3NSYA

The multi-copper oxidase cueo with six met to ser mutations (m358s,m361s,m362s,m364s,m366s,m368s)
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
493
structure length
465
Chain Sequence
ERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAILPDTLSSLPALPSLEGLTVRKLQLSMDPSLDSSGSQSLSEKYGDQAMAGMDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTVLQGDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase cueO
publication title Crystal structures of multicopper oxidase CueO bound to copper(I) and silver(I): functional role of a methionine-rich sequence.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 130
structure length 465
sequence length 493
ec nomenclature
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nsyA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nsyA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nsyA03
3OMNB 2XYBA 1JZFA 2UX6A 2CAKA 1MG3C 4E9TA 2DWSA 5B7FA 2UXVA 1MG2C 1NDTA 3GXUB 3NJKA 1NTDA 1E67A 2IDFA 5B7MA 2XXGA 3DTUB 1SFHA 3AG1B 4DP5X 2IH8A 1CYXA 1OF0A 1GS7A 3PXLA 4N8UA 1JVOA 2UXTA 2J56A 3FS9A 3NJNA 3NJFA 1OE1A 3S8FB 1PF3A 2Q5BA 3AW5A 4GY4A 1W8EA 1L9RA 1MZYA 4TXVB 4L0PB 5I6PA 2BWIA 2IH9A 4YSDA 4DP4X 2HX9A 2BWDA 3FU7B 4DP6X 2RACA 4PCYA 4A67A 1PLCA 2I7OA 2QDVA 4DP1X 4P5RA 2A3TA 2VW7A 4E9WA 4M3HA 1AR1B 2R7EA 3FPXA 4HCFA 2VSMB 2XU9A 2QPEB 3NSYA 3AG2B 3KW7A 1OCOB 2PP7A 3NP3A 3NYKA 1ETJA 1V54B 4KO5A 1ET8A 1AZUA 1L9SA 2BO0A 2J55A 4F7KA 1JOIA 1CUOA 1ET5A 1JERA 1XB6A 1GYCA 3QQXA 3CVCA 4DPCX 4E9RA 1M9WA 4BXVA 1CC3A 3WKQA 1BYOA 3NJIA 5TK4A 1KYAA 2J5WA 3FU9A 4QKTA 4E9QA 4E9VA 4ENZA 2OV0A 3N2JA 2HZHA 1TU2A 2UXGA 3EH4B 2GB2A 1NPNA 3IE9A 3HB3B 1WS8A 3C75A 4A2HA 1ASOA 1RZPA 2P80A 3FYEB 4F2FA 2X88A 1NINA 1CYWA 3BQVA 1ASQA 1DZ0A 2EILB 1VLXA 1ZIAA 1I53A 5LDUA 4BDVA 1NWOA 3NJHA 2OCCB 2N0MA 1IC0A 3UGEA 1IUZA 3U25A 3EH3B 4G7QB 2DWTA 3ZDWA 4A2FA 2QDWA 3G5WA 1B3IA 5B7EA 3TU6A 4YSOA 1TEFA 3UACA 2JXMA 1JZHA 4YSQA 5I6MA 1X9UA 2IWEA 1NPJA 5B3SB 2VW6A 1JVLA 1SDDB 1AS7A 1OE2A 4W1TA 2EINB 1AIZA 1PZCA 2YAQA 3ABMB 2XXFA 1JXDA 2FTAA 2YAHA 1SHWA 4KOCA 2BZCA 4K9JA 3NJJA 4G70B 4JHVA 1AOZA 1HFUA 4G72B 1QLEB 4NAJA 4YL4A 5I6NA 1JXFA 2TSBA 2AZAA 1PNDA 1WAEA 2GI0A 1RZQA 3QJUB 1XB3A 3X1GA 1ID2A 2HXAA 3IN0A 4P5SA 1BXUA 1TEGA 4HIPA 2I85A 3ABLB 3OMIB 3WNIA 1BAWA 3QJRB 1HAUA 1GY1A 4FA7B 3N55A 3OM3B 1X9RA 2E86A 4GP8B 1EHKB 2DY2A 2EIKB 1L9TA 4AZUA 1J5CA 2W8CA 2PP8A 2J57A 1WA1X 2BZ7A 1A8ZA 3SBPA 3AZUA 3S3CB 1KCBA 5I5IA 1SFDA 1NIEA 2IDUA 4G71B 5I5JA 3QJSB 3CZUB 4A2GA 1QNIA 4KNTA 1AACA 1KDIA 2XV2A 3H4HA 1RCYA 2DYRB 2EIJB 2BP0A 4WTQA 3QJTB 5AKRA 3X1FA 2YXWA 5F7BA 1OCRB 1PCSA 2IDQA 1BQ5A 3ABGA 1JXGA 2YAEA 2IDTA 3ZBMA 1A4CA 4E9SA 5D4IA 5B1AB 1TKWA 4BWUA 5I26A 4YSSA 1PZAA 1ILUA 3FT0A 4BK5C 2HRHA 3AG4B 3RYMA 2EIMB 3ERXA 3CVBA 5TK2A 1L9OA 1PLBA 1BXAA 5PAZA 2HX8A 1IBYA 2TSAA 3NP4A 4NERA 5B1KA 3FQYA 2VM4A 1ZDSA 2FQGA 3ASNB 1R1CA 3FU7A 2YQBA 3FU8A 3TA4D 2PCYA 4CSPA 2UX7A 3QPKA 1ZV2A 2B08A 3X1EA 3FSZA 4AKOA 1BXVA 3GDCA 1FA4A 4KO6A 4KO7A 2PCFA 2R7EB 1AZRA 1ADWA 2BW4A 2PLTA 1OV8A 2Y1AA 5I6LA 3HEIB 1KV7A 1URIA 2PP9A 1QHQA 2XX0A 2VMJA 1KGYE 3PAUA 2Y69B 2IDSA 1PMYA 1XMEB 2GSMB 1EZLA 4GP4B 4KOBA 3ZX1A 2XUWA 2DV6A 3PCYA 1AZCA 2VW4A 5AFAA 4Q89A 1KCWA 3KW8A 2OJ1A 1AZNA 4WKXA 1HAWA 1N68A 1M56B 2CJ3A 2ZXWB 3CDZA 1KBVA 4BXSV 3X1BA 4YSRA 3D12B 3NJLA 4GXFA 5B1JC 1NIDA 3T9WA 2VSKB 5A7EA 1A3ZA 1IKOP 1E30A 1M57B 5ANHA 2YXVA 3NSDA 2GC7C 4QLWA 2NRDA 3NT0A 2IWFA 4UF7C 2P80D 2XLLA 2BP8B 3X2QB 4EF3A 3S8GB 1SF3A 4HALA 3OD3A 1GSKA 1SDDA 2DYSB 1MZZA 1GW0A 4YVNA 3WKPA 2FT7A 5EHFA 2CBPA 5AZUA 2W88A 5I5MA 2XX1A 2VN3A 5D4JA 3WIAA 2BW5A 3WG7B 2IWKA 2MRYA 2XVBA 1AS6A 2AZUA 2ZONA 4DPBX 2CALA 2YAOA 2XV0A 4M4RB 1W6LA 2QT6A 6PCYA 3ABKB 4JHUA 2XWZA 1PLAA 1PAZA 3CG8A 2H47C 2FQFA 3JTBA 3T6ZA 7PAZA 2WSDA 1V10A 4KNUA 3ASOB 2GIMA 3FYIB 2H5UA 4G7RB 1AAJA 2PPAA 3PAZA 3V9EA 1E5YA 4Q8BA 1ET7A 1JZJA 4HAKA 2Q9OA 2XV3A 4YVUA 3OQRA 3NJMA 1JZEA 5B1BB 4A68A 3IBOA 5IY5B 1WS7A 1NWPA 3TBBA 1YLBB 2PPDA 3T6VA 8PAZA 4RH4A 2CCWA 4YSUA 3AY2A 1T5KA 3PLYA 2BP0B 2LLNA 2PPEA 1OE3A 2WO3B 3UAEA 4DP7X 4HHGA 1OCCB 1JZIA 2FT6A 1NIBA 1WA0X 2X87A 3MBWB 4HCGA 1A4AA 2ZWNA 2HRGA 4DP8X 2FT8A 2FQEA 1NICA 4AI7A 1BEXA 1MDAA 5I6KA 3IEAA 4KNSA 1FWXA 2FNWA 3TBCA 2UXFA 2JKWA 1PNCA 4G7SB 3OMAB 3DIVA 2QPDB 3T6WA 1NIAA 2AVFA 3FSWA 4AX3A 3QJVB 3FSVA 2AANA 1GY2A 2IAAC 4JKNA 1SJMA 3UABA 1L9QA 1GR7A 2AFNA 1PY0A 2PPCA 3DKHA 3UADA 3TASA 1A65A 1AS8A 2MTAA 1L9PA 1E65A 4BWWA 2CUAA 4BWTA 3H56A 4DP2X 1E5ZA 3NSCA 3T71A 2H3XC 2GHZA 4CSZA 2HX7A 5I6OA 3WI9A 3WNJA 3GYRA 1NZRA 2B3IA 3EH5B 1AG0A 4F2EA 1BYPA 3S3BB 1J9RA 3MX0B 4GYBA 2YARA 2GBAA 1ILSA 2WO2B 2FJSA 2I7SA 4UANA 2ZOOA 3X1NA 3ZIYA 1A4BA 1AG6A 4A2DA 4N4YB 3T6XA 4BDVB 1KDJA 2YAMA 7PCYA 3CDZB 1DYZA 2HLEB 4HHWA 4A66A 4DP9X 4KO9A 4E9XA 3FSAA 3FPYA 1BQRA 2FQDA 5D4HA 1CURA 1FFTB 3H4FA 3SBRA 4UAHA 3EF4A 2BP8A 4X4KA 4MFHA 3S3DB 3L45A 1ZIBA 2JFCA 4NB7A 1KBWA 3SQRA 2GC4C 2YAPA 1W6WA 1V55B 3FQ2A 4HCIA 3PPSA 2FWLB 4YSEA 3V9CA 1ASPA 4YSTA 4A2EA 5F7AA 5E9NA 3CVDA 4DPAX 4AKPA 2PPFA 3AG3B 1J5DA 4W9ZA 5PCYA 3PAVA 1J9QA 3BVDB 4YSPA 1SNRA 9PCYA 4YSCA 2VM3A 1ZPUA 4GP5B 1GS6X 3FQ1A 5B1JA 5FC9A 1AQ8A 4PAZA 4ZK8A 4HZ1A 2BHFA 4E9YA 1OCZB 1AANA 1J9SA 3SBQA 3QJQB 1OOWA 4FAAB 1N70A 1RKRA 1UATA 1WA2X 2YAFA 5I28A 1XB8A 1BQKA 1AZBA 1F56A 4YSAA 3EHBB 3JT2A 1ZDQA 3IN2A 4AKQA 4DP0X 3NJGA 1JZGA 1PZBA 1SHXA 1GS8A 6PAZA 3UAAA 1NIFA 1IBZA 1SF5A 3NSFA 1J9TA
