3UOAB

Crystal structure of the malt1 paracaspase (p21 form)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
378
structure length
364
Chain Sequence
MLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the mucosa-associated lymphoid tissue lymphoma translocation 1 (MALT1) paracaspase region.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
total genus 100
structure length 364
sequence length 378
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00656 Peptidase_C14 Caspase domain
B PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uoaB02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uoaB01
5IASA 3R7SA 3DEIA 4FEAA 1CP3A 1QTNA 2HBRA 4ZVQA 2QLFA 5IARA 4DCOA 2CNKA 3P45A 2Y1LA 4ZVRA 4QULA 4ZVPA 4QU9A 3K7EA 5LU9A 4AW9A 3DEHA 3ITNA 3SIRA 3D6FA 3D6MA 3H1PA 4FGUA 4HVAA 4M9RA 2QLBA 4ZVOA 4EHNA 3GJQA 2XYGA 1KMCA 5H0IA 4NOMA 4QTXA 1SHLA 4NBNA 4AWBA 3S8EA 2FQQA 4I1RA 3EDRA 3KJFA 5I9BA 3NKFA 2AR9A 4NOJA 2CDRA 5LUAA 1JXQA 1SHJA 3UOAB 5LU8A 4ZVUA 2QL5A 1NMQA 1IBCA 3KJQA 4IEFB 3IBCA 2H4YA 1I4EB 1RE1A 4PRYA 5IAGA 2C1EA 4QUJA 2P2CA 4IYRA 4QUHA 3V55A 4DCJA 4QU0A 2H48A 4QUBA 2CNNA 2WDPA 4PS1A 3E4CA 3EDQA 1PYOA 2QL7A 4JQZA 3RJMA 1K88A 1ICEA 5IC4A 3GJTA 2J33A 2H5JA 2J31A 2H5IA 1PAUA 4N5DA 1NMEA 4QUGA 2XZDA 5IBCA 2DKOA 4N6NA 4ZVSA 1F9EA 2HBZA 3H0EA 4JJEA 5JFTA 1RWOA 3R6LA 1M72A 4EJFA 3S70A 5IANA 1I51A 3DEJA 4QUEA 4FDLA 2C2KA 3PCXA 4LSZA 1RHJA 3GJRA 4EHAA 2H4WA 5IAEA 3NR2A 5IAKA 4JB8A 3IBFA 2XYHA 2CJYA 4JR2A 3SIPA 2C2OA 5IAJA 4D3ZA 5I9TA 1SC4A 1RHMA 2HBYA 4FXOA 4I1PA 1RHQA 2H54A 1I3OA 1SC1A 2QL9A 1NW9B 2XYPA 3QNWA 3R6GA 5IBRA 2J30A 1RWNA 3DEKA 3R7NA 4EHHA 4PRZA 4DCPA 3R5JA 4HQRA 1RWXA 1RHUA 4JJ8A 3PD1A 2H65A 4D3YA 1I4OA 4NBLA 4JQYA 1GFWA 4EHFA 1RWMA 4ZVTA 5IC6A 2C2ZA 3V3KA 1CVRA 4QUDA 2J32A 1RWPA 3BIJA 3R7BA 3V4LA 3V4OA 2QLJA 1K86A 1NMSA 2CJXA 4JJ7A 1RWVA 2CNLA 1RWWA 1QX3A 2FUNB 3H11B 3PD0A 3R5KA 4HQ0A 4QTYA 2NN3C 5IABA 2K7ZA 3GJSA 3UO8B 4N6GA 4EHLA 4QU5A 2FP3A 4JR1A 3P4UA 3V6MA 4EHDA 5K20A 1F1JA 2Y0BA 1BMQA 5IBPA 4NOKA 4QUIA 1RHKA 4EHKA 2XZTA 1SC3A 3H13A 3NS7A 3OD5A 4JR0A 4NBKA 5LUBA 1GQFA 3V6LA 4PS0A 1RWKA 2CNOA 2C2MA 4N7MA 4N6OA 3KJNA 4NOLA 4AWAA 1RHRA 4QU8A 3H11A 2H51A 3D6HA 1QDUA 2HBQA 4D3XA 4N7JA 4QUAA
chains in the Genus database with same CATH superfamily
1J8SA 4ZO6A 4UW9A 5EU6A 1OYVA 3DEIA 1JYNA 4N3BA 3VR4H 2FKNA 1KH3A 4F1KA 4ZUUB 1KXZA 1V7CA 4IG4A 3MV9B 5A3VA 3EBGA 2DPYA 3PUCA 2JK5A 4X97A 3DUFA 1XJQA 4GT1A 3O6LL 1QF6A 1UEMA 2J20A 1AZBA 2FZEA 5DUML 4ZT5A 4AO6A 3HVJA 4TV8A 3AJ9A 1IOWA 3CMGA 2II6A 3AKYA 4A8JA 4UQ9A 1OH5A 2PJZA 1Q22A 4JS7A 5D7IA 3HHEA 2F53E 3B3BA 4UILH 4WFHE 4JYBA 4NAUA 3NFPB 1I33A 5IYZB 5PGMA 2DLNA 1TCBA 4RH1A 4F5EA 3DZIA 5ESXA 4RU1A 3INNA 3GJRA 4OHWA 1DTWA 1ZI6A 5B1DA 3NP9A 4OQDA 5GHWL 4OJYA 4MTMA 2V7GA 4FCVA 6PAZA 4GICA 4CGYA 1PVHA 3C5WP 3LPCA 2EX0A 4RLHA 4EHHA 4G11A 2K70A 1NLBH 3AF1A 5DZNA 1F2TB 2NZWA 4WXHA 1OTTD 1ZJWA 3H7LA 2QTFA 2WMNB 3WGHA 1E43A 1JHKH 3WGUB 4LISA 3X3FH 3ULVC 3ZCSA 4PTTB 1F3DH 1C3JA 3KE0A 4K3EH 1GSAA 5D86A 3B2VH 3QNXB 5EZ6B 3X11B 4KNYA 3VSQA 3WNQA 4OMCA 4AQ8C 4PBWD 2J0EA 2QRKA 3QU5A 3QVJA 4L5FH 3OCJA 2JWYA 2VC2B 1ZC4A 3G08B 5JO5A 2E9SA 4OIBA 1QR1B 2O5ZL 4M6ML 2NR6C 4AROA 3ETLA 2AR0A 1HILA 1E28A 3D3VD 3LH9A 4GBXD 4MA3A 5ICYB 4LVOB 5T1LB 4HIPA 3I4CA 4D4MA 3D85A 2Y9PB 1BOOA 4DL9A 1V7MH 2IYRA 4KK4A 4LKCA 1MCSA 3CHQA 2JCXA 3SY0B 2QL5A 4KPUA 4TQUS 3T06B 3F6PA 3VPAA 4BU0A 5BYJA 5HGXA 5CTAA 3GAAA 2GHQA 3SC2B 2QN6A 2R0WH 1JQAA 1CZKA 3CCHB 2VZTA 2EIBA 2A0KA 4QYWA 1PR6A 1FFEA 3RU9A 2P9CA 3OJWA 2XJ9A 4CMEA 2ZOKA 4F85A 5B7PA 4TZ6A 3ZUGA 1UCFA 2FA9A 5GY7A 3S37X 4OOEA 3C3KA 5JDJA 3CKYA 2P80A 4ZJZA 3TIDA 5EUBA 4Z5RA 1XTBA 2C9MA 1JJBA 1HOEA 1U1FA 5IT9A 2YXBA 5GZNA 2O2GA 3EYAA 4QWWC 2H65A 3Q6GH 2VDOB 1OCRB 4BNXA 5JOFB 5K8VA 4QHLA 1KJNA 2IS1A 2R5WA 1I7SB 4MUMA 5A4JA 5IK2A 3QFFA 5EHGA 3MYJA 4G8EB 5BRAA 1EFPA 1NDQA 5ADPH 221PA 3CX4A 4HXYA 3VMFA 2XVXA 4R1TA 2C77A 3ZD6A 3DAPA 4OZGA 3DUFB 4BZQA 5C5EA 2WMPB 2JVUA 2A9DA 5C70A 5JXGA 1J0JA 4LL9A 1OTSC 1C9MA 4DWHA 3PWPE 2ZRHA 4A0RA 4ESHA 3JWIA 4YOKA 4LY3A 2I9TA 3WL3A 2I54A 5K7SA 2HU2A 5IAGA 2NZ9C 1NX6A 3Q88A 4GIAA 3W1EA 4NCNA 4MWDA 5F52A 3QPWA 1M5RA 4MHHG 1OP9A 4GYKA 3SCZA 1IN6A 4LSUH 1SF5A 2I4IA 2V17H 1R5NA 5TY0A 1VYHA 3D64A 1TJIL 2QRUA 1AUXA 1KFEB 4MZ2A 3SDXF 4AMUA 4IHOB 3VWJA 5GIOE 1CUAA 1VI5A 3II1A 1N5MA 1A9EA 3E27A 4YWGH 1XB6A 1X4YA 3V2AR 4YMLA 4XOBA 4YAGA 1BOGA 4GW5A 3N0XA 1UBMS 1RZQA 2YWHA 1OIVA 1RJCA 1TF4A 4KJPD 3Q3VA 1J9CT 1NVGA 5AW6B 1BD4A 4NFYA 4G70B 3C5HA 3CKMA 1YR1A 1WABA 3OZBA 5E8OB 4LXUA 4KWIA 1CD0A 4BZWA 3GMPA 1Z5UA 3IB4A 2RFXA 5ALYA 2GUGA 5LJIA 5EU4A 2YAPA 4WO0A 3DOCA 3MV8E 5LXVA 4RSYA 5DS8A 3AFNA 4J1SA 3OWOA 1YUKB 4WFHD 7PCYA 4MA3B 3LPLA 2Z93A 4KR9A 3GXNA 3OPXA 3O1LA 3VXOA 5ULLA 2Y0PA 1MO2A 4HXBH 1W5FA 2CGRL 5I6PA 1K63A 3IMWA 1KTJA 5IN4A 1JLLA 4ZOQI 2J4WL 5SWZB 2I8AA 3DE2X 1M7DB 4ZRMA 5ALPA 1TTUA 1RYYA 2IYQA 1NBCA 4FTVE 3WXWL 1T0PA 4JBGA 4W9GC 3Q1KA 1CYWA 1ZGLA 3ZUCA 1THGA 4AI6A 1YC8A 3DBXB 4MDJB 1BQLL 3V4FA 1N6HA 3HC4H 2P52A 2GJKA 5DK3A 1D7CA 3V5DA 