3NSYA

The multi-copper oxidase cueo with six met to ser mutations (m358s,m361s,m362s,m364s,m366s,m368s)
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
493
structure length
465
Chain Sequence
ERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAILPDTLSSLPALPSLEGLTVRKLQLSMDPSLDSSGSQSLSEKYGDQAMAGMDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTVLQGDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of multicopper oxidase CueO bound to copper(I) and silver(I): functional role of a methionine-rich sequence.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Blue copper oxidase cueO
total genus 130
structure length 465
sequence length 493
ec nomenclature
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nsyA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nsyA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nsyA03
5D4JA 2YAFA 1OE1A 4BDVA 4M3HA 2H5UA 2PPAA 1KV7A 3HB3B 1L9QA 2IH9A 3FYEB 2PP7A 2DYRB 3H4HA 4ZK8A 3C75A 2FQFA 2P80D 2R7EB 3FU8A 4YVUA 1HFUA 3QJQB 1CURA 1ID2A 1A4BA 3NJGA 1VLXA 3S8GB 4G71B 2XV2A 4BXVA 2HZHA 1AZBA 4YSCA 2I85A 1L9PA 3PAUA 1ZDQA 4YSEA 3QPKA 3NJLA 4E9YA 2BP0A 3X1NA 1JVLA 4WKXA 1SNRA 4E9SA 2MRYA 4FAAB 2H47C 1OV8A 1J9SA 2WO3B 1JOIA 2I7SA 1BXVA 2GC4C 2JKWA 2UXVA 2YAQA 4AX3A 2VN3A 4F2FA 2R7EA 1J9TA 5B1KA 1N70A 2DWTA 1NICA 2QPDB 1BYPA 4RH4A 2FNWA 1ZV2A 3GYRA 4NERA 3FQYA 1OCRB 9PCYA 1WA0X 3EH4B 2HX8A 3CVDA 2YQBA 3N55A 1NIAA 3OM3B 1CUOA 3GXUB 4DPBX 5A7EA 1CC3A 1NPNA 3FSAA 1E5ZA 3CZUB 4CSPA 8PAZA 4JKNA 4YSUA 1PLCA 1AOZA 3ERXA 2FTAA 2IWKA 1KGYE 2CBPA 3NJNA 3CVCA 3JT2A 2UXTA 2P80A 2IDUA 4GXFA 1AZRA 1SDDB 3OMIB 1NWOA 4YVNA 4FA7B 2GBAA 1AAJA 2PCYA 3TU6A 1ETJA 5D4HA 2FT8A 2IDQA 3IE9A 2W8CA 1NDTA 1WAEA 2XV0A 1XB6A 1ET7A 2VM3A 1AQ8A 3AY2A 2PCFA 3IEAA 4AZUA 7PAZA 2CJ3A 1OOWA 1PZAA 2QT6A 4UF7C 1BYOA 4A2EA 1X9UA 2EIKB 5F7AA 1PNDA 3FT0A 2YAHA 2BW5A 5EHFA 1QHQA 2FT6A 1FA4A 1ZIBA 3EH5B 5AKRA 1L9OA 3ZBMA 3H4FA 3QJTB 1GYCA 1AZNA 4A67A 2EINB 4E9QA 1M57B 2VW6A 3SBPA 1KCWA 4HALA 4DP2X 1UATA 5ANHA 2XXGA 2QDWA 3ABMB 2XV3A 3AG4B 3FQ1A 3T6XA 3AG3B 2AVFA 1L9SA 3ABLB 3CG8A 2PLTA 1DZ0A 2QPEB 1AACA 1ASQA 4A2DA 2BWDA 3UADA 5LDUA 2BP0B 2GIMA 1SF5A 4DPAX 2B08A 1T5KA 5I6NA 2HX9A 4YSOA 4GYBA 1L9TA 1A4AA 3SBQA 1KDJA 4JHVA 2GC7C 1FFTB 1M9WA 3AZUA 1IBZA 2Q9OA 4KO6A 2IDSA 4HCFA 1WS8A 2HX7A 4TXVB 1E5YA 4N4YB 3NSFA 4F7KA 3S8FB 5B1AB 1PY0A 4WTQA 4YSAA 5AZUA 3WG7B 1NIEA 3MBWB 2XX0A 2PP8A 2JXMA 2UX6A 3UABA 1AR1B 1GSKA 2DY2A 4DP7X 1TEFA 5PCYA 2YAPA 3TASA 3T6VA 1NPJA 4GY4A 4BXSV 1XB8A 3SQRA 2CALA 1BEXA 2YAMA 3UGEA 4A2GA 1BXUA 3IN0A 1AS7A 3QQXA 3HEIB 2WO2B 2YARA 1NIBA 3QJSB 3IBOA 1JZFA 2MTAA 1KYAA 3S3CB 3SBRA 3PPSA 2RACA 4GP4B 1PMYA 2CCWA 5PAZA 2A3TA 6PCYA 1OCOB 5B1JA 1J9QA 3FPYA 1WA2X 2GB2A 4HHWA 2BP8A 4HCGA 3KW7A 1R1CA 3FU7B 1AIZA 1SHXA 3FSZA 5I26A 3FPXA 1ILUA 1JZEA 1PZCA 3NSCA 5I5IA 2Q5BA 3GDCA 3EF4A 3IN2A 2N0MA 2IDFA 1ZPUA 1BQ5A 1I53A 3OMNB 2VSMB 4BWTA 5I6PA 2VMJA 2GI0A 2AZUA 2AANA 3AG2B 3D12B 5F7BA 2GSMB 3UAEA 1NWPA 3QJRB 4M4RB 1NZRA 5B7EA 2VW4A 4DP0X 2IWFA 5I5MA 1QNIA 1SFHA 4BWUA 3MX0B 1A65A 4DP6X 2IWEA 1QLEB 2I7OA 4G7SB 1PNCA 3N2JA 1PAZA 2X87A 4G7QB 4A68A 2JFCA 3CDZB 1BAWA 1EHKB 1HAUA 2EIJB 1W6WA 1JXGA 1JZGA 3NJKA 5FC9A 4YSPA 2LLNA 3AG1B 5I6LA 1A8ZA 1J9RA 4KOCA 1JXFA 4AKOA 3TA4D 3AW5A 2OV0A 4DPCX 4Q89A 5TK4A 3OD3A 3TBCA 2PPFA 2PPCA 1JERA 1W8EA 1GR7A 2AFNA 4HCIA 2B3IA 2VM4A 4A2FA 5D4IA 2VW7A 1ZDSA 2FWLB 3EH3B 4YSDA 4A2HA 3NSDA 4W1TA 1OCZB 4DP1X 2W88A 3NP4A 1GW0A 1RZQA 4DP4X 3ZX1A 1SJMA 1N68A 3FQ2A 2BP8B 3NP3A 2EIMB 1J5CA 1YLBB 1SF3A 4A66A 2FT7A 1AZCA 1A4CA 2AZAA 2H3XC 3FSVA 4YL4A 3ZIYA 1IBYA 2BZ7A 4QLWA 3T6ZA 2Y1AA 2TSBA 2Y69B 2XU9A 1PLAA 4AKQA 5I28A 1OCCB 4KNSA 4UANA 2J56A 1ET8A 1IC0A 3WKPA 3DTUB 1KBWA 2UXFA 2VSKB 3ASNB 2YAOA 2FJSA 1TEGA 2BWIA 3L45A 3QJUB 1L9RA 1URIA 3X1FA 1XB3A 4G72B 5IY5B 5E9NA 5I6MA 4G7RB 4CSZA 2PP9A 3NYKA 4PCYA 1SFDA 5I6KA 5B1BB 3PAVA 1J5DA 4G70B 2DWSA 2YAEA 3NJIA 4P5SA 3V9EA 1M56B 2XYBA 2CUAA 1RKRA 4X4KA 4E9WA 2YXVA 3RYMA 1GY2A 3V9CA 1E67A 3X1BA 3ABGA 4YSTA 2ZXWB 4KOBA 4Q8BA 1NINA 1AZUA 3BVDB 4GP8B 1KCBA 2IAAC 4KO7A 5B1JC 2XUWA 3FU7A 3NJMA 1A3ZA 1AS6A 1ET5A 4F2EA 4GP5B 4UAHA 3X1EA 4DP8X 1GS8A 1ASOA 3PCYA 1GY1A 1AG6A 4PAZA 1BQKA 5AFAA 1CYXA 3OQRA 3WNIA 1PLBA 1SHWA 1NTDA 1AS8A 3EHBB 4NB7A 3U25A 1MG2C 4ENZA 4K9JA 4BWWA 1WA1X 2XWZA 1ILSA 2PPDA 3TBBA 2BHFA 3FU9A 1CYWA 2GHZA 4YSSA 4HAKA 3S3DB 2NRDA 6PAZA 3X2QB 3JTBA 1DYZA 4AI7A 1E65A 3NT0A 1ADWA 2EILB 2PPEA 3FSWA 2J57A 1RCYA 3H56A 2UX7A 1AANA 3FYIB 1ZIAA 4DP5X 2HLEB 5I5JA 4KNTA 3DIVA 5B7FA 2FQEA 3NJHA 3S3BB 2ZOOA 2UXGA 3BQVA 1MZYA 2FQGA 2QDVA 1B3IA 4W9ZA 1KBVA 1IKOP 4E9TA 2ZONA 5TK2A 1F56A 3PAZA 2CAKA 4HIPA 3FS9A 1BXAA 4L0PB 5B3SB 1JVOA 4AKPA 2IH8A 3CDZA 1TU2A 1WS7A 3T6WA 4YSRA 7PCYA 1RZPA 1V55B 3ZDWA 3G5WA 3T71A 3NJFA 2X88A 3NJJA 3ABKB 4EF3A 1ASPA 1JZIA 1OF0A 1JZHA 3X1GA 2OJ1A 2IDTA 4YSQA 3CVBA 1V10A 2J55A 2XX1A 3WKQA 4NAJA 3NSYA 1MZZA 2XXFA 4E9XA 1EZLA 1NIFA 5B7MA 1OE3A 4MFHA 4DP9X 3UACA 3OMAB 1HAWA 2E86A 4BK5C 4E9VA 2XLLA 2YXWA 4JHUA 2BO0A 1PF3A 1BQRA 1PZBA 2OCCB 4KO5A 2FQDA 2HRGA 4P5RA 1NIDA 3PLYA 2HXAA 1E30A 3WIAA 1TKWA 4N8UA 3UAAA 1JZJA 2BZCA 3WI9A 1W6LA 1SDDA 2XVBA 3QJVB 5I6OA 2TSAA 2ZWNA 1XMEB 2WSDA 2J5WA 1V54B 3KW8A 4QKTA 1KDIA 1PCSA 4HZ1A 2HRHA 4BDVB 1IUZA 1FWXA 1MG3C 1X9RA 3PXLA 4HHGA 3DKHA 1GS7A 2DYSB 4KO9A 4KNUA 4E9RA 1GS6X 1OE2A 1JXDA 1AG0A 3WNJA 3ASOB 3T9WA 2DV6A 1MDAA 2BW4A
