3UOAB

Crystal structure of the malt1 paracaspase (p21 form)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
378
structure length
364
Chain Sequence
MLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the mucosa-associated lymphoid tissue lymphoma translocation 1 (MALT1) paracaspase region.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
total genus 100
structure length 364
sequence length 378
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00656 Peptidase_C14 Caspase domain
B PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uoaB02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uoaB01
2H5IA 1SC1A 3H11A 1RWOA 2K7ZA 3V6MA 4EHFA 1QDUA 4N6NA 2CJYA 4QUBA 3PD1A 2XZTA 3EDQA 5LUAA 2NN3C 4FDLA 4NOJA 4NOMA 4I1PA 4QTYA 4DCPA 4JJEA 1RHUA 5I9TA 4N6GA 5IAKA 2J30A 2QL7A 3KJQA 3R7NA 2QL5A 3R7BA 1RWVA 5IAGA 2QLFA 4PS0A 4DCOA 3GJRA 2FP3A 4QUIA 2AR9A 2HBZA 2C2KA 2HBRA 2CNLA 2HBQA 2Y1LA 4QUJA 4HVAA 2P2CA 3KJNA 1QTNA 1CVRA 4FGUA 5IC6A 5LUBA 2CNNA 5IANA 5IABA 2HBYA 3H11B 4NBNA 4N5DA 2DKOA 1RWWA 4HQRA 2QLJA 1QX3A 4QUGA 3E4CA 1F9EA 2J32A 5K20A 5LU8A 2H4WA 1RWNA 2C2ZA 3H13A 5H0IA 3DEKA 4EJFA 1GFWA 1K88A 2H51A 1NW9B 4JQZA 4PRYA 3V4LA 4D3YA 1RWXA 3R5JA 1JXQA 4AWAA 5JFTA 3NR2A 3IBFA 5IC4A 1RWKA 4JJ7A 4PRZA 2QL9A 3UO8B 4QUHA 4ZVTA 4JJ8A 2C2OA 1NMQA 3D6MA 3ITNA 4N6OA 4QUAA 1RWPA 3V4OA 4FEAA 2WDPA 4ZVQA 2H65A 5IBCA 1CP3A 2CNKA 3DEIA 3IBCA 3P45A 2J33A 2C2MA 2XYGA 4JR1A 1IBCA 1K86A 2FUNB 3UOAB 3V55A 1RHMA 1RWMA 2H48A 2H54A 3D6HA 4QTXA 3R6GA 4ZVOA 2Y0BA 3PD0A 3PCXA 4QU8A 1I4EB 1KMCA 4D3XA 1RHKA 4N7MA 3RJMA 4EHHA 1GQFA 2QLBA 3BIJA 4QU5A 3SIRA 3V6LA 2CJXA 4IEFB 4EHAA 1I51A 4NBKA 4JB8A 4QU0A 4AW9A 4IYRA 3R7SA 3OD5A 1M72A 1I4OA 3H0EA 4EHDA 4QULA 1SHLA 1SHJA 1NMSA 3H1PA 4PS1A 4NBLA 4EHKA 3S8EA 2C1EA 2CNOA 3NS7A 4QUDA 1RE1A 3R5KA 3K7EA 5IBRA 4JR0A 5IAEA 3SIPA 1F1JA 5IASA 5I9BA 4N7JA 4ZVSA 3R6LA 4DCJA 1SC3A 1ICEA 4EHNA 3KJFA 3GJTA 3QNWA 4JQYA 4ZVPA 2XYHA 1RHQA 5IARA 4EHLA 2FQQA 4M9RA 4FXOA 2XYPA 4ZVUA 2CDRA 5IBPA 2H4YA 3S70A 1SC4A 1PAUA 4NOLA 1I3OA 4NOKA 5LU9A 3NKFA 1PYOA 1RHJA 1RHRA 3GJQA 3EDRA 2XZDA 3P4UA 3DEHA 4JR2A 4QU9A 4ZVRA 4AWBA 1NMEA 4D3ZA 2H5JA 4QUEA 2J31A 3V3KA 1BMQA 3GJSA 3D6FA 4HQ0A 4I1RA 5IAJA 4LSZA 3DEJA
chains in the Genus database with same CATH superfamily
2C5LA 3EYOB 4WVLA 2AK2A 4KI0A 3FB6A 3OHMA 2J0UA 2GD2A 3OQVA 2WZBA 1T22B 3LN9A 1XR3A 1ROWA 5K6RA 3PWPE 5KG9B 3IEMA 2R4RH 3COWA 3DX6A 5ARBA 1RUQL 3A2KA 4R1OA 2JD0A 3II2A 1W0KA 4URTB 4DCSA 3HRZB 2QTVA 2O2HA 4XE5A 4HPHA 3B1YA 1XAKA 1LVHA 2C3WA 2OZNA 2H51A 3RJQB 1W80A 1VHWA 1JCKA 1Z6XA 2DKFA 4U6HB 1UADC 4F1ZA 4I3RH 3RNOA 1KPRB 3PUCA 2PO6B 4CIVA 2B4KA 3NIFB 3UZVA 4HPYH 1GZ5A 4OVUA 5HIIA 3I4FA 4YAUA 2W83A 4EIGB 1TCBA 4NUGL 4LLYB 1RP8A 1QR1B 3BXHA 1E90A 2F9LA 3ZV6A 2X4OA 1L6XA 2A0LD 2Q1YA 2ZAYA 1GKUB 2ZKIA 1IVYA 4Y2YA 3D64A 5LXVA 3MAJA 2W1NA 4GZ3A 2DQYA 2NLJA 4I99A 2W9DL 4ZOEA 3D08A 1KAQA 3PWLA 4YQYA 1X38A 2ICEA 1VJGA 4OMDA 4BZ1A 4QRSB 5DSCA 3NT4A 4MPPA 1IBYA 1Z4KA 2EXSA 4C7BA 2XRAH 1W4LA 4YRPA 1NW3A 4OK6A 1W1WA 3T1FA 2HKFL 4NJEB 4NFHA 2CBQA 5C2JB 2FPIB 3VKHA 3W06A 2BEVA 3DQPA 4UHDA 2XRYA 1M6EX 3O4RA 1EXWA 2HRGA 1G84A 4B3XA 5A1AA 3M07A 1FIGH 3I9AA 4PP1C 2YYYA 1S8DA 4GAYB 5FYKE 4E5XG 4DA6A 3U56A 5DNDA 5G4LA 1JF6A 4Z7AA 3FYUC 4GSDH 4J1UA 4LESA 2P35A 1LEHA 4PYMA 4ZO9A 5KBKA 1CUUA 1IJNA 1BD2D 4JHAL 3MFYA 5ADVA 2DOCA 4F7WA 1KHHA 4DG8A 3ZLVA 2F7IA 4M5SA 4CKXA 2WLMA 1T13A 1QTRA 2J1LA 3TUJC 5CZXC 1TW2A 5DH9A 2GXUA 4L9LB 2BFWA 5CP3H 1NX9A 5BRAA 1I80A 3WHIA 3LXBA 3DP7A 4QXTB 1E6OH 1WIOA 4MMXC 4ZQFA 3MRHA 5HXMA 4G6KH 3V7FA 3E03A 1VADA 1G6Q1 1U3GA 3BE8A 1IC5H 2C59A 1RKVA 1VCNA 4NC1E 2W6ID 3FOZA 2HHCA 4J4PD 5DDIP 5GS0L 3L0IB 3ULVL 1M34A 1QW8A 3EPRA 5CFPA 4LU5L 3VTMA 4F9PC 3TZHA 4GINA 3ME5A 3RVUC 5CLYA 2BAGA 1WDWB 3BFJA 5AHOA 2AC4A 3BCDA 4YSSA 2ROQA 5J0BA 4HDNB 1QFYA 3PFFA 1QRKA 3TOCA 1PWXA 2FA9A 3QEHA 4OXNA 3ANMA 1ZVVA 3VFNA 3PYMA 1CDGA 4G8GA 4E9LA 3CSTA 3LYHA 4J2OA 1UADA 5CX1A 4ZSOA 2BPBA 1UPXA 2GVYA 1A9TA 3FBTA 1AKQA 1PYWB 3BWZA 1OXTA 4LARH 3NPMA 5DIZA 3H6GA 5AO9A 1ND6A 5CDYA 4KOCA 1L5VA 2O3TA 5C0FA 1I24A 3WFDL 1RK7A 4PXSA 2LABA 5EIFA 1MG0A 3Q0HA 5F1YA 5B2EA 2F8OA 3J7AC 4PS7A 3A8TA 2VJPA 5LKNA 5AB1A 4HJ1A 2EYSA 5BN4B 1IQDA 2PP7A 1G3RA 1ZOPA 4QFBA 5EMJA 2NU8A 3C4QA 2W2LA 4MIYA 3MRFB 5J23A 1G20A 2ZDQA 4X7RA 4WEQA 4NECA 4NBWA 4HCGA 1N3NA 4CWAA 1R24A 4G82A 1Y7HA 4CV0A 4IBTA 4JEGB 3V4PL 5HE9A 2Z8YA 1XHEA 2VQ4A 1T34A 4IJWA 3U17A 2AMYA 1ICIA 3BXZA 4RK1A 2ZX5A 1H0RA 3P19A 1FA4A 1U3DA 2H0FA 2V2WA 3ZDBA 4DGWC 4BSVA 3QAZB 4FG6C 1B0IA 2O5XL 5HYJB 4MA8H 1KYQA 4YK4B 4WNQA 1GY2A 4FTVA 4ZUSA 2VO1A 1DTUA 2CHQA 3HI6A 4ZC8A 2K7QA 2G9RA 2NV6A 4A2MA 3FDFA 4YLEA 3W3AA 4K0OA 5DWUL 3B6KA 4K5PA 2CLVA 2D8KA 2R68A 3I6ZA 5AKXA 1R8JA 2QPTA 4OVKA 3CK0H 3PRHA 1U0SY 3K0KA 2WKQA 2EERA 5CXXA 2Y6UA 4BNMA 3D8UA 2FEJA 2V7TA 1E62A 2QQKH 1KLGB 2RI1A 3HJCA 2XKKA 2Z58A 4DARA 5GADl 4KO8A 4TYQA 3PEVA 1FFEA 3W6ZA 3CE9A 2CNWA 4RM3A 1C0LA 1D5ZB 1GQ2A 4M9PA 3KWMA 4KFMA 2B6NA 3MGTB 1MHHB 2DV6A 2DKSA 3ATAA 1FBNA 1L4EA 1ET5A 1T5SA 2FMIA 5DFTA 