3UOAB

Crystal structure of the malt1 paracaspase (p21 form)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
378
structure length
364
Chain Sequence
MLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
publication title Crystal structure of the mucosa-associated lymphoid tissue lymphoma translocation 1 (MALT1) paracaspase region.
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 364
sequence length 378
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00656 Peptidase_C14 Caspase domain
B PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uoaB02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uoaB01
2FP3A 4I1PA 2QLBA 4N7MA 5IBCA 3GJSA 2QLFA 3NR2A 1I51A 2XZDA 5LUBA 3H0EA 3DEKA 4D3YA 1IBCA 2DKOA 4JR2A 4AWAA 1K88A 5I9BA 1QDUA 3V6LA 4QU5A 3D6MA 3KJFA 3UO8B 1NW9B 2CNNA 2CNOA 1F1JA 1I3OA 3PD1A 4N6OA 4PS0A 5IAJA 4EHLA 3DEIA 4HVAA 2CJXA 4NOMA 5IBPA 4QU0A 4QTYA 1RHUA 5LU8A 1RWKA 5IARA 3E4CA 5IBRA 3QNWA 2C2KA 4LSZA 5IC6A 4FGUA 3KJQA 3KJNA 5LU9A 3R7SA 1GQFA 1PAUA 3R6GA 2FUNB 3UOAB 1F9EA 1RE1A 2QLJA 3IBFA 4N7JA 1NMQA 4FEAA 3RJMA 3D6FA 3NS7A 4HQ0A 4M9RA 2XYPA 4ZVOA 5IASA 1CP3A 4NBNA 1RHKA 4N6GA 4JJ8A 4IYRA 3V6MA 1RWNA 5IANA 2J30A 2XZTA 3R5KA 2C1EA 4JJ7A 4JJEA 2J31A 4IEFB 1RWPA 2C2ZA 1RHRA 3H11A 3H1PA 2H48A 2C2MA 3DEJA 4QUHA 4NOLA 4QUAA 1RWXA 4EJFA 4EHHA 4QULA 4PS1A 4QUJA 4EHDA 1SC1A 3PD0A 1GFWA 4JR1A 4EHNA 5IAKA 4AWBA 3P45A 4QTXA 3S8EA 4QU8A 1SC4A 4ZVRA 2XYGA 3R5JA 3EDQA 5I9TA 4N6NA 2FQQA 4NBLA 4NBKA 2CNKA 3R6LA 4DCPA 2HBRA 2H4WA 4N5DA 3P4UA 4ZVQA 3BIJA 1NMEA 3V3KA 2Y0BA 4D3XA 1NMSA 2P2CA 2HBYA 4QUGA 5IC4A 1SHLA 2H65A 2K7ZA 3ITNA 4EHKA 3H13A 2H54A 4ZVUA 2C2OA 2CJYA 2Y1LA 3NKFA 5K20A 4JQYA 3R7BA 1QTNA 3GJRA 1SHJA 3EDRA 3DEHA 3OD5A 5JFTA 2AR9A 1CVRA 3V4LA 1SC3A 4QUDA 3V55A 3V4OA 4QUBA 4JR0A 4EHAA 4I1RA 2HBQA 2CDRA 2WDPA 1RWVA 3K7EA 1JXQA 3H11B 1RHMA 4JQZA 3R7NA 4PRYA 4FDLA 2HBZA 3SIPA 5LUAA 1QX3A 4ZVTA 1ICEA 2H51A 5H0IA 3IBCA 4HQRA 1K86A 4QU9A 2XYHA 3PCXA 1PYOA 1RWOA 1KMCA 4NOJA 5IABA 2QL5A 3D6HA 2H5IA 3GJTA 4JB8A 1RWWA 4ZVPA 5IAGA 1M72A 3SIRA 1BMQA 4PRZA 4FXOA 4QUIA 5IAEA 4AW9A 4D3ZA 4DCJA 4DCOA 3GJQA 4QUEA 1I4OA 2CNLA 2QL9A 4ZVSA 2H5JA 2H4YA 2QL7A 2J32A 1RWMA 2NN3C 2J33A 3S70A 4EHFA 1RHJA 4NOKA 1RHQA 1I4EB
chains in the Genus database with same CATH superfamily
2HHAA 4C4TA 1B6UA 3WEMA 2W0PA 1O0CA 2IGLA 3FB7B 2YC2C 4AIRA 2PZLA 2VQ3A 3GBML 5BZZA 1KHTA 1YDGA 4WXYB 4NAMA 4UCFA 1DMRA 1I53A 3SQBB 3OKCA 3V5HB 4YDMA 1JK8A 1VYVA 3JQGA 5DVNA 5CT4A 4JKYA 4HQFA 4I19A 3EYVA 3NGBC 2ZRHA 1TB4A 1RI2A 3BA6A 4XVCA 4J4HA 4JDPA 5EE0A 1BFOB 3C97A 2P5WB 2PWGA 1V9CA 3S2IA 1CFTA 4G7VH 1T89A 4X4YB 3P9XA 5D3MA 1EUYA 3IKCA 4QPCA 2FWOB 3VWKC 1PTZA 4P33A 5DWPA 4RIGA 5AUNB 1HI9A 2ZIUB 4N24A 4TMFA 1O0SA 1KS2A 4GO1A 1XZCA 3E5MA 2FH5B 3IU4L 3RYCA 3ULVC 4PS7A 1U8IA 5E1DA 4JP2A 5HIAA 3P94A 2Y7SA 1KMGA 1TTBA 4O6VA 5J43A 2FEPA 1WBXA 4HMCA 3UKJA 1Y3HA 5JMTA 3L0DA 3EH5B 3K1YA 3TOZA 2OZPA 4HYTA 3INOA 3TG8A 2NYVA 3RZCA 1JJUA 2FKNA 4Q1DA 5DRZB 1A4KB 3VDRA 2I4RA 2O5YL 1IHPA 3V1NA 2YHIB 2GA8A 4JP3A 4BKOA 2WT8A 4XX1G 2QLBA 4J3UA 2GZRA 1DJOA 3PGLA 2BY3A 4UE2A 3II1A 3UATA 4HNVA 2R9VA 1JUFA 3H5OA 1MNNA 5DV9A 2BVPB 4X6FA 4E94A 3VHXB 3T0XA 3EYAA 3P4MB 2X70B 4BUHA 1XMQB 2QSYA 5JR1L 3M5WA 4UIKH 4ZMYA 3ZWAA 5L95A 3KXPA 2M32A 3KJNA 3QEAZ 1CS0B 1N2CB 2IQAB 1AF4A 4OKDA 1XMOB 5EIHA 3IRCA 4UEQA 4HBQA 1NQVA 1FO0H 2JIRA 2YJLA 4JRWA 3DHWC 3LHKA 2AFHE 1LS1A 1M1NB 3TLKA 4DKFH 1HHJA 4JGMA 1K66A 4MA1C 1ULSA 1PX8A 2ZRQA 2GZMA 4TSAH 5KSUB 3SEQA 3I1IA 3I9NA 2R3SA 2ZQ5A 1H6UA 1LBTA 3FTCA 2OMKA 4PZDA 2XQYK 2RBLA 1FVEA 1EFPA 4TLDA 1PKQB 5AVKA 2CNKA 5EV7A 4K9EL 4PC7A 1T03L 5JSZB 3U60B 4M9QA 5EWIH 4JHAH 1XU9A 4YHNA 1J8YF 3CU5A 4PWKA 3K4AA 3T9BA 5HGGS 4LLMB 1AKWA 3RG1C 1TCCA 5LQDA 2F68X 2XDHA 4GAAA 3O31A 3FTFA 3AY2A 5GS1B 5G4KB 2UYHA 4Q89A 1SBBA 3VI4F 5I18H 4XYEA 5E9NA 2V9QA 4ODTL 2G09A 2P9HA 4XZ3A 2ZKWA 3DBXA 2CV1A 2PHZA 4BFYA 2GHTA 1RKBA 5AHRA 4G8GE 3JVEA 2Y9MB 5AVWA 1RXYA 2FJUB 2AN4A 5JVDB 4GAGL 4BFIB 2XQVA 2BZ7A 4PJ8A 2DLFL 1NX6A 3WB0A 1RBYA 1WLHA 1R3UA 3IULA 3N42B 4ZICA 3VFWA 1UBUS 4G0NA 1XO8A 2A0FA 4HK4A 3N0AA 3OQHA 4LI3X 1MIOA 3G9VA 1AV6A 2GN2A 5BV7H 3WENA 2FZGA 2X76A 1YS7A 3RVMA 1TVBA 4PQXA 2PIAA 3U9SA 4Y2YA 4L3EA 1BHJA 3CGGA 5IMBA 3TEYA 3U0TB 1GGMA 