chains in the Genus database with same CATH superfamily
4TUJA 2L8AA 5DD0L 1BX2B 3SE4A 3BRFA 1PL3A 1IM9D 3TJPA 1KV7A 1SEQL 5FIEA 2FZ3A 4DNLA 2ZYIA 3AT8A 2H41A 4P46A 1J12A 1TZGL 1WGVA 2VERN 5LBSA 1MHCB 1UACL 4M7JH 4O2EA 3LVTA 4PJAF 1YMHB 2PTTB 1UJ3A 2VABA 3QUGA 4RFNC 4DETA 3F8UB 3CFDA 1H3PH 5F9JA 4C56B 1PKQB 5J56B 1IJNA 1XR8A 2XFXB 3APFA 2VE6B 1UM5L 5EBMA 4G42A 2D7NA 2OZ4A 4ZNEE 1ZT7B 2FX8L 3ETBF 4JRYB 2F8OA 4MRCA 4FJYA 4OBRA 4LB8A 1AJ7H 1JVLA 2D7QA 3O6FA 4JKWA 2DBLL 3QUML 4Z3GA 1K8IB 4K3EH 1XZ0A 1GCYA 1OV8A 1TJHH 5GGQH 5HHOB 4N1EA 2WO3B 1EZVX 1PX3A 2XQBH 4TSAL 3MLWL 4IU2B 4L3EE 1UM6L 3EJCA 3QJOA 4ZUTA 3CXFA 4YO0B 4BM7A 1YMMA 4AV5A 3QJHA 5AVUB 5D7LB 1BYPA 4WAFA 4NI6A 4P2QB 5C0IB 5FO8B 2PYEA 5KJRL 3VD4A 1LK3H 3EH4B 2P52A 1BV8A 5LHDA 4W9HC 4O4YL 1JGIA 4P06A 5HD8D 3UYPA 1CICA 3SN6N 3GXUB 5A7EA 1P4IH 2I24N 5C0JB 5CGMA 4PSRA 5EO9B 3FSAA 4NRXB 3E6FB 3STBA 3CSPA 4PJ9C 1LO4H 1MCKA 3TZVD 3DO7A 4YBLB 5FGCB 3U4BL 2X4PA 2ED7A 3CN2A 1TOXA 3IDMA 5K5YA 4TV3A 5HDBF 5KVEL 1AGFB 4N2FA 4ILDA 2MKWA 2AJXL 1U8KA 3VRIA 5GQBA 4RGNB 5SX5H 3AY4C 1JGVH 5K39B 2YBRA 4GRWE 3CBRA 1JFQL 5J8OA 5CP3H 4RWYL 3QDGA 2BLFA 1WAEA 4UTAH 4PRDB 4EO5A 1NBVH 3TO2A 3ARGA 5D2NC 2OSXA 1C7TA 1JHKH 4N0YH 5EU7E 3IGFA 2AEQH 3QWOB 4UF7C 3FUEA 4KJYB 5I1LA 2YLHA 1XL6A 3IBEA 3HBZA 5EZIH 1MVFA 2A74A 2B39A 2GJ6A 3SGKA 2EXYD 1JWSB 1WAAA 2YPVL 5AKRA 3BSHA 4F2MB 4TSBH 4UU9B 2SEBB 2X28A 4WU5A 5FCSH 5KG9A 2UZIL 3VE0A 4NKDA 4K8RL 2IPKA 4DK5A 3TJHD 4BD4A 5I1HL 3RWHB 1KUMA 1DBML 1QW9A 1GPOH 2ED6A 3MV7D 1AQMA 4LIQE 1HH6B 3SQBB 4AVKA 4UYPA 1TZ8A 3MACH 1BIIB 3BZFA 4TVPL 3UX9B 4QOKA 3QQ9C 4ONFL 4E68A 3SDXB 1DFBH 2X2HA 2YPLB 4C4BA 2QPEB 3RVUD 1MAKA 5HVGB 1J18A 1USZA 2UYLA 3JV0A 4JANA 1F11A 3MMEB 1TCRA 1S3RA 1UA6L 3LH9A 4P4KB 1OP5K 4DKFH 1PG7L 4NHCL 1FG2B 1ZLUK 4AM0B 4KV5F 4MSWA 2CJUL 4PWFA 3FONA 5F6HI 3RGVB 4I7ZC 3S2CA 4HCFA 1KYOK 4ZS7H 4N4YB 4CUCA 3WY2A 3IGKA 1ZS8B 1RUQL 2IH1A 3SO3C 3OJDA 4QXUH 5C0AB 3HB3C 3BKML 2PP8A 1NKRA 4QRAA 1XGUB 2ZNWA 2YD2A 4PJ5E 1BZEA 4PWHA 4XMKH 2W0PA 3MLWH 3MV8D 2JH2A 4M5TA 2QKIB 2AGJH 1DLHB 2E75C 3LIZA 5SWZB 3U2SA 1R5WA 2NY5L 4GKZA 5LCVH 2GKIA 1I8LA 2HT2C 5FV1L 3TVMC 1YJDH 2BOBB 1VDGA 3SDXE 2B9BA 1I8UA 3AS3A 4Q2ZB 2ZXDA 4WGVB 3RE0A 1I1AB 5AAWA 3CFKB 1HH9B 3BVWA 3GLEA 4RZCB 2YMTA 1FVDA 3PGCB 4FE9A 5PAZA 1LO4L 4B50A 2A3TA 2PN5A 3VFSB 1L7IH 3GMMB 4NZFA 3B34A 4P2RA 1HXMB 5F7MC 1J5OH 1SGKA 1CD9B 4JM0A 4ZBJA 2DTSA 3QDGD 4CVZB 2VLLB 1A8JH 4BA0A 2NZ1A 4PJIB 1OARH 3GSOB 3UYRL 1W0YT 2B0SH 2Z35A 3BDXA 3IFOA 1KSRA 4Y4HC 5I5IA 4Z7WF 3IN2A 2Z8VC 4AL8L 2JTYA 1PLGH 3B9AA 4N86A 1TSHA 1HCZA 2HTLD 4U6YB 3W56A 2Y24A 4POUB 1WIUA 4PJ8D 4OCRL 1CO1A 3WUZA 4QXTA 2WLYA 1NFIB 2JK5A 1PZ5B 2W9EL 3GQFA 4TNWK 5BW7C 3MAWA 5JR1H 3ABZA 4RESB 4ELMB 2C5DC 4U1SB 1EUUA 3V0WL 4WW1B 4HIJB 2C34A 4U3XA 4G7SB 3T0AA 3M7OA 2W60B 2YD9A 3MODL 2JFCA 4G7QB 4XNYH 3APMA 2ZX6A 4QOKE 3OX8B 1TYEB 5FM5O 1P69B 1QASA 5BUPA 1L0QA 3B2DC 2IALA 4FHBD 1QA9A 4D3CH 1JF6A 4FI8A 1W72B 1JGEA 5JQIB 3L3KB 1J9RA 4OGAD 5AW3B 2C4FT 3D2UD 5AW0B 4NNXA 3V6OA 5D1XC 1IGFH 4N6RB 3ARXA 5J12C 2BSBA 4M62L 5DJ8A 4MAYA 4M48L 4OQ1A 2IG2L 4R4NC 3IXTB 2XXMB 1UKTA 3QNZB 4HD9A 1LWJA 4UOZA 4YWGL 4EKXA 4DGVH 4G9FB 3EFOB 2VW7A 3HCVA 5EO0B 3BIKA 4U1GB 5IM7B 2ZD0A 5FA3B 4OJFL 4A7VA 3MBED 2OMNA 1AE6H 3E7JA 5JIPA 4JM2B 2OTPA 5DUBB 4ADIA 2ZT9C 3EFOA 3PL6B 1N68A 1YNTF 3LN5A 5AOKA 4UAOC 1BGXH 2F58H 3VFSA 3LHPL 2C4FU 3I6GB 2H3XC 4LEBA 2FHBA 4G1MB 1P7QB 1E6JL 3ARWA 4ZUWB 3CFKA 3T6ZA 1IFHH 3GHBL 2XQYG 3DJTA 3U4BH 1JG9A 1OSYA 1ONQA 2Y69B 4FQHA 2XU9A 2AEPL 1KGWA 2EDTA 1TEYA 4YJZL 1UB6A 2V5SA 3CWGA 3MJ9L 1MWAL 4LZKA 1EAOA 2E7BA 4JFFD 4JZJC 1NFDE 1URZA 4MXWH 1XR8B 4OIIH 5DEFB 2WCSA 3CFDB 3BSGA 4L9DA 5FM5M 3L45A 5KSVB 1L9RA 2YUZA 2DQFB 1KEML 4AEFA 5ACLA 1GOHA 2R1XA 3VFTB 1OF2B 3F12A 3EDJA 4O5LH 3UC2A 1Q9OA 1Z6JT 2H3KA 4XO9A 5GZND 1YDPA 2NXZC 1GZHA 5FW8A 2ITEA 2VUYA 3OLEA 4UQIM 5F7LB 4KBPA 2CHZA 4LEOA 5E99L 5TE4H 5C09E 3WEXA 5E6UB 4EVNB 3SJVB 1M05A 3T0DA 5GJTL 3RYMA 2NY2C 8FABA 4P04A 1IM3D 5K9QI 3V9CA 1L6XA 4ZX5A 5DDHA 2Z65C 4PJHF 4TS6A 2MFNA 4KKBD 2GSIB 3WL9A 1QAWA 3L6FB 4KOBA 1VPOL 1Z3GH 3OXSA 3SE3C 4B0MB 2OR7A 2N59A 5B1JC 3IU4H 4OFVA 3RWHA 4CVZA 4KH9A 3T0EC 4QO1B 3HRZB 1K5WA 3NIFE 1GS8A 4PRHD 3GI8H 1DLFL 5DFVD 4QYOB 2XQYA 2MOQA 5ISZE 5IJKA 1EVTC 4Z7VE 3HE6C 4FQQA 4ENZA 2K7QA 1NEZA 3NCYP 2H9GB 3DUUB 5EN2A 3LHAA 1IGTB 5K9JH 1IBGH 2WLIA 2BSSB 3EYQC 3BZEA 3GXFA 1PFOA 1U95A 1BD2B 4F92B 3H8NA 4H1LG 1WH0A 5MEQB 3BDYH 4ZS6D 3UG4A 4G11A 2C3HA 2KHAA 2R1WA 3ISYA 4D0BA 3GRGA 1IIIA 3BQUD 4JRLA 3US1A 3EJSA 5ECGA 4L1HA 4PGBA 2E4TA 2FUTA 1LGVA 3B56A 4DUVA 3QZNA 4MMYB 1ZLDA 4NJAL 4Y2DC 4KKQA 3VU1A 3SCMD 2D4FA 3KPPA 3UP1A 1QBML 4M56A 5FYLE 1TCRB 1WFUA 3SY0B 1WBZB 2WXIA 4CILA 5BMFH 3BUBA 2QVFB 3KR3L 1SN5A 5F21B 5HDBB 5A2CA 