3KDMA 3HE6C 3D6AA 3DAYA 4YHML 2KERA 1WE2A 4OB6A 1CI3M 3GSQA 2BIIA 1F3OA 3EYWA 2FNWA 5KAQG 1CCZA 3CW9A 2O8VA 2CVPA 4G5GA 1EK3A 2P46B 1NUUA 1OLUB 2R1XA 1RZKC 1M8FA 1NBWB 3P9WB 1Q1JH 4TTAA 1JJAA 4B74A 5A7HA 4ZARA 3BCSA 2NY7L 3GCZA 2AKRB 4OX9B 4M6MH 4OLUL 1IBGL 4H6VA 4LSWA 3GA0A 4BV9A 4QXRA 1N3LA 1PHPA 4Q1CA 2AT1A 5TPWB 3FQUB 3LPNA 4WI6A 5ESAB 3WO0A 4UILL 2B3IA 3ZHZA 1W2KT 2QQ0A 2G1PA 2EDYA 1HV8A 3O91A 4PZPA 4EAEA 1PS3A 2Y3IA 3O84A 4Q3NA 3DT8A 3EMBA 5JC8A 4HCRL 3PWPB 2A83B 2XWJI 3GSUA 2JIXB 4WJKB 4JFHD 1K7EB 1KGXA 4FR0A 3MBIA 4LNUA 4LVHC 2X0KA 3VR4A 1UOEA 5JFOA 4JPIB 1V26A 2OXGA 2FXVA 4OIMA 4OHVA 4F7CB 3JAMA 5F8RC 2NY1B 3VX1A 4LCCA 2X0NA 1QP7A 4GXVL 1MJ7H 4G9EA 1HHIB 9LDTA 3UKOA 1CERA 1F6BA 3VAAA 5KBYA 4QJ5B 3VKFA 4LQLA 1R12A 5A4AA 5JPMA 4PWGA 4RBPH 3I50L 1C7FA 2WLMA 2OMZB 3K81A 4NQDA 1EB9A 5D6DA 2YV3A 1SO8A 4B6GA 3MRHB 3TFKC 1S2MA 3MAGA 1UOLA 2PWBA 3ZGXA 1TCCA 1QNLA 5EJ5A 3EOAA 3G04B 4NPJA 1D6EA 2G88A 2J30A 1CGTA 1A77A 1IGJA 5DHRA 3QWQB 2EE2A 15C8L 2DS4A 3KTFA 3B2XA 3UGKA 4RKQA 1KBZA 5H37A 1B0GA 4YIHA 1HE7A 3ZTNH 1U4EA 1RR6A 1SEQH 2ZVPX 1DFIA 4KMTH 2HWWA 1TM7E 3RU7A 3KW8A 5I8PA 3U6XS 2O3TA 1JXAA 4EF6A 2C78A 1RACA 4NJAL 3QW4B 2D7TH 1HXHA 2NO9A 4B7AA 1BQHG 3WBJA 4PV9B 3VUEA 1PJZA 1G84A 3TO4D 1KEMH 4BKUA 5HX7A 3I30X 1SOAA 1ID1A 5IZCA 5JU6A 2D9CA 4DK3A 8FABB 3D6FA 1RQLA 4YCDA 2OSXA 2CA3A 2IANB 1XTUA 4WJLA 5D1ZB 5AVOA 4X8XA 2RKBA 1F4YL 1V5EA 1N6QH 3JYNA 3ZWDA 1SXJA 4NXNB 1YBAA 4CDMA 3U4HA 1CU4H 3EJQA 2IW3A 3OKDB 4H0HB 1IATA 1OPRA 3KW7A 3L3IB 4Y0GA 2UVDA 1O7SA 4A6XA 3NZUA 4OLWH 3INYA 5H9VA 4WKXA 3B7TA 3QIBB 4EB0A 3QPQD 5DW3A 1INDH 3S36H 4YACA 3QUMH 4CMEC 4L2IA 3TW8B 1IFXA 4OF0A 3UG5A 2K7PA 3ZXUB 3E7JA 5LN8A 4XW2A 2NU9B 5F7OA 5D7JA 4ZICA 4LGCA 2G75B 4UVEA 2YJLA 2WJ6A 2AZXA 1BF2A 1TKCA 3L7CA 3E9DA 2UZ1A 2RC5A 3VXOB 2PIAA 2WAAA 4MRBA 1CFNA 4PN6A 4CM8B 2P5YA 4RTKA 3EQ8A 5EE1A 1FPQA 1R37A 3LT1A 3RH0A 1QRNB 2KZKA 4TV8B 5GJSH 1VKHA 4G1EB 4OZHE 1PBYA 4URKA 3E9ZA 2JJMA 3U0VA 1F12A 2VPQA 3CXDL 2DQHL 5I5GA 3K0AB 3QPXL 3SLKA 4EBQL 2WB2A 1QHQA 4R26L 1NL3A 2Q8NA 2OMKA 1FL5A 2XQBL 4FZVA 3I2CH 1A3LH 2ZAMA 4ESVA 2P26A 1NQWA 1K7XB 1PQUA 2BSXA 3THWA 1DVTA 3MV7E 2HTKD 2WA2A 3ORHA 1GFZA 3VNAA 2XMCA 2C7QA 2QADD 1EDEA 3OKMB 1J07A 4H7JA 1V37A 1NANH 3SCMC 1ZJZA 1H94A 4DW2L 1VPLA 1TENA 4NJMA 2XUIA 2L04A 3ZGNA 3LCCA 1CTQA 5E94B 1KBOA 4RGNE 5CBKA 1UODA 3FX2A 4XC1H 4NKMB 1JA9A 2GBAA 3DZ8A 3U25A 3L1KA 2VRBA 1AO7A 2COQA 3B6IA 1J7JA 4PJXB 3FLBA 1ZJAA 4B95C 3K1YA 1W47A 3N9GL 2IP2A 5EP1A 4PW4A 1I3OA 1NW5A 1SZCA 2NXYD 1G2QA 2NY2C 5BURA 1PLAA 1UXIA 2C3YA 4P06A 5GRJH 2N7BA 3WTVA 2O14A 1C14A 2IF7A 1IGCH 3DHYA 2F1JA 3MV9A 2IZOA 3QDGA 5I4KA 3HC4L 5CCEA 1EM8B 3E82A 2VAJA 2ZBEA 4Y5XA 2JLXA 1PP4A 4J3OD 5D1NA 3E7DA 2YHIA 1W9HA 3IELA 1CQYA 4PJCE 3RSFA 5HSGA 2QX7A 4LMAA 2XKAA 2EO9A 4LLQB 4O1IA 3ZTDC 1FZQA 3WNDA 2GUWA 1KNOB 4UV4L 3ZE2E 1X2EA 1YRHA 1KBWA 5E0QA 4XN8A 3HS8A 1XROA 3LFTA 4HN2A 2B3TA 2P4UA 4N5HX 1W91A 4CKQA 2VBFA 1MDBA 1E2MA 1E5ZA 2IGFL 4J9UE 2L69A 3IP6A 4UUJA 4S1PA 1PJ4A 5JAIA 4WWID 5KVDL 3P73B 3ALPA 1ONBA 4A7VA 2BP3A 4DN4L 4P35A 1UT9A 5I71B 1NXWA 4F12A 1BD2B 3WGVB 5E6SB 4K8RB 1JFTA 1CJCA 3OO0A 1ASOA 1U95A 4UOW0 2X1PA 4C76A 3ONFA 5FF9A 4HMDA 3BCRA 4PC2A 4QOHA 3OIFA 1TTGA 3KDPB 4JVLA 2QT1A 4V1CI 1PJWA 5BRPA 2W6JA 1JS4A 2AE2A 3OIYA 5ALWA 5KJEA 5JW4Q 3GSUB 1UH5A 1EFAA 1GTSA 1UWXK 2WD0A 1ZCBA 2WVJA 3H5TA 1FFQA 3N70A 5AVUA 3I75A 4ZN6A 3F7MA 3KOMA 4NBZB 3EFOA 3GOHA 3VYSB 3ROFA 4CKYA 2QPUA 4LLVA 3V4OA 1CE8B 1PSZA 2J5LB 3U1TA 4ICXA 4JZOB 3JALA 4LVCA 4P07A 1SEBB 4KC0A 2BP8A 4IGBC 4HWUA 2HXYA 1MJNA 4BFSA 1XJWA 1RKRA 4YEDA 1NN1A 3MA9L 4BZZA 4D6XA 4GYYA 4DCQB 2Y27A 1PLJA 4GO1A 4E2ZA 1F97A 3MYYA 4AV4A 2F74A 2QF7A 4MWGA 3ZX5A 3CUWA 2QE6A 3H7AA 3WLTA 3VZRA 3QWOA 7CGTA 4PJGF 1YE8A 1UFRA 2MJLA 1XCQA 3JYHA 1DO2A 1KELL 2BOCA 3KE8A 2QOEA 1P1HA 3OQPA 1SG6A 4AWBA 5H4GA 2PMBA 5IUKC 2UYCA 5HMLA 1H5BA 2DFKB 3KPNB 4XSGA 1NGXB 1KTRL 1A8HA 3MV01 2ZIFA 4F2MA 4U2BA 1V9LA 2PO6D 3EXG2 3F6CA 4HDAA 2C9PA 5DYFA 3I2JA 3A37A 4TWRA 1ERNA 2R29A 1NC4B 5JLAA 3S4YA 3SJBA 1E28B 3WLEA 3EPHA 4WUKL 5F0LB 3GLUA 4B7IA 3AYXB 4DQXA 4EPWA 1PU0A 4QTIL 2QZ9A 1G7JB 3WTUA 4UV7L 1T36B 3QU7A 3L45A 1NOFA 4NBUA 4XM1A 3OKLA 1VJ1A 2LUOA 4GQIA 3DFMA 4A16A 4GKZB 5IKCB 1I7TA 4A03A 3D6VA 3E9QA 3MLVL 1V2HE 2KMWA 1DQZA 1PYGA 1G8AA 3TS1A 4JY4B 1X1SA 4UWQB 2E21A 6NULA 2E8ZA 4N2KA 1BCRB 4KAAA 3FK3A 1NOAA 2CMDA 3OZLA 4W5TA 1A6TA 4ZX4A 3DXFA 1JBEA 1F58H 3NHMA 1AGFA 2WXIA 3AY3A 4U6NA 1Y5LA 4PRKA 1NFIA 2HMID 5AW5B 2XMDA 5IQ7H 1HCVA 2O07A 4MHSA 1G20E 3JRWA 1HSOA 3CF2A 1JILA 4YCLA 3QA3E 4TUYA 3D2UA 3B3FA 4U3JB 3UJAA 3U9LA 2E1RA 3V10A 3JASB 4FCCA 3M5DA 5EZYA 3DARA 1MAVA 1ZK2A 1VFAA 2FEEL 3EIWA 1P8AA 2AK3A 1J2RA 4UQOA 2E9WA 1UD5A 1UP4A 3O83A 4GXQA 4WCYL 1XIWD 3ZL4L 4Q3EA 4RFNB 2ICAA 4CKEA 4BATA 1LXCA 4LGVA 3V0HA 5F78A 4E9RA 3DGGA 4WKOA 3WHE1 3QUHA 5B8CA 4FXGA 1NY6A 3IU3B 1WWBX 4HEPG 1KEGH 5AZEH 2FEPA 3IMEA 3LUKA 2WSKA 4Y19E 5C0CE 1TO4A 2ZSIA 1RHHA 1K9SA 1GGIL 2AEIT 4B3BA 4DDHA 4LMQE 1IXYA 4I0PC 3V7MA 4ENSA 2CA4A 4XC1L 1OR8A 3F0TA 4KXAA 2OCLA 2OECA 3ZMNA 