3NSYA

The multi-copper oxidase cueo with six met to ser mutations (m358s,m361s,m362s,m364s,m366s,m368s)
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
493
structure length
465
Chain Sequence
ERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAILPDTLSSLPALPSLEGLTVRKLQLSMDPSLDSSGSQSLSEKYGDQAMAGMDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTVLQGDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Blue copper oxidase cueO
publication title Crystal structures of multicopper oxidase CueO bound to copper(I) and silver(I): functional role of a methionine-rich sequence.
pubmed doi rcsb
source organism Escherichia coli
total genus 130
structure length 465
sequence length 493
ec nomenclature
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nsyA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nsyA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nsyA03
2XV0A 1RCYA 1JXGA 2OJ1A 5I6KA 2YXVA 2IWKA 1OOWA 2YAPA 1AZUA 2HLEB 3CDZB 3IN2A 4AX3A 2E86A 2Y69B 4GP4B 4QLWA 4GY4A 3PCYA 2HRHA 5TK2A 3N2JA 4DP9X 4HIPA 4YSQA 1BXAA 1TKWA 2I85A 1NIAA 5B1KA 8PAZA 4HHGA 1WS7A 4P5SA 1X9RA 3DKHA 4HHWA 1PF3A 5AFAA 1N70A 4NERA 1JZHA 3T6VA 5F7AA 3WG7B 4YSOA 1IUZA 1GSKA 4TXVB 3FU7B 1AAJA 2R7EB 4UF7C 3QJTB 1MG2C 4E9TA 5I28A 7PAZA 2OCCB 2YAEA 1SFHA 2XXGA 3EHBB 1NPNA 1ETJA 1KDIA 1BYOA 2H47C 2I7SA 2FNWA 2FQGA 1AANA 1OE2A 5B7FA 1BAWA 2Q9OA 4A2EA 4DP6X 4FAAB 2P80A 2XV3A 2OV0A 4BDVB 2EINB 1JVLA 2FT7A 2AVFA 1ASOA 2YAHA 3H4FA 1ZIAA 2JXMA 1ET8A 1NIEA 3ABKB 2GBAA 2TSBA 3FSVA 1QHQA 4YSTA 2PCYA 3IBOA 3MX0B 3FQ1A 1ZDSA 1KBWA 2EIKB 2XX1A 4DP0X 3ZBMA 2IH8A 2CCWA 1L9PA 5LDUA 5I6PA 4DPCX 1AQ8A 1TEFA 1XB3A 1SNRA 3ZIYA 2IDUA 1T5KA 5ANHA 3KW8A 2BZCA 5D4IA 4KOBA 3WNIA 1L9SA 1PZAA 4HALA 3UAEA 1JVOA 3V9CA 3QQXA 1RZPA 1MG3C 1AS7A 1SDDB 1IBZA 4G7QB 4A2HA 4M4RB 1AS6A 3TU6A 1V54B 4BXSV 1JZEA 1AZBA 3WKQA 1M9WA 1E5YA 1XMEB 2BWDA 4A2DA 4E9QA 3FPYA 3NP4A 3CDZA 2YAFA 3CVCA 1ZPUA 2IDTA 1AZNA 3FSAA 2UXFA 3TASA 4KO7A 1ASPA 4DP2X 1PZCA 1NINA 2BW5A 4YVNA 2GIMA 3PPSA 3G5WA 1NTDA 3U25A 1DZ0A 2DYSB 3D12B 4GP5B 2WSDA 2DV6A 1ILUA 2BP0B 3FU7A 5B1JC 4DP1X 1AZRA 2R7EA 2YAQA 4BWUA 5IY5B 4MFHA 1A65A 4JHVA 3FPXA 2Q5BA 2BO0A 4G7SB 4Q89A 3H56A 3WKPA 1M56B 1KCWA 1GW0A 1QNIA 2CJ3A 1SF5A 2FQEA 1ASQA 4BWTA 2UX7A 4BDVA 7PCYA 2XV2A 3PAUA 1J9RA 2XVBA 3NSFA 4UANA 1J5DA 3QJQB 5D4HA 2BW4A 5B7EA 1PNCA 2YAMA 1NWPA 3GYRA 4ZK8A 3S3DB 4A66A 2FQFA 4E9YA 3CVBA 1KGYE 2EIMB 4GXFA 4G72B 4X4KA 2PP9A 1HAWA 1E30A 1ZDQA 4A2GA 1OV8A 2VW7A 3ASOB 1EZLA 1V10A 4WKXA 3T6XA 5PCYA 3NJJA 2VSMB 3CZUB 1GY2A 3NYKA 1KYAA 2I7OA 1PLAA 1E5ZA 3NSYA 2GC4C 2WO2B 2YXWA 4AKQA 3SBRA 3V9EA 1J9QA 3ERXA 4YSDA 1KCBA 1SDDA 4M3HA 1J9SA 3NJNA 2ZONA 4N8UA 3S3BB 5B1BB 2N0MA 3NT0A 2J56A 2H3XC 1SHWA 5I5MA 3QJRB 4WTQA 2QDWA 4QKTA 2BWIA 3AW5A 3ZX1A 3ZDWA 4DP8X 1MDAA 2CAKA 2VW4A 4YSUA 3MBWB 3IEAA 3AY2A 3PLYA 1OF0A 1CC3A 2GHZA 3SBPA 1SFDA 1V55B 4E9RA 4KNSA 1CURA 1SHXA 2VN3A 1GS7A 4G71B 2IWEA 5AZUA 3UABA 2ZOOA 5AKRA 3AG4B 3CG8A 4Q8BA 1F56A 2AZUA 1WA0X 3NP3A 1BXUA 2BP0A 2CALA 4KNUA 5I5IA 2BP8B 2TSAA 4YSSA 1NZRA 2B08A 2FQDA 4YSAA 1GR7A 2XX0A 5B1JA 2QPEB 2YARA 4L0PB 1NPJA 1AOZA 3T6ZA 1RKRA 1HFUA 2YQBA 3IN0A 4YVUA 2JFCA 2VM3A 3SBQA 1RZQA 1FWXA 4K9JA 1TU2A 3HB3B 3NJFA 4RH4A 3DIVA 1PLCA 3TA4D 1ET7A 2ZXWB 1HAUA 1VLXA 1JXFA 1W6LA 4BK5C 4DP4X 5FC9A 2CBPA 5B7MA 1XB6A 4N4YB 2QT6A 1OCRB 3ABGA 4HCGA 3WIAA 1AG0A 4F7KA 3FS9A 3PAZA 3FSZA 4AKPA 4DPAX 1J5CA 4F2EA 2A3TA 3JTBA 3T71A 4CSPA 4BWWA 1NIFA 2UXGA 2VM4A 2WO3B 4YL4A 3PXLA 9PCYA 1JOIA 2BHFA 3X1NA 3BQVA 4KNTA 4YSCA 6PCYA 1JXDA 2H5UA 2XXFA 2PPCA 1GY1A 1L9QA 3HEIB 2X88A 2B3IA 2FTAA 2EILB 1DYZA 1CYXA 1WA1X 4ENZA 3KW7A 1JZGA 3OMAB 2HXAA 2QDVA 1AS8A 1N68A 2PCFA 1SJMA 4DP5X 2EIJB 2J55A 2GB2A 2FT6A 4JHUA 2XWZA 2ZWNA 1EHKB 3OMNB 1MZYA 2XLLA 3T6WA 1KDJA 3UADA 1B3IA 2VW6A 4KO6A 4E9VA 6PAZA 3NJKA 5PAZA 1WAEA 2HX9A 4E9WA 2W88A 3FT0A 1ID2A 3GDCA 4DPBX 1PMYA 3EF4A 2BP8A 2MTAA 3NJIA 3AG2B 2QPDB 2PPAA 3NSCA 4G7RB 1CUOA 4A68A 4AI7A 1L9TA 4AZUA 2XUWA 3T9WA 1MZZA 3QJVB 1M57B 1BXVA 2IDQA 1PLBA 1L9RA 3EH5B 4W9ZA 1PCSA 4YSPA 4F2FA 1URIA 2DYRB 3CVDA 5E9NA 2AANA 1XB8A 5I26A 1WS8A 1X9UA 1BEXA 1R1CA 3FU8A 2AZAA 3X1GA 1A3ZA 2DWTA 1KBVA 3FQ2A 4NAJA 2LLNA 4JKNA 2UXVA 2FWLB 1ET5A 1NWOA 3IE9A 3WI9A 2PPDA 1JZIA 3EH4B 2DWSA 3L45A 5I6LA 4BXVA 2J5WA 2P80D 4CSZA 2W8CA 1OCOB 3TBCA 3FYIB 3OQRA 3AG1B 4YSEA 1ADWA 1L9OA 1GS8A 2IDFA 4AKOA 1TEGA 4KO9A 1FA4A 1JZJA 3PAVA 3X1EA 5I6NA 1AG6A 1BQKA 1AR1B 3NJMA 3S8FB 2AFNA 4PAZA 4KO5A 4P5RA 2CUAA 2HX8A 3NJGA 2HZHA 5B3SB 1A4CA 3FYEB 1AIZA 1IKOP 2MRYA 1AACA 2PPEA 3QJUB 4YSRA 3UAAA 2IWFA 1JZFA 4E9SA 4HZ1A 5A7EA 1PZBA 2BZ7A 2FT8A 3DTUB 4W1TA 1UATA 1NDTA 2UXTA 3OM3B 1GS6X 4G70B 1ZV2A 1NIDA 3QPKA 4FA7B 5F7BA 1NIBA 3ASNB 2HRGA 2IH9A 1PNDA 3JT2A 2PPFA 3NSDA 1FFTB 2IDSA 5EHFA 3EH3B 1AZCA 4E9XA 1BYPA 2X87A 4GYBA 4UAHA 2HX7A 1OCZB 4DP7X 1PY0A 3WNJA 3FSWA 4PCYA 2PLTA 3UACA 2VSKB 3N55A 2DY2A 2RACA 2VMJA 1WA2X 1GYCA 1YLBB 1OE1A 3OD3A 5D4JA 4HCIA 1IC0A 1PAZA 4A67A 3S8GB 1BQ5A 1BQRA 4A2FA 1E65A 1QLEB 3GXUB 4KOCA 3ABLB 3X1FA 3OMIB 3ABMB 1OE3A 1I53A 1ZIBA 2GI0A 4HCFA 3X2QB 2IAAC 1A8ZA 3NJLA 2XU9A 3NJHA 5TK4A 1W8EA 3BVDB 2GC7C 1A4BA 2PP7A 4HAKA 3S3CB 2YAOA 4GP8B 4NB7A 2JKWA 1ILSA 5B1AB 1NICA 5I6MA 3SQRA 3QJSB 1J9TA 1IBYA 2XYBA 3FQYA 1OCCB 2J57A 3H4HA 3X1BA 2UX6A 2NRDA 3AG3B 2PP8A 3RYMA 5I5JA 3TBBA 3UGEA 3FU9A 3C75A 5I6OA 1KV7A 1W6WA 1A4AA 1JERA 2FJSA 1E67A 2GSMB 1SF3A 3AZUA 1CYWA 4EF3A 2Y1AA