5GRZA 4B5LA 1KLUB 5D7KE 1K5HA 4P57B 1EBFA 4E30A 5CILL 3ZGNA 4FXOA 4MGIR 3GD1C 4U2EA 4GFDA 1PBYA 1OA1A 3D3VE 2AQ8A 2DAVA 1U3ZA 2PO5A 3U4AA 1QLHA 4UXJA 1TT5B 4BNDB 3GRBA 3PJSB 3PUIA 4G5ZL 4DWWA 1QDUA 1TZHA 3L0DA 3OHXA 2VR8A 1L5HB 3I9GL 4H88L 5BZWB 3VFNB 3AABA 4BUQA 5MENE 1LGVA 3FR7A 2HDOA 1TKWA 4J29A 3OMXA 2DQIL 2A6IB 1XSIA 1WPQA 1UDAA 2BOVA 3MGOA 3TWCL 4LZOA 4NC1C 2HPVA 1XNGA 4N0YL 1SMOA 2DFLA 1GT91 2HCZX 4OF0A 3U6KA 1J00A 4F21A 1B6SA 4YHHB 4N90D 4H2DA 4K6HA 4E5MA 5ALYA 3FO1A 1PW7A 2HIAA 2JLQA 3LMKA 3E2IA 3LPMA 3OQMA 1EJ2A 4G8BA 1Z17A 1UD2A 4CA4A 5AKYA 4M3NA 3MW8A 4OGGA 5C0BA 4OHVA 4LLMB 4FFTA 3MU3A 3MV8E 3H54A 4WI5A 4BNNA 4X80H 2CJPA 5T8KA 3KPQB 5EOTA 1NBZA 3WUWG 3OV6A 1C1XB 3ORFA 3OWRA 4BZZA 1DDIA 4O2FB 1BM3H 3PWTA 3OM0A 4QD3A 3D50A 4C87A 4WIQA 1YR6A 4MX7A 4IXWA 3DX7B 4HNVA 2X12A 2X7JA 4JKLA 3HXKA 2X58A 4Q0XL 1ZEAH 1BIHA 1MO5A 2JGMA 1TLLA 3RRXA 4WFFD 3U4BL 4E42B 4WU7B 3ZY3A 4EVNB 4NNXB 1NM9A 2QN7A 3MJ8A 5FBVB 3ROXA 3ARSA 4XPIB 1HMYA 1MCBA 4GX0A 2HMTA 2HY7A 5I7RA 1GG5A 2CXUA 1JPFB 2MHAB 1CLUA 3JWEA 3FXIC 4M54A 3LH2H 5LB1A 3SBEA 4MKFA 3TA3C 4XNYH 2A5DA 3PDDA 2E27L 2R2HB 4P3YA 4GLBA 5KNDA 1R3DA 2VI5A 2HF8A 2V3EA 3QIBD 1XZHA 3T5MA 4WBNB 1CU4H 2RFXB 3DJ9A 4BA8A 2O30A 4UPDA 1I2BA 1X9UA 3R4DA 1IPHA 3H2QA 3IJHB 5D1ZB 1MCSA 2QW0X 4R2GB 5J2TB 4LF7B 4OD3H 3HL4A 1DOAA 2M2DA 4MKZA 5EUCA 4YDKL 1YS1X 2GBCA 5LQBH 5JNVA 3QY0A 3CZMA 1H5BC 3CSYA 3KXFE 2DFPA 4UTNA 3HYCA 2BW4A 2DRIA 1WUTA 1FVDB 3X14A 3CLKA 3EA5A 1HZZC 2XWDA 3QXAB 4QXPA 2WT4A 3H83A 4EHDA 5I16A 5ESVA 2XE8A 3LEYL 3W9UA 4HVBA 4V0KA 2XUJA 4KMSA 1ANUA 2Q29A 1RZ8B 3VXSB 4WUUE 3GH3A 3KFVA 1U2DC 3N55A 4DEPC 2QDWA 4UZEA 1UB6A 4JJOA 1PGJA 4M36A 4KKPA 3APMA 2WSKA 2CBZA 5DD6A 3WYCA 4N2GA 1XAIA 2WXKA 2CSPA 4LY3A 1RTTA 3HPRA 5KHAA 4BQNA 4IG9A 3QMPA 3LRTA 3KCQA 3MOGA 4GM1A 2Z65C 1EXGA 5A2IH 3IP5A 4FQXD 3EKCA 4H7KA 3DZHA 4NG4A 5IJBC 2MYPA 5LDUA 3S5UA 4NO0B 1NJ5A 2JLUA 4GOXA 2X6CA 4HPXB 1GIGH 1VJCA 2AJZB 1FFOB 3PIRA 3K6FA 1G0YR 3MJHA 3O91A 4A6YA 3LKVA 1SY6A 1U98A 2XPGA 4IOSA 4RHXA 3MWJA 5HDQL 5CIYA 1ZL0A 2WVUA 3I6IA 3IERA 1HYSC 4LRSB 2BKUA 2XUFA 1TMYA 3GSRA 4JR1A 3SXPA 3CX2A 7MDHA 4L28A 2GQ0A 5GGSB 4BKSC 4Z95H 4X9XA 1QUNA 1V3MA 1P2CB 3MRJB 4YFYA 5FIEA 3GVCA 1Q0ZA 1PZEA 2VF4X 3FDZA 2O7QA 1SZCA 4GYKA 5F23A 3TG2A 5J2TA 4KQGA 5EMLA 1M42A 4N4AA 4GYJA 3ET4A 3EYQC 2IFTA 4MYUA 2J67A 5BMFL 4FILA 4EFNA 3OAZH 3EA4A 5FYKU 3MMEB 3AYXB 3LJKA 1QFMA 3P5SA 1UACH 4PJFE 1L2TA 3PDGA 5JHDD 1P7CA 1X7YB 1RZRA 1BJ1H 1BLNA 2GFIA 1GTNA 1GKIA 4FHEA 1P60A 1XDGA 4JVUA 2P26A 3QNYA 2OC9A 4E33A 4PHGA 5I76B 3KKZA 4EITA 4YBHA 4E5NA 4UU9B 4HB3A 1A6WH 2F9FA 4F37K 1HFJA 3ILXA 1Z7WA 3BJRA 3JWHA 3OU6A 5AD1A 3MVEA 3O8OB 1NXSA 1GGEA 3L4ZA 2HK8A 4WFFE 1QKJA 2YHBA 3ONFA 1YVLA 1KZ9A 3LKDA 3KJHA 4X5PA 4C3OB 4NBNA 4WLEA 3PJEA 4BJ5A 3KPLB 5J1AA 5HF5A 2PCPB 4UQIM 4Z3KA 5ISZA 1II0A 2ZWMA 3NRBA 5CURA 1HI9A 5JZSA 3L6RA 1DQVA 5IROC 2YMQA 3B1WA 1NBMA 3W9DB 3Q7SA 1LYQA 3H5NA 3K70D 4E15A 3VGPA 3KBOA 3GBLA 2YBRB 3CB2A 3HJRA 4IQFA 3D05A 5GRXG 3N41F 43C9A 1NMAL 3FCSB 1DT5A 4ZJUA 4Y6OA 2C4FT 2PT6A 1QRSA 3F8SA 2I2FA 3OMZA 5MHSD 4HLUA 1MN4A 4ACTA 1FFHA 1K6QH 1G94A 3O2SB 3SD5A 1R16A 3N85L 1A8IA 5K6AA 3AVEA 3DM9B 4CU8A 2VHYA 5EHNA 4KQ9A 3EJZD 4MCYA 1R4MB 3OJMB 4KQMA 4IOFC 1LNUA 3CFEB 2BFAA 5J2UA 3TV3H 3GROA 2YDYA 3MGOB 3BERA 1QG0A 1T5BA 1KTRL 3CZEA 1C7JA 1Z7BA 3QZNA 4ZCRA 1BOOA 5CCXA 4LNVA 2RCYA 3ESXA 3PYXA 4WFKA 1UC9A 2QM8A 1NT4A 4REQA 4X98B 4C20A 1T0PB 5A7HA 1K68A 2A7XA 1RC1A 1QTYT 3CVHL 2JCSA 1G9ML 2J1WA 2FN8A 3KQUA 3MYJA 2BSRA 4PR0A 1KPGA 2ZD0A 3W5JA 5HFNA 3NYQA 4DP2X 4U7TB 1OB1A 4GMDA 1U1IA 1R50A 5T33L 1H3VA 3DB2A 2Q4DA 4RNCA 4M29A 1C1XA 1AJ7H 4PVLA 4LLWA 1T0OA 3KEGA 2KHAA 3C09C 2I7DA 3NKVA 3BAYA 3FCGA 1YR2A 5G41A 1LK3L 4KX7A 2I6SA 3RRJA 1L5FA 1C7SA 2QRMA 3VPFA 4TV3A 1JEAA 2AKRB 2IV2X 3ZHBA 4AH2A 4GSXA 1JKIA 4IRJC 2R7KA 2XOXA 4XAWH 4Q4JB 3BLPX 4X6CE 2O14A 3FQ2A 1BGXL 4GB9A 1IOZA 1WW8A 4LCIH 4OJQA 4GHWA 2WVVB 3MSPA 4M6AA 3PEEA 4NCJA 2B5IC 2PWEA 2ADFH 4G8EB 1WHSA 1ODKA 4Q7MB 2WWWA 4M99A 3N42F 1K72A 5A6IA 3A4TA 3OPNA 4G89A 5DFVC 5A2LH 1WVZA 4P3DB 4LZLA 5ESQB 1YMHB 2ZSJA 3EC2A 4Q02A 2C4MA 2EE9A 2GJ6B 3WZMA 3SZGA 3ILYA 1PR2A 5FA6A 4FAAB 2E4YA 4YHZL 3VR4H 3WDHA 3E1GA 3OOJA 1S7GA 5DHVH 2GAZB 2NTFA 1C08B 4UUAA 2TSAA 4PWJA 1FYFA 3BIKB 4MW1A 3RWIA 2GGSA 4P7GA 2E4XA 3F5WA 1OPXA 1P4LA 4AJ2A 2BVYA 2GK3A 3LZOA 1ZGGA 4IW3B 5ILQA 1QSGA 2Y1OA 1ADFA 5I82A 3B8HA 3LWDA 4R96B 1AKPA 1I4FA 5E4AA 4YUXA 1CLZL 4P4SB 1RIHH 1TVBA 2JV6A 1XZDA 3GCWA 4U1NB 4WW0A 2X1VA 4K5LA 3ZC3A 4U7MA 1JGTA 4G9FB 1SH7A 1EXDA 3WEXB 1BOFA 3P9RA 3PXEA 3D3VA 4D3YA 1EEYA 3V0DA 4BFZA 1JMKC 4D25A 3Q1SL 1X1DA 3RBZA 821PA 4REOA 3U39A 1Z0KA 1ISSA 2HT3D 1M74A 1BAFH 3G02A 4ZU1X 1JLKA 2ZWZA 1K5WA 5FR3A 1L4UA 1MB3A 3B3JA 3CEMA 1J99A 3OEHA 4IV0A 2VDPB 5CH8A 3U40A 2ED6A 5M34A 2QK4A 5LIRA 1N8OE 1DQDL 2DUNA 2X4QB 2Q6WA 1BU8A 2IAAC 3VXQA 4XMPH 1UUNA 4NE9A 4KUZL 3MTJA 5CX1B 3GBMH 3H5AA 2CMKA 2XUQA 1DT3A 2E86A 1XDUA 3E7JA 1AQKH 4Q52A 3JQDA 4GAJH 1KYOK 2Z0UA 3AT8A 2A9MH 2NSDA 1BEUB 3N53A 5TE4H 1X5HA 2Q7AA 1K3IA 3T5CA 3KKOA 3W2IA 