1RHHB 3QUXA 3NCBB 4NWUL 1VFBA 4ODHH 5LCVA 3MOAL 1U2YA 2KZWA 2QLYA 3GI9H 3O3DB 2ZKMX 1KJMB 3PFQA 3ZDWA 3WTXA 2WQUA 4Q74A 5I6XB 5MI0B 3NJFA 3RWEB 1QSEE 5AZEL 5IV2B 3RHWF 3K72A 1BBDL 1E4HA 2OJ1A 4YHLL 1F45A 3B9KD 1KJ3L 4QRSB 4DIXA 2RA1A 3BKJL 3KPNA 4NZUH 1QRND 1ZV9A 4WJKB 4R90L 3U82B 1FZOA 4U49A 3SKNA 5LN8A 1HWGB 4FQ1L 2LTQC 3ARQA 4NQCE 3AREB 4GW1A 1OE3A 3V4VH 4DP9X 5ACZB 4MDIB 1Z9SB 4ZYKB 4B9KC 1QEWB 5GSRA 4OFYD 5FF6A 3QUZB 4IRZH 5DC0A 5ID0B 5D93B 3PABA 2IANE 5IF0B 3BEVB 3QDGB 3BWUC 1BQRA 5MERB 2IPTH 1B4JL 5KJ7E 5F3HA 2HJLA 2EIBA 2NUPA 4WENB 1A14H 3H9SE 5JQHC 3OXRA 4PJ8C 4KPHL 4EZLA 5K1JA 5KVDE 3BPOB 3KW8A 4JHWL 5CGTA 3IDGA 4YHMH 3IVKA 1LNUB 4O2FB 1ZA3B 2HRHA 5CMAB 5JQ6L 2J20A 4KMQA 3L3JA 4ZYKA 5F7YC 4QRBA 5JYMA 3J7HA 4XRCB 4A39A 1JWUA 5DVNA 3T0EA 2UZYA 4WI4A 2LFEA 3CFEB 3FFCD 3KG5A 4LGPB 1A9EB 2Y36L 4L9LA 3DNKA 1OE1A 3FQNA 4PLNC 3DLQR 4QRQB 4WCYH 4M6ML 1UVQA 4NKIL 2V0AA 1FE8L 3F6IA 3DROB 5DR5L 4YQXH 4Z78A 5DYOB 4R4BA 2HG5A 2IANB 3H0TB 1IL1B 1U3YA 2CO4A 2VDLH 4PYHA 4EBQL 3T2NH 5I17B 2Y2WA 2AQTA 1T1ZB 1TZHA 5I0DA 4P9HH 1DJWA 3KYKH 1A4BA 1N26A 1QNZH 3UO1H 5JXAL 4MHHI 5KVEE 3X12A 5HI5D 2FWSA 4BXVA 4IJ3B 4M9OA 3LXUX 4YZFF 1UCTA 4NDMA 1G7HB 2I85A 3GZPA 2G5BA 2QBWA 2ERJC 3HBGA 1YPZE 1NCTA 1T66D 3ARYA 4IRSB 2R56H 4MQSB 3AXIA 4HUVB 4NM8H 3A4FA 4RAHA 4YNYA 1GCFA 4LDCA 3ZZQA 1U93A 3X17A 1KTLA 2CZNA 1CZ8L 1JHTB 3LQZA 2W59A 3P3UA 3AMKA 1CD8A 1MI5B 1TXKA 1DEDA 2YD7A 1AMXA 4RH4A 3LCYA 2VR6A 4AWJC 1U3NA 4D0BB 4KK8D 3AACA 3IMVA 4ORZC 1WGOA 3VDCA 3QEQB 1BG9A 3LDBC 1J8KA 3LEXA 3CFCL 4PREB 4DPBX 1IAOA 1GRWA 4ZFZA 4QJ5B 2W9DL 1T22B 4U7MA 3WDHA 2F54A 2JKJA 1CIDA 1G4RA 2AABH 3HUJB 1DO5A 2X9XA 2ADYA 4FQQB 2X9ZA 4KXAA 4YXKH 4L1TA 4HJ1A 4NZTL 1IGIL 4HGMA 1WO2A 5D1QB 5LAXB 4ALAH 2WUCH 3MBXH 1Q0YH 2Y7QB 2MPAH 4S11A 35C8L 1EGJA 3KJ4C 5I17A 1MOEA 5AL0A 4OUOA 3ZTJG 3VWJB 5EB9A 1FAKT 4XR8C 1U33A 1A9VA 3P4MB 1NDTA 3K1KC 3OHXA 4F7MA 3OC5A 1CDCA 2PO6D 2Z34A 5FUZL 5HI4D 1T0PB 3GC3A 5FAAA 3UP6A 1OOWA 4RX4D 5JNYB 2CJUH 1H15A 2NNFA 3PP4L 1R3KB 1RZFL 3PG2A 5C86A 4KY2A 1A6PA 4H0IA 5F7NC 1MVUB 3FSOA 4ODBD 2V3DA 3CFUA 1LWHA 3CV5A 43C9B 4JPIA 1EZUA 2R0LH 2F74A 3MV7E 3W0WB 4XI5D 1DQVA 5C2BL 1JV2A 2ZNXA 5G4MA 3U7YL 2PXYD 4BHUA 1HHIA 5K9KB 4R97C 2R1XB 2OM5A 3T2LA 5KSVA 3PDOA 2XXGA 1WG3A 4JM2F 1S7WB 4B9IA 3T6XA 3RWIA 4HIXH 1SLXA 1N8OE 4U0RC 4LCWE 4M7KL 1WHOA 4R2GD 2G9HA 1YNTA 1DZ0A 4V11A 3MBEA 3TC9A 2EZ0D 1ASQA 2P5ED 5ENWA 5ADPL 2NDFA 3MZTA 3CK0H 4FQHB 3ZGHA 3C60A 1HNFA 1OB1A 3WBDA 2CG9X 2VMCA 2JLPA 3BKYH 3ARFA 1FFTB 3V6OE 4UILL 4ELDA 5J6GA 4Q9QH 2WXKA 4FQ1H 2GAZB 2EIZB 1A3RH 3NCMA 4KITB 1DJSA 4N85A 2VH5H 2XZQL 3OWRA 1E5YA 4C4KO 1SVCP 3S8FB 4YSAA 4WEUD 5E03A 2J88L 4MB5A 3PXJA 4MKMA 2XX0A 3L3HB 1EQWA 5H8DA 5DYOA 3QIWC 5FA4A 4LSQH 5EULV 2V8LA 1G9MC 3KGTA 3CZNA 1JPSH 4DP7X 4WK2B 3SYAA 4MAUL 4A37A 5PCYA 3KEHA 4L48A 3BP6A 1MREL 2ODIA 1EEYB 4KKLC 4UB0L 4MD0B 3IN0A 4MAYB 4TVSa 3DVGA 2NLJA 3FTZA 3QULB 1C12A 1OAJA 4QXGH 4XH2B 4OFPA 1R34A 2WCPA 4JQVC 4XXCA 2ITCB 5FUOH 4FFYH 2WQRA 5I8OL 3CSGA 1KTJA 3TPUA 2D7PA 3MNVA 2ZUSA 3FCBA 3FHQA 4JAMA 1GSMA 3LMJH 2EP6A 1EV2E 1Z9MA 4J2QA 2N0MA 3ZR5A 3K2UL 5GJSL 2LVCA 1XGQB 3TA3D 2XPGA 4YIQA 2EE9A 2EEDA 5AENA 4CL7A 2WBKA 3B7RL 1PBYA 1PZ5A 1LE9B 3V5KB 5DZPA 5IEHA 3DUUA 4XP4H 3AREA 5HJGA 4X6BA 3THML 1P7HL 2GI0A 1KB5H 1TVHB 3MC0A 2GSMB 3QZOA 1S5IL 1JCKA 3ZGIA 4LASH 2ZOKB 4C54A 5K9OB 5IV2A 3A3YB 2VQ1B 4YAQB 1QFWM 4QO1A 2J1ZA 2VDLL 3N2JA 1KJMA 1WEJH 3EZJB 4Y2DA 4XNUL 2XJLA 5DRXB 1AGCA 1BSIA 1XIWD 4OF0A 3N1MC 2EYTA 5HJ3B 2R4SL 4KUZH 1LTXA 3VXQA 5JHDD 3IKKA 1EEZA 2AQRA 2ZP9A 3VI3E 3PHOB 1EJFA 3KPOA 3FNKA 4OB5L 4GG6E 2J8OA 1CBVH 3B9KC 3DGGA 3FQTB 4LGSB 2DQUH 3AW5A 3DX8A 3Q6GL 2AXGB 1NCNA 2NMSA 4I1RA 4MDJB 3S5YA 4JO2H 4K7FB 3S37H 5I1AB 1GR7A 4HJ0C 3M46A 3C2AH 4CMMA 1ECYA 1IQWH 3C6LD 1ZHKB 1JZ3A 5EWIL 4QTIH 1FVEA 2FEEL 2FWLB 5IB3B 4O5LL 1WZAA 1TJMA 1JWMA 1P5VA 5JOPE 5IJKC 1CGSH 2F1BA 2OI9B 1HHJB 3ML8A 4PMFA 4M9PA 1IEAB 1NSNL 2I26N 2JXMB 4GUPA 4R3SB 2WV3A 4CC4C 1DDHB 1O6TA 2B3RA 2BOCB 3GGWA 4ZUUB 1QBAA 5DC2A 5GRXG 4YHZH 2E27H 3EYUL 4XMTA 3LNGA 1NC2A 3SDDD 2WXFA 4DKEL 5EN2B 5E0QA 5CM1A 5HYEA 2BIOA 1MHPH 4PCTA 4LSVH 5A1AA 3ZIYA 1KN4L 2YD5A 3BE1L 4KUCD 4P4KA 3RUGE 2XDHA 4JZNB 1T1XB 4PB9H 1E5UI 4KRNA 4UM9A 2A38A 3CHXA 4K73A 3MACL 3HJEA 5EC1A 2WHVA 5TTRA 3PL6A 1K6QH 3QZMA 4Q9CA 2X7LA 1DLFH 4IKLA 4GIOA 4UNUA 1LEIA 4GI6A 2VDMH 1J8HE 3C9NB 3NSJA 4LCWA 3L4XA 2YKLL 2VMEA 3EO9H 2J6WA 4TSBL 4JQVA 4X4ME 5CZKA 3N50A 5L2KB 4O02L 4X8JB 5HDLA 4WEBH 2QGEA 5B1BB 1T2QL 4ZOEA 1TYJA 4H1LA 1XXFC 1KIPB 1KXQA 1AC6A 2F6AA 2ZAHA 4WTWA 1RIVH 3NA4A 4AQOA 5ICYB 1I9EA 3FHEA 5DEGA 4GSRA 1OT2A 4GINA 3LB6C 3NDZE 1R3JB 3T5WA 5E94B 1DBJH 1G9MH 1CIUA 2IOMA 1HIML 4HS6A 4YOKA 3UEQA 3BJLA 2J1WA 3LRMA 4EN3B 5KVMC 3SGJA 2NY2D 3J07A 4KO7A 2ENYA 4WI0A 3PDOB 3VGGA 1S7UA 2X4RA 3QXVA 1WEJL 1BG1A 1N3NA 1WZLA 2JJVA 3S7GA 4E5XB 1YEGL 4P2OA 4RQQA 2OKMA 1IB5A 1CYXA 2BVTA 4PR5A 4R2GC 3R8BB 5I30H 3CVHH 2BVPA 2OLDA 3C5XA 1YHPA 2Z8WC 4PJEA 5E1IA 1MG2C 2G3XA 2WYTA 4N24A 5AKSA 4JREC 4RGOL 1WA1X 4WF7A 1VRSA 3E8UL 3GEWB 1ROCA 5EUOE 3MKGA 3TBVB 4HETA 