3UOAB

Crystal structure of the malt1 paracaspase (p21 form)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
378
structure length
364
Chain Sequence
b'MLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
publication title Crystal structure of the mucosa-associated lymphoid tissue lymphoma translocation 1 (MALT1) paracaspase region.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 100
structure length 364
sequence length 378
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00656 Peptidase_C14 Caspase domain
B PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uoaB02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uoaB01
1SC1A 2CNNA 3PCXA 2QL7A 2QLJA 4FEAA 3V6LA 4EHLA 1I51A 1SHJA 2C2OA 2H5IA 2QLFA 2Y1LA 1RHUA 4PRYA 4QU9A 5IASA 4QUJA 3V55A 4DCPA 4QUEA 4D3XA 2XYPA 2HBYA 3E4CA 5IANA 1PYOA 4D3ZA 1RWVA 2H51A 4QUDA 1F9EA 3IBFA 5IBCA 3KJQA 1ICEA 1K86A 2CDRA 3DEHA 4FXOA 3D6FA 2CJYA 3H11B 1IBCA 1CP3A 1F1JA 3OD5A 2FQQA 2H5JA 5IBPA 3R6LA 4QULA 1JXQA 3DEIA 1I4EB 2H65A 3NS7A 5LUBA 5LU9A 3S8EA 5H0IA 1GQFA 4D3YA 4NBKA 4EHFA 2J30A 1RWXA 4N7JA 4N7MA 4AW9A 1RHKA 2DKOA 1BMQA 1RHJA 2QL9A 3H0EA 3H13A 2XZDA 4HQ0A 3V6MA 3D6HA 3R7SA 3P4UA 5LU8A 3S70A 1RHRA 3V4OA 1SC4A 4DCJA 3D6MA 5K20A 2J33A 2C2MA 4JR1A 2XYHA 4NOJA 1I4OA 4EHHA 2HBRA 1M72A 5IBRA 5IABA 1GFWA 4ZVPA 1SC3A 5IAKA 3GJQA 4JR2A 2FP3A 4QTXA 4ZVTA 5LUAA 3UO8B 1RWWA 3QNWA 3R7BA 1K88A 4LSZA 3KJFA 3GJSA 3K7EA 3P45A 2H54A 1RHMA 3ITNA 4JJ8A 4JJ7A 4NOKA 1QTNA 4PS0A 4ZVUA 2CJXA 1RE1A 4NBLA 4PRZA 1CVRA 2C2KA 5JFTA 4I1PA 1NMQA 2H48A 1I3OA 4JR0A 4EJFA 5I9TA 3PD0A 4QU0A 4QTYA 2Y0BA 2CNOA 4EHNA 1RWMA 3SIPA 2J31A 1QX3A 3NKFA 4IYRA 4QUGA 4AWAA 4QUBA 2CNKA 2H4WA 4NBNA 4NOMA 4AWBA 1QDUA 3R5KA 4QU8A 2AR9A 4JQYA 4EHDA 3DEJA 4FDLA 3EDQA 3V4LA 5IARA 1NMSA 4IEFB 2HBQA 3H11A 4JB8A 1NMEA 2C1EA 2J32A 4N6OA 3UOAB 2H4YA 3H1PA 4N6NA 4DCOA 2C2ZA 5IAEA 3KJNA 4N5DA 1RHQA 1RWOA 4M9RA 2XYGA 1RWNA 3R7NA 1KMCA 2WDPA 4FGUA 5I9BA 3V3KA 4JJEA 4PS1A 4ZVOA 1NW9B 5IAJA 2K7ZA 4EHAA 2P2CA 4HVAA 2QLBA 3BIJA 3R5JA 4I1RA 4ZVRA 3NR2A 1SHLA 3GJTA 1PAUA 1RWKA 2QL5A 3EDRA 4ZVQA 4ZVSA 2FUNB 2XZTA 3DEKA 2HBZA 3GJRA 4JQZA 3SIRA 5IC6A 4HQRA 4QU5A 5IAGA 4EHKA 2NN3C 3R6GA 4QUIA 4QUHA 4NOLA 2CNLA 3PD1A 5IC4A 3IBCA 3RJMA 4N6GA 1RWPA 4QUAA
chains in the Genus database with same CATH superfamily
1R6DA 4F9GA 3I1JA 5CBPA 1M74A 2F3QA 1I32A 5DWVA 3BE1L 1VLMA 4L3EB 2ORVA 3BUYA 4U39A 1F9EA 3DRTB 3N50A 2AKYA 1Z9SA 1QVWA 4QECA 1NZJA 5DU7A 2F4VB 4PRIE 4GKJB 5CLXA 4TTAA 4DDTA 5I7SA 3GJFA 1YNTA 4NKIH 4ZXBD 3C1TA 1GGCL 1OX4A 5D1ZB 3IODA 4LT7A 2R11A 4KYIB 2BIFA 4WN9A 4B8YA 1HETA 4NBZB 3BXOA 1SZDA 3WYNA 1FFSA 5E2TL 1XFDA 1YEFL 5JARA 4YHLL 4GVLA 5E0FA 1WG3A 2GJPA 3S5ZA 4IIUA 4YHMH 1MV5A 3GO1H 1CBUA 1CLOH 1S5IL 3BMWA 3QDMD 4LRWA 4HFMA 1SIOA 4U1JB 3EGCA 1KIRA 3FUKA 4QRPA 2KL6A 2CDNA 2YEQA 5DQ9A 4K9DA 4GQAA 4XIFA 3PXAA 1MELA 3Q7IA 3UAGA 5C8YA 4LQFH 3E9NA 4M7ZC 4KIGA 4OCYH 3VFTB 1SEPA 2IW1A 2QD4A 3BRFA 4KXCA 2RE8A 2XZZA 3PNWB 2EX0A 4D46A 2QQEA 3PPVA 2W9EH 4EKYA 4HKXA 3KPRA 3WELA 5CG2A 1N68A 3D59A 2IADB 4HC1A 5IHZA 2P3YA 1I2ZA 4MGZR 1P9LA 1P0IA 3SE9L 1KEEB 3NJMA 2PMEA 1HEJC 5LN4A 1XDUA 2Z6FA 3DJYA 4HN4B 1CUAA 15C8L 2YJ4A 4PCTA 4ZQBA 4KHXL 1OY1A 2HYIC 2DM6A 2AJCA 4R0LC 2O1SA 2C3UA 1WOYA 4Z77A 2VABA 4OI0A 2FHSA 4WU5B 4YEDA 2X89A 2X58A 4HDIB 3GQVA 2VLLB 3UIYA 2CRMA 4XNQA 1E2DA 3TXAA 4I1VA 3VZRA 4LCIL 2JAXA 1MH1A 2PNJA 3CTMA 1AHKA 4R7GA 5TV2A 4RWEA 4NZDA 4L0YA 2VHJA 32C2B 1GTL1 3GXMA 5A7HA 1E1LA 1GCGA 4MAAA 5GGYA 5T6BA 1WIOA 5I30H 1EXUB 1Y18B 3CS3A 4PG2C 5ECGC 4UBNA 1PQWA 1PI3A 1U02A 4OKIA 2PKXA 3ZCXA 4OX9B 4G42A 4YCLA 4F5EA 3HMXH 5GRUL 5CT9A 2MNJB 2Q10A 3ARFD 1QMUA 2VMFA 1LBTA 3BP4A 5JS1A 3ZIAA 4AGQA 4OFZA 3AG6A 1TLKA 3QLUA 4C59B 1W19A 1EHYA 4LEOB 2B4TO 3QWOA 2P77A 3HVKA 1OT2A 4LOVA 4JPSA 4YPOA 5C0BE 3K53A 3GK8H 2P8PB 4NX2A 1LD9A 3MUOA 4S1RH 4ZHQA 2Z4RA 3AM4A 3A28A 4LKCB 2HQBA 3RARA 3SC4A 1TEZA 5TDNA 1U0JA 1U6IA 1OZUA 3SJVD 4L5CA 2C42A 2MPAL 4R8WH 4N8CH 4I3GA 4DLNA 3GL9A 5J6GB 2OHOA 4Z0HO 2QQKL 1YN7B 4B3IA 1WM1A 2BI8A 4XVQA 3KYJB 3B9KB 1ULVA 4O0LA 3WUWB 2ZCHL 3ULUE 4ZMPA 4E1AA 1OAUH 2XZPA 3GMDA 4F45A 4XTRC 3PGMA 3EULA 3QF4A 4HZIA 5I9MA 2ZSWB 1Z15A 3O6LL 3LC2O 3RGVC 4ENQA 3AR8A 3K16A 3RS4A 1KWGA 5HYJA 3OLDA 1IKFH 4FCHA 2ZVDA 5AIBA 4IKJA 5EXPA 3QQ4A 4RMSA 4AO8A 3MLWL 5AKIA 4RHUA 2XPZA 3D09A 2X8LA 3GEHA 4RFOL 4GLLA 3I61A 1QO0D 4MJ7A 2CZQA 1OGTB 2SNIE 1F6AA 2CIKA 2VE6B 2VXTH 2B77A 4CL3A 1K6QL 4KV5F 2EYRB 4I3FA 5TDPA 5H9WA 3QU9A 3NBUA 1XTUA 3G6JA 2JK5B 2BIMA 1WW3A 3DZJA 3GS0A 5I0ZA 4Y9DA 4J3VA 1CXKA 2WTMA 1E99A 1L3WA 3IIMA 5DJ0A 3V1LA 3S97C 1WABA 4NP4L 2Y76A 4ZDHA 2FL5B 3I6GA 3HA2A 3D6JA 4X6LA 3PAUA 1JAHA 1R15A 1S7XB 3NDZE 3TN0C 2MJLA 5J89A 1CFNA 2QNRA 1AKRA 4M62L 5L4NA 3TWOA 3HE3A 2FX7L 1SVZA 1YFKA 2ATAA 4BHUI 4JBXA 4N4AA 3W9YA 1POWA 1N3NB 1ZLDA 2NXYC 2BUBA 2R1YA 1AQMA 2AN1A 1G7JB 4HAYA 2Q9BA 1JK8B 2QL9A 4XGZA 1XZNA 5E4TA 3Q1SH 3KPLB 2RK4A 1QOQB 2JQMA 5K9KA 1GU1A 4DSAA 2C84A 1ZY2A 1BW8A 4EARA 3R8XA 1M6VA 3H5OA 4M1TA 1AJ7L 4LAJH 4CKWB 4JY6B 1NATA 3LH5A 3AFGA 4ZREA 2AQRA 