3WYEA 4ALNA 1P45A 4XOEA 2IBTA 2CK0L 1I1CA 1XFAA 4HDAA 2ARJA 1PR5A 1JHXA 4G6ZA 1QZ3A 1L4GA 1DEKA 4N2IA 4J1SA 5GGTA 3VFGH 1ML0A 1KT2A 1IBHA 2DI9A 5KNBH 4KO2S 3DH0A 2GBFA 1Q4NX 4K3EH 3VFTA 4NQSB 2NXCA 2C7UB 4OAOA 1IULA 4XWTA 1O4WA 1AMNA 4B60A 2D7TL 5JCJA 5FTWA 4HGWA 2IHYA 1TVKA 4YRAA 2P28B 4OD1H 4MGKR 4YQZA 1CDHA 2DHEA 3DLTA 3S88L 2CLRB 3ENVA 4RK0A 1JQLB 3IDGA 1NVKA 2O50A 2WLSA 3C6LD 1UKCA 4XARA 5EU4B 4JVMA 3AUSA 4TLCA 4NWTH 3FPHA 1K4DA 4XMTA 2VIRB 1R9JA 2NX5A 3DUHA 4LV5B 4BMPB 1KDJA 5C31A 4V0OA 1W2HA 2WVTA 3LSOB 4NZUL 2AG5A 5DK0B 4P31A 4D3XA 3GCDA 2YD3A 5EU5A 4JDEA 2OHGA 1L5LA 4BK4A 4ZVKA 2WQ7A 1O08A 3AUAA 3TRFA 4OGQC 3UV6A 3ZQ4A 1H15A 1LD9B 2I9LA 2X44D 3MIIA 3WK5A 4J1UB 1VE3A 1RXVA 4EUPG 3NVKI 1EH5A 1JXGA 4HG4J 4BFIA 1YS2X 5DRXA 4TNGA 4LLVA 5KEZA 2E46A 3S68A 2F5BL 3NZ8A 4KI7A 2WLKA 1CLYL 5DJ0A 1ADCA 3H1FA 4MJLA 3PDJA 2Z3WA 4P2AA 4J2XA 4A2EA 1HYHA 2N0SA 5HYQA 4R3SB 4C01A 2EDBA 3T4XA 2BZ1A 1E2HA 3MV9E 1L8XA 3NAQA 1CNMA 2MNUA 1G1KA 4MNTA 4RZQA 3RNQA 1Z5GA 1N4XL 3IP6A 3JD1A 3IPXA 1QRAA 5CT6A 3I8OA 4FF9A 3KOXA 2GM3A 2LGJA 3VISA 5BXFA 1UZAA 3BH8A 3HJ0A 4IIXA 5B1CA 1H19A 4D4HA 2FD6L 3QOYA 4KBFA 1FFOA 1NAKL 3DK2A 3NSFA 4BKTC 5K0CA 3GLVA 4H26A 3NMEA 1W87A 5IWLC 1XTSA 3K6IA 2X3UA 2VYFA 3L1JA 4BZ2A 3ZWDA 3W90A 1AC6A 3UYPB 4C0LA 1Y6FA 1BRTA 3AQYA 3RBAA 5SX5K 3F6BX 5L4SA 1RHKA 5IMKA 3MJFA 2CPUA 1QS0A 1J20A 5G1OA 1EM8A 3KU4A 2YASA 4LYAA 1RZIA 2LOEA 5FGBC 2H1RA 3K8MA 2AJ3A 2LW3A 1ZTXE 2VDMH 4L4TD 4DV4B 5ALCL 3EDFA 4RHCA 2IC2A 4D80A 5K05A 5GINE 2Y2WA 5DJAA 2J6WA 2WTNA 4HAZA 1LDMA 2HXYA 1OTUC 4KVNH 3ZK8A 1U8PB 5F9JB 3CH1A 2YPLE 4X99B 3SCMA 2XQFA 1V7PC 3M83A 3BAXA 3EC7A 4TQ9A 1WW2A 1C5BL 2PW1B 3WQRA 4AJIA 1NG1A 4BWFB 5DTFB 3K1ZA 2XECA 3WWCA 2YAFA 3TNNB 4PZPA 1ABFA 1BZYA 4UREA 3CNQS 4AENA 2E56A 3M17B 1UQTA 4BRVA 3T7RA 4B95C 4J6RH 4M7PA 4PSUA 3NALA 4MAFA 3GEEA 2YOGA 1S7SA 3CRRA 1H2AS 1NXPA 4PYJA 3JWOC 2B2XL 3PKZA 4LG1A 6REQA 2IGLA 4BSWA 4NM4H 4ZAYA 3ZUCA 3F5QA 4JL8A 1MGOA 1T3TA 3KDPB 4NZFA 4HUCA 4J8RA 4HCRL 4HGRA 1K6EA 2YS7A 4AAYA 1T5DX 3O2WH 1I75A 3KSRA 2WTRB 1X6NA 2HU2A 1X9HA 2L4OA 5KZCB 1DUVG 2I33A 4Z9XA 5C07D 2WVJA 4W5TA 2BOCA 2IXBA 3SIPA 3SXUB 4JN2A 1AKVA 2IPXA 5I1EL 3TF5A 1XKXA 3QI9B 1ECCA 3HCAA 1QYVA 2A74A 4NIYE 4NQCE 3PAVA 5HP4A 3NJIA 4OGYL 2HJHA 2Z3ZA 4IUDS 3H3KA 4NQDE 2IQ9L 1XCPA 2ZJ4A 1IJFA 1N6LA 1E27A 1KYAA 3C9NA 2D0GA 1YU9A 4OJTA 3VUFA 1E20A 2YJNA 4ND3A 4RVOA 1FFDA 1A21A 4R4FL 2Q5JA 4FJ0A 3B53X 4O5AA 2H1OA 1CBJA 5I7EA 1ORSB 2R4QA 5B38G 4POUB 5JMOA 5IMBA 4IEFA 1JE6A 3AG1B 5COAA 4K05A 2GJSA 2OV2A 1GPWB 4FA7B 2QAIA 4GX5A 1G66A 4U3XA 1MIML 5CEZH 2HSGA 2B2NA 2CFTA 3SXUA 3FMGL 3GHEH 1OXBB 4X5XA 3INRA 3GPLA 3TO4B 1OB5A 2IOIA 2HTKC 4B9FA 4QPEA 5KVDE 1VGKB 1U2QA 3GB7B 3AGPA 1R46A 3CEAA 2MSLA 1KETA 1YTLA 4XOCA 2H8GA 1QDLB 3LN4A 3DYIA 4R05A 1YRHA 4BUHA 2ZS9A 1KCWA 3P4MA 1KK2A 2B14A 2EDXA 4WLVA 3QVGA 3EHEA 3SHSA 1HEHC 5ALRA 4CW1A 1SVUA 1HG1A 4GRIA 1ID5I 1MMFB 1A7BA 1Q0QA 3WKYA 1GKKA 2EKZA 3BP6A 5IK2D 1G6VK 1ZWIB 4UNTA 1U0RA 5IGXL 4WH0A 4WDIA 4YJGB 5FM5O 5AUPB 4GXUM 3B9VA 1FE8H 1SCNE 1UFKA 3V4SA 2D7JA 1F0YA 4KV7A 3G85A 5EG6C 1E9PB 2VP5A 3BKXA 3MD9A 1L4IA 2GI4A 3QAZC 1E2LA 3RVJA 4URHA 2FF5A 5B1JA 2WUGA 3QJGA 4Q93A 4YK4C 3IXQA 5J43A 4EM6A 5D5HA 2FPWA 2P9YA 3CSSA 3MS2A 4AECA 2FPRA 4NI3A 1ZGZA 4ID9A 4MXQD 4WW2C 2P5WA 3CEJA 4YC2C 3GRKA 1GY8A 3B1VA 4A6YL 4QM7A 3A2LA 3GFVA 3LS4L 1Z35A 1MRCL 1QRND 2FX7L 1NR7A 1XNJA 3WMEA 3IKVA 1G41A 3GJFK 3DT6A 4QUAA 2JAOA 1D04A 1Y0LA 3BGVA 2FOLA 4BWGA 1KTBA 3FTNA 1HIML 2YJ6A 4CIBA 3OB0K 4JOQA 4OZGE 5BN5B 5KQSA 4M8RA 4QCIA 1OZGA 3LQ2A 1OZUA 3VKFA 3B2DC 5A4KA 2RHOA 5CA1B 1YQVH 4C4BA 4BGLA 3WO0A 1JDBC 3ML8A 1QCCA 3D4GA 2XA3A 2XICA 4CUZA 3GP8A 3VQTA 4P4KB 5I9BA 2OHHA 2QQGA 2OOKA 4FHGA 1NWPA 3SEFA 2QXUA 3UYRL 2ECPA 4X93A 1G5IA 3NYWA 3HYSA 3G5XA 2HKHH 2V8OA 3BH8B 3QNFA 4NOLA 1XDSA 4D46A 5E7QA 1IAMA 2WXQA 3MRLB 2N4IA 3CN3A 2YQ5A 4IRUB 2V9UA 1UJ6A 1HXYB 3THYB 2QGFA 5LQDA 4JASB 4MVJD 2YMXH 3MUFA 2GETA 5THKA 4RXTA 2VFAA 4TNEA 2R8BA 4XJXA 4BLQA 3GRAA 3O2VL 4DBZA 1TM7E 2O6CA 2CK3A 1TU0A 2A6JB 3QUKA 1THTA 4J3UA 3WK9A 2NZ9C 3HMXL 4TXMA 2Q2LA 1YR7A 2YBEA 4MS6A 1MNNA 4DNQA 3JALB 4XO5A 5AOJA 1AB6A 3DMHA 4GKKB 1RRFA 3MT8A 3HG4A 4PRNA 1EFVB 1ED3B 1L9XA 3JUYA 1U2CA 4CCAA 1FP4B 3LVEA 1CX9B 2DCUA 4RH4A 2B82A 3KQTA 2ZJOA 1P29A 2FZGA 3RB8A 3STZA 3M1IA 2ZONA 3EFDH 3FZGA 4JFZH 3WEOA 1M6WA 4RDQF 1L4MA 4MWGA 1ENYA 2NSLA 1YK1A 1GJWA 4MR9A 5F7NC 2V5SA 2BHLA 1KUMA 3P69A 5IJAA 4ADJA 3IYLW 1G7QB 2QI9C 2XCIA 4I5BA 2OTPA 3GF8A 3MJ7B 4YHNA 4ANWA 4L9DA 4QULA 3ID6C 1OF1A 4DMMA 1RKXA 4PWIA 4G4SO 1CY1A 1IM3A 3JQFA 2NYUA 5CW2A 2QVYX 5LKRA 4LSDA 4MBRA 2VNIA 3HMWL 3VACA 3MLAA 4JREC 3FM9A 1QG4A 4M98A 4CNQA 1ZW6A 1EUUA 5DZJA 2WGNB 1SC6A 3I75B 4H1LB 2G0LA 1MOEA 5ADPL 2VNHA 3F3MA 4BFGA 1NBIA 2BHUA 1WCBA 4M43L 2V2XB 4HNUA 3C6MA 3I1YA 1YCGA 1I1AC 1H4SA 1UOVA 5I3ZA 4F8QA 1OK0A 3ZD6A 4MCZB 3ON5A 4FNOA 4I6EA 2QX9A 5D71H 5AG9A 2AI0H 1S5HB 3KUKA 4ZJ9A 1TA9A 3ZVKA 2OK8A 4IHBA 4EN3D 1O95D 2H85A 2W95A 3A0RB 1JDTA 4H40A 4KX5A 3MLWH 4L50A 3KJZA 3AW8A 5FW8A 2D62A 3TOSA 1INEL 4AICA 5HJ3A 