3UOAB

Crystal structure of the malt1 paracaspase (p21 form)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
378
structure length
364
Chain Sequence
MLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
publication title Crystal structure of the mucosa-associated lymphoid tissue lymphoma translocation 1 (MALT1) paracaspase region.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 100
structure length 364
sequence length 378
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00656 Peptidase_C14 Caspase domain
B PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uoaB02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uoaB01
3KJNA 4HQ0A 4QUGA 3DEJA 4QULA 4N6GA 3SIRA 3V3KA 2HBQA 1I51A 1ICEA 1RWWA 1RHUA 4DCPA 1CP3A 3GJQA 1M72A 1SHJA 1SC3A 4DCJA 2AR9A 2HBRA 2CJXA 5IARA 3NKFA 1RE1A 4JQZA 1K88A 3D6MA 3V55A 2CNOA 4D3YA 1CVRA 2XYPA 3H13A 3NR2A 5IAJA 5LUAA 3DEIA 3R5KA 4JJ8A 4JR0A 4HQRA 4QU5A 2H51A 1IBCA 4ZVOA 4NOMA 2HBZA 1RHMA 3V4LA 2J32A 2QL9A 3PD1A 4EHAA 2C2OA 2H5IA 4QUAA 5IBCA 1RWPA 2CNLA 3PCXA 1BMQA 2CNKA 5JFTA 3S8EA 3EDRA 3NS7A 5IBPA 1RHQA 4N7MA 1I4EB 1QTNA 4JB8A 1PYOA 2J31A 2XZDA 5IAGA 2FP3A 5IABA 5I9BA 4QU9A 3GJSA 3R6LA 4QTXA 5IAEA 2H54A 3EDQA 4EJFA 3R7SA 1GFWA 3ITNA 1RWOA 2H4WA 1SHLA 3K7EA 4FGUA 4AW9A 4NBLA 1RWMA 3H11A 2K7ZA 4D3ZA 4QUBA 3R7BA 2CJYA 2Y1LA 3R6GA 4FEAA 4QUJA 4JJEA 4PS1A 1NMSA 4QU8A 1NW9B 1QDUA 5IC6A 5IANA 1GQFA 3V6LA 2C1EA 3H1PA 4NBKA 1RHRA 3KJQA 4QUDA 3S70A 3OD5A 4ZVTA 5K20A 3R7NA 4N5DA 4EHKA 5LU8A 5LU9A 2J30A 4N7JA 1RHKA 1RWXA 2QLJA 4PRYA 4QUHA 3RJMA 3UO8B 3UOAB 1K86A 4PS0A 4QUIA 1QX3A 3PD0A 1I4OA 4D3XA 1JXQA 1SC4A 2CNNA 4ZVRA 3SIPA 4JR1A 4N6NA 4AWBA 3DEKA 1PAUA 2QLBA 1RWKA 2Y0BA 4EHDA 2FUNB 4QUEA 2WDPA 4AWAA 5IC4A 4PRZA 2QLFA 4I1PA 5IBRA 3QNWA 5LUBA 3H0EA 2C2MA 2H4YA 1KMCA 2XZTA 4FDLA 3DEHA 4I1RA 2NN3C 5H0IA 2H5JA 2J33A 4NOKA 4QTYA 2H65A 4ZVUA 3D6HA 3P45A 2QL5A 5IAKA 4JR2A 3KJFA 4ZVQA 4IEFB 3IBFA 3R5JA 1NMQA 1RWNA 3E4CA 3H11B 3D6FA 1RHJA 2P2CA 4FXOA 3V6MA 4EHFA 4EHNA 2CDRA 2C2ZA 4LSZA 4ZVPA 4QU0A 2C2KA 1I3OA 4JQYA 4DCOA 1NMEA 3V4OA 1F9EA 2XYGA 4HVAA 1F1JA 3GJTA 4JJ7A 5I9TA 4EHHA 1RWVA 3GJRA 3BIJA 3P4UA 4EHLA 2XYHA 4NOJA 2QL7A 3IBCA 4NOLA 5IASA 4M9RA 2H48A 2HBYA 4NBNA 2FQQA 4IYRA 2DKOA 4N6OA 4ZVSA 1SC1A
chains in the Genus database with same CATH superfamily
4G42B 3O6VA 5AVQA 3ENNA 1DEEA 1GADO 4BV1A 4HOYA 5SICE 3CDZA 2PXYB 1B42A 1SA0A 3C6XA 3HDGA 3QA3E 2JA1A 5CYGA 1H5BA 1H2BA 2GZ1A 1M8KA 3FHJA 5DZOA 1RWPA 1I3LA 4NZJA 1GSMA 2YN3A 3D2AA 4EMUA 4WIQA 5HHMD 2WXJA 3L93A 3HC4H 5CVTA 4JASB 4ZTZB 3H6KA 3U5TA 3BG5A 5F23A 3RFZA 3U0PA 4R2JA 3W6UA 3UM9A 3I9IA 1M5TA 1YDHA 3W4KA 3FQUB 2AHRA 2MWMA 5A2LH 4JFYA 3EVNA 3MA9H 4FNQA 2WAQA 3K0BA 5C0CA 4EZLA 4LGSB 4N7JA 5I4KA 2HFFA 4KZPA 3TE6A 1PYWB 1CLOL 1SOUA 5CF3A 2HMSA 3QAZB 2CO1A 1QQDB 3UTZA 2WJ5A 2PUWA 4UI2A 4DCTA 3N0XA 1QHEA 1ZO8A 1AI1L 1RRCA 4X6CA 5AZ2L 1KF0A 1IVTA 2GN1A 2FQEA 1V11A 4WW1B 4Q6KA 4M7KH 2VQ6A 4EN2A 4X7BA 4Z9BA 1BQ5A 3SBRA 1ABFA 1NG9A 4W8HA 5DC9B 4E32A 2VHVA 4KTVE 4PV9A 1JQ5A 4J8QA 1SBHA 2TMKA 5L4FA 3RUCA 1ECPA 4ND7A 1O9GA 4CU5A 3UK7A 1USIA 5BQXA 4A7SA 4BZPA 4BA0A 3HY3A 3L3JA 4R2GD 3N0RA 5GOTA 4PLKC 3W0WD 5D86A 1FLRL 2WWWA 4PYGA 2APXA 1W5SA 3QKTA 5IYZB 3QUXA 1JH8A 3F84A 1DC4A 2VTFA 5KAQF 3S44A 1I7PA 2GCIA 1VCNA 3ABKB 5I1JL 1XA3A 5GP1A 2GN4A 3L79A 5GQSA 4LI3X 1NI3A 3PQ3A 1VRSA 3ZQ6A 1XWFA 1W87A 1IMJA 4LQLA 1KYDA 4Z3JA 2JNWA 1J25A 4S0TD 4QPJC 1UYWL 5K9QI 1U0BB 4PZZA 1Z39A 4NUJB 3ILYA 3ARVA 3E80A 4PGBA 4PJGA 4FSXA 4DG5A 5E00B 4MVJM 4XVQA 3ED1A 1I6WA 1XH3A 1D9KA 4KVCL 3R5XA 4LP4A 2EDFA 3OAYH 4F11A 4KPYA 2VDKB 2CDFA 1M1YA 1U7PA 2WZ5A 2FK7A 1Q9OA 2VPZA 4AWAA 4PJFE 2GTWA 3M17A 3JSAA 3UX9B 5TDOA 2HHJA 3PLYA 3M2TA 1KPRB 2BSRA 5A7EA 4IIGA 2ARWA 1XZ8A 3AUVA 1GMIA 1KLGA 2I7CA 4KLAA 2IV8A 4BQCA 3LBAA 2JJWA 3DLPX 2XN9A 3QPKA 5AKJA 4HWZB 4LHZA 4EBQL 3G6JF 4DIMA 2HT4C 3RKSA 3NUGA 4RJJA 4OLFA 3EBAA 2PO6D 3MCUA 1OCWH 3DVNA 3RL2B 4BKRA 5JZOA 1GA6A 3RX7A 2C3YA 4D57A 1Y98A 4K1XA 2YFQA 1W7AA 3VDMA 4N8CL 4BFIB 2QSZA 1FFRA 5AM5A 4KY1H 4KVNL 5DZAA 4FOTA 4M7RA 4DEPB 5ALGA 1TUGA 5LYYA 2B4AA 2J9XB 1ZK4A 4M60A 5D2NA 5KJFA 1GJWA 3L3OA 2REXB 4OF4A 1E28B 3E1ZA 1NTOA 1QYDA 1NDMB 3V2AR 1WABA 2CXTA 1B14A 4ONFL 5KSVA 5DNUA 2A1TS 3W2HA 4UZSA 1YZVA 2DQEL 3DGDA 3AR5A 3L7IA 1AKEA 3QEOA 4KHPB 3VTMA 3EGVA 4B5EA 1LSJA 1KTJA 4OB8A 4XP9L 3KVNA 1PZCA 1CFNB 2EYTA 1WBZA 1V8FA 4WU7B 3V0AC 1KG0B 1U4NA 1L4KA 3KPSD 4OUUB 5CIQA 5EOCL 3SDDA 2QVIA 1SYSB 1DG9A 4M8QA 4MS8D 1G8PA 4MMYB 1G7RA 5CYOA 2YIHA 1AQHA 4PU0A 3QDMB 4K5OA 1VMKA 1BVRA 1LBHA 1HXMB 4EM6A 4ONGL 3BSWA 4XI9A 1MA0A 3KMDA 4JO4L 4ZCTA 3FOAA 3M8KA 3B9EA 2QAIA 5F7KC 4K23L 4UAHA 5DUPH 5AW6A 4I77H 3B53X 4REQA 1DVRA 1SR8A 3CUKA 4QU0A 1XTRA 4LV6A 3ZI4A 1PTJA 4V1DD 1PQPA 4K3EH 2IXDA 4I9WE 4QRRB 1JQKA 4EMTA 1Z5UA 1E5QA 4IBUA 2NU6A 1FP6A 1EFLA 3OFND 1Q9WA 4LE1A 2P6PA 1HLPA 4UV7H 5F1SA 2H63A 1UXKA 2BFAA 1IC7L 2NY4D 4A2GA 2X44D 5EMMA 4RRPA 1CXFA 4DIBA 3TOSA 3GO1L 4EHJA 4MJLA 1OP4A 4KO5A 2JH3A 4KIGA 1GKEA 4OJMX 4GRWH 1IQDA 3QPXH 2H08A 5F76A 2I3ZA 1KY2A 3QZWA 4IICA 