3K2KA 5HHQA 3KL4A 5EIIG 1H15B 3JQ7B 1I6LA 3DLHA 1DQQA 3KR3H 4HU8A 3DG9A 3BPOB 1MJFA 5HDBE 5D7KE 4BE4A 2B9VA 5BSFA 5C08D 4O4YL 3T2PA 4OAQA 4JN2B 2QGEA 4B2IA 4FOLA 4B9JA 3FUJA 3FRJA 2RGUA 3SP1A 3T7SA 2YMMA 2PL5A 4XQCA 3R5XA 4ITUA 1D6EB 1F0YA 3II6X 4FDAA 3AREB 1Q0LA 2YZGA 3VXMD 4WFED 2XWPA 4EEEA 4WGFA 5DK2A 5AKEA 4GUOA 4BVEA 2CNNA 2EQAA 1J8HA 3AB0B 4LVEA 1PJ9A 4LF8B 3TYGL 2WYWA 1SVWA 3RUFA 1OD6A 1CK0L 5TDPB 1T5TA 2J5KA 1OOWA 3THML 4CM9A 4PIPA 3HXLA 4JZOA 3JALB 4U2DA 3J81A 2OX5B 5AVSB 1AXSA 2NXJA 2FWPA 1CF1A 1KK3A 3NR2A 4YAQA 3B1UA 1FYFA 4QHTA 5K3EA 2IL1A 2WMOB 5JZ9A 1DJOA 5I48A 1N8ZB 4YQXH 5JR1L 1QCYA 4KQKA 4OBRA 1Z2OX 2YRZA 1FOEB 3NO4A 4I5BB 3EPPA 3S27A 4J1QA 1TUPA 4J8RB 2VK8A 3EZXA 3JQGB 1AKMA 2W1NA 4G5FA 4C7JA 1KF0A 3GMQA 3UTQB 3RVXD 1RWWA 1NAMH 1YCSA 3H11B 4KBFA 4ZX5A 4M0MA 3E9NA 3K0KA 1QSZA 4FJ2A 2WZAA 3OTGA 2BUBA 4BZYA 5K20A 5IJAA 4RIEA 5EBMA 4U0JA 1EFLA 5EGNA 1U81A 2QQ5A 1BX3A 4IIGA 1ZD3A 3NG1A 1M6YA 4ZMLA 1HORA 4YRBA 1V8OA 4CQLB 2GYVA 1MC5A 1TD9A 1IGFL 3CH6A 3WDKA 2G36A 4WHTA 5C07A 1XGQA 2IDFA 4EN3D 2NUTB 3EJ6A 3I45A 2GESA 4BLVA 1F38A 2D7PA 4OZFH 4R2JA 4FE3A 2R6CA 4C0WA 5FRDA 2QEJA 4ZMNA 1JEDA 3IBCA 4WXPA 2XCSB 2XEDA 4M1QA 1SNYA 3MV7B 1LD9A 5IW1B 4YDVA 3RV3A 2GJ9A 1HZLA 3ARGB 2WHRA 4M62H 4TNVK 1VQ1A 5CH3A 5FYJD 5JWRA 4CVXA 1PZEA 2GSIA 2QPFA 1AXEA 2YJ6A 1E3WB 1DDIA 4BHUA 4MRCA 4XAQA 2RGXA 1LDMA 1RZRA 1ZM4A 3C2AL 1X7QA 1DN0B 4IV8A 3GEDA 3I0ZA 2WO3B 2AR7A 2VZLA 4QAJA 5FB3A 4FJ6A 3WLJA 4Y9SA 1EH5A 4H0FA 1IKNC 4RJKA 2YN3A 2X6RA 4X6EA 3H04A 3UTSB 1AD9A 2DP4E 1KLGB 3CZMA 2ZAOA 4J03A 4H44C 1EIZA 1NFKA 4I0PD 1AMUA 3QXXA 1CR2A 2VJKA 3AG3B 4AN0A 1ZVSA 1D7AA 4O2FA 5TS2A 1BFVH 2W00A 3MLBA 2I6GA 2DQCL 2OD2A 3F7NA 1TRKA 4RSRA 4WZZA 1JWSB 3H3FA 3H8SA 2DYPA 2PIDA 3MJHA 3T71A 3UADA 2Y1FA 3Q9SA 2J5WA 4PYOA 4PUBL 1AE6H 4LXHA 3DUUB 4XTRC 4NOJA 4WKGA 4O51B 2ESVB 4JO4H 4WOPA 2E7ZA 4G1FA 3IXAB 4M6AA 4BFRA 1FSZA 2A3RA 1T20A 3O2NA 2A4MA 5H4HA 3TNJA 1H05A 2JFYA 3G6JF 1T6VN 2IPNA 1OPXA 1SDAB 4A2MA 1CQWA 4FL4B 3IBSA 2YPVH 4UTCA 3JWOL 1QWHA 3ZQWA 2NO4A 1QGAA 1KEKA 4Q3OA 2J3IA 3RC1A 2W6ZA 4D6YA 4KXLA 4DMFA 1ZAYA 4AITA 5JNVA 4OLBA 4KKQA 3HU3A 4V38A 2CGEA 1Y8QB 3RIFK 2VO5A 2DY0A 2D3TA 4P3XA 2J6IA 1ADQA 2FK9A 3Q2VA 4XXCA 2WUBL 5EJFA 2ZIUB 5CHNB 3NJIA 5ERXA 3OUZA 2HRRA 5F3DA 3BWAB 4FQXC 3AGWA 4F71A 5B22A 4J43A 4Y5XC 3S99A 3WIBA 1XH3A 3UPUA 1QYCA 3VDRA 4JP2A 3ZKWB 3UBXA 2Q3DA 4NATA 1UZ8A 2ZVJA 5DJ2B 2IKQA 1FU8A 4QRHA 3HWSA 2DB8A 4F33B 1GY1A 1X1CA 3H9CA 4L5JA 2F5BH 2FEEI 3V0GA 3VWKC 1ZQ1A 4Z8XA 5BOZG 3V33A 3DAHA 2OW7A 2P11A 4F57H 5FKJA 3T38A 1ST2A 2PPCA 3ZE1E 4MJ4A 4S1DC 1YFLA 1ZA1A 4XX5A 3ICWA 4RDCA 1MVUB 3HS0B 2H0PA 3U4QB 3C85A 4RDHA 2F0CA 3RTGA 4E5SA 3PNBA 1C4KA 2BHRA 2UZIR 2FH6A 4ERXA 1OXMA 2QVXX 4KSYA 2O2YA 4YBQC 2A94A 3WRYC 3X1EA 4DG5A 4CUKA 4EGFA 2E5EA 1KN4H 3VCLB 1DRWA 2QSCL 3LUGA 5JMTA 2IE0A 4ZEOA 1HETA 3I1YA 3U17A 5CVDA 4EWLA 1JIJA 3PABB 4MLZA 3LDGA 5IEHA 2O20A 3CFNA 3AUSA 4Q7MB 4FX2A 3GVCA 2VQSA 1A47A 3DVQX 1NEPA 5MHTA 1C5CL 1E9OA 4Z4FA 2JAQA 6ABPA 2R69H 3I5YA 4HQLA 1JV5A 2DL2A 4BX0A 4AQ8A 1U7OA 3RDJA 5ANRB 3ZCRA 2XMSA 3TCKA 1EDYA 1GUZA 4BDVB 2ZJSL 2PVPA 4EHIA 3U7YH 2Z9CA 1JGVH 1YUMA 4HQ0A 1L7NA 2AN5A 5HHXL 2X10A 1H0KA 4KQ1A 2QGBA 1F18A 5I0WA 3PPVA 1ES0B 1DAKA 5I19L 5DK2B 2BLNA 4K9EL 3IPRA 4K26A 4Q4AA 1VP9A 3BKJH 2ATIA 4YRIA 5DX0A 3EH4B 4Z8YA 1NZJA 3O8OA 4MUYA 2VSFA 2QX8A 1VB9A 3GJFH 1S3SA 4DQLA 2Z31D 4YDLB 1FFDA 4ACPA 2Q1SA 5JHLL 1ZINA 5EZLA 2NT0A 2H6PA 2V4ZA 2YX1A 1YQ2A 3A0OA 4P84A 3HB1A 4OQXA 4Q5IA 1WBDA 3MJ9A 1T2QH 3L5WB 1G7RA 5ALZA 1YY9D 4KXWA 3FI9A 2W9EH 1CUXA 1VFBA 1I3NA 4KO4S 1U1EA 4H8QA 1FFHA 4AGLA 1ZOXA 1DT3A 2A3NA 5FUXA 1CF8H 4U6XA 4IU3A 5FO8B 1EZUA 3H4FA 1ASPA 4M43L 5AK3A 2IOMA 4JI4B 3U2SA 3R6DA 2OMYB 2BJMH 1CL7L 3Q8LA 3BAKA 4W4OC 3A1FA 3RUDA 2RI1A 3O4LD 4BVAA 3FN3A 5CH8A 3UICA 3PXAA 1WB6A 1BG1A 2XYHA 2CVOA 4GKNA 3C3PA 3BE6A 3LH8A 3RFRA 4F4UA 3T1FA 4PJIE 4NXKA 5BV7H 1FYEA 4ZPTB 1OXUA 4YUAA 2ZOOA 2JQAA 3KWFA 5CG1A 1W72B 4OKSA 3L7BA 1YACA 2G8NA 1BVHA 3REWB 3OFSA 2XQVA 2OVBA 3LOUA 3HFFA 3N07A 4HIEA 5I51A 3H2IA 2BEKA 4YDJB 3HBQA 3SE4C 2FHSA 3RYCA 3KDPA 5IB1A 1BS9A 3GFRA 2PTVA 1KJ8A 1F60A 4HRVA 3TZHA 4P2OD 3LKSA 2QQGA 3BFOA 1SGKA 3MQ2A 4ARIA 5T3ZL 4PJDF 3O6FA 3PFIA 3THSA 3WYCA 2PPFA 2I62A 1QAQA 1BZ7A 4PLJD 5A71A 5CDHA 4O2AF 4QQ8A 3MRGA 5CO1A 1CP3A 2KWIA 1UVQB 3OBIA 3HFML 4DKEH 1CE8A 3ZHNA 4E94A 4LBYA 2O05A 3N6VA 5AW2B 3T2OA 2HT3D 3FTUA 2QQLH 4FXGB 2ZXGA 5J4YA 4OCSH 3W9BA 1VLXA 3VCLA 2J12B 2VP9A 5C18A 4HJJL 1A04A 3AHJA 4R01A 4GS7C 3EA0A 1FP6A 1ZMBA 2QLTA 2YJNA 4QRDA 4KV7A 4AKGA 4HDMB 4ONGL 3H9HA 2NY3C 3MBEC 1JVLA 1T8WA 1PJLA 3LB6C 1NMEA 2QVIA 2N46A 4KQMA 1INEH 2OZNA 3OSKA 2PVCA 2Z6FA 2HLPA 3PWVA 3MBKA 2ZR9A 4GB9A 1DJPA 3DMRA 4R96A 4KDTA 3H53A 2DQMA 1YE5A 4IOFC 4ZRGA 2Q0XA 2G06A 3VI3A 2VDRL 1PT7A 4FT4A 2BFEA 1QG6A 1GQQA 5GWXA 4OCRL 3NACH 2HZBA 1WXQA 2D7MA 4WN9A 1BXZA 3BQUD 1CR0A 1F4VA 2CR6A 3AOEA 3PD0A 4TF4A 2QYOA 3OECA 4AY4A 1UJCA 2H07A 2JIXD 2EE6A 3GO1L 1OAYH 4WFGE 3AR3A 2ZX9A 2XBDA 2HLAB 4KROD 1QB7A 3ELQA 1YB5A 4N6NA 3P54A 2EKZA 1P73A 2ZRKA 4N0UB 