chains in the Genus database with same CATH superfamily
1JNLH 3QQ3A 2V5SA 5CBAB 3KAAA 2OMNA 3CFUA 4YHML 2D73A 2E0PA 3CXHJ 2A0LC 5E2UL 4MNHB 1NGYB 3EBAA 3R06B 2EYTA 3L13A 2XZCH 1HEJC 3PU7A 4KKBD 2QPUA 3EFOB 1XR8A 2HVBA 1J0KA 3MLWH 3HKFA 1LO3L 3SY0A 2Q5BA 4PJIE 2K4AA 5H8DA 1TETL 4UT6H 4M8UA 2XG5B 4X6FB 4HXBH 4TSAH 4JLRB 1X5HA 5DHYB 1DBKL 1E27B 2XWBB 1BX2A 3R4RA 3ZL2A 3LKQB 1I3GH 2QMJA 4OD3L 2I7OA 1SOXA 2KLRA 3HRZA 3OHXB 3ESOA 2PYEE 4MAZA 4N2CA 1L5GA 3FPXA 2BVOB 2NY2B 3VXRB 1I9RL 5IQLA 2B1AH 2RGSA 1UGNA 3UTSB 5EEUA 3AG2B 3ZR5A 4KO5A 2EDDA 5JZ7C 4MQ7B 2JQMA 4YHYC 1JOIA 4MXQD 4LGPB 2AV7A 3MLSL 4ZW5A 1I1RA 5C0CE 2ZSWA 1ONQA 4QRAA 1UKSA 4DPCX 1MFNA 5JW5B 1SVBA 2V2XB 1AI1H 4CA4A 2GK0B 2F9BT 4NJ9H 1HZKA 3BEWA 2GTZA 5E8EA 3K46A 5B1CA 3UXFA 1Z3GH 5IBTL 3KPSA 5D7SH 1UVQA 1XTLA 3T77B 4ZXBB 5DZ9A 4OLUH 4NUMA 5BVPH 4ERSH 4ELDA 2XA8H 3BD4A 4RETB 4ZW3A 3P4NB 2HJLA 3NGBB 1U8NB 3FO9B 3ARPA 4WTWA 4HU8A 4ZFZB 4WO4A 5HHOB 5I75C 4AWJC 4O9HH 4HAFA 2HG5A 3VACA 3X11B 4PJCE 5LDUA 2C8NA 1NGXB 4O5LH 3ATEA 3VWJD 1FG2B 2YMXL 5FFLA 4N9GB 1B9ZA 1T89C 3BKMH 3QORB 2LQRA 5G2NA 5HVGB 4M93C 3LH2H 2J88H 1DLFH 4K73A 1TSRA 3VMPA 2HFTA 2MCPH 4FQ1H 3MRCA 2R1YB 3L3IB 3TT1H 2J1XA 4AYID 1QEXA 4JEGB 1CZ8L 4GSXA 3TM6A 4FYSA 5KZCD 1MH5A 3IFOB 4HUCA 4QRFA 1FL6A 1Z9OA 2IXQB 2NQDA 4XB8A 5AW5B 3W39B 4Z7AA 2I26N 3BP5B 1F4XL 3JV6B 4U1JB 1Z1WA 1WZLA 2BIHA 3SGDH 2E74C 2X09A 2ERJC 4HZLB 4PJFF 2BHZA 5JORB 3QRLA 3STBA 4RMVA 2NX5B 3Q48A 3DX1A 1HXMA 2GTQA 2A74C 4D0BA 4JCWA 5CWSB 3RIFF 3BAXA 2AI0L 2VIRB 3AWEA 2W80C 3H42L 1Q8MA 5DR5H 1MIML 5DRZB 3ARDB 4PJDA 1FAKT 2Y2WA 4X5XB 2IQ9H 4OD1L 3DOSA 3P69A 2C3GA 3U9PL 3PP4H 4ICXA 4G7YL 4OAWB 2IAND 1X5FA 3QCUH 5HHPB 4EXKA 1RZJL 3SBPA 5IMOB 4WGVB 4HH9B 3T2NL 5TDOB 5BRZA 4LOUC 3AQZA 1A7NH 2BH0A 2IDUA 4G71B 3UC0H 1A6WH 1VFBB 3OZKA 3PWUB 1FH2A 3VFGL 3VXSD 4PJIB 1D5RA 4PV9B 1TCRA 4PLKD 5IB2A 4OLYH 2W65A 3H7LA 4BIKA 1BMZA 3ULUL 3MRKA 2KZBA 4M6OH 1E9QA 3SIKA 1GPOL 1KPUB 2WVTA 1J8KA 4R96B 1WCBB 3UZQB 4QT5B 3KVDD 1ETB1 2IALA 2PYEB 2X6AA 4MJ5B 12E8L 2CLZB 1J05B 3JWOL 4J3TA 4JY4B 1L7TH 4Z78B 3WN5C 5C0AE 4KKQA 1XH0A 3VRLF 3BGFB 1QRNA 3LEVL 4KQ0A 1E9PB 1F1GA 3DMMB 3PWVA 1WFTA 2AK1L 3MO1A 5C0CB 3RPIB 5DFAA 1CICC 1F4YL 5D1XA 1E9OA 2QHRH 5DO2D 3QWOA 1IL1B 2DB8A 2NR6A 3RVUC 3SJVE 5G5DA 5ITBL 2FX8L 4AGMA 2NY3C 5EB9A 2DI7A 3WMSA 1IC5L 1KBPA 2AJUL 4XX1E 4P59H 5J11B 1F2QA 3FT2B 1I3VA 1KNOB 4P9HH 4ZFGH 2HTKC 2ODHA 4RRPG 3FH8A 2X44D 1WAAF 1HKLH 2PTTA 4NZJA 1AH1A 2OTPA 1QTPA 3MRFB 1FA4A 5ALBL 2NLJB 1O9ZA 2PCFA 4PJGA 3MAWA 1WWCA 2OM5A 3TL5A 5MEQA 3V0DA 1ED3B 1T7XA 3GMMB 4JFYA 3D39D 1LO2L 4PJCB 2OX5B 3S35X 3N41F 3F64A 2HUHA 4GIOA 1KN2L 4KPHH 4PRHE 2VDNL 3VXMD 3W38A 4WCYH 4JPVL 1Y7VA 3CHPA 2FJFB 1J12A 2A6IB 1YEIL 1YN7B 5KBLA 5I8OL 2ZWLT 4LSTH 1IJNA 1QWNA 2J44A 3D85A 3JWNG 2ADYA 1UOLA 3KH3A 4UQBA 4GEIA 5D1ZB 4IRSC 1HX0A 1WEJH 1DQLL 5BMFL 2HLAA 2XPYA 5HDWA 5FUCC 4MRCA 2Z1KA 4TVUA 1IEBA 3NJLA 4EZKA 2XWEA 5B1JC 5A7EA 1F18A 3IJHB 2WKOA 4DKFH 4RGNC 2BCMA 4FMVA 3DTDA 3NTCH 3KWTA 3EOBB 2GC7C 1UH3A 1LWHA 2HVKA 1DBAH 1LEGB 3NAAH 2OSYA 3T0EC 3ZUCA 3F6JA 4Y5YC 3S36X 3VXQA 4JGUA 4MQSB 1LE9A 3QFJA 4HOXA 2GK2A 4LE8A 2OMTA 4U7SA 4FLHA 3RDTC 4AQAA 1QLRA 3QAQA 4LSRH 2VUKA 4ZW8A 4XAWH 3TBTA 4PJ5D 1TDQA 1YVLA 3WKPA 2W88A 4QAWA 5EO0A 4R6UA 1G7LA 1KJ2L 4XN5A 3QZOA 1XCQA 5DRNA 3AADB 4KXBA 4NT6B 1QUNB 3OKOA 3DO4A 3LEXB 1T1YA 1YRKA 3I6LD 2J1ZA 4XP9H 3AY4C 1RUAL 4H13C 5DZOA 3FCUB 3QDME 2VXTH 2DQCH 3SDAA 5IJKA 1PLAA 3S96A 4FTVD 4BSVB 2OMWA 3B6SB 1IQWL 3IJSA 3THML 3ASOB 3I50H 5G55A 5KUKA 1N7MH 1UD5A 3KL5A 4MBOA 2QSTA 1XF3B 4IGBD 2CRIA 5DFWH 3MUHL 4U4BA 4K7PL 4OCYL 5C0AB 3B5GA 1JWUA 1WWBX 2VITB 3PAYA 2EEXA 2YD0A 2QGDA 3CVHH 5CEXA 3PXJA 5CSGA 4LCWD 3WL9A 4YHOH 4LPWA 4J6RH 4BSWA 1WC7A 3HMWH 4FJ6A 1GZQA 4HKJB 4U6VH 1G7JA 5C0GA 3SJVB 1NJ9A 1FH5L 2AQ1A 5HGDA 5CEZD 4KGJA 2HJKA 4IQHA 5I76A 3VB8A 3EHBD 3TIEA 4L3FA 1C5BL 4XN4A 3RX7A 1I9JL 3U1QA 3UBGA 2P5WA 5F3HA 3FZUC 3CE1A 4LDCA 3HG0A 4N2DA 2XICA 2XY2A 2HUEA 2BNRE 3QPQD 3CAFA 4M8RA 3SKOB 4BUHA 4D94A 5E00B 3BRDA 2BY3A 1GAFL 4EMZA 3UYOD 3U6XS 2GQHA 2XN1A 3KXFA 4PRHB 4HQQL 4QDGA 1MXGA 3IWVA 4U1MA 4I3SH 3IMBA 3OMAB 3LKNA 2DQTH 2QPDB 2AVFA 3AT8A 3GI9L 4C56D 1NGQL 2UZIH 1U4FA 5LUMA 1R0AH 5TGBA 5IG7B 2IAAC 5INDA 1A4KA 3C8KB 3SQBB 3U0WL 4O02B 4RFOL 3H0TB 3JXAA 4JZNB 1SMDA 1DQDH 2CCVA 1T1WB 4Y4FC 1FDLL 3IS1X 4PGEB 3CJJA 4BM7A 3EYQC 4UQDA 1ZHNA 3V79C 4L3ED 2R23A 4CSZA 1RLBA 1CE6B 2WXMA 3WNJA 1QATA 5TDPA 3UGUA 5B4MC 3SBWA 2XQ0A 3REWA 3PHQB 5IQ7H 1R3KA 4QI3A 5HHNA 4R3SB 3RB7A 1QPKA 4J6IA 1KXTA 3BFQG 1DP0A 4P4RA 1BM3H 2F19H 4K2UH 4A1RA 4G8GE 4F33A 4WO0A 4ODVH 3S0PA 4KKNA 4NSKB 1AG6A 1XQ4A 3JQOB 3KVQA 4E42A 2V2TB 1QVOA 3RWHB 1A4JA 4RIRA 1Z66A 4Y5XB 4MS8D 3FOLB 3I3DA 5C71A 3NA9L 4FTDA 1N0LA 5LN4A 1E4JA 