4WFKA 4MNHB 4PFEA 1GGCL 1PJ9A 5IQ7L 1CDOA 2EF0A 4YR9A 5AVSB 3PNRB 4U8GA 5LP6A 1C4KA 5EUBA 1G43A 2HYIC 1FYTE 1OX4A 1COWA 4JKWA 2C7GA 3IH5A 2RH9B 3HAEH 4HKZB 2QVGA 3V5HB 3OCYA 1DFBL 1R88A 3T3NA 1JEYA 3LV8A 5DLLA 2P6OA 1CYEA 1Y4SA 4MVJE 2G5CA 4S1NA 3ZHFA 1H9CA 1OM3H 1OROA 3EOAA 1CBUA 5ESWA 1DP0A 4IV0A 2LWIA 1G16A 2UAGA 2WF5A 2CB0A 3MLSL 5I0ZA 4AM8A 4P23D 4C4PA 1BJTA 3C7CB 6ADHA 4WY7H 3QRFM 3DXAB 4OV5B 3Q5TA 3HKEB 4PPFA 2DQUH 1KI4A 1L7EA 4XVUD 3GCGA 1CE6B 4XWKA 5HHTA 4FIZA 5LA6B 4B3FX 3AUJB 4TV8B 1RVDA 2VJOA 2VERA 3DV9A 1XWIA 3OO1A 3C6LD 1MCIA 2OORA 3STXA 4HNTA 4D9FA 1GM5A 4GAAA 3FOFC 2GZDA 2VN7A 3MCTA 1WVIA 2AX4A 5KZCD 4JFPA 1VCIA 1GDHA 3LK7A 1I8IA 1AJ7L 3I6GB 43CAB 3GRWA 2BNQD 4X8CA 2MSEB 1CD1A 4AK2A 2PPLA 1S7CA 2DWPA 3TRHA 4XVSH 2A9QA 1UXSA 1MABA 3A70A 4A73A 2IUTA 3SZRA 4DGUA 1F17A 1TVDA 3UC0H 2RK3A 4HS3B 3QHZL 4HWEL 3ZWAA 4HXAL 2FLKA 4DQVA 1ASOA 2CFTA 3DMMC 4X8HA 3EJZC 2UUDK 2BJWA 2EIKB 2OZLA 3O11B 4BX9A 3MRNA 3JXAA 2DJ5A 4XJTA 4JP8A 4Q0MA 2NZ2A 3MUOA 3A6CL 5BS0A 1RJDA 2DLFH 5DHYA 4OFDA 4MNQA 3QR2A 4AWXA 3CU1A 3FOCA 1QOZA 1NJ6A 4D94A 1ZCRA 1PF3A 2BI8A 3M70A 1FVFA 3G5MA 5J5VA 4UU8A 2UXCB 3QS2A 4FNLH 4D8PB 5ANRB 1WBDA 2WYZA 2H6PA 3QGMA 4I89A 1Y4UA 4GR4A 4P9HL 4XCFL 5DLML 1XMIA 4WCFA 1UM9B 1UQTA 2DCUA 3GGSA 4LCEA 2J5LC 1DQYA 4XO3A 4G6ML 1ZZGA 2FWPA 4LDLB 3SE6A 1BA3A 5KBPA 1MV8A 4EENA 5K0LA 3GYGA 2OAAA 2GBTA 1CJTC 3I6IA 1S3KH 3X1GA 2BZ1A 4R8WH 1DOAA 1OQAA 3MRQA 2BEUB 3WLBA 4YRNA 4ZZIA 2VLKA 1A88A 4KQCA 4F60A 1QPZA 3TW8B 1UM6H 3B6KA 4UT6L 1U5CA 2R97A 3EC7A 3LZOA 4RDBA 1NTRA 4BQFA 3LZFH 1NDUA 2V9CA 3TEMA 4MQXC 1MRFH 5D7BA 3ESBA 1CCWA 2F3SA 1I5OA 4EN3D 3CE9A 2XBMA 5H94B 1IB5A 2CD0A 5LPNA 4Y9CA 3BH9B 3EYWA 4NU6A 2WZ6A 2OV8A 4A26A 1HDZA 1AZRA 4FQXB 3JQ9C 4AQOA 5L4IA 2XZTA 1KENH 7YASA 3X3HA 5BN3B 5I3ZA 4F91B 4C59B 1SCNE 1NEZA 1QDLB 5DI3A 3IO3A 4ZJYA 2VT7A 2RMKA 1G1AA 5JZSA 1MCBA 4W6XB 4PG4A 2C5DC 4OHXA 3DX1A 5MFPA 5L88H 1NFFA 4NG5A 4BWTA 1TZ2A 1VPTA 4Y7DA 4XXCC 5EOCJ 1ZGBA 1W0CA 1IM3D 3D33A 3OIUA 2IAMA 3MUHL 3KD2A 5LKAA 4Y4HB 4XC3L 1H2ZA 5C0OE 2BWDA 4WXEA 3BT2H 3KPNA 4B9JA 2XDAA 2O5XH 1I8UA 3V0WH 1WZCA 4NENA 1EM6A 1KA9H 5ICXA 1MFBH 3TN0B 2Q4RA 4AV0A 3DVSX 4ILEA 5JFTA 3RRJA 2MNUA 3DDFA 1IBLB 1UP7A 3MXVH 2VLMD 3HYRA 1NGZA 2N7SA 3BLKA 1SVOA 1RSZA 3AINA 4KWIA 4YIQA 3LYLA 3PQFA 2XKUA 2B59A 3BGFB 3VRLF 4JM4L 4G8EB 3FF4A 3BK2A 2OK0L 1MIOA 3PUJA 5GGTL 2VQTA 2B08A 2Q3BA 4HKBB 5B3AA 2XCSB 4NYLA 3ERXA 1LVEA 2WWNA 3Q85A 5LIRA 4Y5YA 1Y5RA 4X1KA 1T9HA 2EXWC 1H69A 5G0SA 2ZYTX 4N6NA 2WY3B 3VAAA 1D7OA 5CFOA 4WASA 3RYIA 2HSIA 4LOVA 1VXRA 3CFDB 3DTVB 2NZWA 4AL8H 3CRRA 2F62A 2ZXUA 1PYDA 4NUMA 2VJCA 1EAPA 3NASA 4WEEA 2CE2X 4K3VA 3ZRSA 4R4FL 1FRVA 4NZDA 4IOFC 4LAJH 4TYNA 3LHSA 5BSHA 2G7ZA 2X1HA 5AKKA 5A02A 3OKMB 2DE0X 3RS4A 1LWRA 1ZLVH 5FWXA 3GMNB 1XRRA 2ZSHA 2QDXA 3R5SA 3V7MA 3KYAA 3P4NB 1P5UC 5GSRB 2VWEE 1SNYA 4DZRA 1M71A 3FONA 4JJ5A 4DLRA 2EFEB 4UCQA 4BDVB 3O81A 3VFNA 5L7XH 4Z3FA 2PT9A 1V39A 2AFNA 2F15A 2E9GA 3WIEA 2AFVA 1EUUA 3ZGNA 1NNEA 1G8KA 5A3VA 3MJ9H 5TS3A 3C60D 3D6UA 1DSFL 1N6HA 1KK3A 4BZ2L 3HFMH 4GLRH 4C0SA 4P49A 2CHVA 1XF5A 1JPTH 1Z6ZA 3W0WA 2YYZA 2BNRE 3BSGA 2EKDA 4FMVA 5KNDH 1GY1A 1P7CA 1VCHA 5AEAA 3GSRA 3QE2A 3PDDA 1N64L 4KHXH 1E2IA 4YXFA 1PZ3A 4JI1B 1MEJA 1GPNA 4KKCC 4HQKA 4UPEA 1GPAA 2XNJA 1NW9B 3F6BX 4MMXB 1R3HA 1MEOA 2ZULA 3WTWA 2BXZA 3TLEA 4J3OC 4MJ6A 3CTTA 4TYYA 1BXUA 5H37H 3PC7A 4O4IA 2HRCA 4OCYH 1BM7A 2UUBB 4QBHA 2A6DB 2C9CA 5FQNA 3FI0A 4PJIA 4HK3N 1Q2UA 2HVKB 4DYDA 1R4MB 1OEZW 3S35X 4Q5IA 2F6RA 4B6SA 3I02B 4OT1H 3D4IA 3ZDZE 4ZC1A 1MCQA 5J13C 1SXJE 2BF7A 1X8JA 1U3HC 1YEEH 2YD6A 4K94H 2BFEA 4CF7A 2GYWA 2IPTL 5AVZA 3BIFA 5F96H 1U8QB 2X2YA 4BMXA 3AY6A 4HF7A 4V0MA 1E43A 3WS7A 1DJGA 4Q9DA 1YYLH 3DMGA 3K73O 3IOBA 4B48A 3L82B 5BO1L 4NJOA 4OU4A 1YTLA 1QVRA 1D6JA 1MJFA 4GI6A 3IPCA 2PO6A 1RE1A 1FNMA 2XU9A 5DEFB 2E18A 2WP3T 3DZIA 2FCRA 3GFUA 3CFUA 2C2OA 5K9JH 3CCHB 3NJ8A 4Q16A 2Q6TA 3PPYA 1LO5A 4FZVA 5DK0B 3JV6B 5IFJB 2P2YA 3TBWA 3JUYA 1ZNXA 2K7ZA 1IRIA 4WLUA 2ASEA 5ICEA 4B5LA 1QFPA 2NY3C 3B2MA 2ZZKA 1R8QA 3ROPA 1EUCA 3CUYA 3R7NA 5CJOL 1W8DA 4KXLA 2FOIA 3UTTE 3RA7L 3VYRB 3IDIA 4RWYH 4EI7A 3HJCA 5HFNA 4CGUB 5KCZA 3IEAA 3ZHOA 3OX4A 3KJZA 4WWPA 4UMEA 4JLAA 3VOSA 5GZ3A 1I0LA 5FAAA 5G4NA 2F6AA 3RVMA 4ZV9A 2OYLA 3TTXA 3DJRA 1HKFA 5D70L 2H1SA 5ELMA 3EYUL 5DO8A 3ETBJ 4UAJA 3BOVA 3I6MA 3JVGC 3SE9L 2CKBL 3C5ZD 2XBZA 4DFDA 5H4ZA 2NY6B 1BEZA 1PY9A 2B4TO 3QG5A 1DSWA 1RHJA 2ZI4A 4RFVA 4XWWA 3FJ1A 3STTA 3VH8A 2WUVA 1V1RA 5I8KL 1Z9MA 2FDBP 4YHZH 1GGFA 1U2QA 4ZFQA 3HZRA 2YXVA 3O2WL 1HH6B 3QQ9C 1YI0A 2IPMA 1A25A 1I9GA 1H6UA 3CPEA 4V1DA 4FGKA 3AG6A 4YYEA 2YXEA 2PCJA 1INEH 4FYQA 2WKPA 2GX6A 2WQ7A 2PMZA 3OFNA 4G8BA 1J1UA 4HGOA 4XPGH 4YDKL 1L9SA 1OIXA 1QU2A 1I8AA 3K5HA 1ZOIA 4UUJB 4BSWA 1N3YA 3ZCUA 3URKA 5AVUB 4AJ9A 1JIBA 5A62A 4GLJA 2O8EB 1YKFA 3OOYA 4TUOB 4MW1A 4IKLA 1QM5A 4FNTA 4WOBA 5CP7A 2FLWA 2ECFA 5LU9A 4L4TB 4YFYA 3OTGA 4PJ9B 3WBKA 1QDEA 4UTPA 1J2EA 2KH2B 4XBGA 5E8NB 4QXWA 2I3AA 4QAJA 4DDUA 5B12A 4BQ6A 4NIKB 1Y7TA 4R0MA 5E4EB 2IHVA 4OVUA 2CLZA 4NAMA 2J3LA 3ZE1B 4HV4A 