3UOAB

Crystal structure of the malt1 paracaspase (p21 form)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
378
structure length
364
Chain Sequence
MLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
publication title Crystal structure of the mucosa-associated lymphoid tissue lymphoma translocation 1 (MALT1) paracaspase region.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 100
structure length 364
sequence length 378
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00656 Peptidase_C14 Caspase domain
B PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uoaB02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uoaB01
2H4WA 3GJSA 5LU9A 4QUJA 4AWBA 3EDRA 4EJFA 2H5JA 1RHJA 3V55A 5JFTA 3D6FA 3R7SA 2QLFA 1RHKA 3ITNA 1RWVA 2K7ZA 3V6LA 3GJTA 2P2CA 4NOLA 3H11B 3S70A 4M9RA 5IARA 1QX3A 1M72A 1I4EB 3R5JA 5IASA 3BIJA 3DEKA 4HVAA 4EHNA 2QLJA 3IBCA 4NBLA 1NMEA 5H0IA 4PRZA 5IAKA 3R7NA 4EHDA 4QUDA 2HBZA 3DEIA 4IYRA 2FQQA 2QL9A 2H51A 5IBCA 4ZVQA 3DEHA 4N5DA 2C2OA 5LUAA 1PAUA 1SC3A 3R6LA 3K7EA 3UO8B 3IBFA 4HQ0A 4DCOA 3H11A 4N7JA 4NOMA 4ZVPA 1F9EA 4IEFB 4JQZA 3UOAB 5LU8A 4N6OA 2H54A 1SHJA 1JXQA 2HBQA 4NBKA 4PRYA 2C2KA 4ZVRA 4PS0A 2FP3A 2C2ZA 4QTXA 2WDPA 5IC4A 3QNWA 1K86A 1ICEA 2FUNB 4HQRA 4N6NA 3H1PA 1GQFA 1SC4A 1RWKA 4N6GA 3R7BA 1RHUA 5IAJA 5IABA 4FDLA 2J33A 3P4UA 4JJEA 1RHMA 2QL7A 5LUBA 4JJ7A 3RJMA 4PS1A 1QTNA 2C1EA 4I1RA 4QUEA 4JJ8A 3V6MA 3GJQA 1I3OA 2H48A 2CNOA 2J30A 1KMCA 1I4OA 1SC1A 1RE1A 4ZVTA 3KJQA 2J32A 4D3YA 3DEJA 3GJRA 1RHRA 2CDRA 4NOKA 1RWWA 1RWNA 1PYOA 4D3ZA 2CNLA 4QTYA 4QUBA 1CVRA 2CJYA 1QDUA 3NR2A 4D3XA 3H0EA 1NMQA 2AR9A 4DCJA 4EHLA 5IBPA 2NN3C 1NMSA 1SHLA 3H13A 3KJFA 4EHFA 4AW9A 3V4OA 2DKOA 2Y0BA 3OD5A 1F1JA 2HBRA 4EHHA 5IAGA 2QLBA 3SIRA 2XYHA 4JR2A 3NS7A 2XYPA 4JR1A 4QUGA 3V3KA 3R5KA 4QULA 4EHKA 5IAEA 4QUHA 4QUIA 3V4LA 1GFWA 3NKFA 4AWAA 3E4CA 4ZVUA 5IC6A 1RHQA 4EHAA 5IANA 2H5IA 2Y1LA 1RWXA 4FEAA 4JQYA 1RWPA 3R6GA 4NOJA 3KJNA 5K20A 1NW9B 4ZVSA 2XYGA 2H4YA 2HBYA 3D6MA 4JB8A 4LSZA 3S8EA 4DCPA 3PD0A 5I9TA 4NBNA 1RWMA 2CNNA 4QU8A 5I9BA 1RWOA 3EDQA 5IBRA 2CJXA 4FXOA 1IBCA 4QU9A 3D6HA 3SIPA 1BMQA 2QL5A 4QUAA 4JR0A 2J31A 3PD1A 2CNKA 1CP3A 4ZVOA 4N7MA 1K88A 1I51A 2XZTA 2C2MA 3PCXA 4QU0A 2H65A 2XZDA 3P45A 4FGUA 4QU5A 4I1PA
chains in the Genus database with same CATH superfamily
4LDEB 3EYFB 3EZ8A 1QIEA 1MFCL 4PWFA 3ROLA 5JWOA 4BQQA 2ZYVX 3ZOZA 2WWHA 4HAUA 4M8RA 4NBWA 5CX1B 2ED7A 2DYPD 2VDQB 1I4EB 4MCHA 2H3NB 2BVEA 4LCIL 2BFMA 5JXAL 1GL3A 5EIQA 4PZCA 4OZIF 3GSOB 2QZ4A 4C7OA 4EPVA 3QX7A 4JUTA 4YO8A 5TJHA 1XMJA 3UTTB 2LHAA 1G5RA 2CBOA 5CLIA 1D2OA 2QMEA 4KNVA 2O61B 4IDBA 4JJFA 2D0PB 1WRBA 2ZSJA 2YJGA 3GEEA 3C6EA 4XJVA 3K2UH 1GDDA 4MVJP 3FSOA 2D2FA 2ECOA 4Q47A 5J12B 4P3OA 3FKSA 4YSDA 3EPHA 1W0KA 2VHUA 5BV7L 1J20A 2G3YA 2WSMA 3FMPB 3VMPA 1ZA3B 1DAPA 3G6JA 2O6FA 4OSUH 3UTSA 1AI1L 1K6QL 2J7PD 2WIFA 1AK2A 2A4KA 1LS1A 2DWOA 2RGXA 1J1XH 2QVBA 4ZSOA 5HYQB 1L0BA 1NJ9A 4O33A 3BSHA 2GK6A 3V4FA 2C4FU 3FFDB 3P3TA 5H8DA 1NBMD 2YHGA 3Q9UA 3DL4A 4UVEA 4PY7B 3JXEA 3NJKA 3CMOH 2XB2A 1NMCC 1FIGL 4JI7B 2MMCA 6REQB 3GKWH 1BCRA 1OV8A 1V6AA 2IHJA 4KWIA 3AR5A 5DYGA 3JYOA 2RHLA 2EJWA 2ICAA 4W7IA 2O6PA 3O90A 4UOW1 4JEGB 5LYYA 3GUYA 3FOCA 1OZ0A 2DQMA 4OLVL 4EDWL 5M7EA 2CDEA 3KPRD 4GAAA 2MCFA 1THMA 3DHWC 5DQ9B 2FGWH 2MCMA 1SHXA 4ED9A 5LPNA 1VZGA 1G8AA 3RUIA 2ERCA 1JA1A 3DL2A 2IANE 2HIAA 4LSUL 1KVUA 3CIQA 3QNFA 4LDPA 4CDGC 3RL1A 3IUEA 1H4TA 3IEKA 1X8KA 1AHMA 2WB1A 1O6CA 1HRDA 3BH0A 4TOYH 3D9QX 4H31A 3BB1A 3ND7A 4LSTL 3TN0C 4FG2A 1HT3A 1KGIA 2QRVB 3ZE2E 2PD3A 3ZHNA 5FOXA 1SY6H 1ZU5A 1C3XA 3SDDC 4DLXA 1JNHB 5ICCA 3QLJA 6PFKA 3K9BA 2G83A 4MGHA 5CEZL 5BUCA 4F9PC 2IUEA 3TDKA 1EQWA 3OCXA 4JENA 3OH8A 3U0TB 1RQXA 1CHNA 4LRWA 4PX3A 5IMLB 2ROYA 1HYSD 1RWQA 2B25A 4MA8H 4DVBA 1RWOA 3RS0A 4ZYXA 4WIAA 4LXGA 1FSKC 1BXRA 3KZCA 4EAQA 1RVFH 4WHTB 2WBWB 1FYTD 1RAAA 4JE0A 3MLXH 3I30X 5EINA 3AKYA 4BXVA 3PIQA 4IBUA 3TZKA 43C9B 4ICIA 5EIEA 4RTMA 4D8XA 1G4MA 1IC1A 1KMQA 1YASA 1I9IH 2FDCA 4KK4A 3G6AB 4W9DC 4K3UA 2V1XA 1JEEA 3PNOA 5AFAA 3BXEA 4PGEA 5IASA 1AS2A 4LHWA 4EUPH 3VFSA 1S8DA 2DR0A 3V33A 5L0QB 1RVDA 3E3MA 2PVSA 3EAKA 1YC5A 2JC3A 2J48A 4JXKA 3ARZA 3RPIA 2A5YB 4KI7A 4LSWA 1ZD1A 3EX7C 5D6NA 3EWNA 2EX4A 2CIKB 1Y5IA 4QA9A 4BL5A 1RRFA 1SU8A 1E6JL 1FVCB 1VCAA 2YWRA 3BWSA 1Y1DA 1N4XL 2ZWOA 4NJ9L 2V7NA 3C5WP 3DBIA 1Z62A 4G42A 1Z9OA 1U93B 1CF1A 2Q8AL 5JRDS 3PXXA 1J1UA 1IXSB 1NC4A 3ULUD 3WL7A 2QN8A 4O58L 4PR3A 1NWOA 5D7IE 3MQ2A 4IOIA 1E4EA 5E7IA 2FJSA 4RX1A 1G41A 1JRHI 5REQB 1O5OA 4HU2A 4U6YB 1S3KL 3VXTA 3BYZA 1XF3A 2GTQA 3GGSA 1W9HA 1KZ7B 2FH6A 2N01B 1T10A 4CG1A 2XUFA 4ZQGA 1WFUA 2DM2A 4L3EA 4P5MA 4X44A 3VXSE 2XVZA 4J3BA 2CZGA 1NGWB 1RAHA 3VTKA 4FLEA 4WNIA 4U2DA 4WVLA 4ORGA 1RHJA 5JH7A 3AU8A 3QWRA 3YASA 1RIUL 3VXRA 1TJPB 1A7KA 2ZP8A 3UCQA 4LHVA 5BN3A 1CUUA 1NSFA 1VLJA 3GZNA 2JCCB 1HQRA 3KYNB 1BU5A 3WMEA 2K3HA 1JCKA 1NCTA 1Z4PX 3SJVA 2FIKA 2WSYB 2D3NA 4AQOA 2R4RH 2I4NA 1BMDA 1O4WA 3H3BC 3PE3A 5I7UA 4Q4CA 3HO1A 3EXEB 4CUZA 1TVCA 1K86A 3S5LA 1H5QA 4J3FA 3WFHA 4YXLH 4K4KA 5HGDB 4D9LL 1A25A 