1H05A 2ZTSA 5K8CA 3K0FB 1E58A 1UD5A 1YC7A 4Y2TA 5T8KC 1E1MA 2ADGB 1A9BA 5CEZH 5EPMB 2EJBA 2JJQA 5JXAL 2H52A 5JIPA 4CV0A 4ICWA 1VHQA 2R8SH 1PGJA 4GUPB 1T5DX 5ID0B 2GAZA 4MCAA 3CFCL 1K75A 1FDRA 2AEWA 5KN5B 1P4IL 1WVGA 4XYMA 5KDOA 2ZM6B 5E8JA 4N2IA 3DYMA 1KAEA 2OOSA 3JWHA 4XCVA 3K5WA 3ZIAA 2GCGA 3TQFA 3BYYA 2AWOA 1GJUA 3D6TB 5EIVA 1ZLSL 1JEDA 3DUFA 5BYBA 1T2XA 2IYOA 5BPFA 2NQ2C 2G25A 1RYNA 2KBEA 2EEDA 2LU5A 1ZEAL 3MRQA 1L0BA 4ZDIA 2ZIDA 3SFTA 4KVCL 3BP7A 4UANA 1WBYA 1MB2A 1Q9WB 3Q2VA 5IQOA 1MG3C 4J3JA 1KPVB 3FCCA 5TT1A 3AACA 3NTUA 4F2DA 4OQZA 4YH1A 1RRKA 5FD8A 2WJ7A 3CLKA 5TE7H 5I1GH 2ITDB 1BA2A 3RV3A 5BSHA 2JASA 5LL6P 1IKFH 3UG4A 1F51E 5HGBB 2YHGA 2OI9C 1JZTA 1QQDB 4AJ0A 2RGBA 3EDEA 1K6JA 4LECA 4PC1A 2X3UA 4JHWL 1K85A 1NM5A 4AQOA 1J0KA 4PJDF 2HSEA 3SPIA 1Z7GA 4HEA1 1QPPA 2ZJ1A 3L7BA 5IJ0B 3NTOA 1FLRH 3FWZA 4R8KA 4MHSA 4Z7WB 5T1DL 3U0BA 4K5PA 1YQQA 2GJ6E 3WSWA 2VJQA 2R29H 3F01A 1KO8A 4I18C 2ED9A 1R5VB 2VXVH 4K5QA 4IDAA 3WNLA 3HL0A 1Z0NA 4M99A 2YIHA 2V6GA 1CCZA 1UQSA 2P7IA 3RC7A 3X3FH 2DULA 3ILSA 1CVRA 1L5HB 4JM2A 4KQ3H 1A9XB 3EG9B 1WSAA 5FWXB 3KGUA 1IEHA 4M1TA 5CB8A 1SDAB 4JOSA 1PTKA 3O6LH 4ZW5A 3C16C 1G8FA 5C0GB 2E3JA 4ZAKB 1S9DA 3VXPA 3D39D 4PYNA 4B3DA 3VVWA 3FQNB 3FOZA 1MIMH 1CDDA 1W93A 4Y0GA 4LDNA 3WLFA 3S3TA 3T8XB 2I2CA 1Q9OA 4RGNC 5EJ6A 4NPJA 3P54A 4PRDB 4UNIA 3QR2A 4UF7C 5AW2B 2CHNA 1C0KA 4YZFF 5EO0A 3G5UA 4HGOA 2AQKA 3BQUC 4IUYA 5EZIH 5ICYA 3U1SL 3X11A 1HNYA 2V37A 3AOEC 3H5RA 5FO0A 4D6PA 2RGNA 3NSXA 1J0XO 4TXVB 4PZZA 3BYZA 1AKYA 4R3NA 5I0DA 3RWJB 1GGEA 3FT0A 3V0JA 1WZEA 1CQYA 2FEDC 1HA3A 1ND6A 2BFEB 1NEUA 1XGZA 2ALWA 2WMPA 4R7GA 1Z9SB 1N9PA 4HALA 4Z77A 1MQSA 4L5FH 1PLKA 1G4HA 3HC7A 3AL3A 3SYTA 4FQXC 2H0RA 3FO9B 4YBLC 4DA4A 3SQNA 4APQA 3OQJA 1SDDB 1Q7BA 4O4JF 1HHKB 4FXGB 3HKBB 2FN4A 1OF2A 4AQ1B 3GXBA 1KJJA 4YXWA 4C3ZA 1EGQA 1UJ2A 3G6JA 2JBHA 1YKGA 1PWXA 1OPRA 1Y9DA 3KHUA 4UAOB 3DXZA 3U1TA 1K8IA 3AILA 3N0WA 4TUJA 3ETLA 3KDPB 3LNHA 1PFYA 2VVTA 1GC1H 5LGKA 2AFRA 1ORTA 3Q13A 4NENB 4QRTA 3IDAA 2NXNA 3L46A 3U3XA 5JW3H 4QKQA 1R8SA 1JZFA 2FR8C 2I99A 3AY7A 4RF3A 4YK7A 4JPIB 5CT8A 3WWCA 4MS4B 2DQDH 3ICEA 1NFKA 1Y1QA 2CGZA 3PHOB 1ONQB 1UAGA 4P4RA 2WJZB 2Q3LA 1R74A 4ALIA 1SXPA 1YN7A 3TPKA 4BMPB 2JPDA 3GB9A 4WTWA 1UASA 4Y2NA 1NKGA 1W2GA 5GZOC 1JV2B 3CRQA 1A8QA 2ZWMA 2Y25A 1PSKL 5H3HA 3REOA 2C1ZA 2BH9A 5HYVA 2CRZA 1ZI6A 3PLAE 3K9LA 4QREA 3CFQA 1JDNA 2C2MA 2IIVA 1T7VA 2O3RA 4ASUD 2ZUVA 1IXKA 3A9CA 4I0KA 3N2NA 2ZRLA 5GSVB 4XBEL 2I07B 1AGRA 3CKYA 1H8OA 1LMIA 5AFSA 1G7SA 4X9YA 2O3SA 2PW2A 3IKKA 4PR5A 3VX4A 1EHLL 3N6RA 1HSZA 1DKLA 3HI6H 2XN9D 1RFGE 3PPIA 3K8MA 2IQ9L 5B3JE 3BMQA 1E2NA 4ICXA 4BKRA 1ZJAA 5MGNA 5AW6A 3B6KA 1RH8A 4M6WB 2Q7NA 2X6TA 2FGWH 3QW2A 4HPJB 2FYYA 4DCCA 3V1YA 3AS3A 3B6EA 4HGRA 3UBGA 1ZIAA 3EZXA 4H16A 3KM0A 1XF4A 4FQHB 2AOTB 4S1DD 4MB1A 5FOBA 4MKGA 1LPMA 1Y3DE 3BAXA 5E5LA 4EZJA 3MCLL 3A11A 5FLVA 3QQ5A 5DIFA 3CRW1 2PY6A 2WWWA 5DJCA 1CE6B 3UP1A 3OJDB 3ZZSA 1I7ZA 4FFTA 3LY5A 4XCNA 4FJ0A 2OCPA 4KJPC 1E60A 4KX7A 1E5BA 4NC2B 3UC9A 1RWKA 5CGZA 5HD8D 1R6AA 2HLDD 2XWEA 3PC7A 1F58L 4G1UC 5KYXA 1P19A 1I94B 3VAEA 4PZ0A 1HK6A 1I1AA 1ZT4B 2IAMA 1AGYA 2CGRL 2DJSA 3NCHA 3LNTA 5T6BA 3R74A 2WR8A 2BTEA 4M6MH 2P6MA 3HBQA 4J3TA 1FV1A 2D1SA 2EJ1A 4UMFA 1M3SA 4JO8A 3L3DA 4XX0B 5ALEA 1P7HL 3U7QA 4ZJPA 3T0IA 3K2BA 4OBBA 3MTQA 2VWEC 2RGWA 4CJ0A 3EEFA 1FAIL 4S1TA 2HOQA 4ZUVB 3QPBA 4PSKA 5C1OA 4FM9A 3HH8A 1U0NA 1G5AA 5E94A 5J6SA 1I2MA 2W2NA 1E8XA 5L4NA 2V2WB 1U7WA 4C20A 3NJRA 3GEGA 1P61B 1XVAA 4RSMA 5D5QA 3EAQA 4D0NA 2C3VB 3B1KA 4IFBA 3D48R 4IBSA 3MUZ1 2PH1A 5EN2A 1PQ4A 1PT5A 3A4LA 5I0ZA 3O8DA 1MFBL 2B59A 3WX0A 1INDH 3RIFF 1M6YA 5F5XA 3QHFH 3KQQA 2PVPA 4OYRA 4E6PA 4LHSA 1GQRA 3OAWA 3OC8A 4R7TA 2CHEA 2N1MA 1RHUA 2TRYA 1AHWC 5DHTA 2YA2A 5L0QB 2JLBA 3UJBA 3UOAB 3T35A 2WJIA 4G84A 5LIPA 4Z1OA 3D0LB 1U9ZA 2VNAA 3CZGA 1GTL1 2V0NA 5TQ0B 2GVYA 1GGBL 3Q6FB 3HUUA 1FRGL 3NHJA 2H08A 3K2QA 4NHOA 1E99A 1FP7A 5FOVA 2GCNA 4WHYG 5AVXA 1I3NA 1R9MA 3R3UA 1OAOC 2EDCA 2IGTA 5E03A 3K6KA 5LZ5A 4OBSA 4BEWA 1QQAA 2OFFA 2VAMA 3IPCA 1K6QL 4HK3N 3DF7A 4QTIH 1LW6E 1G3UA 1KXTA 4M98A 4LG1A 1YY8A 4QOGA 2P9RA 1LE9B 3QIBB 1E94E 1EDYA 5H94B 3G88A 4ZUUA 2WP3O 2IH4A 4FP8H 3ZZ1A 1FXSA 4QICA 3V0VB 5HX7A 4HI0E 4YX2H 3TQOA 3CLVA 5GGUA 4QRSB 4BZYA 4XB7A 4B46A 