5D4HA 2YOAA 5IHWA 3DPBB 3SBRA 5BV7H 3QYMA 5C0EA 3QDMB 3UBXG 1T6WA 1R6VA 3S4SB 2GY5A 4WNQA 2QADB 2FH6A 3LIZA 2CCLA 2XA3A 5EN3A 1EVUA 2ZP9A 2FATL 1I8LA 4JZOA 4B0MB 2GC4C 4PI0A 2VAAB 1E5AA 2VZOA 1TYJA 3CFBB 2IV9A 3MGAA 5GGTA 3IRPX 1XR9B 4HT1L 3W9DA 4XWGH 1C5CL 1NEZA 2EYRB 2YBRA 3O11A 5A43C 2HT2D 1R4XA 3LHPH 4LLDA 4ZQTA 3MSPA 3BKCH 4JZJB 3BAYA 4QO1A 1XZ0B 1AQDB 1Q9OB 3BW9B 3RNKA 3UYRH 4YBQC 3ROLA 1IGJB 5EUOB 4KV5F 4ZK8A 4UM8A 1JF5A 3FO0H 3C09C 3T2LA 1KLGB 4NRXA 5EOCJ 1QKZL 2DQUL 5DQ9A 4MXVF 4PUBH 4H5SB 1YQVL 1NLBH 5I16B 5GS3A 2C4XA 3FO1B 2EH8L 1L0PA 1SOSA 2BNRB 4LLWA 4P3CL 3TF7C 1WHOA 2WQSA 3C8HA 1LMIA 2G5BB 2VDKB 4PBDA 3HBGA 1NIFA 5F1NA 4QJ4B 1FL3A 1J9TA 5ID1B 1PTZA 1M6OA 3SDCD 2QJDA 4XNZC 1MAJA 1T66D 3OMNB 3BGMB 3LKRA 5GGVY 3ES6A 4TVPE 3TIDB 3VU1A 4KK8C 3FT4A 3VTMA 3GSVA 3MRNB 4QRBA 2IDFA 2CD0A 4ZAKD 2MKLC 3IDJB 2DQDH 2XN9B 3K6OA 3MYJB 2E76C 3EYUH 5A1AA 3QDGE 1QWUA 4XGZA 4GAYA 3FQXA 5CCKL 2JJWA 1OGAD 2QZ5A 1OO2A 3BJLA 3FUFA 5MEND 3HBQA 1A3RH 3VD1A 2J1YA 4CSTA 4J39A 2JMRA 4N8CL 5DJDB 5ENWA 3VW3H 1FCGA 4G8EB 1HCVA 5HY9A 4MDIA 5IR1B 3QSKB 3NESA 4NIKB 2HPTA 4UT9A 3KDMA 1EPFA 3LNDA 1B4TA 3ZSTA 2HMIC 5AAWC 4G83A 2A3TA 4XNMA 1O6SA 2OYKA 1H3VA 3H9HB 1NUDA 4HV8A 3H2QA 4H8VA 1CT8A 2QPEB 2VJXA 1T83C 3QULB 4PLJC 4URKA 2FO1A 3N0PB 1OCOB 1JPSL 3U0PA 1YN6A 5B21A 2DQFA 4QHUB 3V4PA 3FQWA 4QTHA 1AO7A 1ZD6A 2OR8A 2E6PA 3E80A 1B2WL 4LT7A 4RRPA 3HNTH 3D9AH 1C1EH 4O2FB 4ODSL 4IRZL 4PTTB 4I0CC 5T3XE 5FPIA 1G94A 1JI1A 3GSRA 2J7LA 4LARH 5FYLL 2VLKE 2VSCA 3KR3L 3WLWD 2RFXB 2HTLC 3QUZC 2VLRA 4X4YA 5KSBA 4Y4KA 3ATAA 4PJDF 1J11A 1NPNA 4ZS6C 3SYPA 4XOBA 5E1AB 1D7DA 2MNWA 3LKPA 4IBYA 4A2HA 2H1LM 2IBBA 3QH3A 4KJQD 3B7TA 1OCWH 3WKMH 1R17A 2P80A 2Z3FA 4WFFE 1NINA 1CYWA 2YPLD 3LPGA 2ADGB 1X5KA 4FP8L 3C60A 1IZKA 4MNGA 2CE6A 3ZQ9A 5L88L 2CR0A 3D2UD 4KTEH 4OLVH 4XP5H 2NY6C 5DD6B 4OKVB 3Q06A 5D93C 1QBLL 3TU6A 3TEXA 4F58H 2ZG1A 3TNNB 2DYPA 3FH7A 3STZA 4P2OC 5KJ4A 1SDDB 4KKAC 4MD5B 4XCYA 1G6RH 1JGDB 4KKZA 2AKRB 1KGXA 3FCTA 4LLYB 5T5FA 5J7CC 4MMXC 2WTRA 4JN1H 4LCCB 3TJEH 4TNEA 2UVEA 4HWZB 4LSVL 3ETTA 4RFNC 3B2DC 4JHVA 4APQD 4NNYA 4LSPH 1MNNA 2GUOA 2H32H 5T3ZE 4CN1A 1CXEA 3U7WH 1QLEB 4ZI8A 4OFIA 4WUUB 4Z7VE 5L4IA 2ISDA 1Z9MA 3X13A 4PVMA 1XB3A 3Q5YA 4QTIL 2P1YA 4I18B 1UJ3B 1RJCA 1TIUA 3HE7D 4L37B 2EZ0D 2ICEB 3ABLB 2PCXA 2WW8A 4MCYB 5E08H 1G9NH 1MFCH 4NAQA 1PG7W 1UACH 4ACPA 3M07A 2DTML 3MXWL 2VDRH 3ULVD 5CAYB 1N4XL 1CPUA 4GP8B 3BZEA 2ITDA 4BBWA 5KYYB 3PHOB 2C7UB 4EQ2A 3LD8C 1L6PA 2BSSA 2X4RA 3E6HB 4PJGF 4YDMA 5EO9B 4E41B 2Z64C 3QDGB 4S1SH 3EFDL 4ELMB 4W6XB 1RSYA 2A9ML 1AQMA 2XV2A 4HHAA 4NZ8A 3CFDA 5CJOH 1QPXA 5K9OB 1FAIH 4K7FA 1OSPH 1FSKB 1WFMA 3C6LC 3IWUA 3WFDL 2BC4A 2FSDA 3MJ9L 4JDVA 4DFHA 3RL1B 4BZ2A 4L8SC 2FX9L 3UMTA 1YMHB 5ETUA 3WTUA 2YK1L 2YRBA 4DPRA 3SY6A 1UXLA 1PZAA 5IUSA 3D34A 3H55A 5H2BA 4I1RA 2P9RA 4RMWA 1SN0A 5CZVH 5F9OH 4WI0A 4YR6A 3RYMA 1S3RA 5HVWA 2BS9A 4ODTL 1D9KA 2IGFH 1RK0B 3CVBA 2NUTB 3VXUB 3TS8A 5AWNL 2WKOF 3LQMA 4FQXB 2FLBT 5IBUG 2HX8A 5C09D 5I1JL 4M7ZC 4S2SA 1EVTC 4LRNL 2QL1A 1ZTMA 3BE1L 3QQNA 4YJZL 1UM4H 5J6HB 4R0LA 5G4OA 4P2RD 4QY8B 2ZKHL 3T5WA 2X4TB 3CZNA 4UMGA 5FV2A 3E6FB 2VKWA 3VVVA 2PR9A 3WOVA 4UOJA 1BXVA 3O4LA 2Z4QB 3FN0H 5EA0H 4BH7B 3DJTA 3GMLB 2AAVA 4P46C 4RESB 5DS8B 1URZA 3QFGA 1RURH 1RI8A 1DCLA 5DUBB 4F57H 5AOIA 3HS0C 2WC7A 1AR2A 4NQQA 3AAZB 5AW6B 1K72A 2O4EA 3VNYA 4KI5D 1MNUH 4X98B 3WBDA 1EZLA 2NQCA 5FB8A 3W81A 3QJHB 4PB0L 5FO7A 1I8IB 2EXWC 3DRQA 3UTTA 4TQPA 1GGBH 4W9JC 2Q8BH 4B53A 3GJFA 4FQ2L 1U93B 2IG2H 3NMEA 4HEPG 3QNXA 5HVFB 4NQEE 5TF1H 2Y6SD 4ZTOH 1FQ9C 2WLLB 1R3IL 5D1QA 5I74B 2AEQL 4H88H 3RVVC 3GMNA 4OSUL 3TJPA 2ATKB 4MX7B 3L9EA 4GXFA 1NIDA 4N20A 3S5YA 3T9WA 4E5XA 4GXUM 2AJSH 2WJ7A 1CLYH 4QTFA 1AXTH 4XMPH 4L18A 1H6TA 4ATTA 3V0WL 4Z7VB 2HH0H 4UQ3B 1ZVNA 3WFHB 1D7CA 1Q9KB 2JCWA 1NUFA 2HA1A 5JA8B 2VR5A 4ZMZA 2H4EA 5EU7E 3CH8A 3QCTL 4EZLA 2ZP0T 2FGZA 1H0DB 2L7QA 2XNAA 3A47A 4G6MH 4TTGA 1MZZA 4YX2H 2O6PA 2F8XC 4ABQA 3Q43A 4Y5VA 4YVNA 4NPJA 1NPUA 1MRFH 4YK4C 1XF2B 2AJVH 4Y19A 3VD9A 4KH2A 4BD4A 2XX1A 4ANWA 3EGXA 3S34H 2VLLB 3NIGE 3P0YH 1KC5L 5AAPA 4P4KB 4UYQA 2Z8VC 4X0KB 2TAAA 2G5UA 2ZX6A 3NDZE 2HFFB 4Z7UE 5E8PB 5E9DA 1OGSA 3ABKB 1QTYT 3FB6B 2RH0A 3HLAB 2CZNA 1AHMA 1EXHA 1I1AD 2BHUA 4PQXA 1F13A 5E0QA 3UJJL 1LWRA 5BXFB 4I89A 5E4IA 5E5MB 2BOCA 2Y5QA 5D55A 1MQKL 1PFCA 3EOYG 2V7NB 2EC9U 4Z7WE 4PRPE 3HRZC 1HQRA 3LQAH 1XCTA 4PD4J 1T4KB 1EEZB 4L2LA 4K71C 3QXVA 4WWPA 1YLBB 4AE1A 1KB5B 3N9GH 5DLMH 1MVUB 4XTRD 1T0MB 4D8PA 3T4YA 2Q2LA 2WM0A 4FZ8H 4RH4A 3IBEA 4YSUA 1NCDH 1PS3A 2DD8H 2OA9A 2X5PA 2LFEA 4DP7X 5E8NA 3VD3A 3LRGA 1JZIA 1HHHA 1ND0B 3O3AA 2PR4H 4X6DE 5C8JB 3V6OA 2HRLA 4LCYA 2E56A 1UT2A 2FEEI 3H8NA 1R24B 2OBGA 4NKDA 5DWUH 4AYGA 1CI5A 3C2SA 4DZBA 2CPCA 3UJIL 4TYUA 1JK8A 3QUXD 1K6QH 3G9VA 2VABA 3BUIA 3E3QC 4EIBA 2BDNH 5E6IB 4WWKD 1EGJL 3CSFA 1KBGL 5EDXA 3WXWL 3CBRA 3V6FA 1ETZB 3DIVA 2VDQL 1T2XA 2E9WA 4B27A 5ADOH 1YC7A 2C3WA 2AANA 4DEPB 1NGPH 5A7BA 1VZIA 1DL7L 3LRKA 1BZOA 2NY4D 1YEEL 4NQEB 3ZDYF 3NFSH 5KS9A 3HZKB 3FFCE 2DKUA 3Q9QA 3MCKA 4N0RA 3VFMB 1INQB 2C4FU 3BH8B 5F0LB 1YDPB 