3KXPA 3TIDA 1U8LB 3D07A 4A63A 5T5NF 3BKWA 4XLZA 3VXRA 1C3OA 2OHXA 1CIVA 3UO8B 2JKTM 3T54A 3TX4A 5EBMA 1IBCA 2F53B 2JL1A 3TBKA 2HT2D 4A2LA 2OQIA 3BKMH 4UILL 5I24A 5L7XL 1NUHA 1A4IA 2OORA 1H0DB 1T2QH 5IT4A 2PJZA 3GEDA 1O0SA 2BHYA 1LV7A 2AJDA 1WT5A 3ARYA 3BSHA 4OFYD 2VW6A 1Z83A 4OCWH 2ZR9A 5DB4A 3QW4B 4WI0A 2X89D 4KB5A 1NLDL 5I6OA 1T4KA 3SDXF 2WWRA 3BDAA 4K46A 4R96A 4Q48A 3RADC 3GGWA 2CUZA 1MX1A 1FRFS 3AG2B 3O0RL 4MJID 4P4SA 2AR0A 5INTA 5TPWH 2VKTA 2NT4A 3USES 3N86A 4KK5D 1RK0A 3PWUB 1M67A 2YFOA 4FE3A 4LLYA 1QR1A 4RGMC 1U6KA 2FWIA 3WL5A 4DMHA 3KYIB 3SYCA 5JS6A 3FTFA 2EOAA 1M7IA 1D1SA 4MA4A 3H3FA 4ICWA 2XT0A 3ANTA 5FO8B 2R11A 2Q20A 2Q2OA 4FDLA 4PW9A 5AW2A 3GW8A 3LC7O 3U44A 1EZVY 3KLHC 4HEHA 2RHCA 1RMFL 1YLBB 3TQRA 1D6NA 1BYUA 5CKGA 5LZ9A 3OHXB 4X60A 3P9LB 4NZPA 1T9DA 4MNHA 3N39C 2RGRA 1SCIA 4OQTH 2D4FA 4XZ3A 1EFVA 1PLLA 2AXGB 3LDUA 1IY8A 5LMCA 2OKGA 2ONYA 4B8ZA 2CB9A 5J63A 4F8EA 2HT1A 4Y5VA 4V38A 3OB0H 2QD3A 1UPBA 5EWJB 1P17A 2XTNA 4NPKA 4AO8A 3D6NB 3P30L 2ZK7A 3QBVA 3SPIA 3DHYA 3FNEA 3V9AA 1ADYA 5KSUB 3U46A 3KWJA 4UM8B 3SDXB 2HNKA 2C4VA 2Q4EA 2I7OA 3GBEA 5FUZL 3N8HA 5AJXA 2HCJB 4AYXA 3QIAA 2YYSA 3QEMB 4Y9GA 1WCIA 2C1EA 3NJKA 1RXYA 3T7SA 4YE0A 3BAFA 3MCLL 4GP9A 2QHRL 4WW2B 3G2KA 1KFGA 4JO1H 3V1NA 1T0NB 4A2FA 1R0AL 1B4RA 1AFVL 3BSZH 1PD6A 3E9ZA 3DE2X 2Q3BA 1U8HB 1V16A 5TSDA 4GUPB 4XSGA 4M21A 5GRWA 4B80A 4CN1A 4JG0L 4KUCD 4KKNA 3ND5A 5LDDC 5GGQL 3EIOA 1E28B 3OQPA 1RQGA 1AO7D 3O81A 4FFBB 1BS1A 4W9NC 2XOKD 3LIIA 5HHTA 2QMEA 2ZTBA 4FZ5A 1D4FA 4HEME 2FZCA 3GRRA 2BGJA 3FC8A 2L82A 1S7UA 4JNXA 4OP3A 4HPWA 5KVSA 2DYPD 1A9EA 9LDTA 4DIKA 2L7EA 2XZOA 2FW7A 1PZMA 1R2QA 1RIVL 1KGIA 1M2VB 1HK6A 5AM0A 1WQVT 1MCHA 2X28A 4MZRA 2AG1A 3MTQA 2DZEA 1SN5A 4PFQA 1GUAA 3DROA 5M2QA 3T7AA 1QFZA 2FEPA 4PRIE 3QQPA 4UUJB 3OZXA 4NDMA 4BAUA 1P5UB 1Y7VA 3Q72A 4AIRA 1WBBA 2KERA 3ADDA 2OYCA 3CHOA 1WKCA 4XRCB 1LQ2A 1H3NA 1MHHA 3O8XD 2EEDA 3BJIC 1H5BB 3MUY1 3R6GA 1HE7A 2OSXA 2BEWA 5AFSA 2FEEL 4CMHA 2H2PC 2YXWA 2O5NA 2GY7B 3EHBC 3L43A 2XTAA 2NXZC 2RGCA 2XQYG 5DYOA 3VJ6A 5JH7A 4WO4B 1FA9A 4FD3A 4WI2A 1NGPL 1X7HA 4H59A 4IU3A 4PJBB 4I77H 2NZ8A 3MI6A 4TWZA 5CDFE 4KTTE 4L1DA 4EJSA 1URLA 2M6LA 1XOIA 3NU1A 4RBNA 5LU9A 3OKMA 4DMLA 3O38A 3H75A 4RGYA 4PHXA 5FW6A 5GZOD 1ONBA 2OO3A 1YF3A 1H05A 4CLOB 4PHCA 1YC2A 1UOLA 4XODA 3MRRA 2IANE 2VPYA 3P73B 5E8JA 2HA4A 3B9EA 3WQBA 4IMIB 5DJYA 3DFFA 2YRXA 1E4OA 1W36D 5A3QA 1BF8A 5BQ7A 2K0RA 5LQSA 1V8PA 3KPRE 2UZIR 3UKOA 5ICYB 1RU3A 4H60A 2PLWA 3WD5L 3MGCA 1KXZA 4CJ0A 2JIXD 1RW4A 2GFHA 2R6HA 3I9GH 2IMMA 4NO0D 3W8EA 5DBEX 3CZPA 2X4IA 1NGXB 4QYOB 3WKEA 3R5HA 4JSRA 1VENA 2WQWA 1I8MB 3PS6A 4DGYL 1IDN1 2VO8A 2E55A 1GGJA 2QPEB 4ZVOA 3OJDB 3PCXA 9PCYA 2CZCA 1M7UA 2I3AA 4HIJB 2ECOA 2QLBA 1SD1A 2Z5VA 1YECL 2C99A 4KGZA 4QEGA 2R6R1 3R9IA 1RJ9B 3OZRA 4NI6A 5IWAB 3MRNA 5TE7L 1T21A 1YN7B 4JRWA 2WXLA 4DUPA 3OGCB 3BHJA 5DJ0B 2JDID 3WSWA 5CYPA 5I7VA 1Z38A 3CF0A 5SZIA 1TZOA 2X5XA 4UKDA 1H3UA 4GOMD 1RZFH 4FSXA 1BLNB 4O02H 1CVIA 4AGMA 3ARVA 4JVSB 4LXIA 2ZBRA 3ILVA 3KCPB 2IAMB 5D4HA 3ROOB 1BWPA 3ICWA 1GGTA 2CAKA 4U2FA 3GZQA 3GCXA 5BUQA 4MQSB 1TZKA 1YJBA 1G2OA 3G5YB 1YJDL 1A7OH 2WEKA 3S4YA 4MZ2A 1UJCA 2BH9A 4P2BA 4PPTA 2CUNA 5EUMA 2E1RA 3DI2B 4M8QA 3EUEA 2IOMA 3ZXYA 4I2NA 1HLFA 5K9OB 4FLFA 2H0RA 5E2AA 1VJSA 4M1EA 1RULL 4R8SA 1UBTS 3PKJA 2OTWA 2D9QB 3HZ3A 4FQ2L 4JFVA 4OFPA 3EFFA 4BMVA 3HIZA 5DGQA 3ND6A 4I1NB 4II2A 3X2EA 2CLDX 1WD8A 3S1AB 5BYBA 4R7VA 4X6UA 4JM2F 4F5CE 2COUA 1NQTA 5LD2C 3A2NA 4OKIA 4Q6IB 2R0WH 1QLJA 3EA0A 3MV7B 3O9ZA 4D26A 5JJBA 5HBRA 2P2SA 4N7RA 3WQSB 1OL0A 3JAKB 4OREX 1NXVA 3AZPA 4ZAGA 1RZJC 5CGTA 3LV8A 5D1XC 3GKWH 2PP9A 1WGVA 1YRWA 4P3CL 4XIIA 2WYOA 5MI0B 5P8WA 1SXSA 4I1VA 2X38A 3I62A 2XWJA 8MHTA 3ZHNA 2ATKB 4QLOA 4BASA 3MOSA 3RUGE 5HHQB 3TLCA 5DLQC 3RSZA 2FVNA 3LXUX 5CLTA 4MNGE 1IEAA 1VMIA 1Y7IA 3AL0C 3WQQA 2LCQA 3HH8A 1SIOA 2RIPA 3NHLA 4OY9A 3ZKMC 5J47A 4MUNA 4AKSA 3V10A 4ISVA 3DL0A 1K8RA 2NU6A 3X3FL 3B38A 4JP3A 4KAJA 4XYGA 4LJSA 4Y3UA 5KJCA 3HV2A 2LTQB 1ZHBB 3LLSA 5AW0A 1CW2B 3D2BA 3U4DA 5TEWA 4G5SA 3R3WA 3V97A 4LGPB 2QUJA 2JJ8A 3MLPA 3DE1X 5EL0A 1J0DA 4TVOA 5CKAA 1NIDA 1JG9A 2C3PA 1NM4A 3ZD7A 4HBCH 4A7QA 3ZHSA 5E99L 3U0TA 5CLWA 5JQGB 4WU7A 1THCA 1TMCB 3A04A 3LYAA 3Q8WA 2A5UA 2GBIA 4HFRA 3DO4A 1AQ6A 3PIDA 1I36A 1IHYA 2PZGA 3IBOA 1KZ7B 5B58C 4TL7A 2V7BA 3WYDA 1IGYA 2FJHA 1WUHS 4XMWA 4BBPA 5JLZA 3SGJC 4A0HA 5HI4D 3U7RA 1YIAA 3BMXA 3QFFA 3VM6A 5C07E 1ISRA 2GEEA 2Q76A 2YV4A 3FTVA 2QSZA 2ZIAA 4DPAX 5I73C 1BD3A 1DZ0A 4JBSA 3X1YA 4MB4A 1JYEA 4F91B 5CJXA 1WV0A 4X6CA 1JQ5A 3IDFA 1O89A 1WLYA 4GRWH 4QDTA 2W88A 4G6FD 2GRJA 3KPOB 3M1LA 4HPYL 3FZUD 4XP4H 5GZOC 3DSFH 1K89A 4N8VG 3ULUC 2H08A 1OGAA 4ITRC 1M7BA 4M5YL 1L5QA 3PJNA 2X0VA 1BWMA 5JNRA 1OCEA 2Z7WA 5JSZB 1OGPA 2RHGB 5T3XD 1A98A 2WP0A 5DJ6A 1K4DB 5E1GA 1EHYA 1Q3TA 4TWJA 5EFZA 3CUVA 1OLUB 2ZRKA 4Q1CA 4KKXB 3RVUD 5LLSA 1EDDA 1XO8A 2VHZA 3BA1A 1PS0A 1KB5A 1U1FA 1QLRA 1AMUA 1A3RL 3SDZA 3CDGA 4G1EB 1JZ5A 5C09B 2FO4A 2DTDA 2Q3XA 2OFXA 3WKAA 4IOLA 3GSNH 1VXRA 4OQYA 2GN4A 4WO4A 4D45A 2TMDA 4RW0A 1UMBB 3RJ9A 4C7XA 5D72L 