4YWHA 2NXCA 4PJ7A 3K30A 5HF5A 3D4OA 4WWID 3TWCL 4BWGA 4HA1A 2O2SA 2B1JA 3ARUA 5FGBC 5ARCA 4G8FB 1KZ6A 5ABPA 1ZHNA 6PAZA 3LP6A 5IX8A 1UEJA 5D7LB 1ZXQA 3W1EA 1LMKA 1NVVR 3ZCQA 5FCDA 2PWYA 4OM1H 2NUPB 4I36A 3HUJF 4XNZB 4Y7DA 3PJLA 2WSSD 1NDMB 4R7XA 5JAMA 3CEPB 2PR2A 2VMEA 2Y7QB 1QVZA 3DCNA 1EFKA 1SBSH 3IRVA 1S2EA 1YI8A 2NY7H 2YAMA 4PQRA 5JWOA 4UMDA 3G7TA 4MVJH 5IB2B 4L1BA 3I28A 1HYQA 5EI5A 4GMGA 1AQKH 3VD0A 3KK0A 3TZEA 3K05A 1J5OH 1EVYA 5KOMC 3PWPA 3U44A 1Y18B 2PQ6A 2IYPA 3M3DA 2YJZA 4ZMSA 4DSYA 4BNHA 1Y42X 2G0AA 3DDFA 4DT1B 1KEGH 2VZ8A 4K9PA 2R87A 4IW4C 1ZJWA 2DLCX 3L5OA 3T6QC 2VT0A 1ETUA 1C16A 5DHAA 4OKVA 1II0A 2YAHA 2NO9A 3M5CA 4A10A 5TDNA 3WO1A 1T1WA 3PXDA 4X3OA 1MQ8A 1YZKA 4NRXA 1EPFA 3FT9A 5J1SC 1VSCA 4QE3A 4QXOA 3EW3B 4Q7MB 4HUQA 4PRPA 5M29A 3FWYA 2FWNA 3ZIUA 2Z1NA 4WRLA 4WKCA 3GJFH 2A1IA 4OIBA 4PWJA 3URMA 1I80A 2OL3L 2DYKA 2XOKD 1F0LA 5CD5D 3VR4H 1EX7A 1COWA 1WKCA 5E7MA 1ODAA 4OZHF 4L3OA 4BU0A 5FFGA 1U9JA 4MYTA 4UW9A 4URUR 3B8SA 1N5OX 5BN5A 2Q1XA 4YHYC 2VMCA 3IJRA 3T61A 4C7BA 2VEOA 2H8KA 2X6MA 3L4ZA 2BFWA 3KB6A 3NH7H 3R7LA 5GJBA 1NGYB 2W2OA 3NN8B 2ARJA 3WQQA 4WEMB 4D4JA 2NY4C 2BINA 3F6CA 2DWQA 3FSVA 3PNVA 5J13C 1KYXA 2N0KA 1KP3A 1HT1E 4N8CH 4GKZB 2JA2A 4LYFA 2J7LA 2YC4C 1RWQA 4PCSA 3EHBB 1TDJA 5CK5A 3AHIA 3JYQA 5ELIA 4ISVB 3K0CC 4TYQA 3E0XA 5L2KD 1RLIA 1GDHA 3HNRA 3RUPA 1OARL 4NZFA 2C2BA 4K9EC 4QAWA 1SKUA 3OQOA 2AXEA 4BEIA 3KVOA 3T2PA 4NMXB 2HB0A 1U8QA 4FQ8A 2SODB 3SO3B 3E8XA 3SEAA 3GXDA 1G2PA 4J1NA 5LKAA 3C1AA 3CZAA 4NKMB 3TASA 4I9WD 4KITB 1CRQA 2D7JA 1TTQB 3IOMA 3ZKSD 5NLLA 4M9OA 1GKIA 2A9QA 2XYVA 1HQKA 1U95A 2ZSVB 5EWMA 3UT5A 3ULSA 3C5ZD 3EO1A 3G1UA 1NIPA 3V7NA 3ASUA 4GE3A 1QP0A 4ZMLA 2F4NA 1ECFA 4AROA 5HPOA 1C3VA 4F7EA 5EU7E 5AOVA 3ESPA 3QYMA 1K5DA 2O8BB 4FZJA 4KV7A 5F1IB 5TQ2L 3C7CB 1QYXA 4XLLA 3ARDD 2PX3A 4HDNA 4CUKA 1D0SA 5IJAA 1BSIA 2TECE 4PPQA 3FO1A 1C0PA 4J4PC 5HJ3B 3UTQB 1Q1AA 3QB7C 5JQ6H 1QCDA 4J3VA 4M0KA 2G67A 1O9HA 1TM3E 3W11D 5A7GA 3N70A 5ALWA 4QBFA 3QM1A 2ATIA 3NPMA 3BSZH 4LCUA 5TY0A 5K9QI 1NMSA 5IP4A 2AK4B 3ZJVA 2YBEA 3RPIB 5D1XD 5HOQA 2L2QA 4GKSA 4LPVA 4GSQA 4W9GC 2OYRA 7MHTA 2CWDA 4IDDA 1J87A 2DLTA 1NUHA 2YV5A 1MO3A 4G8IA 4M76B 2OTUB 1BX0A 3R7NA 3WDMA 4HEHA 1Q84A 4CQLA 5DWQA 3BXNA 2OCJA 1TMGE 2WI8A 3M4NA 1QRTA 2HZ7A 2Q2OA 3UPTA 1E3MA 4N9OB 4BH7A 2O2XA 4JK3A 1YU9A 1P5VA 5KS9F 1PT9A 1WFTA 5I1DB 1IOZA 4IEFA 5D96C 2CGEA 4LE2A 4RJIA 1VIVA 2C8JA 4NO2B 3SYKA 2C4VA 1FA9A 3B60A 4D46A 4R2JA 2IWKA 4DJTA 3LN9A 4J0DA 2EE0A 2OFXA 3NZEA 1KPRA 4IHOB 1F6BA 4KKZA 1U4NA 1E1KA 1W6WA 4QOIA 2WFAA 4MKMA 1CNMA 4EN3D 4YHZL 1JNNL 1PL7A 2PDAA 5JHDE 3BUYA 3HUEA 3IRPX 1Y63A 2X8WA 3FONA 2A33A 2SNIE 2YPLB 1I5EA 5C0BE 1FRVA 3WIDA 1TKAA 4IIJA 2HGSA 4X80H 3BE4A 2MQ0A 4EI5B 3UERA 2NVBA 1T7YA 1IN4A 1BFTA 1G41A 4EHDA 4TRNA 2Q9AA 4HNGA 2ZWLT 1LNUB 3EJTA 1IZ7A 4X20B 2VW4A 3N06B 1JV5B 1T0NA 5F0JB 4X6UA 2CJTA 4IMRA 2NTEA 3QDGA 2PUJA 3F1KA 2X7LB 4GFXA 1P7KB 1JN6A 4TS9A 3ROMA 4EGAA 3HM2A 2AITA 2MOKA 3QKSB 1KIPB 2F54E 4E9WA 5CUSL 1P2DA 1SULA 2JFOA 4I5BA 1RHHB 1BJMA 4Q4EA 3KL3A 4FFOA 3BKJL 1OA0A 2VR5A 1MJHA 1PG7W 4JKPL 5EIXA 2R8PA 2IOOA 3X1EA 4AI6A 3A28A 2DQ4A 4YZWA 3P2KA 1XEAA 2Z2IA 3QDJE 1HIML 1Z2PX 5F77A 4YR6B 3EOYG 3VOAA 3CFUA 4TL9A 2DYPA 4AYSA 5AW9A 2Z2JA 2AKYA 4I55F 1YEEH 2O7NA 3N6YA 1RZJH 2Q5EA 1DJYA 1OK8A 2R0LL 3CSGA 3H53A 3T3IA 4L74A 1DDIA 4IKOA 5BSVA 1E4KA 4L48A 1I24A 4BK4A 2R6JA 1NQXA 3EXHC 1VSTA 1NJSA 1KGYE 5ITZB 4YQZA 5LU8A 3L1VA 5IARA 1M7BA 2VERA 1ISSA 5HGAB 4K9QA 2ZONA 1Q0EA 2H18A 2V65A 5DCLA 5LDUA 3MM4A 1ACYH 3DMDA 3BKML 4JI5B 1OTTD 1ZHKB 1RU9L 4H25A 1Z0AA 4AZTA 2Z1DA 1FORH 3VSCA 3RIFK 1H69A 2IIQA 1PDKB 1YUHA 2GPYA 3WV0A 4LRXA 4UMGA 4EG5A 5H35B 1RURH 1HZZA 3V9AA 4A6YB 1EGVB 4HNRA 3HA5A 1HG1A 3VG9C 4UB0L 2QPOA 4HK0B 2LV8A 3SKMA 4M03A 4QD2E 2MTBA 1P2BA 3B6SB 3EDKA 2A1TR 2VQ4A 3BDYL 5A2QA 3NJFA 3RPKA 2AMJA 1NDGA 4XWGH 3ZTCC 5C2UB 1FMTA 2P8MA 2QSJA 4FZRA 3GP8A 5ALOA 5UKDA 4M61B 4EB0A 1G3RA 2E4VA 1K8QA 2NY1D 1YJXA 4PGBB 4V0KA 2J0QA 1JA0A 5KZCD 4TZKA 1CLZH 3T4EA 5KU1A 3KLSA 4PJHE 2IPOA 5HK9A 4M8NE 4RMIA 2C7QA 4LIQL 3WZLA 4LDRA 1U31A 3WL9A 1ZQ9A 2HU2A 3N40F 5E8RA 1STOA 3GGSA 3V3TA 2XKUA 4W1SA 1U3HB 5CEYA 3AYZB 4P23B 2JCCB 4PLFA 1Z66A 4FYWA 1IJEA 2PTHA 3ZTDC 3DEYX 4WNSA 4COOA 4NBSA 3O45A 5C70A 7ADHA 1XTRA 