5GZOD 4YAQA 2CUAA 2ZF9A 3TYFB 2PCPB 1E3FA 1LXMA 4FLRA 3PQYE 4M5SA 4DK6A 1UB5A 1L6XA 5BZWA 4PJEA 2C9AA 3B8YA 3T4AB 3MLRH 5DVOA 2LR4A 4JAMB 3NPSC 1XHHA 4KZDH 3VWJA 3HG1E 3SPHA 2JKXA 1GSMA 4JFFD 3KPMA 4UI2A 4HK3J 1TZGL 5ESVB 2BMKA 4F3FB 5A6MA 4N4YB 4I85A 4WWNA 4M7KL 3HPLA 2XTJC 1N5AA 1A1MB 1B2YA 2DIBA 3QEGH 4IRJD 3LZOA 3NIGB 3G9AB 4EI6A 4J3OD 1BQRA 3IKKA 3BKYL 1K5NB 4DHLA 4Z7UB 2VKXA 4WY7L 4L8CB 4MA3B 4ZO9A 2FIKB 5HDBE 4Y9GA 1VEMA 3OAUL 2XZQH 3PWPD 4YDIL 5GRXG 3FUJA 3OX8B 3BJ91 5E5LA 1NMCC 1Q0YH 3D8MA 5DYOA 1KJ3L 5E99L 3N44F 5ABAA 3G5ZA 1X5MA 4IBLT 3TO2A 4UZUA 2NQ3A 1V55B 2QGCA 2VRQA 3ML8A 2FWLB 1N18A 5TD4A 3V9CA 4ETQA 5EFIB 4EI5D 4Z7WB 4PRPB 3TXAA 1CFQB 4NP9A 5E9NA 2ZOKA 1FPTL 2IANA 4H0IA 2NY5H 4W9EC 4FYQA 1RPKA 3P4OB 1I1YB 3QZPA 4G43A 3ARYA 5IBLD 5C08E 3VXSA 1GYAA 4ORGB 3TGXA 1E8XA 1KFAL 1NOLA 4ICWA 2LOEA 3EBHA 5D1XC 3QJQB 5JR1H 4NWUL 3QEQD 4QAMB 1BZ9A 2NR6C 5I1HH 5I66A 3KGSA 5EZLB 4FERA 8CGTA 1HYSD 3BUYA 1W2KT 4K9EH 2WXRA 2LV4A 5J1AB 3TBYB 4ZYKB 3W56A 4UOZA 5KYUB 5IGXH 1GS8A 1IGFH 3D5OF 4OR1A 4OV5B 5IFJB 5KYNA 3ZHNA 4KY1L 4KAQH 3WGVB 4NNXA 5IQOA 2BZDA 3SZ6A 5KSBF 2CKBL 5BS0E 2H1PH 5FM8A 2VL4A 4JG1H 3APMA 2OSLA 1CDJA 1MG3C 1WIOA 2I24N 1BJ1J 3GSQA 3P2TA 5CHNA 5DK2A 2VXQA 1Q9WA 3IPBA 2E9JA 4JFWA 4UIKH 2WB7A 4KK5C 5LCVL 2XKNB 2V5YA 3FFCB 3II3A 4FQHA 1J1XH 4TLSA 2H3NB 1JFQH 4G9DB 1UXWB 2IWGA 3VFWB 2R0LH 3U4AA 3S48A 3ZMNA 1MZYA 4G6AD 1LK3H 1CS6A 2I5YL 4MB5A 2I9LB 3PQYB 4AZ8A 1XD0A 1J5OH 1K3ZA 4DP6X 1M3JA 1RZFH 5D5ME 1FP5A 3D39A 1D5BB 1CLZL 2OZNA 5GS0L 3HR5A 1K8DA 4AGNA 1MJJA 3NJXA 4R4BB 4XE5B 3SE4A 1AR1B 1S7WB 5IB5B 3VXMA 2OYLA 1UUNA 3EYOB 2VSMB 3HG1B 4MB4A 1ZA6B 4PWGA 3V4VB 1ETJA 3DVNA 3ZE2E 3KVPA 3QUKB 1QLFB 3Q6GH 1D5ZB 2XRAL 4TULH 1X9QA 3QUMB 5LAXB 2AVGA 3GINA 1DSWA 5I73C 1GYCA 1ZVSA 3Q3GB 1F41A 2OL3B 4M48H 4W4OA 2CO7B 4Y2DD 1KWKA 4UNTA 1G7QA 5EBMB 3JYCA 1QEWA 1U91A 3N42B 3IE9A 5MERA 5HDBB 3HJEA 4Y2OA 3E9TA 4Z7NF 1C08B 5C0BD 1F4WL 4WRLA 1UFUA 3BVNB 4AQ1A 4QUOA 2F15A 4QRPE 2I9TA 4APXB 3RZCC 2EUZA 1GC1L 5DJ8B 5IJKC 1ASQA 1CTNA 3K6FA 3A6BL 3REVA 4KI1A 3GIZL 3QNZB 4ANXA 4X4MA 1Q1JL 2CDEA 2NNAB 2QTEA 4XRCA 4PJ5A 3X12A 3A4EA 4AJYV 3Q6FA 1IE5A 3H9SE 3HC3L 4K94C 4HJSA 4XNDA 4YHYB 1QUPA 2FD6H 2NXYC 1RHHB 2CJSA 3UC2A 2EIDA 2F53D 5C0IB 5C08B 1I3RB 1O5PA 2EINB 3BO8A 1W8OA 1FZMB 2Q2EB 5DC0A 4AUJA 5CEYA 1B3JA 3VGDA 4NN6C 5H35A 2XXFA 3KPLB 3IGKA 3WS6A 3MNWA 3NJJA 1PG7X 4FTVA 1G4RA 5JHAA 2P8PA 1HFUA 4MBRA 2PW1B 5CCJA 4JQXA 4HIXL 1A14L 3NZSA 1H15A 3NFPB 3L3OC 1OGPA 3HC0B 3NN8A 3QNFA 4DUVA 5KTEL 4IGBA 5I75B 4Q9QH 2DBJA 2YJQA 2NUPA 2XIBA 4D9LH 1P7KB 4MCZA 4ALAH 1A9BB 4ZRGA 3P9MB 3QJRB 4FEMA 5F7FA 4EO5A 1NCTA 4LCWA 5BS0B 5T1KD 3WNNA 1NFIB 2ICWI 4AW4A 4AZUA 2PP8A 5CIPB 1P4BL 3GB7B 4YXHL 3LB6C 3KS0J 4HWUA 4KJWC 4M93B 5FR3A 1DQTA 1QNZL 4UNIA 5I5JA 1KTDB 4ONGL 1F6AA 1YUHA 1CDUA 3N0AA 3NCEB 1FZKA 4QXUL 5FDWB 3N85H 1HXKA 2NTFA 3D3VD 1YYLL 4LP5A 1KCKA 1WK0A 4N0UE 5FUCE 5ICUA 5FYJH 4WTQA 4UCFA 4LMQI 3L4XA 5KVGL 1CWVA 5EZPA 4NBYB 4PJBA 5HYJD 4G6FB 5D5MB 2NSMA 3R4DA 5ALCL 2VMEA 2ERJB 4E9SA 1QWHA 4ZPVB 5GGTH 5K93A 4TNWF 3CXHK 2IF7A 3A67L 3JUYA 3T0EE 5ACLA 1BPVA 1NOAA 4DQAA 3RTQA 2X0WA 4C56A 3SBWC 1JNNH 3LKOB 1S9VA 4XMLH 3CSYA 3RU8H 4MD4B 1VADA 3DXAE 3R0MA 5PAZA 1G7PA 1HVXA 4P23D 2J4WL 4Q9RH 1AYRA 5LBGA 1ZDSA 4XNUL 4RVBA 1R1CA 5AG9A 4HX1B 2X7LB 4QPEA 3VI3E 4X9HA 4PTUA 5CBEA 1ORQB 1RUQH 3P02A 4L3EA 2P42B 2NNCA 5EOCH 4PJHA 4R7NA 3QIBD 1A3LH 3GK8L 3DTXA 2IPTL 1ZSDA 3APCA 4XVOA 2Z9TA 3O6FD 3DHUA 4QRPB 4HDIA 2PLTA 5JNYA 3BIKB 1CD1B 3HEIB 1TXKA 2YLKA 2W5PA 4ZQKB 1R3JB 3J27A 1URIA 4NS0A 3IFNH 4X99B 4XP1H 3GS7A 4QNPE 1JRHL 2C1PB 1OAYL 3VRIB 1WRFA 3BX7C 4GG6E 1Q72H 3H9SB 4XOAA 3WN5B 4FQJL 3ZX1A 4B9IA 1C12B 2DV6A 2ZSVB 1E4WL 3NUKA 1AZCA 1HINH 3ZKNC 1LILA 2NY1D 3JUZA 1CICB 2KH2B 1KCWA 3UCQA 4G8GD 1LWJA 3T2QA 4NHUA 1ZT4A 4GW1A 3TA3D 4ES9A 4BRVA 2EYSA 3VA6A 4W6YB 1OPGL 2NY3B 4BXSV 3VFPA 5LWYH 4HSAC 3HI6L 2Z31A 3LV3A 3CFKA 5GQBA 3AFLA 3HBPA 1NGWB 3BXNA 2ZIDA 1JNJA 4JM2D 5FECA 2YXVA 1SDAB 2KDGA 4I0PD 3EJUA 4NAMA 3ZOAA 1WIPA 1U8JA 1YJDL 4DVRL 2R59A 4UF7C 1A7OL 1IBBA 2E9BA 4E0RB 1BBDH 2DLEA 1A6VL 3GT6A 3D69B 4X7DC 1PKQE 3JZ7A 2EDWA 4LCVA 5I1GL 4AUYA 2Q10A 1R19A 3SDDA 5C7XH 2DMCA 3DJRA 4LLQA 1S8DB 1YEFL 2WZPD 4HIIB 2DWEA 3I6GB 4WKZA 1EA9C 2MHAA 5T1MA 5IT2H 2DQEH 2G75B 1MFVA 4AW7A 2MRYA 2XVBA 4F7PB 3GUFA 1R5IB 1SYVA 2DRUA 4IRSB 1S78C 4UQ2B 4XZUB 1KZYA 3BPOC 4N0UB 1EEYA 2HKHL 3NRPA 4KXAA 2YSTA 4LAJH 5KVDL 1FIEA 3MV7D 2ADJB 1MHCA 4HVBA 2YIHA 2A1WH 1V10A 3QJFA 2GFBA 1UD4A 3WIHL 2F7IA 3BWUF 1FNSH 3ZLQC 2DEYX 2OI9C 5DC9B 3SDCA 5KS9F 5J6GB 3T0EB 4AGLA 2F8OA 1E90A 2IQAA 4XPTH 4AG4H 1HOCA 3L95B 3LPFA 3UEQA 3LXCA 3MCLL 3RDTB 2NCEA 4PRID 4U6XA 3P4LA 4PSPA 3DXAB 3HHSB 3F58H 4ZAKA 3IK2A 5CR1A 3OMZA 3ULAB 1KB3A 3T6VA 4PJEF 3TFKD 4M3KB 2ZKMX 5DEGB 5E6RB 4FGMA 1SLUA 4XT1C 4HS6B 3MLUL 1OGAA 1MN4A 5CILH 2EO1A 2C9PA 3TJHD 2LLNA 3VI3B 5MENA 2D03H 2XT1B 1VERA 3R19A 4GQPH 5C0DA 1XGUA 3GKZA 1A6AB 1U8MB 3I9GH 3MACH 2HFEA 3S5LA 4FNUA 3H53A 4XAKE 4NNPL 4IDJH 4KX8A 3WJMA 4JUTA 1S9KC 2QSVA 1TJIL 3QJXA 4NWTL 4JL2A 3QZWB 1JPGA 5DZLA 1OIOA 