4WDQA 1BYUA 1ZA6B 2MSCB 4ZALA 5TQ0A 4ZA2A 3AQZA 5B1EA 2XJLA 4KVAA 5SY9A 1B1AA 2ZUEA 4Y16C 1WE5A 4JXJA 4Q1AA 5C0IB 4TYMA 4XPTL 4WY2A 1PMYA 2FYTA 4AUMA 2CO4A 3VTTA 5A2KH 3KYOB 5HDBF 5FI3A 9GPBA 4XKJA 2Q7YB 2ZIZA 5KAMA 3EZFA 5D7HA 4KGVA 3F7LA 2Q0SA 2DUUA 4L05A 2E48A 1DN2A 1KJIA 3CN4A 1X7YA 1IV8A 2ZUXA 3VOBA 1FORH 3VZPA 1PU0A 4GUQA 3OY2A 3PQYA 1CGSH 1YQEA 3HZZA 3K4QA 1UKYA 4X6DB 2VSFA 5CGQB 4CC4C 3JQGA 4L7VA 1A8JH 4HHAA 2A7BA 4XVUA 5L3ZA 3ZHNA 4PR0A 3HUJE 5LOVA 1N2EA 4J1UB 1MNUH 2G5RA 1UDXA 4PI0A 5DURB 2JG3A 3LMKA 2H1IA 5K1ZA 3U2SA 2AEQL 2DSTA 1VSUA 4I50F 4ENQA 4QRUB 4CFSA 5P8WA 1RU9H 1IM9B 1N1MA 4RIGA 3ZHCA 4P4KB 2C9AA 4Q9CA 1ETUA 4L8FA 1WY5A 5ALVA 1UBHS 4QBGB 2VQ1B 1LEKA 1HOTA 2F1EA 3U3RA 4KRMB 3Q0IA 2R29L 4PO8A 4NGHL 5CZXD 1L5GA 1MJJB 3CNQS 2O6EA 3CUWA 4QI3A 3BEVB 1T66D 3A6HA 4I9GA 3QF7A 3SC3A 4LOIA 1FFNA 2B1JA 4NMXB 3VJMA 2BAGA 2HJSA 2XAAA 5HD8C 1BYNA 3PNMA 4A1OA 1G7CA 1X38A 1ZY9A 4X90A 3KV1A 1HINH 3LP5A 2H4EA 5DNDA 4N2NA 1LK3H 4BO2A 2QENA 2OBNA 3KDMA 5E94A 4IH1A 1N6VA 4ZQCB 4PJCF 2GFIA 3J7HA 4JLVA 3S8YA 1F4PA 1NVBA 3ZK9A 3QFRA 2EFHB 5K3CA 2Z6FA 2JJSC 3P9ZA 5IWAB 3I6QA 1SXQA 3RB5A 3RIYA 5B2FA 1EAMA 3GNQA 4K3UA 3TJEL 2Q7NA 1FA9A 1ORWA 1KC5H 3VYOA 3O93A 4IVQA 4HRYA 1JPGB 4HWBL 1SD1A 5EN2B 3RSLA 2F7PA 1OP5K 1N6PA 3AB3A 5TEWA 1SIBE 1ZL0A 2XG5B 4PB9L 2NP7A 1ISIA 4J9UE 4FGZA 2Q1WA 4C3OB 1CICD 5BJTB 4FQCL 3KP1A 3N2GA 2JLBA 3MX0A 4GG6F 1G0YR 3GUHA 2QDKA 3T7CA 1U6AH 4OTXL 1NAKL 1R5BA 1R10A 4TOIA 2JHCA 4OGAD 5HFAA 1MO2A 5ADPL 5DMJB 2AR7A 5A6SA 1ZGJA 4HJJL 3QORB 3FO1A 2LDXA 3L2OB 1DAHA 4G23A 1LILA 1C8BA 2ZDGA 3ZXYA 4M6AA 2FYVA 5JZ7D 3EF0A 4XX0B 4EARA 1NMBL 1Q1JL 1LF0A 3WY3A 3L7LA 4YDMA 5BSMA 3I05A 5CP3H 4YECA 2GTQA 5JASA 5CX1A 1EFPA 5C53B 2JD2A 1AT1A 4EN3A 2BY3A 1H4TA 1DVSA 5ERGB 1JZQA 4KHZA 3ARYA 4RGOL 2GY7B 3RU8H 3TH3T 2UVQA 3ROLB 2H00A 1HX7A 2ZZUT 4U63A 2WZQA 3ONFA 1TQ8A 3UCFA 2V8LA 5IDXA 2Q7XA 1KBGH 1R6XA 1AU9A 1H8HA 3D8RA 3FBGA 3T3DA 4OZGA 2ZJZA 2ZUFA 1MWOA 3QJTB 3F83A 3MS4A 3NRCA 1ST2A 2M6RA 2D2OA 5K33A 5IN5A 3S7ZA 4ZDKA 5AK0A 2IHNA 5AD0B 4YRKA 1KEGL 3HG1D 2OMZB 2A8YA 4UOEA 5CGTA 2ZOOA 3NHZA 1ZE3H 4U1JA 3RO7A 3CVWA 4H4DA 3MI6A 1ZMTA 1DIOB 4D4JA 2P8LA 3SGKA 4YJFB 3HK2A 5EC8A 1T43A 4IDBA 1DAFA 2GEQA 2GM3A 4AY5A 1A4JB 3OZDA 1GW6A 4WJG3 1DBKH 5AB1A 5LXVA 1OC2A 1UVQA 3DD1A 2AE1A 2GSIB 2QZPA 2GK7A 1YECH 4HJ0C 4RTOA 2CLHB 3BS4A 3WGLA 3RDPA 2QZQA 2ZRJA 3GFTA 4RLQA 2VBGA 1XX6A 4F1ZA 2BOBB 3TMAA 5GS0H 3D87B 4HUWA 4G1FA 4O4JB 5DH9A 2C4HA 1GO2A 2XITA 4PV1C 4RIEA 4PV8B 1II0A 3KC2A 2APTA 2WTRB 4QGBA 4YO8A 4PS8A 3VG9C 1L7NA 3OKKA 3MLTB 1P8AA 3NV7A 2DM6A 3T7DA 5ALQA 4WBNA 3ZWKA 4NHCH 1XDGA 5CSZA 2BHYA 2W6ZA 2FFRA 2FSUA 3IM1A 2PMDA 3CMGA 4F8LA 3LGAA 1M42A 2LAAA 1XDSA 4IOIB 4Y2UA 5FX2A 3G6JB 2F90A 3C5SA 1AHKA 3IHKA 5IPFA 2JH2A 5C7XL 2QVFB 3OHSX 1V7ZA 2MNWA 4JJFA 5HGDA 1UH2A 3VW3H 1SCIA 3B20A 1WQVT 3IUQA 1NWPA 1NUTA 3DXXA 2H7CA 1NBVL 2IH2A 5AJHA 1HHHB 5EZSA 3HO1A 2FX9H 1IXKA 3C60A 2OSBA 4DTIA 4EIGB 2HSDA 4DWVA 4EUEA 4CTJA 3LDBB 3NT4A 2IPXA 4LPWA 3ND8A 3MRDA 2H5LA 3BKYH 5E2WL 2ATPA 2QVBA 4YNYB 2XZQH 4RD6A 2RH4A 4ODBD 4E6EA 1NCTA 3ADOA 3HR8A 2J55A 2MKWA 1MH1A 2A1UB 3BD3A 3DVAA 1TXGA 1TIKA 4HH9A 2C0QA 1TZAA 4D8UA 1WKCA 1GYVA 1QMPA 1RUKL 1Q6ZA 2BMWA 4JI6B 4OD0A 721PA 4C7BA 3BUTA 3I9KA 4V3BA 3K0WA 2NUTA 4F92B 3K0HA 1M83A 1U8IB 3ZTCC 5JXED 2ZTVA 3ANTA 3UWSA 1U8NB 3INNA 3KDPA 4CDHA 4GOND 3C9NA 2JCXA 1POWA 2WWKO 2WYTA 5HDQL 4UOW1 1KY5A 4IRXA 1O8CA 2F8TA 3WYBA 3BXHA 4PSUA 5LSAA 1NIDA 2G9HB 3H3BC 4MO9A 1W35A 4JFEE 3IJPA 2UUDH 5B39G 2GI4A 2WJAA 3LN5B 4FONA 4JL1A 5HQJA 4HWUA 1BDJA 2ZREA 3DYPA 2XUAA 4GXRA 5DP2A 4AF6A 5JOEA 2HW8A 3VYPA 3QULA 3WD5L 1XAHA 3RIEA 3G0CA 3TO2B 3KAQA 3QEMB 5K0NA 4LF6B 4BP9A 4OQQA 4LEIA 1BZDA 4Y0NA 3FBQA 3IFNL 1KN4L 4OFZA 3TVMC 1FPTH 2P65A 1J0IA 1ACCA 4OCWH 1V05A 5F6IC 3GRAA 1RLBA 4M00A 3NVMB 1IY9A 3DV4A 2DBRA 4PN7A 4ZVTA 3FMGL 4Z4IA 1RHKA 3GVHA 3P9XA 3IKJA 1UPUA 1TCMA 1VL0A 5KVEH 1QG6A 1SG0A 4ZI7A 1O3YA 1GOTA 3ZWYA 4QYOB 3N40F 3PRYA 1ZPUA 3GBML 1V35A 5LCXA 5CVDA 2XZLA 1ZP6A 5JXIA 2IZ6A 1XKLA 4ENEC 4F7EB 1YS1X 4P7BA 1LZLA 4PBDA 3QO1B 4DOHB 2B15A 5FLVA 2NW3B 3BQ9A 5ABPA 2PL5A 4ZX3A 3LEYH 3E1F1 1GTMA 3IP5A 1X5KA 5D5MF 2Y1GA 4ZVPA 1M6NA 3TDKA 2OAEA 3A5VA 1FGNH 5CU9A 2ZK7A 3FVWA 5K3EA 2BERA 4DF3A 4CHGA 2BN4A 2PCFB 5FULA 2D7OA 3STVA 3EDFA 1AB6A 3C5ZA 5FYLE 3C87A 5JSZB 3AB8A 3PFBA 4POOA 3D7MA 4I1SA 4G80B 3EDMA 1U7DA 1R3UA 1QE3A 2V3WA 2FTKE 2JGFA 1NQ5A 1H0RA 5KN5B 2FPPB 4OGZA 3L4TA 1G6Q1 1TUIA 4QYXA 5F7HA 1HXHA 3QZBA 1L9PA 2IOFA 4HKJA 4I1NB 3CSDA 2Y6TE 5AQ0A 4BVJA 1NLDL 3X0DA 3DURB 3BWZA 4L3EE 2HU8A 4KKXB 1QEWA 2WXGA 3THMH 1ECFA 4MGXA 5B3JE 2HGSA 3BWYA 4Q52A 4PHFA 1O54A 4C8XA 3PBKA 4FAAB 3B2EA 3L6UA 4O2BA 5TY0A 1V3LA 1ONSA 3V2GA 2V2XB 5DF0A 4I3GA 5I9SA 2Q9OA 3E2HC 3FYTA 1Y8QB 4DXAA 2PSDA 2IYTA 1C8KA 3L95B 3S3TA 3JAWA 3WFBH 3OOEA 3MJTA 2HA5A 4AK9A 1WMAA 1YNTA 1PWHA 2PUAA 3N5CA 2ERCA 1EXDA 1P5VB 3ACBA 3NYRA 3OD3A 3WAJA 4P2RB 2GOYA 5KSAB 3PL6D 3K94A 4DP8X 3F8WA 1XXHB 1CQJB 4XP4L 5TPZD 2VCEA 4KX3A 4U1KA 1U0RA 5NULA 3NBYC 1HFUA 3PQ2A 2NT1A 3PC6A 4D0DA 1NF3A 