3ZK7A 1AC6A 3MACL 5KJEA 1S7VA 1Y3CE 2QX6A 3V7FA 1RMTA 3JRWA 2B8WA 3AI7A 1L7PA 2GJ6A 4GBGA 4ZQCB 3P3SA 1EP2B 2I2WA 5D72H 1FZMA 1GRVA 5A3VA 1UZGA 1E90A 1RULH 3OJOA 1L6ZA 4EB6A 4L0CA 1LV8A 4RVBA 1D5WA 1GJIA 2GJ8A 5A40E 4JFDA 1QLEB 1DDHA 4E4YA 4QWWC 1OFUX 2ZJ0A 1I1QB 1JVSA 3D2UA 1ZS2A 4OCWH 4WV3A 1NGPL 4HV4A 1DUZB 4KNSA 4OCXH 3D7PA 3HZYB 2OECA 3PF9A 5ABAA 5J6GA 4RMTA 1LH0A 3P9ZA 2EF0A 1NDHA 4F0JA 3KB2A 4HBZA 4QF1B 1C50A 1GOGA 5JCXA 4OGXH 5E4EC 1WB9A 1J6UA 1GP2A 4FFSA 1DQMH 3IUMA 1OLSA 1H8HA 4TXNA 3TCTA 2ZUSA 3HBAA 3ENQA 4KWIA 1C8BA 4UPEA 1FNHA 2BNQD 1CDCA 1WHSA 1GYUA 4FQXB 4TKZA 5B4MC 1DOHA 4PV9B 2VISA 1JGUL 5HI3D 4HSQA 1BD4A 4LFHG 2ZZKA 3ZKWB 1P84K 3SDXA 2COQA 5LM3A 3CHPA 3RWIB 3LNEA 3CFYA 1MXDA 4UVIA 4P5MB 1SF3A 2C4NA 2X2JA 4IFTA 4OK6A 3NDPA 3VOBA 3CFTA 3HHSA 1SKQA 3SQRA 2C7UB 2HJ9A 3ROPA 2IGFL 5DS8B 3KCPB 1IM9B 1NUAA 2UYGA 1PWZA 1CETA 5IVXB 5L51A 2ZUDA 5KOHB 5HF9A 4HKJB 3MA0A 3TK1A 4U1HB 2OMUA 1DJGA 3WY9A 4DIMA 2FWMX 2K0RA 4M38A 1BGXH 4PLGA 3V4UL 3CR3C 4JRYB 2OESA 4G01B 4NI6A 4YJGA 3D2LA 1Q0YL 3EEBA 4US0R 5FLUA 4KV9A 1EO7A 1F06A 4GQQA 1BMDA 1NBWB 4CGTA 5AW0B 1WL8A 4N0PA 1PZHA 4F3FB 1UM4L 1Z8DA 3RIAF 2WF7A 3C8KB 2NO7A 2QMEA 4XAWH 3GGDA 1W0VA 5A4DA 2GHWB 2QADB 3I0MA 2OCCB 3O6VA 2VYND 4MLCA 5IK3B 2UXDB 4NSKB 5F9AC 5IAGA 4FDVA 3ROLA 5LGJB 2JDID 5C7LO 1ZINA 5A3SA 2DQEH 3RDTA 1X86B 3M6LA 3T5CA 5THXA 2CRYA 4IP0A 1OIVA 1PN3A 4AKSA 3SBQA 4TV9B 2BNRE 3BM5A 1BWMA 5C07B 4M0FA 1NMZA 1MJJA 3CJQA 2VDPH 3U6XA 4B2YA 2YUXA 2PPEA 2I25N 1BYNA 1NJ5A 4IWYA 1GGHA 1PNQA 2FIRT 4TTVA 4TVPE 2WU3A 5B30A 3S37H 5K99A 3NSDA 3WXWL 2L04A 4R8WH 4FNLL 3E6FA 3FB5A 1JG9A 5EIIG 5EN4A 3H4TA 5HYQA 5JDIA 3RYIA 4OR1A 5E4AA 2J48A 3D3VB 2IAAC 3BHBA 4GGMX 5JBIA 4HIXL 3Q6IA 1WF3A 1NFDB 1J0CA 1GV1A 3TSCA 4LSTL 4RH3A 4UTBH 1YB1A 3RT1A 2HQOA 2P46B 2B9VA 2I32A 4OF3A 3IT1A 1RYDA 2NO0A 3O6MH 1YVLA 2YR0A 2J3EA 5AUQA 2YD1A 3DG9A 3JPYA 4ZU6X 2IA5A 3NDRA 4KMTL 4U31A 4FQQB 1RTTA 1T5TA 2KLSA 3T3EA 3QR1A 3E1SA 3MUJA 3Q4GA 1AY1H 3C8ZA 1UZ6E 5I15H 2JLQA 4RVHA 2EYSB 2V6FA 1SUBA 5JUEL 4I14A 4BQPA 2PKDA 2AHOA 1SN7A 3HCDA 4Q37A 1U8ZA 2Q6LA 2G1PA 2EZ4A 3RWGB 5BMVB 1RPJA 1YVRA 1DRUA 1RCUA 1YZZA 2WWTA 4P4KC 2FU5C 3ATAA 4IU2B 4UREA 1S7WA 1GTG1 3MJ8B 3T3HA 4BWVA 5FK9A 5AVVA 4YX9A 1XZJA 3K53A 4KYVA 4WE3A 1H6AA 4DA9A 2ZCLL 1ZNWA 1VCNA 2ECOA 3EAGA 2OK0L 3BSGA 1T2JA 3GFOA 1C7RA 1KEUA 4DZ8B 1NFIA 3SY0B 3PT5A 2I6SA 3MMZA 1TUBB 2DCMA 2LCIA 3ESQA 5KREA 5EEWA 1BEYH 5TQ0L 1J8SA 1M33A 1QYGH 2E4WA 4DWOA 5JOPD 4U7DA 2E27L 5IJKC 4TVKA 1FFSA 3DKPA 3DP7A 3PCYA 3CNHA 4WOPA 3P9CA 2AVDA 4KE9A 2Y0BA 3GQVA 4Z8XA 4LASL 4ZW8A 1EGJL 2J7PD 3H97A 4XSGA 4AU1A 2XZAH 1C2TA 3GLGE 1FN4B 1AHWB 3IAM6 4B85A 3OHMA 5I74B 1GHFH 4GS7B 4C4RA 3FFCB 4IS6B 1B8NA 5LNGA 1RKVA 2IH1A 3EH1A 4UQDA 5AVUA 1XGPA 2A1UB 3U36B 1RWWA 4YDIL 5C80A 3JTEA 1LE5B 2R8OA 3T06B 4ZCTA 4GMDA 1QYRA 3WHKA 3FOCA 4GH5A 2ITCB 1U7TA 2NYRA 4BEJA 4N7MA 4PAWA 3KOOA 2A5DA 1MJ7L 1KARA 1M1XB 3M7OA 3N8DA 1H6CA 1EHYA 2W2QA 3U4EA 4DR6B 3PDDA 3Q10A 1XCLA 3O3EB 2FQEA 1TIBA 3MD0A 1UATA 3DJZA 2P67A 3KGTA 3LVQE 3LKQB 1HEYA 3UAFA 1JXDA 3QCVH 2DPYA 4RLHA 4N2BA 1FDUA 2QLNA 3CIAA 3IE4A 1Z7WA 1Z37A 2O5XH 3C08H 2JB5H 3RS8A 1DYZA 1EKXA 4X8JB 4HH3C 1HXYB 2PMWB 1OZ0A 3OTTA 3K09C 5E2VH 4Y1RB 2OXIA 4LQFH 4DGUA 4AYFA 1BFDA 1H3PL 5FLYA 2O2YA 2QXYA 1Z4IA 2OQJB 1X4YA 2N3JA 3WL5A 4TLKA 1AXSA 3CZLA 2DY1A 3V46A 3VC1A 4DM4A 5IJCC 2PLTA 4YT2A 2X7JA 2WYWA 1GZQB 2CE6A 4OIFA 4X7TA 1SOWA 5TC4A 2CUIA 1W5EA 1EFUA 5EIAA 3VDMA 1R10A 4UFNA 2Q5LA 4KH1A 2A1WH 1PYWA 2R5WA 4RLQA 5H4YA 5EERA 4W5OA 1V96A 2ROQA 3P0YL 5DJDA 4ETYA 3Q6GH 3TM5A 1WO8A 3OM8A 2JLSA 5LN8A 4IJ6A 4U7JA 4Z7UF 2ZJ3A 3MNFA 4K8OA 3WG9A 4NGHL 4XDHA 2B15A 5E7FA 3NC4A 4MO9A 5KVDL 5AKJA 3PNMA 1UJ6A 4V1CB 3WNNA 3K70B 1HNWB 4BLVA 2HLNA 5A0VA 3HNVL 5C97A 5JRZA 1P7WA 2PETA 4HX1B 3C7DB 3PFUA 2JAWA 1IGJB 1VLVA 3O82A 4IHBA 3NEOA 3RK0A 3ZKND 3PWSA 3WJLA 1SIBE 2IHNA 3HPJA 1RZ7L 2GK2A 4G7YL 4AYXA 2WWNA 4HH4A 2C57A 4NCC1 4BVFA 4E09A 1F3DJ 1OAKA 3ML1A 3Q98A 5J23A 1FLTX 1WNTA 4FW9A 3WD5H 3KAPA 4IG4A 4U3JB 5BZXA 3FYIB 4D4IA 4WADA 2DMCA 3UWOA 3N8GA 2NY3D 4GQPH 4TYWA 4YSUA 1WXQA 4ZTBA 4GP8B 4BINA 4YHYB 4YRIA 4XP5H 1OA1A 2O3UA 5B3KA 4RW0A 5GVRA 4DG8A 3JSSA 1UT8A 2O23A 2FZWA 3TQRA 2ZRGA 3ZPDA 3GJTA 4YRKA 1GGIH 3GMOB 4L8VA 1R5IB 