4NJ9L 1CYWA 5DQJB 2IAMD 4ZJ9A 3S36X 1BLIA 3V55A 3UYPB 2UV3A 3O0LA 4JG1H 4YE4H 4DF9A 2NZIA 4XMLH 3OHXB 2IO5A 5D7LD 2ICWB 4QGTA 4MJ2A 3RZCC 3P4MA 4U3CA 1MXDA 3MCYA 2Z35B 5KSBE 2LR4A 2PYFA 4RNRB 3D0LA 4JPWH 1K72A 5EC1B 1THCA 2C3XA 1AANA 2HG0A 1XSIA 3L4VA 3KPSB 3L5HA 1YG9A 5EF1A 3TBTB 2PO6C 4O51B 5JLZA 1E9OB 1FYHB 2E9GA 1P4LB 2X1XR 2Y9RT 5HGBA 2FEJA 3B4NA 5E1AB 3S34H 3ATFA 4N2NA 3WD5H 1B3IA 3HUJF 4OVVA 3SKMB 3HJ0A 4XNBA 3FJTA 4JX0A 2ZUTA 3V0VB 4JGJA 5JIQA 4ZSOB 1HYSC 1OAZH 3VNZA 5TK2A 3VRJB 1NCJA 1W72A 4E9TA 5CEXA 3K2IA 4HIPA 3U7WL 5I16A 2YJQA 2FEEI 4F7PB 3OX8A 4Z3FA 3B3BA 7PCYA 3QNYA 4PJGA 2AJZA 5FLUA 5KSAD 3BUTA 4MKTA 4QXUL 5SX5K 4FQXA 4H88H 1C5DA 2IDTA 2DF3A 2YGQA 4TNWF 4YSQA 5CGYC 2EEFA 1DVYA 3AWFA 3PL6C 2WWOA 1UZ8B 3VFNB 4MSWB 1FG2A 4AM0A 4W6WB 1MZZA 2ZAIA 4PV8A 4PH8A 5FCUH 3TWCH 3EO0B 5EOTA 2XV6B 5B4MC 3L4ZA 4J6IA 1EEUA 2VZVA 3KXFD 3L3GA 2AXFB 3LQAL 2X4TA 1S7XA 3FFOA 4Z7IA 3WAJA 4E0RA 2XICA 3MPCA 2GBVA 1UT1A 4V1DD 4N0RA 2FX9H 2QZQA 1WYJA 1YEWA 2RQEA 4KO5A 4RRPA 1I8LC 4WI9A 1MIEL 1FORL 3SQBA 4Y2DB 3ZKND 1N0LB 3UAAA 1JZJA 2BZCA 1YEFH 2C9AA 4NN7C 5DZJA 1T66C 5EF0A 1OPGH 2ZYHA 4IRZL 4FMKA 1V54B 3CXHK 1AOHA 4QKTA 1FVDB 3GUTB 1KDIA 1PGRB 2Y5TB 1HILA 1JK8A 1LHZA 1ZJBA 5ICXA 3FC8A 3RTQD 3TYGH 1MCHA 3NFSL 1GS6X 3F58H 1KXVA 1L5GA 2X70B 3RAJH 3QORD 3CH1B 3HN5A 2FUQA 5CIPB 4PEEA 1DLHA 4GH7B 5SWZA 2VAAA 5KTEL 4GQ9H 3QR0A 4GRLA 4FNLH 4L4TE 5HGGS 3CVIL 3UGUA 1GZPA 4N3UA 1N18A 2W0LA 5L88L 3GJFH 1U8MA 3QAZC 1CI5A 5DWPA 2EDFA 1T5WB 5EA0L 3MKKA 3C75A 1DJGA 4GMTH 2XG4B 2P80D 4MVBD 1HFUA 2PW2A 1FL3A 5DURD 5F3HB 2JWYA 3IK2A 5SX4H 1BM3L 2Q8BH 5MERA 3KPMA 3RGBA 3S6CA 2XV2A 1U8KB 2KC0A 3VDBA 4X7SL 4XNZC 3FW6A 1L9PA 2EDYA 3QUZC 3PAUA 3WNNA 4YXKL 1C12B 4ZNCD 4PIRF 4UV7H 1F00I 3FB7A 2C1PA 4LL9A 4PQXA 3MRNA 2ZX9A 1F90L 1QACA 4XCNB 4N2CA 5CGBA 4PB9L 3MI6A 4JLRB 4PP1C 2DJUA 3VRLE 4JRXA 3QXDB 43CAB 1KN2L 3B9DA 1BIIA 3CZEA 3NCEB 4HCRA 4N26A 5C0BE 4Z7QB 5CD5C 2G75A 2R7EA 3LJ3A 4H8UA 1CDIA 3UC0H 3PF2A 1N70A 2YPKB 1P53A 2ZOLB 3I9AA 1ERNA 1T4KA 2BNRE 2XN9D 3KLAB 5HPMB 2MCPL 1SJHA 4P5KA 1QBLH 4QY8A 1WA0X 3PGDA 4UU9A 1WRFA 1G9HA 4IU2A 1Z5LA 4FC3E 2GAZA 2WLZA 4F58L 2R2BA 1WVZA 4ESKA 3D09A 3K5SA 3MTRA 4R3SA 1IGYA 2R0WL 3VXSD 1PLCA 1WQVT 1PX4A 4K23L 4LCCA 2CBPA 3DGCR 5AZ2H 3HI1A 4JE0A 4PJXA 4ELMF 1N0XL 5IMOA 3T0BA 2QKSA 4N2OA 1LEGA 3DRTB 3A4DA 4QF1B 5ICUA 4HUXB 3EBAA 4FA7B 4ANUA 1Q9LA 1H6FA 5TGBA 3TN0A 2AKRA 2QQLH 4RWYH 5D4HA 1JGLH 5I1KH 4ZPVA 4DVBA 5LBSH 2A7BA 4IS6B 4QTHA 5FFLA 1GZPB 2DYPD 5EORL 4J4PC 5C0GB 2VM3A 2BNRB 1E4WH 2Z9TA 4OIFA 4RGND 2VB5A 1UT9A 3B5TA 3P54A 4APXA 32C2A 3KPQB 4ZDHB 2BS71 5ECJE 4RDQF 1UASA 5DTFB 1S7VA 1S9XA 2WQWA 1ZHNA 3PPEA 3KHOA 4EI6B 5FB8B 1U3JA 2WOYA 3SYOA 3D08A 3S4SB 2Y06H 3IJ9A 2PWEA 4ABVA 5CCHE 4YHYB 3LKRA 4GRLD 3BH9B 4F7MB 2VDQL 4IGBC 2WPGA 1OK8A 4FXKB 5T1KD 2QMKA 5E2UH 4XOEA 2AXWA 4LCWD 4XO3A 1B0WA 1NLBL 1UD5A 5GS1A 3LDBB 4NO5B 1U8PB 1N0LA 4I88A 2Q2EB 2JKLA 3JT0A 5FHAL 4DH2A 3CLEL 3CCHA 4MJHA 4GEIA 2ROYA 4MXQC 3I9PA 1QLFB 2O93L 2D03H 5DHEA 5I1DA 3QNFA 8FABB 5AB2A 3SY0A 1T1YB 2CLVB 4PJBE 1DBKH 3SBQA 1RV6X 4H8PA 5I19L 1PZ3A 1SXZA 2XBDA 1LQBC 3IF1B 3JWNE 3LNEA 1RZFH 4IU3A 3N44F 4S1QH 3TBSB 3HG2A 4HHAB 5ESQB 1P0SE 5IGXH 3B2VL 4EI5A 4QDGA 3WHE0 3O2WH 3A24A 5ILTL 3TGXA 2UX6A 5IVXA 1YN6B 3GF8A 3K4ZA 4BJLA 5EIVA 1JNJA 5DSCB 1T7YA 3OKNB 3WNPA 3REVA 3VAEA 1SY6A 2AV1A 3T3PF 2E3VA 3F7QA 3O4OC 4QJ4B 4XZUA 1IGTA 2VL5A 1UB6B 2ALAA 2R29H 1U8NA 2X5PA 4A2GA 5IJBC 1H3WM 1AS7A 1JF1A 1S5IH 4MNQB 2WO2B 1CL7I 4BBWA 2EVIA 2X09A 1KYAA 3UTTE 3PPSA 2DKUA 5DHMC 3F6LA 4CMHC 4Y19B 4QYOA 3X12B 1RJLB 5I8KH 3KH4A 3O9WD 4N20A 3OB0H 4P0DA 5ALBL 3UTSB 3WS6A 1R1CA 4WHCA 3NFNA 4HW6A 2OK0L 2QGCA 3OBAA 3BJ91 3PJSA 1W15A 2GTQA 2W0FB 3FTVA 2AQ3A 2WLKA 4UTBL 3DGDA 4WV1A 4FXKA 3NSCA 1G0XA 4YHKH 3S35L 3MRKB 3O3AB 1NFKA 3HCVB 5IT2L 1OL0A 4AITA 2JCCF 5TDOA 3QZWB 4RA3A 2DBJA 3QEGH 3QNZA 1QSFB 3UXFA 3MLXL 5ITBH 3I6SA 1M1XA 1MQ8A 2BM3A 4IRZA 4L2LA 2GITA 4OTXL 5F7EL 4I3SL 1UM5H 4ZW5A 1QFHA 5AB1A 4A55A 2NY4B 1KEGH 3L4TA 1BD2D 1V3MA 1Q0EA 1QSVA 2ZOWA 2KPWA 1GGBL 7TAAA 4JK0D 3F12B 4OCNC 5B38G 4C56D 5DUML 2E27L 2CHNA 5C7ZA 2FO4B 3TH4T 3ETBJ 5F3FA 5D1QC 4OJYA 4OM1H 4HUXA 5HVFB 3BWSA 3IWVA 3O3BA 1JZGA 1M7DA 4FDWA 2X4NA 4XXDA 1PEWA 4WW1A 2FECL 3AG1B 4MJ4A 5DD0H 4ELMA 3MCLH 5EUOA 4AKOA 2F54E 5E94A 1Z9PA 4HWZA 2DQEL 4ZMOA 3GHEL 2OV0A 3MRMA 1WBYB 4MBOA 3HR6A 4K15A 1FYTD 3TBCA 2IG2H 2DJ4A 1NGXA 2R2BB 2PPFA 2PPCA 4LVHB 5HHMB 4UCFA 3SKOA 3ZQWA 5CAYB 3UO8B 3TEXA 4RCAA 2RIKA 2HTKC 5E2VL 1SPDA 1GYWA 3UYOD 1S7RA 4XVJL 1FBIH 2PYFB 1F8TH 5DRZA 2V37A 1MSPA 1Q72H 3MUJA 3NSDA 4DW2L 4XBPB 4G8GE 4NZRL 4F57H 1AO7E 4DP1X 4M1GL 2A83A 2DIEA 4PW3A 4L0ZA 5L4JA 3ZX1A 2IBBA 5CCGE 4NN5C 1E5CA 3JWNC 1QVOA 1XCWA 3Q8CA 1XCQA 3LY6A 5HHVH 3JTTA 1U9KA 1AZCA 4JM4L 3QPXH 5CKAA 3FSVA 2DWYA 3CFNA 2DWDA 4WW2A 3QCTH 5G5DA 3S36L 2NW3B 5LNGA 2K8MA 2Y7SA 4NNXB 4Q4IA 5ICZA 3L7FB 3Q13A 3IJ7A 1TZIA 1XCTB 4P2QD 2P5WA 4UM9D 4B5ZA 4MMYA 4MRBA 4F37K 2Q7NA 2E74C 2J56A 3DTDA 3LH2H 2EXWC 4M7KH 2XG4A 1TQBB 2I60H 3ASNB 3BKJH 4NZUL 1HEJC 5A43C 4XTRC 5BRZB 1ZV5A 1DQJA 3I75A 