chains in the Genus database with same CATH superfamily
1MW0A 4K94H 3WNPA 1S5IL 3TWYA 4W4OA 3VFNA 1F3RB 5IB1B 5IV2A 1UVQA 4NBXB 3NAAH 3JV4A 1S9KC 2Y69B 3DO7A 1KF9B 2WBWB 5LKNA 3PCYA 4KK6D 5AVRB 3CFKA 2D9QB 1NJ9A 4NRYB 2I24N 5IK3A 3JBG7 2P5WA 3MMEA 4YZWA 2ODIA 1JF5A 4BZ1L 1CIDA 4P9HC 5L7XH 3QWNA 2IH3B 4M02A 1HESA 4ZNCD 5HBBA 2V5SA 1YO4A 2ED8A 4F9PC 5K9QG 5KSUB 4IBVA 4I0PB 1O7VA 5F0JB 4G8FA 1FSKB 1U3ZA 3VXSA 3ECBA 5HGDA 5ETUB 1O5DT 3MBXH 4JGMA 1ZS8B 4ODBD 5IREA 2HTKC 3US1A 2AK4B 4YIQA 1GHFH 3AQXA 2HJKA 4FFYL 5I1LB 1KDIA 2F19H 4ZZFA 5AB9A 4EI6A 4FFVD 1AMYA 3CNKA 3P73A 3BIKB 3KYKH 5EO9B 1UXSB 5D71H 4XMLL 3VX1A 4HX1A 2EINB 4OCXL 4JQIA 4J2XA 2DMHA 3H4FA 5T1DH 3FQ4A 4OB5H 2NXZD 2X70B 3FSVA 2CKBH 3POCA 3HZKB 4HUXB 4QXWA 1ZA6B 5D7IB 5DHXB 2XX1A 4QRPD 4D0BB 3KMDA 3QYCA 2A1WH 3VFVA 5JIDA 2CDEA 3GTNA 3TV8A 4MAYA 2KLTA 4N90E 2ZUTA 3P30H 5TE6L 1CDJA 1J0ZA 3FOLB 4R5VA 4FHBD 1JMZA 2OSLA 3UTQB 1RUPH 3VWKC 4L8SB 3QRGL 4GNKB 3BYTA 4HALA 3W9DA 4QYOA 3H9SE 2EYRB 3RIFK 5I2IA 3DA0A 3P77A 3QXAB 4ZFGH 1GZHA 4RFOH 2J12B 2QADD 4N8VB 2FBOJ 3DMMC 5AWNH 2HTLC 2KT6A 1UJ3C 5FM5O 1FL6B 2Z3FA 4KTYA 1JZEA 4AEIL 3UP6A 1OGTB 2NXYD 3FTUA 4TL4A 5G5DB 3D0LB 2CWRA 3P3RA 4PJFA 5CLYA 1QPXA 1FL5A 2EYTA 1EWHA 2Q86B 2DJ4A 5GXBB 4ETYA 4JRWA 2B4CH 2ZXDA 4FQJH 3CDZA 2ATKB 3K8LA 2E9BA 3FSAA 4JBSA 2J25A 3KR3L 2R2EA 1BECA 1KZQA 1NM9A 1UB6A 4BZYA 3FFCD 5F7WC 5D7LD 3RGVA 2V17L 3G5WA 5D9SA 4UZSA 5HHOD 5C0FA 5HP5A 3V8OA 1KNOA 1NOLA 1IB5A 4WI4A 1HH6B 4BHUI 4F8QA 5FDWB 5D72L 5E2VH 3B43A 5DTFB 5C09D 3ULVD 2K6ZA 1T89C 2DD8H 4KUZH 4XVSL 1FH5H 1UURA 5CKGA 3VYNA 4AJVA 4ALAL 2EO9A 3LNHA 4YHKL 1D5IH 4Z7IA 5BOJA 2AJXL 3U6RB 5F6HI 2G2NA 1IX2A 4I3GA 4XAWL 5D2LF 5IJKC 4IBUA 3VJ6B 2DI8A 3S2CA 2ICEA 1X4YA 4E5XG 2DM3A 1ZTXH 4I3SH 1KTBA 2HG5A 4JCWA 4PJBF 1MFEL 4FE9A 1BAFL 1ND0B 1T0OA 3GRWA 4A37A 5KEZA 1FNAA 1I1YA 3BHBA 1KEMH 4C56E 1DBBL 3GJEB 2AJYL 5EZJB 5MHSE 3DO4A 2HLAA 2WCSA 5SV3A 3QPQD 4H88H 1YMHB 1XO8A 2H8PA 2HAZA 1CI3M 2QPSA 3C6LD 4MCYB 3CFDB 1LP9E 1OZUA 1WWWX 3WNLA 3OKOA 1F1GA 3DYMA 1E4JA 3ASOB 4MAZA 3T6XA 5F0PB 2D03L 3S35X 1AGCB 4JDEB 3VM5A 3AS2A 1U8OB 3HZYB 4NX0A 3UCQA 2Z34A 3C5SB 1IAIM 3C9NB 3L16A 3HS8A 3MRNA 4IYKA 2R4RH 3U0TB 4JG1L 4MJIA 4UQ3A 5E8OA 3EO0A 1EDHA 4M3HA 2YMXL 5KBPA 4U0QB 4XN2A 1WZKA 4XWOC 4D0DB 1L3NA 5F44A 1FI8C 3GS7A 3PL6D 1AXIB 4YLBA 4JFHE 4ZMXA 4KITB 4XO9A 2W1NA 3KJ4C 4H5SB 2PN5A 2AMGA 1RK1B 3IJYB 3L3OC 1MOEA 3GMOB 4F8PA 1TQWA 3IEAA 1FZJB 1CQKA 2XZQH 5HXMA 3D85D 4XP4H 4LRNL 1WO2A 4KHXL 3S3PA 4MASA 2C8NA 2ED7A 1FUNA 3C09C 4DFIA 4P0DA 4DNLA 4S1DD 3KLKA 4KNSA 2M83A 2ENSA 5F97E 1S9VB 1UD8A 2VLJA 3O2VH 4MNHA 4G71B 4WFGD 3RJDA 5BZDB 3E6HB 4IHOA 5I1GH 4N2IA 3LRHA 1U8CA 1P4LB 4KQ4L 4EUPG 1MWAL 2UZYA 3Q3GB 4KX9A 3HZVB 4XNZC 2EDMA 3WTVA 2V5RA 1F4YL 4LSPH 4FXKB 4S0TD 2QPEB 1HOCA 1AOZA 4QJ5B 2GJ6D 3N42F 1E2VA 3CUPB 4M3JA 4KXCA 3AS0A 4FL4C 5F7EL 2EDOA 4WI7A 4PSRA 4WF7A 5IJBC 1CD8A 1A9BB 1KPVB 1UADC 3HNTL 4LSTH 3LAFA 5A2AA 4PB0L 2G9KA 4ZMQA 3B7RL 5ISZA 1WC7A 4S2SA 1GYWA 5ADOH 3LRLA 5LBVA 1HAUA 5FGBC 2W60A 4QRUB 3ZLQC 4LXFA 4E0RB 5EBWA 2DEXX 3WUWG 1P4IH 3FOMB 4PP2A 4TPRL 5IBUB 2QGEA 4RWYL 4LRIA 1BG1A 1U8HB 3UPRB 2ZWSA 4GXUN 2Y22A 5DJCB 1EAQA 1YAIA 3F85A 4KX8A 4BV1A 2GIXA 5HPMA 3CZLA 3LN5B 4BSWA 4RRPA 1KIUB 5DO2D 4Y2OA 4F7KA 1BVNP 5D6CA 4CC1A 1INEH 3T71A 4FS0A 3UBFA 4NC0B 2NT1A 5TTRA 1GJUA 2BOCB 4HIIB 4CC4A 9PCYA 5HYIA 1S9XB 2R2BA 3DGGA 1EEYA 1UH3A 4NDMB 2IADB 2PPCA 2WGXA 2PCPB 3CXFA 2Y25A 2HT2D 1DANT 1SXZA 2FK9A 3OXRB 3T2QA 4EXKA 3Q2WA 3BVVA 4JFDA 1AO7D 1WCBB 4MHHG 2Z8SA 1UT1A 1W8NA 3BN9D 2LVCA 1C1EL 4M6OL 1RZFH 3F12B 2EUXA 5LVEA 4JFEA 4CILA 4S1RL 2WZPA 2DIBA 3U7YH 2IOMA 4G1MA 5DWUL 5CZXD 4NQEB 1JGLL 3FB8A 4IBSA 1DQML 3O3DB 4GRWF 3DROA 2XKUA 5TQ0H 2VERA 3H0TB 2BC4A 4P2QB 1GPOH 1SXSA 3CLFH 4MNGE 5GRUL 4Z6AT 4A68A 2ZSVB 2V6HA 3DV6A 3KPOB 4FQCH 1CXHA 1L9TA 3GZQA 4G7VL 3T9WA 1EERB 2DL9A 1U58A 5B22A 4J4PD 4X7DC 3BAEL 5H35A 3QXTA 4N22A 2VAAA 4OZGF 4Z7OE 4WU5B 1U4FA 2BERA 2P8PB 3QI9D 5J9PB 2CGRH 3FW6A 3S37H 2GTQA 2JKTM 2BOLA 4RMRA 3G9VA 3I6LD 1QUNA 4XNAA 4AG4H 2DQUH 2BVPB 1OAZL 3HR5B 2BNRE 1DJWA 3PNRB 3VXUA 5C0NC 4UUJA 2YPVH 3NZ8B 5GGQH 5JLZA 3AUVA 4EIBA 1YC7A 1XCQA 2ZXAA 4HC1H 1NH6A 2XIDA 2Z0UA 4MXQC 3V4VA 3BYYA 1G9HA 1IILE 1KCLA 3L45A 3CZSA 2ZT9C 4KZEL 1VJSA 1XSKA 2WOBA 5G4OA 4WRLA 1NLBH 4HG4K 2VUKA 4PTUA 2Z7UA 1L7IH 3OQRA 4PJHA 2FLBT 43CAA 2H26A 2P3YA 2JMRA 2E9JA 1EXGA 1DP0A 3RTQD 5DS2A 5E4EB 5HVGB 2BNUA 2HFEA 3UYPA 3HMWL 3LZFL 3QUZD 1R0AH 1JWMB 1OAXH 4Z3JA 3S5YA 4G6ML 4Y5VC 4H25B 3WFEL 2GKIA 3GHBH 1X4ZA 3GMRA 3MLSH 1NAKL 2XKNB 1KLFB 4N68A 1CFQB 5D7KE 3ZE0E 5D1QD 1HHKB 4B9ZA 3CSGA 3JV5A 5F1IA 5EORH 5GSVA 4E9SA 2IFFH 1R6VA 2VJ8A 1KXVC 5HDQL 3GMMA 2FNBA 4LSSL 1TKWB 4N2HA 3FT3B 2AXWA 2W5PA 5F7BA 3TO4B 