2VCHA 2NY4B 4L4YA 3LQ1A 3DMGA 5J13B 3BO8B 2NCMA 1YJAA 5C81A 3H9SB 4JYZA 4KSCA 5GS1C 3LLCA 5D7IF 3ZE0E 2FSPA 2KBFA 4C56B 3G0CA 1CQIB 3O8LA 4Z0BH 2WKOA 1CDOA 3BAYA 3VBEA 1U0OC 3PLNA 3BMXA 3H1GA 1JE0A 1QI3A 3A05A 4KWCA 1F4LA 5MERB 3GA7A 5G55A 3A7EA 3R2JA 4ANUA 1QHEA 3B3GA 4G42B 4MMXB 4F7PB 2A6PA 4KI7A 2YVUA 3DZDA 3SKJH 2W9DL 4L3VA 3I6SA 4BH8B 1XTBA 5DE3A 2R1TB 1ZA3A 3Q11A 2FQYA 2DI7A 4I4LA 2H0AA 3RH0A 3QKRA 4M1ZA 3WXBA 4NUJA 1WJGA 2EATA 3DLPX 2X4IA 1MF2L 4JG1L 2ZXQA 4BFJA 1TI7A 2I6FA 5C0EB 1T22A 5CXXA 3KELA 4UOZA 1NVWQ 3D64A 1Y9AA 3Q40A 2KQMA 5LGYA 3AIMA 2VBGA 3L0PA 1F97A 4O51B 2XZOA 1KTVA 2WYUA 4AN0A 5KSAD 1UINA 2VR1A 4W8GA 2B9AA 4D8PB 4YR7A 2CMGA 5IBTL 3GFGA 2H6UA 4XO9A 4HWEL 2QX7A 2BVUA 1MGOA 4G8DA 2MYPA 1Q9LA 3HMXA 4ADGA 1JSYA 3D07A 2PPCA 2WIDA 5AVYB 4LHUG 3NG5A 3IF1A 2QROA 1I8UA 4DKJA 5CP7B 3ZCPA 4QOSA 4RA9A 4Q6IA 1MTZA 2ZIXA 5KOJB 4GC5A 5FXMA 3DBOB 2YNMA 2G9UA 1M8JA 2E9BA 4KXNA 5F1SA 1WU8A 3ZNQA 3UJNA 5FM4A 4BJLA 4EEZA 5DJZB 3WDSA 3RIAK 4PHTA 1LWOA 1Y9ZA 3DX7A 2C0PA 1I7QB 3EXIB 4KOEC 3MGGA 4P5EA 3V0GA 5KINB 5GPRA 1RLJA 3KQSA 4WERA 4N9WA 2P7TB 2MQ3A 3KPPB 2UZXA 2CDNA 3FUNA 5FA6A 5L4SA 1ZNQO 1ZWKA 3SYRA 1XA0A 4AZ0A 1G6HA 3RDJA 2OHVA 3A4TA 3K91A 4QXUL 4MCZA 4UDUB 3L95B 1HT0A 4KVNL 1HKLL 1JYWA 3TIIA 4GNKB 1B0AA 1XSKA 1KC3A 4ZU1X 3VYWA 5AVSA 2BY0A 4MX7A 2H2WA 3STLB 2WSIA 1ED3B 2O54A 2QKSA 3B1YA 4XIIA 2V54A 4S11A 1PZUB 3TZVD 2YDYA 1FFGA 3ITNA 4GKVA 2PR4H 4YHKH 3QUKA 3GJ7A 3E9UA 1RZPA 2DHRA 1YCHA 4ANFA 1DQJA 1HI6A 1N26A 3R41A 1MAKA 5DGQA 4LRYA 3AVUA 2DG2A 4ZQKA 2FECI 1YNKL 4GEIA 1P9MC 3AHDA 1TJYA 4OB8A 4YIQB 5F7KC 1Z45A 1DXHA 1J70A 1UT2A 1G64A 5JDSA 3TL5A 4UUPA 1LO4H 4FR5A 4AYGA 2I4NA 4UOW1 1J5PA 4E4RA 4FX2A 2WYOA 1SJMA 4BFZA 3D2AA 4CC4C 4G0ZA 3A6KA 3KUKA 4YL9A 421PA 1KTLB 5C8VA 5FB8B 2G7MC 5HQ3A 4ZAKC 3HZVB 3S44A 2IOMA 1QNZH 3TO5A 3DV0B 4L1KA 3NBQA 4F2ME 3P9QA 3SCMA 3T38A 5KBLA 1GKOA 4U1JB 2NU9B 4P5SA 1BXZA 4HR7A 1N0LA 1R66A 3FQWA 4WHTA 1FFOB 1F4WL 1CG9B 1G1MA 2VDMB 4JM0A 3GUUA 3UEQA 4HQ6A 1J2UA 4N76A 4AVYA 1YR1A 1BWSA 3SO5A 1DWUA 3CSTA 1NPDA 1N59A 4IJVA 4DGVH 4UHEA 1Z3GH 1CQWA 3C3MA 3ZGXA 3D50A 3VSBA 4LSDA 1Z2CA 5JAOA 2F54A 2XG4A 3L4JA 5HFJA 4JDVA 5JIDA 1NBVH 4UBLA 1PJSA 5D71H 1RSZA 2W2MA 3CR8A 3AGPA 4A6YL 1J5XA 2F00A 5AW1A 3E9NA 3NYQA 4TMTA 1EUQA 2YMMA 5FHRA 2CJYA 4I4NA 3UK7A 4GJTB 2QFRA 3WO0A 3NKFA 3G6JE 3QDAA 4HIEA 1EVKA 1P6FA 3VI4B 5A05A 1GUBA 5B6PA 5F7OA 1A3RH 4DNOA 3WN6A 2PAAA 8FABB 2F55A 4QCIB 1CZRA 3A26A 2R79A 3GZTB 3W9EA 3D85D 4UATA 2H1LM 1J0HA 3UPCA 4U5XA 5EU6B 1EVLA 1VKOA 1M1YA 5CGQB 3CRMA 4FXGC 2HPOA 4NC1C 4LKOA 4CGUB 4AQ1C 4Z6KA 3TMAA 5F3HA 4Y2JA 2ZWZA 3GLFA 2H59A 1VIDA 1TGYA 1SZDA 5I9SA 4DRZA 4XTRA 3QXSA 4C0HA 4Z0XB 2D31A 3F2VA 1JE1A 4V03A 3SE6A 3QI9D 3KJ6H 1X5MA 4KXVA 7MDHA 1RXCA 2RIPA 4UAOC 1IBKB 3BFXA 4K8RH 3G23A 5D70L 1JQDA 3ZNNA 5JXED 4JANA 3B5EA 1QAWA 1RKRA 5BVHA 4G0UA 4OHRA 4P3WA 2YS7A 4TMVA 1RM3A 3FIJA 4RHFA 3DKHA 4C0LA 4Q7KA 4DZZA 3ZHFA 3EVCA 3TSZA 1IC4H 1QD0A 2XVYA 2XA1A 4JOCA 3QLVC 4B35A 3A2KA 3JV7A 3TLMA 2FBOJ 2FPKA 4PZUA 2XOTA 1CZNA 3H9QA 4LCWB 4ZV7A 1CJBA 2VUTA 3CLUC 2PUHA 3EJSA 5EO1B 1I2ZA 2BISA 3NBUA 2CJ3A 4LLVA 4X1YA 1VGKA 4D3FA 1I7LA 4O8CA 5CGTA 1QLEL 1D7CA 4KPUB 1P1ZB 1Z3IX 2D7QA 1K4DA 4MNHB 1I7UA 4WBNF 3TM6A 3IERA 1BLNA 3WGQA 4Z49A 5K4GA 3NFNB 4YUZA 4PJHA 4DTGL 5CJXA 5BNTA 3ZSSA 4NJAH 4B71A 1HM5A 1Q91A 2P6PA 2GARA 4APXA 2E76C 1QS0A 2Q5OA 3FKSA 3I9V6 2C5HA 5LNK6 1LO2L 1DQQB 1CFSA 2Q0XA 1LDNA 3LOQA 1TKWA 4YDJB 2FFJA 3ZH2A 4FMCF 5DEFA 2C5EA 5DISB 3EO9H 2B08A 1VSQA 1B0RB 1OAYH 1G9EA 4P53A 1M7HA 2WKSA 5G1PA 2JJ2D 5SWSE 1E4EB 2W2XA 3F49S 1JWUA 4LJ7A 1UAAA 5AI8A 3KVQA 4IU3B 4UM5A 4PJDB 4XYLA 2CO2A 1T15A 4GG6F 3L9EA 3EARA 2QU8A 3VCLA 5D9SA 3AVYA 5CVVA 1UH2A 5ALQA 1UEMA 2PPDA 3X1WA 4LRUA 3FE2A 4Z0TA 1P1FA 3KTFA 3HCBA 1SCUB 2WUBL 1VGEH 4KO3S 5I0WA 3U83A 2HT2C 3T1HB 4OQMA 3HMXH 1KJMA 2JVUA 2YYZA 3Q2IA 3WOVA 1QHSA 4GRLA 1TZAA 3P5SA 2D54A 3D7NA 3X1YA 3RYFA 3IVXA 3TNNA 5HWSA 2HXYA 1KG0A 3DZGA 2ERXA 3B7WA 4PGGA 1KYOK 3UTSA 4LZOA 5I23A 3FTGA 2XMGA 1SY6L 2R27A 2P91A 2N56A 1RUPH 3HR4A 2YKGA 3GFPA 3HB4X 5IWCA 1PS9A 3IDIB 4IHKA 4GEGA 4A2HA 1XEDA 3LKZA 3KTOA 2J0UA 3UO1L 5GIRB 5KVEL 1CX9B 2PFKA 1X74A 2F74A 1Y80A 4W9HC 3FSZA 1Z4PX 2GFHA 5EBMA 2O4EA 4JY4A 2QLLA 3RFTA 3DVFA 4BKMA 5KYVA 