2GDJA 2Q3AA 1JPTL 2R5FA 4XVSL 5KWYC 1ZH0A 3UIYA 4JUIA 4B5EA 3RFTA 1S78D 1CJVC 3KEQA 3BHMA 3UIZA 1AB5A 3IMFA 3L0CA 4Y1GA 1OXSC 3SC2A 5HP4A 4MVJP 5LQSA 3TCLA 2IV2X 5D87A 3OJXA 4L4SA 3L1IA 3OG6B 1ADGA 2H2SC 3PQFA 1J1ZA 5HDWA 1YUHA 3AI2A 2V59A 1Q44A 3C3WA 1NCCL 1YB4A 2I1LA 5HUQA 2BSDA 1WSWA 3DTVD 3O5AA 4LBZA 2Q7NA 4LCIL 1SCQA 3ONNA 5AWFC 2PSFA 4P5DA 1AZLA 2EC9U 3APNA 1G55A 4BKRA 3HBPA 5F4ZA 2BKXA 2ISDA 4ONHB 3R8XA 4BQBA 3KHTA 3ARBC 1Z13A 4BX3A 3INUL 1X3DA 4OXRA 4JJOA 1OGYA 2CIIA 1T8RA 1TZGL 2BEJA 3OQHA 2VMEA 4XVUC 3E05A 2XXCB 2C8JA 1M0SA 3Q72A 5G5DA 3CO0S 5T3UA 1DANU 3R9XA 4JQYA 4Q3AA 3JV4B 2EDFA 2OTWB 2JNZA 5EWMB 4J3OG 3PJLA 1KCVH 1K8IA 3MO1A 4FZRA 5LQAA 5ECGA 1FLRL 3MV11 3RKDC 2AQ8A 1LGVA 1D0IA 5D5PA 2LRHA 3X1YA 4GX2A 1MFDH 3WDSA 2F8IA 4CLRA 5A4KA 5LMZA 3DZGA 5JYMA 1E69A 5EE3A 4G42A 2Q8BL 4K81B 2DEXX 2R65A 4KZDH 4F5YA 1VFBB 5C1BA 4RABA 2P6UA 1GT6A 1ECZA 1Z5PA 3AIIA 3V32A 4CLOB 3ULAB 3PCYA 3T3MB 4IVPA 4BFFA 4YAQB 2VAXA 4YRDA 3IUMA 3TIIA 3CK0H 1VCIA 3RWHB 4UVIA 3MBXH 3PGXA 1T2VA 1UZGA 3L41A 2QXTA 3EF1A 3UV7A 3LWZA 3OMAB 4XYMA 3GS0A 2FUQA 4WCVA 4QF1B 1BWWA 1L6XA 2H2PD 1BHO1 1MTOA 1NPTO 4C0SA 2VHZA 4QI3A 2O7VA 4X6BB 2JIDA 2NSMA 4L8YA 1LK5A 1EQWA 3LC7O 4E41B 1ESEA 3D4ZA 3QJXA 3HN7A 1VLLA 4QPNA 5KNCA 4RKYA 3SQMA 1UG9A 1T3GA 2VP5A 2W92A 4CHGA 3DQZA 2H4WA 2ZE5A 1SUCA 4ELKB 3FQ2A 4JHZA 4RX4A 3QJHB 3PP3K 4IPTA 1B2LA 3HNRA 5DYIA 1GPUA 1C9EA 4UU0A 4ZALA 2WXOA 1H4SA 2AIRA 3MV8B 4PJ7E 3EVFA 3T99A 5LGKA 4HBZA 4MV0A 1H8HA 4GPIB 2SECE 4EO5A 4NNOA 3UK6A 1ID5I 4H1HA 3SDAD 3VQLA 1HKLL 4N3UA 4LJ8A 3FCYA 4TKUA 3IMBA 1SC3A 1HF3A 2XXAA 5DJDB 3CVJA 3TG8A 5HGHB 1H8EA 1J8YF 5COAA 3RADC 1CRWG 1QRSA 1KFAL 2ZSUA 2AMVA 2R29H 3LAWA 1XYVA 4MXVE 1XD2B 2DLGA 3I9IA 1WIWA 1L7VC 1BZEA 4ZJYA 2P4AB 3SIXA 4D1YA 5KS9E 4FS8A 6LDHA 2OFQA 3K9LA 1OBHA 3M3DA 4WY2A 4TNEA 1SJVA 2N59A 2JJ2D 2VG8A 1XTLA 3GTVA 1Y0LB 2GKIA 3I76A 1EE1A 4D2IA 2BGUA 1TSRA 5B39A 4ZFQA 2PGNA 5TPWL 5LQBH 1LX7A 4E5MA 3TKYA 3CF6R 1PFVA 5DX1A 4HEMA 1WAMA 2X89D 3FTWA 1XWWA 3QU2A 3MJ8B 4KIFA 2AJTA 1JF6A 1J7VR 2WVSA 3HYLA 1JFQL 3MTJA 4Z76B 4NESA 1YRYE 4X1IB 3AIOA 4H35A 3X2SA 4WI7A 1A21A 2Q6OA 3P0EA 3DF9A 1Z45A 5ES3A 4Z6AT 1KI3A 1VIAA 4GQPH 2WWYA 1T5SA 4HG4K 4QRSA 1A9TA 1FTGA 3QUBA 2VLIA 3RVWD 1E62A 2UYOA 4WJ5A 5E08H 3K92A 1ZTMA 4D25A 2VPIA 5D1XE 2ZWZA 1JXJA 4OHYA 4TTIA 4KDTC 3NCYP 1VFNA 2BC9A 2MIIA 3QF4A 2ADIB 1CZ8H 3V0FA 5AJXA 3Q9UA 5HYQA 2HFGH 3LIZH 2F8XC 4CNBA 1FORH 1GPJA 2I7DA 4KFUA 3UJTL 1M7BA 4PJFF 3HKFA 1KJ2A 1XEUA 4ODVL 4WLCA 1U7XA 2IEAA 1O0BA 1W9XA 3Q85A 3KZNA 2HDNB 4R5HA 3VWJD 3JR3A 4Q89A 4B2YA 3AEKA 3F83A 5ICUA 4X20B 4YRAA 1MG2C 4Y16A 3ITNA 3CT6A 3ETTA 5A02A 1QQAA 2Q6IA 5DHYA 1V8PA 1W49A 4Q6KA 4E5VA 2GO1A 1G7HB 1DSFL 2XUPA 1PLLA 1IY0A 2YZNA 4IEFB 1EO7A 3TBSA 5J59A 4C1BA 1XU4A 2V5TA 3ZGZA 2PXAA 5JJLA 1FNGA 4ZAXA 3BD7A 3UZQB 4P9NA 2XGSA 3G59A 2PCPA 2CL7X 1MABB 1H6DA 3BDYH 2W0PA 3N7TA 1G7QA 3PJRA 5D9SB 2LBPA 4X4MA 4RZCB 4HLUC 4Q7EA 4HHWA 4F24A 3OHSX 4MP6A 2BS71 2HLAA 3ASWA 3G5WA 1U6IA 1YC5A 1I7QB 2Z95A 4NMLA 1QFWH 1R8SA 2IP1A 2E4FA 2AKYA 1KTDB 4F58L 1BOFA 1G8JA 1F7UA 4ZZ0A 3EUUA 4HDSA 5E1DA 3KLHD 1XP8A 2V4MA 3A6CH 1QS0A 1T1RA 1FL6B 1Q4NX 4U7SA 4GEJA 4Z4GA 3P9MA 4P2RD 3TS8A 4CC4A 1A4XA 3I9KA 3DF7A 3DCIA 1DZ0A 3KCNA 1SKBA 4HHEA 1JE6A 2IPLA 1W0VA 4YPOA 4TXHA 621PA 4R31A 2Y0CA 2EQBA 2XE8A 2VPPA 4HZLB 3NIGB 1BOYA 3P0YL 2OAAA 1UXOA 4N86A 2DWPA 4RW0A 2JI3A 2R1TA 2EC8A 2QHLA 5EOQL 3U30C 2QFPA 2J59A 2O6LA 3MLUL 5ALRA 4C22A 1CRPA 3PNQA 3APFA 4A10A 2DPKA 1GTFA 4KK6C 4OJQA 3A9CA 1A7QH 4L3EE 4AZ8B 1G5QA 5LZ8A 3BKCH 1TJIH 3SKNB 1NUDA 1NAHA 1VF5C 1QBLL 2P8PA 2CDRA 2AITA 1OAUH 4YAIA 3GHEL 4ZOBA 1Z4IA 1SU6A 5LB2A 4YFVA 3FR8A 3QO0B 1J5OL 4X7MA 1VTKA 2HUNA 4R2IA 1J0DA 2GNAA 5IZCC 2MYNA 1WWKA 2AC4A 4NENB 4REQB 4ZDKA 3EJTA 2ZYGA 3FSJX 4G8IB 1DZBA 2QVCA 1AGDB 5DD3H 2VATA 4H9GA 1X38A 2DQTH 4FC3E 4B6EA 3L79A 3WKBA 2PKDA 3ZHXA 1ZHBB 2C9QA 2GC4C 5E2AA 3ZO9A 4B6FA 3P73A 3ANLA 5A40E 3ZWMA 2CALA 4ERSH 3HB7A 5D7IE 3BE8A 3K31A 1QLEH 2APXA 1K8XB 1H3TA 2HHAA 3VXRA 3IE1A 3V4VL 4P2QD 3ZBQA 2PUDA 4TLSA 2BZ0A 1ICIA 3D33A 3BMQA 4EB6B 2NSQA 5A6VA 2R2HA 1P9MC 1UPCA 5FI3A 4P31A 3GFBA 1FGVL 4WRLA 3RHTA 3MA7B 1WBBA 1S2LA 2XA9A 5HI3D 4OCXH 2G4GA 1JAYA 3FFCB 2H92A 4FGUA 1D5RA 1W581 3SKXA 5EU6B 5JAPA 1TVKB 2FT7A 3HTXA 1FFPB 2DLIA 4NYIQ 1LBQA 2E0PA 4XASA 8ATCA 3LZPA 1RVFL 2R4QA 5E4TA 4R5XA 4PJIB 4YR6B 1JT9A 1JZ3A 5A06A 5MENE 3OZKA 5FF6B 5HA5A 4UQAA 2ORYA 4QUGA 1ZLVK 3O9WC 3HDJA 1DO8A 1T43A 2XDQA 3ASUA 3NWOA 4EJSA 3ZPXA 4DCVA 1YEEH 3VDCA 3HI6L 1JALA 4ZMRA 1E4YA 3NIGE 3GB7B 3O0TA 4NQEB 2EDDA 1KJ3H 3QXAA 1FO0A 4ZODA 3KZXA 2CHGA 2XWRA 1E99A 3P2JA 1S78C 3N43F 3NIBA 1SXBA 2BWJA 2OEPA 2QV0A 3A1NA 3BMVA 4K9SA 3GOQA 4BFCA 5LZ4A 2X0FA 4EMZA 3PXJA 1T2XA 4UQDA 4UNVA 4H1UA 3IF1A 2VQ1A 5DGQA 4OHCA 4Z7VE 1LH0A 2ID8A 2WSYB 4D56A 5CJXC 2V3WA 1YEJH 6REQA 5K8LA 2P3YA 1J1XH 3QDJB 4HRXA 4AMZA 4QXVA 3ARTA 4BOYA 1U2TA 2WSMA 1C30A 6GPBA 4MV6A 1OTUD 3BAFA 3M5WA 4GL4A 2ZRFA 3LUAA 2X19A 2BKVA 1LWOA 4LDNA 2DMKA 4I4TF 1ODLA 3WIFA 3NP7A 4ZVRA 4JAMA 2BLLA 1G18A 4ZCLA 2QRGA 4HJ0C 5HIJA 