2O2IA 1NBCA 4K8RD 3DAFA 5ABPA 5D7EA 2YYSA 4UBKA 3T95A 2JKXA 3AEQA 4D3ZA 2ZBPA 3DSFH 4DCQA 5D1QB 4NG4A 5IUNC 4ZW5A 3KLAA 3NZHH 3EB9A 1SGKA 4P4UA 4YZWA 1F51E 2E85A 4YZFF 1E5QA 5K2MA 4UVIA 3IEXA 3FH0A 2CXRA 3U9UB 1XTMA 4Z78B 1Z8NA 3U7RA 1QNLA 4F58L 2PAFA 5F73A 4J1NA 5LQRA 4ZS6D 4JKOA 5BV8A 3S35H 2VEOA 5HHME 3CXHJ 3VXUE 1B00A 3IQEA 4WGGA 2WYZA 4NBNA 1CULC 1XN4A 5D2LF 2X0FA 1G7JA 4O4YH 5D1HA 4ZZ2A 4UAVA 4X65B 5C51B 1T2XA 4DILA 4G5AA 1JQKA 2LDXA 1KN2H 4TKLA 4EKGA 5JJKA 3UT5B 4EKYA 3M89A 3NABH 1KTCA 4R7XA 1TCBA 1E1QA 1BE6A 2H92A 3QM1A 5AW7A 4GAFB 1X92A 1NUAA 1WFNA 5B5SA 3AB3A 4B2IA 1I2BA 4QRPE 3SE0A 5D72H 3GARA 5KVVA 5JHGB 3TA3A 5DULA 2BIHA 1CGSH 1MAMH 3T09A 2KERA 3Q88A 1RK0A 2GETA 1P4RA 3Q3JB 3CW8X 2YKGA 1Z6XA 3LRMA 2VRCD 2PMEA 3Q9PA 5JSFA 2MYUA 2J32A 3VSEA 5CJPA 3O9MA 4G0NA 2RAMA 1JFLA 1U80A 4EYKA 2I2FA 3IAGC 3I62A 4ELMA 4LHJB 4AXXA 3P9YA 3Q5GA 3VDBA 2OUKA 4BECA 3ZJ5A 5JW4N 3C3YA 3O9WC 3T0ED 4ZICA 3D39B 2YV1A 3EYOB 3AOGA 4G4GA 2IOIA 3N0VA 3SPVA 2LTAA 3SN6A 3T8XB 1DQPA 4OZGE 3AY7A 4IDOA 1M0EA 1OTTC 4UOQA 1BXZA 5F96L 3GDOA 3KQKA 3EUAA 5TDPB 4FWTA 2GFHA 5K3FA 2AG1A 4KJQD 3EO1B 1AURA 3OQJA 1F14A 1BVLB 4IGIA 2HQOA 4MMZB 5HPOA 2X0UA 2EGGA 2RBKA 1OKKA 3A1SA 4DS3A 2HA2A 2LQRA 4Q1EA 4BN4A 3KXFD 4XE5A 2HL6A 1QOKA 3HRZB 2X8JA 3H2PA 4PC2A 1VYVA 3B6ZA 4PJ9D 3STBA 2NU8B 1XQYA 3ZN2A 1TAGA 1DJIA 4C56E 1U92B 4MWGA 5BN4B 2HWYA 2VTBA 2O05A 1JZTA 4M1SA 4Y6RA 4I4CA 3JWEA 4MUHA 4US1R 3P2YA 5C0EB 1HSAB 5EZYF 2VE6A 1A0QH 4GOMD 4MPPA 4ADSG 3T2OA 1L7QA 3NA4A 4BHUA 4HIXH 4PFKA 5MEPB 3EVGA 5CSBA 2BVNA 5A05A 4B09A 3QG6A 5HHOE 2F1HA 4S1QL 3AUWB 2XXMB 3P30H 4KJYB 1C4WA 3ORQA 5H37G 2QRKA 1M7XA 2AJYH 3SKYA 3EZYA 3HMWL 3ASNB 1B7GO 1M7BA 4Q1AA 1UMDA 3MSCA 4CADA 4IJKA 2UYHA 4LRQA 4D96A 2ZYUX 2MSCB 1QHFA 1HOEA 1BN7A 2Q9AA 4GGOA 2NU7B 3R7AA 1JW9B 4QFBA 1ZQ9A 5KOHB 5I66A 3TEWA 2XDYA 3W05A 1VFMA 4PJ7A 3F7MA 4OV5B 3BGFB 5LM3A 2C2BA 1GSOA 4LRTB 2JJWA 3W06A 2WGNB 3X1KA 4XCYA 2Q50A 5DBFA 4L75A 1AO7B 2IYOA 1XGZA 1W76A 1XR8B 3DETD 4FTVA 3ED1A 1R4NA 2BM0A 1OKEA 4BFZA 4MDHA 1U28C 3WHE0 1NYRA 2H2PD 1L5QA 4MB5A 5CM1A 5CEYA 4HB0A 2HMUA 4HG4K 3ELUA 1DU4A 4U4BA 3S3SA 4KPHH 3IQDB 3O2JA 3V0JA 2DP4E 4TSCH 4UTAH 4JLKA 1WEJH 5TQ0L 3WIFA 1BVKA 1DX9A 3O8LA 1UJ3A 3BPOC 3O2WH 1CXIA 3ESNA 2FZGA 1ICEA 3STUA 4DR2B 2P43B 1ZAGA 2C5SA 4Q9RL 2C5EA 1YQDA 4AEHH 3BEWA 3GNML 3QORC 3IFNH 1QO7A 1U4FA 4W5NA 3OZFA 4MPJA 1YOVB 4AMUA 4QRSA 2EYRB 2QVFB 5JDSB 4B97A 3F7VB 4K86A 1SOQA 2CO7A 1U42A 4EI9A 3OJOA 1N1GA 3C5SA 3PWPB 1MOQA 2OCPA 4NQDE 2JVKA 2VFAA 3ARDD 3IEUA 4GXNA 3HI1B 1DBJH 1M10A 3H0TB 2NG1A 1FQWA 4CMIB 3O8BA 4YMTA 4FQPA 5JAOA 1KT2A 2N4IA 3G0OA 1QQDA 3MA7B 5G3YA 1Z3CA 4A5SA 3P45A 4LCVA 3ZQUA 3S1AB 3GTVA 1IGMH 1BQLL 2IEDA 4IOLA 5CDFA 4DR7B 1R5OA 1IC7H 1R8YA 3KPYA 4YALA 3S2SA 5DOVA 4KPUB 2BC4B 2PO7A 4Z6KA 3TW8A 5IMKA 1NJ2A 1LKZA 4TSAH 1R3IL 4GLFA 1I3KA 4B7ZA 3X13A 1ZJBA 2QN7A 2W0SA 3OURA 4V0NA 4F8JA 5F0PB 5LA6F 1GPYA 1EZVX 3GVPA 2EFDB 3WMXA 4LJAA 4ZPTA 2GBIA 3BWAA 4N0RA 4RMTA 2LR4A 4B81A 2YOCA 3HNVH 5ELIA 5A3RA 3FC8A 4C0HA 1CVSC 1UA7A 3ZE0E 4JLDA 3VPFA 3BQNB 2QSCL 4NZNA 2AFNA 4N8VB 1T1WA 3O1LA 2IEZA 3RFZB 1E4OA 3A6OA 3UATA 3SDCA 4MCYA 3LYLA 3QKIA 4MAUL 2GJAA 1Z0MA 2Y9MB 2BNRD 5JD3A 1ZKDA 4EYSA 1BQ4A 2X1XR 4FJ1A 3GTNA 2C9QA 3SR3A 5KYXA 3BZEB 4FQ1L 3S28A 2NUTA 1FL5B 2ODWA 2ADOA 3QIWC 2IHVA 3UJNA 1LJUA 4ZHSA 2ZCZA 1ZMRA 1S78C 5AOJA 3EK2A 3INGA 3ZQJA 4O4IA 3QOFA 2JI1A 3NQIA 2J41A 5E2AA 1XZGA 2RD0A 3T5PA 5SWZD 1VDMA 4ACBA 5DU7A 1KL7A 2G2PA 4GI9A 2QUKA 5FA3A 5CBEA 5KTRA 1QGOA 4ARZA 1I31A 1E3FA 1J7VR 1NCIA 2JGDB 4HU8A 4L76A 2J4WH 3HC2A 3R3UA 2JGMA 3I09A 4GOOD 1SN5A 2MIZA 1N2CE 2GXQA 3PFHA 4PJDB 4NICA 32C2B 1LBQA 1IAOB 5DLQC 4G8IB 3PC8A 5FKAA 4YXWD 4GFXA 4OLFA 5ALLA 1USQA 4XP1H 4MQBA 5L2KA 1FX0B 2G80A 3O3AA 5C8XA 3VR1A 4Y1TA 4KKCC 2Z2YA 3TJZA 2WLLB 3PCTA 2WQ8A 3LA6A 4PB9L 2QMYA 1BP3B 3IU3A 1BMFD 2KHAA 1G0YR 3CIAA 5DT1H 1IQDA 3KJ4C 3RREA 4B6RA 1JZ8A 1PWHA 1ULHA 4K7PY 4KQXA 2PABA 3MWKA 3T1OA 2HTKC 3DIDA 2A9DA 1RJZB 4WI8A 1YC2A 1F4WL 4RMHA 1LTKA 2N46A 1TPXC 3K5RA 4Y2PA 4LECA 4C4TA 3D1LA 3VGFA 1YPZE 4U33A 2WP8J 1CY4A 3LV3A 4WTZA 1X9QA 5D7JB 2DH2A 7AT1A 1MW0A 1Z3GH 3ALXA 3MMSA 3HR8A 5EE9A 1T9GR 4O02A 1E2MA 3O4GA 3C60A 3FYUC 4RMSA 4PAZA 2UZXB 2IO5A 3LIPA 5IARA 4OKVB 3EF0A 4TKUA 3IAM1 1B1AA 5CGMA 2JLUA 1N2ZA 1WPRA 5K8IA 3F5FA 1SEBB 1Q2XA 3S6JA 4KOCA 3KB2A 1M0SA 3E38A 4ITVA 3TN0D 5HKKD 4Q39A 2R29L 3MV8A 1KEEA 4C14A 4RAUA 4RH0A 1EUTA 4PYGA 1BM3H 4HBQA 1E9BA 3HN5A 1JXQA 3U81A 4AXWA 4C7KA 4LVNC 3LPLA 2EYTB 4UULA 3I1FA 1VECA 4L50A 4OB6A 1PSKL 5FGSA 4C21A 2Z93B 5GRWA 3U7QA 4B8WA 4TS9A 1U8MA 2IIVA 1DBML 1NUFA 1LA2A 2B4RO 4LVUA 4Q82A 4GP6A 2OCYC 3UXMA 2F67A 1MCRA 1IVYA 4KU1A 2V9TA 4X6CB 4ZEVA 3WLHA 1U7HA 4CKEA 4LGVA 4QRBA 4PCYA 4KN6A 3EQ8A 1EWYA 1OQOA 1S5HB 1EVKA 3B7YA 4Q93A 2B1HL 3IJHA 1QUFA 3HZOA 1LK5A 3DB2A 3O4LA 2HQBA 1QEWA 1S1MA 2WF9A 2REXB 1P1RA 1R5BA 5T1MA 1VDZA 3NAQA 3Q48A 2WYUA 2ZE7A 4A39A 3R7RA 1E8NA 3GJXC 3F5SA 2X0VA 4NCDA 5T41A 1UG9A 4NGHH 3L3OA 3O6ML 1M6VB 4PGZA 3FM9A 2UYQA 4B5KA 1CJBA 3FO0L 3TBTA 4NJAL 1RERA 2Y1DA 4GKNB 