4ZFZB 1NIBA 1C5BH 4KVNL 1J0HA 4XB8A 4FEMA 1AI1L 1HYRC 1IGFL 3WSQH 5FO8B 2R51A 1NGWA 2ZX5A 1BVKA 4TF4A 4E9XA 2WWMC 3ARSA 5H37G 5AALA 3LNGA 1GZQA 3PWUB 2GW5A 4XBMA 4K3DH 4FJYA 3VRIB 1SOQA 2CR0A 3LN9A 4WGVB 2GUOB 3LKQB 4Z7VE 5JIMA 1U8MB 2QFPA 1JGVH 2J1YA 2X4UB 3P4NA 3F62A 3SEPA 4OZ4B 3VI4E 1X5FA 2R2HA 3QUYC 3ZTJG 1GTFA 2X1QA 5F7MC 1IM9D 2YFNA 1IVLA 4HH8A 3QDJD 4LEXH 2DZEA 5DJXA 2I9TA 3X2QB 1AQMA 1R47A 1I1RA 1MXGA 3F8UB 3PQYB 4K5PA 4QRAA 2DWXA 4JE0A 3WTWA 3MRJA 2P5EE 3CZKA 4Q7DA 3VGBA 4J8QA 1IC1A 1JPTH 1NGPH 1NGXA 4NO3A 5F9WB 1WUNT 2VDMH 1OTUD 2YD3A 5AVYB 4OF8A 1ECZA 3DBXA 1B90A 1TZIB 3FK3A 4IQHA 3TX4A 2NXZB 4XP5L 3FTGB 3WFHA 5CCKL 2P46B 1K5WA 3X1BA 1KC5L 3OZLA 3G6DL 4QRPB 1TPXB 1XGQA 4PV1C 3HUJE 1X5YA 1W6WA 3FFCE 1BLNA 3BH9A 3VMOA 4ZFOL 2AEIT 3FCSB 4LCIL 1CYWA 4R4BA 3WXWH 5A2KH 5GS1A 3TT1H 4JJ5A 4OGXH 2AGJL 2VL4A 1IFHH 1UD2A 1ZHNA 2FECI 4JHBA 4KK9D 1FFRA 3DGDA 5AVZB 1MCRA 3B34A 3NCJH 5D1XD 3VXNB 3BUBA 5DJAB 5C09E 5DMGD 1BQHA 2ADGA 2YBRB 1ZLUK 4A55A 3JV6B 3ULVE 2QADB 4OLUL 3B56A 1VFMA 2WIIA 3IDMB 4F27A 2FIKB 3ZL1A 1JG9A 5D5MF 3WTTA 4HSAC 1URLA 5J11B 1IBGH 2R1WB 3SODB 4X6CA 3VW3H 5IQ7L 4HWBH 2VL5A 4I0PC 1YNLH 3MGAA 2G2RA 4LPVA 1FSKC 5BW7A 1QLRA 3EJSA 4LFHD 5AFAA 4GG6A 4OV6F 3T5WA 5C0DB 4XXCA 1BFSA 4WU7A 1E8XA 1FDLL 1CFNA 4HUMB 4JRFA 2V9RA 4IEFA 4UZGA 5D7LB 2WXKA 1L0QA 3AT8A 3VXRE 3U9PH 4N6RA 5F7DA 4AQAA 2CUHA 1I1AA 4U7MA 5HHOB 5M94B 1JN6B 2NUPB 3GMNA 3ZIMA 3K8KA 4UV7L 2EUVA 5J4MA 1OPGH 4TNGA 3TN0B 5B7FA 3D3VA 5F3HB 1J1PL 4U6HA 1ASOA 1BEYL 2Z91A 5DGQA 2VRKA 1D9KD 3S36X 2X41A 1RULH 3BIAX 4NRZB 2MIZA 5BRZD 3MRIB 1Y0LB 3LIZL 5F7HA 2DRUA 2X4PB 4AE1A 3PGDA 3UBHA 1KBWA 3C2AH 5L0QB 2HYMA 1BYNA 2A4CA 2WQVA 3ZBMA 1ZVHA 2XI9A 2ICWI 2EABA 4AH2A 5FEBA 1EBAA 2RCSH 2WXGA 2COVD 4L8SC 4YBQC 5E08H 5TDNB 5LCVL 2F7RA 3E9UA 4BSJA 3D50A 3IT8D 4RX4D 1DQDH 1HJBC 1JVOA 3C6LB 2B39A 1OP3H 1G6RL 4KPHH 1MG3C 2ODHA 4JRYE 5CR1A 4AUYA 2XWRA 4F7EA 4UT6L 3AGVA 3IVKB 3WDIA 3QYNA 5ACZA 1FVEA 4WFGE 4WNQB 4A6YB 3GEFA 3TZVA 1JZ3A 1DDHA 2YAFA 2ZOUA 3HMXA 3B9DA 4HDIB 4PY7A 4Y4KB 3TA3D 3ZO0A 3G9AB 2UXFA 2WYZA 5C0BE 1IQWL 2BRQA 3QZWB 1KCSL 1NINA 4D9RD 1LO3L 2WXFA 1TG8A 3PL6B 5DQDH 4GW1B 4ANKA 4EOWL 1URZA 3NK4A 4R8WH 2NR6A 4ZG1A 3Q1EA 5KYUA 2JELH 4WHCA 5CSGA 2ERJB 4L4TB 1GJIA 3IMSA 3GMLA 4U1JB 5GSRB 3D85B 4QAMB 2SEBB 2MH4A 1G0DA 5IY5B 1YEJH 5DC9B 4BCYA 2Q87A 4CMMA 2G0LA 3NZUA 2ARWA 1UWGH 5CJOL 1KTRL 4NPJA 2Z8WC 3O6MH 1AXSA 4P5MB 1UFUA 4Z3HA 4BZ2H 1P2CB 3WJLC 5T3XE 4UQ9A 1A7OL 2ZUUA 3L4CA 7PCYA 1HDMA 1RIVH 4K9EH 1MCDA 4P2RD 4XVUD 5EULV 1THAA 3PP3K 4LSRH 3S36H 1EO8H 2LQRA 3GXPA 4OCSL 2CJSA 3MX0A 1A02N 4Z5RA 4KXZI 1I85C 5IVZB 1YQVH 4OCMC 1GOGA 3IRCA 2AXHA 1A7RH 2XZCH 3V6OA 3W0WD 1PD6A 1N12A 5INCA 5A2CA 3D4GA 5KTEL 1OTTD 5FA3A 1UB5A 4PD4J 1KYAA 2I7OA 3D05A 2C34A 3H3BC 1XIWD 4OIBA 5EF3A 1Z5HA 3L08A 5DUBB 2I07A 4AKQA 1NMAH 4XTRD 4RNRA 5JXEC 1ZT7A 2PW2A 2ZOWA 5EBLB 4N2BA 2VXTH 2EXWD 1QASA 2WLZA 3A4AA 3HPLA 3I3DA 4IU3B 2OR8A 3QDME 3O11B 3FH5A 3L95B 3DLQR 3ZKXB 4PJAA 4NQVA 1G7QB 2ZONA 3ZTEA 3NT0A 5DRZB 2H3XC 2VN6A 1R3LA 3BKYH 4FNLL 4PREA 2EDTA 3MACL 1GIGH 1R3JB 4XX1E 2AV1B 1N6UA 3PV6A 3ZDWA 1A9EB 3MUZ1 4J27A 4LOUC 1EAJA 4WW2F 4NWTL 2Q7AA 3JVGA 3RURA 4JKPH 2K9FB 3HC4L 4G83A 1SXBA 4N2FA 1RHHA 1SFDA 3QIBB 5KOMC 1U3HA 3F7LA 4WSKA 5HJDA 1Z5YD 3RPKA 1MQ8A 1SDYA 4P06A 2OYPA 2UZXB 4XMKL 5JUEL 2VZTA 3SE3C 5ELIA 1RMFL 1UM6H 2CRIA 3TCLA 1MRFH 4GBXA 5HHMD 1AQKL 3OHXB 1U92B 2AI0L 5TDPB 4AYGA 2B08A 1W0VB 4MNQA 3I6LE 5A7BA 3THMH 1JMXA 2XG5B 2LV4A 3SJVE 4AQZA 1E8YA 4HYTB 4OCRL 3RL1A 1KGWA 2JFCA 5EZLA 5HY9B 3IXTA 2E8YA 3BSZL 3RX5A 1MCJA 2AITA 3D34A 2V9QA 4QRRD 5EEWA 1K2DB 2XC8A 1JF1A 1A8JH 1N8ZA 4AVHA 3QQ4A 3W5NA 4KKLC 4X80H 1SJXA 2BDNH 3EGXA 3FQWB 4Z77B 1J5OL 3RB5A 3QWOB 4BK5C 3D18B 3T0BA 1LWJA 2EDHA 5A6IA 2JB5H 1WZ1H 1EUUA 3QI9B 4BH8A 4I0KA 5DF0A 4N4YB 4C55A 3MRBB 1N0LA 4RMTA 4XVOA 3FUJA 2OSYA 1MCIA 3OAYK 2MHAA 1KTJA 4QHNA 3DX3A 2IGTA 2ZAHA 4JPWL 5KYXA 5IFHH 3BZ4A 4UIKL 5I19L 3SE8L 5D1ZD 5GZNC 4GW5A 3V5HA 5IMLA 3AJ7A 5GS2H 2WQRA 4H1LA 5LBSA 4RMSA 4U6YA 4BK4A 3TBSA 2Y06H 3ZYZA 1A3RH 3AMLA 2APSA 3MV9D 2B5IB 3LRSB 4X5RA 4JY5L 1BVOA 2F5BL 3EYFB 4UM9A 3ES6B 4TUOA 1LVEA 4J3BA 1SOKA 3DSNB 3KJ6H 2Q6WA 5HVHB 5FKAA 2EIZB 2EIJB 1LK3H 1VESA 4XO8A 3GSRA 1TQUA 2OXGB 3APMA 3RTQB 2QQKH 5EDSA 2NNCA 4J28A 4PLOB 3GNML 3OMNB 4FP8H 2DW5A 4QNPF 3RKDD 4ZMVA 3UJJL 3FT9A 4R83A 1BQUA 2EYSB 4M7JL 2QPUA 2X89A 1IAOB 3GD1C 3V4UL 3U6XA 2BSSA 5E24E 5D1QB 4KI1A 3C8KB 3IGFA 4G7RB 4GRLD 4A63A 5HHVL 1O6SA 4OAWA 3BEWA 4H44C 1F97A 5F7KC 3F6LA 1G9ML 3L3DB 2IALA 1KBGH 2L04A 2PYEA 3CU1A 3CXHK 1KJMA 4N0UE 5FCUH 4M6NH 4UINL 4W9ZA 5EU6A 4B9CA 2H41A 4PR5A 5EO0A 1XGYH 1CGYA 2BJML 2Y36H 5BS0B 1QEWA 3NN8B 2JIXA 4U6VH 1V7ML 4YDLB 3V0EA 2X2IA 2QLVB 3K2UL 1OARH 3ZHLA 5CZVL 3FQ2A 5IVXB 4LKXA 3KLLA 1GCFA 4JPSA 5TPWL 3DX1A 1OT4A 5JORA 3LS4H 4LSQH 1D5BB 2GSIA 3LEVH 5FS5A 5BUPA 4DO6A 4HIXL 1IM9B 1E9PA 1MI5D 2DH3A 2FL5A 2GBVA 3KXFE 4MKTA 4PJGB 5E00B 4PI0A 1XTLA 1MRDL 3ZHNA 4DKTA 4EN3D 5JPNA 2W65B 3QDJB 3GK8H 2ZCLH 4Y4HB 1UACH 1USZA 2DB8A 3K2KA 4UQDA 2YC1A 4IMKA 5T3XH 1NEZB 3B2VH 4AC4A 3VXTA 