1S8DB 1NLBH 1WUNT 3KBFA 3NGBB 5IQLA 5C0AA 1YQVL 4XXWA 5E00A 1U8IA 1FVEB 3D34A 3EXLA 3EYOA 3MREB 5DMIH 3CSBA 5JHBA 3CH1A 5A2JH 1OT4A 4ZW3A 1SY6L 2CO7B 4JY5L 1L5GB 3TVMA 4F8NA 2YAEA 3QUXC 2H32A 1RFDH 3FCTA 1U8CB 2P44B 1BVNT 3DIFB 4MMZA 4BZ2A 1IC5L 3DJZA 1D6VL 3KLLA 5FYJE 1G9NC 3ZXAC 1AD0B 3MNDA 4Q6IA 2NY0B 4ANWA 1E67A 3ZVVA 3G6DL 2JF1A 3MLXH 5F71A 5ITBL 1R17A 4QRPB 4X5XA 1Y18B 4C8XA 1N5AA 3WS3A 1SYVB 2CDFA 4NIYE 4GP8B 4L1DA 3VD5A 1EWHA 4NN6B 2IIJA 1RK0B 3NJMA 1OGAE 1T0OA 3I6LD 4W4OA 1KEGL 1C5BL 1VFUA 4HWNA 1EO8L 4JKKA 2P28B 1GY1A 3DYPA 1F6FB 5DDHB 2J1KA 4P57A 3VI4B 1W0VA 2YRLA 1HH9A 4RZCA 2EIDA 1NTDA 3Q43A 1RPKA 4NLHA 5C0FB 1I1AA 1K4DA 4YLQT 2PPDA 3WJJA 4G8IA 4R5VA 4XTRD 3D0VA 4B41A 1TITA 3LMJL 4YLBA 3QBTB 2EO9A 3D1MC 1FFRA 1C5BH 2QADB 1H9VA 1VJSA 2BOCA 4NNYB 4XE5B 3TV3L 1CFNA 2WQ8A 3JTBA 3RVXD 5D1XD 1L3WA 2H1XA 4X6DA 4IOIB 4KDTA 3I6KA 1SM3L 4B97A 5FUOL 1I4FA 4N2KA 5IMKB 4AUUA 4BKSC 4TM9A 5J9PA 1MJ8L 3F5WB 4PS7A 2UX7A 3FYIB 3JUZA 4NZJA 4F15B 3G6AA 3MLPA 3ZY7A 3V0VA 1CGWA 4OZ4B 3OZ9L 3SO3B 3QDGE 4I5BB 5CZXC 3Q6FA 3K6OA 1XCXA 5HVWA 1MZYA 4WW2B 4GUOA 4HIQA 4JANB 4U33A 1FDLH 3CJJA 3TTSA 1OW0A 4JFEB 1BQHG 3I6GA 4Y2OB 5IVZB 3HNSL 3US9A 1IKOP 2EJ1A 2NNAA 4LT7A 3PAZA 5I0YA 2OW6A 4F8OA 3OAYK 5J1AA 1GZHC 3D0LB 2VO5A 5B3SB 5JXEA 3CFJA 2OMYB 2UUDK 3VXMA 2G5RA 2OL3L 3GB7B 4RSYA 2F8XC 2ICWA 2I60L 2H1PL 2E9JA 2HTLC 4YDKH 2P48B 4XPHL 2CJTA 1NPUA 2DWEA 3OAUL 1JIBA 5GJTH 3S4SG 2Z8SA 1SN0A 5LG1A 3M45A 4OCMC 3ARRA 4LAJH 1F4HA 1MLBB 1WFNA 3D18B 3ISWA 4MQXC 1NGWB 4NOBA 5J6GB 1AC0A 1CICC 4G3YL 4N6RA 2WAHA 4TUOA 5B7MA 1FNFA 3V5KA 3UACA 1XBDA 3FO2A 1HAWA 1COBA 4LE8A 2GEEA 4RMVA 4RQQB 5D1QD 3WDIA 2F8VA 1P4BH 4H88L 4DZ8A 1AYRA 2Z31C 2XTJD 5IHBA 3M17A 4JDEB 1IAIH 4JO8A 3HC0B 3PE9A 3TYFB 2ARJB 1TKWA 4N8UA 1SBSH 2FO4A 1NM4A 4HKXA 4HT1H 4P4RB 2ZXQA 3IJSA 3A47A 1ZOXA 1BIHA 1WD8A 2V7NA 5CINL 2Z8RA 1IQDA 3ZT5A 3G9VA 4AYID 3BYTA 2WTRA 5IB4B 5KYYB 4HZ1A 3CFMA 1CLCA 4G9FD 1JSYA 1G1OA 2YEZB 4YDLB 3C5ZA 3UIYA 2PXYA 4JFQA 2X6AA 5DVLA 4K3GA 4F7EA 3FQWB 3O9WA 1A66A 4AGOA 4FG2A 3L5XL 5K59F 3FOMA 4OD2A 4ABWA 2B77A 4L8SA 4NZDA 1I85A 1AR1C 3EBIA 4ICWA 4CKQA 1E5AA 3VSUA 2HCZX 2Y6SD 5E2TH 5DJAA 5I82A 1ID2A 3QEUB 2X41A 3L5IA 3WY1A 1K6QL 4NQSB 4Y19A 2F7IA 2OR9L 4PMEA 1HINH 3GM8A 2ZCHH 4UYQA 3DVNB 5C0AE 5IOPA 2NSMA 4UUJB 1MWAB 5CXPA 1YNLH 3RWGB 3QARA 4AGMA 1EZVY 1HYRC 2DLGA 4M4PA 4KZCA 4OIBA 2BIIA 3O81A 5CSGA 3ARDD 1CR9L 2MRYA 1SZNA 3W2DH 1WWAX 1G6VK 3L2MA 4AG4H 2EADA 3LEXB 1JOIA 3IFNL 2BY1A 3RWIB 4FLSA 1XGYL 5MP6H 4AXWA 3COOA 4XAWH 4XCFH 3L7EB 1LP9E 3VFGH 3P4OA 1QHOA 4B9YA 3VFUB 1VZIA 3G6DH 1FIEA 5HDBE 4FYTA 3FH8A 5T33H 3ZZ1A 6CGTA 2CR3A 1F6AB 2K9UA 1U3ZA 1VEMA 5KAQG 1KTLB 2RR3A 1NIAA 4NJ9H 3CVHA 5GGRA 2HKFL 4HJJH 1J5IA 1DE4A 1QZ1A 1OGAA 4MCZA 3W2DL 3PWJA 3MA9H 3LPGA 3QO1B 4KUCF 4LCUB 4KK6D 4UQDA 2DQMA 4LGRB 4GIAA 1H3VA 5FOJA 3T4YA 1AOZA 5DWUL 4ZFGL 4H20H 2G5BB 4D0CB 3BVVA 1EEZB 5IUCA 2P80A 4HBCL 4DEWA 3ULVE 1XSOA 5JZ7C 3BPCA 5DRXA 1AY1H 1D6EA 1RUMH 3NIGE 3NCJH 2BCMA 4J3OF 1XVSA 4DAGL 1HHKA 4GBXC 4J8QA 4NKDB 1JZ5A 2HG5B 2IANA 3H0TA 4HV8A 4BGDA 5KYNA 5SWZD 4QXWA 1G1CA 3VXUE 1NUNB 5EH1A 3U36B 2EKJA 2O6CA 4GRWB 1IM3B 5I19H 4GB9A 2X1QA 3LN4B 1I8IA 2QT6A 3MGOA 3O4LE 4Q8BA 1DBKL 4PG9A 3HMWH 4J3OG 5IEKB 1RIVL 3WXVL 5F72S 5LGJA 3OKOB 2ATKA 3UZEA 4WGKA 5C70A 4JCLA 5F9OH 4LVNB 4GFTB 4HLZG 3RVTC 4YUEH 3ARGB 4HSCX 3N44B 5LBGA 1TIUA 2F5BL 4PS4H 4MMZC 1R46A 5IB1A 1F8TL 2HT3C 3DHUA 1BWMA 4MA3B 4ABQA 1VGEH 3B43A 4FFZL 2QPUA 1ZLVK 2P49B 4DFIA 2QDWA 3O8XC 1OWWA 2WBJC 1QKZH 5D72H 3IMWA 5I18L 3WXVH 4PRNA 5EO1A 3GO1L 4BCZA 1F42A 2C9XA 4FL4B 4XH2A 2PLTA 1CT8B 4PJXB 1TZOA 2CQVA 4JVWA 1A02N 2R0LL 3HRPA 5FF6B 5GISH 4FULA 5GSRB 3CBJB 3WXWH 5IIEB 3NACH 2KLRA 3FTGB 4DPAX 2AAAA 2WXQA 1J5HA 3N1QC 4AENB 4YSOA 1CE1H 3GHBH 5FUCE 5KVGE 3C09C 3LV3B 4NDMB 4PRIA 1Z5LB 3TN0D 5F1OB 1U2HA 1QRNE 2IDSA 4LARL 4LLMA 4XBGA 4LRIA 2EUXA 5I1CH 3VNYA 4PJCE 1SJHB 2ZXCA 4P5KB 3BGMA 2FR4A 2XKUA 3ZDXE 1FO0L 1N59A 1CJYA 1UXSB 1TQWA 1AXTH 5T1LB 3WFBH 4Z78B 1Q94B 4ZMZA 1NCUA 1QO3A 2NYZA 1A5FH 3GSWA 4HULB 4PGCB 4HGKC 4A7GF 3CH8A 4Z95L 1Q9KB 4KXBA 4NS0A 2OSWA 1Q0YL 2VWEC 2YAMA 4UMSA 4NQVB 3MRLA 2PNDA 2C9VA 5CJQL 1ZT7A 5SWZE 3JWOH 3AB0B 1A7PL 2BRRL 2WXPA 3IBOA 3KPRE 1CT8A 3SBRA 3IDGB 4GS7C 3V0DA 2CCWA 5ANMA 1VB9A 1KCRL 4XMWA 1O6VA 4E9QA 3HPLA 1FIGL 3ME0A 5B1JA 4ZTPH 2GB2A 3C8KB 1OAKL 3T4AA 4Y1AB 5B8CB 2I07B 1E40A 1U4FA 1UKQA 1P6FA 4PUBL 4K5LA 2EDMA 4L23A 4Y8DC 4PJBF 5K9KA 3U1SL 5J89A 4JDZB 2OBGA 3HZMA 5D2NA 3PV6B 5GGRY 4IYKA 4NHUB 4OGXL 3RUGA 5HHXH 4WFGE 5FO7A 3ZTNH 2BY2A 4PJIE 5JW5B 2X1PA 4QXGL 2ICWJ 4M4RA 5L6YL 1CVSC 4MDIA 1EXHA 1I82A 4KKCD 5I6PA 4NPYB 4JRXE 5KBPA 2AZUA 2LHAA 3AG2B 1E6JH 3B2UC 3IPEA 3CZFA 5IEKA 2XZCL 2IQ9H 5KJRH 1ZVHA 1PAMA 1YC8A 4XB3A 2HRLA 2X1WL 5F0JB 2Q10A 3WSQH 4S0TD 1U8QA 3FFCE 1A1OB 4LLDB 3O4OB 1CPUA 5BQ7B 1XF3B 5TF1L 3EUDA 3CU7A 2H45A 3D52A 4HUCA 4JMXA 2HLAA 3N04A 4NWTL 3SDXF 5BVJB 4OF7A 5I6LA 2R69A 3KZ8A 1ZMYA 1UUNA 4ODTL 3KLHC 3VD1A 3T4YB 1XGRA 1CL7H 3BH8A 5D9SA 1H8OA 3MXVL 3NFSH 1HHGB 3MV8B 5DJ6A 4LF3A 4X5QA 2JI1A 5AOZA 4PVMA 2NTFA 2H0PA 