4J91A 4DTCA 4P58A 3CSFA 5DMYA 3SZGA 4AIZA 4GPAA 2TSBA 2FJFB 4NZOA 1OZAA 5D1XE 1H93A 2ESRA 4CF7A 4IKKA 1OB5A 4X1KB 3B2VH 3GRWH 5L7YA 5LXTA 5IXSA 3BK2A 5B1JC 2PX3A 4ND6A 4QEKA 4UDUA 2JZOA 2OTWB 4JLAA 5BVJB 4LDAA 2ICWJ 1ZZGA 1MC1A 3DBOB 4UBOA 2GS9A 3IGAA 1Q9WB 3R06A 1R34A 1I01A 4LF7B 4HUQB 3CAFA 3OKFA 2DD8H 2AMGA 5DD1L 3UBTA 3SHQA 3ZE8A 4KKRA 3L7OA 4QHKI 1NFRA 1JUFB 3OPYB 2PYEB 4CIDA 2JH8A 5G1PA 2QUBA 4LVEA 3LKPA 1YKFA 3AOEA 1HDMB 1CLZL 4HWBL 2RGRA 1E63A 3AL2A 3N2EA 5K20A 4HISA 4OBRA 1TG8A 3U7HB 3A9SA 3QUML 4K5MA 1IEWA 2BVYA 4MDRA 4QRDA 4DNQA 2UYLB 2X2JA 3JAKB 4AJ2A 3QUAA 4LWZA 4M3KB 3JSXA 1PV2A 4XC3H 4PQXA 4FFBB 2HB6A 4EDHA 4NQQA 4YGXB 4XZ4A 1B0PA 1EGJL 4B3IA 1SRRA 4QYSA 4AURA 2VMFA 1LV8A 3OJVC 4ZTUB 3ZTNL 3T0GA 4DPCX 1U91B 1VE3A 3VZCA 5I9QB 5EV7A 2JKLA 5KOMC 3PJFA 4G24A 4JBWA 1IMHC 1CICC 3U9TA 3KWFA 4DTGH 3QVTA 4FD2A 4YAQA 4B96A 1RZKH 1S0UA 2PF6A 1DC6A 2QT6A 4OGYL 1NR7A 4JI2B 3PQYB 4Q4JB 2C8VA 3L4JA 3CFKA 1I9GA 1H2WA 4D79A 4S12A 3QVVA 3KS0J 1V1RB 2JZNA 3D0VA 5HZKA 2ZI6A 5F1OB 1JSXA 3UTPD 8MHTA 5D2NB 2XRFA 1E28A 1KYZA 5JW4M 5I3ZA 2BF4A 3Q7RA 4ZDHA 1V96A 4LNVA 3SQOH 2ZX8A 2O5CA 4WI2A 1UOEA 4G1EB 1L7RA 5I75B 2O5RA 1Y9ZA 2IZ6A 2OXEA 2CMKA 4L5JA 1MX1A 4LOFA 3H4IA 3EUWA 4JG5A 3GLHA 2OAAA 4EMBA 1BPVA 4XN1A 1MHEB 1WLHA 4FFWD 4FZ8L 6YASA 1MO3A 1VI6A 3DFIA 3IR6A 1F3JB 4X5XB 3OF2A 1R18A 3W7VA 4N8UA 4NLLA 2WC7A 1JG1A 5HQ3A 2AMLA 3EVDA 3BJ91 3KYOA 4MLIA 1JECA 1F11A 3HUJF 5A4IS 1OLSB 5GJVC 2DCMA 4G6KL 2CGRL 3BD6A 4PU2A 1FSPA 3NBZC 1MO5A 2Z2JA 4K23H 2VITA 2OZVA 4EH1A 3SE4C 1R5WB 3RIAK 2C4MA 3P5SA 4PO1A 3HZKA 3HE7C 1B0UA 1FFDA 5BN1A 2VDQL 3ZHDA 5ADOH 4N2FA 3CFBB 2AJBA 2YARA 2ZP0T 4X6UA 4XJXA 5IG7A 4CT4B 1XRJA 2MSPA 4WZ6A 3WFJA 1ZIXA 2R8SL 4PLJC 3RUGA 3D3VD 3TIDB 1E2UA 4TZ6A 2JSFA 2XNAA 4EZIA 4FC6A 4JSTA 3C5EA 3G5UA 3AS3A 3EJTA 2YWXA 4AZ0B 1APBA 2DWEA 3DRQB 1R5VA 4CSSA 3O9WD 1LO3H 2JF0A 2OR7A 4OB8A 1RCFA 1AQNA 4GX5A 4AG4L 2GOYA 2XYHA 4RMRA 5ER6A 3CN2A 3PYMA 3QSYA 3QQ9D 2P5EE 3O4FA 3R40A 3N2YA 5JLAA 4QYTA 1OTTD 2VPIA 3GMQA 4DN4H 3SIWA 3P11L 1FNNA 2YNMD 1HBJA 2NO5A 3LQZB 3EXHC 2WTOA 2WWRA 4Q7QA 4N5MA 3ZDAA 5EULV 4FMFA 4MWOA 4IMLB 1U2CA 4W5JA 3DXXA 4P4SA 1XXHA 2IOFA 4Z9AA 1VKZA 5C1BA 2HVKA 3N8IA 1MQ8A 4HUUB 5AHOA 2OGZA 3KR3L 2WBJD 4UM9B 5C09A 5DU2A 1CLYH 1T2JA 5BS0D 3D6FA 4QXOA 2BW4A 1QIDA 2AC0A 3DCNA 3C3XA 4PLCA 3B2PA 1P9RA 1XVUA 1ISPA 3P9LA 5A7BA 5AKVA 4Z0TA 2PR4H 2I55A 1LFDB 1XTSA 2F1EA 2E6JA 4LC9A 4Y19A 2YQ2A 5ACMA 2VO8A 4D3CL 4OO3A 4OLZL 1IPFA 3SOZA 5CG1A 2OAP1 4TN9A 3CDZA 3G5ZB 4WEBL 1MJGA 4PV8B 4NQCE 1IQWL 5FUXA 5KJ6A 1XD1A 2XKNB 2B4CH 3WE6A 4TVSA 1S7QB 1QIFA 2P46B 2IZZA 3NNNA 4TSBH 1V10A 3HZMB 2BI4A 1SG6A 4GBXA 3JWDL 4C4UA 4OCYL 3OAUH 1WVIA 1GAWA 4IM7A 2OS7A 1QG3A 4S3MA 2FP4A 5DK0B 4Q21A 2J0SA 1W2GA 4FG0A 4PRPE 5GS2H 1XBDA 1IY2A 3PNLA 4DF3A 5BSMA 1UCTA 5E2IA 3STLA 5BYJA 3LWBA 3VV2A 4DETA 2XGJA 1T43A 1FP1D 2XLCA 3K1DA 3L2NA 1AOZA 3TKYA 3BCFA 4BC1A 1JXMA 2IV3A 5H1YA 3VUEA 3PUWA 3ZX5A 1JHUA 4JRYD 2ZW9A 1SUEA 2R6ZA 3DEZA 2JA1A 4M7KH 4HTAA 1JHRA 1G18A 5TK2A 2VP6A 3LW8A 1W0VA 1JB1A 3O81A 1T1XB 2L7JA 1BZ9B 4GLRH 2KZ1B 4EY5A 1DG1G 3B48A 3OTHA 4R97B 1TM3E 3QXDB 4M1KA 2A4MA 3AHFA 1OANA 1QASA 2GBAA 3OO1A 3WS3A 2EYUA 3JX9A 2VJDA 2XGSA 4C54A 1DBIA 4QVGA 2A3RA 2HHJA 2DQCL 5FO8A 1IOZA 4MS1B 4HZGA 4ZV7A 4ZT7A 1U2TA 1MJ8H 2EL7A 3L4TA 4W9NC 1F4XH 3T35A 2A38A 5EHZA 3B1FA 3GAMA 5INTA 2GC7C 4NUJA 5AK4A 4PM1A 2EIMB 4IBOA 3THYB 2XTJE 3UERA 2E55A 1HE2A 1RPAA 4W9RA 1G84A 5GGUB 1QRKA 4AQEB 1JWUB 2RJOA 4RM2A 2B98A 2QX6A 4MV4A 3O6FB 5DYOB 2NGRA 3MGBA 2HQ1A 3QORD 4OLXL 3HK2A 3BT0A 1TADA 3CM0A 1Y8RA 5J9PA 1FYFA 1FE8L 4NIYE 1BVUA 2W42A 5FRDA 3EJRA 1VKHA 2ZIXB 2CXHA 4B7IA 1CQIA 5C7XL 3EG5A 2VZ9A 4LE2A 3ZDZB 5A4KA 3EA0A 1ZSHA 4WEMB 2I76A 2XWSA 3KVPA 4HI0E 4ARCA 4C78A 3FB1A 3H87A 1QANA 3I2CH 5EBLB 1SVIA 5B4UA 5GPRA 1H4QA 1RPUA 1TZKA 2NM0A 1Z75A 1F0LA 5TDNB 4D0CA 2IZ1A 2XGOA 3CBKB 4GXRA 5I16A 3IRCA 1OK8A 3WLWD 2NNFA 5T6MA 1U3CA 1PNVA 4DO4A 5C0BD 3B12A 2RG1A 4XNQB 4YIQA 1XWWA 4O5LL 4I0PD 3DKRA 4MRPA 3EIHA 2QYSA 2GJ6E 2OTUA 3QFGA 3UNXA 4EBBA 1KELL 2DICA 1PRYA 2FFJA 1OALA 2E56A 2XXFA 1Z83A 5CM2Z 3PQ4A 4HFJA 2QSVA 5ESAA 1QFZA 5I7EA 3ZYZA 1C8KA 3SZUA 3FO9B 1AKJA 1G4HA 1ZT1A 3H11B 4DR1B 3ZT6A 5BSUA 2JVIA 2XUKA 1C80A 4FFZL 1G6Q1 5ICYB 3ME0B 4M6AA 5HVWA 2HVJB 1EH9A 2RH4A 2A7QA 2H47C 3OQ1A 4FXPA 1WD9A 1U58B 2QTGA 5D3MB 2ATPA 4TT3D 4HD5A 2ZJAA 1M6WA 1WO8A 5IT2L 1OM3L 4Y8VA 4JFDE 4JHLA 1IAQA 1J5DA 4O5AA 2I22A 2JLXA 4N25A 5AM0A 3RX9A 3ZCTA 4G70B 4W9JC 3I9IA 2FSPA 1JVBA 4NJEB 4PX9A 2QGCA 3PQCA 5GRZA 3QIWD 5EE1A 1PJWA 3RIFF 3V1UA 1W581 2YEZB 1I3GH 1S78D 2FJUA 4KR0A 4B7CA 4N3AA 3UA3A 1M2NA 1PMYA 3HHSA 5DC9B 4IIFA 2XYGA 3DHNA 2WVVB 5EXTA 1E7QA 5LBSL 1YY9D 4GQAA 1MVUA 3JQ9C 2Q7DA 3PDDA 4ZN6A 5CVEA 3VFOB 4KVNH 4HDRB 4FDMA 1NHWA 3T61A 3OZWA 5JHLA 3GXBA 3QZWA 2XBDA 2JK1A 3MWEA 3OEEA 2XDWA 4ZOEA 5ICZA 2X0NA 3CDFA 1C1DA 4BB6A 4JDPA 4GRAA 1YNTF 4LPSA 3U4MA 3BVNB 4M22A 1G9HA 1NFDA 1JZ2A 2E7HA 1L3CA 4LFHG 4I3SH 4Q6YA 3GB7A 3KVRA 1JIXA 4YUYA 1R0LA 1IBKB 4G5ZH 4R51A 3DVQX 2ZWLT 1Q91A 4X8XA 3LV8A 5KC9A 1QLRB 