1KR2A 3RS9A 4BS9A 5J0BA 5A1AA 1OHZA 1TEHA 4MUJA 1P2TA 1XXFC 4NJ9H 5H4HA 4HCRA 5C6TL 2YEZA 1N6QL 2H52A 3D5TA 2IBZX 1SPDA 3KL2A 1H1TA 2AMYA 1T4CB 4P81A 3RRYA 2FO4B 2OKMA 5ADVA 3PNWA 3HJGA 3O83A 3Q1KA 3AKEA 3U9PH 4PJ8C 1NASA 1WMBA 1KI8A 4FZ8L 1VE9A 1ZVSB 2A9JA 4L16A 4GUAA 4AJIA 3ONNA 2KZBA 4NVRA 3QPDA 3SYPA 5TQ2A 3BSZL 4P2OD 3O94A 3U6XS 2D54A 2EFJA 2BJHA 1TZJA 3PL6C 3D8UA 2H1XA 1U4FA 2I2CA 2ZI6A 1O87A 2CHNA 5JYDA 3ZO0A 1G0OA 5AFSA 1WFNA 3ET4A 4U6SA 2ATKB 2VC2H 1FFQA 3V0JA 3G02A 1A2BA 3R9IA 1T5XB 2YYAA 3PRJA 2PGDA 1U1CA 5DK3A 1DANT 2C97A 3G9QA 2XNAB 3GJ5A 3KQNA 2W0FA 3FZEA 2V3DA 3F0TA 1UOVA 5EKUA 1A5SB 4P38A 4HKXA 2G17A 1THZA 3OLYA 1IZ8A 4GW1B 1KYXA 4NNPH 1I7SB 1GKLA 3A9CA 4Q9BA 1YJXA 3TT3L 1A6UH 3VACA 1KMCA 3V5DA 3A1FA 1N92A 2BH0A 3D50A 3OG6B 4WXYB 4Y4KD 2MINB 4FN4A 5EJFA 2RGNA 4F4HA 3BPCA 4ND6A 5JNTA 1L7TH 4FLHA 1RQNA 2IEAA 3D2UB 3A1NA 1UK7A 3X13B 1TW2A 3QH4A 5FDFA 4JYMA 5JMTA 3VSVA 3L6CA 2IF7A 2RA1A 2OBLA 3QZMA 3FCCA 4YRQA 5F9OH 2EE3A 2E6PA 1IOZA 3B6MA 4UPVA 1QTPA 5E9WA 1FVOA 4FC7A 4A03A 5I47A 1KNOB 5LMZA 4ABQA 2NW6A 4XGZB 4D1YA 2C4WA 4ZJPA 1MREH 4QDGA 3K6KA 1U8HA 1DQIA 1GH7A 4HAOA 2EQBA 1SU4A 1A7RL 2A35A 4EYQA 2VDKL 3D3JA 1D2OA 1L5FA 4XHJC 5A7BA 4F57L 4JI0B 5HDRA 2QTTA 1KFAL 1G5FA 5IAGA 1SPBS 4Y4KC 4KIJA 1RI4A 4HJGA 1JYFA 4LMBA 2C84A 2CDCA 3DZKA 5CLWA 3HWRA 4V0KA 3ML1A 1L9RA 4RIHA 1OTUD 1FP5A 2ZR0A 4D8XA 1JAHA 2D7JA 4LFHG 3D3NA 1CICA 3H3XA 3SKYA 1ESEA 3GP8A 4APXB 4PN6A 1KEPA 1JEQB 3VXTA 5EBMA 5IC5A 5LHDA 2ROXA 2FQWA 3BVNA 2EARA 1KB5B 4LZZA 2QHRL 1CDEA 1XPUA 3SE7A 1QFWI 4JMLA 2VZ0A 3GJFB 3T6WA 4N1AA 4IMJB 4G25A 2BSTB 1M05B 5ERWB 4QT4A 3G82C 3RHSA 1AY1L 3MNWB 3H4TA 3PICA 3C5EA 4RRPG 3AABA 2KJQA 3A3KA 1ZGGA 3BMCA 2I07A 4YSPA 4OF6A 2GVNA 1ZW6A 4ER5A 5B4VA 1VYVA 3DXFA 2C82A 1SU8A 2GUYA 1QK5A 3JWPA 5TFSL 3D4GA 1BWWA 2BXYA 2B5IC 1GC1L 3THWB 4PGGA 1T04B 3MLXH 1CERA 3P9QA 3DCYA 4KFZC 1GCIA 2NU7B 1ACYL 3QX7A 2JZNA 4YDJA 3U4AA 2XC8A 4HDKA 1W4RA 4WI0A 4OFXA 1S6YA 2OYPA 3PWSA 4UUOA 1I1OA 1PRYA 4IDOA 2X9GA 2N4IA 2ZUWA 3EGIA 4LK3A 5IVKA 3W06A 2AC7A 1P1BA 3WA6A 4HT1H 1GQQA 4D9LL 3K8LA 4DP9X 4B9EA 1FQOA 2IWEA 3V6OC 5EHIA 3PCXA 3TH4T 4R1MA 1RKVA 3HG1A 5FW8A 1I7LA 4AAYA 5K0JA 3UV3A 3VR4A 4JFDA 2WVJA 4JK0D 1MG5A 2YVUA 3TLXA 2RALA 4BNJA 2QROA 1UKTA 2IH3A 1ADCA 1XA4A 4LK4A 4Q48A 1W5EA 1TVKB 4LOEA 2GESA 3CGWA 3OLCX 4AC4A 1HNYA 3W6ZA 2IZ0A 3ZLTA 1ADQH 4YFLI 1LJMA 3H0KA 4OQXA 4MNGB 2NX2A 2HZHA 2FRXA 4Y89A 2EVJA 1FTSA 3LV3B 5J6HB 4P8RA 2A38A 2AN4A 3N8GA 4K9OA 2PCPA 5THXA 4JU9A 2YSSA 4FILA 5M7QA 4U49A 1NYQA 1H8ED 1MT3A 3CIOA 1DBQA 4WKGA 4ACTA 4S1RL 5EIEA 5I48A 5JYEA 1A4KB 3FQNA 3KSRA 4A68A 3TBHA 4D9IA 4N0DA 4GYKA 2BKUA 4YDVA 1FNNA 4EO4A 5E6YA 1C12A 5F3HA 3IVKB 1ZFNA 1RXEA 2DPYA 1XEDA 1JQDA 4IMIB 4M9ZA 3BRDA 1IFGA 2WY2D 3VGEA 1UWEL 1OAOA 1NKRA 3KQMA 4D8TA 1CFQA 1AS8A 1GYUA 1YPZE 1CFZA 3RYCB 1CB4A 4MYWB 4FDVA 3W5JA 4FM9A 1IGJB 3FRPG 2R1VB 2BE7A 5AENA 1AK9A 2CY0A 1K0UA 5E95A 3TVDA 2JB5H 2EUZA 2IT1A 4JSYA 4KDTC 4OZFH 5LNK6 5EH1A 3FFCB 5E5MA 1TTFA 4ZW5A 1SVWA 1N5RA 1WS8A 1V3KA 3MRRA 4X9GA 4G1MB 2LLLA 2OCGA 3CXFA 2CCKA 3VRHA 3KPWA 4ZGWA 1MAHA 3IJEA 3ZHZA 5HJ5A 3IKCA 3OLWA 3IR5A 5FIEA 2GEJA 5FWYA 5DZJA 4TLSA 4BGVA 1R15A 2JGMA 3AETA 5LWYL 1EXVA 1QI3A 3A6JA 1KXVC 2G77B 3WG9A 3WHIA 4ZZFA 4CT4B 2J20A 2IEBA 4JFSA 2ETXA 2PVSA 4L0QA 1OSEA 5HPMA 1H8NA 2DQIL 1RC1A 4MIEA 4GY4A 1L0XA 5H02A 5CTJA 4GWGA 1VE7A 4WESB 2JGRA 1S7SB 1GAEO 1HMPA 3I09A 4EZIA 3SSOA 3AFLA 1ZONA 1Z3GL 3B7SA 4L4YA 2MYPA 4M55A 3IMFA 3QYCA 1IQRA 2YWYA 2QUAA 4KXZH 1H3XA 1Q0YH 1NBMD 3VGPA 4P93A 5D9SB 3OZ7A 3W5MA 1K5PA 4MS3A 5EXPA 4J2QA 1UG9A 2C29D 3K92A 5H2BB 1G7LA 1P33A 3FROA 1YS6A 1R17A 3MREA 2VRBA 1P2DA 2HX8A 4YO0B 4FZRA 1KVRA 2ZRAA 5DFVD 2PSEA 2MQGA 4AYBA 3ABRB 3NEYA 2BMKB 1D5XB 2REQB 1D1SA 1GGNA 4QJ3B 4CNIB 1A4BA 4EG1A 4YHKL 3Q8AA 1HSBB 4OQLA 3QXSA 4XMLL 1DL7L 2R59A 1XEWX 2J45A 3FR7A 2WA2A 1BO6A 3GT3A 3NFYA 3QYPA 5JBIA 5JOFB 5TGZA 3P2OA 2R7EB 3CKLA 4DPLA 4XGQA 1Q94A 4UBMA 3TSZA 4RMTA 1AXEA 4R1UA 4FXKC 1HYSD 3QH3A 4AC9A 2HK8A 4DJFC 1GRVA 1I6LA 4OI9A 1OTSC 3TZEA 4W5QA 4J6EA 3PB3A 3GLAA 4W5HA 2NTJA 4M1DL 4OCZA 3Q44A 4BECA 2DF8A 2H92A 3WOHA 4V2IA 2EW8A 4EUHA 5H35B 2PUTA 4TYWA 4Y1TA 1AGDA 4O25A 1RQPA 2GPZA 4ZS6D 5FPPA 2DQTL 4QARA 1N33B 5C0CD 1E5XA 2IS6A 3MK31 4WHTA 5T3XD 4TQ8A 1FCCA 2AC2A 2G2RA 1ZKMA 2PZ8A 2TSYB 1M8PA 3LY6A 4BNFA 4G6JH 1BJ8A 1I2BA 1W0WA 3B2XA 2CO7B 4KFUA 1NHWA 5AO9A 2KDYA 3LKQB 2YYSA 3O0TA 4UIKH 2XUZA 1K89A 3C45A 3TL3A 4MB3A 1PFUA 3MWFA 4EGJA 1ZR4A 4ZFFA 5GONB 4MHHG 1J5EB 4KQ1A 3VYSB 4I66A 4X20B 1SEPA 1NAMH 1FUNA 1F4LA 4YROA 5FOUA 1D4AA 3VHXB 4LP8A 5IHXA 4A5OA 1GZPB 2OMYB 3SOBL 2Q3EA 4HLUA 1RUMH 2X4NB 5LQSA 3T54A 1UQRA 4QTUB 2P2LA 3IULA 3GLVA 3D25B 4X80H 1L9MA 3U0WL 3RFZC 4P9MH 3CHPA 4PUBH 2FY8A 2X4UA 3IIJA 3G2KA 4I50B 3FAWA 3I1YA 1YG9A 3LS5H 1CE8B 5ITBL 3QV2A 4IRSB 4GRLC 4GYJA 3R5TA 2PXHA 3U44A 4UM8A 5HJGA 2OFWA 3LOUA 5MEPB 4F4UA 4X6XA 4FQPA 4B6OA 4ZUVA 5AALA 2EF1A 3QUXD 3K2QA 1KZQA 3QDJD 5ALCH 4DB2A 4ILKA 1X19A 4U1GB 4Q6IA 4FCTA 4HOMA 2PSJA 3WQQA 1D2RA 4AW7A 4ZAYA 1IXYA 1UMBB 2RCSH 4JFXB 3EB9A 2E7CA 