5E9DB 2XRAH 3B2XA 2I8AA 3FTYA 4A39A 3K2MC 1K5HA 1X6VA 1U81A 4HAFA 4JMNA 4N2DA 1IEQA 4U2KA 5CLIA 1JR2A 2DLIA 5I17B 1E5DA 1E6KA 5E1HB 2VDLB 5ICMA 4JY6B 2PP9A 5AUMB 3MRIA 2BM0A 3E4CA 5CP3A 4BNWA 3SE8H 2Q4DA 5L4LA 1C5CL 2RH0A 2GS9A 4BVJA 2CFTA 3IDUA 4Y4FB 4G89A 1NAMA 4GW4B 5ALYA 3AG1B 3PVZA 4ZTUB 4NQZA 2OMEA 4ALMA 2P2DA 1FXWA 1S7QA 5JATA 3UAYA 5L0QC 2V7VA 4O4JB 1MCRA 3VFUB 1I8AA 3NP4A 2UXCB 3QUBA 1SR8A 2PXXA 4N3UA 3RC9A 1YZUA 3SDYL 2OO3A 1QSFA 3ZWVA 5I4KA 1MRDL 2QDWA 2XT1B 5I47A 3GIWA 2QJTA 1UADC 2NXZD 2DL2A 3PPWA 2IOHA 1WD7A 1RBQA 4B0OA 1NOJA 1Q7TA 2ZDQA 4IOLA 1U2DA 4MCHA 4ZRDA 3I53A 4PJ7E 2Q0HA 2HI0A 4FE4A 1E4XL 1HINL 3DUWA 1ECLA 4IGIA 3QIBC 1U41A 3TUIC 5DHRA 4WW2F 4Z9FA 3VNVA 5KW9L 3TBYB 3OZEA 4U7KA 2F8IA 3SOPA 4FX5A 1RADA 4RU1A 3GDGA 2LQRA 3IXQA 2DMBA 5E00A 1BX2B 3GNQA 2K3TA 3Q8MA 5E4JA 2MR6A 3SSAA 1JMVA 1WHTA 1A8PA 4ITVA 4XNMA 4QRRB 1MV8A 4UPVA 1KFJB 1H2FA 3RHWF 3K0SA 4NQVA 3FTUA 1EUTA 4N2EA 4J0KA 3LPCA 1XDWA 4CC1A 2WFZA 2R62A 3KAJA 1TOXA 4A2LA 1U0TA 1RXEA 3UJCA 2RB4A 4GPEA 3HYNA 3LB6C 4KXDA 1KKMA 2QI9C 1EPUA 4ZHQF 4TKWA 1DIHA 1P1CA 4KNWA 1WCQA 1QATA 2XU9A 3PWPE 2QRNA 5JEEA 1D5MA 3PDGA 4HPOL 2JH8A 4PJIF 4M1EA 3UICA 2JC3A 3CLTC 3DGGA 4TUOB 3KKEA 4OQQA 4DNPA 1NCBL 3IDXH 3W9UA 5HTOA 5FUBA 4PX9A 1U63A 2IH3B 5JW5A 5AM5A 5I7EA 2K8MA 2EG5A 5IM7B 2P90A 4FLOA 5B58T 4C6TA 1CLOH 2V45A 5DJXB 2D5BA 4ZQBA 2ARJQ 2DSTA 1V8PA 3QPUA 1BMFA 4AX3A 5E8OB 1GA1A 1GPAA 1Q17A 5ETJA 3RY5A 5L2KB 5E99H 5IK2D 1LWHA 3TYGL 3KYOB 3V95A 5KQPA 3FTVA 3Q5GA 3FN9A 1N2BA 2MNUA 1C8LA 3S8GB 4LXIA 4AC2A 1RIVL 3C6KA 1S3RA 3ZKMC 4RDXA 1AY0A 1W16A 1KCSL 2GWRA 2IHZA 1L1EA 1IBZA 1L5VA 5IEBA 3VXME 3C7AA 3OQIA 1X5XA 1MSPA 3DBHB 2LCFA 5JS6A 2PGNA 3U4CA 2HKHH 2ZDGA 2ZCKH 1QZZA 3C5ZB 3KOWA 2AC0A 5FF6B 1M7XA 1Q1JL 3WN5A 2GNOA 2XWBB 1PV2A 1ZJ4A 4G9BA 2YA0A 3A36A 4OCMC 3DLQR 4C78A 5C09B 2ZIAA 2NLJB 4YJ3A 5IESH 4BVEA 1S3IA 1YJDH 3OFJA 2FJHB 4AW7A 4JFYA 1NCCH 5I7UA 3TEJA 3ARDB 3CZKA 1BJTA 2YEZB 4LB8A 3IT2A 2ZYRA 2YYYA 4XNQB 4MK4A 3WHXA 1Z8HA 3P5BA 3N58A 1ZNXA 2H7YA 3GLGA 4KGLA 1KJNA 2GM3A 1Z47A 3D0AA 1Z7JA 4Q4CA 1WX1A 3BUQA 4NQRA 1YJ8A 1FFPB 1P31A 5ADPH 4PJCF 4QG3A 2P2SA 4FLSA 4HUXA 5F9JB 2RB5A 4D0CB 2WINI 3O4JA 4RV4A 3W2GA 4OAWB 4JFUA 4UNNA 2QX8A 5JO0A 3PQCA 1CF9A 2P24A 4KJQC 1RSYA 3NJNA 3EHBC 3MTXA 4M9PA 2GCOA 1DXOA 4JZJA 5J11B 4MWDA 4D9MA 3QOXA 4RD0A 3NSFA 3FULA 3MSXA 3QNZB 3SPVA 4HS4A 4HLEA 2OR7A 2NNWB 4M7RA 5E4TA 1UM6L 2DH2A 4XCCH 5GHWL 3QPDA 1KPHA 4LNVA 4FZ8L 3BRCA 4E3ZA 2B0CA 4JAVC 4BFRA 3K2KA 4M5SA 3ES9A 2C34A 2NNFA 3CSYB 3SO3C 4KAJA 5AHKA 2ZPKH 8ADHA 2CHXA 1N2HA 4BNZA 4FQ5A 3GSVB 3LHIA 3T3PE 2QD3A 3N1PC 3B9KD 1FUIA 1L4YA 2W2LA 2PLAA 5TFSL 1OXVA 3L40A 1EAPA 1U8NA 4NQDB 4XW2A 1P0CA 2YMXL 1Z9MA 4D0RA 4CKXA 5HG0A 3VGEA 3H4FA 1BFVH 3FFDA 1I85C 4KNQA 4AJWA 1NDUA 2BKUA 4I5DA 4IIXA 1SAYA 5DUJA 3EPPA 3MD9A 2ADIA 1SK8A 2MCFA 3SBDA 4JG0H 4ZRGA 3RL1B 3WDHA 1LD3A 3EH3B 3RI5K 1TLFA 3EVTA 2IRWA 4LMAA 4CUJA 1M5RA 4C7OB 5C5IA 1T1JA 4TRPH 1ZW1A 1JEJA 2AJUH 4DJEC 2QPFA 1A1MB 2Y1DA 1CK0L 5IC4A 4LHZA 4I9UA 1AK2A 3C5CA 5CNKA 4KZEH 2A0YA 3TO2A 2QMZA 3PFHA 1CDJA 3GBSA 1PHRA 1HZJA 4CMAA 3WNZA 2JJVA 5F89A 2RKBA 1UURA 3MN8A 2H2IA 4P3YA 1U8KB 1J2JA 1I6MA 2IY9A 3AR8A 3HBMA 2YXWA 1AO3A 5TQ2B 3T9WA 2YC1A 2N7AA 5HI5C 4PCLA 3NTVA 4YHML 1YSOA 4H7KA 2R1UA 1EFRD 3EJWA 3HUJB 5FYKD 2C97A 3L6RA 4JVOA 1KFCB 2IIBA 1CG6A 2NZYA 4WZBA 3H2QA 3EIOA 3PWNB 1V7QA 2X4DA 2VZ3A 3SGLA 5ICXB 2J0VA 2D7TH 3PVSA 3W39A 3DXAA 5JAIA 3GMQA 2OC4A 3H2GA 4LUCA 3RBZA 4EY8A 5T1MA 1V37A 2DV6A 3DARA 2JKJA 4FR2A 2I4MA 1RPTA 1HHGB 3G0OA 4TLSA 1RMQA 3PQ7A 3AB3A 2H3NB 2PL5A 2I3AA 3JUZA 4GW5A 4N6GA 2F9MA 3FQ4A 3ZPXA 5T8IA 1QLWA 3MBED 3QOWA 1UA6L 2BHRA 3QU9A 2PO6D 3W79A 1V25A 5AI5A 3M9XA 1M6OA 1H0RA 1KY3A 3MODL 1DO0A 2ZNXA 4M3HA 1KXVA 3RVWC 4MRCA 4F3YA 3QDGE 3AUAA 1V0JA 1D07A 4BMDA 1IV8A 5CDSA 4O4LA 3RCBA 4MDEA 2UXFA 1V95A 3OLDA 4IMLB 4EI5C 3NDBB 1B42A 2BW4A 3G5WA 3WYCA 4DSTA 4BWWA 4IGBD 2CKNA 4TVPH 1UXHA 4MTLA 2PSFA 3CUPB 1S7RA 1DIBA 3FHCB 3HAEB 2HSDA 2HKAA 3AP2A 4FNPA 1ZD5A 1WXXA 3HR8A 4JFQB 2Q7YA 3Q44A 4XN4A 3FGPA 2E18A 3FKQA 1AO7B 1WM1A 3K2EA 3QWHA 1AQLA 4OZHB 1C7IA 2L19A 5GISL 4RETB 1RUMH 2R2CA 1KAGA 3AFHA 4GFDA 3PIDA 2XXCB 4B6RA 3L01A 2NXYD 3T0AA 3PYXA 3ME0B 1TD9A 2CZGA 2F59A 2HRZA 4WWNA 3I6YA 4M7KH 4MQ4A 