4CU2A 4MHOA 5D4HA 1PEAA 3AH8A 1ZN9A 4P92A 3O82A 1RUMH 5TEWA 2Q2LA 1JWUA 1Y3AA 3FH7A 1FA4A 4KH0A 1C0PA 2P91A 4GBED 1DRVA 4YVUA 1H8HD 1KG0B 4PGFA 3AZUA 4EDWH 4MKFA 3LNDA 1ZTXL 4HEPA 1G5AA 1UXHA 3ILHA 3FAZA 3GBPA 4XFJA 5CVJA 4BKLB 4PUBL 5EJIA 5FADA 3AR4A 2Y9RT 3CUPA 4KZ0A 5B39G 1R75A 1LPNA 1KY6A 4DR5B 2HRLA 1C80A 2CT8A 4PO1A 3FDIA 2LLGA 1I82A 3QJHA 5CEEA 5I6NA 2JFYA 5EA2A 4Y4FC 1JU3A 3LEYL 4LRYA 3RKSA 1Z29A 5D96C 2O4CA 4LE8A 3W9BA 3RG8A 4RA6B 3G5YB 3O3BA 2FBRA 3RR2A 4Z76B 5IHLB 5EHXA 1SLVA 1C8VB 4B31A 5KWIA 4QUJA 1CR0A 3RFZA 4AP5A 2LTAA 1MX9A 1QI3A 1HR0B 1A3ZA 4JA0A 1ZLXA 2FR8A 5CGQB 3SKVA 3OCZA 5GJTL 4PWHA 1DE4A 4XVTL 4R98A 5CIWA 4XTRD 5GADl 4WDIB 2ZT8A 1PL3A 2PGLA 3WMPA 1A8JH 2E9WA 4NK5A 1TQ6A 3GMSA 2W65A 1T10A 2BZGA 3RGVD 3B7SA 3H4VA 3QU2A 3N8NA 2GD6A 3CFMA 1E1CA 1UIMA 4CVWA 3RZWA 5J2UF 2EICA 4NVRA 1L4BA 4MNQE 1TOAA 1QQ6A 4KXUA 5I8OH 3TNLA 2JKSA 3F5MA 2QSTA 3H6AA 3VFSA 3G8BA 4OREX 3KNBB 1SBTA 3LHIA 1HKHA 3QUSA 1ETZA 1JKXA 4N3BA 4O02L 3ZR6A 5KVGE 5LVEA 3LVQE 3KPTA 3KYNB 1NZFA 4LJ9A 5FTWA 2WZAA 3DVAA 4W9MC 4PU0A 4J2TA 4OU3A 4NN5C 2IVFC 3QPUA 2QQ5A 2RGCA 4DARA 3QDME 2Y7SA 4TQGA 4HF5L 2DEYX 2FLMA 3NPAA 3C7TA 2FSEA 2H1LM 3GFFA 2G9HB 3U46B 2WQRA 2FZ3A 1A4UA 2H2SC 1ZD2P 3GMRA 1J5DA 1B9KA 2JKZA 4B3BA 3FCSB 1XGRB 3TN0D 1XI2A 1QFHA 3US0A 2J3KA 1K1EA 5JFOA 1JDCA 1P80A 5HKLA 3VFPA 3EOBI 1JXQA 4IZ6A 3R0XA 4D8WA 5I6DA 1HL8A 2VDQH 4BXOB 4GRDA 3SDCC 3R4DA 4K55A 1EERB 5TQ2A 2VJYA 2Y9MB 1DCLA 3HKFA 1S7VB 2ONYA 1XF2A 1QPXA 4K8RB 3MQ4A 4N76A 3U4HA 2IXBA 1SJVA 3LRTA 1CGVA 3PQDA 4YAKA 1XEFA 3CUKA 1ZLSH 3C16C 3QUMA 1DX9A 2X19A 1CD1A 2BWQA 3QXDA 2C98A 1I8MA 2WD7A 4TQIA 5JSKA 5KYNA 2CWRA 3GUVA 3O2JA 4TL7A 2NADA 3MTRA 4ZGWA 5AQ0A 5AI0A 1QSFB 2ZBEA 4F7CB 4TTTS 4XFDA 4IPTA 5FORA 2NXZD 3NKVA 3L4CA 4Y4FD 5GJWC 2VHVA 3MV9D 4BK4A 2VXUH 3EVAA 5JIIA 3LUFA 3VPGA 3RDJA 1SVSA 1MRCH 2JJTA 5PCYA 2O8CA 3LT0A 2XVKA 4I36A 1DRJA 3QYCA 5FKPB 2ODPA 3ARDA 4GDFA 5IHUH 4A7PA 1VQ1A 2ZX7A 5F7MC 3MGOB 3FZNA 4B9KC 4IJWA 2ADMA 3ESCA 4J0FA 1WCBA 4OH2A 2P8SA 3PNBA 4LSQL 1MB0A 4D6PA 4TTQA 5M7QA 2PQ0A 3KJHA 5CJXC 2VNKA 3Q3CA 3D30A 3KZ8A 3SJVE 1SA0A 4A2EA 3TW0A 5EJ5A 2QJDA 4ZMXA 4CQMB 3RADC 1QLFA 4QXVA 4GRMA 1ZHFA 2A8YA 3WVNA 3IMFA 3O95A 1H69A 4NYJQ 4G9EA 5LP1A 1MQ9A 3HBGA 3K8KA 1EBUA 2QV2A 2G06A 2HJHA 3DLCA 4IGFA 1KMHA 4JH0A 4C4OA 1ID5I 2JW5A 4WWNA 4DBZA 4W9EC 1QSGA 2Z1DA 1GAXA 1PL8A 1FXWA 1EJFA 1BZ9A 3IRCA 1FZMB 4HMOA 2WYZA 3ORJA 1IEBB 1WFMA 1VESA 3BZFB 5CM1A 3CNBA 2XOTA 1J9TA 4RVCA 5IU6A 2Z2XA 4W9IC 1MF2H 1TUPA 1RLBA 2Q8BL 1ZVJA 4S1PA 2BM0A 4U2EA 4X7TB 3LIZA 3K6IA 3FB8A 1X7ZA 1RZPA 5C8DA 4KDRA 4O33A 4ZZ1A 1SXCA 1C08A 4MJXA 1TMCB 1NI4A 1QH9A 3LNIA 3VAEA 3V4RA 2BZCA 1J7JA 3BSSA 4GG1A 1KB5L 3SQOA 5K0EA 2H2SD 4FFPA 3VQLA 3PWPD 2I9TB 3CX3A 3RK4A 4EBFA 4D82A 4F2GA 2Z3FA 1R4ZA 4NO3B 4LCWB 3KX2A 3EA5A 1NLFA 1M4KA 3D8NA 3FYSA 3KVPA 4GG8B 2W6CX 2ICWJ 1XCTA 3LECA 3P9IA 5DMJB 5EN3A 1KMGA 2F53D 1U65A 2JF0A 3KEMA 3SDCD 4DSUA 1ZOLA 3JVGC 3KM1A 3JRXA 3IVKB 4CAGA 2QTVB 3G5WA 3OCWA 2V4MA 2XNDA 3OT1A 5LB1A 1OPRA 4TMXA 2W42A 2VL5B 3ZE9A 3EH3B 2BP3A 1DBKH 3QFHA 5FO9B 4ELMA 5KBDA 1ZVSA 3SS8A 2FJUB 4Q6BA 4PAZA 2Y0BA 3UAZA 4F9EA 1ECLA 2UAGA 5B6PA 1ZA3B 2IPLA 2HFFB 1B76A 2ZUEA 2ZT6A 3HS0A 3BK1A 4NUGH 1MN6A 1N8OE 1OF2A 5A40E 4B6ZA 1JWLA 5BR8B 3UCQA 4R97C 2FEPA 5AR1A 5I6OA 4LIQL 2C0PA 5CSGA 3C5SA 3OB0K 3DX4A 4K1XA 3WLAA 1YR2A 4XP1L 3C5EA 4QTHA 3ORFA 1P4LA 1ZH2A 4LHWA 2QPTA 5JXGA 1NGQL 3WNNA 3E7DA 5BQXA 3SG0A 4X7CC 3UACA 1LPOA 3UGXA 3X1DA 1CETA 3A2MA 3TSAA 2WXRA 4E42A 1LM8V 1JZQA 1GYCA 3FTWA 3EIUA 4NAHA 2FPWA 3QUTA 4AYSA 2R5FA 4JUSA 5F89A 4M36A 4OVUA 2EFCB 3ACBA 5I8ZA 1JPTH 1P2CA 1JJVA 3RS7A 2QUJA 4ND7A 4L8CA 3FUDA 3Q0HA 1E5LA 4U2KA 1SHWA 4MCHA 2XTMA 1DRWA 2FZ5A 3HRHA 4KPHH 4GW1B 4U7WA 3S3TA 3TFWA 2Y0EA 1Z9PA 5KBMA 1EDOA 2HSDA 3L7NA 2ZEJA 1SEQH 4FTVB 1B15A 5JD4A 4CL2A 4YPGB 2F8VA 3PJSA 4XMTA 4L50A 1KGIA 4HC1L 5DDHA 2O1AA 2WSSD 4AYMC 3BDBA 3WO4B 2A6PA 4HNVA 4PJAA 2OYRA 4DMCA 1BD2A 4MUMA 3CE9A 3W06A 5DGXA 1VKNA 3H8JA 3LQRA 4XN9A 1A6WH 3SN6N 1MFMA 2B92A 5I1KL 4W5WA 5JYDA 3AJ8A 4XBEH 2QSCL 1QHYA 1HE3A 1F41A 4LSDA 1NW9B 3TD2A 2HKAA 3MRVA 4RX4D 3QWFA 2RHJA 4NZ9A 3QEGH 3A70A 3O73A 4KVCL 3GJEA 1EJOH 4CT4B 3PDGA 2QWXA 1OD6A 3FFDA 4NKMB 2NTSP 3K2EA 3TBVB 1PEKE 1BE0A 2XFXA 1A6ZB 2XICA 2WZBA 2QVCA 4F04A 5L9DL 3RGGA 8OHMA 3O11A 4RSVA 1VKRA 4F8EA 1CFTB 1CURA 1L4LA 2F2TA 1FZJB 3RVWD 3IT2A 4JYPA 4NDMA 4RDQF 3AV3A 3WGNA 4GEJA 4FYVA 2B8NA 2FEKA 4APQA 3KLSA 2VR6A 2BGKA 3K2UL 3QUXB 2V17H 3INTA 4KO3S 3U1SH 3RY5A 3UTTA 1JHZA 4HWBH 1VHDA 1NMYA 5C07A 1B3IA 3QUKA 3L7YA 4IHJA 1KYIA 4ND5A 2VK1A 1EA9C 4RJLA 4RADA 1CNMA 3QH3B 2ZTUA 1Z2AA 2ZJBA 1FI8C 5BSTA 2RHWA 4D4KA 4Z7VF 5IBLC 4W4OA 4INAA 2K6WA 1ZIPA 5FDWA 1NC4A 3OJOA 3WLMA 2GJZA 4AMUA 2ZSAA 2FWRA 2WPNA 5JXEC 3PGCA 1PX0A 1VSQA 2WWRA 2UVPB 4DLZA 3H1PA 1K0UA 4ONGH 3F5DA 4JGNA 5IG2A 4Y7DA 5HIIA 3V5HB 1G8JA 4K9LA 1IKNA 3LJKA 4QO1A 2LCQA 1YEGH 4AVIA 1V2GA 3WB9A 4FJZA 3DPUA 4AV4A 2HF2A 2FWJA 2AC7A 3B7TA 4MD5B 5C0CD 1UOOA 2W2KB 3OSKA 5B7GA 2A5FA 4CMKA 5C8XA 5H35B 2VCYA 5KVDH 2L04A 2JC3A 4BZPA 1Z9OA 