5BQ7A 3LH2L 5CAYB 5E4EC 1MWAB 4LHUA 2LHAA 3PWPA 2IANB 4JQXC 1V05A 4L2YA 2XJKA 5BUGA 2IBGA 1CFVL 1HIMH 5TF1H 2BS8A 1W9XA 2Z65C 1AG6A 4FG6C 4WWKA 4NFCA 1MLBA 5LDSA 3DV4B 2VXUL 5J13B 4JVWA 1P1ZA 1ZMYA 4XPAL 2B1OA 3MRPA 3QHZH 3BE1H 1HZHL 2ITDB 1EJFA 4WEBL 1O0VA 4XNQA 4G8GA 1E3XA 3LKOA 4H8WH 4PG9B 1XD1A 2BWQA 3RJQB 3QZMA 4EI5A 3FYEB 4PLNC 2BVOA 1Y7VA 1U3JA 5B1CA 3MXWH 4ZMYA 1P5VB 3ARFA 2DKUA 3C5ZD 1A22B 3S48A 4KK8D 4WSJA 1CE6A 3RDJA 4PCKA 4ZQKB 2BZ7A 3GI9L 2FT8A 2MNWA 3LXCA 4W1TA 2YLKA 5HJ3A 4R26H 5CGMA 1FL3B 1LE5B 1NSNL 2X42A 4KK6C 3I9IA 3Q5OA 5J3HD 4H0HB 4L9DA 1ETZB 5DK0B 3NCYP 5K59E 5D1XB 1SY6A 3EG9A 5KANI 5CBEB 3M17A 3TC9A 4X5XA 4PJHF 4IRJD 4FN0A 5IJDC 1KN4L 2HX7A 3U4BH 2WLIB 1E3FA 4PTTB 5C0CD 4F9LC 4XO4A 4D3CL 4ELDA 5MEND 4YNYA 4R3SA 4YWGH 4HJJH 3U36B 1W72H 1BZOA 2J44A 2XA8H 4DVBA 1SYVA 4P5KA 2MWCA 1IC0A 2JCCA 2YGOA 3DIFA 2W91A 3GLZA 5IG7A 3SDCA 5JW4R 2DQGL 4OKVA 3E3QC 5SWQB 4BH7A 3HG0A 4XO5A 2IH3A 1NC4A 3QRLA 1YN7A 4F7MB 2XU9A 3SDAA 3TBWB 5F9WC 3DYOA 1W8EA 4ZSOE 2VR6A 3I6GB 3OL2A 5HGBB 1EVUA 3LS5L 4TN9A 2NXZC 1T7ZA 2P48B 2BIQA 3SQRA 2VTFA 1EJOH 5J12B 1AR1D 1JPSL 1P7HL 3QEGL 4OCNC 4Y9CA 4E41D 4LPUA 1TPXC 1TTFA 2F54D 3ZN6A 5BRZB 2BSRB 5DFVD 2DKMA 3GSNL 4QOKE 3UBGA 5IHHA 4M62L 5F7NC 1I7RB 3GLDA 1BFVL 1BMZA 1K9TA 3CN3A 2BXZA 2X05A 3S34L 2VCOA 3JXAA 5I1JH 3WFDH 2C3VB 3O4LA 4ONHA 5LGJA 2MOVA 1NCWL 3QXWA 4HIHA 2OJ1A 2CO3A 2YXVA 2QADC 1S7WB 1EGJL 4X6DA 3ZDYE 1EZUA 2LLLA 2AJYH 3L3HB 3I9PA 3IDNA 2WLMA 1AHWA 3SY0B 1CICD 3PE9A 4KKCD 5J11C 1R33A 2BP3A 5E8DH 1AY1L 4ZMTA 4Z7NE 4HUCA 4OZIE 1XAUA 2DYPA 4XCCH 1EFXA 4HLZG 1I7ZA 1YEGH 3QBTB 3MLPA 2QR0B 1UKTA 5E5UB 4HOMA 3FOLA 1AGFA 2XCMC 1DQLL 4JE4B 4XXWC 5IHUH 3RX7A 3TNMB 2R9HC 3ULUH 3QE5A 2APBA 3LPOA 2VQTA 3RX9A 4NIYE 5I75B 1M2OA 3LVEA 2OTUB 4C83B 2ZOKA 1FZMA 2HCZX 3VGFA 1AAJA 4TM9A 3RU8L 1NGQH 2FGZA 1S9WA 1Z7JA 1H3WM 3AGWA 5I28A 4P4KA 2ZQKA 3SGKA 7PAZA 1OVZA 3TN0C 2ADJA 1BPVA 2F74A 1WFNA 4ELKB 3EH2A 2DH2A 1XF5A 5HYQB 1HH9B 4PRHA 5L8KB 1UOVA 3LKPA 4TV3A 2NY5H 5L0QC 1SHSA 1MJ8H 5I16B 2Q10A 3WS6C 1OQOA 3IJSB 4X6CF 5F93C 4CVXA 1QSEA 1BLIA 4EZKA 2FZ3A 3L3KA 4HT1H 2R4SL 1UWEL 4FG0A 4Z7UF 1DLHA 7FABH 3EIFA 1MUJB 1JHTB 3SY6A 1BVZA 2L7JA 2VN5A 1B9KA 4P2RB 5EBGA 1U21A 3C6LC 3HJEA 5HHXL 1LEKA 1KB5H 2C3XA 1OP5H 1J87A 4K5NA 4JGNA 3DHMA 1F4YH 2HKHL 3WEOA 3ARDD 1ETA1 3L1EA 2J8UE 3HTLX 2FYYB 5EEZA 4PJIF 3D4ZA 3RWFB 4FZ8H 3BT0A 1FNGB 3ROOA 4V1DB 4YK4B 3MA9L 3W0WB 3TU6A 1RU9H 3BW9B 4WFEE 1F0LA 1P7QA 2R56H 2FX7L 5M95B 4BUGA 1H3XA 1D6VH 1YMHA 4HLZH 4J3SA 1R46A 3QNXA 5IT2L 4FFTA 3O2DL 3PL6C 1RZKH 2WBKA 1E42A 1QSFD 2A7BA 2BX5A 2DQIH 2IQ9H 3MRKA 4FQ1L 4OCYH 4DP2X 3U2SB 4QDGA 25C8L 2MCG1 3PPSA 4XC1H 4P2OB 2ERJC 1A64A 4JB9L 4ZO8A 4JHAL 3P0GB 3NRQA 2WSDA 2MCPH 4DCQB 3FO9B 1MCWW 4ZMWA 3FH7A 4S1DC 2X4SB 3FO0L 3L1OL 4QRRE 5ECGA 1S7TB 2R7EA 1PGRB 3CDFA 1E4KA 1KT2A 2GUYA 2CJUL 2MJWA 2BIMA 5GRJH 5GZOD 2BO0A 4HD5A 4X6BA 4Q89A 1MFBH 1WZAA 4HZLB 1OK8A 4K3EL 4LVOB 2XOTA 3UTPE 3HKFA 4H5SA 3RFZB 2YSSB 1KYOJ 1JPEA 3V4PH 1DN0A 1JE6A 4M7ZB 5HYJD 2JKIS 2PO6A 4FMVA 2C1PB 5HHMB 4GXVL 1FZJA 4OLZL 1Z3GL 1YY9D 4ZFOB 2UX7A 4BDVA 5L9DH 2OMXA 4RGND 1HCVA 4PJCB 2EXTA 3OKMB 3QUHA 2J73A 2XV6B 3D51A 4RBPK 3LH8A 1ZANH 3QR2A 1NMBL 3CHQA 4LSVH 5F3BB 4MQXD 3BFQG 4IKLA 1ZDQA 2PTVA 4EMZA 1EHLL 3FRPG 3U46A 4HIEA 4NZUH 4Z76A 2ZAIA 3VH8G 2ZE0A 1SMOA 3H54A 1JYWA 4UTAA 4Z7WA 5DI8B 3KLDA 2D3JA 4POUB 1HHHA 1QQDB 3CJJA 4FXKA 3R7RA 2FWUA 2Z64C 1Z9SB 3DHJA 3ZE1B 2WUCH 3DYPA 3ZKXC 1IBHA 2D3NA 1QRNA 4EZMA 4RMUA 5DO2C 1TQVA 4XN9A 1MF2L 2AJSL 3BAEH 4PB9H 1A6UL 3CPLB 4OJFH 3EOYG 4XPTH 3ARPA 4F8OA 5LQBH 3QUML 1Z9PA 3B37A 3QCUL 4JPKH 5FHAL 3REVA 4HUKB 2J56A 4OIIL 2L8AA 3OZ9L 3UMTA 4KZDH 3M45A 1E5UI 2EDXA 1PZ5A 4KTGA 1A1NB 2YUXA 3BKJL 1CL7H 1EFQA 2CIIA 3FFDA 3PGFL 3QIBC 4V2CB 5F70A 5D1ZB 4ZD3L 2HT2C 2ZUVA 3EDKA 1HWWA 1MELA 2DQEL 5FM4A 1EZSA 3TS8A 2UUDK 3SBPA 3MV8E 3B83A 3MV9B 2RGSA 3L5HA 1GOFA 3OHXC 4OM0L 3BN9C 4CVZB 5E5MB 1X5ZA 4NQXB 4PY8I 4WUUA 5CLWA 4ONFL 4Q8BA 1CD0A 1F56A 3ZE2E 1ZSDB 2FJHA 1E43A 2I5YL 1DQTA 2D2OA 2CHXA 2K8QA 3PWVB 2Z4QA 1OGAD 4K5MA 3CFMA 4ENEC 5CZXC 2WLLA 5C07E 2C9VA 2GTWA 2C7UA 5B1JA 3HFFA 4PJAF 15C8H 5ABAA 1KENL 2J6EA 3T6ZA 3RL2B 5CILL 4HS6B 4DQOH 3R0NA 4PJXA 3CTTA 1GAFL 1FYTD 5DMKA 5TH2A 1MHHA 3NFSL 1G6RB 1TZGH 4KTEL 2ZPKL 3NIGB 1XR8B 5IB4B 1IJ9A 1BG9A 3VFUA 1H3UA 4KXZH 4UT9H 1KEGL 4GRLB 3QWRA 3NJFA 3WLBB 1KTLB 4MXVE 4MA8L 3N1GC 5DDHB 1KCRH 1FBIL 3K1KC 3QI9C 3RTLA 4M7LH 4BFKA 2OKMA 3D0AA 1KJ2A 5TDOA 5BZXA 2VLRA 5HDWA 1U93A 5K9OB 4IDJH 4NQDE 3EBGA 4XO3A 3IPBA 3F58L 4XPGH 3S7GA 1JV2A 1CE1H 2K1MA 1TQBB 4Z0BL 4CNIA 2CCLA 3H9HA 3LYRA 4JZNA 4AWJC 2P5PA 3HZ3A 4G9DB 2ZSVA 3EYQD 3ARGA 1BREA 4ALAC 2DJMA 4OQTL 1A6ZA 4N85A 1S5HB 5E1QA 4O58H 4X7FC 1N0XH 1JZDC 1JOIA 2KZWA 3UJTL 2B5IC 1QSZA 1KB9K 1ACZA 1VCBC 2M1KA 1JXDA 3LJ3A 3QEHA 3QO0B 5BPPA 4EN3B 1CLOH 3Q44A 1UWYA 2BVPA 3HEIB 4LEEA 2DM2A 4HKBA 4I77L 4XP6L 5AW8B 3HRZB 3RTQC 4RAUB 4A7GF 1BZ7B 1AS8A 4JQVC 5I18L 2J55A 3MUJA 3IAPA 2BNQE 4MJHA 3V5DB 4M43H 1YMMA 3DX7A 3L4VA 2PWDA 3QFGA 1YN6A 3T6WA 3C8DA 4XC3L 2YGPA 1XH3B 1TUPA 1KIQB 2RB8A 4Q0XH 