1JXOA 2HKFH 1GR1A 2YRLA 3T8VA 4C6TA 1ZA3B 2WC7A 3G8CA 1KT2B 1A72A 4B45A 4CG0A 2EL9A 2ZJZA 3QHZL 1OTXA 5FO7B 5C6TH 1H85A 3NBXX 1Z6JT 1FIGL 4HKZA 3LFUA 2R8ZA 1CD9B 1PT6A 2PR4L 2XUZA 4KWIA 1MFBL 2EH7L 4BYMA 4PG7A 2X0NA 2A1UB 2YUXA 1WEJL 3GQVA 4LV8B 1I6WA 4KPHL 4CU5A 1PKEA 4X98A 3CFIC 2H7WA 3DBVO 1DRKA 4YMPA 1DIOB 1W4CA 2PT7A 2ORIA 4OV6B 1IGCH 3M4XA 2YRBA 3NWOA 1T2AA 4PP2A 1E8ZA 3EOYG 4LSUH 5HDBF 1XA3A 2QYTA 4F1JA 3BX7C 1ZRMA 2M26A 3WNZA 1UUSA 5IW3A 1VPVA 3N43F 4V1CB 3R40A 5JNUA 3VI3F 2WOJA 5KTKA 2VLKB 5LO7A 1SOXA 3BD5A 5E6SA 3EXJA 3NBKA 1ZRSA 3GFBA 2G75B 3TLYA 3HW7A 2NY5H 1E2EA 3V4PA 4AGLA 1EZUA 5E8PA 3GRYA 3T61A 1R3JB 2EW2A 4YDLB 3Q48A 4C3ZA 1GW6A 3T0AA 2EC5A 3TMAA 1UDWA 3IGKA 2HSIA 5LNGA 3LRMA 4CVWA 1M6UA 2LD4A 2PRKA 4BQQA 2ZPUA 1RL1A 1BVNP 1LSUA 5E3JA 3VNUA 1G8KA 5AVQB 1KBZA 1RV6X 3LCVB 2VSFA 4K3JL 2I99A 4KQ3L 5BV0A 3V4FA 4ZDKA 2BKAA 4Y4KD 1U94A 1NEPA 3AHGA 4OW6A 2FSVA 5DJAB 2FNWA 4JRXA 2JCCF 2ZXEA 2PPLA 4ALAH 1RWMA 4XLTA 3K8OE 3W6PA 2P7TA 5DULA 1M1XA 5L8KB 4G2NA 1A1SA 3O4LD 3FUWA 4IKKA 3V52H 4FVTA 3WB0A 4L8BB 4WNQB 3WK7A 2CKNA 3TVDA 4JXZA 1O6CA 5GJSH 2VNJA 1DBML 3NNDA 1J8HA 4L29B 1SLVA 1MA3A 2X0EA 5E8OB 1YS7A 1E79D 1ZM3A 1PTKA 4FW8A 1BVKB 4YSDA 4L05A 2ONCA 4JFQB 1BJTA 1KJIA 2FQXA 2YAHA 3KJEA 1Z62A 4G1VA 4NRZB 1VFMA 2HX7A 3IFNL 1GRNA 1RAHA 1U8HA 1MOPA 2GEJA 1OIVA 1FQ9C 4C8XA 2O4CA 1ZKAA 2Y66A 3B2XA 4RGMB 1TO2E 2IU6A 3TCKA 5IKPA 2Z31B 3DO7A 3RL2A 2NP7A 3LIZL 2ZRFA 3LLUA 1XR9A 4FFZH 1OAZL 1SF5A 2EARA 4G1EA 4P46C 4JU9A 2PCYA 1P5FA 4A0SA 1S7WB 1SOMA 3QDGA 4BX8A 1SXJD 1OSZB 1GCOA 4H7EA 2AC0A 2XKUA 3CH6A 3OJWA 1LMIA 4B79A 5EWIL 1O54A 1SHTX 1J5DA 2BSED 1AT1A 2H1FA 5CGYD 4YDQA 3LYLA 1CZRA 3SLKA 1P4GA 1PYWA 1Z22A 2O8DB 3TTUA 4PV8A 1QSEB 4UQCA 3M9WA 1IBBA 4OLBA 5JA8B 4H6VA 1LI4A 2EEZA 4F04A 1TVCA 5AAMA 5E2IA 2PXCA 1DBWA 3AEKB 4G7VH 2NDGA 1R6VA 2EYTA 4XNDA 5A5GA 4LTNA 3F0TA 3ZWPA 5F7EL 4MRAA 5CLIA 3KGUA 4JFED 4Z7QB 3IDQA 3SQBB 5J9PB 2P6PA 2FSGA 5HDBE 2IK8A 5DNYB 1C30B 4OUDA 5D7KD 1OTUD 1ENPA 4TLUA 4MV4A 4C05A 1SOAA 4I8IA 1EZZA 3VNVA 1SEPA 4RK4A 4TTSA 3S55A 1DV2A 1XEXA 4I1RA 1H1LA 2RAVA 4DHWA 2MSWA 1C14A 1W91A 3L3HB 3T3ME 5JW5B 2WAHA 1TK9A 5BV7H 3BMVA 4XO8A 4XCQA 4YDVB 5U1PA 2VISB 4XCVA 3S35H 4ER3A 1TK3A 1SJHB 1OXYA 4IKJA 3FT4A 2I8CA 2PKCA 2VN3A 3FYSA 3KUUA 4YX2H 4EE2A 4ENZA 1RQXA 5HHVL 1H3FA 4FLHA 2X6BA 5DSCB 3QFJE 1KCRL 1AHWC 1I0IA 2G04A 2NTYC 3U7AA 3FB5B 4KQIA 4ZVMA 5HQ3A 4A67A 2QHXA 3K0WA 5TE4L 4LDCA 3ZX4A 1JJBA 4DVBA 4HTFB 1J5OH 4ARAA 3L49A 4NFLA 1XYYA 5BRQA 2H06A 3HDHA 4BE7B 1J9GA 4HWSA 4PE5B 2R1XA 3JVEA 3U3RA 4J9VA 2VR9A 4MZXA 3MV7E 5I1IH 3UAXA 3F7VA 3I02A 3V79C 1NOFA 3C5ZB 3E8SA 3T9AA 1H2HA 5EJIA 4ZYKA 5CB0A 3WNLA 1IQUA 2AK1L 1CICA 1XGUA 2GXQA 3X1MA 2YJLA 2JGIA 1SPXA 1YCFA 3AR6A 1KYYA 2EIXA 5FJIA 1PZCA 4D9IA 2YPKB 3SKMB 5IDQA 2K5UA 4MLDA 1BW9B 2EQAA 3OFNA 2IY8A 5FA5A 5IREA 5AW9B 4WKXA 3ZZNA 4RTPA 1GG9A 3JZ7A 1SOWA 5TPWA 3I04M 5KVFE 3BHNA 4HVTA 4BFBD 3RX5A 1IXZA 1LRJA 2CVOA 5EBLB 3HGQA 3LBNA 1NDQA 2I7XA 2XGOA 5IB4B 1MJ5A 3QOWA 3X12B 1ORQB 3W9BA 1BO6A 3LNIA 3CNEA 5DT1L 4KRPB 4MPRA 4RXUA 4Y9CA 2IVFC 3NSDA 4AI7A 3IOBA 1J1OH 3TBVA 4M9OA 1LEKB 3KXDA 4E4RA 4Q0XH 4PRDB 1RLBA 2F4VB 4JFEE 2FW0A 5F9MA 4BA0A 2AQRA 4Z8YA 3QUCA 4GP5B 1GAQA 4K7PH 4DLWA 3ES6A 4WKZA 3WFCH 1KZQA 2ZSEA 3TZBA 3DEKA 3Q0IA 1YCSA 4P5PA 4ZTOL 2GJRA 2C1OA 4M7LT 3ESVF 1RR6A 3QJQB 1XE3A 1U4EA 2B4CC 4Y2OB 3KVOA 3SIKA 2WO4A 2CHEA 4OHZA 1UZ8A 4DDWA 4M88A 1QR6A 4XQEA 3G0DA 2FMTA 1R0XA 4MTMA 3VFMA 5JBQA 4GQIA 5K2OA 4J7AA 1KEKA 2PKEA 4K5NA 3FIUA 3KKMA 1GQFA 1THAA 2CV1A 3CFKB 2CJXA 5KSVA 4OA5A 7AT1A 2H6EA 4F60A 4TLDA 3BO8B 1KNOB 1ZUNB 5D96B 4Q4CA 2CH8A 2AW2A 1U3YA 4AQAB 1AGNA 1NBAA 3K72A 1A2YA 1QWNA 1KEMH 3RVVD 1K4KA 4BMYA 5DSXA 3JV4B 2OCYC 1YNTF 1UT1A 3UAAA 1QHXA 2A5JA 3IVRA 3S29A 4ARBA 1YVRA 5TJ9A 1FDTA 4X6DA 4Z77B 1B2LA 1FQKA 1URZA 4HK3N 1POWA 4LZJA 1I8IA 5ANMA 1IEBA 1KIPB 1QDEA 5I7FA 1UBJS 1ZK1A 1SC1A 5JO5B 1D5ZA 1MB0A 3MLYH 2Q50A 3IDAA 3SBQA 4HMQA 1TD1A 5B38A 1T1IA 1AZTA 1Z6YA 4FK8A 2JI2A 1PFWA 4JFYB 4WWKD 2O5ZL 3VHQA 4PG9A 4DLTA 4RKFA 4IFIA 5C0GA 4Z7QF 1S9KC 5AI8A 3VSTA 3MGGA 4DDMA 1KKMA 1JU9A 1KC1A 2QZZA 3CZJA 3FNRA 3QYCA 4WTXA 2KWIA 1PBTA 3C48A 1XXFC 5H3LA 2A74C 4GE0A 2CL5A 1W59A 3ARGA 1TAGA 3S3TA 1YBVA 4LSVL 1BJMA 3G1WA 1N5IA 3RA7L 4YZFF 3QQ3A 3I6QA 3QG6B 3MRSA 1H6AA 3BK1A 2PWAA 2NY7L 5AKEA 1CJSA 4UVIA 4EGSA 3B9PA 3L6BA 1TJPB 2O1XA 5DDHA 4F6RA 4N48A 3WXVH 4LNUB 5DZSA 3ZDXE 1FJ1A 4JGMA 4G42A 2E8YA 3WTXA 2F1BA 1O6ZA 1JUFB 4JM2D 3MFFA 2J09A 4KNQA 1G5HA 4P6VF 1YEKL 4E2OA 1GSIA 4PRPD 1DS6A 3PNKA 5JZ9A 5E7MA 4EW1A 5D7JA 1L5MA 3S2CA 2QAGC 3UPRA 1N70A 2YINC 1R33A 2ZPKH 2QOEA 4MV7A 4ENSA 1RE0A 3EF0A 2QT1A 4U1NA 5F88B 1U0HC 1BX2B 1RFDH 5BR7A 1E9BA 3C6LC 4NUMA 1WVGA 2JKRM 4PJFA 2ITCA 1B76A 1V10A 1KOFA 3KBHE 2OEPA 4GMTH 3PHOB 4V2IA 1Z5LB 1L1EA 4D9QD 1XVTA 1KGWA 3LBHA 1NC2A 4HH9A 4E14A 2HFGH 4WINA 2DQUL 4AN4A 1WWCA 1X5AA 2XG5B 3AADB 3O74A 4Z4EA 3QVGB 2WWOA 1CDYA 4B4KA 1OZ0A 4AV0A 5GONF 3R5JA 3RB7A 1EXMA 1LM8V 3PQFA 2R59A 1HSBB 2AJUH 1BE8A 3D6JA 3DVRX 1U31A 4HB4A 4QU8A 2ISSD 1L9TA 3QRLA 