3ARXA 3VQ2C 4S1TA 1GQOA 4OLXL 5AIAA 4K6OA 2AABL 3G02A 4MWFA 3KPQA 3FG9A 2JFUA 2WIIA 1Y8AA 1UWXK 3HI6A 1VI2A 2VDML 3F7VA 1E89A 3CHXA 3C7CB 4G8GB 3L6OO 5CMAB 3LWDA 1NVXQ 3MV9E 3OX8B 1AE6L 3OAWA 3MOBL 4EN2A 3FOCA 3MJ7A 3RQSA 1G0XA 1IOLA 1I1CA 2GDZA 1XZDA 4KAQH 3EGIA 4I18C 2OQJA 3S7ZA 2AJVL 5E8JA 2AFHB 1J22A 4A2MA 4OQYA 1EJ2A 4IXDA 3VDNB 2R751 1E59A 3HCVA 4L5JA 4A6YB 3MHTA 3QK7A 4ZCMA 1T89C 4Q4HA 2M6SA 1JZHA 3NHJA 3KQWA 2EQAA 3JQPA 4ENWA 1QTYT 4UUMA 5MP6L 3ZU2A 3QWNA 3RPBA 4HRVA 4XAWH 1OYWA 3GROA 1IHPA 3UA3A 1FFTB 4TLSA 4LDQA 3I05A 3V95A 4OF5A 2QYHA 1VE1A 1H15B 2GMWA 4F9FA 2NYZA 3ROXA 5GSRB 3ESZA 4G8FB 2G0LA 5B38G 1DP4A 4QGAA 2IEZA 3CHOA 1BYUA 3OQBA 5D4IA 1BWSA 1JZ3A 2EWMA 4O2EA 1XWVA 4LKXB 3FU3A 5TXGA 2ZQ5A 1XMWA 3B9VA 3MNFA 1ZESA 2QMZA 2FGWH 4JFZH 2QTRA 3ESMA 4JR9H 5FYKU 1KC5H 5IDVA 5ALVA 5I4CA 2WUCH 1DCEA 5C0DA 3M88A 1SXAA 2QRHA 4W6ZA 4A55A 3ZV6A 5LCVH 3ZTWA 2R1XA 4DFHA 5B3JE 4N26A 5KJ4A 4LESA 1Y80A 5YASA 1YZKA 1ZVNA 4Z7VB 4Z0PA 3ZY2A 3K20A 4U2FA 4HJIA 1PJWA 3UJJL 1MFDH 3GBLA 3HO1A 5EY5B 1MABA 5BV7H 3NHMA 3GY0A 1ZHBB 5J4HA 1ACCA 1XTKA 2AVFA 4Q4EA 3PWPE 4GQIA 3AY4A 1MAWA 4NP9A 5EP3A 3ESDA 4XQ0A 1L7BA 1KPHA 4K9JA 4L9RA 1UZ6F 3PGKA 4LSVH 3CPHA 3FU6A 4R5MA 1WRFA 3S5JA 2AOXA 4J0DA 1JTEA 4B0OA 4LF4B 5I74C 1GZQA 2F53E 1IJ9A 1UMCA 4IIBA 4LMQI 2F55A 5K0JA 4R0VA 4L6CA 1L9PA 3WNLA 3KXPA 1N6OA 3P2BA 5JXED 1DEAA 4LMQE 4BO2A 2F1IA 2LNDA 4JKWA 3SF8B 2CF6A 3DEJA 4UQ3B 4MKMA 1DQML 2NTFA 1Q7RA 1G3RA 1CDGA 2J8HA 3FZUC 3IQWA 3QOWA 2BEKA 2B1QA 2DLFH 4P3CH 1QLEH 2GTZA 3W9EA 4JFOA 5D1QA 1PGRB 2E4ZA 3C8UA 4AY6A 3LRPA 1O5IA 4MUIA 3L3DA 5SZIA 4KB5A 1G42A 1YY9D 4QVIA 4IU3A 4P31A 2QUHA 3OZEA 4PU2A 3QELA 1WSAA 5KX5A 4JQVC 3QUAA 1GOHA 3HZKB 4HTAA 4XWOA 3GLGE 1FYXA 1GARA 3WEBA 3N85H 5AYUL 1AKYA 3F4KA 4Q03A 3VX4A 4M7JH 4JGUA 3MV8A 1KTKE 2C4MA 1GR7A 3HZ3A 3EHBC 2QYOA 1W6LA 2AEFA 3T6QC 1ZLVK 1PS8A 4JQXA 1QYVA 2ZS7A 3OJDA 5IG7A 5EOCH 4NH4A 3WGLA 2HSGA 3ECQA 2Q45A 3UTSD 3U81A 3QKTA 4G9FA 2WD8A 3UABA 5BVGA 5HHOA 1WDWB 4Y2OA 1OZAA 3ZSTA 1M67A 3DCIA 3RIHA 5JCOA 1BEUB 1XEXB 1XR8A 1ZIBA 3N41F 3WA6A 3OJMB 2XJ4A 4L0DA 2D00A 3VZSA 1ZTMA 1I7RA 2F54B 3RBXA 4X20B 4U8HA 5BMVA 1MX5A 4AYDC 1C30A 3CNLA 3I04A 1EZ1A 3T3GA 4XPIB 3LQKA 5DJDA 3ROGA 3OY2A 5ERXA 2DLTA 4PR5A 1IQWH 4QTZA 2XQYK 3W8NA 2A9MH 2O0LA 4XB6B 2J1ZA 1CJMA 1DT5A 1ZONA 4U33A 3WFEH 3H7BB 4NO2B 2A33A 1TIPA 1JLKA 4MQTB 3TL5A 2OCLA 4TKVB 3WJMA 4YMPA 3LKRA 3ZW9A 4AL8L 4LYYA 2A99A 3DE5X 1VI6A 2P80A 3B1YA 4R96B 1WBJB 5GOTA 5TQ2L 4ELDA 3A3NA 3F7KA 2DQZA 4JZJA 4FQHB 3G59A 3K5IA 1QO3B 4HGKC 4YNBA 3HB4X 35C8L 3U7WL 1TA9A 4X4ZA 1BPLB 3QKSA 2YRWA 2WWVD 4XPFH 1BCSB 1CI3M 3QUML 4HQQL 3SZGA 1ZP6A 1ZH0A 1E63A 1OJ7A 3ZJTA 1JQDA 5DZJA 1W9MA 4Q9IA 4EGAA 5TGTA 3F6JA 1Y1UA 1YRQA 2A6IA 5I2IB 3AY6A 2ZXQA 4KBYA 3NNNA 2X0UA 2P3QA 4M9PA 4QAQA 3HZVB 1J99A 3NFPB 2ITCA 3ZIMA 5KSAA 2BVOA 1A4BA 4N7RA 4RBPK 3PXEA 2PHZA 3HP1A 3BN3A 5KTKA 3OKLB 3IS0X 3ZO9A 3HY4A 3H85A 3KL3A 5B1BB 3FZUD 4MB0A 4NMHA 1OCZB 3L1EA 1T26A 4B3JA 4CVZA 3G2PA 1MH9A 4KI5F 2P1DA 5IT0A 4HJGA 4X0EA 4YQXL 2C4FU 4HAOA 4BFFA 3HPQA 3AG5A 2YV2A 2X2PA 1K8DB 2KI6A 1NTRA 3CYFA 3U6RA 2EKLA 3V0HA 4V2UA 1NDTA 3P2EA 1OMOA 2VZOA 2G4CA 1W9HA 2UKDA 2HWZH 4JHVA 2A9KA 2BPBA 2WXKA 2LOEA 4Z8XA 4AVHA 1FNGA 2GK2A 4A23A 5KW9H 1UCBL 3D8UA 1SO8A 4ZFGL 3O2QB 5C0GB 3PV0A 4HMEA 3CSGA 3I9NA 3T3PE 4NP6A 3N41B 3EHBD 1HKFA 1QANA 2JBAA 5C0CE 3LM8A 3FU5A 1QV6A 4LVOC 4PEEA 1RBQA 4JJ5B 1BCRA 2YWGA 3JQ6A 4G1MB 3N0RA 2JGNA 4Y2XA 2IEGA 5MEOB 1SOAA 3DR3A 3CWQA 3VFVB 4NARA 3NUGA 3DP9A 5U4XA 2VLME 1QC5B 4QATA 3MLVH 2LU7A 3NG1A 4ATTA 3LIZL 5HJDA 6FABL 1M83A 4DUGA 1V43A 3T7TA 1I2BA 2KBFA 2GHQA 3V6ZB 5K9QG 5ADVA 5G53C 2O61A 5HCIA 3NBXX 5KKCA 2XUAA 2O2XA 3MGCA 2F68X 4CM8B 1JDSA 3S8YA 4TMFA 2VR3A 3SQOL 2BKUA 4G6KH 1UGKA 3FN3A 2A3NA 1G41A 3NJHA 1STOA 4HFRA 2O5CA 4EG7A 3JR7A 2H59A 5AHKA 5EG6C 3PJDA 3K0WA 3MUHL 4KUEA 4M48H 3JWOC 3TQOA 5E9NA 1Q6ZA 2W90A 4UAUA 4FNQA 2CBTA 1UDCA 4DW8A 1JOIA 3SIRA 1SZNA 3AR7A 2EDRA 3N86A 5DURD 2XN0A 3HVUA 5LGKA 4CDHA 1LX6A 4HG2A 4L8FA 4R01A 3GFSA 3K3PA 3G5MA 4DYHA 1KZYA 1DJOA 1KPGA 3P4MA 2OUKA 1I9RH 3RWHA 2Y7QA 1GM5A 1J42A 3X17A 1ZNZA 4F5ZA 1JDJA 5CBEA 2NSJA 3CLWA 4RORA 3P5SA 4UM8A 1SLXA 1WB9A 1SC9A 3ECWA 1LVEA 2P9YA 4ETMA 4CF4A 3EGXA 2MINA 1C9YA 1V7CA 3JXAA 5JOQA 3KLPX 2OCGA 4NZFA 5AKXA 5DP2A 4P0DA 1VB3A 2VLRA 2C2MA 1RLWA 4Q1DA 3GPEA 5IAKA 4LNUA 3UWKA 4DBVO 3VOTA 3LXRA 5GQSA 1LJMA 4MMYB 2X2IA 2IYPA 4HAGA 3IOBA 2P2YA 1C50A 4YDIL 4KAFA 3QG5A 4HKBA 3HY6A 3DX6B 3BDYH 1OAOA 5L2KB 4AVJA 2Z92B 5IS2A 1V4VA 3E22A 3HJEA 4R16A 1T4WA 5DTJA 1QFWL 3PNVA 5TFSL 4FSXA 1MH5B 3DBSA 2A4MA 3DPBB 1UA6H 2C5EA 2AQIA 4ODTL 1TW3A 1Q2UA 1UJ3A 3P9LA 3THRA 3VHQA 4AG6A 4GF5A 4A66A 2IYOA 2OXTA 3GFRA 3KWJA 3DE6X 2MDTA 1HOEA 5AI4A 1BLNB 1YCHA 5FWXA 3K8MA 4CM6A 1B6RA 4YAUA 4UANA 4WWKC 5FV2A 1TCCA 3ML8A 2B8JA 3M45A 2O5XL 1G7QB 5JNSA 4PJEA 1WQ4A 1M2KA 1E6OL 2Q3AA 3OAUH 2XQVA 5HTOA 1BKDR 3OTGA 2XODA 2G3YA 1W16A 1K86A 2IUTA 1X5FA 1H5NA 4PBSA 1S7RA 4U6VL 2EQ5A 3KVOA 2BOCB 1XU9A 2PRJA 1GGEA 1QVOB 2IAMA 4HISA 4ZPXA 3C2QA 1UWVA 1TEYA 1MLCB 5B2ZA 