4RMBA 4F8PA 4N0FA 3VFRA 5IESH 3ZSSA 2H2PC 4FMFA 2XWJB 4GG6B 1YZZA 4YHKH 3B7UX 4A55A 5FS5A 1N5YL 3C60C 1NAKH 2CLRB 5AW7B 3QUYC 1GY2A 1FNEB 5A2FA 1FORL 1RUPL 5ERWA 5CLYA 3R7RA 4M1DH 3U4EA 4PJFE 4M7LT 4MHHG 4IHOA 1G0XA 3CHSA 3VG9B 4C83B 1DQVA 2BIOA 3H56A 3MYZA 1U3HD 2KBGA 1DFXA 1EJOL 2VLKD 3P73B 1IM3D 1Q0XH 3D4GA 3WI9A 1MF2H 3D48R 4LEBA 5ESQA 2IBGA 4KUZL 4BCXA 4HUUA 3JTSB 2A99A 3D2UA 3G7TA 2A6DA 1BYPA 1GGYA 5D8JL 2BINA 1BFOA 1PKQB 2YARA 3R1GL 4NQSA 3EO9L 3VSVA 2WO2B 1P84K 1CFSB 5A2KH 1A1OB 3BOVA 3KLSA 1E5CA 1X5ZA 3NCJL 4AJWA 2X4NB 1RIHL 2WLIB 2WOYA 3WFCH 2ZJSL 2VOTA 3DV4B 1JE6A 4U1KA 1FN4A 4JFZL 5HI4D 4WZ9A 5GIRB 2DOCA 4KQ4L 4NQUA 1AMYA 1JZ7A 4XO5A 2FQDA 4XP4L 4NUGL 4APQA 4Y4FB 3GM8A 3L3DA 2K8QA 3D05A 3RGBA 1QSVA 2P7TB 2BP8A 1T21B 4B9GA 1SEBA 1ZIBA 3A4FA 4JB9L 3VFVA 1V3MA 3PWLB 4XBPB 5I18H 5C6WH 3HE7A 1QR1B 4WENB 1NUNB 3IMRA 2VQ1A 3O4OC 3VRLE 4ES8A 1JN6B 4IBQA 5FGRA 2MCAA 2VDOB 3ALXA 4JO4L 4PIRF 3A6OA 5TQ0H 4OH2A 4MZ3A 4DPAX 4HSQA 4D9RD 2XWTA 3IMWA 1P7BA 4FC3E 2ZKXA 3QQ4A 2YD3A 4X2UA 3V6ZA 4ZOBA 4FNTA 1SNRA 1CTMA 1BQLH 2VR4A 3F84A 4NQDE 5KJ7E 5HDRA 4Z18A 4FQCH 4A7TA 3D2TA 1LJMA 1WAAE 2J43A 1CE1H 4XZ4A 5F3FA 2D31B 2WYZA 4W68A 1KT2A 3SCMD 5C3LD 4Z7QF 1P6FA 4FAAB 3W9EA 2A77L 4R0LC 4BGLA 2DL9A 4GG8B 1A6ZA 1DEEA 4YFEA 5DJ6B 1CU4L 3ILQD 4NKIL 3OJDB 1TOXA 4HMEA 2XFGB 3L9YA 4NI6A 4Z8FH 1SHXA 2OMZA 4OLWL 1FNGA 4OCWL 3V0JA 4N6RA 3P9LA 1P7QB 1RMFH 3K6NA 4EQ3A 1MCOH 2XACC 4H44C 4BFGA 1MCKA 5L7XH 1XGZA 1UUSA 5IVOA 5FA3A 5B7FA 1UWGH 1NSNL 2FWSA 3GXUB 2OMVA 1V3KA 5TE6H 5I8CB 3QWRD 4FNPA 1DN0A 1OW0A 1QACA 3O2VH 3PABA 1H6FA 4LSQH 1OZUA 4JS7A 4NQCE 4GUOA 3TCLB 2IH8A 5EOQL 5IOPB 2YMOA 4P2RA 1GS7A 1JMZA 2QPSA 4FFVC 4NC0B 1BVLB 3VFSA 3LQZA 3TESA 2V17L 4PJFB 4OUUB 3BDBA 3RJOA 1BAFH 3RL2B 3WJJC 3C09B 2IH9A 3MRJA 5D1QC 4B97A 1CXFA 1ZT1B 4PCTA 3FU7B 3SOBL 2GHWB 3SYOA 4JDEA 1R34A 5AW4B 3BIAX 2CGRL 3RGVD 1VAHA 2YSSB 2NT1A 3RUGE 4E9WA 4M3HA 2F58H 5D7LD 5HBBA 4AL8H 4Z0XA 1OAXL 2PO6B 4F9LA 1NBYB 3KLAA 5DHMC 1M2VA 3KLLA 3KW7A 4OBRA 6FABL 4XNZB 2R56L 1L9SA 3T0XA 3DROB 4U1SA 3PGCB 4FKKA 1F90H 4HMDA 1QBBA 1SJEA 3O2DL 2BY1A 4RRPM 2AABH 4R5TA 1BWMA 3M17A 2O61A 4S11A 2FBJL 4ZMOA 4P5TC 4MMYA 3LRHA 4MJJA 3BQUD 3DUSB 1S7SB 1ZE3C 4HS8H 4H26A 1NC2B 1W8NA 1OB1A 3EH4B 3VU2A 3VD0A 4HIEB 4LASL 1C5DB 1WS8A 3SPVA 2BVUA 4EUPH 2F1AA 2JB6B 4UAOC 5DSCA 1F8TH 1XAUA 1CFTA 3VXOB 3EADA 1ZVHA 5D70L 1S9XA 2FJGB 5D7HA 1M4KA 4IOFD 1RVFH 1NWOA 1RUMH 3I2CH 2CDFB 2IMMA 1F1AA 1YMME 3B1UA 3DPDA 4NRYA 4QF1A 1KXQA 2PUQT 3PV6A 4GEJA 5IFHL 3WEBA 4XPHH 2SODB 4HFUH 1I8MA 2AJXL 3ESVF 4NQTA 2G9KA 4LCIL 5F71A 4PJBF 2DM3A 4NQDB 3HZYB 4Z1PA 1I4FA 2WVVB 3PNRB 4KKRA 1F1DA 3BDYH 4KKBC 4EN2A 3IDMB 5LBSL 3MOQA 2FTAA 1DFBH 1TZOA 5DEFA 5GGSY 4F24A 2AQPA 1BYNA 4GAFB 2OMYB 43C9A 1I1AA 4K8RL 1ZEAH 2A73B 5BUPA 9CGTA 3ROOA 4HJUA 4YUEH 3N41B 1JXFA 4ZUSB 4JQIA 3U6RA 2GY7B 1AGFB 5AYUL 3VG0H 1ID2A 3V6OC 2JCCA 4LPCA 4NHCL 3H54A 5JDSB 2C3XA 2F18A 2XWDA 4IMKC 1F4AA 3QIWA 4OZFH 4F7MB 2CO6A 3N55A 3ATDA 3L4VA 3F7KA 2E86A 2BVPA 2NY6B 4PJHF 5E9AA 2GJJA 4KROD 1A47A 2V8LA 4TSBH 5IB1A 5D93B 1WZ1L 1SLVA 3MRDB 1FYTE 4G1EA 2Z4TA 4H0HB 1XGTB 5GSVB 4Q74A 4MXQC 5FO8A 2OAAA 4OFDA 4P2OB 4XH2A 5IWLA 1UWEH 1FVCA 1PSKL 2XVLA 4WUKL 1KCUH 4MMXB 4FD0A 1YEHL 4JHBA 4N0YL 5AAMA 1TQVA 2F0CA 3W11D 4XCEB 4RFNB 5DD1L 2OJZH 1UXSA 3HW7A 4FCAA 5E2TL 2ENYA 1UZGA 3ABGA 3MTRA 1OTSD 1JXGA 4P3DA 3QUXA 3HMXA 2YD5A 3QDJE 3RUGB 5L4FA 5LXGL 1TTUA 2B59A 5ACZB 1OB0A 3G6AB 4R7DB 1U21A 2VDKL 3MVSA 4XBEL 2ZNXA 1AY1H 4EDXA 4N5UA 3UIYA 2CH8A 2G2NA 5GRUL 2HRHA 1T1ZA 2W9EL 1R5VB 2EXYD 3MV9B 3GRWA 1JYXA 2I07B 3VWJC 1DJWA 2OK0L 2DQGH 2WUCH 2G3NA 4IJ3C 2YHGA 4LLMB 1PYWB 3U9UA 3FQYA 3PHSA 5AVQB 1CR9L 1AGDA 3KYKH 5GZOA 2O5YH 5DCCA 4N86A 5IK3A 3QEUB 3NFNB 2EEBA 3IXTA 4CMMB 1YC8A 3NCXA 3DSFL 1BWWA 3NVQA 4JVUA 5IQNA 5B8CC 1U3NA 2YKLL 1MUJA 4OFPA 1MREH 1ZANH 1A6UH 2YN5A 4NJAH 5HHXL 1BQHA 1VPOH 3ETSA 1IBGH 3BVWA 4FG4A 1ZHLA 1DVUA 4WTXA 5CN3A 3WHE0 3P2DA 1QHQA 1IGIH 2O6CA 1AQKL 2OQJB 4G8IA 4PR5B 1JGLH 1LO0L 3AACA 2R0ZL 1YMMB 5FXCH 1K4DA 5F9WC 1XGYH 1I31A 3V0AC 5JQ6L 1P2CA 4KV5E 3L1OH 4H1LG 4CVWA 1N59A 1BJ1H 4G6KH 4KDVA 4S0TD 4XB3A 3U83A 1NDGB 3WUWB 1ANUA 1KTRL 4IRJA 1MWAA 1U8IA 4FQLH 4Q89A 1HHJB 4IOIB 4XNQA 2W9DH 4MGXA 1S7VB 4M7ZB 4R26L 5GGQH 4NKMA 4RSVA 4XCNA 4HLZH 4MXVE 5K5YA 2P5PA 3JTTB 3QCVL 1EHXA 2CJ3A 4L1BA 2ZXWB 1NEPA 1N3NA 4X4ZA 4NM4H 3PWPA 4UTBH 2IEPA 3EJCA 1RULH 5D9SB 4PLKC 3MLPA 2WXPA 4UQIM 4Z3EA 2WXKA 4I5BB 1T20B 2F1BA 4P46B 3HFFA 3KPSE 4YLBA 5A3IC 1CXIA 4G6JL 3QARA 4AEIH 1XIWC 5KYXA 4EI5A 4YHLH 2XLLA 5FAAA 1CK0L 1IMHC 3P77B 3GRGA 3HS0B 3ZE1E 2XIIA 3TO4D 2KLTA 4LQ1A 1IAIM 1TMCB 1K5WA 3LN4A 5GS2H 2R69A 2EQDA 3L5XL 5F0JB 3CUPA 3UFIA 2FT7A 2XN2A 3HE6C 4MD0B 2COQA 4O4YL 2BW5A 2FBOJ 3DA0A 5SWQA 1J9CT 1SJHA 3L5JA 3L4ZA 4D7PA 2YBGA 4RGOL 3OXSB 1AS6A 5JUEL 3QEQA 5BZDB 5H4YA 1HH6A 1QSFD 1S5HB 1QI4A 3FRPG 4M4RB 5SWZA 4ZNEA 3T1FA 1GGTA 2J2ZA 4JKMA 4OCRH 3JYBA 3D50A 5IB3B 3JTBA 1RFDL 4J4PD 1QLEL 1NBZB 2WWNA 1UCTA 3HAEH 3ME0A 2GIMA 5DQDH 3QDJB 3WNKA 4CILA 2H5UA 1INEH 5JOFA 1KENH 2PPAA 1J1PH 3PAZA 4OBSA 2DEXX 3TOPA 3CDCA 