3BMCA 4OH7A 1EJ2A 2VF4X 4BJLA 3CUYA 1FC1A 3G08A 4FHBD 3T0VA 3ICOA 3JQ8A 2AEPH 3ZIAA 1N2EA 4IJ3B 1CTOA 2VJBA 3OU7A 2A9KA 2B16A 4KKZA 3E38A 2YOHA 1TPXC 3KWMA 2VTKA 3CBRA 4HIXL 4IFBA 1NKTA 3A23A 1T3ZA 1SJXA 1N34B 3LKPB 1XTVA 4OGXH 3BSHA 2NOYA 3MJGX 1AHMA 4X5WB 3W4KA 1M34E 3QUYD 4X6FB 3P4OB 4YAWA 3OE4A 1S7QA 1OLXA 5FHAL 1KIMA 3O41A 2DB3A 2OJ1A 1C12B 2D8AA 1XMEB 3GMOA 4IOIB 1CIVA 2QIPA 3CVXA 3UFXA 1P2BA 3HNOA 1K6JA 1QHYA 4LBWA 2H59A 1IKNA 3G04A 3TIDB 5ICZA 2RAVA 3ZKNC 4XPIB 5JANA 4KGVA 1W8DA 3TIFA 4E9WA 1RUML 1PDVA 4ZGGA 1YDPA 4OV5A 3ZLQC 3F2IA 4HAVA 2SKCA 1P4LB 3O8XB 2VDNH 2JGMA 1A76A 1NGPH 4L1TA 2MKLC 4W9NC 5EJ4A 4BWVA 3BP6B 2PT7A 1LDNA 4JO1H 5K4AA 3W8NA 4IMIB 5KNDD 1RQGA 4W9KC 1I2CA 1G6Q1 4XP9L 3MMNA 1HFWA 4PNEA 1UK9A 3RU3A 1A5FL 2JKLA 2YEZA 5IMLA 4Y19B 4CZ2A 2XWBB 3OHXB 1BVRA 1XZDA 1UKQA 3ZY6A 3BZUA 1B3RA 1U6AH 1NBOA 1HH9A 5EHXA 5I6XC 2JATA 1GT91 1V25A 1IM5A 1IGTB 1ETHA 1NMQA 1Y7TA 4Z1MA 3DX9B 3DEAA 4AJIA 5EFOA 4BFVA 3OGCA 4DJMA 4MHTA 4UNUA 1AGXA 3PUZA 3NTUA 3BUPA 5ADUS 3NSDA 5A16A 4HUKB 4ES9A 2X38A 4C2TA 1QQDB 3GTNA 4UCWA 4CKXA 4KGXA 1JHRA 4E5NA 1ISHA 2ERJB 2BNUA 4M87A 4XXDB 2GIMA 1C81A 4COKA 1NFAA 1MCPL 3MOGA 2H6UA 3KU4A 1MI5E 2B9AA 5JXHA 1C08A 4ILKA 2V7QD 3Q5TA 2W60A 3TW8A 5F97E 1LVHA 3PNSA 2ZYUX 1BYUA 4NZZA 4OM7A 2BC4B 3LW7A 5L51A 3QGVA 4J23A 3FWKA 2E6JA 2WT4A 3PX2A 4MCAA 3TIGA 4A2GA 4TOYL 5GGSY 3U9PL 4HG2A 3X0DA 2QMZA 2AXEA 4M1DH 1B93A 1C1HA 1YAHA 5INTA 3UJ6A 1U8PA 2YRLA 4QU8A 5EMHA 4WI9A 1Q1GA 2VJQA 5EN2B 2YV2A 3TTWA 3OC0A 1PG7H 1B74A 3DOEA 3FT4B 2XTJA 1TA9A 2ZR7A 3F3SA 2H9IA 5IDQA 2F7PA 5BT9A 3RWEA 2WJIA 1MQ8B 2LTAA 4HLDA 1PGRB 3D08A 2K8MA 1VZHA 1LJ8A 3QQ9C 5IHZA 4N0FA 3WB9A 3SFTA 2CCKA 1YY8B 3PWNB 3UHJA 4XRCA 4YSOA 1CQIA 4MROA 4DUZB 1AQUA 4QE3A 2LV8A 1OW3B 1P44A 3WWEA 4ZI7A 4FXKA 5FPHA 1E5BA 4A8JB 3FZNA 1KB5A 3DO6A 4ZVSA 25C8H 2VYVA 1X9LA 3QVVA 1FNAA 5IP4A 1S7WB 4U6YB 2DRUA 4AJ2A 15C8H 1BMTA 1JPTH 2BFFB 3S3SA 3TL3A 1G7TA 1NW9B 2OY0A 1IMJA 2BHZA 3BT2H 1RWNA 1V1RB 4UIMA 1AF7A 2EVJA 1MRNA 1V7NH 4W68A 2YUTA 1X94A 3SPVB 2O61B 2F3TA 2QK4A 1HAWA 1A4RA 3W2TA 4CYMA 5AIBA 4M8QA 4WFFD 2QTEA 1TEGA 3KVYA 2HXGA 2EX1A 3LE8A 3F6IA 2YWGA 2GJ8A 2HU7A 5AW1A 2PMEA 4CF6A 1JU9A 3I50H 4DEUA 3FOCA 3SS9X 3UTSE 5HJBA 2NIPA 3H99A 3O2JA 4YL4A 1UWFA 3G2NA 1DG9A 3NABL 1JYSA 3PAZA 4PCAA 3TZ6A 4CRPA 2P91A 1GNVA 3H75A 4HZUB 1L4BA 1EIBA 4TT3D 3GEGA 3LN5B 3OTHA 5DHUA 2QTNA 2PWAA 1MQ9A 1KPVB 4C4ZA 2VJNA 1NFRA 4AKIA 2Z5LA 4M93B 4UOQA 2VRAA 2B5IB 5KJ6A 4EFMA 4MYTA 1NLZA 1GL6A 5C07D 2O6CA 3MROB 1ETJA 3VFPA 4MMXA 3E7WA 5AW3A 1IEWA 1JHUA 2OX5A 5IVXB 1RE1A 5DN6D 3TGPA 2J3LA 1PWZA 4HH4A 2Y7QA 3FCSB 5BW6B 1XQ1A 5EOCH 3ZBTA 5HRUA 4PJBF 4RS3A 1LI7A 2CLFB 4FFDA 4X9YA 3D87B 4WAFA 3DHVA 1Y4AE 1NVEA 1MPXA 1FN4B 3VFVA 2XNJA 5AQ1A 2AJBA 1KQNA 3M33A 4UQCA 5DHPA 1RZKH 1NGZA 1ZAGA 4AC9A 2QI9F 3W5CA 4LLWB 1T4BA 3NQ41 4KBPA 4EA7A 5GGTH 1GU7A 2ERJC 1DV1A 2C99A 4Q1EA 3K70B 5JC1A 1MVOA 2RK6A 4D9NA 4JRWA 4BZ2A 1C1DA 4QXGL 4BQFA 5DRZA 5FOBB 1JTTA 4HAYA 5JARA 3BVUA 1SHUX 2TAAA 4TNFA 1FVCA 4C7KA 4GAFB 2F3SA 5B1JC 3QBJA 1MIOB 1WICA 2OBFA 3ECSA 2DCUA 1T9KA 4X99A 4YDIH 1ET7A 1ZNXA 2ZJ7A 3I58A 4OSOA 2BSQA 2GZ3A 1WW2A 5EZLB 2CIKA 5EIVA 2C3XA 4B31A 3LGXA 3OMWA 4XJTA 5BRZE 5BR8B 1TKBA 1XMXA 3TE6A 3VKUA 1OV4A 4E2OA 1R1DA 2DM4A 3EADA 4HWBA 2AABL 4RXUA 2G17A 1KOGA 1Z73A 4B3EA 1A8QA 2BNUB 1EBPA 1RYEA 4F37K 5G3YA 4AENB 4AMGA 5FCSH 1NBVL 1HG1A 4JP5A 4F06A 3DMFA 4JVSB 3KEGA 4ZOCA 3EDQA 2CHUA 5JLJA 1RLWA 2I9PA 4MR7A 4CMJA 4EF5A 3WK4A 3LRTA 4DLWA 3HIZA 4D0DA 3DE4X 5DVOA 1DC4A 5I8EB 1G7IB 4M56A 2JLUA 1YRAA 3FAZA 2XU9A 4X4YA 3IP5A 5L2KA 1JGUH 1S7GA 3PNWA 5I1LA 5C09B 4EDWH 4JY5H 5C0AA 4QRRD 3QDAA 4GMKA 4D9QE 3F04A 1RQNA 3WFHB 2O2SA 5B7NA 2C0CA 5G1OA 5IG2A 2OR3A 4HNAA 2UUAB 3QVOA 3P4NA 3VD1A 2WU3A 1IZ7A 3LKSB 2VTEA 4JGJA 3HP7A 3CX6A 4KQ2A 1EH9A 4C06A 2CF5A 3N0TA 4XJVA 4KJQD 4P4RA 2KPOA 4KZEL 3L46A 5JXAH 5CINH 4JXXA 1KTDA 1N18A 2KC0A 3CONA 4JDUA 5KQPA 1PFYA 2BCGY 3PAVA 3STXA 1AG9A 2D0FA 1U2YA 4IDAA 4QXQA 4IRMA 2L42A 2M1KA 3FBWA 3ZE9A 1V6AA 4CQMB 2HU5A 3QBDA 5DJ8B 4AFNA 4FEEA 1I85A 1L3WA 3KPSB 3HHSB 4F6RA 1QTYT 3FSOA 1A69A 4K94C 3HSSA 2UWEF 3E48A 4JQIA 2IALA 2ZUVA 3OOJA 2WBJD 2NZVG 4FWIB 5ER9A 5AWNH 4H0NA 2FUG6 4DBLC 4I77L 2VXQL 4CL2A 4DLBA 4OFYD 2BGTA 1Q21A 5D00A 2X0EA 2YHSA 4NPCA 4N2OA 3WA6A 2Z7YA 5K33A 4YSUA 2UV8A 2VXQA 5LNK6 1HQ4A 2YR0A 3QPBA 4XUDA 5I2IA 2JRLA 4JAMB 3HU5A 4RK1A 3I3BA 4FP8L 1ISFA 4BNHA 1GO2A 4KEAA 3LFHA 1DGQA 2Q3ZA 1II8A 1E2UA 1JRHH 4ZDWA 4R7ZA 1OGAB 1Q20A 3OVUB 1R4NA 5INCB 4B3DA 1XJ0A 1LDGA 2EIKB 4RELA 1MR3F 4KROB 4MA4A 2PH5A 1PD6A 4NOLA 4MMXB 5AW3B 1SVUA 4BZ1A 4KAXA 2OD7A 1KEZA 4CE6A 2GCYB 1JYFA 2FB9A 3GRVA 1QFHA 3RIKA 4H60A 1KWKA 4PJ5E 3B2PA 4R16A 3KXFE 5IB3B 4GG8A 1CICA 1S7WA 2ZUDA 3O93A 2HM7A 1V3MA 2W9DL 4FZ3A 3ULSA 3Q2OA 4EBBA 2QE7D 3CRVA 4HS3A 2IBSA 1VA9A 4RFEA 5D85A 3UK7A 3ZW3A 3FQ1A 4ERNA 2ICWI 2RHEA 3L7YA 1JKFA 2R2HB 1C50A 4B3SB 1SYSA 4QYOA 3OQ1A 3NEXA 4DDVA 3GXOA 4ATTA 2RD0A 2XOEA 1UPTA 4PJCF 2XI9A 1ZVNA 3AJ8A 1BYIA 1T3SA 4JBLA 2WD7B 3NCWA 2H1VA 1FGNL 2WLNA 5KX5B 2BM8A 4JG5A 