1AQJA 4YRPA 4AW9A 3GXPA 1S4QA 1SHZA 4L22A 1ZCJA 3HHEA 4NHUB 2GDJA 3G7TA 4R8RA 1DGQA 3D52A 5A62A 5JYCA 4BLWA 5EUOA 4R1MA 3QNYB 4IGAA 1PU2A 4Z1OA 4WEEA 3RJZA 3KYDA 4AOFA 1L9OA 3VO2A 3WS6C 4UCWA 2YPLD 5DZLA 2ZRHA 3QR1A 4O4IA 1PR3A 4FGJA 3KLAB 3D05A 1E4HA 1TUGA 4N5NA 2Z8XA 3EY4A 1ZSHA 3S27A 5HSGA 3UTSE 4FHDA 4OBEA 3F6LA 1F0YA 2DBQA 2IDFA 4ZD6A 3U82B 3EDYA 3EO0A 4DCUA 1KNOB 1S7TA 1MW1A 4ZPTA 4IQ4A 2I8CA 1Z4JA 1KLGB 1GUYA 4FGUA 1SJMA 1RP7A 4XMPL 1N0VC 3R0QA 5CS7A 1PWHA 1MCWW 3VOSA 1S7WB 1LSJA 2IQAB 4ON9A 1LS1A 5BUGA 1PNRA 4GWKA 3KGSA 1KFGA 1V4NA 3QFFA 4N8PA 4I4TB 3ASNB 1P5HA 4XMLL 4UBLA 5KVFL 2ZVJA 1O0CA 2XKKA 1MI5B 4O9HH 3TTYA 3HXLA 4HV4A 1K8IA 2JCCA 4EB6B 3TJHC 2MIIA 3X1YA 2WV3A 3LRHA 1U8XX 3FMOB 5FGBC 1F3DH 1OM9A 4F9LC 4UE3S 2P47B 2WXJA 5EXTA 2YWZA 4FCCA 1B4RA 5J9PB 4FGKA 5TS3A 3AREC 3BPLC 1N7HA 4A7GA 5REQB 2FEXA 4S04A 4PC3A 2X4GA 3AV0B 3A47A 2O2GA 1X7SA 2D2OA 2QBWA 3BH4A 2IGFL 1N6KA 4JPIB 3WMEA 1XF5B 5DD6A 3M07A 2MTAA 3DMTC 2BEWA 1P6XA 4MDIB 5EA0L 2OJEB 1S3FA 4P4LA 2YXMA 1JR2A 1FE8A 4Z8FH 2FEJA 2PSHA 2ZOSA 4KV7A 3TP4A 3BXPA 1A0QL 1KPVA 3O9VA 3L3KA 2Q6IA 3UTPD 1KKMA 3PQFA 2GRUA 1EO8L 2LIVA 4L0PB 3ZZMA 2I7TA 1D5ZA 1J1UA 5FB8A 4YP6A 1NQOA 1IQRA 1EDEA 3HI6L 5KANI 3NJ8A 5DI8B 5L6LB 5CHNB 4U3SA 1P31A 2QW1A 2WQ6A 9ABPA 4WWKD 4DGVL 1YBHA 3TH4T 4PX3A 2OZ4A 1UOEA 3SEQA 3S2AA 5BVHB 1OIVA 2O0JA 1GTG1 3U7JA 2WVAA 3AX6A 2CUIA 2ZSDA 4ORGA 4FKMA 4QUEA 4TWAA 5LQAA 2BKAA 3I85A 4WLEA 3T5DA 3SPHA 1EU1A 4DP8X 4NU0A 2QJFA 3QVXA 5I8EA 1ZANH 2OPHA 2IXDA 4D80A 5J12C 1O9WA 3RL2B 2BVEA 1MRSA 3CLSC 5CB6A 3ZQ9A 2AL7A 4XDHA 2Y2UA 2OZKA 4N1AA 3EVZA 4HXAL 2NNCA 2D4FA 2NTVA 3LQZB 1BZOA 1AIFB 3W2GA 2DQTH 2GPSA 3C85A 2CR6A 1C5BH 2ADIB 2EDHA 1TQHA 5LMUB 4V39A 2GSGB 3GGJA 1UMBA 3T4AC 4C0QC 4NKDB 2L7UA 3II2A 4M56A 3D2BA 5J2TB 1NMXA 4RWYH 3CMOH 3X1FA 4ZJZA 2OP4H 3OKNA 1CVRA 3TNMB 5B22A 4ARSA 3HO6A 3GQBB 1BHO1 3B3QA 1TCRB 1W0VA 4V1CI 2LE0A 4GMXA 2OMXB 1INEH 2X4OB 4J7UA 5T1LD 4IHBA 3PS6A 1E1KA 2WLSA 2QGDA 4AC4A 4CGUB 4Y1AB 5EE9A 4B4VA 2GITA 3OTIA 2JCBA 1K0FA 2GCOB 4K7FA 4FULA 4LNRA 3EJPA 4HXBH 3HSYA 2DFPA 3FOLB 1MD9A 4ZXPA 2ZB3A 3LBFA 1WPCA 5LGHH 3PLRA 2O3TA 1ULBA 2HXAA 3VM7A 1XH0A 5LVAA 1A7RH 1OSEA 1ZSDA 2X4UB 4V2BA 4CMMA 4RAVB 2FEDC 3MXWH 4QYAA 3WFDH 1NUQA 1N6QH 3TJHD 3W5DA 4I55F 1E5VA 2W0FA 4JO3L 1XZPA 4JKYA 1IU9A 4MHHI 3NJVA 4R2GB 4HZ1A 2AKRB 4OQEA 4JEUA 4UNTA 4WZBA 3ARED 4MD4A 1DN0A 3QUGA 3GFTA 1URLA 3VB9A 4MI1A 4GQPH 2QN8A 4JVSB 1SBHA 4LKOA 2QQNL 3DCNA 1OLZA 5JNWA 3ESPA 5EEXA 1ZH6A 1IC7L 4L5FH 2JVJA 2IPKA 2F9BT 3T08A 2J5WA 3F73A 5T4HA 3V1MA 3NTXA 1LK5A 3ZL1A 3GEBA 3C41J 2ZRGA 3H1FA 4J1QA 4D97A 1HH9A 1L5GB 1QTRA 4P93A 2EDJA 3P32A 4G1EB 1WF3A 2FG7C 1XTPA 1FCJA 4IQGA 3TL6A 4BEWA 3DMHA 3PB3A 1ZUWA 3G68A 4GKLA 1KJZA 3VH4A 3GMNB 3EZXA 1IM9A 1KZ4A 4I88A 2D06A 3GMLA 1TVMA 2UZ3A 1X4YA 2X2FA 2E4AA 1Z07A 3MUGA 3F8SA 1F6FB 4LV5B 3HJCA 3RSZA 3HKCB 2HP4A 3IDJB 3OLVA 3CEPB 2BEUB 3G0OA 2YN2A 4WK2B 4YP0A 5C1IA 2CCJA 1JFFA 3KZCA 5KVCA 2OCBA 4LYGA 3P0VL 4NYIQ 3W4JA 4BO4A 4PG9B 2R6AA 1A6TA 4MAYC 5EGSA 4BO9A 2K2QB 2YKKA 4ZFOB 4NYMR 3TLGA 3W0WD 1FH5L 4J27A 4HPYH 3Q3HA 2V7NB 2ZOTA 2YR3A 1MCKA 3DCYA 4CIDA 4IKOA 1U3HC 4IOFC 5CB4A 3IDOA 2FP4A 3QJGA 3V33A 4ZQKA 3CLSD 2ZTHA 1BH2A 4NQTA 4GFTB 3CK0H 4G83A 3EYQC 5B7MA 3HC4H 1H3TA 4MSWA 4AX4A 1VMKA 4IXMA 4BZWA 3BD6A 3THSA 5ALKA 1X1RA 3K0YA 3EVCA 4JY4A 4H5SA 2PKEA 3BZ4A 3AB8A 4M0DA 5I19H 1REQA 4YCBA 1PE0A 1C1DB 4L29A 4EUPG 2DFLA 1MPTA 1N59A 3OEHD 4AQYB 3KHTA 1CEQA 4B84A 5IEKB 1KHHA 2RHCA 3FSOA 1QQDB 3PD0A 4PGHA 3DDSA 4MB2A 1AV6A 3MMSA 4Y98A 4BINA 5I76A 3JXEA 3OM0A 1R7RA 3IPCA 4JI6B 2KPWA 3G04B 1SCAA 4MRNA 4FSHA 5HA5A 2NTNA 4KQXA 4I55B 2X87A 1XGUB 2VW6A 2MYNA 4OXQA 2WVVA 4BP9A 2BXZA 1NN0A 4N01A 3SC2A 3IA7A 4UT6H 2YPLE 1K6EA 1OARH 5KWSA 1J0ZA 2K4MA 5EKDA 4GW3A 4RM3A 4TGLA 3K9LA 1OKEA 4UHHA 5HJGA 4UVHA 1EANA 2CSUA 4JP8A 2VPQA 2EKSA 3F5SA 3QKIA 4L4RA 3NQIA 4XVCA 1CVSC 1ZRUA 4Z0NA 4Z7WF 4YBQC 4E4RA 2PRYA 1D6NA 4YHPB 3J80A 4E9RA 2VHCA 2VHUA 4EO7A 1WHTB 3PC6A 1C9NA 3R0ZA 1RZJH 2X4LA 1OPOA 2M6RA 3F1LA 3QVMA 5T1DH 3MLXL 1GZSA 4A8JB 2FNAA 5SWZD 4YAWA 1V5WA 1Y63A 1KN2H 4POAA 2WMNB 2CBPA 4FHKA 4M76B 4C4PA 1QH1A 3S70A 1L9TA 4RKWA 3RH0A 3TNYA 3KEQA 2NZYA 3L8FA 4Q1AA 1GFWA 2O7QA 3LA8A 2ZFUA 4C7BA 3HNVL 3FNRA 4C87A 2MH4A 2A0LC 1OCWL 3EOYG 4U6HB 5INCB 2QRPA 4R3SA 4OFPA 1RV6X 1YUKB 3HOGA 4PJCE 1TCUA 5HUHA 3QX8A 5EPEA 1CQKA 3I02A 4JHWH 3TZVB 1E2QA 4JVPA 1FFCA 4WK6A 2K4WA 3ZL2A 4U9IS 2N47A 3KPOB 2D5IA 1IWBB 2ZX5A 2Z43A 2ZRDA 3MRNA 4ALMA 3OTQA 4YDJB 1S7UB 3V9CA 1L5YA 4YDKL 1NLDH 2GFIA 4CL0A 3NORA 3ABOB 3JATA 4LSTH 4MAYD 3UTPE 2LGNA 1P60A 1OP3K 5KMGB 3OJVC 4LOLA 3N6YA 1FMFA 3EXG1 3TEXA 2XE7A 3DWGA 4NEHB 4DO6A 1IGJA 1HL5A 3T5GA 1R4XA 2W58A 2WUGA 1U3HD 3QIUC 4IOFD 4CIWA 2RD2A 4BH7A 3AF0A 3EYQD 2RGXA 5MFPA 5A3JA 3TPZA 3EDJA 4KXYA 1LNQA 1XAIA 4OGKA 3NB0A 3FT3B 5L0QC 4UMVA 3VCLA 5JY6A 3C98A 4TYNA 2PH7A 4RZXA 4XPGH 5T5FH 4X64B 2OG1A 5BQ5A 1AXSA 4PN6A 4DQUA 3P8ZA 1K4MA 1WAAE 1I7TA 3NRBA 2P6PA 1EQAA 1BH6A 4YLEA 3SOTA 2W6JA 3VU0A 3C6LA 3FNBA 4HBCL 4C57C 4EB8A 1XL0A 4KNWA 3COOA 4AJ4A 2WTAA 