5DA0B 5C0CE 5D1QC 4E9WA 4JFFA 5MENE 1IKFL 4DPBX 3NK3A 1WYJA 2ZUYA 5CP3H 4H0IA 3EF4A 1CT8B 4FYQA 5T1KD 3VE0B 1CN4A 3C5ZB 4B53A 2L7QA 4BKTC 4JQIH 2YD1A 3EDDA 5SWZD 3NA9H 1UWFA 2FH8A 1ORSB 2YPLA 1I3RB 1ZJAA 2HFFA 5KVEH 1NCGA 3JWOH 2R8SH 4N8CL 4I85A 4LEOA 1YSOA 3GC3A 3P4MA 4LU5H 5C3TA 4IMLB 4YXKL 4NUPA 5FGRA 2IPKB 5E9NA 2X0UA 3KM2A 4IRJB 4YDLC 4ZX3A 3BGMB 4EIUA 3K4AA 1FLTX 5DHYB 3FU8A 2Q8BL 5FHBH 1NQBA 4QCIA 4LLWB 5E8EA 5A6MA 2IEPA 4PJ8D 4E5XB 3TEUA 1DVQA 2F54E 5F1NB 1NC2A 3TO4A 2CG9X 2UXVA 3GMQA 5DVNA 3LIUA 2Y7QB 1H8SA 5HHQA 4B5ZA 4Y4HC 3RNQA 3TWCL 3WI9A 3GMPB 3OGCB 4Z0XA 2QLYA 4ZUWA 2IGFH 5I66A 3QNYA 5C0JB 3DX6A 2MQCA 3V52H 2EE9A 1RK0A 1AHMA 3SPCA 2R23A 1RP9A 2CDGB 2GUOA 1XAKA 1DUYB 1EDYA 2DF3A 4FERA 5DGRA 3UPCA 4MB4A 5JIPA 1OTUC 1K8DA 4JANB 5J13C 3OAUL 5JZ7D 5T1JA 2VDNL 1RIHH 2EZ0D 5ALCL 1HK6A 4JKWA 2E0PA 4CADB 2C4XA 3MLRH 4ZUTB 1G7PB 2OR9H 4Q6IB 3L4YA 1AR1B 3LV3B 1LEIA 2JQAA 4MCZA 3EYUL 2R1XB 4AIEA 2IC2A 2XTSA 1PKQA 1J0YA 1E6OL 2K0RA 2WLJA 1VFBB 1TF4A 1T5WA 2E6PA 3II2A 3ULAB 4IRSA 1OY3B 3BP5B 3MLYL 4KK9C 2WZ0A 3DO3A 2CM5A 3DUHA 5D1XC 2CUIA 1A6WH 1ORQA 3WBDA 4IHBA 3DTUB 5E2UH 3OM3B 4KAQH 1CZ8H 1T0NB 3ZTDC 2F7OA 1BMGA 3EFDL 2VMEA 4DTGL 2WXLA 5A6LA 2D0HA 2GAZB 1HHIA 1BX2A 1SDAB 1ZA3B 4QXTB 5DJ0B 4GKSA 4FI8A 4UAHA 2IG2L 3UZEC 4UOW1 1PY0A 5JR1L 3L5WB 4EUPB 5JPMB 2VXSH 2X28A 3VFWB 3VXMB 5BZWB 2R29L 2ZOLB 1S7RB 3WAKA 1E4XL 4BKLA 3A67H 3F2LA 3HCVB 3LVTA 4CUCA 1JNHB 3VQLA 1KXQE 2ZX9A 4K55A 4Y1AD 4XNMA 3W39A 3GBEA 3CFTA 7CGTA 3MA7B 3OPZL 4HUNB 1LILA 4HP5A 2QEJA 4ODUB 4JX0A 2NMSA 2HN7B 4K8RL 4M3KB 5CLXA 2OMYB 1FFOA 2FSEA 1A4BA 3S3CB 2YAOA 3T4YB 1M7IB 4RRPG 3SE6A 3BFOA 1NBVL 1QTYT 1CQYA 2OCJA 3WUWB 1SVZA 3QQDB 1JPGB 3QFJE 4DGYL 2FEJA 5EU5B 1BP3B 1UWXH 3FQYA 3BKCH 1JN6A 2OSWA 2H4EA 1QLFA 4X9HA 1XCTB 4A2MA 1D6EB 3LMJL 5B21A 1LO4L 5HYEA 3ESMA 3LN4B 5DZPA 5FDYA 5FYKE 4ONGL 1CFTB 3T3MB 4M03A 2CHDA 4YDVA 2CH8A 4GAFB 4PJ5A 3DVGA 2JCCF 3B4NA 3JUYA 3G7TA 3BD5A 4MYPA 3V7AG 3KYMB 4A7UA 3GSUB 4GUCA 3W81A 3VFGL 4B0MB 4DGUA 3IFPB 4CSTA 4O9HH 5E8NA 3ARDB 1XVSA 2WZ6A 1NDMA 2VLLA 3UIZA 4KKRA 2Q2LA 1A1OB 4NN6B 1TTAA 5LAXA 4EO5A 1MCQA 4XCNB 3RDTB 5IBLD 2I85A 2KLRA 2OK0H 1MCLA 3GSXA 5I75C 1OB0A 3CGTA 4MX7A 2OMWA 3MPCA 1LP9B 4IM8A 1Z9NA 2XETA 5EBMA 1U2YA 2A74A 1QSFB 3UIYA 1RFDH 1IUZA 3QWQB 4PJ9D 3S5ZA 5DUPL 1P4BH 4Y16A 4DUVA 4FLOA 1MG2C 4R2GD 2HVJA 3QC5X 1G43A 4HVBA 1UJTA 4CRPA 4AENB 2RQ8A 4ODWA 3JTTA 1IAIL 2NZ9C 4WJ5A 1NUFA 1SN2A 3UTZB 4X6DF 4OT1L 2FX8L 1KPUB 4DKAA 3MRLB 2YD2A 4ODSH 4LSUH 5D7IF 4D0CB 4W9KC 4KI5D 2P80A 5FECB 3T3PE 4QHKI 5INDA 2BVYA 3NG5A 2ESVD 2I60H 4GQ9H 1JXJA 5IROD 2W94A 1AIFB 1UYWL 4OLWL 1I9RH 2PCYA 1N4XL 2DLEA 3L3GA 5I8EA 3IDGA 2OP4L 1Z9MA 1ZT1B 4XVUC 3KDPB 3ZYJA 4P4RA 4A7SA 2PW1B 5IEHB 3N9GH 5DQJB 1MDTA 2Q3AA 3QC6X 4FQHA 3IM1A 4WO4A 1FO0L 4RGNB 4G9FD 1AQKH 5KUMA 3WENA 4HCRH 4UMSA 4F57L 1AQHA 2GT9B 2TRHA 3LQMA 4YK4C 4OV5B 3SYAA 1N10A 3N50A 4EBQL 3BAIA 3RBGA 1L9SA 1BD2D 4ZW7A 1OTTC 5AL0A 3HOGA 3KPRE 3GSOA 2YS4A 1XIWC 4XZUB 4F8LA 2CNYA 3TVMB 4XTRC 4Z95L 1V54B 4IBQA 2EXWC 1AZBA 3NSJA 3R06A 1LDPL 1X5LA 4NUGH 4LPTA 1TJIL 3H2QA 4TLUA 4MKMA 3NPSB 4J3OH 4P2OC 1AZNA 1CGSH 2B14A 4I9XA 4PRAA 4QRTA 1U8NB 2X4TB 3CAFA 4TUUA 5KYYB 5EF2A 2LW3A 3ZQXA 4YVNA 1HSBA 4K94C 3NFNB 3EO1A 1Y6KR 1QVOB 2X7LB 1QKZH 3T4AA 3ZGHA 5GJTL 4JKKA 1H3GA 3QJFB 5C0RL 1FYTE 3O6KL 1WT5C 4IBYA 2O6FA 1ANUA 1S7VA 4S0SD 4LVOC 1D5ZA 3RFZC 2VAJA 3AM8C 4FCAA 2EECA 4U3SA 4M7ZC 3KWWB 4TVUA 3GSNB 4YLQT 1XZWA 4ES9A 4HAGA 2A83A 1C16B 3DUSA 3GXNA 3IFOA 2VC2H 2RFXB 2MTPA 5CINH 3V4VH 3MOBH 5HDBE 3ATBA 1GW0A 3MJ8A 4MVBD 4NC2B 1T0MA 3BWAB 1OGAB 4L29B 3O45A 3C6SB 3FONA 5CGYD 3WNKA 2XFGB 1EHXA 1E6JH 2WKLA 4PGDA 1N6QL 3KYNB 3CVBA 1KXHA 1PW3A 3Q43A 4NKDA 2YWZA 1DSFL 3HNVH 1E30A 4MQSB 1U33A 4N1HB 2IAMD 1TVDA 2GSGA 1VERA 4LLAA 1OCWH 1G7IB 3NYKA 2ID5A 2DMKA 3VCLB 1RP8A 3HS9A 3RVUD 4HGWB 2PR4H 3GSQB 4JZJA 3TBVB 2IPTH 1I8KA 3VG0L 5C0AE 3U2JA 1G9MH 2XPYA 5KW9L 3FTZA 3G5XA 2DI7A 2UWEA 3BDXA 3ILEA 2CMRL 3H8NA 3FUFA 2QSCH 4PJEA 5D1ZC 1XF2B 2FHCA 5IB5B 4AQ8A 2HP4A 1BQHG 4UIMB 2XN2A 4QKTA 4ANXA 4ISVB 2M2DA 3AW5A 3GO1L 4WFHE 5KSAA 5J6SA 3D18A 4FTVD 3FB5A 3RP1A 1T3FA 3QO1A 5BNXD 1PZDA 3FO2A 5JIIA 5FLUA 3LQAL 1OF0A 3QYMA 2H7WA 5SWZE 2BNRB 4KBPA 5FYKH 4XRCB 4LPWA 3OLEA 5T1LD 2FE0A 4Z7WF 3IFNH 4K07A 3MU3A 4NUMA 4MD4A 3VACA 2R0LL 1FFNB 2GK0A 2CALA 4TQ8A 3RKDC 4YGVB 3DJZA 1C12B 2OTPA 43C9A 1QW8A 5HHNA 4AYFA 1AMXA 2CXKA 4O4YH 1Q94B 1MJUL 4YR6B 1KELL 5ANME 1RKRA 4YVUA 3WFZA 4BFIB 4Z3GA 2XQBL 4GRLC 4ZW3A 3ARUA 2CKNA 3P3YA 1N5YL 4LT7A 1F4XH 4Q14A 4XMXA 4QT5B 4K9JA 3JWNE 5BXFA 2OXGA 3BDYL 2B1HH 2NZ1A 4PRPB 4NZDA 3VRLF 4Q52A 3VI3A 1E5AA 3B2MA 3MLUL 4P59L 3MV7B 1YYLL 3DIDA 4GLRI 4QEGA 1JF6A 1U8LA 4I1PA 2XWDA 3FRUB 5ESAA 2COQA 4NXKA 1TQBC 2E75C 3BZEA 1RJYB 2QTVA 1JFQL 3HLAA 2Y7LA 4HF5L 1PEWA 1X44A 1M71B 2VKWA 5C2BH 3TNNB 4L3ED 2BY3A 3LD8B 2CA3A 1XMWA 5CM1A 3T8VA 4TVPL 2AEPH 1XGUB 3B3IB 1MLCA 3OR7B 4PJ8B 4ODHL 3KNBB 3S5LA 2WVTA 4Y9FA 2ADIB 1JGEA 1FZOB 3KE0A 4HXAH 4EN3C 3S0PA 4UV4L 3MNVB 4F3FB 2YRPA 4U05A 1T04B 3HRZC 5DJ8B 1VPOH 2P47B 4F9PA 1HSAB 3RZCA 2RBLA 1CPUA 