2A9FA 3BMCA 1E6UA 1QTYT 2OV2A 2AH5A 5EE1A 4JS0A 1LD9A 3A2LA 3UCXA 1LNZA 4ENEC 2ZF9A 2WRZA 3WIAA 5C7OO 1JQEA 5C7XH 4G67A 3DGDA 1TLKA 3VZQA 2AOVA 4EOWL 1ODUA 4PPNA 4DR5B 4X6BB 3BFOA 2J8UA 2I29A 2BPOA 3MINB 1N6KA 4POAA 3UUWA 2VDQB 1QPGA 2Z30A 4R5XA 1M54A 3NHAA 3B2NA 2WBLC 5HDQA 3SWWA 3K2UL 4R2GD 5EDSA 2NX5E 3ZW7A 4FF9A 1RI1A 3RKPA 2Z8ZA 3MJWA 4RMWA 2BZDA 4F5CA 4QEZA 3H65A 5LQJA 3D4GA 3THYB 4TMYA 4FXTA 3A25A 4XNDA 3ZLUA 2B99A 5IIEA 2EO1A 2FWAA 2YJ3A 4PN6A 2C9RA 3KWXA 3F85A 1KMNA 1P6WA 1JS4A 2RG7A 2J25A 1OHHD 3EOAB 4XIGS 3DUUA 4V2IA 4GX5A 3KT8A 1E4OA 3C12A 3E1GA 4LFCB 2FHFA 4GPZA 1RWOA 3LKSB 1KJWA 4E42A 4NOBA 4WGVB 4QBHA 1CT9A 2JQMA 1U0EA 2JLCA 4U8HA 4ZUWA 1FLVA 3A6CH 2J33A 4RHCA 1XLTA 1DFHA 2PUWA 5F7AA 1YZ3A 3B38A 2IL1A 1F8YA 3C5SA 4JFTA 3LZ6A 3QQ9D 3OZDA 4M0LA 1YL6A 3EWSA 1P9RA 1IFHL 3K5IA 1L5OA 5TPZD 4K6KA 1PJ3A 3G8CA 2QGFA 1E66A 1J1PL 1TTFA 1RVFL 3VPSA 4P22A 1U3HC 1OTXA 4P23C 2LU3A 5E9QA 3FN4A 3K1ZA 4JFDE 3ZV6A 1CB0A 2W4MA 4KJWC 4I8DA 3BH9A 3RHWK 1W46A 4KMLB 2VDML 3ZUCA 3S7ZA 2GYWA 3RIHA 2Q5JA 5E3HA 2APXA 3FU7A 4NCAA 1A7OH 4V1DD 4PJ9D 4U6XB 4V0RA 3P77B 3HEBA 3P9LB 4YJZL 2CN1A 4PCAA 1E9OB 3WL6A 5FTMA 4LDOB 3BP5B 2IXGA 3VYNA 2VRCA 5EJ4A 3PR2B 4XUEA 3OAYH 5JA8B 1Z62A 2YIMA 3QRLA 4DCQA 1CTQA 3J7AC 4ZO6A 1CD0A 1YN6A 2Q9UA 3ARBB 1E0SA 1A7KA 1JD7A 5M95B 4F2MA 1HH9A 5LQMA 1PL0A 4U2FA 5KVMC 3AFGA 1HTYA 3CJJA 3SU8A 4HDKB 4ZDHA 3SDXE 2CYBA 2ATPA 1N19A 4GXNA 5GS3A 1B00A 2O8NA 4CT4B 2I55A 2DT8A 1B6DA 2Y1WA 3QJYA 2A14A 2VSFA 4QJ4A 4LYAA 3C2AL 3QIWD 4G86A 2O2EA 3W2DL 4MR9A 4BV1A 4I5GA 5CZRA 3JV5A 3SE4C 2FEEI 3HA7A 5FTLA 3THXA 1JLSA 4J03A 4JI8B 1ZUHA 3B9AA 2WLTA 3OHXB 2V7HB 3H6HA 4GI1A 3QUYA 1EK6A 5CN3A 1OCWL 3GD1C 4D0BA 1YQ9A 3MXWL 5IVHA 1RI3A 2WM9B 3MLSH 5A9SA 1SHUX 1UBSB 3O11A 4FNAA 3D8BA 3HHMA 1RKQA 4WV1A 1YBAA 4RZXA 1DBAH 2ZAIA 4HS6A 1DC4A 1H2XA 3KYCA 3HSSA 4M6NH 5ADHA 3KSAC 5FNVA 4IKEA 4GKNB 4XCYB 3ZDDA 2O1WA 3IDGB 3E7DA 1ZIDA 2ZI3A 1TLMA 3N2ZB 4TS4A 5L4MA 3ETNA 4I55B 5FA3A 5DX8A 3IXTA 5DWDA 2DH6A 2X41A 1FFCA 3RS3A 3T0VA 5D5PA 4FQ1H 3GSNB 2IXAA 2WD9A 4MKXA 2I6XA 4ZMWA 2W5UA 3PLRA 2WHPA 3X1MA 2V7TA 2QADC 4OFXA 4UNPA 3VFOA 4L5YA 5BQXA 2W6ZA 4KI5D 5CR1A 4C21A 1W0KD 1SJHB 4FQCH 4N2GA 1SM4A 2I5YL 4CLRB 2CY0A 2V59A 1CN4A 4P86A 2NPIA 2X0WA 3CZFB 5I75C 1ZSVA 1A6TA 2OCAA 1FLDA 3R20A 1DE4A 4JDTH 1CY4A 1FJHA 3DOEA 1PLAA 1L8XA 3M6UA 4J6IA 5HW0A 1MAHA 2HWKA 1N8ZA 3FHTA 2CR6A 1YIAA 1INLA 3QE0A 1JWSA 2YXEA 1KU6A 3RUDA 1K5WA 3QEUA 3US1A 5K0CA 5T3XE 3DVGA 3MV8D 2Q6KA 4AVJA 1NDQA 3RFCA 2I3DA 4RKFA 2HHJA 1OXBB 1T3HA 1JG4A 3OY2A 4AENB 3QZWA 2IYRA 3ZEAA 1NPNA 1QK4A 2QTBA 5KVGL 2D1TA 3ZIYA 3K7EA 4J8PA 2HFEA 3NESA 1JCKA 2F67A 3GJ8A 3JQ8A 5FEBA 3MFYA 4UD2A 3WTVA 5SWSA 3A4DA 2BMJA 4NC0B 1O95C 4JNCA 1ZOPA 3CVVA 4O2CA 4J5VA 2CNLA 5JBQA 2CMDA 2BFVL 2IVFC 2Y99A 4F8TA 4OD2A 3ZU8A 1ZGLP 1JA9A 4FC7A 4CMMA 4OP1A 5EAIA 1E9AA 4EYEA 1GTRA 4BO0A 1W85A 1GM5A 3MRFA 2AMLA 2OZEA 3L7FA 2CE2X 1V1MA 3AR9A 4XOIA 3LGXA 1M7DA 3Q9UA 1O7DC 5EZLA 3AB7A 4RNDB 5B6JA 2BMEA 2VDLL 1HSAA 5ELXA 3SJVB 2P8PB 4JPWL 1DJSA 1THMA 2IE0A 3DQQA 2AQRA 1PEDA 4XCEA 3ILXA 5B8CA 4JJEA 2IDQA 3HO6A 2PZAA 2A0LC 2L42A 3ZHVA 1T35A 1W4RA 1E40A 5TF0A 5JCJD 3QF7A 5E9AA 2BSTA 4H88H 4CRWB 4HDMB 3CVOA 4ZVQA 3BIJA 4X7RA 3D6AA 3VA7A 3FB6B 4R84A 4K7PX 3MXVH 1FYTB 5BRZD 4CM3A 2PF6A 1JPJA 1TTPB 3DV4A 4OD3H 5AYUL 3SDDB 2VJMB 2AEJA 4HNAB 5E8NA 4PG9B 3AIKA 2E7CA 4GWLA 1AR1B 4XGNA 5A4MS 3UDWA 2W59A 3M5DA 3BP4B 5FUOL 4G6FB 3MV7E 4ZMTA 4L02A 1HC1A 1N7GA 4U1LA 1LK7A 2C5BA 1MORA 4FFNA 4IOFD 4FFBA 1HYSC 5K9ZA 3WYAA 2R0WH 1T4GA 1XTKA 5IUJC 1IC5L 3Q0EA 3QY0A 5I74C 3K6OA 4GS7C 2WOOA 4F5ZA 1ZM9A 4UTCA 4Y1AA 2BZ0A 2O0JA 1JXJA 5FGRA 3QYNA 4L0YA 2I7XA 1Z0UA 2R4UA 4BUJA 2Q6WB 5J58A 5JECA 2C5DC 4G83A 2YFHA 3C70A 4EAAA 5JLJA 4HSCX 3FWKA 1JALA 3CLFH 1ADBA 1HQYE 5J9PB 2O52A 2GH1A 4PM4A 1UBJS 3REFA 1NJFA 3FQXA 3GI1A 1MQKL 1QFWH 1ZWIB 3JD1A 1QX4A 3H2SA 4GSRA 2HT1A 2WW8A 1I1CA 4N8UA 1WV7T 3CHOA 1GG2A 2CFCA 4G4GA 43CAB 3RU9A 3TGWA 2JG3A 5A7FA 4TOYH 1HE4A 1MDAA 1XIWD 2YJQA 3VISA 3OE5A 3BF7A 4EKEA 1N6RA 1WR8A 1V8ZA 5ALGA 2HG5A 5EP4A 2UYOA 1Y34E 5H8WA 2BRUC 2PGJA 3DUSA 4XRCB 4E21A 2Y0SA 1CK4A 2JI1A 4HWOA 3ZQ9A 5EPEA 3MV9D 1HXMA 4BFTA 3HC0A 4PQYA 2YH2A 1GNPA 3KYJB 1E62A 1KOAA 1JPEA 3BD8A 5IFKA 3EGCA 4BFVA 2RHBA 4W9LC 