3CMOH 1R6BX 4XO5A 5TPZA 4OB6A 4ZEMA 2APWA 3GEMA 1UOWA 1ED3B 4L29A 2WMOB 4LVOA 4M9SA 4Y0AA 4UTAH 3MB8A 4NQVA 4TVKA 1I7ZB 1LJ8A 1FIUA 3QJRB 3P0EA 4FA6A 3ELQA 2OTCA 2JAHA 4OQMA 2CFOA 4HDOB 4BLTA 1YC5A 3I2CH 3RVTC 4MYUA 1U91A 4PJEB 3T95A 5J2UB 2J25A 5DYGA 1LNUA 2I62A 3X1NA 5E6UB 4DCMA 1DAKA 2JCCF 4H17A 1LTQA 7FABH 2VJNA 4GICA 5IBLC 1GYQA 2B69A 1VXOA 4F5WA 4U3XA 2XN9D 2I2DA 4GG6B 1S7RB 4FR5A 3ZXIA 3A11A 4LPTA 2HVJB 5LZ8A 1QZNA 3GLGA 2UZIR 3ZS8A 1OE0A 4IFTA 3ZJUA 3KYCA 4KDVA 5FUZL 3PWPB 1TVCA 1XCBA 3ZYJA 3SKNB 2E2WA 3OKFA 4H8UA 1E9BA 1JLRA 3WISA 2DQKA 2AK4A 4N9GA 1ZVQA 1D9KC 4BVHA 4JI5B 2WBJB 1XKQA 1TVHB 3PXLA 4YCDA 3JWNH 3ROGA 3NRQA 4AJHA 3T5MA 1KIMA 3ZZLA 1NVEA 3FOLA 4RLHA 1N25A 2YRPA 4UB0H 3F5QA 4Z77B 3QF4A 2ZROA 4Q74A 5CR8A 4EUPA 2OWEA 3EMDA 2CYAA 2B4QA 4I14A 5IBUG 2O48X 2C9VA 1XGTA 1ORSA 2AMGA 2B3TA 2YC2C 1UWXK 4QRTA 4P3DB 1BFKA 3CJTA 5JFGA 4N39A 1CD8A 3UJCA 1QZ3A 3FBTA 2O1AA 3T4UA 1I2MA 3KEMA 1KEWA 3PU6A 5JHGB 2YBDA 5CCJA 3AFIA 3REFA 3SLRA 3MO1A 3LVRE 4HFWB 1QKKA 2GJ6D 4OLVL 3ARBC 4KRFA 3UMVA 4I18C 1YFKA 4U9UA 4F2DA 3CK0L 4M7JH 1NSTA 1X7WB 5HP5A 3FTYA 3Q8CA 3MYRA 1KTDA 3C3DA 3OZWA 1UJ3B 5GHWH 1PHPA 3LFTA 1MDFA 4M1KA 1LU9A 4LFHD 2BSSB 1GZSA 5D2NC 2FLBT 4BH8A 2I1VB 5FPYA 4MDJA 5AVTA 4ID9A 3FGOA 3L6BA 3G2LA 1UT6A 1Y6GA 1WXDA 2X77A 2GB4A 1QOQB 3GJ4A 1RZGB 1T5WB 3D1MC 3VH8G 1X7HA 1Y6NR 4LJ8A 2HREA 4AZWA 2FZCA 1M4KA 1N2CB 2LRHA 3KSBC 1B8UA 3SVZA 1DEXA 3CLTD 4DABA 4JL5A 1HESA 2F58H 4KRXA 2CBQA 1MEXL 3KPPB 1XF2A 4B31A 5AW1B 3RT7A 3SDDC 4RD0A 1PR5A 3AGQA 1NFKA 3EHDA 2WXOA 2Y7QA 5GSVB 2FP4B 4MLIA 4XODA 4IMLB 3CE1A 3RUGB 2ESRA 1I3OA 1OK8A 5JJ5A 3M6MD 5L53A 1TGYA 1FSFA 1KFJB 3FWPA 2QGDA 1N1DA 4IXNA 4DKDC 3IEMA 5EUKB 1ZD5A 3MUJA 1PTJC 3FKQA 4UDTA 4HFNA 1JNHB 3DX8B 1COWD 5EZLB 3B1FA 5CYFA 3S55A 5A4MS 3O4GA 2AFHB 2ICWA 3TW6A 1UB5A 5TVGA 2R6JA 5IUSA 1VC2A 1GGIH 4O2AA 4GXNA 5J63A 3GMRB 4OMUA 4AVHA 4ROTA 3TNYA 3W77A 1A1VA 4ANXA 2W2OA 4MGZR 1FE8L 5EDXA 2RARA 3IDJA 4NHUB 3G5XB 3ARFA 3C98A 4CIDA 1HLGA 1BW8A 1QH1B 4E09A 4X4YB 5INDA 4YUEH 5FPSA 4GSYA 1FU4A 4UU9A 4HVLA 3RTEA 2Y06L 3UA3A 3KZ1E 4PQXA 1OWOA 5KYNA 2ZT5A 4TPRL 5IVXA 4I6JA 3KLNA 4EJSB 2F1IA 2NZ9C 3ITKA 3U17A 4K6HA 4IJ3C 4Z7OE 3IQHX 1Q90A 5C0EA 1EIZA 3RNQB 3BMWA 5AUQA 3DUUB 2Z98A 5AZEH 2LGJA 1Z5NA 3CX7A 5JORA 4WNIA 4LOUD 3LH9A 5DMGC 2X7LA 4U39A 5IH7A 4DEWA 4UQAA 4HD8A 3JQDA 1U04A 1ICIA 1Y3HA 5KJ7E 2IH1A 4CN8A 1LVHA 4N18A 3VTZA 4UYQA 1Z22A 3LNTA 2IWGA 4HEHA 4LCIL 1OKEA 5JLZB 4L3FA 1A5FH 1H8EA 5ALIA 4O2CB 2DM7A 1JEAA 2PQMA 4HGPA 4U2BA 3GDFA 2JWYA 3LRXA 4OOEA 4GAJL 1E3WB 4BLUA 5BQFA 3HI6H 4ODUB 3MFQA 2XMBA 3DEIA 2BCJQ 2VP0A 1TG8A 4I5BB 3AJAA 2QW1A 4PC2A 5CM1A 4G0QA 4BH7A 3AU1B 1IAKB 2QXTA 3L1OH 5BS0D 4DADA 2JLQA 1KMNA 5COBA 2E46A 4MNQD 2XDQB 2OORC 4B96A 1JUFB 5DQDL 1L8AA 1ETHA 4Z7WF 3IDYC 5KYYB 2ERYA 1BE8A 4H1WA 3JWOH 1CIJA 4Y2DA 4Y7CA 4PFQA 5KDLA 4IZOA 2PKCA 3P5SA 3QUQA 1P6AB 1WMFA 1P7QB 3FH5A 4IIJB 4F2FA 4MVJP 3IJHA 2R6R1 1LS1A 3FQTB 4EOGA 5AVRA 2CMRH 5I16A 5EZJB 2C9ZA 2FJSA 4RY8A 4OUKX 3II1A 2YWXA 5AUPB 1KAOA 4E94A 1NX9A 2PR7A 5K05A 4UHDA 4L4TE 4YIHA 1E0KA 4MUFA 5HX7A 2Z1PA 4J3OF 1Z6XA 5FI5A 4JGNA 4AXWB 1AA6A 2O2JA 3RARA 3LLCA 3CSBA 3EPHA 5A2BA 2WP0A 1FZOA 1UD4A 2OXCA 5EG6C 4F2MB 2FLVA 3EWNA 1PGQA 1JIQA 3ZE1E 1FL5B 2DQDH 4M87A 4HS6B 1PJ3A 3UC5A 4UE2A 5JW5A 2GZSA 5GJTL 5CAEA 5D5MB 1WF3A 2IUFA 4OLJA 5ADHA 5BQ7A 3WGVB 2H7WA 3U2JA 5GGRA 2FZ3A 3P52A 2FMKA 1NXXA 4HCIA 3WYEA 1M1SA 1IOVA 2UZ3A 5T64A 1DUZB 4M1OA 3TKAA 2ACEA 3I0MA 1N3IA 5M2QA 4YAQA 3HRZA 2FMIA 4HEPG 1H6CA 1ZLDA 4KLNA 4KWTA 4G1UC 5B39A 3CXHK 1JDDA 1NBMA 4LSRH 3NCJL 2HXAA 1W2WB 2CJPA 1JG4A 2OC9A 4IO0A 4YZWA 3WO3B 4KK8C 4KR2A 3AR8A 4Z78A 4HMCA 1AG6A 2I80A 5F9HA 1A9EA 3MOBL 3BK1A 1N59A 5JYMA 4JLMA 3K46A 2FZGA 1I32A 1WZNA 3SOTA 2IYNA 3BF8A 2X2JA 1YZHA 3NPSC 1FY2A 3N85L 1L9XA 2MTBA 1SBCA 5DRWA 3KLPX 1LQTA 3B7TA 3BZEA 1IQUA 5EMHA 3GXOA 1P6QA 2CJUH 4TSFD 4AQ7A 3DVQX 4KQKA 4EEEA 2G9QA 2X9NA 1N57A 4FN0A 2GJZB 1JZHA 1XN4A 5C0DB 2WHVA 5HM6A 3U60B 1D5BB 1AUXA 3HE7B 1GAXA 1GZ5A 4J3NA 1F38A 1EGJA 1PK9A 5BZDA 1IY1A 1AXTL 4DV3B 3GZJA 4GMSH 5K59E 3HJHA 3RG8A 1Z5LB 4BDTA 1A7BA 4KX8A 4AYTA 2WNXA 4L5FH 4OO3A 3DV0B 3UAZA 4U1MA 2B6NA 3OZGA 3ZD9A 2SEBA 5EFIB 3LHAA 2IAMC 5KKAA 1EANA 4JL6A 3MUUA 3KSUA 3VR6H 1KBWA 4EDWL 3V7YA 2G9ZA 3ADKA 5CH3A 3BPLB 1XCJA 3O3NB 1QYWA 2AN5A 3FUXA 4JDTL 1VGKB 2HEGA 3LVBA 1QUPA 1B0RA 3RIAK 2H54A 2XLCA 3JYHA 1PS9A 3GLFA 3BTUA 1M7DB 3CQFA 3UMTA 1ZGLA 3DA0A 1L4NA 3PLRA 5KOMC 3ITDA 3UC2A 3OHPA 1UD8A 3C8MA 4TKWA 5ES4B 2PZFA 3V0HA 3FS9A 1MJNA 3CFEB 3ROEA 1F6BA 3BOSA 4UVIA 4PJXE 3IGUA 2WQSA 1KACB 4Y5YC 4AF7A 4YC7A 4EPVA 1O1YA 5FF9A 3N41F 1F58H 4OD2B 4TVSa 4XPFL 4RPJA 2QV7A 2E7LA 1D5WA 2WWOA 2IDFA 3LUGA 4PQFA 3LQFA 4FCCA 2QX4A 1EFAA 5J6SA 3LIUA 2K7QA 1ZUNA 4FQHA 4Y6LA 4LZOA 4LSPL 2FVNA 5TH2B 3QDJA 1F9EA 1IZ7A 3W5UA 4R0LB 3REQA 3P0VL 1U93A 5EIOA 3T0EB 1X4YA 2WOJA 3DX6B 2ID8A 4P5DA 1JG9A 2HB0A 1DMRA 1N4XL 5I0XA 5D00A 2BVEA 3PFIA 2WQWA 4BXOA 4HHEA 1ZD2P 1T0NB 4KL8S 1XX9C 4PXSA 1OALA 1BROA 1KXJA 3QA9A 4LZWA 2JHPA 1IBYA 3U30C 5FPTA 2EC9T 5CVUA 2H5IA 