3MREB 1SJEB 1IEAB 5F1KC 1IAII 4U1HB 5EIIA 1O7SA 5GRVK 2D7QA 4PJ7E 3RA7H 3UAJA 1IC5H 4JRXE 2G2PA 2NX5D 1ZLEA 1HWHB 3FB6A 3T0EE 3CN0A 4LL9A 3PJLA 1I8UA 5IB3B 1B9ZA 4YHIB 4E9VA 4NCC2 1B6UA 2H3NB 1KY6A 3GBMH 1A3LL 1B2YA 4G42B 4YBLB 4YDZA 3C5ZC 4L4VD 4F5CE 2QKIB 2QZ5A 2GI7A 1MCOH 4KK8C 4G8IA 4U2YA 2D7OA 5DVMA 2LFGA 5KS9A 4CW1A 4Y9EA 4K7PY 1PPIA 2QPDB 3P9LA 3NSCA 3VXOA 3N43B 5L2KA 1CUOA 1R5WA 3L9RA 5E1AB 1T4KB 4IRJC 4NWUL 3OKKA 5DUJA 1CIUA 5KJRH 3O2WH 4M29A 1M57B 2AK1L 1SQMA 5AAMA 2WTPA 2H6PB 4N0RA 5LLIC 3IRZA 2DYRB 1ZLUH 1Y1UA 2AANA 3QEQA 5JO5B 3QUMB 4KGJA 4R96B 3QRFM 3MBEB 5EPMB 1M9SA 4F33B 4PSPA 3IKCB 1YEFL 1FORL 1TQSA 1T5XB 2ZZUT 3IPEA 5AZ2H 4EDWH 2DWTA 1IO4C 3MROB 5DMIH 5F1OB 3BO8B 4F58L 1IKNC 1QWUA 3TJHD 5CBEA 3E8UH 1MEXL 4GRMA 5T3ZL 3X14A 2CDFB 3IK2A 4W6YB 4Y1AB 4XP1H 3B5GA 4FQXB 5E94B 1MJJB 4KKBC 5C08D 3PWNA 1LLAA 3UC0H 4WWOA 3WL9B 1F00I 2E6QA 3FQNB 1VGEL 3O6LL 1JWSA 1W91A 4OBSA 4P46B 4YGAB 5E03A 4Q6IC 2MQGA 1AR1C 1MFAH 3U48A 1HHGA 1AZVA 1P4UA 1DVFD 4ZUSB 5ITFB 5DFVC 1QFWM 5LB1A 4G80B 2EH8L 3SPGA 4YDIL 1MAJA 2XYCA 3PV7A 3O6FD 5SWQA 4JFPB 4HKZA 4X98A 2APVA 4TNEA 3GRWL 4L37B 5T5FA 4KJYB 2PTTB 3UXFA 3NJGA 2HZHA 3Q6FB 1I7TB 4X0KA 1D5XB 1FGNL 4XOAA 2V2WB 3CFJB 1CF8H 3PJSA 3U30B 3UAAA 5DMYA 4JJOA 2IWFA 1B2WH 5EU3B 1CICC 4KKCC 1GS6X 4JM0A 1ZV2A 4ELMA 4YUEL 5SWSE 3Q2VA 4NO5A 1IMHC 4WCYL 3KPMA 5CMAA 1S8DB 2E4TA 1Q0XH 2WJ5A 4UT7L 5DHVA 5DS1A 5KVMC 4ODXA 3BVUA 1CLZL 5JPMC 4LBEA 4LCWD 4AMKL 3GBLA 4AJ0A 3KBFA 3HNSH 3ZKNC 5K39B 4R6UA 2DTML 2RIKA 4CU8A 1RLBA 2XHNA 1NKRA 1P7KB 5KYWA 4NOBA 3FHEA 5ECJE 3JT0A 4WENB 3GIVB 3D25A 5DLLA 4NQTA 5JTWA 1GYCA 3ZL4L 1QFUL 4OSUH 4XP9L 4AV0A 3SD5A 3KLAA 1KLGA 1ZVNA 4PJ9B 4R7DA 4LCVA 1BM3L 2IXQA 1VADB 3NCXA 1WP6A 2FJFA 1M1SA 1DE4A 1XCXA 1KPRA 1V7NH 1ZHLA 1PU0A 4G9FE 5AENA 4WW1B 2AKRA 4NQSA 2P24B 5D2LE 2ENQA 3G6JA 1O9ZA 3M1OA 1A8ZA 1NFDA 3IU4L 1XF3B 3NJHA 1BD2E 1EHAA 4JHWH 2PP7A 5IEKA 1YY8B 5B1AB 5ID0A 3P0YH 5IW3A 1CO1A 2VLKA 1LO0L 3RUGE 1F11B 3EJYD 3C5XA 2VDPL 2ESVB 2KPNA 2W9LA 1OCCB 2J57A 3JWNH 4NNXB 1A4JB 4DHLA 4H1LG 4NGHH 3QULB 4NPYB 4NOFA 1ZD6A 3NJXA 2VZVA 3QJHB 2K7PA 4P57B 2FATH 3PP3H 4DPRA 3ARDC 3DC0A 1OAQL 2NSQA 2Y1AA 3FXIC 4WFFD 1VEPA 2P5WD 5I6KA 1BZ9B 4P48A 4NN6C 3TH2T 1MHPL 1RI8A 3RDTC 4IRZL 1EBPA 1YUKB 4P3CH 3A6BL 2P49B 1AFVL 4PJBB 3QDGD 3RWJA 4ERSH 2EDYA 4J6RL 4XXDA 5IOPA 4TVPD 1JPST 5CJBA 3SB3A 3D0VB 4U1NA 3VXSD 1JI1A 5L88H 1AGBB 3IJHA 1KWGA 4LEBA 4B9YA 8PAZA 1Q9KB 4JN2A 4TNWF 4BRJA 2DM7A 2Q8AH 1IZKA 2FYYA 3SKJH 1NL0L 4ICXA 3WG7B 2F1AA 2Z31A 4H40A 2CHWA 2ZF8A 4WAFA 4FA6A 1VKXA 1KZYA 2D31B 2WNWA 4ORGB 2Y72A 3QJTB 5DRXB 5IMKB 5MEPA 3KLSA 3H3PH 5ALBL 2P8LA 1N59B 4K23H 1DUZA 2QQNH 4CVWA 1U91B 1DQJB 3QIWA 2VDNB 3QDMB 5GZOC 2FNWA 1S3KL 2XFXA 3WOVA 3ZRCC 1GRWA 2ICWJ 4Z3TA 1UTDA 1OE2A 1F6AA 4A04A 2CO6A 1HN1A 4A2EA 5BRZE 3LB6D 1TFHA 2JQMA 2D4DA 5T1MA 4MAYD 1HXKA 2DS4A 4E42A 3D87B 2F58H 1YY9C 4FQQB 5I30L 2H1PH 3P9WB 4RGNC 3FQ1A 4FZEL 5KUKA 1AE6H 3VD0A 4M1DH 5LBSH 3CIAA 1W72B 3D2UA 1V8HA 1RH8A 1NGYA 2BVQA 2WB7A 4JO1L 4YN3A 4NKQB 1I8MA 4LHUG 3UTTA 2CBOA 1C8QA 4MQXC 2Z92A 5EWIH 1QATA 4HZLA 3GXDA 1Q72H 4MLSA 4X4ME 3VDCA 3WD5L 1J1OL 4AJYV 1NUDA 4XPHH 4MWFB 3CMGA 1UM5L 1DL7H 2AV7A 4ABQA 4WIQA 5F1SA 5JNYB 2IAMB 1SDDB 4H7VA 1AS6A 3BWZA 4ILDA 1A5FL 2YK1H 4DJMA 4KVPA 4TLTA 4F7TA 3RGVD 1L5GB 3QUXA 5EDXA 1XMEB 2CR3A 2WMPB 3BRDA 5T3ZD 1XSIA 4PS3A 4L8CA 2IDTA 2Q76B 3QR0A 3BRFA 2VITA 3FT2B 3OAYH 2DEWX 5LAPA 2OZ4H 1NEUA 2ORBL 1J8HD 5IR1B 4HQQH 1SBSH 1KY7A 1Z9SA 3BP6A 4JMNA 3RY6C 2VM9A 4DZ8A 5EU7E 3OLDA 4B7LA 2CKBA 2EKSB 3WKNA 3L48A 4NJ9H 3FU7A 2NW2A 3WNNA 4PGEB 4RQQB 5L2JA 5J6GB 1IC4L 1H19A 3B2DC 3D4YA 5T1LB 2R1YB 2H32H 4U6XA 4FG4A 4XWGL 2R0KH 5IJVB 3EFOB 3AREA 1F8TH 1T22B 5EU4A 3W2DL 1M56B 1MVUA 2BOBA 1JCKA 3BP7B 3GUFA 4GRWE 4NSKB 4KMQA 5AL8A 2Q7YA 3CSYB 3UDWA 1K5NB 3HE6B 2FQEA 2WP3T 1P84K 1L7TL 4KY2A 5D8JH 1U8JA 1I4FA 4JDVB 3ECUA 5I18H 2VDKL 3VFPA 4UANA 3IMVA 1Q0YL 2F5AL 3QJQB 4HH9A 5CZRA 3RG1C 2YQ2A 1V27A 4ZK8A 1I3VA 1NWPA 1H0DB 4OZGE 3P02A 4OCWL 4UM8A 4YE4L 4G72B 1JS4A 5FUOL 3ALPA 3KWXA 1IKFH 2AVGA 3HN8A 4FADA 4A2GA 1LO5B 4DH2A 3BAYA 4D8PA 2A73B 3SKMA 5BO1H 3Q9QA 4HPYH 2OJZH 1XFPA 5IWLC 4NKIL 4HS6A 1RUQL 4TNVK 3QXDB 1KG0B 3TYGL 4L05A 2P28B 4UOQA 3MRMA 3Q6GL 1O9WA 2NX5E 3HHMA 4ODTL 3UTSE 3L8QA 2BM3A 2N4IA 1PL3A 3GJFB 5F8RC 3D48R 1MCCA 2NTFA 4FQ2H 2WN2A 3BLPX 3TPUB 1SHWA 4WTQA 4HEPA 3D39A 1SLVA 2K8MA 5C3IA 2VLJD 4L4VE 3ZXAC 3D30A 1IQDB 1KB5B 3PS6A 4N26A 1MWOA 4XBPB 3CQQA 1CGXA 1P5UB 2AEQH 1JHLL 3LNDA 1WVZA 2BFVH 2XPZA 2ATPB 2EP6A 3G5ZB 1JNLH 2X4QA 3HBGA 1JUFB 2AS5M 4MDIB 3KVQA 1CTOA 3T65B 4JY4A 4BCZA 1T66D 1DBJH 3FNKA 3QNZB 4RZCA 2GK2A 1R3HA 1X5GA 3G6AB 5GS0H 3QB7C 1CK0L 4X9YA 1FO0B 4UDUA 1QNZL 2ZCKL 2J2ZA 5I1DB 4YSAA 4DO5A 2HWZH 3ZZLA 1LEGB 2BMKA 2F0CA 3IS0X 3P4OB 4RAUA 5CHNB 1I7UB 4HJ1A 1OTSD 4JL1A 5AB0A 1QI5A 2YWYA 3REWA 3LPPA 2XVKA 1SEQL 3A6OA 4NQCA 1KYOK 3WS3A 4UILL 5DSCA 5LWYL 4S1QL 1MVFA 1FE8L 1SN0A 4ZUUB 1DFBL 4XB7A 4P3WA 4O2EA 4KXBA 4PJ8C 3E1F1 1HINL 3V4PB 1XB6A 4WUUE 4ZMOA 2GEQA 3NIDF 1JPFA 2C1OA 2P1YA 2VOTA 3F7PC 5EUOB 4OZFH 2J5LB 4YDKL 3WIAA 