2J1KA 2ERXA 1YDMA 3T12A 2HJLA 3ZKXB 4PM1A 3ULUC 4C7OA 1GQQA 1P3Y1 3I2YX 1V54B 4WU7B 4Z7WB 2BAGA 3M4ZA 4I9WD 4ZZKA 1RPJA 5JAOA 2VSYA 4PRPB 2IBGA 5AVSB 1MX1A 3ZLVA 1DJMA 5GZOA 4ZARA 1GRCA 1FTSA 3LUAA 4LS3A 1T7XA 4AG4L 3HN3A 3C6SA 4HW6A 3WXVH 4GMHA 1X38A 2NXJA 3D5TA 1O03A 3IE1A 3UYPB 4IIFA 4N0CC 3LN5A 2OLEA 1E9QB 3HPLB 4NCBA 3P02A 2NMVA 2HJFB 3B9PA 4YBQD 4Y1EA 2FX9L 4LHUG 1CU1A 4ESKA 4JT8A 3WIFB 4EI7A 5IFLA 5FOQA 4D3ZA 2YXDA 5C18A 5K6RA 5JYLA 2YQ3A 1UT5A 3LPGA 1RUKH 1KO1A 2CE7A 2Q41A 4RA9B 1JI1A 4AVKA 3LHPH 1U9YA 3TQRA 5LZ4A 2JJ1D 1CWUA 4PINA 3RBZA 3T5WA 2WYOA 5J11B 3FSWA 2C0QA 2UY7B 3H9SD 1DXHA 2ODNA 4LU5L 3DMMA 4F71A 5D2CA 2JI3A 2Y2WA 5I71C 2A0LD 3C74A 2VDNH 2OYKA 4BQQA 4LPXA 4XLTA 1M3JA 3HE7A 1DRUA 1GAWA 4B7ZA 1HT6A 3I42A 5AOAA 4N2DA 1I53A 1ENZA 2D3TA 4PV8A 1YJBA 4AQ8C 2TMKA 1XMIA 4Q56A 4QWMA 3NZ8A 1URPA 1NICA 1YMHB 2VS1A 3V00A 2XQFA 1K8XB 1U8NB 1KMCA 2WYVA 5AVKA 1NUDA 5JI3E 3NC0C 4WZ6A 5IGXH 3O4LD 3THYA 2DI8A 1WLSA 5FOBB 2HLDD 4HUXA 2GKIA 4E5NA 5AUNB 1GYVA 1KPUB 2R2EB 3GJRA 1MGOA 4MDJB 4OJYA 4X9GA 3NHSA 4BP1A 4FN0A 1NEUA 1CICD 2JQAA 4JC5A 4ETWA 5C0AB 3HRIA 4QUAA 5L4JA 2GN2A 3PK0A 2GFBA 4FDTA 3AIKA 1IBSA 4OO3A 3AXHA 3LCMA 5C0FB 4RD2A 5ADOL 3QIUD 3V7NA 3F8UB 4AJLA 1E6LA 2FGKA 3EYFA 1CUBA 2RCSH 1RUPL 4KXNA 1EDZA 2KHAA 4Q3BA 1LCIA 4EF5A 3GC6A 1CT8A 2ID8A 5I17B 3HYCA 4TV8F 1OAZL 2N4IA 3G6DH 1QHSA 5FM4A 3RTGA 1G5GA 3AQIA 4S1VA 3W0WE 3MV11 2ZJ3A 3DBHA 4XYBA 1JJUA 2I9LA 3JPYA 1EHNA 2R6CA 1I4OA 1JRLA 1I6MA 1T6BY 3MMEA 2ZUQB 3JQRA 2BCEA 2VSOA 5KTOA 1DEOA 1KI1A 4J8RA 3TT3L 4YDSA 5TDOB 5L3SB 4AURA 1GDHA 3PA6A 3HXKA 2ZXUA 3DXXA 3CPUA 5D7LA 3BDAA 2B5VA 1RAMA 3FT9A 2DBLH 3DYOA 5K3AA 1JYFA 2GPWA 2VT3A 3EJZD 3IAQA 1NMSA 3LMKA 4J3BA 2J43A 1OOEA 1R3LB 3FDFA 4OM1L 3NJRA 4XOIA 1XSIA 3PHLA 1KFEB 2CLRA 1DVFA 4M4RB 1B6UA 1FC0A 3DOOA 2G88A 3IUNA 2REQA 2VPYA 3PWUA 4KRLB 5C8JB 5D84A 4AV0A 2JATA 4ZI5A 3GLUA 4ZSOE 3NIDF 4NENB 5IY5B 1XCJA 3FCAA 4RBNA 2ZXFA 1R2QA 2EJVA 3ZWCA 2H0EA 1VRCA 4G8AC 3PUZA 1AXIB 2W6NA 3NU1A 4M6WA 1ACMA 1DANT 3LN9A 2VSDA 1A8SA 1TJ3A 4Z3TA 1IAMA 3CJTA 1UXSB 1D2EA 4MUFA 1ZA6A 4WSGA 2HHAA 1ABEA 3OJEA 1WDAA 1T80A 3RTQA 1HE1C 5AJXA 5CINL 1JJIA 4CMCA 2AJDA 2CMRL 1FE8L 3URMA 4WVRA 5EBWA 3ZU4A 2B6NA 1BZ7A 2Y6SC 4RH1A 2PD4A 2AN5A 2VM4A 3RYIB 4ALAL 1FSKC 1NYRA 1FN4A 3AVOA 1BECA 3ATAA 1BJ1H 4GAGL 1FS5A 1UFGA 3RTBA 1OHQA 4JM2A 4KIJA 3H42H 2W8BA 1Z8FA 1KFJB 3FUCA 5I1DB 4Y0AA 4B3MB 3GDFA 5BV7C 4QBTA 4NDAA 3V7YA 4DA7A 4KAJA 3I9MA 4MS3A 1M34B 3O0RL 3JQ9C 4K23L 3DV2A 4Z7IA 5EJGA 1QHOA 5DHMC 4JIMA 2B1GA 5SWZE 2ZXEA 3MNZA 3V5DA 4KMOA 2BIHA 2D31A 4IS6A 4UDTB 3LZ6A 3TL2A 2AXEA 4MR9B 3TUIC 2OZ4L 3RRYA 4J3OC 1A8QA 1EHXA 4GO8A 1S46A 5H2BB 4OUDB 3K5WA 2ZCKL 2VLKA 4ZDIA 4WW1B 5TE4L 3BRGC 1EGQA 3IEMA 3Q3GE 3FO1B 3LKNB 4BQ9A 5GJCA 1E6WA 5F52A 1E3WB 2JLZA 4TV8B 1EVKA 2AF2A 3ZYCA 1RU9L 4B7IA 4CKCB 3ZZNA 5J57B 1KBWA 5F1OA 4OD3L 1JALA 4GSLA 1FFNB 2F18A 2ADGB 1QIEA 1LJ8A 4LRNL 4X0NA 1BDBA 1ZICA 4CJ0A 4Q3LA 1YVDA 1SVKA 4P2RA 3VGAC 3JBG7 1MU0A 1AMYA 3MCVA 2BGTA 3D6UA 2ZIGA 2BDNL 3U44B 3R06B 3BW9A 5A3SA 4WDRA 4M0EA 2AG6A 3AONB 1N3LA 2A59A 3MNDA 2DULA 1KO5A 2QZZA 5DSTA 5CBAB 2XE4A 4WI7A 1Q19A 3FB5B 3FO0H 4AQ1C 4NQEA 5K9OA 1H23A 3ZDCA 1SOUA 2IMMA 5E9WA 1C5DB 2Z34A 5I6MA 5LZ9A 2C04A 4BX8A 3NIDB 4IHKA 3EIXA 3MRDB 1RYNA 3WO0A 4YLBA 3AS3A 3AHDA 3T1VA 3AB3A 4LVEA 1NUAA 5L88L 1IXZA 3FQ2A 5DQJB 3HE6C 3T4YA 1X13A 4HGOA 1H42A 1YIOA 4MWGA 1FYFA 3O92A 2VWHA 3TLMA 1J86A 1TJMA 3TW8A 5KTYA 2GH1A 5HW0A 5GGTH 3OKDA 3WKPA 1SDAB 2OV6A 1I9GA 5CB0A 2NY1B 3RAPR 2ZBRA 5DRYA 5CZKA 1NKRA 2PUQT 3LA6A 1RYDA 4MNQD 5C9ZA 3ZGHA 5IMOB 3R3JA 2XU9A 4F4DA 3E23A 3L9RB 4OM0H 4KOCA 1YUNA 3ZX4A 5ADPL 2QKIB 2YFYA 5UKDA 2V5AA 2CXOA 4I9WE 3OQOA 1UVQB 4U1NA 3QUBA 2Z5LA 5LDDC 3DIFA 4FQCH 1NZDA 1J0DA 3ABKB 4DMKA 2NLOA 2Z9DA 4OL9A 2ZJYA 5IOPA 1D2NA 2Y6SD 2IPXA 4QXTB 2PYIA 3P0GB 2QN6A 4JKIA 3AKCA 1EFAA 4BNGA 1DBAL 4UEKA 4MMZA 4AL4A 4QYIB 2R1ZA 3AUKA 2MWMA 1EBPA 2X0IA 2OZEA 1NIPA 2FP3A 1YU6A 4X6DA 1HXMB 2EO7A 2CFOA 1TQCC 5JZVA 3LKSA 1G6RH 2EL7A 1ZOXA 1IU1A 2J3QA 4EJFA 5I9TA 1EVZA 1AA9A 4MA5A 2V6MA 1WUKS 3UC0H 1SFHA 3GXIA 2FEEI 4J3OD 4BMZA 3NOVA 5KOHB 1ZHKA 2B1OA 3T09A 3NCXA 3NSJA 4YAQA 4LEXH 2AXFA 4OI4A 4QOFA 1QRSA 3QORB 2TSYB 3H9SE 4IK7A 4UQIM 5I6XC 5KWVA 3WS3B 4NPHA 1NMZA 5CFRA 4KPUA 3NFSH 4FGMA 5EU4B 3MX0B 2P67A 4JJEA 4TRRA 3ZZTA 1RQPA 3AL2A 4PGZA 4UUQA 3WGZA 3HB7A 4FNRA 2XADA 4P3DB 1Q0YH 3GZQA 4L5IA 1WU8A 1MCQA 5SYMA 4QXWA 1WFIA 4NQZA 1A96A 3VU9B 2WW8A 1ZLWK 2IOFK 1F17A 3TIIA 3BWXA 3RTAA 3O4LE 2I2BA 4N12A 5HXAA 3WLTA 5C0EA 2HQSA 4OHUA 2VKQA 1I1RA 1EEZA 1ZW6A 3RTCA 4LE1A 3ZQUA 1EWHA 4LBEB 1T2JA 3IPRA 4XOUA 2GAZA 1P1CA 5J4VA 4C0AC 4K3JL 4V2CB 3K0FA 2O2SA 1A3CA 3DDWA 4UCFA 3SE8L 4X8CA 2HPAA 3P0EA 1F02I 3GT0A 2H3KA 2WOOA 4ZCIA 4RTKA 4WCDA 3W6UA 3IB4A 3EARA 2W0LA 2QIOA 1LD3A 4OH1A 5BN4B 3G79A 3KKMA 3VHLB 3A7DA 4DJMA 4K86A 2BV3A 2HC9A 1UH3A 2QUZA 3VVWA 3N2ZB 4LSSL 4HFUL 2IBMA 4WOKA 1R6AA 1L0BA 4C08A 3FHJA 3HE6D 2GEFA 2Y6VA 3DW1X 3JARB 1H3PL 2C7BA 4NERA 2V74B 1FPTL 3D2LA 3L41A 3I9V1 3V3TA 1AR1C 1XR9B 3RBGA 1BW9B 3TTSA 1ZVQA 