4IIJA 3U7EB 1ML4A 5G3ZA 5IOPB 4OM7A 5C7LO 4UDOA 4CR6A 2HYMA 3W3ZB 3DONA 5D3QA 4HPJB 1B3RA 3U7QA 2YZ1A 5T5FH 4Q6WA 4B6GA 1VZ2A 2Y1WA 3H0TB 5GGVL 3GK8H 2QDXA 4N7JA 4WW2A 1TNMA 3HVDA 2D1FA 5AW5B 3MRGA 2HADA 3AY0A 1M8PA 2H3KA 5HVFB 3SFTA 3W1WA 1PYOA 5DO2C 2PX8A 2RMNA 1Q9KB 2Z30A 3EMDA 3GOQA 3IB4A 3D1JA 3DT9A 3SF0A 1F8UA 2IS4A 1HF3A 4R9UC 3EGEA 1Q9OA 4C2TA 1OE0A 5G53C 5IGXH 2FECL 3IOYA 3UXEA 3MV9B 4FB5A 4MP3A 4KO3S 3F6YA 2Y05A 5FCUL 3D0AA 4HZAA 2PQ6A 2BVPA 3GX1A 3DXZA 5DM4A 2ODIA 1MH9A 6NULA 1DVFD 2H32A 4CKVX 2JLPA 1W46A 5EUOB 3B8EA 4HB2A 4PRAB 4Q4IA 5L95A 1MJGA 32C2B 3TBYA 4Y30A 4EIWA 3QHFL 3OR6B 2YPKA 2ZTHA 4XIJA 5EB9A 4DVRH 2A4CA 4ODXB 2XF8A 1R5IA 1MWAH 2FQYA 1NW9B 1GN9A 4WLUA 5DOVA 5J40A 1VGVA 2XFGB 2IG2L 3GFGA 3EGDA 2HPHA 2FPPB 4CM4B 1WF5A 4TL5A 1I3LA 3R7LA 2IBZY 3G8DA 4CI0B 5JNYB 4FMFA 2GNAA 3U44B 2G17A 3VRIB 4G43A 1BN7A 3W7VA 4JN1L 3NZUA 3HKFA 1T2XA 1DEOA 1ZLEA 2G07A 3SOZA 1OALA 2VSNA 3BGSA 4B2LA 1N4DA 4MJ5A 3IA7A 4A6YH 1IAVA 4WN9B 4PEEA 2DEYX 1MUJA 5EORH 1U0OC 4LVOB 2V7EA 4G5RA 2IPAB 4PYLA 3S4SB 4BBZA 5AOMA 2FIKA 4MI9A 4S0HA 3O4FA 4AV5A 2BRQA 5D7IB 2NLJB 5AI6A 5PCYA 1NBWB 4IWNA 4FCCA 4IF6A 3RWDB 1E2IA 5JIKA 2EG5A 3CFUA 4IHJB 2G08A 1H1LB 3D2UA 1YSOA 3P9QA 2R8SL 1SBSH 3SO3C 4NKDA 2PGJA 1V11A 3NHMA 3C1AA 1N59A 4Q5IA 4Y4HD 4DM7A 3ND8A 5E0OA 5AKVA 1N12A 1UGKA 1AS0A 2F5AL 4LJ7A 3NIGE 3DVGA 3KZNA 1D5BA 1JGUL 5IT2L 2EVGA 4HGOA 1BXGA 2OPHA 4ENRA 2XN0A 1SFRA 1BCIA 4JL5A 1F5SA 5ICUA 5JW3L 2NY2D 2Y36H 2P9EA 5FWYA 1FZJA 1JVSA 4EYQA 3VMFA 3GRUA 2DEUA 2AK3A 3FD8A 1TUBA 4GS7C 3R5XA 4KXQA 1FLTX 3TJHC 3VSBA 3EGIA 3FOFC 2BFFA 4Y6PA 4FRWA 4WWKB 2XD9A 4M9XA 2CG9X 1IZZA 4YRRA 3CJRA 1FO0B 4F9LA 3W6OA 4JM4L 1TJNA 3H8VA 2DKNA 2QUHA 3VI4B 3LRSA 4RVNA 5C08A 3LW7A 2GXAA 4YP9A 2CLFB 1Q77A 5I6XC 4G0UA 1A9PA 2MINA 3KD3A 3NI2A 1PJBA 4NZNA 4BKLB 3H9SE 1EX7A 3UENA 2J20A 1NJ6A 3UJTL 4RGVA 4NYLA 4U7HA 4HD9A 2WAQA 3C2QA 4OIIL 1PG7H 5IHBA 4C0JA 4IVNA 2JLVA 3A4VA 1FZOB 4RFNC 3N04A 5F1KA 1LP9B 1NU6A 2FYYA 5I9NA 1KFAL 2WOYA 4WWID 1ZGLM 1VRVA 4JLKA 5F7DB 2PYEB 4A2GA 5K0LA 4GAJL 2OXGA 4U2ZA 4JGUA 3GAFA 3DA8A 1E5QA 4PLKD 4BZ1H 4H13C 1JKJA 1KIAA 3HUFA 3H5OA 2EDCA 4W8HA 1B0ZA 3K0AB 1FBIH 2GJPA 2C2ZA 1IN8A 2LLNA 2GPWA 4EB3A 1NEUA 1JMYA 4LEOB 3VFGL 3LW8A 4G6JL 1ZXQA 4P2QD 3RTDA 2C2GA 2WIMA 4FEMA 2AD5A 2VCOA 3VWJA 1TJ4A 3TSAA 4EKEA 5JYDA 1GMIA 1A9RA 2AQKA 4EKNB 1CDIA 5DZ9A 1S4MA 5IHHA 3TR6A 4AP5A 4P57A 2OYRA 4JLRA 1J88A 5ADOL 3PXDA 1QH0A 4MNQD 1NN0A 1T3SA 4L3ED 1WBDA 3HABA 3FSZA 1XJ5A 2FJUA 4CC4A 2WK2A 4XPHL 2BEWB 4CRWB 1YRKA 4WOPA 3IXMA 2PZLA 4XMLL 3UACA 1E4WH 1ZFNA 2PQMA 3NLLA 4PRIA 5TDPB 4HL6A 4XXHA 3WRXC 1P5UC 1TVHA 5LDGA 5I23A 1AF4A 4Y7MA 4PLGA 2ATVA 1BQHA 3LXAA 2OMEA 1DV1A 1TU4A 5D2NC 1U65A 2VZOA 4ZPTB 4MRMA 1VF5C 3SJAA 4NDNE 1OQXA 4A0GA 1NLDH 4L9LC 1CE6A 1DQQB 3ZR4B 2AG8A 1KPRA 4JX9A 1GGIH 3RHZA 4BQIA 4XCYB 5DMJB 5HGAB 4G5QA 3T15A 2PZEA 2OT3B 4O2AF 3MXVL 5I0WA 3JWNE 2PUDA 1O9WA 3O3NB 5BQ3A 3T0FA 4IO1A 1P19A 3T3MF 4ARZB 1F11B 1HUQA 2C3VA 1OKKD 4KDEA 3LRXA 2OBYA 4ELMB 4AYDC 2FZ4A 4FN0A 1UM6L 4GIPD 4UDUB 1HQDA 3T3IA 3AUXA 2IU0A 4MWDA 4BNVA 2XKNB 4OXRA 1CP3A 1EP3B 1RLTA 3WISA 4KFTA 1USIA 4GC9A 4HJUA 1AA6A 4KQEA 1E3ZA 4M61B 4R7GA 4DPMA 3FSGA 1EAOA 2FD6H 4Q47A 1IEXA 3OPUA 3BIJA 1EGHA 4KMLB 4GNKA 1GPKA 4Y4FB 2WWGA 1RUKH 3ZZSA 3I73A 2VLIA 3PNMA 2HRZA 4CU6A 2BBWA 2CUKA 1QMPA 4G70B 4G7YL 2NSMA 3Q2VA 1G4HA 2JGFA 4ODTH 1ONQB 5MDHA 4GMSH 1F6AA 1V9CA 3A3PA 5DASA 4CEJB 4ZMWA 3OKCA 3WYRA 4X94A 4HIHB 4KDRA 2A5LA 4P2CG 1XTVA 4FJ6A 2P9BA 3AS1A 4O2AB 4IGKA 5DS8B 4M8KA 4N41A 3ZVRA 4KE8A 2W2QA 2CRZA 1A04A 3IEUA 1UWGL 4ODXA 3LRKA 1C9KA 1EO8L 4PLJD 3QLTA 1ULBA 1JA1A 4LLAA 5ESWA 1RIUL 2WF7A 4W7IA 4LGVA 2P0YA 3TC9A 4I1OA 3PD7A 3K46A 4KXNA 4LFAB 2XIDA 5BRJA 4ERSH 3WGNA 4WI3A 1VBNA 2Y1XA 4FX5A 3GM8A 4JG0H 4IGIA 5A62A 3I2GA 4I9HA 4WPGA 1JNLH 1EHLL 1OGYA 1U80A 4RPJA 4WKCA 2BEUA 3FYCA 1E4JA 3KSMA 1D9KD 4C6TB 3PHOA 1UXKA 3QKWA 1QFOA 4HWZA 4IM8A 1HL5A 4TLLB 5D1QE 4OJNA 3ICOA 2IP1A 3WMSA 5FBZA 3NJGA 3UZEC 1NC1A 2GN2A 4P54A 2I25N 5I1CL 2VTBB 2FEDD 4KHXH 3L7LA 4OQFA 1WMDA 4PLHA 2CYCA 3W5SA 1V5FA 5C0CE 4JD5A 3CR3C 1QE3A 2AJTA 5FFFA 3T0BA 3QXXA 2BNQD 4TLBA 4AN0A 3P2YA 3KETA 3UATA 2LKCA 4NM4L 4G42B 4WOJA 2XUIA 2C92A 4QPDA 2PSJA 1XGRA 3F7QA 5LIPA 1AGEA 4P2RA 3W8NA 4HWBA 3UERA 3O2WL 3D8NA 3B5IA 4B6PA 4KE7A 1SPDA 1SUPA 2IDJA 2HSJA 4P4LA 5F4BA 3PPWA 3W0LB 1D6SA 1LRLA 1QQDB 2I4TA 3ABMB 1U0EA 1XIVA 25C8L 3S7ZA 3ETCA 3HI1A 4DN4L 3RVTC 3LXXA 2QL5A 4HWEL 1F4VA 2ZF9A 1FFNB 1PQWA 1UAGA 1E7MA 3SJVD 4GPBA 1JHQA 3TI7A 2GFBB 1CFTB 2GCPA 4UHEA 2BFCB 3MBOA 4NJEA 3B43A 4L07A 4TT8A 4EI7A 1NUTA 2L18A 1A5SB 2FSDA 4KMTL 3MZ0A 1J6UA 2M1ZA 1SBIA 5FECB 3ARFB 2JGDA 3H6KA 4HIQA 5FO9B 4BCZA 1GJUA 1O94D 4YHKH 3UKJA 5HRUA 2WANA 3MA9H 3QXUA 5T3ZH 3CF2A 3U9PH 1B0WA 4O4LA 4DXHA 5JJ5A 5BWCA 3UBHA 2XMCA 2P9RA 4CMHC 3VH2A 2VBIA 1NUGA 2R69A 4UDTB 4PJDB 1VIYA 4PJ5B 5D86A 2CMGA 5SICE 3CLSD 5K8JB 4D5EA 1QTQA 3K81A 1VKRA 4JFXA 4GOND 2O5YL 2R4UA 1WSDA 4PQYA 3UNXA 4ZV7A 3MWFA 3Q1LA 2F1RA 5CP3A 1KF0A 5C3MA 5ITSA 5FRDA 3BXFA 4AVIA 1SUSA 4ZYZA 3TUZC 3DMRA 