1K9SA 3M8OL 3FCAA 1GCYA 4DA8A 3BJMA 4NKMB 3P77B 4YSRA 4M83A 3TEXA 4R2GC 3GSUA 3KYJB 4C78A 1KZ7B 3RWHB 3FUVA 4N3CA 3MRBA 2V7WA 3T2NH 2HLEB 3AAZA 1IIRA 2K4AA 2ZJ5A 3U3KA 3TLBA 5CWSA 3M5CA 5K20A 1V3UA 3DIFA 2QT6A 3IEVA 4U2GA 1MAMH 4FCAA 1DKNA 2VWPA 1SWWA 2CR6A 1F6WA 1QGDA 5LDHA 3L9EA 4AJOA 3KTFA 2OG2A 4MDRA 4FFTA 1UC9A 4JLSA 5HHPB 1ORQB 3VG0H 3QENA 4RJKA 1A9QA 3W2FA 5CMAA 4H25A 3CZCA 2AEWA 4DM3A 3DX0A 4RE6A 5DMHA 2A14A 1WT5A 1JWMB 4DETA 1ATZA 1WEKA 2H2SD 1R3KB 2GZHA 2VPXA 1NR5A 5I1GL 3TWCH 5EUOF 3DS8A 3AJRA 2X2IA 3TEYA 2C4KA 4FP8H 4LAFA 4TSAL 1UUFA 4S1DD 1WHOA 1MTZA 1JRHL 5TS2A 4JHZA 5LUAA 4JGIA 1XGUA 5HPYB 2OG1A 2PO6C 2YGNA 3V8EA 1Y6MR 1HE8B 5AW7B 1VL1A 2PWGA 4HIQA 5ESAA 4ZK8A 3RPIA 3QIBD 2QSVA 5I18L 1V25A 1IZ0A 4M48L 1OILA 3CEHA 5KYVA 1YJDC 4HNVA 2GJ6A 4M7WA 4L0YA 4F3FA 2CGRL 4N5MA 4MFHA 3VWKD 3WVNA 1WW3A 3HS0A 1IN8A 4N3BA 3SKJL 1BXXA 3GM8A 3DL4A 2BGIA 1SUEA 2GDZA 4F7WA 2NYVA 3HXMA 4JBIA 3HDQA 3RVJA 3AI2A 2ZPKH 3KVYA 1UOLA 4ZRDA 1JU3A 3ASVA 4TTQA 1P2FA 3RABA 3G6AB 3EQ9A 2PZLA 5E2VL 4JVSB 3UZQA 4YHIA 4BO8A 1H6DA 2OAP1 1FCJA 4C5AA 3OKNA 4HXBL 2R65A 2XXCB 4KWUA 5AKIA 4TV3A 3UZUA 5B3LA 2ESVB 2GIYA 2VXTL 1OLSA 4ZVMA 2EEBA 2V97A 3NWJA 3P2EA 1N19A 1AHWA 1R0ZA 3VMOA 4X6BB 2VM9A 1GD1O 4IHAA 4MS8C 1RZKH 1ZCJA 1ZN8A 4CR8A 1KJWA 4FNOA 1VJSA 3I3OA 4AY6A 4RF5A 1HNGA 5HBGA 1EVUA 4JO1H 2VZ8A 1PIFA 1T91A 2FLRT 3TOXA 2ZYVX 3V95A 1HQRB 4TZKA 3W38A 1W75A 4ZVOA 5FC9A 4Y1RA 1XZDA 4AT6A 2ISCA 4IXMA 2VH5R 1WIUA 3EYFA 3MZ0A 1FTYA 4U3SB 5F7LB 3QE3A 3FUNA 2J1XA 1J24A 2NY4C 1N34B 2VL5A 4DJTA 2WV3A 1P4HA 2O5ZL 3V4PB 3NAMA 3A1EA 3JD3A 3KLAB 1T29A 4CLRB 3QBTA 1HNWB 3OM1A 3FFWA 1G7JB 1PJBA 4N0EA 5E0QA 1SUDA 4BYHA 5ABDE 2OOKA 3FFDA 4NCDA 1Z3IX 2AERT 3U37A 1O7JA 4HX1A 3IT2A 3PQYD 4JM0A 3RASA 1NUDA 1UODA 4QHPA 1FP4A 2YD0A 1GUFA 4IGBD 3TCXA 3B36A 5A2JH 2DWSA 4EKJA 3GFGA 1KSFX 4CADA 2OFQA 1XZBA 4Y9TA 2OR8A 2WJHA 3HYSA 3KVOA 2FUQA 5T5FH 3WS3A 3KOYA 1UR5A 3AVPA 3EYAA 4PQYA 1YFZA 1JSXA 4OCNC 4COKA 5EEUA 1VFAA 2MJWA 2TAAA 5ACMA 2BY4A 1E4OA 5CEZL 3S81A 2V3EA 3VOAA 4DOHE 4O5OA 1M1XB 2YA2A 3KAAA 4OGQC 3VCLA 3RC2A 3S8FB 3KPYA 5KOHB 2JKWA 5KYXA 2YARA 5CEXA 1NDGB 5EZPA 1ZNWA 4P5TB 3TG2A 3D3VB 1WPCA 1KYAA 3IIEA 5EDSA 2HXYA 4ENRA 4RAVB 1TZIA 1KO1A 2RKBA 3TZLA 4P23C 4RQTA 1NQAO 1GWNA 1NUQA 3FZYA 4DK6A 5L0QB 1J1OH 1GL9B 4WOPA 5DM1A 4EYOA 4PHZA 2XXAA 4W8GA 3EADA 3ZIDA 2JRLA 1DX9A 5IVPA 4S3MA 4K8RH 3DNPA 3FRPA 3OKLA 4GAGL 4UQBA 3DAPA 1X1BA 4XVUC 2B8JA 4NZ8A 3MINA 1EDBA 3BREA 4P5KA 1GPDG 3DDHA 3FUUA 5F2KA 2WUBH 1S5HA 3LS2A 3VD3A 1D2AA 4K5QA 1KCVH 4PG9A 2EXTA 2PW2B 1E18A 3H04A 1LLCA 3G89A 2IIQA 4XD7D 4KTGA 5K9OA 5CEZE 3C6LC 5TD4A 3OCVA 4JJZA 2XUHA 4D80A 3PE3A 4WZBB 5EC1A 5CVVA 1JHTA 1KCLA 3QJUB 1YB7A 1AYOA 3SYKA 3NEEA 4S1VA 4RPCA 4X8JB 4YUZA 2WIIA 2X2FA 2ZRLA 3QKRB 1BFDA 5G0UA 4QHUA 1QX4A 1PR9A 3HZOA 5IJDC 1WFJA 4HATA 4PC6A 1Q3TA 1J42A 2P8JA 5ADUS 2WP3O 1OFHA 1JHKH 4JG5A 1J99A 4M1TA 4IVNA 2J72A 4B3BA 4NXKA 1XXHE 4GKAA 4OQ4A 1DAGA 2B0SH 4BATA 3JWDL 3FYSA 1YQVH 4P05A 2I9LB 1RH8A 3A26A 2FE1A 4EG8A 3JV4A 3ORYA 1FFYA 4OZHE 2ANCA 2V5AA 1C5DA 3ZHVA 3LUFA 2YWJA 2ZRDA 4H0GA 3C70A 1LE5B 2LTQC 2JJ1D 2V7BA 1E67A 5FH9A 1BIFA 1OF1A 4A6YB 1W72A 5DYFA 3HV2A 2C83A 3CLWA 4HNAB 3HB1A 4TPKA 3U80A 2Z64C 1PE0A 3HZYB 1DTEA 1RJCA 4NOFA 1JV5A 5LGKA 1QB8A 3GW8A 3KR3L 2KPWA 4PJDA 1D6SA 1RHRA 5EF1A 1IQWH 3TNDA 5JANA 2IJGX 1QRTA 4G5SA 4IHJB 4GUCA 4D9RD 1H8HD 1TO2E 5AYUH 4JKPL 3ZGHA 1CFTB 4NUGH 3WLAA 4UUNA 4DQLA 3ALXA 4M99A 4DK3A 3VMNA 4H4NA 3REWA 2YJ6A 2W90A 4JLUA 1D4ZA 1EDDA 5IF3A 4AGOA 4ES9A 5JTWA 1EEZB 3MMEB 4OJCA 3LY7A 1P4LB 5T6MA 5AFAA 4CIWA 4EN3C 1VGRA 2NTEA 1NFDA 3NA9H 1KI7A 1IC4L 4TSFA 4AB1A 2J7LA 1ZSHA 2IS1A 2K3TA 3CC5B 2XI4A 4ESKA 4OSUL 1P1JA 2I69A 4IYRA 3BAEL 3VRJA 4KWHA 1A47A 3EGWA 4LY6A 1KYYA 5AWNL 3IAAA 4HK0A 1GTNA 4ELMA 1G9NH 5IMMA 1Z5VA 1DBAH 3B12A 2OLEA 3LXAA 4OZIF 1KB5L 4IUCS 4RGYA 2B25A 4QO8A 3OWHA 3FAKA 4YACA 1CK0L 2JANA 2ZSBA 1G2QA 5FTKA 1BD2B 2PWHA 2V7NB 4J1TA 5A7HA 3BWVA 2H1OA 4R97C 4Q4JB 1T5KA 1VI6A 3D6TB 3GI8L 4A6XA 1RWBA 1SHWA 4ODXA 1G7SA 2W65A 1GFWA 3E3OA 4ZSOE 2JGDA 1V3JA 3F6YA 3DHUA 3SGKC 2JCCB 4ANWA 4ODWA 3EW9A 4GINA 5EE5B 2XACC 1GARA 1C5CL 3WJLA 4RV5A 5INCA 1XTLA 5I4IA 1H3GA 4WUTA 3D6NB 2HAEA 3CHOA 4DMKA 3CZ9A 4Y2OB 5IF0A 3PDHA 1ILWA 4H7FA 1EV2E 1PNRA 3NSFA 2WTXA 2EW1A 1F3JB 3H9YA 4KRPD 4GKLA 5E6RB 4J28A 2RHGB 2AEEA 3QV1A 3LNGA 2AQ1A 3H9SA 3VRLE 3PFUA 5MEND 1RACA 2PGIA 3UO1L 1KTIA 1U3DA 5JLAA 1SOSA 1IILE 1JVNA 2FX8H 2W58A 2XMDA 1NQTA 1J48A 3V0GA 2C95A 3GMOB 2PBRA 4II3A 1ZAYA 2ID7A 2AKRB 4FGSA 4JYZA 5EIBD 4ES8A 2NAPA 3OETA 3FSVA 2AAVA 1SU7A 3FTEA 2IS4A 2AK3A 3I84A 4YDIL 2VIRA 3OM9A 3U83A 3HE6D 3W04A 2PDAA 3Q0TA 4B6QA 4ZRGA 3D1VA 5JPNA 2BF4A 2DBLL 3DSFL 4ECAA 1VLMA 2DTXA 1LW6E 2EHDA 2ZCKL 4MW6A 13PKA 3T52A 4BHUA 2BIFA 1M10A 5JNUA 4IHOA 2EVWX 2WMPA 1UBMS 5PAZA 4N0PA 1CBVH 4WTWA 1Y3AA 1ZT4A 4Q58C 2JA2A 1UF9A 4Z3OA 1UKZA 3R7WB 1ZLWH 4GIBA 2MU1A 5KTKA 2XF2A 5FECB 4UQ3B 1RRFA 1RWMA 3KCWA 3LXUX 4FFZH 4MCNA 2J5LB 2HXGA 3C60C 3I9MA 3TCKA 3WTBA 2ENUA 1UMKA 4Z5RA 2NP6A 3HDYA 3L3HA 3QVXA 2AP2A 4G0UA 