5L3QB 3L1OL 3FUXA 1CUGA 3N2KB 1T66C 2APWA 3X1XA 1BVZA 3L79A 2A6KA 2LE9A 1C7EA 3NHYA 1OC4A 1T36A 4MRVA 1KZQA 1IN5A 3L7AA 2EVIA 1WEHA 4L07A 3CGWA 3K6RA 4NOBA 2D0IA 1YR6A 1P7YA 4JU9A 5AW6B 2ZKYA 3NTCL 2X4SB 1OI3A 4DN6A 3WK9A 2JDIA 4HYTA 1XHLA 2XIIA 1VMEA 4PYJA 1CE6A 4QHTA 3VKGA 1T2FA 2QTLA 1XTZA 3TCNA 2QSZA 4OLZL 5LYJF 1UINA 4ANUA 4OP2A 5T4EA 4ECAA 3VE0B 3M1LA 3ONWA 1IUZA 3E3QC 3O3MB 1KLFB 5E6ID 4BYMA 5LU8A 3DZIA 1ADCA 3RS8A 5CA1B 1O7JA 1AGRA 4YPJA 4EO4A 3FFBA 3BCUA 4JFUA 4WLFA 3GEMA 3FNGA 4TS6A 1JVNA 4NO0D 5I1AB 3EVFA 3IPBA 3FGOA 4PQFA 2XITA 2A7BA 4YHYC 3I4LA 1XROA 1XH2A 5EOQL 5B8CC 4FD3A 5ALLA 1D9KA 3D0OA 1LP9E 4LYHA 1BXXA 1EMTH 5IKPA 1Z82A 5JC8A 1PCSA 1I8UA 1EFHA 1MCDA 3E05A 3GP8A 4HH1A 5TE7H 5ILTL 5CMLA 3C5WP 3F2VA 4JRYE 1M75A 3SBXA 3G0BA 2FN7A 4ENTA 3NC1C 1Z5YD 4UINL 4CFZA 4UZUA 4DETA 4Q6IC 1ZAYA 4F7TB 4P5RA 1FIGL 2XF8A 3ODPA 2DL2A 4OKNA 4IDBA 4M8RA 4KX9A 1N2ZA 3P9MA 4XP9L 1Z6PA 3DHUA 3T7RA 4QXUH 3H5AA 1NN1A 3JSAA 4M7KL 5TF1H 1I2DA 5BRZB 3T6XA 1SKUA 2XNHA 5HVFB 1R3KA 4JU8A 3N44B 1EA5A 2FWLB 3NLLA 1VYUA 4EJ6A 3NHZA 1OWOA 4M5ZH 5IKCB 1KDVA 3DHYA 3IM1A 3VWJB 1II0A 3C8KB 1A6AB 2CK0L 1FDRA 1DOAA 2YHIB 3DEIA 4MIOA 4LDNA 4KTEH 1L5LA 3JSXA 2H0QA 2ZSHA 5G0WA 1G20A 2PXHA 3ZXSA 1T1GA 2C7GA 4UIKH 2CHUA 3L4BA 3FO2B 2EDKA 2PZBA 1MCBA 5DTRA 1NFKA 1U8ZA 4JT4A 2XUQA 2PN1A 1IGFH 6CGTA 4U3JB 1F3OA 3HV0A 3ZDYB 2PT7A 1A9RA 2GZ3A 2WU0A 2EKQA 3VU3A 5KVDE 2XTJA 2QR0B 3EAGA 1PX2A 5BSVA 2EE9A 4GP6A 3BFJA 3FMVA 2IV3A 2ZIXA 4EHNA 4F1ZA 1THZA 2NXZC 1YR7A 4QUGA 2CUAA 5DSXA 3WQRA 2CXNA 1HNYA 1EFXA 1D09A 1UM6L 2EE2A 4H3VA 3LF1A 1AR1D 1HWWA 2VRNA 3TRKA 3LDBB 4TYMA 3M33A 5T67A 1T66D 1M7UA 2K4AA 3UEZA 3P26A 2P52A 4G2AA 5FECA 5LYJB 3FOBA 1X39A 3ELYA 5BSKA 4R4JA 4JG0L 3U17A 1WO2A 2A0XA 1FSSA 3CO0S 2XZTA 2O52A 1L5WA 2CPCA 4EIWA 1C4OA 1U0NA 5I1LB 2ZB8A 5L7WA 2HDWA 3QXVA 3BERA 2NZXA 1QG4A 2AJUH 3TLXA 3THMH 4HS9A 7ADHA 3AMKA 3WHIA 2Y1DA 1E9EA 1RHUA 2DG2A 1QFPA 4JLJA 4CUZA 2PSFA 1RVFL 5A6SA 5CEFA 1E27B 3LLSA 2O8EA 1LVGA 4WOCA 5ISZB 1ZJ6A 3F6YA 2PTTB 4PZ9A 1UA3A 4IBOA 5AJTA 5J1AB 4X8GA 5DSCB 1IO4C 5D2LF 1NHGA 2Y07H 4V0OA 2WIBA 1VJ0A 3O3OB 1NTOA 1DFXA 4BWFB 3WGKA 3FT0A 3UZVA 4CTNA 1ZZEA 4HXFB 5AK5A 1E2KA 4BSWA 4MKIA 3KPMA 1XO8A 5H59A 2JHAA 4YGVB 1F4VA 5LB4A 5MI0B 1W0CA 4NM8H 4I1UA 2IBSA 3WXWH 1HJBC 5KI6A 1CTQA 2GF2A 5JDCC 5LBSA 4EI0A 5KNCA 5B3JC 1ZXKA 1W581 4U1KB 2DQDL 1I85A 1GRQA 4Q7DA 4F38A 4NG4A 1C8PA 3UBXB 3FVRA 5ALZA 4MIYA 3LZPA 1H8EA 3MJ9A 2I7CA 1KC3A 1RYZA 1YKGA 3BWVA 4JDVB 2AFVA 2V0CA 3IP5A 1QHQA 4LCCA 4ZVOA 2FT6A 4APXA 1KJMB 2FYTA 5EB9A 1I6LA 4YSTA 1FAIH 3ZKWA 3ZNQA 2VP2A 3W11C 1U80A 1FRGH 1VZ2A 4U1SA 3DBVO 2IHKA 4RNDB 4X84A 3GOQA 2IG2L 5MEPA 1P9MA 4OPMA 3G17A 3SPJA 4P4KC 3SDAC 3HZYA 2JCSA 1V96A 3G5VA 3U2IA 2PGOA 2X0KA 4IBLT 1AANA 3CT4A 5IM5A 4QRTA 4RTRA 5G55A 1ZM4A 1LE9B 3IBEA 1GGTA 4ZMSA 2TSBA 3QCTH 3P9QA 1KMIY 4AM0Q 2BR5A 4R26H 1JXAA 1R0AH 3DGGB 4LCJA 1BX2B 4G6JL 4OCWL 2NAPA 5BRQA 4F4CA 3UW1A 3ORSA 5FPHA 2ZJ0A 3PGFH 2P9ZA 5GAJA 2NU8A 3RAFC 3D4ZA 1L4IA 3KJIA 3HJFA 2AYXA 1LVHA 2ZKLA 5AB0A 4BRWA 4DBLC 1FJ1B 4PBRA 2VUHB 1NG9A 3TV3H 5FGSA 5C3LD 3WX0A 3M9WA 3ARBD 1LK0A 3AKYA 5E8NA 3VC2A 2WTUA 4A7SA 1CWVA 3KAQA 3CFKA 1DINA 3GGWB 5AHXA 3WLRA 2XA9A 5JS2A 3A6ZA 4HEJA 3KDPA 3REWA 4P33A 3W2DL 4Q3AA 1EP3B 4H8QA 4OLVH 4A37A 4QLRA 2G2RB 2IDSA 4DRXA 4V0SA 4PRBB 2XKSA 1P2SA 3FQRB 5D2LB 1QWOA 3NDBB 1PKQB 4J8PA 4NV0A 1S4IA 5E4EB 3SLGA 5HYQB 3QFTA 1E4OA 1X1EA 2ZYSA 3KGRA 4B9ZA 4AUEA 2XN1A 3DSRA 2I9PA 5CW1A 4Q4JA 5IF0A 3ZDXF 4FQ2L 5DMKB 1GS8A 1A5FH 1FDLH 4WJLA 2YK1L 1QTPA 1BOFA 3EKCA 3VSCA 3GBEA 2ZBPA 3TCXA 3VQTA 2R69A 2HG0A 3IJHB 4F4FA 1KIPB 3KYOA 4JQIA 1W76A 2VLJB 1W88B 3L3OC 2B36A 4REQB 1PQZA 2Z35A 5HF5A 3CPSA 4N20A 3VFWB 3KZMA 2IX9A 5AOKA 5TGBA 2KZBA 1W0WA 1MHEA 5LP6F 1XEWX 5LBTA 2OZLB 3ZXXA 1KT2A 5GGXA 9CGTA 4FTDA 1EM8A 2JHFA 5TE9A 3RFCA 1TJ5A 5IDWA 3NETA 2PPVA 4HXYA 3BUIA 4XWGA 3KGUA 3T0EB 1MAJA 3TQQA 1D5IL 4OZHE 1UWEH 2J4WL 1N5AA 3IUSA 1V10A 1K9SA 2D7PA 1YULA 4DPRA 3P2OA 3VRJA 5DTMA 5AZEH 4B3RB 1MFBH 3LXBA 3W11D 2Y7OA 4IIQB 1HO3A 3NCYP 2ZW9A 4LNHA 4QEGA 4Z9YA 4Y4KB 3RVWC 4E11A 3GBMH 4KJWC 3GEWB 2BTQA 2W0PA 3BH6A 5D9SB 4P4KD 3SDAD 1T35A 1W9XA 4LJKA 4DCPA 1EUZA 3JASA 3ST7A 3ROPA 3NABH 2UZYB 4BUQA 4C0WA 4ZYWA 2DI7A 4BBJA 3CEAA 3A9VA 1SRQA 3VH1A 4EY7A 3ARGA 2ESVD 1NJ9B 2Z4TA 1C1EL 4K9RA 3C7AA 4QD2E 4JREC 1Q9KA 4NZJA 2ARKA 4BE9A 3AHFA 1NOIA 4UAGA 1TTGA 5ILGA 4R84A 4ZANA 1IAIL 5IVIA 2YJNA 3U37A 1U8FO 4ZRGA 2X9XA 1J8HB 2HCJB 4OFQA 2QW0X 4AJIA 3ZZ0A 4Q4AA 1M76A 2ZCVA 4OIAA 4AZ3A 2DWXA 4U3XA 4P4RA 3UATA 4B43A 1X1SA 5TH2A 2GI7A 5A2AA 3QDJD 3LY8A 2WIGA 4GBMA 1ZD5A 3ECVA 4YQFA 4GKAA 3MODH 4GC5A 3RNKA 3I84A 2AMFA 2HTKC 1LQBC 3AETB 3GMOA 5TE6H 1V3TA 4TWRA 2X4PA 1KMNA 1QPPA 2H0PA 1NW3A 5AB2A 4Y67A 3GR6A 1X44A 4UZSA 3OE5A 1XGQB 4PPNA 4OBSA 3ZDXB 1WBXB 3HV2A 2VJQA 3CM0A 1P2UA 1VGEH 4HDKB 2PYZA 4QOSA 1CJTC 1Y4UA 4BJLA 2K45A 4JV5B 2ZG3A 1MCHA 4PSRA 3U16A 4Z7NE 4IDNA 4IKNA 3COSA 4B6GA 1SG6A 1VSUA 4F57L 1NCIA 4LOEA 2EBHX 4OSUH 4WHCA 6LDHA 3L7IA 4JL8A 1AFVL 1I1YB 4EHJA 3EC7A 1TEFA 1HORA 4G3YH 1D4OA 