4APXA 5KJ7E 35C8H 4Y19E 4LZKA 4NHCL 3PAZA 1TZHA 3KEDA 2BCMA 4ZXBD 5A16B 2A3TA 1NCBH 2NY3D 5MEQB 4HWZB 3NFPA 3BPCA 3MO1B 3IGAA 5LHDA 1EIBA 1RZ7L 1KCUH 4DW2L 5F96H 2Y2TA 2BHFA 4M4PA 5D2NB 5J8OA 1CGVA 2C3HA 4JFDD 4HWEL 2FIRT 2R29H 1IT9H 2HT3D 3CVHH 4X8JB 5C08B 1MHEA 4JM2A 1E28A 4MA7H 1W0WB 3EGDA 1C5DB 1GC1L 3RWGA 5JZ7C 5F1NA 4W9FC 4PV9B 4G43A 1SBBA 1SYSB 5BOPA 3ARBB 5IW1A 2R0WH 1DVFB 4LLDB 4K5OA 4I9WD 3WKMH 4YBLC 3WFBL 4C58B 2ALAA 5MEOB 1WBXA 1YNTB 2QKIC 1QX1A 3C5JB 4AQ1A 4OFKA 3RWEB 1I9IL 1U6AH 5IKCB 3FT0A 4XE5B 4YEFA 5ITBL 4U1LB 1DUYA 4AL8C 4N5UA 2FO1A 4TQIA 3B7YA 2NY7L 4IKNA 5BCAA 2Z93A 5LGKA 4B96A 3RVWD 3NJIA 5IF0A 1T21A 1XF4A 4IBTA 2C3GA 2AAVA 4FYSA 3LV3A 5E8PA 1GGYA 1LMIA 1OK0A 3MBEC 1ZJBA 3VXUD 4Q74A 5IVXF 3O3BA 3HFMH 4GLRH 1URIA 4JPIB 3VFGH 3NJVA 1XB8A 1Y18A 4LCWB 3VXQA 5CP7A 4ZPTA 3W11D 3HMXL 3OX8A 3KWUA 3BAKA 1PQZA 4PJGF 2EDNA 2AZAA 4Y1TA 4X8XA 5H2BA 4AGPA 2EIDA 1MIMH 4N0YH 4Z3IA 1AKPA 3UL4A 2EE0A 3SOBL 3T77A 3B6SA 5FGSA 5ENWB 3EOTL 1SJVA 3OR6A 4M93C 1IAMA 3MRDB 3SPHA 3ZTCC 4P46C 4W9GC 3S9DB 5D4QA 5E9DE 1HZKA 4I2XB 4WI8A 2JI3A 3O41A 2L0DA 4BXVA 1F13A 3TH3T 4GSDH 4JG0L 4TQEL 3IGKA 3FRPB 3H9SA 4IGBA 5D70L 3TBCA 2A77L 3MJ9H 1RZIA 4XX5A 5E99H 2CGYA 3VH8B 4WY7H 4KO9A 3QG6B 3H2WA 3QDGE 1FLRL 3PAVA 2OR7A 1M7DB 1UD6A 1BQKA 4S1SL 4O2FA 2AFNA 3ML9A 4FKEA 3D69B 4ZX6A 4P5RA 1WJ3A 4NNPL 3N40F 4HIHB 2LTQB 5LN8A 3U30C 5FO9A 2VZOA 5A2LH 3VFNB 1J86A 5IV2B 1TJHL 2NYZA 1UVQB 1UYWH 1A14H 2X6UA 1SRDA 3SDXA 3TBTA 3JV4B 3TP4A 3DO7B 3T0WA 3CFKB 4HZ1A 1NJ9B 2B15A 2JI1A 2XRAL 4G70B 2P5WB 3MMEB 5IK3B 4J8RA 3HN5A 4AK1A 2MNUA 4DGWC 5JYLA 2A6JA 2YPVA 5IBLC 1GL4B 3JT2A 5E2WH 5CGTA 3P11H 3PDGA 4HC1A 3M88A 1K3IA 1I9JL 3A4EA 2PXYA 3L3IA 4PRBA 4G8FB 3U1PA 1BIIA 1K4CB 3VXSB 3ECBB 5HGDB 1OANA 2O4EA 2NSXA 3EYVB 3VGGA 4PJ9C 5I15L 2BY1A 4YIQB 4O02H 4LOEA 2ISDA 2V7NA 2HJKB 3L9YA 4G6KL 4R2GC 4DZBA 3EOBA 4AOFA 4A67A 4EI6B 4C56A 1BQRA 1JNJA 1E65A 3V95A 4UTAH 3P73B 1PLGL 2WAHA 5JQ6L 4CA4A 4HX1B 2PWEA 3QCVL 2W9DL 3IF1A 2EE6A 1S46A 2BK8A 4KI5C 5ID1A 1MFDH 4IS6A 1ZAGA 2AJUH 3HAEA 2JKWA 4H20L 5IROC 5EV7A 4ZJ9A 3B2XA 3AXLA 4PVBA 1GVIA 3PP4L 1R24A 3VFVB 2AERT 4Y89A 1U9KA 4RISH 2CDEB 4HUVB 5C7ZA 3T2NL 4MAYB 3CXDL 1GA2A 3TV3L 4JR9H 1NUNB 4M56A 3ATDA 3UC2A 5DK3A 1EEUA 3D08A 3AG3B 2OSLB 3TJEL 2PP8A 5AOMA 1HCYA 3MV11 5I5JA 3VTTA 1DHKA 2WY3B 3HI6L 3C75A 5CFHA 5I0ZA 3W9DB 4DKFH 5IMMA 3BT2H 2VN7A 5I0DA 5GGUA 1KJVA 3FHQA 3P77B 1CFSA 1A4AA 4OF3A 1J8HE 1YNKL 4LAQH 4TRPH 5SX5K 4HJEA 1JXGA 5DYOA 1NCUA 4RBPH 4IK6A 1WH0A 4PJFB 4GXUM 2YUZA 4LCCA 1FL5B 2EYTB 1W8OA 1XD0A 1PG7L 2HLEB 1NFDF 3CDZB 3T0VA 3QZNA 2E86A 2J4WH 4WUKL 3Q06A 2ZJSH 1PFCA 2R2EB 3I2CH 4AW4A 4Q97A 1UB6B 4CU7A 3DXAE 5CS7A 3RGVB 1UA6H 2O6PA 2VDOH 5D9SB 5JYMA 2XICA 4OFDA 2FO4A 3LXAA 4H8WC 1I1AD 3IJEA 1F3JA 2N59A 2X3BA 3MJ7A 1WS7A 3WIHH 5C0FB 1KNOB 2OM5A 1X9RA 4GJTB 4XBEL 3L2NA 1DQQA 2WM0A 2HTLD 2JKSA 2UV3A 4HV8A 5EIVA 4CMHB 4OLYH 1Q1PA 2FSDA 3F64A 3QORA 1YPZE 5IBTH 1YYML 4W9EC 2I7SA 2X44D 5K1VA 4AY0A 3WO4B 1AANA 3ILQD 4U49A 2UUDH 2HG5B 4FC3E 5FUZH 1U8KA 1T1YB 4WI0A 2FT7A 1I1YB 3BHBB 1MCFA 4MVBC 2MNJB 1U8PA 1IAKA 2G60L 1OSPL 4O51A 2HLAB 5F89A 1JGIA 2WTRA 1EHNA 5CGYC 2NNAB 3B2PA 4FJ6A 4B97A 4H8QA 2H8PB 4DP0X 1KB3A 1Y07A 4NO2A 1ADQA 3OKOB 4R0LA 3FU0A 1JTTA 3N1MC 5DUMH 3BSGA 3VFTB 1WHOA 2XN9D 3WTXA 5I1CH 4N0FA 1E7UA 5AVTB 5CUSH 1KLUA 3ZE2B 2A5UA 2YZ8A 3HG1D 2IAMC 2IVFC 1RIUL 3MRNB 5CCGE 3LDBC 4HWBA 2NY2B 3TZVD 4K7PL 4MJIB 4UQ3B 4Q9QH 5E8OB 3EO0B 3PU7A 3WJJC 4YHOH 3RVUC 3OGOE 3SYPA 2QHRL 3Q8CA 2OL3H 3FU5A 3PHAA 2V33A 3QXVA 4MAUH 4QRSA 3UBXI 4TUKL 3X3GL 2NR6D 3FPYA 5TE7L 3PG2A 3TEZA 3GS0A 4K8RC 1CMOA 2ZKWA 3L2MA 1LD9A 3OBAA 1PZCA 4R9HA 4TSCH 3PXHA 2B1AH 3ZMNA 1CXFA 2Y07L 4X6EA 1B88A 3RWIA 2EC9T 1KJ3H 4JEGB 3IGLA 2VLJB 4MNHB 3BUTA 4HPHA 1MJ7H 4IHOB 1LGVA 4GMSH 1U8CB 4OZHE 5DD5L 4MNGA 4X42A 2UZYB 4N2AA 4BUQA 3SGJC 1VZGA 1BBJA 2LU4A 3TLRA 1BM7A 2VDPB 1JK8A 4QKXB 5TE4L 4EE2A 4QNPE 1MAML 1KBPA 3HBQA 1QLEL 1W2KT 1TR7A 4G7SB 1HOCB 3HE6C 3LZQA 3ULUC 1MCBA 4PJCF 5EOQL 4YQXL 1F90H 4GMTL 3H56A 3KPSE 2D73A 3OB0K 3GB7A 1MKFA 2VQUA 4MMXA 2QGBA 2XV2A 3SKNA 4G8EA 5ISZB 4NJAH 1WC7B 4S2SB 1J18A 4X4YA 4P49A 4DFHA 4FEIA 1JFHA 3WN5A 4W9DC 2W60B 5EBWB 3ZE1F 2AQNA 1H9VA 3IDXL 5GS0L 2ZCZA 4GSQA 4PP2B 4YXLH 5EN3A 4LP4A 3WEBA 3ZO9A 1AD9A 4G8AC 1SY6L 1TJGH 2NY5C 1YEIH 2VW7A 4PVNA 3LNEA 2OMNA 4YHMH 5DCCA 2WANA 4P5TA 2VSMB 4YR6A 4G11A 3MJWA 4B3EA 4BSWB 3ZR6A 1EVTC 5HPMB 3QG7H 2YIHA 4Y2OB 2X3CA 4FF9A 5D6CB 2E6JA 5AUMA 1U8QA 2HPOA 1IFGA 3HG2A 2OFQA 4JFYA 1LJMA 1GGIL 1FAIH 2R2BB 3DGGB 1EEYB 2H3KA 2QBWA 2N0MA 2Q0ZX 4TULL 4ETQA 4ZI8A 2E7HA 3FRUA 4PY8J 1C7SA 2VR3A 3SQOH 4JFOA 2APWA 4LSDA 4F7PA 3K6NA 4JFQA 1TTGA 1MIEH 1RUKL 5HI3C 1WV7T 4FLSA 2Q7NA 3JTSA 4BZ2A 2WLNA 1O5PA 1A25A 2JKNA 2VDRH 5FYJL 5JHDE 5E4IA 4HD9A 4CDHA 2ATAA 4HFUH 4JLRA 3KNBA 3MKKA 4GIPD 4JFEB 1FZOA 4U4IA 5AKRA 3UABA 1DQVA 5I2IB 2WO4A 4G1MB 2FEEL 3F7QA 3L54A 3FB8B 3RHWF 4LO9A 3DROB 5I8OH 12E8L 2BC4B 4ABWA 2WN3A 2XX0A 4Z7VA 3Q1SH 3QJZA 3DV6B 4NT6A 3INOA 3MLVL 5HD8D 2NT0A 1U58B 2BVUA 1BGXL 1INDH 3IMUA 5H35B 3VI4A 2VAAB 1DSWA 4WI3A 3OMZA 