1E6OH 2EE6A 5IVNA 1QFPA 4W9IC 3V95A 5AZEL 5TFSL 3LNHA 4TVPL 3SKJL 1EO8H 4XXCC 3QXDA 4YK4B 2OTUB 3IFPA 4DKEH 3QQ3B 1XCXA 3H6AA 3KPPA 2YQ3A 2XTJE 4N26A 2WOBA 4BQBA 2IADA 1TO4A 5E03A 1XTMA 2FWOB 2W59A 4BZ1H 1B4JH 2BIMA 4FX5A 5JOPE 2FT6A 2EYTB 2R83A 2C26A 3QI9C 2Q20A 2VDMB 2EE3A 5BRZE 3DX9A 4L8DA 1XR8B 4OF5A 4DVBA 3WN6A 3SY0B 3FAWA 1JP5A 5BPPA 2MMXA 3MJWA 1BEXA 1NMAL 4AVHA 1BX2B 4ONHA 3VGGA 3HRZB 3KNBA 2ZCKL 3ARBD 4K71B 3K74B 1AKJD 1L5GB 3TV3H 4HGWA 1UADC 4ZUVA 1CLOH 2P45B 3NH7L 3CZJA 3KS0H 3M7OA 4Y2DA 1JZ5A 5T3XL 4PVBA 1F97A 5FCUH 4U2YA 4X5QA 1PY0A 1QRNE 3L2LA 3V7AE 1IVTA 2MQCA 3SE6A 1I7RA 4L1DA 2GJPA 3ULVF 2AV7B 1IFHL 1L9PA 3RNQB 1MRCL 2Z0UA 2ZSWB 1ONQB 5KOVC 5HYIA 5D1XE 3EYSH 5C0BA 4Y9BA 3SO3C 1SEQL 4AC4A 2B7DT 2AGJL 3ML9A 3LRSA 4JFHD 3BEWB 2GTZB 2PKDA 4GB9A 5E8EB 2K7PA 3FKUS 4OUOA 4U1HB 3KPSB 3EH5B 2DMBA 1UVQB 1HQ4A 3TVMD 1LO4L 2BIIA 3BKJH 4JQXC 2EDMA 5HGAB 3ZE1B 3QRGH 4M02A 1GKEA 2HJLB 3RA7L 3FFOA 5DA0B 4XN1A 1VFAB 3MLYH 1QSEB 4KC3B 4N2HA 5CJQH 3PJLA 3WY2A 2HG5B 3H7BA 2F53A 5TF0A 5KSAD 1FZOB 2OCFD 2D8KA 1H3GA 1MCFA 2AERT 2CLVB 2RCSH 1H3PL 2MTPA 3HB3D 2E7LA 4QLRA 2XXCB 3TYGL 1EXGA 1T6BX 4AOFA 2A9NL 1WQVT 1U8CA 2CG9X 3MRCB 4QOKD 1FG9C 1WG3A 1PEZA 3EHBC 4NO3A 2FVNA 1KACB 2MEJB 3NCCB 3LMJH 3OLGA 5T3ZL 5L6YL 1MI5D 3EG9A 3IETA 2BY0A 1MH5B 4AGQA 3UP1A 4FNQA 5EBGA 3DVIA 8FABB 4FQPA 2YD9A 4J23A 1K2DA 4GUPA 3QPQC 5T1KA 5DTFA 5D72H 3U1PA 3DDGA 4X83A 4FFYL 1JS4A 3WXVH 1HXMB 1MEXL 1J5DA 2C1OA 1PLGL 1IQDB 1OZTG 3ZYIA 3BDXA 4D0BB 1N6UA 5EZOH 3C8DA 3DX7A 5IKCA 1EBPA 5DT1L 3QFJE 1K85A 4B3VA 1TSHA 4GAAA 1ZPUA 4GRWF 4PJ7E 2XTJB 3D3VA 3GUTB 4KI5F 1XSIA 2X53A 1I9EA 1RP9A 2E27H 4HWEL 4KZEH 4ZTEA 5HYJA 3GKWH 2J21A 4S1QH 5BRZB 5EU3A 3L3GA 4M1CD 1LTXA 2O5NA 2OJEA 1NMCB 1TCRB 4MAUL 5HYSA 5IB2B 2W65B 1LQBC 1QPPA 3NACL 4XPFL 2R2CA 3MRKB 2VR3A 2E5EA 4GQ9H 1E9QB 2Z93A 3SEPA 2RAMA 1KYOK 3MA7A 4WU7B 2MQ3A 1AGEA 5F9AC 4GRMA 1JZFA 4WTZG 5DUPL 1NFDA 2H3KA 2LAAA 3IJEA 3WFBL 2JTDA 4FHBD 1NDTA 3IFLL 1E43A 4YHIA 3LZLA 1QRKA 1GGIL 2OR9L 2YUVA 1IVLA 2WQ8A 4HJTA 3DTUB 2OYPA 2DZEA 5LNEA 4MA7H 4YDKL 4ZMVA 1T22A 3IE4A 4KRNA 3PXLA 1VFUA 4HJ0D 2F61A 2J56A 4JKPL 4MS8C 1K4CA 3F7VA 3Q2WA 3LIUA 4I48A 3QIBA 1RLWA 5D1XB 1E9OB 1AGCA 3I85A 4L3AA 4ZFQA 3QWOB 4ZFOB 3OKEA 4LB8A 5G5DB 3O6FA 3OB0H 4KMQA 3ZMRA 4DP4X 2HT3D 4ESKA 1MAML 2GJ6B 3MLVH 4ZMXA 4JO8A 4HK0A 4Y7MA 4ODXA 1GGCH 4FFZA 2X05A 2XZAL 1IBDA 3AREA 3HR6A 3T09A 2DWXA 3VTAA 5MI0C 4YFDB 4B9YA 2PTTB 4LK4A 5F7HA 2P5WE 3JWDL 5JQIB 1IEHA 3OWRA 3EBGA 4TUOA 2PCFB 2VR7A 1J1OH 1V54B 5MEQB 1JF6A 4JFYB 1OT2A 3BAWA 3CU1A 2VAJA 2CM6A 1W72L 3MBED 1UA6H 2VXSL 3AXLA 3KXFE 3TA3A 3ZTCC 2R4SL 3O45B 2LT9A 1TVHA 4H8HA 2CKNA 1Y6NR 3ZKMD 2JCCF 3L4WA 2NZIA 2F5BL 3D08A 4ENZA 2PF6A 3FQUB 4OFVA 3FOMA 2E7MA 4U3HA 1LEIB 5FX3A 3WS3B 4KVCH 1DDTA 1FCCA 2ICWJ 1Z5HA 2GB2A 3A4DA 3D85B 3S3PA 4AVIA 5KYWA 4JM2A 3LNFA 4GFTB 1Z5LA 4OZ4A 3C75A 4I0PA 3TNMB 4OGXL 2HLAB 5IEHA 1IEBB 3LS4H 4PYHA 4AK2A 3WENA 3ILPA 1KBKA 3F83A 1NCJA 1KXVA 3U25A 3DV6A 2WZPA 4NGHL 2IAMA 3GMPA 2HVKB 4YC2C 3FUHA 4M61A 3VI4A 3SDCC 1B0IA 5FM4A 1LE9B 1T66C 3LHAA 3EJYC 3VXQB 5LHDA 2R29H 1OLZA 1Z9LA 3QFJB 2Y4SA 3N04A 4MAYD 5I73B 2OMTB 4JE4B 4AQAB 4W1TA 3DYPA 4PJ7B 1QLRB 4HWBL 3CFCH 5EH1A 4ZAKC 1OAUH 4OD2B 3RG1C 3RFZA 3CMOL 3O2WL 2YAQA 2V5TA 4JANA 5H94A 2KL6A 2YAHA 1SM3H 5D7IA 5EO0B 5I1DB 2BZCA 3MV7A 4S1RL 1G7LB 2YQ2A 1S7TA 3AS3A 1XCQB 4AYFA 1SLWA 3TCTA 2ADFL 2G30A 3CZGA 4PJ9D 4RNRA 1GTFA 3EDEA 5AW9B 4P2AA 3D33A 3OKOB 4L4JA 3AQYA 1T1YB 4MJ6A 2BP5M 2H8PA 3RZCB 1ADQL 1TQCB 2XDHA 4GT7A 4GSUA 1TTRA 3EYFB 3S96B 5H37H 2NX5D 4PRIA 5D1ZI 2OMWB 1GY1A 1U95B 2D4DA 1DJZA 3SPGA 3MOAH 4GIPD 2B2XL 3ZDYE 2W8CA 3FRPA 2ODIA 3H2WA 1S7UA 3OR6A 1V7NL 1I8AA 2H7WA 2NDFA 4OIFA 4V1DA 1YEJH 4PW4A 2FO4A 4K3EH 1MCPL 2ZXEB 4GPVA 3OKMA 4ANUA 3C5JA 3QJSB 4S1DD 3M8OH 4TS6A 5EZJA 1BIIA 4N1CA 4U3CA 1WDAA 1RCYA 2X0UA 4NN6B 1GZQB 1UCBL 3QXUA 1G7JB 5C0GB 4KK6D 2BP0A 2XG4A 1NJ9B 3WJLC 3ZY7A 5MEOA 5AKRA 3X1FA 4BQCA 4KQ3L 3UTOA 2EC9T 3ECBA 5HGDB 1GOGA 4IOSD 2HJKB 5C3IA 4LOEA 2W0FA 5I76B 3S7GA 5DHEA 1BLNA 3TIEB 3NABH 2CDGA 4L4VD 3PREA 3KWVA 4J3OF 4KJQC 4OV6F 3OLEA 2P5WB 1HZHH 3DX8A 3I84A 5F3HB 2IGTA 4WNJA 5L8LB 2VC2L 4YE4L 4R7VA 3H3PL 1GC1C 3EH1A 1XCWA 3KXFB 1CLVA 3NP4A 2YPVL 3FB8A 1JGEA 4U1MB 1F00I 3LKNB 3WSQL 3TPUA 5BW7C 4XMTA 3S35L 4OIIH 1UC6A 4UTAA 5E4EC 2ROXA 5TGBB 4LIQH 5INDB 1A4KB 1U3HA 2B08A 1ES0A 3VM7A 3EF7A 3G08B 4WFEE 1IM3A 1JGVH 2WQWA 4GMSL 5EC2A 2P8MA 3Q8FA 3UGXA 2F74B 1CQYA 4N8VA 5FYKE 15C8H 4NDMA 3K8KA 3MRRA 3GBML 2Y69B 1VB9A 3HE7C 1Y6KR 2D7QA 2R23B 1D3CA 3IU4L 2EZ0C 4QYOA 1HOEA 5TDPB 3V4VL 5ADPL 2C4FT 3REWB 1C9SA 1R3KB 3ULVC 5HHNB 2VW4A 4Z77B 3QUML 4WJ5A 1KXTB 1OD7A 1KEGL 32C2A 5GRYA 3CLEL 3IF1A 3IKCA 4HCRH 5D7JD 1GCYA 4L9LA 4RAUA 4H20H 4F33B 3LS5H 2OL3L 5FF6A 1HAWA 2WY3B 1TQWA 3S36L 3OR7A 3CDZA 1KBVA 1S46A 1AO7E 5CLXA 3B2VL 1TENA 4YSRA 4J3XA 5DRXA 1A4JB 2ZCLH 3BP4A 4RIRB 4DN3L 2AITA 3FUKA 1O7VA 1A3ZA 3QRFM 1IAKB 2VLRE 1N0LB 1KCRH 2DICA 4P99A 1OM3H 5KSBE 1WGVA 3P3SA 1W0VA 1Q0EA 1WIUA 2DQHL 2JVUA 4XNXH 2DH3A 4W9HC 3UMNA 4KY2A 2UWEA 4WNQB 1GHFH 3ARGA 3UO1L 