1FFGA 1U8YA 2ZAMA 2XA9A 4EQ3A 4JVOA 2PPAA 1WB4A 4WU5A 2B9EA 2OJZL 3EOBA 3OCYA 3L3OB 1IY2A 4O5OA 1QU2A 4LYJA 3L4UA 2REBA 3PFCA 2VAXA 4IV8A 1CXEA 1AACA 3WIDA 3AS2A 1MI5E 3UROR 2SBTA 3M4JA 2JCYA 3ET5A 1TA0A 1QNZL 1SKQA 1TPZA 4J3WA 1MFCH 2PRIA 2I7VA 3TTWA 2TRHA 4YECA 4LHWA 5B39B 4RBPK 3RYHA 3U7FB 2FHSA 3DXFA 1XL4A 1AMYA 1M9SA 1O7JA 4D3SA 1A50B 3OWXA 3P9MB 4G25A 1INQB 1EESA 2OCAA 4Q6IA 3VXKA 1BZOA 1L3BA 4G71B 3UZEA 4EZLA 1YO4A 3EJTA 1E7VA 3G5XB 3DD5A 1ZPLA 2FJUB 1ISIA 4QSHA 4J4PA 5C09D 1EKXA 2NSYA 2BWIA 2KI6A 3T6QC 3UBXB 1D5XA 4RS3A 2H0EA 4GW5A 4L5IA 3G0HA 2I60L 3O1IC 4RPHA 2WJ5A 3AERA 5GRYA 1U4FA 1WZ2A 2I32A 1ILWA 3WL9A 1C1YA 4ORZC 3AVPA 3FDXA 3RQIA 4XI5D 1DELA 1PY9A 4BO8A 1J1IA 3SBWC 1OGAE 3OTQA 4HKTA 4DNOA 4OY3A 4DR6B 1MQSA 3B9DA 3L7OA 5JW4R 3NHYA 4RTLA 4OZIA 3C3DA 1J8MF 3F78A 4M8IA 4LVHC 3A4AA 2CLZA 2PWPA 1N68A 5EU5B 1NC4D 3MRXA 1I9RL 4PTUA 3T8YA 2F8VA 4RMWA 3FI0A 4X9GA 5F35A 3DDHA 1H15B 1LD9A 4KRPD 4BV3A 3MWDB 1GL6A 4PJ8D 1QKIA 5BVHA 4FYWA 2IXGA 5NULA 3BOVA 5C3TA 2RC6A 3T4EA 3WFIA 1FN4A 1GAWA 5B6IA 1N0IA 3OKMB 3ZBTA 3TLMA 5EN3A 1DQJA 4XH2A 3R3UA 1ZV9A 4IKLA 5LBIA 4JMNA 4K3VA 3TFKD 7PCYA 4PONA 1SHMA 1XD2A 4HKJB 2F1IA 1XMWA 3IR7A 1VKXB 1CE8A 2EJVA 1JHPA 4R2LA 3LHDA 3Q5EA 4PMEA 4GMXA 4HPOL 1AA9A 4X1KB 3SPCA 4IJUA 4ZFZA 3I30X 5FEUA 3ER8A 4QNPE 4IRJB 4RPKA 5IU6A 3ARFA 2DTXA 2JGDB 1X4YA 1F0NA 3SCMC 2DPKA 1IJBA 1ZC4A 1BZ7A 1FU7A 4PJ9C 5DHSA 1RERA 5C86A 4LDLB 1IHUA 3C3AA 4UEQA 1ZD9A 1N64L 4P2GA 4YAJA 3RJMA 3VJLA 4EA8A 1RMTA 2VYNA 4QDUA 3BI9X 1HFWA 1L4BA 4AY6A 4JFTA 3PDCA 3SYKA 4H3HB 4FUQA 4NBLA 4Y7DA 1FUNA 3KUCA 3B5GA 4U4IA 4XBPA 1IC6A 2VRBA 3SQOH 3IAS1 1FPMA 2CR0A 3LKOA 3FH0A 3OXRB 2CJTA 5DCLA 2EDNA 3B37A 4DUZB 2CO2A 2IOYA 5HNKA 4G80B 4RANA 2CGYA 3UMJA 5AOBA 2D7DA 1LEIB 3RO7A 2P43B 3OR6A 2DJIA 3K05A 4B9KC 4YVFA 1FP2A 2FRXA 4K23L 1UPFA 2AGJL 2B77A 2V9PA 1DSWA 1BVRA 3RARA 1UOEA 2LQRA 1QH1A 4CETA 2UWEF 2FWLB 1F58L 2LFGA 4MQUA 4O2FA 1QOQB 3BDBA 4NEGA 4J3VA 2NZ1A 3I83A 3M3HA 5K51A 2D13A 4MRSA 2C4KA 2CUMA 1GUYA 3BWYA 4B9PA 4MINA 1MHCB 2ZSUA 4IIQA 1PGNA 4QUIA 5ADPH 2WZQA 3V7AG 4DXAA 5L4NA 3ZTNL 3RJDA 4M5YH 1OSZA 5B7EA 3HI5H 3T1HB 4PYNA 4PR5B 1JHZA 1RJZA 3DV0A 3A7DA 1Z2NX 2R2AA 3KQHA 3L3HA 1FP7A 2J85A 1JMZA 4NDMB 4OJEH 3HB0A 4OUOA 1KBGL 4B41A 3CX6A 5FV2A 1RFLA 1AGPA 2YC1A 1M56B 1FNBA 5K4GA 1TF5A 4Y2UA 2ZCKH 1DBBL 4H7FA 2HRQA 5KQMA 2GYSA 3BUTA 3S5LB 1XGYL 1J8FA 2BGNA 3A3YB 3A9UA 1T5XB 5DZPA 2DIBA 4FS8A 3DBLB 5A3SA 3NACH 4NYMR 3ASYA 1ZO8A 3S8EA 2LW7A 2I6FA 2PM8A 2P8PB 1DWQA 5SYNA 4YRTA 2VN7A 3JWJA 2QQFA 4KTEH 1UH3A 4XRGA 5IJ0B 4W6WB 1H2WA 1F41A 4KROC 1INDL 3EVGA 1BAGA 1N9PA 4PH8A 1KCLA 1X7WB 2ZOSA 3REGA 1NCOA 1IM8A 1NQUA 4YXHH 1RJGA 3WMWA 4OCWL 5GM2A 1RZ3A 1I1HA 2NSQA 2B20A 4FOMA 2JLZA 1YE5A 1KGJA 2CM6A 5DMKA 2QR5A 1SOSA 2C9QA 1CQIA 4GICA 2XUAA 1PYGA 4EF6A 2HU5A 2JCXA 5IVHA 1TEVA 5IBQA 4HJJH 5HGHB 3AY4C 1EVYA 5BJTA 2Z83A 4Q4AB 3DX0A 3ISVA 4RMNA 1EE9A 3OLDA 1TTFA 3TXXA 3E5RA 5FUYA 2IU4A 3LAFA 3CS3A 3BUPA 4P2RE 3AMVA 1FVCA 1Y1UA 2MWCA 1X1QA 5G4OA 5BOJA 10MHA 4PJEB 1KPIA 2QY6A 3DOUA 4H8UA 4KHZA 3IV6A 1IYZA 1O7VA 1WFIA 4MW6A 3CD4A 3EW9A 2A57A 2V17L 1CUZA 1NKTA 2WHXA 4QOFA 3K2QA 4ZOBA 4Y4FC 4REMA 4KQ3H 1GCIA 3FQXB 4WHTB 2GAOA 1KQOA 2WZ6A 4GM0A 1VM6A 4YGXB 3VR5D 3HC2A 5TY0A 1R6UA 3QYPA 2GJ9A 1V39A 3UPCA 1LK2A 2DQGH 2H8PB 4LVUA 2GT1A 3HCFA 2C5GA 5C7ZA 3L01A 4QIHA 4YCNA 5D3ZA 4ODHH 5IYZF 1Z5LA 1DAFA 3B48A 4WVFA 4NCAA 4JUFA 3U7HB 3GJRA 1ODTC 3ASNB 4KR0A 5EPMB 3C6EA 2QT0A 3WTVA 1AXGA 4UVHA 4PJFB 1Y8CA 3QIWC 2QHRH 3J27A 2OAEA 3FJYA 3MT9A 1F56A 4TNWK 3NXKA 3SHVA 1P7ZA 3LL7A 3RIFK 4BK8A 4U31A 4YDZA 5CR1A 5DTJA 3TGPA 4G4JA 1Q0YL 4L5YA 5IMMA 2HKIA 2YHIB 3T7JA 4C89A 4C6RA 1U7PA 1MJHA 3KZOA 5GGQH 1Z88A 5DW3A 3GUCA 1HQKA 4R7XA 5H8DA 3PPVA 2D8MA 1KTDA 3Q3IA 3X2SA 4PANA 2VDJA 1YTUA 3GJFA 2R1ZA 1WM1A 3LIZH 1N34B 5HJ7A 2X0UA 3NW9A 1Z6ZA 3IJEB 4WKPA 3SKJL 5AUMB 1KARA 1WQ3A 5CT4A 1A7UA 3MLRH 5EWMB 3WIVA 1MZVA 4HH8A 5KAQG 1P7YA 3PUYA 1YAJA 5HI3C 1XEUA 3A1FA 2QLNA 5F78A 1S8OA 3Q3GA 2X23A 3P3RA 3GXIA 2QLMA 2D7QA 3DL4A 1P8AA 2NLOA 3VAZA 3NIBA 4EFDA 3W0WA 3NTOA 3L7FB 2E4FA 4OLVH 3BZFB 2A58A 1BZEA 2DT5A 1NYTA 2JJ2D 1OMOA 3T71A 3NH6A 4EYSA 3M8KA 3LRSB 2GN8A 4C0BA 4LHUB 3ZBMA 1PF7E 2CJWB 4JSYA 5TK4A 1CR9H 4A1RA 2NQTA 5HKLA 1MB2A 2CLOB 1BAWA 4KX9A 1C4XA 5FWXA 3VD2A 4U05A 4EMSA 4YGVA 4PR3A 2R0ZL 4ZI7A 3TS1A 4MS1B 5TT1A 3NCCB 3EXEA 3T34A 3TSOA 4RACA 4BE4A 5JTTA 2WWMD 2BFNA 5B39A 4WMLA 3BWCA 3HPQA 2JVKA 1FL5A 3VOBA 2FP4A 2J59A 3MILA 4PJIA 2HVKB 4GLJA 4QRHA 4KJYB 1UP7A 4URUR 3LTEA 5CB6A 1UYWH 3S35L 3PFKA 5F7XA 1AM4D 1Q7TA 5TD4A 1RZRD 4JB2A 3A4NA 2E4WA 4MDYA 2QIPA 2IWFA 5I1GH 4NT6A 5IJDC 4Y6LA 2VQSA 1UBCA 3K6SB 3D51A 4NMXB 5DLDA 4QAJA 4QXGL 2PW2B 1R64A 2YGPA 1TLMA 4P7JA 3IT0A 5EF0A 1X5LA 4URZR 2W98A 4LXTA 3EJRA 3QJFA 5CH3A 2WT8A 4HAUA 4D7BA 5L2KE 3UAJD 1K85A 4JFXB 2ISCA 4FMKA 4R2GD 4HUKB 4FFWD 1TUGA 1TOXA 4NLLA 3ZKQD 1YPZA 5ANME 4TN9A 1R66A 4BNYA 2G9NA 4WENB 1PYDA 2GN0A 5JJKA 4ZYWA 5H83A 1OE2A 1NBMD 1KB9J 5GJTH 3ZE1F 3O26A 1DOZA 3KPNA 4O33A 2GYYA 4B6FA 1DJXA 3EYAA 5BPHA 1RI4A 2CNYA 1ZIDA 