4BE6A 1QRDA 3HG4A 3JZMA 3UXHA 1AVTA 2C4TA 1K6IA 5FW6A 4C0KA 1UD2A 1DJXA 4QXAA 1IKFL 4RIIA 1H42A 4B1FA 2FLRT 3NGMA 3PV0A 4KBFA 4JKPH 1M34A 2IKSA 2QM0A 4YHIB 1C7SA 3T9DA 1KERA 4N5HX 1VLZA 1UWVA 4Z7QF 4X3CA 5AAPA 2OL3B 4MVCA 1GR7A 4Y9FA 5F9DC 3HNTH 5DNWA 2HTKD 1FYXA 1S9HA 4OL9A 3T0AA 1QH0A 1E2ZA 8GPBA 2RHGB 4F2PA 1U0JA 4BXOA 1TFUA 4AP9A 4LOAA 3KQHA 5HGAB 5C3LD 4BMNA 3VQ2C 3O74A 4MWDA 2VLMD 4YAGA 3O94A 1CMOA 1EYZA 2YIVX 3KV1A 4OHCA 5HM6A 3ZWAA 3WKML 3NALA 1KPVA 3FLAA 3VDXA 3QVXA 4NO5A 3ZI0A 2ZCHL 1MA3A 5EUOF 2ZGVA 2N7SA 3BHIA 1U8AA 3ZTWA 4PW9A 2O5VA 1P7ZA 4A4DA 1ZQ1A 2E27L 1CY7A 2I26N 1GZ6A 2NZ8A 4NN7C 4MLCA 3UMMA 3AAZA 1XBTA 3WRVA 3BFWA 2NY4B 1NJFA 3RPBA 1U7WA 1F6LL 2AW3A 2X1QA 1L4UA 4E03A 4EA6A 3PAZA 2IV8A 2UXFA 3VM6A 4UZSA 4PJXA 2CMHA 3LAWA 4QJ4B 3ZKXC 5IWCA 1G7QA 3X11B 1ZTXH 2R00A 4WI0A 5DN9A 1HNFA 1F5SA 3H2GA 4OPMA 3I04A 2FK7A 1SC4A 3L3JB 2D4DA 5MDHA 4QXRA 1XCQB 1SUCA 4PG9B 1RQ5A 1ND5A 5L95A 4MYPA 2XZPA 2G4EA 1OT2A 3FNEA 3BTSA 4YEFA 3PICA 1MQKH 4WWID 4CEJA 4WT7A 4BIKA 5E2TL 3NRBA 4HMPA 2RGSA 2BO0A 1FFXB 1U36A 2ZP9A 1AGNA 2XKAA 3RDTD 1X5ZA 3KOOA 1LM8V 1VL1A 4PW0A 1SBNE 1GJWA 1REQA 3T5TA 2PP9A 3QIBA 5F6HJ 5CCDA 4ABWA 5ELXA 2FF5A 3WOVA 5KVQA 1FYEA 3QWOA 3OKMB 4FLFA 4TMKA 2AUNA 3QWNA 4JZOB 2ZT8A 4X98B 2NPOA 3HI6A 2L04A 3T3PB 4DFHA 4U31A 1NDTA 4M2LA 2FPGA 3EDQA 2GO7A 2SKDA 2R27A 3LUKA 4IIJA 3Q6GH 4I55A 4X9XA 3UTQA 4JI5B 1ES9A 5TTRA 2W90A 1BJKA 5JARA 3BAEH 2RQEA 1C7JA 3NVAA 2RAUA 4W70A 4MR8B 1U81A 1SEQL 1ZH2A 2ZEJA 3RGHA 3ZRCC 1MBZA 4AYTA 4C7OB 3HV2A 2I25N 2VP2A 3CFCL 5T67A 5LMUB 1XKTA 3SGDI 3K8OE 1AE1A 1XNGA 3A3OA 5DGRA 2FEJA 3E82A 3NXSA 2RHOA 2H2WA 3S34H 3W9UA 1QBAA 2NZUG 3IAQA 3KBEA 2P9YA 4NOBA 2DWPA 4M1EA 1AC6A 2CO1A 1HEZA 1X39A 3IT8D 1YQGA 1HL7A 2PCJA 1XKQA 2WDPA 3E7WA 2HQSA 5DWUL 3CLRC 3NJHA 1O1YA 3ZHTA 4F96A 3G6JB 2FUG6 3ZU4A 3HHRB 4WHYG 1GRVA 4U6SA 5HTOA 1OXKB 3NLLA 1L9OA 4FI6A 3SPJA 4ZSOB 1ZGHA 4C0QC 2IP4A 4IVRA 2YCLA 1YJXA 1Y0LA 4K3VA 1EJBA 4LQFL 2JA2A 4JUFA 2XQBH 2QPLA 2YUVA 4HGWA 4BAUA 4Y1AA 1KLFA 2ETXA 2PT6A 3JVUA 1SHMA 2GUOA 3L4BC 5GY7A 1L7PA 4Y4FB 4JREB 1OLUB 5LMZA 3QE4A 3MODL 4P3CH 2PZFA 4LJSA 2QKSA 5EVJA 4PVLA 2F19L 4B53A 4XR4A 1ZGZA 3L84A 5C8DA 3UJ9A 2FWOB 3S7TA 1V0JA 1SM3L 4D8VA 2CDEB 2H6OA 2PV0A 1JMKC 3TT3H 4NHCH 5EOQH 4N7MA 4CIVA 1J0YA 1K88A 1BVNP 5I0VA 3EZ2A 4AAYA 3ANTA 4B33A 4DZTA 1NPJA 4M60A 4KQIA 1BDJA 2A6PA 2QAGA 4CFYA 3RL1B 3RAPR 4HADA 1T03H 3GUVA 3TJRA 3B7WA 3BEOA 2AZ4A 2ZKWA 4C0WA 5CM8B 5J6SA 1A4JB 3MLZL 2YXEA 1A9RA 1NXVA 1OU0A 1TAQA 1G8PA 1D8AA 1I1RA 2CLIB 2ZSDA 3RKDC 4F45A 2ADYA 4GUAA 3W3AD 3ARSA 2PXYD 5JA8B 3OQBA 3CO0S 3L18A 1K2VN 4MI1A 3E9RA 4ODIA 5FNVF 3APDA 2ZRQA 3ZKWA 2W2VA 4AUEA 2MSWA 1LE5B 4Y4KC 4CMHB 2VHYA 5CD3A 4JT2A 2GM4A 2HEGA 3LPOA 1SXIA 4BNZA 1M9NA 1F13A 4IBQA 5E6IC 1W88B 4EIBA 1QGZA 4HUVA 1FQOA 1BXRB 1NVMB 2IYLD 4EN3D 2D5IA 3T9CA 1YZKA 3AP1A 4QYWA 2VXSH 1K66A 3PIQB 5A3VA 1DBRA 3JWJA 3CJJA 4KRPB 1B6GA 2CO4A 3BIOA 4RZQA 4YHYB 1JTEA 3BRWA 2H6PA 3L7EA 1WUIS 4IH9A 4AY3A 2XQYA 1QZUA 4HDIA 3HBQA 1GRRA 3I6LE 4PGEB 5FWRA 1PLKA 5AJVB 4LPUA 1VL6A 2VSOA 2DSTA 3VFSB 3OF3A 1S8DB 5AKRA 2XB9A 3IE2A 3NHYA 4CIXA 3PFCA 3W5JA 2ZBGA 2XB4A 1JR6A 3HE7D 1FTGA 1I1HA 5KCMA 1W4AA 3RPIB 2DSNA 3N42F 5HGBA 1MREL 3C7CB 4XZUA 3C2AL 2PP8A 4H7VA 4U7KA 5MENA 5EUKB 2X3YA 1IJFA 1AXTL 4PLJD 2V7NB 2Z83A 1QUEA 4WNCA 2AS5M 4BV2A 3G88A 4G42B 1C8VB 4DANA 5EJEA 1HDXA 5DXFA 4B3TB 2K9UA 2BN4A 5D7KE 2PVCA 4DIKA 2JEZA 3CY6A 5ICGA 3LPCA 2E9BA 3U7JA 1NC4B 1Q5PA 3ICCA 2D0HA 3GO4A 4IOIB 2Z1MA 4LV6A 4R1TA 3A2KA 5KVGH 4O4HF 2NUPB 1G7IA 3QI9C 1ZS8A 3UGQA 3NFPB 1KQOA 2IW1A 5MN4A 4TUKH 1LK2A 1LD3A 3VXTB 1PEYA 2RK4A 2VJXA 5LCVH 3V6ZA 1RZIA 1XF3B 1UZMA 3IEIA 621PA 1A6AA 4PGGA 1A4BA 4L3EB 3AONB 4P5MB 1Z6AA 4DP8X 3A67L 4NCKA 1QYRA 4D9NA 3RRYA 4ORGB 1EZZA 3POHA 5I6OA 2ID7A 4KH1A 5JH7B 1WDTA 3VPAA 3VXRB 4F0JA 3EPJA 2BR3A 5KANG 5TQ0B 1DLFL 3H85A 5FUYA 4CF4A 3LHPH 4XFDA 5BN3B 1MRDH 5HIJA 3GZNB 3G2LA 4OM0H 1HQRB 3UK2A 1OBFO 3AW8A 2FFHA 4UT7L 3BWDD 4YGAB 4XMKH 4YNBA 2A9OA 1ED3B 5FYKH 3SJVB 1JYEA 4D42A 1Z2PX 4KQWA 3RJ5A 3S5LB 3FQWA 5AHRA 2BRQA 1ADYA 4D8UA 3WFHB 5E1OA 3NIDF 2CXNA 1SOXA 3O03A 1Y6JA 4BDVA 2YKLL 1OY3B 2HA1A 1AKWA 3MTJA 2ZRPA 3JYBA 3OCYA 2I7SA 2YRLA 3RPEA 4NQEE 4DCQB 3EOTL 2R7MA 4DDTA 4OZIE 4Q7KA 1F45A 3VR4A 3PPVA 3KLAB 3PF2A 4Z4QA 1X5IA 4G63A 4NR0A 4PJIA 2CRZA 1U2PA 3H54A 1NLMA 1TF4A 2J3KA 3QYJA 2NZYA 1QQTA 1NBHA 1FS6A 3K53A 1CUWA 2FATH 1C7RA 4XVHA 1UWEL 3BPCB 4XBEH 1CY8A 1V5GA 1SHUX 2YIDA 3ND6A 2CLFB 4IJWA 2EIKB 3EY4A 1UZUA 3B6IA 4HXAL 3BB4A 5CD5D 4PUBH 1PK8A 1SLVA 2BOBA 4B9ZA 1NSYA 1RZGA 3D31A 2G0NA 1YYLH 4B4VA 1XIWC 2CMDA 4TSRA 1GCGA 3CK0L 1H9DA 4XVUA 4YCCA 4ZCSA 4ZBJA 4JRXA 2IPMA 3EEIA 3R0NA 2EUXA 3V8VA 3SHVA 5BSWA 4HH9A 3K8QA 2EP8A 2ZP1A 3LY9A 1PZSA 3VA2C 3AI3A 5AW7B 4K05A 3MBWA 2BMJA 5D7BA 4I3RL 2F8LA 1BX2B 2OP1A 3ANNA 3JVGA 3R0ZA 3ATEA 2BP8A 5B1AB 2QROA 4ZOBA 4ZUWA 4IKEA 2ONKA 3WKAA 1P1BA 3MV11 4M9RA 3RUEA 3TA3B 1A7NL 3I8OA 3IIKA 2XTNA 2R8BA 3HCFA 1JB9A 1N6OA 3NAAH 1RK0B 5EA0L 2ARKA 1JFRA 3SD7A 2EC9U 4BJ1A 1VHJA 4KUEA 4XPIA 1FZMB 2X9NA 3M6VA 3LZRA 