1KG0A 3VQMA 4DGYH 2V37A 4Y8AA 1U36A 3FN9A 4JZOB 1GW0A 1YYMH 3ZDYB 3P3UA 1M7XA 4M6NH 1AC0A 1FLTX 5DHXB 4WAFA 1MSPA 4MNGE 1F6LL 3W9DB 4KK9C 1L4IA 2YBRB 3EJSA 1G7HA 2WD0A 3UTQB 2LTQC 4RA3A 1NAMA 4ZOEA 3CH1A 3SCMA 3VGHA 2WLJA 2GBTA 3TEWA 4LLDB 4OLZH 3W2DL 4NQXB 5AZ2H 2ZWSA 3BHBB 5CMAA 4OW6A 3RNKB 1WD9A 3BAEH 1MFBH 2FL5A 4PRDA 3ROLB 3U36B 4JHUA 4NXKA 2FB4H 1KEML 5T1DH 3UJTH 4YHZH 1ZK9A 1XEUA 2BFVL 2A38A 3I6KA 1UT9A 4UM8B 3K91A 3DGCR 2XIDA 4NRXB 1CDGA 1IBFA 5DQ9B 3MR9A 4ZT1A 3WDJA 4HUVB 1JZJA 4TSAL 5HGGS 1GMIA 3NJMA 4LLWB 3Q9PA 1BCIA 3QWRA 1FLRH 4Y1TA 5KVFE 2A4EA 1FGNH 4ZMAT 8PAZA 5F1NB 2VWEE 1KXHA 4FQIH 1M6OB 2DQMA 4JFQA 2XWCA 1T5XA 3VCLB 2NY2C 3LKRB 1RJZB 4Z7NE 3GSVB 4NZDA 1VEPA 2OZ4A 3ARSA 3N44B 5INCA 3UL4A 3BPOB 3FQNA 3LX9A 3RGVA 4MVBC 4GRLD 3FQXB 4FG2A 4I88A 4IMLA 4XGZB 4D0DB 5HDQL 4K94H 3ESNA 1OAQL 4XC1L 1MJ7L 5D7LA 3G6DH 1E7VA 4FOMA 2B16A 1DVQA 4QXGH 3UAJC 5E2WL 1MHPH 4OTXL 5ENWB 1E7UA 2OI9B 3CN0A 5BVPL 1X7QA 4IKIA 2XA8L 4HOWA 5HY9B 1JZDC 1TZIA 3M7FB 4G7SB 4F7EB 3KDMB 4YHMH 2Z35A 2CUMA 1E5BA 4XNMB 1EJFA 1O6SB 4JVPA 4X9BA 2QVIA 4HV8B 3R8QA 3UABA 5E2UH 4RMQA 1AD0A 1L9QA 2YFOA 1CT8B 4FI8A 2ZUVA 3D18B 3U0PB 1YN6B 3BQUA 1WLHA 2DQFB 4JPIA 4Q56A 3UADA 1LO3H 4O5LL 3FQWB 3V4PB 4DWHA 4QTHB 1AO7B 1TETH 3ATBA 3S97C 1YECL 4PYGA 4S10A 3PWNB 4MRBA 1HCYA 5D2LA 2BXYA 1DBKH 4G8FA 4NUJA 4P57B 2XQYG 3T71A 3IPFA 4CNIA 1MFDL 3U9WA 4X4YB 3GSUB 4QCIA 1PD1A 3GYRA 1XF5A 3TT1L 5I2IA 5KSBB 4OD3H 3W5NA 1ZLUH 3ZHKA 4RDQF 2VO5A 5DK3A 3O4LE 1J9RA 5E70A 4ZUTA 4DKTA 3LKPB 5EOTA 1I9RH 3VH8A 1X4YA 2G4EA 2O5ZL 3IMSA 3IJ7A 1YPZA 3QH3B 5G4NA 4A6YA 2Y3AA 1FE8L 2PXYD 5E24E 1OTTD 1C8QA 3C6EA 3HOGA 4F7TA 3C60B 3MLSH 1P5UA 4MNGB 1E4XL 2CJUL 1FZJA 3MPCA 4XTRC 3LYRA 1EFXD 1TJHL 2VR6A 2ATAA 3ARZA 3UTTE 1FFTB 5IBTH 1HWGB 4U6YA 3STZB 1ACZA 2XKSA 5IMKB 1THAA 4QRRB 5IWLC 2R8SL 3GMQA 3MUUA 4MFHA 4XCYB 3S3DB 1NFDF 4R9HA 2FHCA 5D1QE 3ASWA 4Q2ZA 5AAMC 3UC0L 4M1GL 4WHTA 3QG7L 5GGSA 2K1MA 1X4XA 1DQQB 4XO3A 3PPSA 4WFHE 4NNYB 1B4RA 1EDYA 2MCG1 4OLYL 2VZTA 3QUXC 4YGVB 1CI3M 3ZZQA 3VNZA 1BVNT 4YHNA 4WWKC 1IC1A 3CHXA 3F7RA 2YMXH 5L9DL 4Z7OF 5HYQA 3PP3H 3AGWA 2NPLX 4MYPA 5DK0A 2YEVB 5C9KA 3HS9A 3LH9A 1L7TL 4Z7NB 3BZEB 2ITDB 4JDTL 2NY4C 4ZX5A 4Y19E 1FYTD 4Y1SA 2BSSB 2X4RB 2YAFA 2V5RA 1XB8A 2CIKA 5C7ZA 3T8VA 1MJUL 4XCFH 4L4TD 3TBSA 4GAJL 1ZDQA 3JVFC 4HHAB 5C9JA 1BZ7A 4MA8L 4ODUA 5HHMD 3CFDB 4F37F 5IREA 1PZBA 5E9DE 2M2DA 4K7FB 3O4OB 3AWGA 2CRMA 4BSJA 2BC4B 2ENQA 2AI0H 5J11C 1HNYA 1EQWA 1RAMA 3S88L 3H42H 4JDVB 4Q0XL 1HKLL 2XYBA 1OPOA 5SWSA 1MIMH 5TE7L 5AB0A 5ETUB 4HSCX 2ZOWA 2BWQA 4JM2F 4OD1H 4QEGA 1CBVL 1URLA 4G7YH 3TZVC 5H2BB 2EDYA 4B5ZA 3FAXA 2HCZX 1RZJH 4JDZA 2YGPA 3P1VA 4WW2A 2HYMA 4WI0B 3RX8A 4YR6B 3T2NH 5AQ0A 5I8EB 1D9KB 3KCPA 5F2FA 5JHLA 2X4QA 4IRJC 4OJFL 1PU0A 3C5SA 5JXEA 2PMZA 4J3OC 2GSGA 3ZL4L 3FHQA 4Y4HD 4YNYA 3ULUH 2NY7L 3VI4F 2NY0D 2ZWYA 4R0LB 1PLCA 1BHGA 3EJRA 4Q9BA 3UAFA 3GXIA 1H6UA 2B15A 2R7EA 12E8H 3V6OE 2RB8A 3JWOH 2B77A 1RSFA 1N0XH 3K6DA 3MN8A 1HSBA 2YUZA 1JPST 5DMGD 3X3FL 5D7IF 1AZUA 1OT4A 3LEVH 1OSZA 4EI5C 2JK5B 2AK1H 3NTCL 4PBWD 5C70A 3C2AL 2XVKA 1Y18B 3JSSA 1PGRB 3BFWA 5T33L 2BIPA 3LH8A 5FGCB 1CC3A 2QQLL 2VLMD 4OJAA 1WTLA 4B9KC 4TTDD 5FB8B 5ITBH 4PB9H 1MLBA 2JSFA 2WGXA 2FX8H 4XCCL 5FO7B 3SN6N 3V5DA 2EKJA 4N2IA 3UTTB 5IBLC 1IC5H 1B0WA 2J8OA 1TFHA 2AJUH 4X5LA 2IOIA 1T7WA 1HC1A 3GSNA 1MW1A 3GJFB 3NIFB 1NMBH 3QNXB 4N22A 5CKGA 4MZRA 1HTYA 5T5NF 5KS9E 5ALBH 5D1QB 4NZUL 3O9WD 2ZX5A 4N2FA 5JHMA 2ZOUA 4UMSA 4B41A 3D0LA 3BQVA 4AMXA 3H3BC 3HUJA 1HYSC 3VE0A 1LO2H 3FFDA 4JUSA 4JPQA 4N2KA 3TO4A 4D0CA 2H2SC 4E5XB 5ID0A 4N3UA 1KN2H 4XP9L 4PJEE 2VDNH 4KVNH 3TEUA 4W9GC 1IGCL 4WNSA 2DQCL 5E1HB 4JPVH 3ZDWA 3I74A 1XT5A 1BVKA 1XO8A 2H26A 1H3TA 4OFYD 1YEIH 2UYLA 1E4KA 1A6TA 3WNLA 1TZHA 3BAJA 1EIBA 1JJUA 2UY7A 3VX1A 3QYCA 4OCXH 4B6ZA 3TF4A 4IKNA 4DO5A 1YCSA 3S8WA 1QSFA 3FC8A 2WXIA 2OTWA 2WUBL 3CVHL 1DQLH 4Y19B 5ICXB 5BMFH 3ZTDC 1X5GA 4J3SA 4WEBL 2ICCA 4JFOA 5B39G 5HPMA 5JIMA 3WLBB 1CGWA 3EGXB 4N8PA 4J4PA 3RVTC 3U7YH 5KBNC 4HC1A 3OJ2C 4BKSC 3JWNH 5F3BA 4GLRH 4LVEA 1TEGA 3D51A 4JFUA 3EZ8A 4NUQA 1GL4B 5E9DB 5T8IA 3SGJA 1USQA 3WNIA 2R4RL 4WUUD 3FBKA 4MKTA 2IH1A 2VDOL 4RGMB 4XBGB 4E36A 1HAUA 4ZUUA 3G5YB 3QRBA 3MREA 4UT6A 3QHTC 3NSJA 4O2CA 4U6HA 2BOCB 2C34A 3OWEA 1DN2A 2H1XA 5MEPA 1QI3A 3S3CB 5I5IA 4ZBJA 4AE0A 1A0QH 1SFDA 1KJ2H 1HQRB 3C9NA 3KJ4B 2FECI 2IANE 1L7IL 4LLUB 1TMQA 2ITEA 5DZNA 1C16B 4L1HA 4JGJA 4D8PB 4C47A 3T4YB 2CR3A 4W6WB 1QFUL 1RUAH 2GCYA 3GMOA 4HS3A 4P5KA 3RE0A 3VXSE 1BQ5A 4OIAA 5C2UB 5E8NB 5FOBA 3THMH 1JHTA 4OB5H 1HHHB 5ELIA 2ENPA 4LQFH 3MNMA 1UZ8A 4LCYB 4TLTA 3UG5A 4K7PH 4NKDB 4OCYH 4YDJA 2DJUA 3PUUA 4DZBB 1AKJA 1JK8B 4RAVA 4WHCA 3RY6A 2VABB 1QP1A 3AXIA 2VGLM 3RI5K 4HMCA 1VCBC 2FR4A 3SKNB 1UH4A 3FU8A 2F19L 4K2UL 4KRPD 1D6EA 1VDGA 4UILL 4C4KO 1VKXA 2UWEF 5I9QC 3QPKA 1QFWI 3VDBA 4TF4A 5F7YC 2UUDH 3X1EA 1UM5L 1C5BH 1I9JH 2RMNA 4D2NA 2QKSA 1BPLB 5FHBL 1DANU 5KS9B 3MCKB 3VD2A 4EKXA 4YAQB 2DF3A 3B37A 1IM9D 4EI0A 4OJCA 3IJ9A 1LQSR 1BG9A 4A7UA 1UB5B 3BC9A 3Q2LA 5BZWB 4PJEB 4XNBA 4KXDA 3D39E 3QIUD 4HQQH 4M7LL 5DO8A 4QGTA 