4TQEL 2OI9C 3UAJA 4Y2YA 1HYGA 3GA5A 4RCYA 4FI8A 2EJWA 1IGMH 4X50A 4XBGA 2HA3A 4IOFD 2XCQA 4OKVA 3UJ3X 1P5UA 3L4XA 1IM9D 5IEBA 3HKBB 4WK0B 4OR1A 3L0IB 4FDWA 4G89A 4C3ZA 1F2UB 2QPDB 3UO1H 2GRAA 3I8OA 3FU7B 1T66C 1E4XI 1HL4A 4UDTA 2WNXA 1RK1A 1T9CA 3IFNL 1KMIY 3CWQA 3ABLB 5AMXA 3B1XA 1SBQA 2VCOA 3KWWB 1VJDA 1OM3H 3LO8A 4PJHE 2E85A 4N0EA 4MGKR 3O1JC 4XDZA 4N3AA 2O8DA 1CPYA 3SHFA 4B1FA 3JS5A 3RJQB 1T26A 3HCPA 3IRCA 1IJ9A 2ODQA 2N42A 4RYLA 1XVTA 2CLMB 4F97A 2ZPKH 5BV7A 1NM9A 1OLXB 1JIUA 1DU4A 3H5RA 4ZK8A 5ISZB 5KNBD 2BBTA 1DEDA 1HESA 1QYDA 2Y2VA 2P4SA 2HH0H 3P2TA 5JW5A 1AQKL 1PBTA 2C9UA 1Y9ZA 2R1VA 1YB6A 3LZQA 1S6NA 4DT1B 4U7FA 3MSXA 4HB0A 4PF1A 5BW8A 5BW7A 1HWYA 3DETD 3ENQA 5KZMB 2OZPA 4F1WA 9MHTA 4MB3A 3CX7A 1S7CA 1A8JH 1WCIB 3F2VA 3LD8B 1XTJA 4KQIA 2OZKA 4UNTA 1IPEA 3TYFB 4OHOA 2SCUB 3EHEA 4EYGA 1FLVA 4LXXA 4JHXA 4LJSA 1QPGA 1NIDA 4PJBE 5CNIA 3QNUA 3CLEL 1JZ6A 5I9SA 3VSAA 1KTVA 3TLGB 1TF5A 3SDAA 3WDLA 2Z98A 3D18A 5CMLA 2FK8A 4H25A 3KP1A 3ICQB 1G7MA 5L88L 4PY2A 1ORTA 4ZXFA 4NPYB 2KYRA 4X60A 4PWJA 1CIJA 3QXJA 3QQ4A 5FV2A 1HCYA 1D5CA 3EXEA 4B6JA 2E48A 3TZQA 3IXLA 2PLRA 3U9UA 1U9CA 3IE0A 4BE9A 4WY5A 3AERB 3IMGA 1KMNA 4NDNE 2ZR8A 1WXDA 2JJTA 4WO4A 1NUPA 4WXYB 3CFEA 2C31A 1VA4A 3F64A 2CIIB 2R86A 3U16A 1LC0A 3S0PA 3WL9A 1CUZA 1X9QA 2R69L 3WFEL 1KYTA 3PC3A 4XPZA 1F4WL 3QEQB 3DMYA 3GLIB 4DERA 5T7BA 4ISBA 2D03H 4MKZA 2P45B 1E9OB 5TMBA 4Y4KA 5CJ5A 4OFWA 4XX1G 4ODHH 4Y4HB 1J2UA 1U4OA 4G80B 3BXXA 4TTRA 1MXGA 4AYTA 5CMAB 2C7VA 2D4AA 3K0FB 4Y8VA 3KH3A 4GKLA 2CK2A 3F67A 4GVPA 2B25A 5EOTB 4G42B 4IRZH 3EAFA 1R4MB 1LJUA 5EINA 3WTSA 4XHJC 1CE6A 2J9ZB 3OTIA 2QTVB 1F6LL 3X3GH 4QUEA 2OT3B 4ASUD 1J8RA 3ER9A 4HDQB 1C5KA 2IYZA 4BP9A 3O21A 2IDMA 4FLFA 4X1OA 1G5HA 2XNKA 3PGFL 4JROA 1SH7A 1ZN9A 2BNQA 4YO0A 3HV0A 5B3KA 4K2UL 3KC2A 4FONA 1MFEH 1A02N 2PTGA 3VKVA 5DASA 2PABA 3OJOA 5BN4A 1RMYA 4WO4D 3DUWA 4OGXL 5DSCB 3LQQA 4OL9A 2JHCA 1OH6A 3ZTJH 1JXDA 4JKMA 4ZCIA 2GI7A 3PHLA 2FCBA 4H3KB 4X6CB 4BZPA 5JXWA 1QIDA 4QO8A 1T6XA 3RIFF 4TV3A 4F2WA 2EYRB 4K7FB 5U1PA 4UU9B 5FNVB 4HKXB 2EXYD 1Q11A 3RD5A 5FUOH 1H4VB 3N1QC 1KJ3L 4E5XB 1H3PH 1XQVA 3CJTA 5B4MD 2Q1UA 3MAJA 2SEBA 5CX1B 1AR1D 5BXQC 5DHYB 1TD1A 1ZHKA 1JAEA 3DE7X 5F6HJ 4CF3A 4M9PA 3RI5K 4WW2A 1GCOA 3F9CA 5PNTA 1CFZA 3AY6A 4UE2A 1NZFA 3AS0A 3V1MA 5B38G 2POCA 4PG2A 3IVAA 4JFEB 2EFJA 3UYKA 3V6ZB 2DBZA 1H1LA 4MMYA 1A6UH 3UEZA 1B0IA 4GQBA 3LEVH 3WA7A 3HC0A 3SQNA 3REGA 1R3HA 4ZXPA 1C3VA 5ITSA 3ISVA 2PL1A 1G9TA 3ZNNA 4RC9A 4ZS6D 4AJNA 5ALBH 5GXBB 2YPLD 3CLFH 4BQ8A 1YMUA 3K5HA 3UH1A 4DGIH 4TUKL 3DZKA 2ZU0C 2D2FA 3HNSH 4AVYA 3IVCA 4NHUB 3QMMA 3FTGB 1CRLA 4UHKA 3FFWA 2CLOB 4K3HA 3QYNA 3IDNB 5DD1H 3SQXA 1IE5A 4DLNA 3CEMA 4UDUB 1GW0A 3WEOA 1YVLA 1AHWB 1XCWA 2NU8B 1O89A 3R8BB 1D2CA 2IHNA 3WY4A 4OCXL 4YUXA 3G5ZB 4D3CL 3K94A 2YY5A 4LNRB 2GA8A 2FUNB 2AJ3B 3DAOA 3K74B 4BMZA 4ZO4A 1C9YA 5ISZD 3MLZH 2LFEA 2XJKA 1WFMA 4IIYA 1M2NA 4YP9A 1P6UA 1PD0A 1ZGAA 3HCOA 2WNHA 5LXGH 3SHSA 3CZFB 2OK0L 2Z43A 4YT8A 3PWJA 1DQRA 2AQ1A 4RCZA 4EDXB 5JOPD 2KLHA 4PVDA 4LU5L 4GBXC 3QKRB 1IJNA 5KJCA 3B3IA 1P1VA 3BSSA 1TZCA 4OJDH 4XNMB 3HZYB 3I39X 1BJ1J 4PO9A 1M1XB 4CMAA 4EI8A 2V9CA 4II2A 4YGYA 3DX7A 3I6GA 1TZHB 3B7RL 4G5YA 3T7EA 5IJ9A 4N2HA 3DGGB 3AIMA 4N2LA 4GSKA 4AKHA 3DSNB 5IU6A 2N0KA 3F5WB 1EXNA 1XBTA 4KQXA 3CFIC 1AGDA 1CJTC 3HMWH 4H8UA 3T0FA 3RQSA 1MO5A 3AWFA 2BCEA 4FFTA 1DC3A 2ZUCA 2WQSA 3FLAA 2RBGA 3RJ9A 4X7BA 4U6XB 3ETSA 3GXTA 1XCTA 1WCBB 5F1IA 4R98A 2Q9BA 3HU2A 2G60L 3TOXA 4JJIA 1SHTX 5F7BA 3URKA 5LCVL 4L0DA 2GN6A 4S24A 1KOAA 2NAPA 4R1OA 4MUIA 4CU7A 4MJ7A 5DQ9A 5L3SA 3ARUA 3RSGA 3IB3A 5CWSB 4BHTA 4Z4EA 5G40A 5H68A 5EHIA 1TQ6A 2BF7A 3EK2A 5FLUA 4AYID 5EBLB 4KHPB 2XA1A 5HVNA 4FFVD 4LLDB 3FSZA 1FXSA 3OQ6A 4BWGA 4OHBA 5IJ0B 2AD1A 4YYEA 3AMVA 2IWGA 3TBTB 1LP9F 2HZ7A 2R6GA 5CGMA 3ONDA 3BPNC 3G5UA 1A9YA 2VTBB 2BSTA 1G9NL 3A6CL 2FEXA 4QEZA 3BJLA 4RNCA 3PQ6A 4W9IC 3BH8B 1JQDA 2VN8A 4K87A 4IOMA 3AS2A 1V47A 3UXFA 4X5LA 5C1MB 3G7TA 3KJFA 1U4FA 4D99A 2O2CA 3D4PA 4L7VA 4B33A 3TLGA 5JH7F 4G1EA 2KLTA 2H57A 3H2ZA 1JU4A 3JQOB 3OKKB 2GBFA 1CZLA 4C4KT 3V8PA 4G5SA 1A4AA 1GG8A 3ZHUA 1E2WA 5D6CB 3D1VA 3LZ6A 4BFJA 1MF2H 2WIAA 2O5NA 3OU2A 4LEOB 3RU8H 1M34A 1E5XA 4Q4DA 1T1XA 4FHFA 1ZDSA 3ESDA 2YWCA 3MVSA 5IW3A 4BRWA 1HEZB 3QRGH 3UJCA 5CIPB 3HI6A 2BKAA 2QD3A 3JVFC 5AJVB 1KZ1A 2VSNA 4HKXA 2R7EA 5C4GB 4WZAA 4EG3A 1QF9A 5HBGA 2CXGA 4DXAA 5E1QA 1UM9B 1T5HX 1AR1B 5M3BA 3AO0B 3R7BA 3NYKA 4EF3A 3RABA 2CB0A 1IXZA 4RZUA 3ZQ6A 2GM5A 2XUOA 5BRZA 4GRIA 5AZ2L 4MD5B 3S29A 1E3ZA 4AEHL 2R6R1 4I0WB 2GEUA 5I1KH 2V37A 1KNQA 1ZTXL 1PG7X 1M1XA 3WRYA 1WU7A 4W7IA 3GIZH 3RAFC 1L3CA 3SPIA 1YNOA 2V2TB 3QHTC 4FDUA 2WTNA 1NJ6A 2K7QA 5CYFA 3GI9L 1FGVH 3RQ3A 2DUWA 2FOXA 4LYJA 1RXEA 4QXTA 1E4KC 2Q7YB 3ZQUA 3NEEA 2ERCA 3PDGA 5AVXB 5HI5C 1E3QA 1IFRA 2ENYA 4Y2DD 1JG2A 3A1DA 5FUWA 3UXMA 4WV1B 3HC7A 1EZZA 4MNHB 5CX4A 3RNKB 4G6KL 1SXHA 2B9BA 3N2EA 5CB4F 1CDCA 2DMHA 3L7FA 3RAGA 3OKLB 2XJLA 3QWAA 5IFHH 3G8DA 1PW7A 3N2NA 1MCWM 2J25A 5EEWA 3SE8L 1KIRB 5CD3B 1XD2A 2FIKA 2J0VA 4GRLB 3WIHH 5CEFA 3HO8A 4F3KA 4ME6A 2OCXA 4D8WA 