4NPAA 4IOSD 2C03A 5LP6B 4EFMA 1W8IA 2WHPA 2PLAA 1N3BA 4O58H 2MCAA 1XNQB 1UEIA 4RVFA 4YDZA 5DD1L 1Z33A 4XH2A 1XD1A 2ZIAA 3Q0TA 3WWPA 3OR7A 4D57A 2EJUA 2WMYA 1WOMA 3EEBA 3VAZA 4Y19B 3WYBA 1GKEA 1DBML 4NQCE 1JYVA 4C21A 2V0NA 1NNLA 2RFLA 2UYLA 3CDFA 3FTEA 4YMTA 4R0NA 1N70A 1TKWA 5P8WA 4KWIA 4A16A 1UL1X 5D5PA 1EHIA 1T91A 1D7AA 3E3QE 4KRFA 2G9QA 3SDDC 1AHHA 4J49A 1FP6A 1K8RA 3CKKA 4Q9JA 4OQMA 1W2WB 4KFRA 2D03L 2PH1A 5F2OA 5DTQA 4BFCA 5I8PA 4BWVA 2WILA 2WXOA 4QHUA 4JOSA 2XPCA 5F7BA 1J8VA 1G1CA 3VA7A 4XN7A 3DEZA 4UASA 4TKUB 1NU8A 1P6QA 3HL4A 1FCCA 1XF4B 1NFQA 421PA 1RQXA 2RI1A 2VRBA 1CZLA 3AUSA 1B0GB 4KJWD 2DYSB 2I07A 5JVDA 1BREA 1YS2X 3SWWA 1L7QA 1GKOA 3M86A 4XP5L 1V0JA 4AICA 1FIUA 1KU6A 2IA5A 2Z9BA 1CKEA 3CDGB 4P57B 3IKJA 4JBNA 2A9CA 1NW8A 5E1BA 3SO5A 4DUXA 3FYHA 3PGLA 3SYPA 3VD5A 2NCEA 1VGKB 2F7OA 4TUKH 1PL7A 2V7EA 4NRZB 2VW4A 3P0HA 1L5MA 3CRQA 5T33L 4QFMA 3BULA 1MWAB 4XMZA 1ECJA 8MHTA 1CT9A 4EP1A 3MJRA 3WQBA 2PMDA 4BUGA 4MZXA 1OX6A 1G21E 1FF9A 4XOAA 3PDIB 3L4JA 2O6LA 1NF3A 2W93A 1AV7A 1YMMA 3OG6B 3VI3A 5ARCA 3ZWXA 4X6CE 3GGOA 5HJ3B 2AN4A 3TXYA 2BDTA 5CAYB 5BZXA 1Q0XL 1QRKA 3VXKA 1J2EA 2I3AA 2HTKD 5IB1B 2EW8A 1LC3A 5J63A 3GNQA 2BY2A 2CNKA 3UMBA 1YY9C 5JUEL 5KAQF 2WWYA 4WV1C 1G0DA 4L27A 2FSVC 4A7TA 1E9OA 1GC1H 3V8NA 2ZG6A 4AUJA 4MNHA 3BF7A 4FXKC 4JRXD 3LUPA 2DAVA 4I9XA 4HUTA 2VLMD 3QAZB 4LE0A 4KPEC 4ZTZB 4MYRA 3T0WA 3K0BA 4CHGA 1MW8X 1WDTA 4C0BA 3I2FA 2CKBA 5A3QA 5CLFA 1F3LA 4OHXA 2GG1A 4DJTA 5LIPA 4P4TA 3VR4A 1MA3A 3C4QA 3DXAD 3HG2A 5C3TA 4G9DB 3IV6A 4D9GA 1QGDA 1H05A 5A6LA 3L3GB 1KEUA 3WLFA 1HQCA 5F2NA 1OAYL 5FHAH 3IVCA 3A4EA 4Y9GA 2NVUA 2ZJ8A 2WOBA 3TNNB 5HRCA 2NV2B 3QZWB 2RHBA 3ZT6A 3HSKA 5TQ0A 1GGCH 2NXCA 1OSYA 4HX2A 3RJQB 4XQGA 5IMKA 3AEXA 3AEKB 4I19A 1DQIA 3VXQB 4BKQA 3REVB 3HR7A 1YEFH 4YHLH 1ZQ1A 4I50F 1MFCH 4OFYA 5EBLB 1OGYA 3OZIA 2VDKB 1T5SA 4HH9A 3EXEB 3ICWA 4FLMA 1HSOA 2Q7XA 1F12A 4ZU6X 1UB6A 2H57A 4AKHA 5CDFA 3IJSB 1M42A 2DZEA 1J5OH 4GLRH 1EFLA 1T20A 4UNQA 4HEME 4IMIB 1KI6B 1X3LA 2X6RA 3WE6A 4B41A 3LQFA 1BN7A 3SDDD 4M87A 2CDAA 4PW9A 1WK0A 2BOVA 1J1IA 3OF3A 5KSYA 2V5UA 4HQOA 1F5NA 2VRCA 4RY0A 1NCBH 3DUSA 4HIXL 1XUOA 3BEWA 2CXHA 3T77B 1A69A 4OI8A 1HH6A 4NQDA 2WLMA 3LZFL 2OCYC 4LFBB 3F12B 1J06A 1T1IA 4MZDA 3U1VA 3SVLA 4PS1A 5KU1A 5KJ7E 4KHXH 2V37A 1MZVA 3V2GA 1JEAA 4MO2A 1MHCB 2DL9A 2TRSB 4F3TA 1OB1A 1BMFD 4X60A 4FT2A 5K3CA 1KBPA 1IMJA 4EGQA 3LS5H 4PJDA 2FMXA 1ECGA 3PXCX 1GPWB 4UDOA 1CDBA 3E1KA 3ZWQA 1S3KL 4M7LT 4UMDA 1W6UA 2YJGA 1AYRA 1QWNA 4BP8A 2KDGA 5TT0A 4G5FA 3CG8A 4Q9LA 5KZCB 4EUPH 1JZ5A 3MRKA 1GCOA 4AC9A 5D1XE 1V8BA 1PX3A 2QQFA 3WBFA 4Z4HA 3U36A 2IIVA 3U5TA 3PAZA 3V7FA 4U05A 2PLTA 1BU5A 4LDEB 3N55A 1JZDC 5GRUH 3B56A 4CN9A 1AD0B 1HNWB 1MCIA 4J94A 1SFDA 4DR1B 1PKOA 5CD3B 5ES4B 4P5KB 1BSIA 4Q15A 2Z4QB 3ZJ4A 2ESVE 4YH1A 3GWGA 1O96A 4C0JA 5KSBE 3D12B 2V9QA 3G49A 1YL6A 3DMDA 4LRXA 3TO2A 1LE5A 2VWGA 5KDLA 4BEVA 4YBLB 1SXJC 5GS3A 4H3SA 4B8ZA 4E15A 1LEHA 2A5LA 2OL3B 3FUEA 4JYBA 4DBLE 4JPQA 3V1NA 2P2CA 5GY7A 3QDJE 5IW1A 4EIUA 2B25A 3T6KA 3U61B 3LZQA 4Z5XA 3UOGA 5D5ME 2QQKH 5IBTL 2FFAA 3C08H 4E5XB 1H3WM 1J4AA 4F6CA 3GUUA 7FABL 1CY1A 4I50B 2EF1A 1KOJA 2AZTA 1FMLA 1G9TA 2ZSVA 4R6XA 4F7PB 1T5IA 4WHTB 3HYRA 3BGVA 4HAXA 4C2BA 3PNSA 2JIDA 1NDGA 2ZCHH 3BGFB 1VL2A 2QRVA 3E4DA 3F49S 2D1QA 1AG0A 1K5NA 2OC4A 2C94A 3KT6A 3PYLA 1GUZA 2WP8J 4OM7A 1I6KA 3P96A 2NSHA 3QJZA 3BAWA 4IDOA 2RHOA 5EXEA 1JPFB 5LBSL 4RFEA 1NM4A 3CWCA 4WZZA 1IC1A 4RKEA 4Y16B 2WFLA 2XKUA 2V3VA 1FU4A 1PEWA 3IRVA 1A7QH 3MRSA 4RUKA 4YRBA 4H1VA 3QJFB 4IXTA 4LZOA 2JIQA 4FSDA 3QEMA 1B8UA 1HCZA 4JSYA 4FFBB 3IP6A 4FCVA 1CUIA 3INGA 4EI9A 5TK4A 4F15C 3MJ9L 1HWGB 1Z5HA 3L7FB 3H19A 1TB4A 3A36A 1BQLL 2OHHA 3C97A 1M6OB 2EW2A 1ZOOA 2VJCA 4M1WA 1IDN1 2A73A 3SBOA 4GUDA 4FQ8A 4F6RA 1TVKA 4YTEA 2PT5A 3HB3B 4XB3A 2EUVA 2NY0B 3EVGA 2ZRJA 2I4OA 4GT7A 4Z49A 1OSZB 1J9EA 2FHPA 1HG0A 5B7NA 25C8H 2YR0A 5KIAA 1I8KA 1VCBC 2P48B 3C8HA 3KKQA 3D4NA 3D5OF 5FP0A 1YEJH 1CR2A 4QHNB 2W4MA 5HJEA 4RDIA 4L1BA 3AMLA 3DJ9A 5CLYA 4L5FE 4TTGA 1HTBA 4CU5A 3FOEC 4OMUA 3C2AH 3WJLA 4DOHE 2YFHA 4RFSA 1YUHA 2FX7H 1AVAA 5DZNA 4X80L 3ZGIA 2X6MA 3BT2L 5CILH 3G5LA 2AK1L 3G08B 2R1TB 4D8XA 5AW1B 1C0EA 5D71H 1HSAB 1PZBA 4OP3A 3G82C 1ZA2A 1ZM7A 1YEKL 4W8OA 2UZ0A 1HT3A 5EIIB 2A9AA 4FJ1A 1AKJD 1ADQH 3CSTA 3H4HA 1SUJA 4QPEA 4GBJA 1FL6B 2R48A 3VH8G 3D2AA 3H87A 1XCQB 3D6HA 4HZUB 1WS6A 2ZXCA 1TZMA 3OT5A 3ZQKA 1P5JA 1WZCA 3RVBA 1YH3A 2QROA 1FO0H 3GM8A 4ZPVB 5B7PA 2FNBA 1YEIL 4YXKL 2FCAA 1TXKA 3HDTA 1GLNA 1M0TA 4ZV4A 2VJAA 4ECNA 1XZAA 3KQSA 3U4MA 1ZTXH 4XM2A 2H4XA 4XXCA 1RKQA 2GK0B 1LMIA 4RYDA 4LRSB 3SYCA 1RRMA 5F21A 3E3OA 4LARH 1WMAA 2ATCA 3FUWA 3L3BA 2Q20A 5T3XH 3NGBB 1C5CH 4QPNA 2HLAA 1R5VA 1LBQA 1SXJD 5FX2A 1O9BA 2BI4A 3BGMA 1MNNA 2PYEA 1W80A 3EXAA 3LEYH 2XTLA 1W0JA 3NAMA 5EPMA 2MU1A 1GL6A 4J1UA 3EMDA 2BINA 2RHDA 4JUBA 1LRKA 1V1JA 1J21A 2E37A 4DN3H 4TT8A 4KH9A 1SEBA 1J49A 2YQBA 1U93B 4RACA 3GSNB 3NP7A 2R69L 3PXLA 1DDHB 4BWGA 2CGRL 5ESXA 3E61A 3TEJA 3T7JA 4JQIL 4JRXE 3NJKA 5T8KC 4PRYA 1I0ZA 4S1OA 2WIAA 1BXAA 5E2IA 2P5WD 3IXLA 3IJ9A 4K2AA 2V9RA 