2QTLA 4QEZA 3MLRL 4JGJA 1AR1B 1ZN2A 3R76A 1M76A 5AALA 4UTBL 1ZNXA 4RGYA 1SOMA 2WXQA 4C6TA 4NI6A 2MCG1 2QGFA 4U1HA 4ELMB 3T4UA 1N5YL 2FB9A 2QYHA 3GUUA 2HDWA 1MOZA 3OJWA 2G82A 1P4JA 1LHZA 3CLUD 2VAPA 3KZMA 2GM3A 3GCDA 1YKGA 3TTXA 5DMGC 4RGMC 1PR4A 2HFFA 2R23B 5TE4H 1NMQA 4UCWA 4FNMA 3W2GA 2YRZA 4WK6A 1K4DB 5CJQH 1UIMA 5E9AA 4R8LA 5CT5A 3SIRA 4IEIA 1JT2A 1SOAA 3U7FB 4PJEB 1GUBA 1YZHA 3QKUA 1W44A 1MJJA 1VHPA 1E65A 2XVAA 4ESVA 5K3FB 4J3TA 3DUSB 2NXCA 1UJNA 3V9EA 4CRWB 4B75A 3QW2A 4WY8A 5AXDA 2VUTA 3ABIA 4XXDA 4QEDA 4XE5B 4L4UA 3AEKA 1YI0A 1RZKC 2CA3A 3RK0A 2X8JB 1J00A 1NIEA 1J8KA 2JCBA 3TCNA 4REMA 3WGHA 3V6OC 3OQRA 3QW9A 2NY7L 3UJTH 3EPPA 5EXDA 1W85B 1OLZA 5EZ5A 3FTYA 4U63A 1NBYA 1FA9A 3SWWA 5EJ6A 2VH2A 4E3ZA 1MHHA 3WKYA 3QG6B 4HKBB 1E1DA 1HQ4B 4UZEA 1MZYA 3CFDA 4ELDA 3GNSA 4MHSA 4XP5H 3W3ZB 3NZSA 1LJ8A 4LF6B 1QABA 4KQ3L 1GPOL 1IK4A 2I2BA 2HA3A 3CX8A 4G71B 2C0QA 3BREA 4ZHQF 1UMDB 4LXHA 1WCV1 4CADB 4K94L 4NKIL 1NGZA 4RH1A 4RQAA 1E60A 3UB4A 4K9SA 4G1FA 3IKVA 3DAPA 3RQSA 3FI0A 1Z4LA 5L88L 5I66B 2RBGA 1SM4A 3G2QA 5GHWH 4UANA 1C81A 3GI8H 5HFNA 4PJ7B 5JCJA 2W4IA 4PJBA 1N3BA 1MFPA 3MJCA 4WD3A 1L8XA 3HS3A 5AI6A 3N6RA 4XCYB 5E4FA 2WQVA 5KSBA 3A1EA 3TEJA 5E9DE 3Q8XB 2JBAA 2GESA 4I48A 2JB5H 4M9QA 4NM4L 1N8NA 2W2NA 5B7QA 1R4NB 4NE9A 3ZWOA 4YDJA 1KOFA 2XVYA 1CT8A 3DX2A 3VUFA 1NMBH 1JJFA 1RRKA 1T66C 4KLZA 1DCLA 5JHDD 5CEYB 5FB8A 2D3LA 1E9PA 4G7RB 4LFHD 5E2WH 3QXAA 1O5TA 2O5YL 1GT91 1EJOL 1BQRA 5A16A 1DV2A 4WOKA 2ZWMA 2CKBA 4N82A 4RVOA 3WIFB 5KYWA 3IDNA 3O2DL 1KZYA 5CU7A 2BSTA 2EIZA 4MYSA 3KALA 1GR0A 2WPDA 4J07A 4IZHA 3HNSL 5CYPA 5IN5A 1GGBH 3DNMA 1JNNH 5JQWA 4RY8A 3CEAA 2C59A 3BEWB 2D3JA 4I1VA 5T5FL 3WRXC 2EJVA 1HLPA 3OL2A 4JY5H 4RPLA 4UQAA 4ANVA 4YJ3A 3LY7A 1KYOJ 4QRSB 4PAWA 2V4LA 3GJEA 5TE6H 3VO8A 3FAXA 2CO7B 3MX0B 5K5YA 4YAFA 4TTJA 2J5LB 1CZ8H 4ZS7H 2FOIA 4U7TB 2I2WA 4HLEA 2IK8A 4X80L 2AYXA 4TVKA 4AGQA 1M1YA 3TR5A 1JGEA 2VMCA 4XCFH 3N28A 3E61A 2JAWA 1G5GA 1GUYA 3FN9A 3VA6A 3D1VA 4C7BA 1K9TA 1GTRA 1Y80A 2WJPA 1KT2B 5MI0B 2ZTLA 1QQDB 4K7PX 4HGZA 4K3JH 3R0VA 5FA8A 1S7TA 4YBQC 2HXGA 5FIEA 4APQA 2J4DA 3FU3A 1ISSA 5AHWA 1GZPB 4X94A 3ESBA 5KTSA 2QTZA 5I4BA 1T8WA 4HGPA 2VB5A 4XWTA 3G23A 1TI7A 3O75A 3L6EA 3TW8B 1E7UA 4RETA 1WQ1R 5IMKB 2B4CC 5C6PB 3X13B 1QVOA 5ALBL 1P4LA 4ABVA 4PVMA 4QPNA 1OPXA 1CU4L 3BH8B 3UWPA 3MV9E 1KP3A 1KH2A 4JG1L 1OSZA 4DV7B 3BWAB 4QXVA 3EXAA 2IYUA 3P4OA 2V7TA 1IUZA 1RUPL 1T1JA 5DVZA 1MT0A 3U13A 3BORA 3FMGL 1JA0A 1HMYA 4PYRA 5C92A 2D2XA 2XMGA 5ALJA 1T1WB 2CB9A 1NP3A 2WWXA 5IUSA 3H1PA 1YEJL 2A3TA 4NXMB 3EH2A 3QUMB 1Q21A 4RKWA 3R5XA 5AKSA 2GI0A 5AQ1A 3ZHXA 2VT7A 3L5WA 4HATA 1CFZA 2XRYA 1TQ8A 2ZTUA 1YB1A 5DD0L 4UOZA 4OJQA 1AOHA 5FWDA 3D7KA 2NUTB 2ED8A 4XX1G 3DUHA 1GL6A 5KAQF 2WAHA 4JR1A 4EO7A 2K4AA 3IPXA 3IDOA 1HWHB 3JQPA 4O4IB 4TKMA 1F6DA 1V41E 2X3UA 4NKMA 5HGHB 4Y2LA 4DLRA 1FJ2A 4WA8A 4MV0A 1LQUA 4IGBD 4OTXL 1CFNA 3EYWA 5DZLA 5C1MB 2IT1A 5GM2A 3HZYA 5FA3B 3MJWA 2PV7A 3IFLH 3EGWA 5D7LA 4BUZA 4ARZB 1QF9A 1N7IA 1LY1A 1NYTA 4Y1RA 4JVUA 2C9SA 4N24A 3AH8A 4OI7A 3BHNA 4WKZB 4CBVA 3W5MA 4IDPA 4R2LA 3A6BH 1KULA 2VDUE 4PJFF 4ZU1X 4K9DA 3RWDA 1PSWA 2QAIA 5I5RA 2O14A 3R7NA 3O3AB 2APJA 1E6MA 2OM6A 1IM8A 4ODVH 3IXTA 3PV7A 4PJDF 4H0LC 1RKQA 3CLRD 4H3VA 4XN5A 3LVRE 4U2BA 2WTXA 1UK8A 1TC1A 1Z5LA 4Q03A 4JQIH 1D6VH 3TOPA 1YYCA 2J1KA 4OP2A 1KP9A 3C15C 1P7KA 4QF1B 2Y1CA 4Q5IA 5KIAA 1Z37A 3LVTA 1PEAA 5H59A 2DQ4A 5EHFA 1QE5A 3DUWA 3MO1B 5YASA 4G37A 2Z3VA 1HEHC 1V9LA 2EDEA 2FTAA 3TWCH 4RVBA 3EA4A 1QZTA 2CUZA 1PFVA 4HCGA 1KDYA 4L4TA 3OCJA 5J13B 4DNPA 5JTTA 3CC8A 3SODB 5AH0A 3K6DA 1OWOA 1YI8A 1KV7A 4NPHA 1V48A 3LV3B 1FPTH 2VDNH 1VADA 4HIPA 2XOTA 1T0NA 4XIGS 3RB7A 3EDFA 5F2OA 4YGVA 2HM7A 3RIHA 3ARXA 3S4SG 3KLHC 3MJ6A 1TCCA 2CUHA 4NC0B 3PC3A 3VVLA 5KU1A 4BLPA 1NM5C 3Q2CA 4RHXA 2FX5A 4XOUA 1TK2A 2VHQA 1KKLA 2I85A 1DKUA 2MYPA 4UCFA 3MRFA 4L4JA 2BVUA 1FUIA 1XGUA 1EEZA 2J7LA 3MV8B 4KTEH 1KEEB 5CJJA 4RAUB 1JIQA 3L4CA 2A99A 4AXWB 4LHSA 3NFSH 3RKDD 2W2MA 3KKKA 4YR7A 2H1PL 1X7XA 2EDTA 2D00A 2PO5A 5B58T 2DTDA 3BD8A 3U7QB 3KKEA 1U8MB 1RPKA 2C96A 5T3ZE 4X7TB 3KYIB 3AG1B 4E9YA 3NAMA 1USVA 3V1KA 1U02A 3WBJA 2JD0A 2LBPA 3BJZA 4A92A 4PHHA 2C34A 1XH2A 4IQ8A 4JB3A 1K7FB 2QQNL 3A4TA 4AZ3B 5DF1A 5KUTA 4XFKA 5JI2E 4BINA 3ZE1F 3D48R 4D8TA 3IJHB 4F4DA 4YDQA 4PJGF 4LF5B 3O4LB 1VJTA 1OPGL 5T1MB 2CHDA 2HVBA 4JO2H 1PX3A 1S4MA 3L01A 4FBGA 3PEFA 1ZPUA 2IH8A 3PR1A 2CNDA 3H9SD 1INQB 1R3HA 4MJJA 5EORH 5E2VH 3L3OB 4PV1C 5CT4A 3GIZL 3RY6C 5IM5A 4U7MA 2Q3MA 3TBTB 5DR5L 2DYPA 4ODBD 4JLUA 4ZZ1A 2YHIB 1MHCA 4L1BA 4EA7A 1DKRA 4IRUB 3PLRA 3G02A 4AIZB 2O2EA 2W8BA 3TIEA 1PG7W 4NCJA 1YCSA 4WLOA 4ILKA 3NDBB 4L2IA 5JFTA 4UEKA 1P2SA 5IHUH 1C3LA 4IXMA 1SXJC 4MRRA 2N1TE 2EYQA 4EA8A 5LXTB 4Y5XA 2FEAA 1KFKB 2WILA 1KCVH 4ZEMA 3ZY7A 3BQMB 4UDUB 4Z4HA 3T8VA 1Q77A 3E22A 2PMCA 1J5XA 2ITFA 1OEZW 3NEEA 4RK1A 1MO6A 3IGAB 4G6FB 1Y89A 2KUTA 1W36D 2A78A 5J4KA 2VWQA 3NHBA 4N0FA 4FB4A 2J7PA 3VB8A 4AJIA 2J09A 2WINB 3IDIA 3SSAA 4MFHA 2P30A 3LKPB 1JIJA 1NUNB 3H8VA 4DZ8A 1YVRA 5L7XH 1U1GA 4EHLA 4CLHA 1XV5A 2G28A 2VNSA 3TKAA 2AGVA 