2X4OA 4Z7NF 4TULH 2WP3O 1WISA 4MAUH 1MRCL 2J6EL 4WUUD 3FOLB 1BPVA 3MVSA 2B4CL 2BSCA 4W9EC 4YK4C 4ODXB 5DMIL 1KEMH 3RPIA 4NPJA 1SRDA 3DX4A 3ECUA 5KSAB 3NQKA 3NP4A 3AGWA 4YHZL 3ZYOA 3V4PL 4LAQH 1T21B 4DP4X 4FEMA 4UQ3B 3ZE2E 3BZEB 4U1NB 2EIMB 1J5CA 1DQMH 3VTTA 3GBDA 1PQZA 1LO3L 1UD8A 4DO6A 1MLCB 3V6OC 1B0IA 3VDAA 1MWAA 3LNDA 2VDMB 4OFDA 4UV7L 1ZGLM 2B5IB 4DKTA 3F01A 2O5NA 4ZUWA 3ZUCA 2A6DA 2YQ2A 3ULSA 2TSBA 4GMSH 3W3BA 4EUPB 4JFFA 2XN1A 3TT1L 3O2DH 3MLYL 2CRYA 4RRPG 1I8MB 2IPUK 3ZKSD 3F7PC 5DJAB 3FQXA 1IC0A 3WKPA 5H37G 4WU7B 3T08A 4HIEB 4R0LA 4MYPA 4NOFA 1A0QH 1JRHH 3ESMA 2FJSA 1FI8C 3DX6B 3F00A 2ZCLL 4QHLB 1GC1C 3LNIA 5HSFA 3AM8A 1OQOA 1BZ7B 3G08A 2ZXGA 4G6JH 1Q72L 2FK9A 4WNSA 4K3HA 4TQIA 2WVVB 3H42L 3UBXG 4DCQA 4WUKH 5EZLA 3FRPB 4G1EB 2DWSA 3NJIA 4DOHE 4LNVA 4F1SA 1AKPA 4WFHE 1MW3A 2EVJA 1QSZA 2ISDA 4MB4A 4AK2A 2CCVA 4AVIA 3WMPA 1Q9OB 4ODSH 2QSQA 2EUWA 5J57B 4E5XA 1SM3H 3X1BA 3ABGA 3L95B 1A6TA 3F7YA 1LK2B 4XMPH 3K91A 4XN4A 4PN6A 3K46A 2EO1A 3SJVE 3EIFA 4GUQA 1QG3A 3CU1A 3EF7A 3IXAA 2FL5A 3BEVA 3GD1C 3MNZA 1ESOA 4UI2A 4JPVL 5EF3A 5BJTA 2EH7L 4X7DC 4EN3D 1OAYH 1EVUA 3OQRA 4NPKA 4G7VL 4LCIL 3NIDB 4RGOH 2XN0A 4XP5L 4GAAA 3U1PA 1QFUL 3TNMB 3IFLL 3U25A 1F41A 2CLZB 4K3JL 2BSRB 3R0NA 4J1UB 1RLWA 3KH3A 3WJLA 4QWWD 4N25A 4OLWH 3KPNB 1TQBC 3V4VL 4AQAB 4AOFA 2D4DA 4NC1E 5D7IB 5EG6C 4CC1A 3BAKA 4MJIA 1H6UA 4RMWA 4RSVA 1MLBA 4HS8H 4FHKA 3QEHB 1GXEA 3M7FB 1B2WH 1KXTB 5EPMB 2OR8A 2WLLB 4R83A 2X89A 4RMRA 3QIUC 3QDMB 3X3GL 1ADQL 3GUFA 5EO0A 4HK3J 5IM7A 4GT0A 5A6LA 3IFPB 2G2RB 3DHMA 4YZWA 1TMQA 4HPYH 5FW7A 1SYSB 4XPBL 1FCCA 3VX1A 5IVZA 2G60H 3NJHA 1OTSD 2YRBA 1KB9K 2XZQH 3B1UA 4N90D 4AYEC 4P05A 3QIWB 4RETB 5HHOE 4CJ0A 4WNQB 5GGTA 2NR6A 4Z7NB 4H26B 5E8DL 3B37A 3V52L 1M2VB 3IJEA 2IMNA 4KGLA 1MCBA 1QPXA 2H2PD 5D1ZC 2JMRA 5FDYA 3DDGA 4X0KA 2W91A 2ITDB 3MJWA 1OVZA 4TTGA 3N9GL 3CD4A 4PRPB 4AKPA 4F7CA 1XF1A 1F1AA 3N5AA 1LEKA 3F5WA 3F85A 3O2VL 1O0VA 2W60A 3HLKA 4EDWL 5IQ7H 3EOYG 4K3DH 4WI7A 2RFXB 2Z3FA 1ORQB 3NN8B 4XO5A 1BD2A 3NJJA 4X6DB 2H6OA 1JYVA 6FABL 1ZS8A 5JOFA 3JBG7 1CFNB 5I9QB 3ARFD 3LPOA 3H1ZA 3IYLW 3O8XA 1NFIA 1JNNL 5AUMA 4OLEA 1VERA 1KIRB 1JZDC 5FCUL 2V9TA 2QPSA 2A4EA 2EC9T 5DJ0B 4YFEA 1P5UB 5I1AA 4E9XA 3U46B 4AT6A 4ZFOB 4MB1A 1H3TA 3OR7B 1XIWC 2YGNA 3MRHA 2FYYA 1JD9A 4P57B 5J13C 1IX2A 3NRPA 3H85A 1W0VB 4MZRA 1MJUL 2BS8A 2PWFA 5JDSA 5JHDB 1CGXA 1WCQA 2Z4QA 3WYRA 5BRQA 1CLVA 5A2IH 3U6RA 3ZOAA 1Q9WB 2EYSA 4LQ1A 2VJ8A 4YXLL 1VFOA 4U7SA 5BZDB 2GSIA 2VXVL 4NRZB 2TSAA 1FN4B 1CGSL 1S9YA 1ZK9A 2E59A 2NNCA 3M86A 1F3RB 4YFLI 3ZZLA 3N41F 3WEMA 4E41A 1A6UH 1C1EH 3HG1A 3ZDYF 2LOEA 5BMFL 2DYSB 3FCTB 4F2ME 3UZQB 3D25A 3GBNL 4PTTA 3IGAB 5TQ2L 1BMZA 1OSPH 5I1LB 3T9WA 1QFWH 3S3JA 4I18C 5DJ0A 1N67A 2R2EA 3TN0C 4C47A 3RTQB 4PRDA 3RU8H 2VTFA 4HJUA 2RFXA 2YBRB 1TZGH 3PDGA 4MXQD 3ARFC 4HJEA 3NJGA 4PRPA 1BJ1H 1AZBA 3P0YL 4M1DL 4K0OA 3O8XD 4DWHA 2DIBA 3OV6A 4ZO6A 4G80A 2EYRB 2R15A 1JGUH 4XPGL 1TR7A 2HWZL 1N5YL 1MNUL 3CFQA 3EJQA 1IAMA 5G4OA 2NW3A 4NRXA 5SV3A 1EEYA 5EO9A 2ITFA 3ARZA 4K9EH 1KWKA 1A1MA 1RSYA 4WUUB 1N2RB 1O6SB 1T2JA 4PP2A 1BM3H 1MFAL 2JKWA 4HKBA 4FEIA 4PCSA 4PGDB 3UMNA 3NZHH 5BS0D 3P0YH 4M1DH 2V17H 1KGIA 3BAEL 2QLVB 3SPIA 5AWNH 1CICD 3MUHL 4JQXC 1FYTA 3AXHA 1DQDL 2YQBA 3OKYA 4GW5B 4PJ5A 4OGYL 2EIZA 2MWCA 2FHFA 3EJUA 3RG1C 5ANME 3F04A 2QQQA 2V2XB 2ZX8A 2Z7YA 1T7VA 3FB5A 4BSVB 1RURH 3V7AG 3NFPB 5GRWA 5C92A 2WB1A 4OZHB 5C0NC 2BSEA 1FAIH 3Q5YA 2ED9A 3NJNA 1FZJA 3FBQA 1J9CT 5IFAH 2BK8A 4PFEA 1NAMH 2PXYC 4N0UE 1WFTA 3D4CA 5H94B 3ZTJH 3BMWA 3U0PB 4EIBA 5JPNA 3PGFL 3A23A 2CBOA 5F1KC 2J88H 3T8VA 1B2WL 3ZDYE 2FJUB 2AS5M 1TJIL 4X5WB 3B9VA 5D7SH 1RUPH 2MCG1 2X38A 3C60D 1ET7A 5CZXD 1AQ8A 2GSGB 3EOTL 1R9FA 4PTUB 3UROR 1BYOA 3Q48A 3CGTA 5B3NA 1PNDA 1XH3B 4UQCA 4LARH 1ZLVH 4LKXA 5CR1A 3ZQXA 1G7QA 3KM2A 3RVVD 1IMHC 3EH5B 2XN9E 3Q8AA 1I7TA 1HSBB 1IM9A 2RAMA 4JQIH 3OAUH 1S7TB 4OZHE 4CU8A 1QLEH 2K9FB 2AI0H 3QJTB 1HCFX 3ARDC 4L4VD 1RZKL 1CYGA 4OJEH 2X4QB 3GFUA 4GG6B 2OMUB 3CSTA 2Z64C 1GTNA 3N43B 5HYQA 1YMMB 4G6KH 3S3PA 5KBNC 1U92A 2J43A 5TH2A 3JV4A 1DBMH 2PTVA 1FHGA 3UCQA 3UTSA 4BSWB 5CF3A 3ZDYB 1AY1L 2UY7A 3SKJL 3QSKB 4Z77A 3JWOC 1EAPA 5C2BH 1TJXA 3DXAA 5E2VH 4WSKA 3AAZB 4X7TA 1KCRH 1MCDA 2FATL 5AW8B 1KGCE 5IQ9A 1K8DB 5E9DA 3W1ZA 4KK8C 1P84J 3EYVB 3QB7C 3WCYA 2Q9OA 3N3EA 1YN7B 5A6IA 5E4EB 1ZT1B 1B0RA 5KW9L 2AXJA 4OQTA 4WO0A 3TH2T 3EW3B 3H7BA 4OZGA 4BINA 1NH6A 1MDTA 4KQ3L 1KY6A 1VEPA 4V33A 4XP9H 4P46B 4PWJA 4WWKD 1OIOA 3AM8C 4IU3B 4OBSA 1GGTA 2X4UB 5AZ2L 3SDCB 4F3FB 2QELA 4WHYG 2V2WB 4KVNL 3R4RA 2FJGB 3KS0J 4Q9RH 4KAQH 3WEAA 3U7WH 2X4OB 5AW4B 1GHFH 2VERA 3DV4B 4WTZG 3UGEA 4JG5A 1CCZA 1M7IB 2EUZA 2GI7A 3MROA 4GRWF 4HIIA 1RMFH 4A2MA 4HX1A 2DQTH 2YIHA 4C57C 1N6UA 5EIIA 2XBTA 2BY3A 2J1XA 1YUHB 5ABZA 1QLFA 3BQUA 1WA2X 3QYCA 2BP8A 1FJ1B 1A6ZA 3CHSA 3JSSA 1TJGH 5JW3L 4FL4C 1ILUA 2K6ZA 3P3YA 3MLSL 3CDGB 1NCDL 3RU8L 2ZOUA 4L3CB 5CGYD 1T83A 2XIBA 3CC1A 5LKNA 4G82A 4HOZA 3VD2A 2NSQA 5E8NB 1I53A 5BRPA 5I23A 1JDCA 4CNIA 2GJ6B 1A9EA 4XAWL 1NDMA 2DYPA 1U3HA 4TLUA 5TQ2H 5ESAA 3VFOB 2AANA 3KPQA 5F96H 4LLUB 2DLIA 3ZO0A 4D8PA 3UAEA 