1DTUA 1PX3A 5JHLH 1JZ4A 3T0AA 2LVEA 3GKWH 1QUNB 3UYRH 1EXUA 4PGBA 3EYSH 3GXFA 3VXUB 2P5EA 1JXFA 2J5LC 5C2UB 2UZIL 5C3LD 1QYGL 4EVNA 4BBWA 2KHAA 1XCQB 3HG5A 2O5NA 5B7MA 3NTCL 4L1DA 1MFMA 1CCZA 2VC2B 4QIRA 3V4VB 4DAGL 3ABGA 3DX9A 1B4TA 3K2IA 3TJHC 3DOSA 5E5RB 4BHUA 1CLCA 3FS9A 2F53D 3ZZ1A 5D2NC 2P52A 3JTBA 2AF2A 4PTUB 2XTJD 4UM9D 2A99A 1IC7L 1FIEA 1IGIL 3QHTC 4PJHB 3HUJA 3FFCA 43CAB 5I1KL 4MQ7A 2H26B 2MKWA 3PNWA 4B9GA 4PBVC 4DOHE 3B8SA 5JA9A 2GCYA 1P0SE 5B4MD 3FB7A 4ZO7A 5K9JL 2E76C 3S88L 2BNUB 3NRFA 2HFEB 4KGLA 3UYPB 1DVFC 1WA1X 1WAAF 1ZWIA 3GZKA 5C09A 5JW4Q 2YEVB 1P7BA 2YXFA 3MDJA 1T83C 3O6FC 5JMRA 5T5NG 3NBNA 2YUWA 2X89D 3GMRB 3MLXH 1F41A 2CD0A 4FQXA 2VDKB 2DQCH 1EHKB 4HS8L 2EIEA 5E7FA 2EEXA 5F1IB 4QHUA 5GGRB 5GSVB 2D0FA 1XCWA 3GMMB 1B6DA 1OT1A 1LQSR 1XDTT 3NCWA 1PMYA 1I3GL 4X5WA 3WS6A 2E7LC 2APTA 5EU6D 4DQAA 4LL1A 1BZQK 3BEVA 3VXRA 1NGWB 1BVKB 4NYLA 3LEXA 5F9AC 1UCTA 4ATWA 3MODH 3MN8A 1R3KA 3TIEA 1GZQB 2J88H 3GI8H 3AU1A 2JIXD 4JM2F 4ZX4A 5CEZE 4Q9RL 4KDVA 3B7TA 1QW9A 5AYTA 4KY1L 2XWJA 5DR5L 5AKSA 3P4NB 4N2MA 1BQSA 1CS6A 2R2HB 5L6YH 4ZMLA 3I6SA 2X6VA 4JM4H 1YDPA 3LQAC 3UMNA 3TF4A 3NABL 4MBOA 2AABH 2CLRA 4NAJA 5FGCB 5ILTH 1K6QL 5DJXB 2I9TB 3IFLL 4HOXA 1A7PL 3K5SA 5FV2A 4BEIA 3EBAA 3MRJB 3PWPD 3TPKA 4I4WA 4BQBA 2PPDA 2JTDA 4PUBH 3D8MA 3L7FA 4NO3B 5I6LA 1NGXB 2ZKHH 4XI5D 4M1GH 3DBXB 4HPOH 3WFHB 3VQMA 4XVJL 4L5FL 3QUGA 4JRYA 4KQ0A 1GS8A 4G8GD 3F6IA 3DVNA 4MZIA 4EI5D 3P1VA 4Z7UE 1FNEA 3X1EA 5K1NA 1XGQB 2HT4C 3EADA 5MP6H 3K46A 3ARFD 3WTYA 3S8FB 2KL6A 3C60A 4W4OC 4B50A 1BLNB 2XVLA 3BH9B 3L2LA 2O61A 3ILDA 4LPCA 4N24A 3K71A 3ARWA 4R4BB 2F7PA 5GS1B 2GVYA 5GS0D 4GAJL 2FBRA 4JJ5B 4XH2A 3B2UD 3PHOA 2P44B 3CZNA 4DUXA 1RPUA 5C0BA 4JNXA 2A9MH 4C57C 1BQHB 2ADGB 5KVFL 3VNYA 2WIIB 2GJ6A 3FTWA 4QD2E 5BVPL 5HDRA 4N6QA 1WGVA 2VXQH 3SE4C 4X6CB 4BIKA 1JNNH 2B9AA 1FRGL 4J39A 2VL5B 3ASNB 2G2RB 2HH0H 1PNDA 1QLRB 4MJ4A 4G6AD 3STLA 4GG6B 3NMEA 3NSDA 2QHLA 4JDTL 4WU7B 4ESKA 1T7YA 1CFNB 3L1GA 1HL4A 2JJUA 1T1WA 4IEFB 4QXGH 5JXAH 2BSEA 3SDCD 2IQAA 3H3KA 1O7DC 1BZ9A 4N6RB 2D7TH 5F7DB 1I1AB 4ECNA 1OO2A 3N55A 5EMYA 5BMFL 3L5XL 1WA2X 3MGTA 4GAAA 3GMNB 3CZJA 1OE1A 2AQRA 3WO3B 4YHLH 4U1IA 5FYJD 4HS3A 5KSBE 2IV9A 4CGUB 3ESUF 4KOCA 3JWOC 3CFUA 3X1FA 1UCBH 2XN9E 3D3VB 1J11A 4HK3N 4U6HB 1AXTH 3KH4A 2Z91B 5JW3H 3CVIL 3HG1E 2K70A 2CK0L 2AK4D 3LB6C 5TK4A 1S7XB 2VN4A 5LXGH 4MAYC 3PGDB 3BKML 3C08H 5ESQA 3S5LG 1PS3A 5HYSA 1NICA 2UVEA 3T3MF 4AH2B 3OKNA 2WKOF 2D31A 4ORGA 3O4LD 5E2TH 4YL9A 2WQ8A 4OTXH 1NCDL 3F04A 3DTXA 1GZHC 4ODVL 2FEEI 4DGIL 1DQJA 2J6EL 1WEJH 4HMEA 2VO5A 3CSFA 5ICYA 2JE8A 3VVWA 2NYKA 2FJSA 2YO3A 5EIIG 5KAQG 5E95B 3Q13A 4F7EB 3C12A 4C4BA 2XV0A 4F2ME 1NCAL 4Y5XA 2X2HA 3CLEL 5ACZB 4FQQA 1FVEB 5FFGA 1HT6A 2XSKA 3VWJA 1N3NA 4RIRA 2X6CA 3TZVB 1DDHB 4MB5A 1KJ2L 1LP9F 2GABA 3MCYA 4PY7B 4QHPA 4YBQD 3RGVC 4GY4A 2CXGA 4OCWH 4UTBH 2DOCA 1MFCL 5EZIL 3JWDH 2V5MA 3IMRA 3QHFH 3WEMA 3UPAA 4J4PA 4XCFL 3X11A 4RFEA 1HOEA 1ZHKB 4RWHA 4P4KD 4K2UH 3FULA 4CMHC 2WLKA 1UM4L 3CFBA 3UROR 1CR9H 5KYUB 3FCTA 4APQA 2B77A 1ACYL 5IQ9A 1MCPL 4KFMA 4XBGA 5GGSA 2IPUK 3GMLB 3SJVA 4QHKJ 5DD0L 5J56B 3DJSA 2RQEA 4Y7MA 2ICEC 3LX9A 3WO4C 1J1XH 4CMMB 4ZTPH 5DFTA 2XXGA 1UH2A 3EHBB 4PJDE 1AXSB 3NCMA 3AWGA 2FQGA 1QSED 3QVAA 5SX4I 3UO1L 2NNFA 4R4FL 3SGEI 2OV0A 4FHKA 1HDMB 1NCJA 2AVFA 1N7ML 4ZMZA 2YAHA 3NACH 1FNSH 4H8HA 4JAMA 3U1QA 4F7CA 3ABKB 1ET8A 1WDAA 4ANUA 5B3NA 4P9HH 2O5ZL 4PRNB 3MX0B 2HVKA 4KTDH 4XMVA 4Z5RB 1ZDSA 1KFAL 1JRHL 1MQKH 3MVSA 3MOAL 3CXHJ 1PBYA 5CEZH 1NLDL 3DBSA 3QUZA 4FYRA 1CK0H 5INCB 2NY2C 4LAJH 4TSAH 5FA3B 1UB5B 3Q8AA 1TETL 2B9BA 1DFXA 3OHMB 4Z8FL 4OJAA 5D4IA 1A9VA 3QZLA 2I07B 3UAEA 4RNRB 2DQHL 1OP5K 1ZT7B 2PW2B 5D7JA 1ZV5A 3OPUA 2CPCA 1Q9OA 3RQ3A 3HPLB 4RSVA 1E5CA 5I1EL 1IBDA 5KVGL 1CXKA 1ICTA 3CHSA 4NQVB 5IZ7A 2WBJA 2ZAGA 5E6YA 1ITCA 1R3LB 2W80C 2LLGA 3OJ2C 4PS4L 4PREB 3T2PA 1EMTH 3PV6B 3Q8EA 4HBCL 4AXWB 4GG8B 2CRMA 4OLVH 1ASPA 5EFIA 3SN6N 3RILA 1RHHB 1KBKA 5JXED 5E56A 5AKTA 3T1WA 1E5BA 1PY4A 3FC8A 1U3HB 2YZ1A 3CQFA 4XODA 2XIIA 2F18A 8CGTA 1UOLA 1K4DA 3BP4A 2PO6D 1T66C 1HXMA 5EZOL 3TCLB 1YJDH 4GBXB 1G1YA 1BVLB 2XXCB 6FABH 1IEBA 2XY1A 4MNQB 4U3XA 3PGCA 4N0UA 2C9UA 5ICXA 2ZYSA 4O5LH 1FFPA 3IU3A 3GZOA 5EZLB 1NAMH 5IFJA 4NM8H 3IXTB 3GBNH 4FQIH 4KHTH 1P5UA 4N3TA 4ZS7H 3G5ZA 1ASQA 4OD1L 4XOCA 4D9QE 1JF1B 4XNYH 1N8ZB 3CK0H 5HVWA 2BXYA 1TYJA 2F53E 3QQ4B 4LRIC 3U7WL 2OMVA 3EGXB 1IZJA 5DWPA 4MDJA 1T03L 4I48A 1FPTH 5CNHA 3V0WL 2SODB 4X4KA 3RBSA 1QRND 4FLRA 3KXFA 1YUHA 4FDWA 1BBDH 1G9NL 3SZKC 4XPFH 4BH8B 1V10A 1N0LB 5I1DA 1HQRA 3BFWA 3M07A 2K4WA 5T5FH 2MHAB 4QHNB 4NENA 1E5ZA 1OIOA 4LVHB 3RAJL 1ZGLA 1HI6B 1G4RA 1INQA 5KYXB 3BZ4B 5KBNC 4U3CA 1VDGA 1UENA 4YHNA 4GW5B 3V5HB 5IMLB 3QJXA 4H1LB 2QSTA 5K9KA 4U6YB 1NOAA 5GGVH 4X7TA 5FUCC 3SDYH 2J7LA 1OHQA 4DO4A 1NOFA 2XTJB 4UM9B 3NIFB 2MMXA 4LIQE 2Q6WB 4AUJA 5CBAA 3T1FA 2VE6B 3V4PA 2J20A 5FKAB 5IGXH 1FV1A 3EZJB 2OBGA 1VB9A 3GSRB 1KV3A 1DBAH 4E9RA 3A4FA 4IW4C 3EUDA 2CIKA 3LHPH 1TTBA 1H3PH 4A38A 4U1MA 4AGMA 1KYFA 2IWEA 2ZOOA 2ICWA 3J27A 1T2QH 2BCKA 3KD4A 2WXQA 3A6CH 2FDBP 3QPXL 1A7NL 1Z5LA 4AEHH