3K9FC 2O8EB 3W4JA 3M34A 1P7VA 3OKNA 3PHOA 2RHHA 1J0IA 1XC7A 3NHLA 4GAJL 2XVAA 1Z28A 2B1AL 2XF8A 4MVYA 1NQXA 1SXQA 4EOWH 4U5XA 1JEYA 4PD4J 4L4YA 3OM3B 4X0KB 1EUDB 1HL5A 5AP9A 1S4QA 2JI2A 5DJ5A 3DSNA 3HI4A 3I9GH 1YN6A 5B1EA 4LRTB 2RQEA 1QFXA 1HIMH 1TRHA 2ED9A 2OOSA 5JPNC 1A8SA 4Y1AD 5C0DA 3E70C 3I6KA 1A4BA 1TZIA 4A1RA 1OE2A 1YMMB 3BIBX 3H9SE 3HI1B 2DQZA 5KVFL 2FFJA 1RL1A 3V0DA 1IZJA 5I0DA 4AY3A 1FIGH 5KU7A 4OLWL 3BPNB 4J3TA 3JYPA 4AW4A 3BAYA 4M7WA 1ZN7A 1FH5H 3ZD8A 5I1JH 2CC2A 2WWMD 4XIFA 1JGEA 1W52X 4YWHA 3MRVA 1I8MB 3GT4A 3FD8A 2X44D 3K0WA 4OEHA 1JSRA 4E14A 2C9XA 3R3ZA 4QUJA 1PTZA 3INTA 3QDJA 2VH2A 3WI7A 1TMCB 3SDBA 3A25A 3O45B 3GRCA 1NJ9A 2C98A 4QF1A 1EQUA 5KAPA 2X4RB 2HFFB 4BJ6A 3F1LA 4Q05A 3OJVC 1SM3L 5ALTA 4FDLA 2YJTD 4MS4B 2XCTB 1KQPA 1IL1A 3FAKA 4XYBA 3QLEA 4IICA 3FBKA 1DIRA 4R7GA 1MFCH 1VLHA 4O2EA 1VG0B 2D2XA 2CLVA 2FJFB 2Y36H 2AUNA 1JFSA 3LQMA 4EAQA 1UUFA 1WFOA 4PSDA 5FO1A 3PEVA 3B2DC 4H1LH 2C42A 3WV4A 2ZT9C 4YYZA 1WA2X 1U1DA 3ZYCA 3U3JA 2Y6SD 1FS4A 1B4DA 3WTWA 2BBOA 3RRZA 2RHJA 2RGWA 4FABH 5CZKA 1EANA 1Y98A 5IT2H 1ZI9A 1X5JA 5DK4A 1T2NA 2QLNA 4H6WA 4DHLA 3QUXD 3VQ1C 3N44F 1ANUA 1E2FA 2VWHA 4UTNA 1KCSL 2XG5A 4C7BA 3S7ZA 4D8OA 4WU7A 1X86B 3PGCA 4XOUA 4MMZC 1KZYA 4UYPA 1OP4A 2Y24A 5IC5A 4ALNA 1M1SA 1BIHA 3AHIA 2HK7A 1VIYA 5E51A 1J8HB 2DIAA 3VWKB 2VSXA 4NZRH 5IR1B 5AVXA 1NCCH 2FSUA 3ZKQD 3HVUA 5EFIA 3BEDA 1HHHA 3AUJB 2B3DA 3COYA 2F59A 3II3A 1F0LA 1QYVA 1ISIA 2QKSA 2ODWA 1DN2A 1D8AA 1H3GA 3WD5H 1G98A 4AKTA 4ZW7A 4BXVA 3OZRA 1NXPA 4XNZC 2DQ4A 4DN6A 3EXEB 2HD4A 2R56L 1KB3A 5EE9A 5KBKA 2W9DH 2FPPB 1HHKB 2DHDA 4GP4B 4H3HB 4OHFA 3EPRA 4I48A 3US1A 1LLQA 4KIWA 3V3TA 2NGRA 5K0GA 3HMKA 3D5OF 3EXFB 2VLLA 4Z0PA 4JL8A 3H3BC 3MWDA 1JFQH 1FRGH 4UMFA 3IB6A 2AN4A 2QL1A 2XA2A 2IYFA 2VLKE 4HJGB 1PL0A 1Q9LA 3OZCA 3HAEA 4HJIA 2I6XA 2HAEA 4LKOA 3RK0A 2H0EA 4UMGA 1TZOA 2BVPA 4NSNA 2EEAA 3K6OA 1E18A 4P5PA 2P28B 2A9BA 1YQVH 3IU3A 4OP2A 3LRHA 1E96A 4PZEA 1ZEMA 4G5AA 3OTTA 2IH2A 3IRPX 3V4PL 2NXYB 1Q3HA 1Y6GA 5I6MA 3KOOA 1P4SA 2O9JA 4FLSA 5LU9A 1HVXA 3R0QA 4FZJA 3OKYA 4JBXA 1SHLA 4FXPA 4DE5A 3QR1A 1EX6A 3ADPA 5IUNC 5DE3A 4KFTA 5GV7A 1DCLA 1YYMH 3BSZL 2YSTA 3BD4A 4X5WA 3DDNA 3EBPA 3PHJA 4GI2A 4HJUA 4ZCSA 3JVIA 2PBLA 3HG1B 3W39A 1IUNA 2F1HA 4E4RA 3W5IA 4QKXB 1UXJA 4UQLA 2OLDA 2OLKA 1T4CB 3NYRA 5KN5A 1XB2A 1BDYA 3HXKA 3KJ6H 4Y1SA 5L9DH 5BSWA 4RA9B 3ICEA 2O5YH 4N8SA 3NNNA 4OM1H 4F9FA 2DD8H 3WFJA 4L4TB 5KCMA 4W8OA 3NM6B 2JHGA 1DB3A 3FB8B 1H0DB 3C75A 4QRUA 1BZ9B 4MJ3A 3BK7A 4KCGA 1CS4C 1NVBA 2AD5A 4KVZA 3ZDXF 1L4MA 1R5IB 1EJ8A 4KUCD 4AIRA 2E5LB 4OA5A 3ZR6A 2QTMA 1FL6A 5HF9A 1KZHA 4DA6A 2Y22A 2ZTUA 2AZMA 1YA8A 3DIDA 4AWAA 4U1KA 4OLVL 1HJCA 4IRSC 4ENPA 3MI6A 1TEFA 4HUJA 4TLMB 3WELA 3T9BA 3IIJA 2GSGA 1APBA 2WIGA 4PIMA 4G9DB 4QXMA 4MAYB 4KL8S 3I02A 3B43A 3U1PA 3IVGA 2IJ0C 3EXHA 5DSCA 4IHAA 4ENQA 2WQUA 4P98A 1CUOA 1Y9AA 4HBCL 3IAQA 1EGJL 3KPYA 3E8XA 2V6IA 3GFPA 2ZQZA 3G6JB 5AM5A 4K7FA 2GAZA 3EOBI 5E94A 4N20A 3LEYH 5DNDA 3VRLF 3I61A 1Z3RA 2QG4A 4ZUTA 5AZUA 2F7QA 4QHLB 3HS0C 1N2HA 2CCJA 4GM0A 2GCIA 2A38A 2AZTA 4YDHB 4JBHA 2D62A 2Y77A 2OYSA 3RG1C 3WEMA 2F17A 5I24A 2R8RA 4M7JH 2ZSWB 2NPFA 2MR6A 3HG1E 5I17A 4Q9LA 1Y9JA 1B90A 1THCA 2AEQH 2AI0H 1VPWA 3PR3A 5JSHA 2Q6VA 3BYTA 4JVOA 4NQCA 4F8NA 4HBGA 3Q2CA 5IVNA 3CRMA 4IFTA 1MPTA 5IJVA 2B4TO 3AQDA 5A2JH 2HN7A 4KJQC 3RVDA 5K05A 4G1BA 3QIUC 3K32A 3AVEA 1UHVA 3V4UH 4FHEA 4NKIH 4YVNA 4M1WA 1XV5A 5F89B 1IKFL 5BS0A 2DLTA 3TJEL 2GLXA 4CQMA 3CVHA 4U1SB 1S4MA 3QXHA 4KXCA 2WZ5A 2PANA 2VWGA 1IGML 3AG2B 1MOQA 5JAOA 4JFPB 4KAQL 4U39A 4EMUA 2X22A 5TGBB 3UB2A 2PYZA 4PRNA 1PR4A 2DJIA 2D2OA 4KNWA 1T6BY 4AQ7A 2D31A 1XD8A 1ASQA 1HK6A 4ZUWB 1E3JA 3BPOC 2A9NH 1K4DA 1V43A 2TS1A 3JWGA 3ZKXC 4RKFA 2B5OA 1A6AB 3PE4A 4Q47A 1JEJA 1T9GS 2H2GA 3DUSA 4Z8FH 3FM9A 1L8OA 3DYPA 1ODCA 1KEPA 4BNDA 1P84J 4RIHA 1S7UA 1BQ4A 4AMVA 4X93A 4KI5E 2M2DA 1PT6A 3DX6A 3VTMA 2X0DA 4MUEA 2GBTA 5JCXA 1XF4B 5EXEA 2FX8L 3Q01A 4RX1A 1P9NA 4P57A 3MT8A 5IT5A 2ZE0A 1W85B 4QJ3A 2PH1A 2LU3A 2FL5A 3TDKA 4NSKA 4Y9CA 4RMNA 4H4CA 1OFHA 4Q9KA 4UJ5A 5CTJA 4LOLA 3DBXA 4UPEA 1INQB 5BVHA 3ARFD 4CEHB 4EJ0A 2FR8A 3CZGA 4FQCH 5ADHA 4QIRA 5K3FA 3QOFA 5DWQA 1QPPA 5DGHA 5BN3B 5CDTA 1CLYL 3LX9A 2W8BA 2QMUA 5ESVA 1YEHH 3I2IA 2IE8A 1HDYA 2KT6A 5ID0A 3B6SA 3PNVA 1MRDL 2MH4A 1F51E 4JB9L 2ZTSA 3IK2A 3AQXA 3CVHL 5SY6A 1C80A 1QOPB 5CXQA 1TFUA 5B36A 1YRWA 3LRXA 3VX4A 4DO6A 1CEQA 3OCVA 5I76A 1JPSH 4C6SA 4P2QE 1A7AA 2JH3A 2RGDA 5FV1L 2YGPA 2BGGA 3FHLA 3F7OA 3L3OA 3FBGA 5HVGB 4I55F 3HR5A 2DQ6A 1FCJA 2IGBA 1RTTA 3OFNA 1GTMA 4Q4JA 4PBRA 4Y2VA 3PUWA 3SY6A 2HA7A 4GO6B 4LNUB 1Y1PA 4ZQGA 4Q18A 2CR3A 1SIBE 2VKQA 3DX2A 1KI9A 4M93C 4D57A 2YPLA 2IIVA 2ACEA 1SXCA 2RKWA 4UTZA 2P6MA 4HA1A 1SZPA 2BKUA 3Q7PA 2RGCA 1I7ZB 4DCTA 3BQUC 4MAYD 3S8WA 3PDIA 1T1JA 3CA8A 3DPIA 4DM7A 1YZGA 3LQ1A 1RIHL 2FSEA 1JKJA 3R44A 2MOKA 2X2JA 1KJYA 2O30A 3NBNA 4P2RB 1QVRA 4XPFH 3GIDA 3MRFA 1EA5A 4OHUA 3LWNA 1HAUA 4A2WA 1BEXA 3SSMA 5E1IA 3FVVA 3SF8B 4Y2SA 3S37L 1TGYA 2EZ8A 2DQEH 3ROQA 1W75A 4IZ6A 3KVPA 4RSVA 1VPDA 4JKWA 4YSRA 1PZ5B 2K3TA 2XVMA 4E33A 