1ZHNB 3ATBA 2K78A 2JKRM 2FIRT 4GRMB 1HYSD 2IWFA 4IS6A 2ZXEB 4K5NA 4QTHB 1B2YA 5E6YA 5T5NF 1J1PL 1E4KC 4W9JC 4H0GA 2P47B 2X9WA 2ARJQ 5E5RB 2CRMA 5K39A 1GC1H 2X87A 1DJZA 5IW1A 1TT6A 1SOQA 4MD4B 5EFIB 5J7CC 1UENA 1HAUA 3MA7B 4JS7A 4WO4B 1LEGB 5LB1A 3QISA 5D6CB 4M6MH 4Y1AA 3RAJL 3GJFB 2UWEA 2OW7A 2E6PA 2KT6A 1JZ8A 3MYZA 1T0NA 5ANMB 4TN9A 1X4ZA 5L7XL 4D8PB 3F7VA 2JKSA 4L8DB 3U48A 2ADFL 3APDA 3OD3A 3O2DL 2C7FA 3MLVL 4KRMB 4WKZA 4ZQKA 1ZSHA 3QO0A 4A7QA 4BSVA 2BFVH 4FQLL 4JY6B 4RIRA 1KPRA 1KPUB 4Y16A 4JZOB 1WCBA 4CVUA 1QO3B 4F57L 2OP4H 1FYTB 1XR9B 1CD1B 3B2XA 3FH7A 3OGCB 3ZRFC 4HG4J 4K3DL 3SDYL 2R2HB 2JB6B 3DMMA 2D8KA 1GGIL 2BP8B 3NP3A 1NGZA 4N9OB 1YLBB 3MO1B 3N1FC 4UT6H 1BAFL 4TL5A 4Z76A 3SCMC 4A66A 3QRLA 1JV5B 4OKVB 2CE6A 2QVTA 3SB3A 2A9NL 1XL4A 4HF5H 4XNXH 5CHNB 1ZS2A 2B20A 5HGHB 3DURB 1YPZA 4RISH 3S88L 2VGLM 1N10A 4YDKL 3MXVH 3ZE0B 2UZXB 2HFGL 4H8QA 1KBWA 3VXSE 4H25A 4R7NA 2Y23A 4W9KC 3L3OB 3QUXD 4DGIH 2OMTB 4URTB 1CI3M 1YEDA 2AJSH 2VQ4A 3D69A 1Y1UA 4ZO9A 3ZLQC 1DVUA 2VAAB 5AW9B 4X5PA 5L2JB 2WBJD 1MY5A 1L0YA 1HDMA 2KPNA 4LBEB 1XF2A 5CCJA 4GRLB 5T5FA 4HAGA 3V0WH 1RZ8A 1ZVSB 1IGMH 4AIOA 3GSQB 2WGNB 2WNGA 3UAFA 5ESAB 4J8RB 2XYBA 2NQ3A 4KRPC 4L29B 1DVSA 5AOLA 3IE4A 4I0PC 5AVRB 1YA5A 5DZOA 4PJCA 5EU7C 1HK6A 5ICXB 3BAEH 5CN3A 3C6EA 2BHYA 4RBPH 5JW4Q 25C8H 5DRWB 1Q8MA 1MFVA 2MNUA 1B9ZA 1NINA 1AZUA 2MTPA 2X6BA 3MRPA 1XAUA 4I48B 4IKJA 1HZHH 2IAAC 3BZDA 3DVIA 3HOGA 4FFVC 4YDJA 5DT1L 5CLYA 3B7YA 3A0OA 1TQVA 1XSJA 5GSVA 4FXKC 1S7XB 2XRAH 4WY7H 1AG6A 2MMXA 5B39G 5BO1L 1CFSB 3IB4A 4EIGB 2NY5C 2QHRH 4ZTOL 3X13B 5JW4N 4K2UL 4U1JB 1KCSH 1R47A 3ZSTA 1LILA 4E41E 2EVFA 5JZ7D 4TF4A 1F90H 4YDVB 3TBBA 1BMGA 4DN4L 4XB8A 5A2AA 2CPCA 4HYTB 5CSZB 1R24B 5CP7B 4FS0A 3CVHB 1UZ8A 4BFBD 1M4KA 1AKJB 4YSSA 4YHIA 3X2QB 1LO5A 2ZCKH 4H8WL 1PX8A 4MWFB 4KXCA 5KYXA 1E65A 5E2TL 3S3SA 2ORBL 4NUMA 2VYRE 3BVNA 5E9DD 2J57A 1BZ9B 3QNYB 4JFOA 4PJGB 4U1LB 4HWBL 2DIJA 2QL1A 2JJUA 3VRJA 1B4RA 3V6FB 2FH6A 3ILQD 1Q0XL 4KH2A 4Z7QE 3S3BB 3WIIH 1DEEA 4Y7MA 4LXFA 1V27A 2ZTBA 3KPLA 1E9OA 5GIRB 2OYKA 3S48A 3HPJB 5DEJA 4PRID 3T8XA 5KUKA 1C16A 4HISA 1MFUA 5DLLA 3UTZA 4HLEA 1P7KB 1YQVH 2A6IA 3QXAB 5IK3A 4XMKL 2PWDA 3VXSA 3O2DA 1MI5E 3TBTA 4Z7UA 3WN5C 4N1HB 4XNMA 1IBHA 1D5XB 3UBGA 3DX9B 5T33L 2F08A 2JIXA 1P84K 3L13A 4X9IA 1I9JL 2XTLA 3UTTD 4R4ND 4OCXL 4HS8L 2X4SA 3FO9A 1WC7A 1JZIA 1OF0A 2EDXA 3ZTCC 1JUFB 3QQ3A 4MD5B 3TIDA 3DI3B 2FWOA 1HSBA 2A1WH 2VLRD 4Z6AT 3A67L 1QTYT 2M2DA 5DD5H 1SMOA 4UT7L 3ATAA 4OAWA 4MZIA 2VXUH 3KCPA 4IGBA 1WBXB 1I7ZB 4I13B 3W9DB 5J1SC 2WLMA 3FCGA 5JIDA 3MRGB 5DMKA 4AV0A 2J2ZB 5EBLA 5CJBA 3QIUB 5KSBA 4GSDL 1YY8B 4N9GB 1IQDB 3HZ3A 4Y1TA 1OGTA 2Y7OA 3UBFA 1DQML 4X5WA 3VCLB 1A6WL 1IC4L 2DQDH 4XVJH 4YMPA 1AQHA 3ZL2A 1JHLH 1MCQA 1J05A 4Q0XH 1EGJL 1FLRL 4YFDB 3RIAF 3FQUB 1G9NH 3SD5A 3HHRB 2J4WL 1B4LA 3V6ZA 5FOBB 2YRZA 4B3EA 3HI6L 2JNZA 4M62H 4NUJA 1KZYA 5B39A 5JHMA 4UTCA 1AO7D 4OZHA 4A7SA 1XDTT 2H7WA 5AAPA 1CLOH 1KC5L 1XT5A 4P2RD 4IRSD 1E4XH 5CBEA 5E70A 1SEBB 1EANA 4QRUA 3C5ZC 4XNDA 4D3CL 1NCDH 4HT1L 1YJDL 2J73A 4HBQA 5F88B 5CZRA 1Y0LB 2IH9A 3N42F 5JYLA 3FYEB 4AZ8B 1UCBH 2J6EA 1LEIB 1A21A 1G0DA 1T80A 3HG5A 1MW0A 2H1LM 1KGJA 2V7HB 4LCWB 4QHLA 1QATA 4UT6A 4JDVA 4MJ6A 5IMLB 3EYFA 4HXAH 2HT2D 3DV6A 4YSCA 1OXYA 1BJ8A 5IBTL 2DN7A 2ZKHH 3SDDA 3VI3A 3QWNA 4KQ4H 1RZJH 2OXGB 4NN5B 5FYJL 4CSTA 3DSNB 4FCAA 3HB3D 3U4AA 3Q6FB 4QCIB 3SPGA 1TTCA 1E9QA 4JPVH 5FGSA 4KVPA 4MX7A 4R8WL 4JFEE 2GK0A 3GXNA 2NYYD 5JOFB 4RLDA 4GG8B 3WFDH 5FYJD 4P2QE 2XVKA 5C09D 4NERA 1FGNH 4FXGC 3A6OA 5ISZA 3S35H 4RGNC 5TF0A 3UG5A 4DVRL 4ZFFB 1JWMB 1P5VB 3O3EA 4I4WB 3QEQD 4OD3L 2MJWA 4I18B 3KWUA 3BI9X 2HFFB 3CZUB 4CSPA 4FG6C 4XC3L 2UVFA 5CUSH 3TNNB 1K4DB 4MTMA 4OI9A 1YYLL 1AGEB 2KZBA 1NL0H 3TJHC 3E6HB 4RDBA 4HK3N 3APNA 4TOYL 5GRJL 1MF2H 4K94L 4JFZH 2FWUA 3JWDL 5HI3C 3LEYL 12E8L 4LVEA 5D1ZB 5BZDA 3OMIB 1I8KB 1NWOA 2MOGA 5F1IB 1BOGB 2G2RA 4FG6D 5EOCJ 3BSZA 5KSUA 2V7HA 1QOKA 1A6WH 5IHWA 1AGCB 1H8LA 5C0DA 4FMVA 1XF5B 3BKMH 2FSEA 1G84A 2IDQA 2H32H 5JHDA 3ZHLA 4PJ9B 3AQYA 5DFWH 3AADB 1M53A 2PCFA 4LSPL 5BUGA 1ED3A 4B27A 3DBXB 4Y2DD 2FBJL 4A2EA 4AY0A 5I9QC 2FEDC 4JFYB 5L4IA 3WIHA 3D85D 2RH0A 3WN6A 2WIMA 1IEBA 4V2CB 2FT6A 4CN6A 3L08A 1MJJB 1FA4A 4X6BB 4HCRL 5BZWA 3UTQB 2JQMA 3GXDA 1NMAH 4NQEA 1CDYA 1I8AA 1MCPH 4PP1D 1I1AC 1GYCA 3QT2A 1YEJL 4IBYA 5JW5A 3ZMRA 2WKLA 2DD8L 4L1BA 2VW6A 1XGQA 1QSEA 1XO8A 2IAMC 4PIBA 4Y5VB 3SBPA 3VH8A 3VWJD 4QNPE 6TAAA 1IEHA 1JF5A 2LLGA 3MNVB 4ADGA 1E50A 3QUZD 5EUKB 4OZIE 3OZLA 1S9KC 3QK0A 4G5ZL 1LO2H 2Y06L 3L8QA 3LKPB 4IMLA 3W39B 5HI5C 2QFRA 1IIKA 4KMTH 3MXWH 1A7NL 2BMKA 1RMFL 4MXVF 2X4PB 2CIIB 5TE6H 5LGHL 5A2LH 4QRRD 4A2DA 5EEXA 3QZBA 4M7ZB 1KGUA 4PY8I 2EXWD 1FPTH 1KDJA 2ADJB 2EH8H 3MRQB 2UWEF 4OLZH 3J8F7 1KYUA 3LNFA 5HYSB 4MA7H 4JUTA 5C9KA 2AGJL 3EG9B 5F7UA 4R7DA 3RB7A 5DQ9B 5IMMB 2WVVA 3MCKB 5D4QA 3ZT6A 3UJIH 4PBXA 1ZANL 3U0WL 4RWHA 1OM3H 1GYVA 4P2QA 5C0IA 1GGCH 2O5XL 2WZ5A 3DMMB 1THAA 3L3HA 2EABA 2VLJE 2R0ZH 3RTQC 2R4RL 4MXVE 5EEYA 4PI0A 3X3GH 4XMLL 3PWPD 4KFZC 3E3QE 2EC8A 2UZPA 1RPUA 4DGYL 3B6SA 3MJ8B 3K8KA 4OFIA 1RZGB 3OKDB 