5CF3A 3GY0A 2N56A 1VCOA 2XV3A 4DUWA 1F0PA 1XCBA 4QULA 1CJKC 4M6ML 4WFGE 4MI9A 4W93A 2AE1A 4CVXA 2F7SA 2OL3L 4ZAVA 1D1SA 3H2IA 4YWGH 3F3HA 1PUIA 4GRWB 3ERXA 1Z2OX 3ZX4A 3G2PA 4ANUA 5EZJB 4XPBH 3KPRA 3FGNA 4L27A 1BBDH 4P93A 3A1WA 3QEBZ 4Y7OC 4S0XA 2OYSA 4EHIA 4OXYA 3TLXA 3JT0A 1RSYA 5BXQC 4H1LG 4N0UA 1EESA 3EDRA 4FFYH 3NDJA 5IRCD 5AJZA 3CLSC 2DE0X 4KQFA 3GG9A 1YR8A 4N2NA 3I8XA 2BIFA 1UEYA 4RSYA 5DUPL 4PVBA 4ZMRA 1V7ZA 4OFIA 2QL9A 2B2XH 1EB9A 2P0EA 3HA7A 4ND5A 2VISA 4TTSA 2X5XA 1I7NA 1HZHH 3D0VB 4YCJA 3UV3A 1CW2B 1TKCA 3V8QA 1ZG3A 1DVQA 4OQPA 1HQKA 4B3EA 3T3IA 1E28B 4JFZH 3RJ9A 3QFFA 3VMFA 2H1OA 4ZDHB 2C3XA 3G1TA 1GQSA 2UXCB 3BHBB 4UFPA 1J0KA 3H3JA 5FTNA 1FU4A 4JN1L 3F96A 1UC5B 2ICEB 2AEOA 1BN6A 4HOWA 3GLHB 3FG9A 4JRLA 4G2NA 1FYTA 4ENVA 3USCS 2QMQA 2WKOF 3JQ7A 3JVVA 4MZXA 4RTSA 1V26A 4MP3A 5A9RA 1QW9A 5A7EA 4TTIA 5HQ3B 2WKPA 4LV8B 1NUSA 1KY3A 1WCBA 1IBSA 3KYOB 1QATA 1RLJA 3CZQA 5SWQA 1F11B 3ESYA 3KT6A 3VGAC 2P3YA 3GI9H 3SE8H 2J1LA 3U0WH 4DSOA 4BATA 1RBYA 2VITB 3ELQA 4B6ZA 4Q1BA 1L3WA 2HSEA 3PGFL 3PSHA 2QVIA 4U5XA 1BJRE 4LYJA 3HZKB 4UOEA 3QZPA 3LQYA 2VP4A 4KO1S 3PGCA 3FFBA 3GI1A 4D1YA 2WYVA 3WOHA 5CXXA 2XCSB 3TWOA 1GA1A 3GUCA 3FO2A 4DA0A 3I50L 3A1NA 1JF1A 4OLWH 1BX1A 2XNAB 1XWIA 5H4ZA 1HFEL 1H5UA 3A32A 3ETBF 4N6OA 4J94A 3KEFA 4ETIA 2V7EA 3SBWA 1R5VB 3SMQA 3HU1A 5CLWA 4AMXA 3EDMA 4JJEA 3ESDA 4M93B 2NLJA 1NF2A 3OU7A 3QDGD 4M61A 1SKQA 3DSRA 5IBPA 2EDMA 2FT8A 1NKSA 2E0IA 2G1JA 1QSFD 2YMOA 2Z0MA 3WUWA 2WMOB 3FFCB 2F7PA 4M98A 3FOEC 4P4SB 5ECYA 3NTXA 5DJYA 2V97A 1CJTC 1W75A 3T2QA 2HVKB 1N6QH 1MQ8B 3OO0A 1ZHBA 3GBLA 5CCXA 2RD2A 2WLJA 4HXYA 1N4AA 3BHJA 3EMDA 4E22A 3HS9A 4O1IA 2PUVA 1TYBE 2NXNA 4YJGA 2N3JA 2DWXA 1GZ5A 3ESAA 2DBLH 3P9LB 2A9ML 4ECAA 4YHKH 3C3DA 2F6AA 3QBJA 1HL3A 1QLEB 4QE3A 3S5ZA 3CDZB 4CNIA 2ZUVA 2HCRA 3U4BL 2XUAA 3ZGVA 3C5HA 3BC1A 3DPBA 3WE6B 1RI4A 4J1UA 4OF8A 3PNYA 4H18A 1WJGA 4GBXB 2OLDA 4PINA 1U7UA 3X3GH 4U1IB 5G0UA 4LGSB 4XOBA 4ABQA 2JFXA 1X44A 4EKEA 2FP4B 5HSFA 4YBZA 3IAEA 4B4DA 2BXYA 4HNTA 5CILL 3ILYA 1ABFA 3VYOA 3GGPA 1RPTA 4C1NA 4CI9A 1WKCA 3D4CA 1F8TH 3F2VA 4C06A 1X7QA 3U9WA 3DTUB 3N91A 5FV1L 3D6NB 3NACL 4ONEA 2BFCA 5CB4A 2NTYC 1P7HL 3IP7A 4K7PL 4P59L 3V0WL 3HEAA 1NCWH 5FUVA 2G0TA 4P4KD 4MD4A 2O8BA 4MJIE 2BTQA 5A1AA 2DWDA 1Z8DA 4G89A 3VU0A 1CR0A 3WS3B 1HG0A 1TMGE 3OMXA 5HRUA 1T66D 1TT5A 3ZV5A 2ONYA 4CCWA 3MV7A 4QTUB 2DF3A 2OYLA 1FZJA 3RGWS 5FO8B 3D25A 3R6DA 1OOAA 1RZUA 1LVUA 3L5IA 2FNWA 5JVDA 4R7TA 3E05A 2AYYA 5AAWA 1WIPA 1XEFA 2VIRA 1Y9JA 5ILGA 2EXSA 4POYA 4NUJB 1KB9J 1PSDA 1PAZA 1PJLA 1AC0A 4R2MA 3QUYD 2X28A 3KU4A 1CL7I 1M7DA 1XZEA 4H7HA 3PWLA 5ES3A 3U4HA 2VRCA 2XDAA 1RK1B 4PZUA 5CB8A 2RHDA 1KEKA 2DM4A 3OMZA 3R1GL 3MQIA 1WFTA 4B0MM 1Y8RB 4KY1H 1IWBB 3MRMB 5J9PB 5AOZA 3BZFB 5K9KA 1JFFA 4XD2A 1QQAA 4LEIA 4WKPA 4PJAE 2GBVA 3K70C 3DXAA 1CQIB 1G9NL 4GZ3A 1FA4A 1OBVA 4FZRA 4LPTA 4G5YA 4FNOA 1XTBA 4MWEA 5GRUH 2GASA 2ZKXA 1LBHA 4R1LA 3HC4H 2PJUA 4JYAB 2D7OA 1UWCA 4YRDA 1SURA 4D0CB 3MB8A 2PBLA 3I34X 4JJGA 2R48A 2YW9A 4WZZA 3OOEA 4B4WA 4L1DA 4YBQD 1UPCA 3HJRA 1ZY9A 4MLZA 4R4FH 4YIQB 3FN0L 4POAA 3ISYA 2AZAA 3MD0A 5HJ2A 2F1OA 2OTUB 3PUYA 4U2KA 4ZPVA 4R6XA 2PO6C 4KR2A 3WRYC 3KXFA 5COAA 1TNMA 4NZZA 5ESAB 1CUJA 1MAKA 1OT5A 1SB9A 3EFDL 2DUNA 3P94A 4V1CB 3NOXA 3V9PA 2KKQA 1XZFA 3MLTA 1N18A 1GAXA 2X8BA 1ILEA 1F00I 2UVPB 3NC0C 2FQGA 1Q83A 4ALAL 4NQSA 3N5AA 3DG9A 5F7LB 1IULA 4J6IA 1JGVH 1BAGA 5ALPA 4M46A 1QRND 2IW3A 3ATDA 2JI8A 3DVNA 1OTHA 1P6FA 2ATPB 4RK7A 1CB0A 3OGOE 4DE5A 3N0XA 2PTVA 4JI3B 4WXHA 1UT1A 3KYBA 3CPJB 4HC1H 5A2AA 1XD0A 2HPTA 1R5JA 4M00A 1M3JA 4QFDA 5AVKA 5TE9A 5A2QA 2CJTA 2YVKA 2JPDA 3V7MA 5BVPL 1JDTA 3WDSA 2R56L 2BPOA 1ZRUA 3THOA 3A37A 5IK3A 4US0R 4M43H 3NOQA 2CL0X 2D31A 3L02A 2DJIA 3LWZA 3TQTA 3RF7A 4DZBB 5EIHA 4R2GC 1GZQA 2EO9A 4P4TA 1Q1NA 3QUGA 5C0AD 3BEDA 5T3XD 2FSEA 4J9VA 1MVUB 4TRNA 4B6OA 1FFRA 2BNQD 1T4MA 4PNEA 1R0ZA 3OF6D 2GCNA 2AJZA 1ZAKA 3MWEB 4GUOA 1SLWA 4ZFGH 1QP4A 5ICZB 5ITBH 1P7QA 4DLLA 5JW4R 3BZWA 1TVBA 2W83A 1W4RA 4LGMA 4RPHA 1O5IA 1X6LA 3A4LA 3NT2A 1IY8A 1LMKA 2IG2L 2OBXA 2IOQA 1LNUA 3GB7B 3U82B 2HLHA 2ZR0A 3KCNA 4NWIA 2KC0A 2CHZA 4KKLC 2Z0UA 1KSRA 2Z4QB 4LSPL 3QEQE 4RVFA 3EH5B 3TCTA 3RRBA 3GN1A 1TJGH 3SBEA 3NCJH 1Q95A 1FGNH 1P1IA 3GJ5A 4DTIA 3ZDRA 4TPKA 5C08E 5CP7A 1O8BA 3FHJA 4V1DE 1Z0NA 4YK7A 4B84A 2BVQA 3AETA 4A23A 3RA7L 5DYYA 2Y7QB 1PZDA 2XVLA 3HN3A 1Z0SA 4M8VA 4XXHA 3IUNA 2HKIA 4FYQA 3LU1A 1WSBA 4BXOB 3ULVL 3ZJVA 4GINA 2EBUA 4BV9A 4FFMA 2FSFA 5FFNA 3ARDA 4YL9A 2B7CA 4M8IA 4QO1A 2NXYC 1B8OA 1KPVB 2FR4A 1QP8A 5CA0A 2J1WA 4XLLA 1R46A 2HRPL 2YY7A 1TJ3A 4F5WA 3TLCA 1JILA 2HKHH 4NO5B 3NTCH 3O3EA 3TEZA 1B0ZA 3KLHD 3TNYA 2CD0A 4X99A 3OKOA 1DPFA 1MCSA 4HP8A 3KW8A 2GZ3A 2K8QA 2MINA 4TYQA 4RK5A 1Z28A 4A10A 3KPMA 5ECJE 5JJIA 2Z1DA 2BDTA 4HHAB 3HPJA 5H70A 4WINA 1QHQA 1T2NA 1VKJA 5F7WC 4RDQG 1RIHH 1CU1A 3IE0A 2ZWVA 4PJXB 3O3OB 5IM4F 2PZAA 4L8DA 5FGBC 4MVJF 2XQ0A 1G7QB 1THAA 3ID6C 1G5IA 5B3AA 4WI0B 3OM9A 2D8MA 3A5VA 5HBGA 1DV1A 1YUNA 4E9QA 4PRDA 3WGYA 4H0FA 4JI8B 4CMCA 4ZJZA 4E6EA 1LSOA 2A77L 4ER3A 4XMPH 3G08A 3AB0B 