4ZO7A 1HKLH 1NCOA 3NANA 2VIRA 4GMHA 2JFFA 3ENVA 1C3LA 3DHUA 1A9QA 3O7MA 1JHMA 1E7UA 5JTWA 1QF7A 4L28A 2EYSA 1ZGJA 2WTPA 3EYQC 2BVYA 4TNVF 3E3AA 4FFZH 1ZU4A 4X8GA 1A50B 3EGXA 5SX5K 2OCKA 2WQXA 3H2PA 1GZVA 3SDYL 1U3GA 2I99A 4QASA 4NHCH 2XKKA 2EZ4A 3C6ZA 1KJMA 2MSKA 4AZ3B 4CAGA 4N0RA 1VDMA 3VR0A 4GW4A 1X7XB 4TTDC 4NO0D 4ELKA 2JFXA 4HX5A 3CZPA 2PLFA 3TWCL 1RHUA 3R0MA 2I4OA 2VRCD 1UJBA 1ULSA 3NRPA 1V4NA 3OLYA 3RRJA 1FYHB 2JFHA 5KOYA 3GZNB 3EEIA 3DBSA 4GLRI 4PG6A 4M03A 5KTTA 4GINA 4R7DA 3LN9A 4F3RA 3IUYA 3SGKC 3QEQE 3GLIE 1JNYA 4H3VA 3WADA 4J49A 1ZIYA 5JY1A 2MMXA 5DJ8A 3VDAA 3RLSA 5DCUA 1P5JA 4NS0A 3BB4A 4TROA 2VL5A 3HN6A 4N2NA 3AM1A 5ID0B 3ZY4A 4BNJA 2OMUA 3DUSB 4OK3A 3CS3A 4F4FA 3V9CA 3PFNA 5B64A 2QSVA 3KETA 2ZYAA 4X90A 5IWCA 2OMEA 2P2DA 3KZOA 3GK3A 1M05A 4LWOA 4D9LH 4LPSA 5HOEA 3VXNB 1B73A 4PYKA 3MACH 1KCRL 1NANI 1SZDA 1W88A 1FZMB 2VJ8A 3QUZC 1YEJL 3W6UA 1QP1A 4HDRA 4NT6A 2GZDA 3FNFA 4TPRL 5AOJA 1D1SA 3ENEA 3B3AA 3RTBA 2H45A 1BEZA 2OJEB 1IHUA 1FMJA 1W85A 5JUEH 3NOXA 5G5DB 2ZJZA 3M6LA 3IMTA 4E41E 1MRDH 1ZVQA 2XKBA 1YRKA 2Q0QA 5LLDA 5IW8A 2WZQA 4KQ9A 2XYCA 2WCPA 3NCMA 2CIKB 1KC5H 1FU4A 5KKNB 5C9JA 4TTDD 5IZ7A 3GSRB 4UAGA 3S5JA 4TL4A 4B85A 3T1TA 4MS1A 3K4PA 1Q94A 3A31A 5J5AA 5SWZD 2FGJA 1S7XA 4QQRA 4C56A 3Q5EA 2Y7NA 5ALFA 4RA3A 3FYEB 3U4IA 2PR4H 3VM6A 4B60A 5T8KC 1W8NA 2RGAA 2WCSA 4L08A 3WBFA 3STWA 2RCSL 4LV5B 2FSGA 2WWIA 2R51A 1L5HB 4WJG3 3W78A 2O57A 2P5SA 4R8KA 3SCMB 3PFUA 1SDDA 2H51A 4AT6B 3GQBB 3Q06A 4G7RB 1LB1B 1VKXB 4GI7A 3ZT6A 4UAJA 3DX1A 2Y5TB 3AEQA 4FQHA 5J11B 1EAJA 2BF4A 1QFJA 4I0PA 3F74A 3HI6H 5C97A 3H6GA 1UP6A 2ZW9A 4R0LC 2PCFB 5JI2E 3BUDA 1DJGA 2OVFA 5JROA 4W6ZA 4MIKA 1T1WA 4POZC 4JOCA 3B8SA 4Y2OA 1NTOA 1X1QA 4MW5A 3LS5H 4UCQA 4BO1A 5I5RA 2H0QA 3P8ZA 3GJYA 4Z0HO 2KLRA 4OZFG 2C83A 1XU9A 5DHFA 3ZDYB 1JDZA 3ZJAA 4G9FD 5L8LB 5HI5D 4MW9A 2W59A 1J23A 5TV2A 1L9XA 5SWZA 2ECFA 1GYQA 1H6CA 1D3CA 2GN4A 3ZN2A 2ATKA 1NDMA 2EFYA 3AL0C 1EXMA 3HZZA 1CFQA 2A99A 4IJ3C 2GN2A 3QUSA 1IAIH 2DI8A 3TZEA 3CCFA 2BFOA 4ZHQB 4GX5A 4OX9Y 3PKJA 2HJRA 2HMAA 5C0NC 2W8BB 3AXTA 3QIBC 1YHYA 4CQLA 1ZISA 1KBQA 4KUGA 4WEMB 5ABDE 4XBPA 3RY6C 4AIZB 3WDJA 2GFBB 1U4SA 4WI8A 3GEMA 1QVZA 3PA6A 3K3PA 4UM8B 4N0UE 1UM6H 1IUZA 1KAHA 1YL5A 4Q52A 3C14C 5HYFA 4DAOA 1GRWA 2I65A 2QM0A 4C3VA 5EKDA 5D4QA 4CR8A 3PEFA 1PNVA 3KPQB 3FNKA 3RPIB 1E1RD 4B73A 4JITA 2YAMA 2APJA 3DAGA 5DULA 3IQZA 3D0LB 2DQTL 3GC3A 2R6FA 2I1VB 4HK4A 1G4RA 1QLWA 2EKPA 4I5GA 3BZWA 4BFGA 2N3ZA 1INDL 3S36L 5TMPA 2XYGA 1Q2XA 1V3LA 1KKMA 3WLFA 2Z35A 2PN1A 5AVUB 3UGEA 4DP6X 4K8RC 1E9QB 1U8XX 3F3HA 4WGKA 1F8YA 2X76A 1ND6A 3T7IA 1U8ZA 5EG6C 1FUYB 3PGVA 4GI8A 3TK1A 3QFDA 4V1DD 5EU3A 3TZVD 4O25A 4C89A 2E75C 4JPIA 4ZX3A 3ATFA 4NMWA 2J1ZA 2I5YH 4PHZA 2QTTA 1JGVL 1F56A 5CWSA 3ARBA 3RVQA 5BYBA 3KT6A 3D52A 4J12A 4LOHA 2F19L 5JNSA 1JZJA 3QWBA 5HKLA 5BV0A 2OAP1 1RH8A 4DV5B 4YIQB 4QRRA 4K9EH 3C5CA 3OX8A 1CUEA 1NU6A 9PCYA 5GZ1A 3EULA 3PHGA 1J1OH 1OB2A 1GPNA 3B12A 1G5AA 4ZUWA 4LARH 2KSQA 4E15A 2JZOA 3MAAC 1DEOA 3GXBA 4F3NA 2CNOA 1G2IA 4TSKA 5CCHE 4D0BA 1A5TA 2QNBA 2ERYA 2V0NA 3MTRA 3KGSA 2XJ4A 2CUIA 4UREA 3QK0A 5BT8A 1MVUA 1AUPA 3SBWA 1D3AA 4NP6A 2KB0A 4WDQA 2ZG3A 2XZQH 3U4AA 4ZV7A 2M6SA 3R75A 4G0UA 4KKAD 3WSWA 1ZHLB 2BK8A 4U6QA 3N0VA 2R0LL 4JJKA 4X6FA 2A58A 1OZHA 2PRKA 4FI6A 1Z9LA 3G02A 2C1XA 4RVOA 1ZT7A 4GRMB 3MV9E 4YDMA 1JR3D 4JDTH 4TRPH 4DEXA 3LOWA 4HEA6 4NQSB 1LQSR 3AUTA 3GGGA 2YUXA 1TJ3A 2IU3A 2P3LA 3H7IA 4BX8A 3C5XA 4N5EC 4DGIL 2N1TE 4B40A 3JQAA 1JOIA 4ELMF 3P32A 3WKEA 4GLBA 2I2XB 3T4PA 5DGDA 1V8DA 1JNXX 5J11C 2VSOA 2ZKWA 4EX6A 4O2AB 3C5SB 1KY2A 4ENTA 4I2XE 2X4NA 4F91B 1D5MA 1MJJB 4TYMA 3TVTA 2IMMA 1DVZA 4OZ4A 1VJTA 2NSJA 3HR8A 4NBSA 1EGQA 3WLIA 4BCXA 1W6WA 4C7OA 2C8LA 4J2HA 4FLOA 1BQHA 2PUCA 2P9HA 5EPOA 2IEDA 1NKVA 4PGBA 2B7BA 2MSNA 8LDHA 3NDJA 2XUGA 3BJ91 2GZSA 2IDCA 3AEQB 4KREA 5C0BA 1T0UA 2BSSA 4H17A 4XX0B 3L3IA 4BQ9A 1T3FB 2H6EA 2V5UA 3SPXA 2Q5HA 1ZVJA 2IOYA 1UBSB 5ANHA 2X9VA 3R6WA 3WMGA 3JASA 2VFAA 4CMMA 1M74A 1NBQA 1CZHA 1IQWL 4YMVA 1IVYA 3L8CA 2B7DT 1Z9PA 2PLTA 3ILQC 3SN6N 4QHUB 5IKOA 1TAHA 1SCKA 3EIXA 3TAUA 1UENA 4R1LA 3MWFA 1F3JB 3CGTA 4QFDA 1MRZA 2Y1YA 2QD2A 3SQWA 4X9XA 4R6XA 2GEVA 1R3UA 3GNQA 2AB0A 5I7WA 2P1RA 5TGDA 2AEOA 1QSFA 1WV7T 1G19A 3LPAA 1ONQA 4S1RL 2XOKA 5HDQH 3KYBA 2O0JA 3HDGA 4DV7B 4AX3A 4FYHA 4DPCX 2VR4A 1L9PA 3FONA 1NI3A 5IVKA 1SVNA 4MJ6A 4JM2D 3R6LA 2B1HL 2JA1A 3B20A 2ZXWB 1FZKA 5DM2A 1WUHS 4LI3X 5DEJA 3U5ZB 1G7HA 3SCMA 3I6YA 2R29L 3V4RA 4RDQG 1KQOA 2CGRH 3G5YB 4II3A 4O1MA 2B4YA 3TO2A 1GR0A 5FV7A 2K5UA 3IDJB 2YHBA 4HS9A 5AT1A 2ZSEA 5FL7D 3B9BA 4RJ2A 3DRTA 1CUFA 3WK6A 3NA9H 4TMPA 2X13A 5DQJA 5B2EA 3ONWA 3MRPB 1H6FA 4CKZA 1A6AA 1TCMA 2LCIA 2O3QA 1AZRA 4BQIA 3DTVB 1Z6YA 3ZVKA 3N5CA 3DMTC 5D6CA 3PYXA 1V2GA 4DLYA 3BC1A 4EIGB 3NS7A 4TVPH 1BD2D 2R4SL 5JIDA 3ILYA 4AZTA 3VR1A 4RTPA 3KQKA 1QRNA 2OMWA 1KIQA 5DLMH 2ORWA 1N12A 1SOSA 3GP8A 2JF1A 1E5AA 1MFMA 2CVHA 1R0SA 5IB5A 5GGRA 3BILA 3HFSA 3CCHA 1UWGH 2OXTA 2OSLA 3QPAA 1NURA 3NRFA 5D7SH 5KSBF 1OP3K 3K5IA 1W1UA 4IEEA 3KOWA 1VENA 1FMLA 5KS9B 4CL8A 4QJ4B 3GJTA