2VIRB 1KPUA 2BDNH 1SUHA 2VDNB 3TASA 4DPRA 1SHSA 4FXTA 4PVLA 1IILE 4OTXH 5F7EH 1VENA 3TA3B 1A6AB 1W16A 2G4EA 4JFFB 3QO0B 1AVAA 1G7IA 4JRYA 3CFTA 3HPJA 2YARA 3CC5B 4NUJB 3RX9A 4OI8A 2XWJA 1YNTB 1ACXA 5FYLH 3SE9L 4X9BA 2VN7A 1INDL 1LJMA 2FGWH 4S0SD 4AGPA 2X42A 4Y88A 4AYBA 1PQZB 1R3IL 6PCYA 1FNGB 4KAQL 2X2YA 1NMCC 1P2CB 4PJHE 1BZ9A 4DEPB 1AYOA 1W8NA 5EMYA 3WEBA 1A7RH 3FPXA 5FHAH 1M7UA 2X44D 4HGWB 1WTGT 2WBWB 3CSYB 2VN5A 4BV1A 2V2TA 3JWOL 1FFOA 1MHEA 4GXVL 4OV5B 4G7YL 4KKZA 1NUDA 4YGVA 2OZNA 1HEZB 3NZ8A 5K1NA 3C6LA 5JNYA 4TRPL 1T3FB 4OJCA 4K7PX 4GQPH 3HN3A 4WI6A 4TLKA 3A6BH 3NRQA 3VI4E 3LKOA 3U36A 3BVXA 1JGVL 5HBBA 4Y8AA 4NKOA 4GQZA 1ORSB 1GTFA 3Q0HA 5DJXB 5HYIA 1OLZA 3BSZL 4JL2A 4KDWA 5CEZE 5CLXA 5KBDA 2C1OB 1SEQH 1ZVYA 2KLSA 3VA6A 1P7KA 2AV7A 3QXAA 4NQUA 4HF5L 2ICEA 1S4IA 2G4GA 3VMPA 4FABH 1MFNA 1SQMA 5EIIB 4QRFA 2FIKB 1MRDH 4KROB 4HSAC 4L29A 2P5WD 4CGUB 4Q89A 3SHSA 3RILA 4UAOB 1ECZA 1J87A 1RUKH 4QJ3B 1HEZA 4QR7A 2VL5B 4KK9D 4IDJH 1EGJH 3F58L 3GLAA 4MCZB 4D9QE 2GABA 1CK0H 2F58L 2PCPB 4I2XB 3LZPA 4JFOB 3EOAA 1ZDSA 1B90A 4XNAA 1NSNH 1NANI 5D2LA 4J3OD 3L4YA 3HE6D 4RVBA 4NM4H 3MLZL 1AQDA 1PIGA 4JN1L 5D1XB 1OP4A 1SJMA 4EE2A 3O6KL 1L6ZA 1R24A 5CP7A 3ULVD 2J3SA 5HHQA 1HXYB 2VDQH 1U93B 2FX7L 5E8EB 3GJEB 1FBIL 5DD6B 5DU7A 1RZKH 5IROA 4FFVD 4IRSA 3SIKA 1MRCH 2J6EH 1IBYA 4QLWA 2CLVA 4IOSD 3UPCA 2EIEA 4IBUA 2QGBA 5D9SB 3MUGA 2BVUA 4ECNA 1I3GL 4U1IA 1QR1A 1ZLSL 3MO1A 4I0PD 2P43B 1GYUA 2CBTA 3MV11 3O4LD 1WAAE 2NNRA 1J88A 4P48A 2VSKB 1QLRA 2O30A 2ZCLH 4M3JA 5JPNC 2K70A 1DDTA 1MUJA 2NXZD 1WZKA 4OQTH 1NAKH 1CFVL 4G7RB 5A16B 3LKOB 4JZOA 3FB6B 4HD5A 4RISL 4JKPL 4UIMB 4LASL 4BH8B 2F9BT 3GLZA 3S88H 2JKTM 5BRZE 2VR5A 2Z6FA 5D7JD 4NZTH 4WZ9A 3PAVA 3SD2A 4WHDA 3TT1H 3T0EB 5FM4A 4ALAL 4WUUE 2VDKB 4L9LB 1JGDA 1IBDA 4TUKH 4M48H 4OVUA 3NZ8B 1XWVA 1FAIL 2IMMA 1G7JB 4YFLF 4AEIL 1VADA 2R1YB 2ZPKL 4JE4B 2P5EB 2VXVH 3IVKB 4YSTA 1DVFB 2CUMA 5A40E 3KEDA 3GSRA 1URLA 3C12A 1S7SB 2A9ML 3LKPA 4IMLB 3FU6A 4OCWH 5FKPB 2B0SL 4J3BA 3G5YA 3P11H 2ATPB 4NX0A 5AVSB 3NIFB 4UAHA 4YE0A 4KZ0A 4Z7OB 4LSSL 3D2UB 3FFCB 3TLRA 4Z5RB 3GIVB 5A7BA 5HGHA 1MXGA 4WWNA 1CFTB 5EZJA 5IQOA 3OPZH 1HINL 4GW1B 5E23A 3MUY1 4EAEA 1HE7A 2R29A 1QQDA 4NXSA 1RZJL 3EH2A 5F7WC 5I1IH 3TBYB 3VVVA 1PKOA 4JPSA 4X6DE 5HI3D 4KHTH 4KVNH 4X6CB 3B7UX 5HY9A 4CVWA 2XTJB 4UTBH 1NGWA 1RQ5A 5E9AA 2G3ZA 5EBWA 2LTQB 3AUWB 4HAKA 1ITCA 1NGQH 5F93C 3TL5A 1JRHI 3HNVH 3PNWA 4JM2D 4OF5A 5C0CE 3BKCL 2VDLB 5GS3A 1IRAY 5CLTA 5DD3L 3O3DA 3E8VA 2E8ZA 1CN4A 5FLVA 2YMOA 3ZSSA 3H56A 4UZGA 5AAWC 3MLYH 4JKLA 1CDGA 4S1DD 4M6OH 1O6SA 5HVHC 5IR1B 5LDSA 2D2CC 4KNTA 4AUJA 5I6XC 2FQEA 1ZXKA 2WTOA 1G9EA 3P4NB 3F7VB 3E6HA 3NVQA 3TWYA 2H4EA 1JXKA 3RTLA 1M7IA 2CK0H 3QFDB 2C1PB 3A5VA 5F1NB 1EA9C 4JFXB 2FATH 4QHNB 1H3PL 4PRBA 1NGYA 4MNHA 1F56A 1H8NA 3GJFA 4PJAB 1JPSL 4XN5A 1BLNA 1BXXA 1G9NL 1WS7A 4JRXD 1MAML 1V55B 2ZWKA 2BZDA 5LXGL 3O45A 5EF2A 5DHYA 4A63A 3GIZH 3TZVC 3FDWA 4HP5A 5D2LB 3RFRA 5IESL 3S5LG 1ASPA 4NEHB 4F37F 4IOSA 2OSLA 4JFPA 2XZAL 3PJLA 3WNMA 4RMTA 4XGZA 3SDAA 4BQ8A 3NSYA 2LLLA 5AW5B 1ZT4B 2LU5A 3BAYA 5DJZB 4EQ3A 2BVQB 1KTCA 4ZXBA 5T1JA 4XPHH 4JPKH 3FAWA 1IAIM 5ABAA 2JTDA 3N85H 4IRSC 4Z77B 3DV6B 1JI1A 5AW2B 5ITFB 4BSWA 4ZX3A 3FZUD 2FYVA 2DRUA 3EBGA 3VFWB 4FN0A 1HKLL 4D2NA 2LU4A 2W9LA 4MJ6B 3PY9A 2BFVL 3QJVB 3BPCB 3WFEH 4XN7A 4YGAB 2ZWNA 1HHHA 3CDYA 1U30A 3QCUL 1N5AB 1A9BB 4Y5YA 5D2LE 5E4OA 5D7EA 5J11C 1IM9B 4N8VB 1MCSA 4KO9A 3TYGL 2B7DT 2PR9A 3KR3H 1HE8A 4JEGB 1M05B 1BZOA 3D4GA 3FZUC 3L5WA 1KCLA 3U46A 1KY7A 4I0CC 4AT6B 2BW4A 3OQ3B 2ERJB 3I6LE 5GGRB 4BDVA 4TTDD 2H5UA 4NWTH 2X4UA 1MCOH 1JHKL 4YXHL 3QI9A 3SDCA 5LBVA 4PJ8B 5B4MD 3WFHB 4XN9A 4WWPA 1W72H 2E9WA 3HAEG 4OB5H 3R19A 3NBNA 1ZCRA 1F3JA 3C08H 1FL5B 1X44A 3WKMH 3L7EA 3QJQB 1D3CA 3U0PA 2XBZA 4K7PH 4KRLB 5EU5A 4G71B 4LLYA 1JPTL 3KS0H 2GPZA 2ROXA 3AT9A 3QDME 4FX5A 3T2PA 5EBLB 5SWSB 2XNAA 2BVOA 2IGTA 3GSVA 4I8DA 1SNRA 4A6YH 1S46A 4XI5C 1CWVA 3L48A 3T1FB 3UJJL 4CN4A 4IBLT 1JZ4A 3ZMNA 1J9SA 1EFQA 4LAQL 4NQSA 1FVCB 3EYFB 1EO8H 2OULB 1MCNA 4WGWB 3MFFB 5IHZB 3HN8A 2ZKYA 1PVHA 2CMRL 2OR9H 2D31A 4F2FA 4Q9RL 3T0XA 3FO9B 2X05A 2VZ1A 2D73A 4YQXL 3Q8FA 2ZWSA 2IXQA 2WB7A 3D0AA 1UEYA 3GB7A 1FUNA 4LSTH 2BPBA 3C60C 4JKMA 1KXTA 2ZIDA 3PHSA 4X9YA 5EPMA 2YD4A 3KJ4B 1X5LA 1N7MH 2F7QA 3RI5F 5AEAA 5GISL 3WXWL 2BSRA 4J1UA 2AQPA 4D0DA 3WO4B 2OZ4L 4G80B 3PUUA 1A7QH 1R3HA 3BXNA 3MUUA 3BKYL 1ZY9A 5DJ2B 3RY6C 2E5EA 2GW5A 1I1FA 1QA9B 2FJHA 2DOCA 5F70A 2CR0A 5BV7L 4D7BA 2YGOA 4J6RH 4M8QB 4AGNA 4WFHD 3RWDB 2B1HH 4YVNA 5EUKA 1U58A 1ZE3H 4GSUA 3ROOB 3T2NL 5BPPA 4LOUC 3LH2L 3V5DB 2VXQL 3BVNB 1NGQL 2JSFA 3TF7C 3F65A 4JQXA 2MQGA 3LKNA 1OGTB 5L0QB 4PJ8A 4HEPG 5I0ZA 3ULUF 3WFCL 2IH3B 2DMCA 1GIGL 4ZI8A 5I75B 3U7YH 2EDQA 2EIKB 3K8MA 1KENH 2AEPH 3FULA 3VXTB 5EHFA 1QHQA 2LE9A 4U0RB 2V2XA 4AQZA 1DFXA 5J3HC 3VXNA 2OMXA 4P59L 4Z3IA 1F4WH 4HQQL 2WXOA 4JGUA 3H4FA 3PWLB 5TDOB 4ANXA 1EDQA 1KIQB 2XVLA 4X8JA 1KCVH 2OTWB 2QTVA 3RL1A 1KCWA 4WTXA 5GSVB 4QD2E 4JJOA 2AJUH 4PJDA 4WWKA 5AVXB 5EOQH 1LDSA 1UWEH 2EKSA 5F1IA 2VLKE 5C97A 3VXMB 3U6RB 3GMMA 5DK0B 1A1MB 1KGXA 1T20B