3X3FH 1ZWIB 3OFJA 5JSYA 5BWCA 4PWFA 1AMUA 2CRZA 4B3IA 2B3DA 3MJ7A 1SG6A 4RDHA 3F4LA 4R6XA 1KI6B 4AYXA 1G7HB 3JVEA 4IMKA 2H4YA 3DX7A 4TQEL 4PXAA 2WWXA 4DR2B 3UAVA 4QZVA 3D7KA 3APFA 5JAHA 3GLQA 4MNGE 4TRNA 4M4SA 1U0OC 2EIJB 1CR2A 1R9MA 7ABPA 1SVZA 4ER6A 2I1LA 5E1AB 3MU3A 3T7SA 2C3VB 3EMBA 2HNBA 3G1UA 3GKWL 3RH0A 4L5BA 1CJBA 2CO6B 3I52A 1PNTA 4F71A 4BFNA 3GT6A 1BQKA 1DDGA 2YHUA 2FW8A 3V9AA 2QI9C 1BGWA 3OKYA 3CBQA 1I9JH 4S12A 3WDLA 5BRQA 2GJRA 4KAJA 4N6RA 5ICGA 1RKXA 5FO9B 4PVCA 4IIXA 3V7FA 3EYOA 4B2PA 4C7MA 3H3FA 3OAZH 3GLZA 1MJ8L 2FSVA 1BVHA 2JIQA 5HS6A 4DTGH 4Y9SA 5JJIA 5ER9A 1F4YH 3THSA 5FAXA 5DB4A 1T0PA 4MUXA 3SYAA 3OSVA 4LLAA 1HF3A 2ZQYA 3CVCA 2YXNA 3OLXA 5HGGS 1G2OA 2FW9A 3I9NA 1DLHA 5BV0A 5IKPA 1K8YB 4QGFA 4OQTL 1H3PH 2PP8A 3E9TA 3EGOA 4CUKA 3BJLA 3JYBA 3QIBA 2Y9PB 1T83A 4NO0B 1XZLA 4JT2A 3UJHA 1OXTA 4D9EA 4QHNB 3FFCE 3NOOA 4GQ9L 1TCCA 2X1WL 5B6PA 2C2HA 3MJSA 4PYMA 5T1MB 3VWKA 2A7XA 1TJ4A 3QWAA 4RMBA 3E7FA 4WVFA 5DZVA 5KUMA 4PJBA 5C34B 3NMEA 4P5PA 3ZGYA 5IG7A 4MNTA 2Q1YA 3KG2A 1V7NL 4CKYA 3BW9A 3KVVA 1ZJAA 1Z5OA 2BFFA 32C2A 2CL0X 2PNFA 1UA6L 1Z6TA 1VSTA 4NQDE 1RZFL 2F5BH 5EOTB 2YRFA 2NY7L 1R5NA 2L7UA 2H8PA 3N2YA 2ZG3A 5AJVB 4CEJA 2ORBL 3ARUA 3O45A 3KCQA 5IHZA 4AH2A 3K8MA 3NFPA 4TSCH 1UC5B 4W9RA 4HZGA 2QR2A 2Y3NA 1CP3A 4JZJA 3C5ZC 3WNJA 1E5LA 4N8VG 4RIFA 3WI9A 1NUNB 5I6DA 2GFBB 1TJHL 3QYJA 4DXHA 3KYMA 3HR4A 3QDHA 3JYOA 3HBFA 2ECPA 2IU3A 3UPUA 1P5UB 3QNXB 4KTDL 3BPSA 1JR6A 4ZNEA 1IDN1 1MQ8A 2C4TA 4BZWA 5A9TA 3V9EA 4YS4A 6NULA 3GLHB 4BFRA 2J41A 4IY1A 2WU1A 4LISA 1YNLH 3VGFA 5CS7A 2QEJA 2LCIA 4QODA 1FTWA 3VXSB 1YWGO 2ZRCA 4F38A 3RWFB 1PQZB 4QY8B 1I3MA 3RIFK 1YMHA 1XGPB 3ORRA 2CSUA 4IBSA 1WCBA 4TUJB 5K3DA 3RUHA 1MJ5A 4JKNA 4ZS7L 3UCXA 2AG6A 4A2WA 3RIXA 1HIMH 4D74A 2ZOLB 2F43A 3BWEA 1Q0HA 1U7OA 1NV8A 1RCTE 5GGYA 4Q56A 2A0XA 5AWFC 1C16A 5E23A 3D54D 3KQUA 4KJPD 4AQEA 1S8FA 3S2CA 1QFXA 3VKWA 3EUUA 1N0XH 4IGBA 2FN3A 4IJ5A 3JCZA 4N25A 1WW2A 1XZJA 3V7AG 1JTVA 3MERA 2O61B 4ZT5A 3IS3A 4JHWH 3VGDA 4G4SO 4LFAB 1G55A 1TEGA 2QKIC 2OGWA 1JSLA 3IT1A 1FIEA 4ZAWA 3NALA 2M26A 1JHRA 3OF3A 1XBRA 1T34A 2GKIA 4HIEA 4F58H 4PTTA 1HQ4B 5KNLA 5J13B 2BVPA 4I55B 4PJHA 4ND8A 1U3HB 4D45A 3SBQA 3H7IA 3LHKA 3IPRA 1J8HA 3NZUA 3TEJA 2VSKB 2VTBA 4UBOA 1H2XA 3LKRA 1JB1A 3G1TA 3UJIH 4K7FB 4ZPTB 5A2GA 4M1EA 4H0LC 4KJZA 3S6CA 4LLQA 1P2UA 3S2GA 5KSBF 2W93A 2QK4A 1H3EA 3ANLA 4AQZA 2ZM6B 5JPDA 1GPKA 1LPMA 3Q5OA 3QP9A 2E75C 4EUPG 2CDAA 3VC1A 2GARA 1T5BA 3OKDB 1CLYL 4EGFA 2HJKB 3USES 1CRWG 5TIIA 4CJXA 3VFSB 4XD7A 4FTVB 1YEDB 1AXSB 2R1WB 2N9UA 4WDIB 4OL9A 4BGLA 4LU5H 3TT1L 2VW6A 1NU6A 4PGCA 1YVRA 1U2ZA 3BC1A 5CZXC 2NY3B 1XDDA 1SQSA 4MTCA 1DEAA 3LMJL 1T66C 1WA0X 4UQLA 1Q1EA 2FPUA 2A30A 5G0TA 4NJMB 5I9TA 1RM0A 2I6QA 3QVTA 2O52A 1CQPA 3KPRD 4FLRA 5EE0A 3IGAB 4HOWA 4M0PA 1ISGA 4K5PA 2BCKB 1EEXB 4GYYA 2OL3B 3M9LA 3P3YA 2I8CA 2WBLC 5FW7A 2H59A 1FDSA 4CNBA 1UZLA 4LMQI 2DVMA 4J6FA 1S9YB 4A4DA 2X8AA 1HTTA 3PJSB 4X7CC 3D51A 2G09A 1IXSB 1YDWA 1A6AB 5SX4I 4G6KL 4PEEA 3BE1H 1RHQA 1J90A 4HEPA 2DGDA 4F33B 3ZT7A 1Z8FA 2B94A 2JJ1A 4QYIB 3T5GA 4DYVA 4L8BA 2HPOA 1U0SY 2QRNA 5BRNA 5AW2B 4PJEE 4G3YL 1HILB 5EEXA 1U21A 4YDLB 3S1AB 4UILH 5BW4A 1M2EA 4OAQA 2GAZA 4N0UA 5ESDA 4QRAA 5CFPA 4DG8A 1DIGA 4F5CA 4F1WA 3S70A 2OKCA 3OI7A 5HJ3B 4RGBA 1MFCL 1YMMA 5IVHA 1CICC 3TMKA 4WRRA 1MIHA 2R0QC 2WF7A 3QOYA 4X71A 3VPCA 4MB1A 4IR7A 3RAJH 5AW3B 4GLFA 4WWID 4MZDA 5FOQA 3C6ZA 4G5ZL 4INOA 4XC1H 4OGAC 5JA8B 2CNYA 3EIUA 2QR5A 4X83A 1NR1A 1U8JA 4LVNA 1AGYA 2ZXEA 3NYWA 4RHEA 4ND1A 3PGFL 2OHIA 3WTVA 5JZ7C 3N41B 2HF7A 4FFYA 3WXVH 1I1FA 1QNZH 1WDTA 5TARA 1ZMYA 3VR4D 4JFDD 3V4OA 1M2VA 1SIWA 5ESQB 4F1JA 1DE4A 2NTFB 3LKDA 3DROA 4HJIA 5CGBA 3QX8A 4D0CB 3L4EA 5GRWA 4BMOB 5LBIA 2XWPA 3LRSB 1HE7A 2ZS8A 1JJ7A 2HNAA 2ACKA 5LD2C 3MV7B 1JZ3A 1L4EA 1OIOA 1RI8A 1LSOA 4BNHA 5GGXA 2OHHA 1YJAA 2L69A 2R2BA 1V41E 2EYRB 2P5WB 5E24E 1X5IA 2BHNA 5ED4A 4CDNA 3AHCA 2VXQA 3DTTA 4CM7A 3IFPA 4JYAB 1L5VA 3SC4A 3HPQA 4JUSA 4D4LA 2PMCA 3ARGB 1KY4A 2HYMA 2ZSKA 4LASL 1Z8HA 4HV8B 3FMIA 4K6OA 4BFJA 3HY4A 4FDUA 1LLFA 2XOEA 3GGCA 2Z8YA 3I9FA 4FFBB 1URZA 3H4HA 1UM8A 1ONQB 1TCRA 4F8JA 3GFPA 2NQCA 4N0RA 2VDQH 2W81C 3QJHB 1HH4A 1FL6B 5I9MA 5U4XA 4UM9B 2KQMA 4R8LA 5GJSH 5B7GA 3K8YA 8ATCA 3MODL 5I5GA 5CN1A 3QFGA 4ALAC 1H2RS 1UPBA 3RTAA 3CVUA 5F3DA 3VR2A 2VK4A 4EATA 1T1YA 2ZI9A 1YZGA 5IIEA 1KJ8A 1PSZA 4ZEVA 1KJQA 3QW9A 3V4VA 3PKJA 1OSNA 5MENA 3VXNB 2PX6A 4CT0A 4KK5D 4L4VB 4G9FD 1XALA 4MWSA 3IMUA 4X6CF 1J00A 5HZMA 4RZHA 4H26A 3RUGE 1M3SA 3MXTA 1U90A 2WN2A 2VLJA 2HHHB 2CHXA 2VE6B 2QR3A 1G7IB 4CMHA 3AQXA 1FZMA 3ZHBA 4HALA 4YHPB 4IH9A 1MXGA 2XSZD 1GAFH 3HE6A 5TRTA 3F73A 3P9IA 1TNNA 1MCPH 1G63A 2W43A 3PX2A 1EXGA 3S7GA 3P3UA 4IIZA 4N7MA 5TE6H 2AFHE 3K71A 3MRPB 4XYEA 1PJ8A 2R0ZH 2H4WA 2R9VA 2C3WA 1CHDA 1JE0A 2QVYX 5BV8A 5K99A 2EC5A 3UKJA 4MJIA 1CVLA 1ZC3A 4KZ0A 3UEOA 1TF5A 2AABH 3G79A 1G9MC 5GQBA 2G5TA 1FDOA 1FEZA 4Y2SA 1M9NA 3DFKA 4I48A 3MUGA 2LW3A 2YASA 3TB6A 3NWBA 5IBRA 4JBYA 5CT6A 2ZBEA 3UV7A 5JNYA 1GGJA 1GG9A 1T0IA 4IRJD 1F0LA 3UXFA 2WAAA 4UXHA 1KFKB 4PJGF 3JQAA 2PTHA 5BRJA 