1QLJA 2AEPL 4LEEA 2QZ4A 4G4JA 1D7FA 2P7TA 5E1GA 3DXAE 4X83A 3F46A 4GS7C 1ULTA 4B87A 1JA0A 1EIWA 5BUQA 4NU5A 1R46A 2Z6QA 4XWGL 4NE7A 3DKHA 4LZKA 1RZUA 1K6MA 4MJID 4YA6A 1OALA 2GX6A 3ZW8A 4IJUA 1R8JA 4R0MA 4P23A 1O5PA 4O02H 3APCA 4PS0A 5ER9A 2IBTA 4KEAA 4GIOA 2QVIA 4C7KA 1SB9A 4P46A 4J28A 3G8AA 4E5PA 2W2QA 1Z36A 2G30A 1LXMA 1ATZA 1K5PA 1SHTX 4U7GA 2YD4A 4EJ2A 4GB9A 1UWFA 2JKRM 2VSMB 4PSKA 4WK4B 3JQAD 1Y8RB 2ZB2A 1QKKA 1DCFA 4W9HC 4XFKA 1R0RE 3ZDAA 4KE6A 3T9DA 5EIEA 2GJ6D 1PVHA 4NC0B 5IKOA 5G41A 2NUBA 2Z7WA 3AERA 4LVHB 2BY3A 1HHGA 1Z18A 1NE2A 3KKKA 1F4WH 1CR9L 1NQAO 5IAGA 5IW3A 1XMQB 3CFEA 4KBGA 4N41A 1M2VA 5JS6A 4E1BA 1LDPL 4JMLA 4V0MA 1VCAA 4FADA 1G6VK 3P1JA 4I4TF 3ZOZA 4E9WA 3MLZL 2IYNA 4W81A 3N2GB 1KMMA 1J8MF 1ACZA 3PQ4A 4NICA 4EKNB 2ONJA 2V5SA 3N39C 1RHHA 2H6EA 2ORED 4YOKA 3ATDA 3TLBA 1SF3A 3M89A 2UWEA 2BFVH 2C1ZA 2QL6A 1UPXA 1LGVA 5E08L 2D8KA 4E5MA 1OE1A 5J6HB 2FPRA 1Q9WA 1DJNA 3E8UH 1K8YB 1HBJA 4IDJL 4LGRB 3BUTA 3VNYA 4GXVH 3JV6B 1Z9MA 5IYZA 2WG1A 3TECE 4UQLA 1GJIA 1NDHA 3QFJD 2X2YA 1Y6KR 5IFJB 2ZR0A 3GU3A 3HU1A 3LZDA 1NGZA 3H6KA 2CL5A 2OD7A 3OOHA 5DPMA 4LZAA 3W7AA 1DUYA 4PLFA 2HSWA 2CXGA 5JO9A 3TZQA 2HSEA 1YACA 2VSKB 4NTZA 2WAYA 4WT7A 4GBXA 5DRWA 5ESAA 1V3JA 3FYEB 1XXHE 1O6VA 2AW5A 3MOAL 2BSEA 1IXSB 1N9GB 3BZ5A 1UPBA 1C8QA 4EBQL 4AJPA 2NW2B 3VOBA 4YSUA 3FAKA 2A4ZA 3APDA 3CC8A 5I23A 5EOVA 5LXGL 1S78C 1T4CA 5DM1A 4BX3A 3EYUH 4OD2A 2ZKXA 3TS8A 4BEIA 1QLRA 3DAGA 4M7PA 2DQGL 3VUFA 4RMJA 2F3PA 3EJSA 2ZRKA 4HH0A 4QTIH 5ED4A 1Y6ZA 2ZWMA 3FXAA 1LEKA 5L53A 4LSQH 4YHIB 2BF7A 1X8LA 4I4WA 1U3JA 3ILPB 2Z0BA 4R4BB 3KYCA 1WXXA 4GI2A 2JFXA 1T9HA 5KOJA 2Y22A 4ZO6A 3EIEA 3LSOA 3IDGA 1H19A 1ZJBA 3QC5X 4PJIB 1QCYA 3AFIA 4MI3A 2YYAA 2E86A 3ONVA 4L37A 4Q47A 3DPSA 4IFTA 1I1AC 4YDNA 2VF2A 3UJIL 2GJAA 1BF2A 4RPCA 3NA9L 3VTZA 4DDHA 1BQHA 5IH3A 4WRLA 2N0KA 4L3VA 4QVKA 4UBKA 4KPFC 1ZT1A 4GAJH 4FBMA 1BGVA 5ADUS 3QHFL 4KJQC 4O2LA 3IS3A 3S4SB 5J2TF 4YO0A 2QR5A 2X05A 5D72L 3CQFA 5BZWA 3L4TA 3EISA 1UQSB 2GEJA 3EYVB 3ZBMA 3MXVL 4G81A 3UYKA 1NC2A 2DSNA 1WUJS 4FZ8L 3L7JA 1YZUA 2XZAL 3PU7A 4M1MA 5D7KD 5KO2A 3NV7A 2J41A 2ZKHL 5JHGB 1NXPA 3NBQA 1MJHA 1BZEA 2EP8A 3ILYA 4Y3UA 5EN2B 1JBKA 4PJ7A 1S9VA 4YAJA 1FSFA 2F61A 3B12A 3KBOA 4PJ9A 3FRPB 3FTUA 5LXTA 3M6IA 1JKMA 1ONSA 5DM2A 5E1OA 1NBYA 3RZCB 2HRHA 4UQ2A 4EZLA 1BRTA 1G5QA 3UWOA 1A7UA 3DSNB 2GJRA 4A7QA 2V8MA 2QI9C 4N3CA 1S5HA 3QEQD 1B0AA 4ZTBA 4R05A 1MC4A 3O8OA 2QGNA 4DM7A 1XZLA 4CKYA 4TTVA 3GBVA 4R1UA 4DTGL 2QM7A 4J8QA 2E6UX 3K0AA 4BSJA 1X7QB 1MCPH 1PYWB 5D3MA 1ZRNA 1JG1A 1ISPA 3IETB 4HN9A 4NCAA 2GW5A 2CKBL 2CD7A 3CEJA 3QQ3A 1YA5A 5TR9A 1LUAA 4R5TA 1KBVA 2WICA 3SZOA 3D0VB 3VDAA 4YACA 2ECKA 4IJQA 3G5ZA 3T0XA 4ZT2A 4JANB 1YDWA 3X13B 5DT1L 2YZ8A 3WL9B 3PCTA 3B20A 4GKKB 1S78D 3CIAA 4NU6A 5TQ0L 4QOIA 3UZUA 3ELUA 1GPDG 2E87A 1J09A 3L93A 4AJNA 4YN3A 1ZMBA 1SOMA 3RUIA 4OCLC 4PGEA 3LX4A 2F1OA 1DX6A 4WNYA 4QRDA 2VH5H 3ETGA 2ILTA 5DYFA 2M98A 2VF7A 1SXJE 4HADA 4GIPD 1Y89A 2FG5A 4K94L 3FSAA 1E1DA 1NAMB 1I24A 4KCGA 1PTZA 1DHKA 1A2QA 1OGJA 3DLAA 3UICA 3SCMA 1W72A 4DM4A 1BNCA 3MTDA 4UJ3A 4N86A 2RONA 3BH0A 3DIVA 1FNCA 4PVDA 3BM5A 1RTKA 1CUSA 4OSEA 4G8DA 2GTQA 1YOVA 4I1NB 2C54A 3P9CA 1GVIA 5F1NB 1B3RA 2F43A 2G9VA 1I1AD 3UC5A 4RESB 3G2HA 5D2NA 3JYNA 3O8BA 1JILA 3IPFA 2J33A 2HLFC 4CBPA 1QS0B 4RF3A 2C3PA 5EERA 3ZL4L 3TLAA 3NAGA 2P5WE 2WHYA 1M1NA 3VYRB 3LUBA 1JZ7A 3TEZA 5JYMA 3D2UB 1F2TA 1FQWA 4KJQD 2JLPA 4W68A 4HIJA 1EO5A 1P4SA 4KZDH 1YQEA 4WTZG 5IK3B 3NFNA 2J59A 4WXMA 4FP8L 5BO1L 1RC8A 2LLLA 1R47A 4MJIE 1WWAX 4FFTA 3IU3A 1KVQA 5GRXG 4KVCH 3O8QA 5DX0A 4ZUVB 4H8WH 5KVEL 1HEUA 1DVXA 4RMUA 3TLRA 4RVOA 2D59A 3HYLA 1LV7A 2UYGA 2WLHA 2XTZA 5IT5A 4X4MA 3WRVA 1T9AA 2WUEA 2G7ZA 1M2WA 4QTUB 1J9CT 4D3CL 2W6OA 5DJCA 4W99A 5I18L 3FNHA 3FSJX 4B9YA 4PJ8A 3IUJA 2VDRL 1SGWA 1YR9A 3TOXA 2QLNA 4RTMA 3MFFB 4YK4B 2H0AA 4BAUA 2DMCA 1QP0A 4J0HA 4YMVA 2A7QA 3ML9A 3KUKA 3V9AA 2GJ6E 5FS5A 3IMUA 5EF3A 3WYGA 4DMHA 4EA9A 4X85A 1A9BB 1LDSA 5CCKL 2VK8A 1YE5A 4OSOA 3S2YA 3TEFA 4JDZA 4PTZA 3TVMB 4NNXA 4MQEA 2SCUB 4JO4H 2YUZA 2DKOA 2YGOA 4MQBA 1RWQA 2PCPA 2J2ZA 4XNBA 1A4AA 1TCBA 3OPYI 2YCLA 3L7BA 2GAIA 1KIMA 4AUKA 4XODA 2GBIA 4MVJF 1XGYL 3O3AB 5KG9B 4RYLA 3IAHA 1MOSA 2IF2A 3DQZA 1ESEA 5G1NA 5BW8A 3NA4A 4YUYA 5CX1B 4ZAKB 1PY9A 5JFTA 5C2BL 3DMNA 5HGXA 1T4KB 4CEJB 2GUOA 5A7FA 2X13A 4NS1A 1BIIB 5C0JA 1V5EA 4YGYA 4IF4A 4L15A 4HLQB 2NW3B 5LHDA 1CGSL 4M0CA 2YNMA 3NGLA 2C3WA 4O2CB 4R9NA 1A02N 2IUEA 4Z7OE 2JV6A 3QFJE 5C4GB 5LQNA 4Q6YA 4WXEA 5BXFA 2Q3DA 3MQFA 4MTMA 3T52A 3BAXA 3I6BA 3ABIA 2CDFA 4OXIA 1G9NL 1C16B 1R3HB 1VPOL 2HBZA 2VDLL 4D0BA 4PSVA 2XI4A 5E4JA 5FGCE 4OHFA 4RFNC 4XPHL 1PLJA 1JGLL 1I3KA 5HMLA 4P5EA 3ONFA 3ZGOA 1XZJA 4KKBC 4UDUB 4HRAA 4TN5A 5EC1B 2BBSA 3MOBH 3D0LB 1Q91A 1U92A 4UU1A 2GKSA 1YYLL 2BVQA 3BI9X 3ANYB 4QUDA 2WCSA 1P7BA 2J9FB 1Z7EA 5DD3H 1MQ8A 4GX2A 1I8IB 1E4XL 5BZZA 4XZ3A 2XOXA 2AJVH 1M1SA 3VGBA 2FN8A 5TK2A 2HMWA 3ZGNA 1KJ3L 4QLWA 1GGHA 2BM8A 4PC7A 4WQOA 3P40A 3BIXA 2VJLA 3PYXA 4WESA 2H1XA 2HLFD 1TJNA 3D6MA 4ABWA 1MUJA 4CC4C 2CCLA 5HKKA 1WT5A 5MP6H 4FLOA 3DZCA