2XKJE 2CUKA 4CEJB 5JLJA 2APFA 4EQ2A 1U7XA 4MQFA 2BNRA 3VYRB 5JOPE 2ZCJA 4FIDA 4ZPXA 1NIJA 3GMMB 4N22A 1REQB 3QIBB 1URPA 4E9TA 3Q5OA 3QWOB 1LEHA 1TO4A 4CC4A 2RMNA 3EUFA 1QDUA 1ZHLB 1UM9A 4ONFH 4XJSA 4GQQA 2QP9X 3R7WB 1WM1A 3MA0A 1N57A 2WMNB 2FPGB 5SWZA 4M0KA 4IIJB 3K20A 4I55B 1YDPB 1VCNA 4RZ2A 3UTQB 2WQSA 3DFUA 2COVD 4Q9CA 5GGQH 2BE7A 5AKLA 4BFWA 4MVXA 2RBLA 1JQLB 4YXKH 3VTMA 4ENZA 2CEAA 4H15A 4Q7DA 3V7AG 3QA3E 1CBUA 5AB0A 4LMRA 3SCMC 5KG9A 3BKJL 3CIFA 1SXJD 5FECA 1C5DB 4J29A 4QU5A 4BE7B 3I9GH 4BP1A 4PMEA 4KNQA 5E24E 1PT5A 2D2VA 2DLGA 4OVKA 2IX3A 1GC1H 3SDDD 3DYPA 4JZJC 1HEZB 5KNLA 1YS6A 3JZAA 3GLSA 2GN8A 2EQDA 2UZ4A 1VL8A 4O2BA 2XQJA 3QJYA 1ETB1 1X6VA 4N9GB 4ATTA 2ODHA 4OQLA 2X7LA 4HCRH 4JPWH 5DUMH 4YSRA 3C1TA 2V5AA 3FOMA 1TU2A 4YLYA 3FHQA 3WXBA 1W19A 2VT6A 1IAII 2OFWA 4Q3KA 3RIEA 4PS0A 2IH3A 1E92A 1JZ6A 4KLNA 1OT1A 3FH8A 4NXSA 1CUIA 1Y0LB 4FHDA 1CG9A 2EVIA 2Q0SA 1L4NA 4PFEA 4IHQA 3PL6C 1BLNA 2VDKH 4HGWB 1D3CA 1IBZA 5IW3A 2OGWA 4Y1AB 4HAXA 2GUOB 3CXHK 1JR4A 1WB6A 2XSZD 3GBML 4WCYH 2BRUC 3WKDA 2JLLA 5CX4A 2IS6A 1IGCL 3QDJA 3SF0A 3HCRA 3H3PH 3RHWF 2FQDA 3B78A 3HA3A 3VFTA 2R6CA 1QQBA 3FLBA 5ED4A 1I7DA 4WW0A 3H2BA 3IEPA 1GLGA 3SSGA 3LN4A 5CR9A 1VHLA 3K16A 5K1NA 2ZRCA 1UA6H 1D1PA 2A3NA 1FVFA 1MJUH 1XMIA 3F6RA 4E1VA 4CG2A 2ZUCA 5AW3A 3WAGA 1Q0XH 2QAGB 5LXVA 2RALA 5DHPA 2DTMH 3WNVA 3IIMA 1XLWA 3LZOA 4NYJQ 3CLSD 3H9GA 3WKBA 1GYPA 5HKKA 1LVEA 2NXZC 4AVHA 1QFWL 4GKSA 4OJTA 4M3JA 5K3DA 4UASA 3L6DA 3PQ2A 2HMTA 1P1ZA 3V3TA 1JWMA 3MWLA 4Q4AA 4FQHA 5EL0A 2CFIA 5BRQA 4GXFA 1YC8A 4X64B 1X5AA 3UWSA 4S35A 4KOAA 4Z7UF 2ADIA 3T8YA 3KU1A 1DJQA 1VQ1A 3ZKWB 4IFTA 3SAJA 4DIUA 3FQRA 4DMCA 2PSDA 5J1SC 5K01A 5KVEE 3PP8A 5B2EA 4BMCA 2WKSA 1G3RA 4GT7A 3DDGA 4JSYA 4RACA 4HUVB 3MLBA 5JMOA 4QHTA 3DYBA 1A7QL 2J2ZA 3VPSA 1PZCA 3B9RA 2OCAA 2Q3FA 4RAVA 5LQAA 4TV8F 5CU5A 4BQOA 4C03A 3PFWO 1WCWA 3VCLB 3K9FC 4UVDA 5EEWA 3AFHA 1SQFA 4F5EA 4K9MA 3DMYA 4HDIB 2AQTA 4QYIB 4XRGA 1IC6A 2EFHB 2I1QA 2NYVA 2ZQZA 2GF0A 3NPSC 5DLML 3D6MA 1H3WM 4JFFA 3LZPA 3WYCA 1XU9A 2G71A 1J9SA 2ZAIA 1EXGA 4U1GC 3FUCA 1HKLL 2UXGA 2E37A 3LS4H 1U8XX 4OD1L 3HB7A 5HGBB 2QMJA 3PFGA 4RIFA 1DAMA 4HJGA 2N3ZA 5GGTH 3BJIC 3CVHB 1YUBA 5MENB 3JTSA 2I2CA 4HN4B 3F8UB 3BKML 1KRHA 4DDMA 3II1A 4JMXA 1BFOA 1E9VA 2AW2A 3GLKA 4ONGH 1AZUA 2P0YA 5HWSA 5AW1A 1ZI6A 4RZSA 2OSLA 1ROCA 4G82A 3QJZA 5SYAA 1F7VA 3FSRA 3TOXA 5LJIA 4XGKA 1C9YA 4OZFB 1XALA 1G7IB 3OB8A 1NGXB 1ZS8B 2XE6A 4IJ3C 1ZLYA 3EO9L 3SNHA 3BKXA 3L6RA 2JKJA 1MF2L 3CUSA 4PLHA 3V6ZB 4UEOA 1E5XA 5ERWA 1MCJA 3ZUCA 1A6UL 2H2DA 1KMCA 2FPPB 2WNKA 1A6AB 4MA3A 1TQ2A 4FYHA 4QTYA 4XO3A 4E33A 4BNFA 2OBLA 1A71A 3UJJH 3P0VH 4QY8A 1G38A 4F91B 1X7DA 5ISZD 4OCXH 3VPBA 5DTIA 3TQIA 1H5BA 4EHAA 1T6VN 3AT9A 3KSDO 1KJ2A 5FL7D 3GS0A 1VSBA 2X0JA 2DTEA 3L04A 2JLWA 5HIMA 5EIOA 2DECA 1U63A 3KBBA 4EBQH 3QWBA 2WFZA 1WDAA 2YA0A 4EP1A 2LKDA 3I32A 2I4IA 4O02L 3OT4A 4GSUA 3RBGA 3FW1A 3N0TA 2Y77A 3BAFA 3K5PA 4DOHB 4MRMA 1YOBA 2WTMA 2OJZL 4BRVA 3WQSB 3H2HA 1D6MA 4BDVB 2EDLA 1AB6A 5BUSA 4JVSB 1FRZA 4HEA6 5C7OO 2W9DH 3ITKA 5JW6A 4FF9A 3MVSA 1YR2A 4HVTA 2HU7A 4PJIB 2ZKMX 5JW3L 4E5XG 3HL4A 4W6XB 5EHXA 3MFGB 4MZRA 1YZUA 3BSYA 1UP4A 3MGGA 2G1PA 4PZPA 3VNBA 1DRVA 1PBTA 2D1SA 4BM7A 1ULBA 1N92A 1ETUA 3PQFA 2KZWA 3AB7A 3VGGA 3ARGA 4RX4D 4W9GC 2DJUA 4IDJL 3VAEA 3LCUA 2CIIA 5EU4A 4N2DA 4R4BB 3KP1A 2ED6A 2EEXA 2BOBB 4FFWA 2P5WD 2PX2A 4YHNA 1RZGB 1JBJA 1ORQA 4JKNA 1NOJA 4WCFA 5J43A 4JDTH 2QW0X 1E9QA 2R0KL 3RO7A 4JRXB 3VNYA 5MN6A 2VYVA 4P2OA 4HH9B 3HM2A 1FZTA 2VSQA 1R16A 4H88L 2FZ3A 5I9TA 3MBWB 1RAFA 5E95A 2C00A 3DTVD 2GBFA 3LQ4A 3BRSA 1WISA 1N1MA 4HX2A 1DFXA 3EHBB 4ZUWB 1JAYA 1KBBA 1N2GA 4D46A 1NPYA 1VESA 2J0QA 3IN2A 4FABL 1W91A 25C8H 3ZBUA 3DO5A 5F5XA 3GEGA 2I6QA 4XPIB 1LSSA 1FORH 1WT5A 1GAQA 3OZAA 4LSQL 4Y5VB 3UJBA 3KK0A 4MXWH 1QWHA 3IT2A 4J6EA 1ZBDA 5H82A 4C6TB 2HPOA 4MKTA 4U1HB 4J4HA 4ZAWA 2IQAA 2Z6QA 1DR9A 2HJFB 1HFUA 1IBGH 3GPEA 1KJIA 2D1TA 4P34A 5BNZA 2JDIA 3I2YX 2VZUA 5CP8A 2VLBA 3FUHA 1SNRA 4NCBA 4UTVA 1IWOA 1H5NA 4E0BA 4Z4IA 1I1QB 1I1FB 4YPOA 3AGVA 3PC7A 2DQUH 2YNMA 1SCQA 3E1SA 1BBJA 4QTIL 2E82A 3JQAA 4RFLA 1MJJB 3FVTA 1WWKA 3KWTA 4EUPG 2RGAA 1QSEA 3THWA 3R5TA 2EIDA 3AQDA 4J0JA 5K4GA 1W29A 2ZWZA 5IAEA 3RX7A 2PO6D 2VXYA 1B23P 4XXDB 5F51A 4PJEF 2AHRA 2WBJA 1TTFA 4MRVA 5BS0A 4PCSA 4RCVA 4R0LC 4MUFA 4C4SA 3AGWA 1V8DA 5MP6L 3TXXA 1YA4A 2OHJA 2IS2A 2VR4A 4MB1A 3GSNH 4BZYA 4PPNA 2B8NA 5F5NA 1E7RA 1YT5A 3FTEA 3NT0A 3S3BB 1Q0SA 2I3ZA 4E4TA 1GA2A 1NBYB 3ZDYB 4P9HL 4AGNA 1BYNA 1MHHB 4C59B 3E2PA 2HCTA 1EDOA 1FTNA 5DQDL 3ZZQA 3FONA 5H37A 5DM2A 4NFLA 1YEIL 4UHFA 3KHQA 1Q0HA 3R20A 2H4EA 3WSWA 5D4QA 2C98A 4M1MA 4PRYA 5FX3A 3QMVA 1JZ4A 2D5LA 1LDPL 3X1EA 4JUIA 3WQHA 2JJ8A 3FOBA 4YVNA 5I18L 2R2EA 3TF4A 5F93C 3LY8A 2IDQA 4B60A 2CNOA 5MFPA 4R2GD 1I8UA 4PJBB 5IB1A 2JIQA 3RZCC 3SE3C 3GGOA 1CVRA 1AA6A 1DHTA 2OSBA 5TX7A 4D81A 1TETL 3T7IA 5KSBB 3B5JA 5E56A 3IESA 4TN1A 3RTQB 4I48B 5DTRA 1A9SA 2VLKD 3P20A 1QWSA 2JBHA 4MKHA 4C83A 4ZXFA 4YDJB 1N9GB 3OZSA 1W6RA 1TLTA 5F21A 1CT8B 4H8WH 3NW9A 4NKDA 4CF6A 4OQNA 2HLEB 3AVPA 3KGRA 1PY9A 1M8FA 