3LQYA 2OQJB 4LRSB 3QG7L 3GLIB 3U2IA 3UP1A 3A1TA 1KAEA 1OAKH 3I9OA 4YMSA 1LD3A 2VSXA 2BJML 4FE3A 1FDRA 4RFLA 1KEKA 3T71A 3FB6B 3LKOB 1JPVA 2VDMH 4LKXB 4MJHA 3NIBA 1R27A 2DBQA 2CR0A 4F27A 5JXEC 4CN6A 2KZ1B 1Z35A 4N2CA 1XVTA 3HMQA 3STZA 1A76A 1IRXA 3PX3A 2P45B 5FXCH 2GC4C 4G8GD 2VR3A 1DS6A 2CLIB 4QASA 3BEOA 4NRYB 1QTNA 4JB8A 3T2LA 2J31A 2VJDA 2FP3A 3FSRA 3STUA 3P4LA 3SYRA 1JGVL 5HVHC 1W5FA 2BISA 1S2DA 2J5WA 4N47A 3TO5A 3HPLB 2G4CA 2YHIA 2ZWVA 3GMQB 3L4JA 2Q4TA 4MQFA 3HS3A 1OFVA 3AU8A 5A6MA 3Q5DA 2YO3A 3QFHA 1VGEH 3VDRA 1N5YH 3L3KB 3HMXL 3I01M 3FCGA 4JFVA 2B3IA 3GJEB 1A2YB 4MDYA 4LCYA 4IKIA 2ZWAA 3WNLA 5DWDA 3HBPA 2PMFA 2CDEA 4JC0A 1HDYA 3L7AA 4DLUA 1YE8A 1HE2A 2YS4A 2BIIA 4R96A 5I8OH 4U8HA 3L08A 1D5ZA 1N9GB 3O0RL 3WZLA 1P6FA 5C35A 4IEFB 5AXDA 4DCCA 4HIJA 5DJ0A 3O6LH 4BKPA 5B6IA 5DEGB 4N24A 4YPGB 3UB2A 2JGLA 3GF8A 4HH0A 5EJ9A 3RNKB 1PR4A 3ZL2A 4XVRA 3I6BA 3K8ZA 4OAPA 3SBEA 1SMDA 4DV5B 3HB7A 2BOCB 2NYZA 2OLKA 3EXAA 3C14C 3ORQA 3P02A 5G1PA 1JTEA 3ECVA 3MXOA 1EWYA 3BWDD 3S37H 1NICA 3PDWA 5DHVA 5DRZB 3NACH 1Z38A 3Q8XB 4TGLA 2AI3A 2UX6A 2OECA 5JXJA 3R4DA 1F86A 1RI2A 3H8NA 3FJOA 1A7OH 4G4SP 3TAXA 1NN0A 4H8WC 4FYPA 1AJEA 4XAKD 1MNQA 1CF9A 3B51X 1Q95A 5JI2E 4U1SA 2HK6A 3FOEC 3L7NA 1D6MA 5BV7C 4HLUC 2F18A 4XD2A 1Q0PA 2Q2QA 4KXQA 3TNLA 3KYBA 1DFIA 4CFYA 3ZE2F 4P53A 3QYFA 1YUMA 2NPIA 4PHXA 1AD9A 3NJMA 5T1JA 3RWGA 4P83A 5EU6D 1TAQA 2VHWA 3WNPA 5I19H 3ML9A 2R4SH 3PABB 5LVAA 3QCTL 2OO7A 4O3FA 3KAJA 1E4WH 5LP6F 3ZE6A 3T1TA 1KH1A 4NCIA 3GA7A 2Y5QA 3FUWA 3VSDA 1MWAA 1EUDB 2J73A 5AG9A 3KQSA 3GRVA 3ZTWA 1WWBX 3PFWO 2IU4A 1CRPA 1GCAA 2CN1A 5EZIL 2QBWA 3L5XH 3RSQA 4DUVA 2VP3A 3QQDB 2MTAA 4UV4L 1DQML 3CZ4A 2PUQT 3V9CA 1T0HB 4UNVA 2XOKD 1QI4A 3P9NA 1CF8H 4RORA 1CVSC 1VADA 1GQYA 2D31A 2AK4D 2WXIA 4X7DC 3IE1A 4HLZG 2HUPA 1E1RD 4F3TA 1ZTXL 3WEOA 1VLLA 4OSPA 1RIUH 4IH4A 5LAXA 4UBLA 2DPXA 1ID8A 3A3YB 2TRSB 5A7FA 5L3QA 5BR8B 1YRQA 3KQKA 1YXMA 1PKXA 2I2AA 1OPGH 1T22A 4NSKA 1TZGL 4P8QA 3K9FC 3H42H 4P2OC 5BVPH 1N5AB 4NRXA 2F7IA 4EBBA 4HEME 3FCTA 2NGRA 1L6PA 1PV4A 2E27H 2WRZA 3WLQA 3KW8A 2BFDA 4KAQL 2P62A 2PD4A 1D5CA 3GGWB 3L6FB 1EQ2A 3AI3A 4BV9A 1JU9A 4RE5A 3TVMB 1ENYA 5EXEA 5EZ5A 1FV1A 3BZWA 2ED7A 1JFQH 3G6WA 1UP6A 2HA6A 1EFQA 1BBJA 1BV8A 3HLYA 3O8QB 2G82A 1IGCH 5F6IB 4WY8A 3BZUA 4E11A 4RWEA 1SXHA 3BN3B 3MRFA 1ULZA 3U9SA 1GPLA 3FTVA 5IMOA 2DYRB 3AACA 1ULAA 2UVFA 2EIZA 1EXNA 1QH8A 3BULA 3I8XA 5ALTA 1HZJA 3U36B 2CVPA 3BILA 5CT5A 4CLHA 3A6DA 1W80A 2A9KA 3IPLA 1XELA 2HAZA 1OLOA 1J5DA 5KW9L 1EXHA 3ZDRA 4NYJR 4EI2A 2GBLC 5HGHA 2J0UA 1XCTB 3OC5A 1QR6A 1BFUA 3BMOA 3WK8A 3RRZA 2H2GA 1NJ8A 3QUSA 1KKUA 3KPRA 4E41B 2D7NA 3SNKA 2WSSA 1RFDL 1NLFA 2L17A 3ABSB 4NBRA 3IGKA 1YEJH 3V1NA 1M0SA 3R0XA 1SUPA 3HKBB 4Z76B 5T4HA 1VA5A 4OZIB 4CE6A 3ILHA 3P30L 1N4DA 3WICA 4NQSB 2FQDA 5IJWA 1YR8A 1EAYA 2XY2A 2H3XC 3LWNA 3PVCA 1ETJA 5PNTA 4FKKA 4I0PD 4PBTA 3UBMA 4DCSA 1U8OB 1KCSL 1X7DA 3O6MH 1YZLA 1UTDA 4LYEA 4X6EB 4J4HA 3SF0A 4MKFA 1YDEA 1TF2A 1MFDL 4YT2A 5AUMA 4U7MA 3MRLB 2PRSA 4KPUB 5DDHB 3CN2A 2VLBA 4V2UA 2C20A 2ZJAA 1N67A 4O63O 1CUSA 1KQOA 5AK3A 4Y2LA 1OTUC 4NJAH 1UURA 2CHUA 3CB4A 3LKBA 1BZ9B 1PJCA 5DNYB 5LN8A 4Q9RH 3PWNA 3GLRA 3PFNA 2PH7A 3H6JA 2PUBA 3E2HB 1VBMA 4D46A 4QOIA 1UM4L 3B5HA 2FPOA 1DBML 1VE5A 4AT1A 4M43L 2VR5A 3ARFD 4EL0A 1Y5NA 4P08A 4GNKB 1N1EA 1IGYA 3VGBA 1MENA 2Z09A 1A9ZA 1E3DA 4JAMA 2GZAA 4RZ3A 3KSZO 3NCYP 1QWNA 4Y88A 3PNYA 1NJ2A 2JDIA 3VZBA 2BKXA 2RQEA 1CY7A 3KHKA 3SJUA 5IW6A 6TAAA 1OYWA 5A4IS 1SHKA 4UTBH 2JW5A 3L02A 5KSYA 3HXKA 1OWMA 3DB2A 2VUUA 1QBLH 1J23A 1BZ8A 4JGGA 2BRRH 1FPQA 4G84A 4KI0A 2NCEA 2AWOA 3E3QE 3PDOB 3MQ2A 2X6TA 1JFVA 1MUUA 1N5MA 1XLVA 4UBIA 4NQEB 4PJ8B 3L8EA 1NWOA 3ARFC 3EA4A 3HNOA 2DPGA 4FP9A 1CS0A 4TL6A 3HU2A 1K4CB 1X1CA 1SJ9A 3A4AA 1KGDA 4NBWA 4HIPA 5F5LA 3FKUS 4DGWC 5DYYA 1GCUA 4BC0A 5LQUA 4PZPA 1L7IL 1XP8A 3QDME 3GDCA 3QW4B 4N0YL 1WCIA 4IJVA 1F0PA 5HMMA 5EB9A 1C9YA 3LY9A 3KVRA 3KOZA 2OFXA 1S7XB 5DGCA 3RFCA 4J03A 4WI8A 5HI5D 2C9XA 3PJFA 1ZMOA 3OGOE 2YPVA 4CKBB 1E3SA 4XB3A 2P11A 4L02A 3HZ3A 2FWUA 1WUYA 1HOCA 4QRRE 1DKMA 2C2KA 3C0KA 4RO0A 3GRPA 2I8LA 1KDZA 1L4FA 2FR4B 2ADFA 4GKBA 5TE7H 3GA5A 3ECBA 3VFOA 1YZTA 1EHYA 1QUFA 4Y2DD 5TMPA 2W94A 2ESVE 3V4PL 1M2WA 1I0ZA 1Z17A 3PGVA 5ENWB 4PF1A 2ZBFA 4C0JA 4C4UA 2IYYA 2P0EA 5CLJA 3DMHA 1NKGA 5DVLA 4RQUA 4TLAA 5FPQA 2DPLA 4G9FA 2OYMA 3FW6A 3I12A 3LKNA 4J2XA 2CBTA 3BPNB 5JLJA 5T3ZH 5DVNA 1J0YA 1FN4A 4E14A 3RC9A 1ONBA 1L1QA 2O2EA 3N91A 4GKVA 2XSZA 4LLUB 3UMSA 3ONWA 3VO1A 2D4DA 2EEFA 5FEUA 2ZSAA 1L5RA 3NU1A 1E6JL 1KJ2A 5HYQB 3V4FA 4ZOCA 2Y24A 1ABEA 3LT5A 3H2IA 1TQSA 2BLLA 3WLLA 3NK3A 3QLUA 1W36B 4PJ6A 1CUVA 1UA7A 1K97A 4BPRA 1QLWA 3MXWL 3LUJA 4QXOA 4RA9B 1LEHA 3EYVA 1I3UA 4IVRA 4E07A 3SN6A 3OR7B 4DHEA 4LF3B 1P77A 3IOYA 3W9BA 2H26A 3DJ9A 3GM0A 2VJKA 2VOEA 2V8OA 3IP6A 1Y18A 4PSRA 4GAFB 4P4GA 2VERN 4AY2A 4GWLA 1PVOA 3EJJX 4FYRA 1NJ5A 5I1DA 1N8NA 4CT5A 3DXAE 4O4IF 4MQMA 4IRJA 5ECJE 2Y0EA 4TUKL 4AMWA 3OJDA 2O3TA 3ZTJG 4PJIF 3JD2A 4R83A 1VRWA 5FOBA 3MAJA 3NK4A 5I5EA 3ENKA 4GVXA 3K5WA 2ZIFA 2DEXX 2XMGA 1A9RA 1CTMA 3DDNA 1J18A