2VZUA 3B2UD 4UV7L 5FUOL 1U6AL 3GI9H 4LAQH 5IF0A 1NGQH 2XUWA 3K4AA 3VXME 5AFAA 4BQ6A 3RKDC 3VWJB 3U0WH 5LN8A 1N19A 4RFOH 3VXTA 4IJ3B 4DNLA 3PFUA 43CAA 4DAGL 5CGYD 3KPMB 1RZ8B 3V8CA 2FRGP 1N8ZA 2YUXA 2GIXA 2YQGA 2BMKB 5TH2A 2Q3AA 1FDLH 4GUQA 4DFIA 5CU5A 3S37X 3HPLB 4AIOA 3OZ9L 2W91A 3ZVVA 1N5AB 1LMKA 1MI5A 1BGXL 4JZJC 5KZCB 3FCBA 1IKOP 5DJZA 4LEOB 4PN6A 4EI6B 3JVGA 4NBZB 3TWCL 3NCWA 2NW2A 4UU9A 2O93L 1J5HA 4FNSA 4BH8B 1XXDC 4MKMA 4RQQA 3VSTA 5I30L 5DYOB 1TG8A 3G5ZB 5E1GA 3AM8A 2ZICA 5CFAA 5F9WB 1FRGL 1PW3A 1ZT7B 1TPXC 2O72A 1AYOA 4ETQB 2DWDA 3F7LA 4X4ME 5CO1A 4PJ5E 2XCMC 3MNZB 4P23C 1L3WA 2ZOKB 4P2QD 3STLA 3ZRCC 4XXWC 1CD9B 2IANB 5I1IL 4KKCD 4OJYA 4Y1AD 4S0SD 1I1CA 5DUJA 3NG5A 2F08A 2V7HB 4G43B 3GRBA 3KLHD 2AEPH 4LBEB 1PAZA 3VXSB 3CG8A 4HPYL 1S7XA 2DQDL 3RDJA 3CMGA 3QIBC 5F7EL 2AQ2A 3I6LE 4J3VA 1XL4A 2FATH 1BZ9B 5AB1A 5I66B 3O6FC 1U8HA 4FTVE 4OLEA 1XIWB 3RWIA 3NA4A 2YKKA 5ABZA 1I8UA 3WAJA 4HT1H 1JG9A 1C5CH 3BUYB 4XVUD 3KGRA 4A68A 3IBOA 1QZNA 1SOKA 1K8IA 3RQ3A 5D2LF 1NWPA 1ZE3H 4FA8A 5CBAA 2PPDA 3KPOA 4UOW0 3SDAD 2BOBA 2NDGA 3BCDA 3DC0A 4NNXB 2A83A 2KPNA 5KEZA 4LCWE 3BISA 3AC0A 1AXSB 3PDGA 4J12A 3DO7B 1KPRA 3GSQB 2OSLB 5DK2B 2Q6WA 2C7FA 5CHNB 4K3JL 1YNLL 2F7QA 2AK4D 3DI3B 3TA3C 3EFOA 1Q9WB 4TUUA 1YPZF 5AL0A 1FHGA 2NYZA 1QKZH 2DQUH 1EDHA 5IFAL 1FVEA 1HHIA 4RWHA 5CEZE 5L4JA 1YQVH 3FDWA 4ADIA 4LHQB 4FQHB 3H2PA 3VQ2C 4G59C 2EH8H 3M88A 4JM2C 1KGJA 3LTVA 3NJVA 5IVZB 3LKQA 4M6AA 4I0PC 4GUCA 4AZ8B 2EDFA 5C0JA 4KFMA 3KE0A 4KNSA 4JE0A 2LVCA 1IGYA 4J8RA 3D39B 2UXFA 3GBNL 1RJLA 3HR5B 3T6WA 2BVOA 2V6HA 3DOIA 3MBEA 4Z0BL 1QO3A 2QGEA 5BNXD 3VXMB 5DI8A 4JKNA 1OVZA 5EUKA 3WY4A 1R46A 4C56E 4NP4L 3N1FC 3DVNB 4GMTL 1AMXA 5CZRA 5CCKH 5JW5A 1JPTL 4MQXD 3TASA 4LLVA 2GK0A 2EIEA 1MLCA 1ZVSB 5HDLA 3RFZC 3MV11 1AGBA 5AUMA 1T80A 3QI9B 1BAGA 4ZXBA 5K9QI 4GI9A 2PWEA 4HUXA 1G7QB 4DTGL 1OKEA 2J6EL 3WUWG 4FG6D 4C55A 3BZDA 1U91B 2JTYA 4L3EE 3FO9A 2UY6A 4OT1L 4XPGL 1TZAA 4Y2OB 5GZNA 2W38A 1EAOA 3KBEA 3SHSA 1L0XA 2JF1A 2HLFD 3MLZL 1IB5A 2J5LC 4YXLL 4LHUD 1QR4A 2VXUH 4WSGA 1W16A 4F8LA 3ENEA 4F8TA 1NGXA 4MAYA 3REVB 4I18C 1B2WH 1JWMA 3FTXA 1GMEA 2CDEB 4IRZH 1H3XA 4ODSH 2H6PA 4OQTL 4XRCB 2ICEC 3WD5L 1G9NL 4KO9A 4H8WH 4JPKL 5DVLA 3TFKC 3UO8B 4E9XA 5DVPA 5FYLH 1VZHA 2VDRL 3KR3H 3Q2CA 5HYFA 1UQSA 2XXMB 1R3LA 3SYCA 3ETBJ 3BYTA 4PJ9A 4H0GA 3SO3B 4HOMA 3BO8B 2X6BA 7CGTA 1GIGH 4YQXH 4S1SL 4U1JA 2FDBP 4WV1A 1QW8A 5H35B 4Y9EA 4WW2F 4XN7A 5GRVL 3MNWB 1THCA 4FTVB 3HFML 4FP8H 2NX5A 2P8PB 3MNVA 1W0WA 3B9KD 4JY5L 1G1KA 5L88H 3CFJA 1H15B 5M94B 2E59A 5CWSA 1FSKC 3DX6B 3NN8B 3RFRA 3FT3A 3QT2A 4IGBB 3CFEA 5PCYA 1A7RL 1QBLH 5ES4B 5J6SA 5DRZA 3BVDB 3ARDA 4G3YL 4MCZB 2BLFA 5GRJL 3S2CA 2XVGA 5FYJD 4OAWA 4I3RL 2XZZA 4M5TA 5HHPA 4GJTB 1FL5A 2FLRT 2PTVA 5F9OL 4HH9A 1MW2A 2IGFL 3UPCA 1JPEA 4B96A 2MJWA 3B1TA 3BVXA 3BWAA 4ODWA 2NTSP 3QR1A 4PJIA 4PV9A 1F56A 3C5ZD 1B4LA 1F6AB 5GHWL 4YSAA 1YUHB 3QJZA 1X4ZA 1OM9A 2AMGA 4KKPA 1FZKB 3EHBB 4L4VA 2X1XR 4UZSA 1VJSA 1QHOA 2WNXA 4QTIH 2NTFB 3DO3A 4R96A 2G60L 3UZQA 4HP5A 1DQJA 4GKNA 4N1EA 2BSBA 4EN3D 1HCZA 2DTMH 3BP7B 1J05A 1HIML 3MXWH 4MJ5A 4R8WL 2AXHA 1W0YT 4JY4A 1N4XH 4NZRL 4JFVA 3LEYL 4N3TA 3NJKA 2NW3B 1NTDA 2EE9A 2AAAA 4POYA 1UYWL 2L04A 1IIIA 4C56B 3RPIA 4YDLB 3HUJF 3CSYB 3CZFA 2Z65C 1LGVA 1VADB 3EFDH 5FUZL 5IW1B 1OE1A 1SN2A 2ZYSA 1MNUL 2A9MH 1G7PB 4X6EA 2BWIA 1G1YA 1OGAE 3CN3A 3WFDH 5FIEA 2Y25A 2VDML 1XBRA 5CP7A 5HGHB 3MJ9H 3QUGA 4A67A 5CNHA 5MENE 4PTUB 3C08L 5TF1L 5CBEB 3MRFA 4KTYA 2NLJA 4L3EB 5J0BA 4KNQA 4XI5C 4A38A 3O6LL 2YK1H 4R7NB 3OPZL 1EH9A 1ED3A 2VL5A 4R97C 3OVUB 3TBVA 4PJCA 4TQIA 3UH8A 5EZIL 5GJSH 1CLYL 2WYTA 1JAEA 3E7JA 4HDIB 4HIJA 4NN5C 5EV7A 5JNYB 2A6KB 4ODTH 3V5HA 2ZAGA 2L7UA 2YZ8A 5AWNH 2AXFA 2W0LA 2X70A 5D7JA 3GEFA 3CXDL 5I1JH 2FJFA 1U42A 4M6ML 2VDLH 1RPQA 3OZLA 4AMKL 5JLZA 2N4IA 2VQUA 4LRNH 2C3VA 3FU9A 3BE1H 3CD4A 4E9QA 2Q7YA 3B5HA 3NEEA 4V11A 4YX2L 2B5IB 1B0RA 2A0LD 2ZKHH 4NI3A 4X7FC 3FU0A 3KDPB 4ZNCD 2E3VA 4NHUB 1ZT4B 3DJ9A 4GW1B 5AKVA 3SCMC 5C6TL 3WTVA 3SOTA 1FNLA 2MOGA 2EYSB 3OF6D 2LU5A 3KPNA 3OLDA 4Q58C 3VFPB 1RIUL 2AJYL 3DURA 2A5UA 3LV3B 2V9TA 5B3NA 3CFKB 3ZQXA 3BXNB 3CSGA 3ILQC 2OCCB 5MI0B 5FECB 2HRPL 2YPLE 4HW6A 2EXTA 4PHZA 1PG7L 4Y4KD 4I1NB 3U2IA 1KJVA 1U8JB 1UHVA 1SMAA 3NIDE 1AQHA 5DHVB 3QHZH 1HWWA 2VN7A 3DIFA 4HLEA 4Y16C 4HPOL 4U1GC 4FQ2H 1WO2A 3AQXA 4LLQB 2KUTA 3HTLX 3WMPA 1R3IH 2DWEB 4WKZB 1DUZA 2HB0A 4OSUH 3MUJA 3PNWA 4X9IA 2MHAB 5T1MB 3M46A 1XSOA 4MTMA 3L2MA 1DDHA 4UWQB 2VMDA 4FZ8L 1U8QB 1WBZA 1SYVB 3V0WH 4K5MA 5L2KD 4I7ZC 2Y6TE 3ZQWA 4BSVA 4L0ZA 4CU7A 3RGVC 4RLDA 5LJYH 1JGUL 4ZUWB 2P26A 1SBSH 1IEAA 1ERNA 2GI7A 2PR4L 4EDWH 1MHCB 2WBWB 1XF3A 3QJFB 3OKDA 1X5XA 2GFBB 1CDYA 2LW3A 2WXNA 4NPKA 5D71L 4YC2B 3Q8AA 3RRQA 3SDCB 5KJRL 1A8ZA 4A39A 3ULVE 1NCAL 1T04A 2IQAB 2R1WA 4ZTPL 1HOCB 5IW6A 5FOJA 4HKJA 3HI1A 4U6XB 3O0RL 1AJ7L 4ZAKB 1A7PH 1KC5H 5HI3D 3MJ8A 2ZUQC 3H4HA 1RZGA 1NM4A 5ADOL 2QKIC 5IHHA 4GRLA 5EN2A 4K5NA 1UA7A 3F62A 1OGAB 4PS4L 5D6DC 2YD4A 2O6FA 1DVSA 2VERA 3MOBH 1MRDL 4UV4L 3WIFA 1WSST 5MENB 4GO9A 5D4IA 1XGUB 2F7RA 4NIYE 3UJJH 4B9FA 3OXRA 1X44A 1OQXA 2HFEB