2DLDA 3CXHJ 4X5QA 5IEHB 1M2JA 1A1OA 1RXIA 1KFCB 2APSA 2PUFA 4HNTA 3UHJA 2V9ZA 3O84A 3QRWA 4B6SA 2Z3VA 4JI6B 3ETLA 4GKZA 3BP6B 1RZFL 2Z93A 1EWKA 1BCRB 4IBQA 4MXVF 2A14A 4AKIA 1SHUX 1PK9A 4H5SA 2JNWA 4U6YA 5CLZA 1EP2B 4ZRNA 2NTFB 1AC5A 2AS5M 2J46A 5I4CA 1HCFX 5F7YC 1PFCA 3RWJB 1YG9A 1QJ4A 1NWHA 5JW4N 1E3MA 4HO1X 4K3UA 2UZPA 1YJDH 2FH6A 3OU2A 1JWBB 3KVPA 3IPYA 1PWYE 1K2DB 2P3OA 2GTQA 3WFCL 5HGXA 3VMPA 2PUBA 4DQ0A 4N76A 1OM3H 3ILEA 4JGGA 1RULH 2ID7A 3C6XA 3BDYL 5GGRA 1QSEA 1XWIA 3IMCA 4LQDA 1I3CA 1ECGA 1Q0TA 3TDMA 1C16A 3TW8A 1OT3A 1QK4A 1AY1L 4Q4JA 3HG2A 3CW8X 2FQQA 1G3QA 1HAUA 1MCNA 4HUMB 4HIEA 1KAGA 1PK7A 3EPPA 4GSRA 2BP5M 4ITVA 4XNMA 1GGVA 2QY9A 5JZMA 3B2EA 3ZQKA 3HHRB 3C9NB 1PR1A 2X4SA 3PGA1 1AI1H 4Z78A 4UUQA 2Q9CA 2VN4A 4HDIB 5K0SA 5K8IA 3L8YA 3GI1A 4E3WA 2JIPA 1AHWA 4H4DA 3GJ3A 3QI9A 2Q7YB 3D31A 4MGXA 1DFIA 2TSBA 1DC6A 4PB0L 1NBME 3M4ZA 5FYJH 1V8HA 3QFJB 4BWWA 1JZFA 5D87A 3AQIA 3T7TA 4GRAA 3X3FH 3H6HA 1I8LA 2VRNA 4NQCA 4HCIA 2ZG1A 4KJPC 2OL3L 3KBBA 1VDZA 4DSUA 2I62A 3T0EB 1Z2OX 2QT6A 4UATA 2WZCA 2XVGA 3SHOA 4MXDA 4OM1H 4BXVA 4Y88A 1YR1A 1Q8MA 2GPZA 1KEPA 5IKCB 2RHTA 1KJMA 4HBCL 2AKEA 2O5ZH 1UDRA 4G5AA 1U2PA 3D39A 1DU4A 3QIBB 2OHVA 4R8LA 2YOCA 4NX2A 3SJ7A 3W6NA 4LOUD 2WJGA 4DRYA 4RTMA 2HP4A 4JFOA 4D6YA 1GTG1 4LQFH 1UBRS 2RI6A 3PXJA 2JB6B 3LA6A 4TKVA 2BCGY 5KVVA 1VBKA 3HSSA 2XG4A 2QD5A 3GQBB 3WIAA 4LVOC 2XKAA 4C88A 2XAUA 2J88H 1QC5A 3LY8A 2IITA 4P5RA 1T9AA 3QFGA 5DQDL 2IOFK 2H41A 3K9HA 3E4DA 4YWHA 2OCIA 3NA9H 2GIYA 4IDPA 4ALIA 4LVEA 4LDPA 4PYGA 4XXDA 1J9QA 1SMKA 2I78A 1F4WL 1TA4A 3DZGA 3ILPB 5DUJA 2BY3A 1QH1B 1OLLA 3I6LD 1D0IA 5MGNA 3MINB 3QQ4A 4JFHE 1K8QA 1WTGT 3HM2A 2AKYA 4B3RB 3EADA 3P97A 1FNLA 5DS2A 5IC6A 4DDUA 2UUDK 1XDDA 2O93L 4MV3A 4LCBA 5DD0H 3WXWL 2P0EA 3QDMD 5D4QA 4AX4A 1MPAH 4KI1A 5IVZA 3O9WA 1H9DA 2BIHA 2C3HA 4JB0A 2XN2A 5IZ4A 5D8JH 2R5NA 3OKDA 5CAYB 4GOSA 4MTCA 2XIBA 3QGVA 3SHTA 1QRNB 1XJWA 1PG5A 4TROA 4N18A 4D7PA 2BHRA 4JYPA 4AXWA 1SA0B 5DGCA 9LDBA 1EFXA 4KSYA 1AE6L 4OLYL 1X3LA 1UJ3A 5T1KA 3ILPA 5C0OE 5C0GB 3N7UA 4PY2A 1FTYA 4Y2DC 4LJAA 1R3LB 4L48A 3QU5A 2CMRL 4JFYA 3UAVA 2C7GA 3FRIA 4L5BA 5IASA 1GZ6A 4GBXB 4FABL 3B2NA 5J7CC 4F4IA 3NZHH 4Q05A 1N1DA 1F13A 1PWZA 3E9DA 3T99A 5CJ5A 5L53A 1HNFA 1F20A 2BGMA 3GMSA 2D03H 3DMDA 4P32A 1SKMA 2WBWB 3ABSB 1TM4E 5HDOA 3ZJYA 1QB7A 5AL8A 3UQYS 3IUJA 4LRYA 4ZUWB 1XIWC 5DV9A 5LUAA 3BGDA 2Q3MA 1C7IA 2YPLB 4JFUA 2CHDA 5JS7A 4LSUL 5MEOA 2AEEA 3OQ1A 4FXLA 1DIGA 2RE8A 2IEAA 5F9OL 5D7IF 2H0PA 3LDGA 2DTSA 3QUBA 3DZCA 2ILTA 2GKIA 1RXLA 1GCUA 4A6DA 3E1KA 3DHMA 4PFKA 2QADD 5F5LA 5G0WA 3E7DA 2C4WA 4EB8A 5FGCB 2CBTA 4PI0A 4Y0VA 4A0QA 1SEBB 3GUHA 4PXYA 1SN7A 3RS2A 5B7QA 2QL6A 1OBVA 3P3UA 4BB0A 3K0HA 3HU5A 2NY1C 2QTWB 4M0DA 2AITA 4JDTH 1ZVKA 1G1YA 5TE6L 5GZND 4RX4A 1VCIA 1TRKA 4QVKA 1RK0B 2FG6C 4AITA 1T9BA 3N6VA 4XVTL 5IN4A 4LU5H 2C9YA 4EL5A 3DDFA 4F4DA 2AFIA 1JNNL 3PWKA 3ECWA 4JY7A 2O4UX 4MROA 2FPLA 1C4WA 4UOQA 1LE9A 4XNZB 4M76B 2AZDA 5TH2A 4L9SA 2ETVA 1EEQA 4FWIB 4ZUTB 3L1OH 3NKFA 1BFSA 3EBGA 5J3HC 5FWQA 2PKDA 4AUUA 3T5TA 2Q62A 4UT9A 2PN1A 1G5PA 2FLWA 4I0PA 1JTTA 1GYVA 2C9RA 1PLKA 5DP2A 5TS2A 3UAFA 7FABL 2ZCHH 5HXAA 1JQBA 4UFNA 1MF7A 5HGJA 4POZC 5E08H 1G0XA 3M1CA 1MQ9A 1L9QA 2DR0A 3RUGF 2I27N 1DCFA 3PV0A 4LRWA 3BE5A 3BE1L 4EUKA 4FQQA 3RWEA 4XASA 2IO5A 1RPTA 2G0AA 1H0SA 5LZ5A 3MLSL 1XGUB 3NC0C 4V24A 2FEDC 1BXGB 2LFEA 2MPAL 3BMCA 1WZKA 5TDOA 2Z2YA 5JU6A 1K88A 3ESBA 2XA1A 2OMZA 1KMQA 4P1ZA 2HEGA 3NH7L 1OH7A 3D48R 2RQ8A 4BFJA 2ZIFA 2A77L 4HWRA 1N1EA 1LDBA 3AOEA 3NBNA 4OD2B 2GZRA 2PGAA 1XTZA 1OWRM 4NPYA 1RJLA 3GMLB 2J9GA 4U6QA 1BBJB 5ARCA 3UW1A 5C71A 5D3KA 1IEHA 2WSIA 2GCGA 4QRQB 2PLFA 2GUOB 3SPVA 1E9EA 2WYZA 3NIDE 2YBGA 1AZSC 1GS7A 3JYOA 3A6DA 1MZYA 5EEYA 1IBZA 1J2UA 2VJMA 1LLUA 1T0JB 5JW3H 1N5DA 2FX8H 2JJYA 1O96B 3C09B 5D7SH 1J05A 4X5RA 3FNHA 2GUOA 5HY9A 5JCXA 2QS9A 2GTZB 4NEHB 4OLUL 3ZXAC 3H97A 1FYDA 3FF8A 2OMZB 3CZKA 1GYAA 4IBOA 4ZOLA 4K94L 3SYLA 2R1VA 2ATIA 4OFVA 1VSUA 3UGQA 3ZLQC 1EI9A 3BT2H 3WV0A 4WKNA 4MJ5B 4YCMA 2VSKB 4DK6A 1R9MA 3JWGA 2PUVA 4BP1A 3V0AC 1RWOA 1HDRA 3PE6A 3EJQA 4R0LA 2PUAA 4H0LC 4HNRA 4IICA 4OJDH 1P0SE 4Z3OA 3GLRA 5IWLA 2A6IA 4A8JC 3VFRA 3HKEB 1J2EA 4F8YA 2IW3A 5KSOA 1ZNYA 2E9SA 5CG1A 4JWTA 3CZFA 4A7VA 3LV3B 4XFKA 2ESVA 2KC0A 3VUAA 3RLIA 5I30H 4OQEA 4OF7A 3HWX1 3CSDA 4H35A 4QOHA 2XQYA 3IN2A 2ZNXA 2QDKA 4BCYA 1FSFA 2QPDB 3ZRCC 1ZCFA 3TPUB 3I5XA 4IO0A 3T5PA 4F9LC 3CFBA 2DMGA 1KFAH 3LQFA 2MOGA 1WZUA 3AS0A 4EKIA 3SY8A 3RIAF 4UVEA 1U8CB 3Q9SA 1R4XA 4XN7A 2WDPA 5IF9A 2O72A 4UVGA 3FLAA 3FPFA 2J1XA 2PKRA 1KXHA 4ZG1A 1I4EB 3HU1A 4WHYG 4L4TB 2JLWA 4PJ7E 4MNGB 1EK1A 2W11A 4TS3A 2PPEA 4NHUB 4XJSA 3CC8A 4Z76B 4Y1AD 3BGFB 4HJGB 1JN6B 3BGWA 1QKKA 3F49S 3AIMA 5FKPA 2YSTA 3RYFA 5F6HJ 3EVAA 5IWCA 2VSXA 2YD1A 4N0RA 2ASVA 4N86A 3PAZA 5IKMA 2BSTA 3Q8MA 3KXKA 2H4YA 3HLAA 3WZ2A 1R6BX 2AEWA 4XB6B 2JKWA 4RVHA 2D7PA 4MZDA 1MW0A 2A9BA 3HA0A 2HTLC 4RAVB 4F85A 4G0OA 1QI3A 4ZCQA 3Q88A 2COVD 2VDOL 5BNTA 1G4AE 4PJAF 1L5HA 3BHMA 2W6MA 1I8TA 1KY7A 1ZIBA 2WKOA 3MERA 2HMAA 3SC4A 4BCBA 1DIAA 2PZBA 5AUMA 3LBFA 4TMWA