4MJ2A 2NY0B 1E9PB 2CJXA 2W6MA 2OSVA 1R0WA 2XCTB 1QCCA 1KBKA 4EFDA 4JR0A 3RT7A 5A16B 3IMFA 5T4EA 3UADA 1ZH8A 3G5AA 3BD9A 3ESUF 2YSTA 3CURA 4U2YA 5EU5A 1AQUA 5KYWB 1GQOA 3IDNB 2V7GA 2A84A 2WXIA 2BSTB 2EIZB 5JEEA 2AK4E 4CA4A 1D9KC 1LE9A 3N8GA 3TLGB 4CDMA 3VI4B 2PQMA 4LDZA 4CZ2A 3OKDB 3THSA 4FQJL 4EAEA 1KJ8A 2Q9OA 12E8L 3QQNA 3L3HA 5AKGA 3GZTB 1I7QB 4U0QB 3VXMD 1FNDA 2BH2A 4YJ3B 1T5TA 4WK4B 4HUWB 1R0AH 1R0RE 4HBZA 2QTMA 4NRXA 2ZWPA 3KPSA 3WDMA 2PQ0A 1HNZB 2GIXA 5KVMC 1KY6A 4L1TA 1JAEA 5JZ7C 2JI2A 2YUXA 2DKMA 3OMIB 2H0AA 4G5XA 1LQBC 3G8YA 4N1CA 5GISH 1ZIAA 4Z95L 5DB4A 3W5NA 1OZFA 1SY7A 1M1YB 3D5TA 5FH9A 4FQXB 5JSKA 1JGEB 1SK9A 2R7KA 4PFSA 1AKMA 5IQ7H 3T7KA 3MBKA 4Z7VF 3IAUA 4F60A 4CN8A 2YN2A 3VFRA 2BI7A 3N6VA 3U6XA 1S7TB 4GW5A 5C0BA 4APQB 2Z6AA 1WHOA 1OLXA 2GBCA 4I0PA 5SZJA 4LF9B 1RZFL 4UKDA 3M1OA 4EN2A 3NIFF 4KW7A 1EEQA 4OQMA 4BFLA 3L1FA 4OHKA 2NWQA 2B3TA 5B3JC 2G04A 4O2AA 2F3RA 4FNLH 5F9MA 1OYVA 3CXFA 5LQJA 1NVEA 3BKYH 1QVOB 3SSNA 1P4LB 1Q9LA 1M2HA 1II9A 2VXTH 1SNYA 2Q4RA 1X7ZB 4E2YA 4JQCA 4GT0A 1JYXA 1NFKA 3O3MB 1OSZB 5I1HH 5F33A 5AJXA 1IN5A 4AC4A 3P4OB 4KKCD 4G67A 2GUWA 5FO9B 1IHDA 2HH0L 4IU2A 1Z6JT 1R74A 2WWWA 2XWJI 3DBXB 3E3QE 2Q3LA 3FJ1A 1QLEL 4UHDA 3I02A 5A43C 3R7DA 1TUGA 1JE1A 5IB3A 3PXEA 4TT3A 4MAYC 4KFTA 4AZVA 2FMUA 3LQ1A 2ZSEA 1O4VA 2HK7A 3K0CC 3W11C 1OFGA 4B3RB 5CA1A 2C2GA 3QNZA 4G1BA 4GS7B 4Y0VA 2DJ5A 3L5WB 1KCUL 1POXA 1XDUA 1WXGA 1GLNA 3HKBA 1Z5ZA 4DGVL 1XGPA 2GZ2A 4F7MA 4FC3E 2LCIA 2W6OA 1ORTA 5AW4A 2WJ4A 5AWNH 4Q18A 2C97A 1DWOA 2BZSA 4IRZA 3BMQA 4NKMB 1TTTA 2WU1A 3U83A 1N0VC 2HMYB 3SYCA 1XN1A 3NH9A 1WA5A 1CFNB 4C6SA 4LS3A 3IKKA 4KQEA 4HNUA 3HZYB 4F9EA 5KNDH 5D7LB 1K5NA 3LPMA 4ADIA 3MMZA 4OZHA 3KO8A 2M98A 4JMLA 1RY7B 3VDQA 1BMZA 4O4IF 3VX1A 4MNQD 3H8WA 1PL3A 4OT1H 4PY2A 4LBVA 3VAAA 2ZT7A 4ALJA 1CUOA 3FWHA 3W9DA 1T5SA 2FMFA 1M6YA 4RPCA 1HXMA 5HDBE 3WTTA 1OI4A 3CZCA 5IF9A 5EGNA 1FMJA 3BWCA 3RWDB 2C5BA 2GTZA 4URHA 2QB5A 3B3GA 1FSGA 2A30A 1P91A 1LDYA 4FIZA 3VI3E 1TM7E 4DGIL 3HEMA 1R88A 5JQGA 1FNSA 1Z5LB 3U0VA 4YHMH 2IAAC 1II0A 5ERGB 1QRTA 1YFLA 5KANI 3S6CA 2GGSA 5FWQA 1P7KB 2R0QC 2ID4A 4NN6C 2VC2L 5GPBA 1B26A 1RCYA 1YJDC 4P22A 1AG6A 3C2SA 3VTZA 3IDMB 4TL8A 5HRAA 3K6RA 4P7GA 1LH0A 3FAZA 4WWKC 4L4TB 3IKCA 2ACVA 4K3HA 1K7CA 2PXCA 1T1IA 5I8PA 3UYPA 2V37A 3T4AB 3DMHA 4Z7JA 2X2IA 4PWKA 5F12A 4Y9RA 2DT5A 2B5WA 3N87A 1VADB 5E5MA 3ROLB 2QENA 5AAMA 3NZEA 4U2EA 2VW6A 1K72A 4JBLA 2K4MA 1I4DD 1UWYA 1CRLA 4Z54A 1QV6A 1TJ4A 3QDME 5PCYA 1T29A 4DDKA 2NNXA 1M1UA 1JHQA 4RMVA 5C1OA 4HKJA 2GILA 3UGJA 1A5FH 3MRFB 3SO3B 3EWIA 1XGUB 2B39A 4MV1A 1PFYA 1EEZB 2AS0A 3NV9A 2WTRA 4NCC1 1T91A 4NTZA 5DCLA 5KBDA 4NOFA 5JHMA 5I82A 1NDQA 3GLEA 1OB2A 1VLLA 1YAJA 4HUCA 5FYJH 1X7XB 5EESA 4OHMA 4Q8BA 4JRWA 4AIEA 4TNEA 4AJWA 5AJHA 1LI5A 2VJCA 3UTSB 4FINA 1OP3K 2GD6A 4YIHA 4AL8L 2ZG3A 2N1BA 4L3AA 4HAYA 4PTLA 2O6EA 2COKA 3PAVA 1NJ9B 2RSLA 3CZKA 1ID1A 3PWVA 3GVHA 4NQRA 2NSXA 9PCYA 1BOFA 4MP8A 3RDTA 3IELA 3COZA 1UKTA 3DGEC 1N0HA 3QU7A 5I71B 3S2YA 3K8MA 3C6LC 1EJ2A 4P35A 3U7YL 2FZVA 5IP5A 4R9VA 4TMPA 1KF9B 1XSOA 1BCRB 4TXVB 4QATA 1D5BA 1WW2A 3SC2A 3OAZK 5EOCL 4JJOA 2YAQA 3QP3A 1R3HB 1UWGL 1TO6A 4AUMA 4JROA 3RARA 4R01A 2FEPA 3RSZA 5DHFA 2XQVA 5J89A 3O8CA 2DJ4A 1CD1A 1ZLUK 2CFTA 4LIQH 3AU0A 3FNFA 4M6NH 3WAKA 2AVGA 1DE0A 2W8BB 1FLTX 5B1CA 2CNWA 4WAUA 3AREC 4M7JL 1JHMA 3QTTA 3MOIA 4ZVNA 4U7PB 1CICD 5JJBA 2VGLM 5C5DA 3MUOA 9ATCA 2R4SH 4H8VA 1E4WL 4OCRH 1JVNA 3DPUA 3KDAA 5JHLL 3TDMA 4GMSL 3PPXA 3JYNA 4LLWA 2VZVA 3FB6A 3TR0A 4HPOL 3PHQA 4IEEA 1Y6MR 2HT3C 5C8YA 4BLRA 4L8GA 5C35A 2Q5BA 1UC6A 4TL5A 1WIUA 1AGYA 1U7ZA 1P9MA 5FYLE 4MQSB 4HFWA 3OD1A 5IKOA 1B6UA 1AE6H 4N0FB 2B5IB 3F7RA 1P7VA 1M54A 1N8KA 2CK0H 2GA8A 4FFNA 2FEXA 3KUUA 1HYQA 4ZD3H 4V03A 3B5IA 3BCRA 3IDIB 2FXIA 1XQXA 4MASA 2P35A 4N01A 2XYBA 1EGMB 2JFZA 1F90H 4J3WA 4DZ8B 2OCKA 5B55A 1RK7A 4DVBB 3BFJA 5FP0A 1F4LA 2XJLA 1MU0A 3U7IA 4PCKA 5I7OA 1U2HA 3SQXA 4EZLA 4CVXB 3FIUA 3WSQH 4D9BA 2QY9A 2XZOA 4DSUA 2NY5C 3EF1A 4YV1A 4NZUL 2VG8A 2I69A 4C08A 3CSUA 1NEPA 4RZ3A 4M7LL 1JEQA 2G36A 2ATKA 3MKKA 1T9ZA 3C1OA 2FVYA 4GSRA 3EEOA 1TRHA 3EYAA 1AG0A 3D05A 2WAMA 3KDMA 4GRWF 1CGXA 4N0UB 4U3XA 1Z0ZA 1M33A 4GI5A 4HUMB 4MNGE 2PNFA 1LF5A 1CEYA 4QU9A 3QLVA 2R6R1 3AUTA 5C8ZA 1R66A 3GMIA 2HXYA 3Q3VA 2HKFH 3K15A 2X4SA 1L6PA 3O8DA 4R7NA 1C8BA 3VXQA 2ZRHA 1HNYA 1T5BA 3TRDA 3SJUA 4UD2A 3ZO9A 3BQUC 3W5DA 2VISB 4ZKDA 3GBDA 5HEKA 4AIIA 4LSDA 4ZVKA 2PXYA 3OIDA 4J0FA 4OTZA 4UNIA 1AGRA 4FQ2L 1E4EB 5J59A 2X2EA 1U9JA 2WSPA 4PJFE 1YJCA 1U6AL 4AZ8A 3RKSA 5BXFA 5CCGE 3AV0B 2PFGA 2W88A 3QUTA 1XA4A 4BEBA 2FPRA 3ALWA 3OKNA 4Z8FL 1OK0A 3QCUL 2DPGA 3NRQA 4XVSL 3ESOA 4HFMA 3LVBA 3NUGA 2WDZA 2OHGA 1FL6A 3GPLA 5LMNB 1A66A 4EN3A 2IYNA 3AY2A 1Q0ZA 1G0OA 4DKEH 3JQ7B 4TYNA 1AXGA 2JKTM 5I45A 3O2VL 5CJXA 5GZNC 2OKCA 1JDBB 4MS8C 2DF8A 3LXCA 5T7BA 4QHYA 4N0DA 2DZEA 5JPNA 4Y2TA 5SWQB 5LD2C 2ZRJA 1QV7A 3HI6L 1ISMA 3TOVA 2C4UA 5JOEA 4LVOA 4LTDA 1GC1C 3L2OB 3VZSA 1DOAA 5DZPA 2WU0A 3MUJA 2FIKB 1J49A 4MGKR 1DC5A 1ITCA 1SUAA 3ZTDC 1JGUH 1OOEA 2BCEA 3LZFH 3ZU8A 3PGCB 2JCCF 4N1HB 3TRIA