3L6DA 4KDTA 3TJZA 3FH7A 2XV6B 3RV4A 3LSTA 3T5GA 1K63A 2YHUA 4DN4H 4N2MA 4KB5A 2Q8QA 4GRWF 1BIIB 2VBIA 2WKWA 2O2HA 2AJ3B 4A37A 3AY6A 2CDBA 1P4LB 3IWUA 5FOJA 1XR8A 1X5HA 5DRNA 2BEWA 2O8EB 3UCEA 5DSXA 1LEGB 3G02A 2AG8A 4OQDA 3RVTC 1G8PA 3V4ZA 4BJ3A 2DETA 3E8MA 1TNNA 1KI6A 4Q4AB 3RUGF 3AXIA 4O63O 2ONCA 3ZLTA 5FYLD 1M1UA 3S37X 1CF8L 1XD8A 3RC8A 4TYUA 5AG8A 3I2IA 4ZYXA 4BIIA 1VRCA 3B4NA 1J2EA 3SFVA 4UBMA 2QUBA 4XNUL 3IMKA 3MGBA 4JREB 2IAND 4IBQA 1MLDA 4LKXB 3G17A 1JWMB 4L28A 5HHXL 2C9MA 2FUTA 3EOTL 1RYYA 1SOAA 4Z1MD 2AJSL 1W4BA 4N20A 1XGYL 3UTPE 2XOEA 3OLZA 1L4KA 1RRFA 3QFJD 1RWPA 3VU9B 2PW1B 3REQB 3K70C 2JW5A 4EGJA 4NN7B 1HE8A 4B3GA 3V8EA 3H7AA 2DH5A 2DBRA 2A9JA 4XWOA 3UM9A 4P9HL 3MTIA 4R26H 3G3LA 4O00A 5KNCA 2EJTA 2GAAA 1RUKL 3SS9X 3PR1A 1B0GB 1HDMA 1JGDA 3V32A 4QEKA 3ESBA 1A25A 2GTZB 3LSYA 1N92A 3KPSA 3MQFA 3OESA 4IFEA 4OQ1A 3VXMA 5FR3A 1QX3A 5CJQH 4XVJL 3PUVA 1PR2A 3IJHB 2Z6QA 2CIKA 4Z76B 1ABEA 2JFYA 4I9NA 4ND7A 1T6YA 3IIJA 1FNCA 3VM6A 4F33B 5TJHA 3DJYA 5CMLA 3P32A 3SBPA 2HRPL 2F43A 4GGOA 1HQRA 3I2CH 3BVNB 5LVEA 3HC2A 4OH1A 2AIRA 1EEZB 1MFUA 2WM0A 3GJSA 5AOLA 5AKIA 3OPYI 3EFEA 4OXQA 1TK9A 3M83A 2CNOA 3EGDB 3IIEA 1HZLA 4E5XB 3BWZA 2OCIA 3U1QA 1JPFA 2QJRA 1GRWA 3T0ED 4BFEA 1UD4A 5H5JA 1PG0A 5EWLB 1Y0LA 2TSAA 3PBKA 3UAZA 5L7XL 1XR9B 2B7CA 3IP6A 4MAYA 4AX8A 4L3CA 4MXVF 3GRPA 3G5XB 2I1WA 4NS1A 4DIBA 3BXFA 1TYAE 4UM8B 1VCAA 3OKNA 3BE8A 4O4YH 2EDJA 4MMXC 1FUKA 1FVFA 4EJFA 1NR7A 3ZY4A 2X1QA 1BZ7B 2KS0A 4WWKA 2WBXA 1ZEJA 2V7EA 4GT7A 3DBIA 1BVOA 2AV7B 2FZ4A 3HE7D 3RRBA 5T33H 2OCYC 4YXFA 4HGZA 2FVXA 3G7UA 4OI1A 1FHNA 1OQOA 3QUZD 3O8XA 1RM5A 1RFDL 3CZJA 3O6KL 4HDQB 5LUAA 4ZK8A 4HUMB 5E2IA 4DV6B 3T5BA 3M0EA 1Z5LA 3K5SA 4LJKA 4EQ2A 1KQ3A 4Z8FH 3AGVA 4UWQB 3LRXA 2ICAA 5F1PA 2Z98A 1K2WA 1OGIA 1QGAA 3INUL 2A7XA 1EBAA 1NBYB 3VSUA 4F6LA 2HNAA 2G82A 2OMVA 3TCLB 5HHME 5DCWA 2QBYB 1GZ4A 4Q82A 4CM9A 1MBZA 4QPPA 3R8XA 4E5VA 1HDCA 4FQJH 2ZU0C 1C5DA 2CZQA 4AMWA 1FNGA 1Z74A 3CO5A 4Q16A 3M17A 3CCFA 2FATH 1KZYC 2TMGA 4F92B 1JSXA 2PH7A 3K72B 2IP4A 3N2GB 3PYMA 1S3KH 4NWUH 1ZN9A 5J7CC 4Y6SA 4M5TA 2ZBFA 1MCWM 1R16A 1DQDH 5L3ZA 2QTVB 3F58H 5EEYA 1FZTA 3AUXA 1SPBS 3AB0B 5IYZA 1PGOA 4X66B 3JVUA 2XE7A 4HG4J 1RBZA 1E7WA 3C6SB 4HWNA 4NQCB 3WIHA 3AVWA 3E8UL 1ZS9A 4HG2A 2OFQA 2K4WA 4CEHA 3FO0L 3D08A 1IBLB 1V7PC 3QWQB 4J23A 4ODIA 3VO8A 3VNSA 5ALDA 3ZT6A 1QO9A 3GSXA 5L8KB 4F5DA 5FDYA 3W3AD 1QB7A 5FPKA 3PFNA 2PJDA 2FA9A 3QG7L 1UB6A 1NCGA 1JXFA 2WXLA 3L1EA 4NM8L 3BRSA 3H0TA 5BS0E 4P46B 1F2VA 1YB7A 4URVR 2IEYA 1U4EA 4GAFB 2X8JB 1TKBA 2PUFA 4Z7UB 4DO4A 2NU8A 1AZZC 3D85B 1ZOSA 3ZTNH 1CEXA 1GQOA 3JTSA 2ZBPA 2VAWA 2GCYA 2QTRA 4KBFA 2XWJA 4PO3X 3H5AA 1VMAA 3A6PC 1FTWA 1TTHA 2WZPD 2JGDB 3I9FA 3ZSTA 1YV9A 5DYWA 1AS0A 1UKQA 2YWHA 3RKDC 3EKCA 1G19A 3A2MA 3QI9B 1NGWA 4CMHB 3N8HA 2PLWA 2GJRA 4IBLT 2H31A 3CUSA 1KTJA 2ZG1A 2B34A 3TJRA 2EZUA 5K0NA 4R2XA 3ABMB 5HYIA 2IFTA 3FU3A 1REQB 5FKJA 4X7SL 4CM1A 3PL6D 1C7TA 4MP3A 5GZNC 3FQRB 3OEWA 1JL8A 4LMBA 1O9WA 3V8NA 1SHWA 5JNVA 5DW3A 2ZUUA 3T2LA 3AINA 2IALA 2VDQL 1Z5UA 3V2AR 1GLVA 1TF2A 1Z5ZA 1XYGA 4E9TA 1HORA 3FMVA 1IL1B 3L7OA 5D7NA 4HLUA 3EJUA 2E85A 1HAUA 2DQIL 5DHVB 5F1KC 4JPKL 2G1KA 1T1YB 1MJGA 1NOKA 4B9KC 3PXCX 3D0QA 1E89A 5JZ9A 3HO1A 4YC7A 1CUFA 1X5YA 4QGHA 4DIEA 2R66A 3NIGE 3CK0L 1RLWA 1CUIA 4MVBC 3X44A 1M1YE 1SWWA 3HE6D 4JJ4A 3HJAA 1RJEA 3GLFE 5E0OA 1R3IL 1VPLA 1AP2A 5D7IB 1QGUA 1A77A 4D3ZA 4C6HA 4JO4H 2D5IA 2FEXA 1E2WA 2RGUA 2ATCA 4PLCA 1YR7A 5EJEA 2E21A 4AXBA 5HYEA 1YULA 2ICWA 3NNDA 4N2NA 2UVDA 5LAXB 1XXDC 1ZGLA 2O3QA 3UFXA 3QFFA 2XMQA 1KEKA 3ZXYA 1CMOA 1XGTB 5DBHX 3GGPA 1FFTB 4DV7B 1W0JA 2AI0L 1WCIB 3E2IA 1P0FA 4BQ8A 1QRDA 1TPXB 3KEFA 4PM1A 2NX5A 5TDOA 4RHXA 2ONZA 3SPGA 4MW7A 5AW7A 1MAVA 4HVCA 2YKKA 3Q7JA 4ZSOB 3KM1A 5ARBA 2NUBA 4H8VA 4DWWA 2H6PA 4S0SD 4D9BA 2H2DA 3IAS6 1L7XA 3UV3A 5C08B 3LN4B 4JJHA 1ADCA 2VPWA 3ECWA 3K4DA 2L82A 4YI5A 4G72B 3A37A 1E2LA 1BJ1J 1QZ1A 4JN2B 3P11H 1E42A 3V4PB 3IKTA 3SC2A 4Q19A 3QWNA 1NIDA 4KH0A 35C8H 1GN9A 3ZDZE 2R7KA 1N77A 5A43C 4PXAA 1J1UA 1PLGL 4HFNA 4X85A 1I2BA 4WN9A 5DGDA 4BHUI 2CLRA 2KT6A 4GM0A 1E3WB 4YO0B 4I9XA 1PS0A 4G97A 4RAOA 4ZMPA 5JC8A 4WWOA 2W07B 1J1ZA 2ODHA 4REQB 5BYAA 1UP7A 2XMCA 3CUYA 4KK9C 2UY6A 1TTRA 5F7DB 3VMOA 1T5HX 2QKYA 1PJ8A 1T4DA 4N25A 3TN0A 3CBQA 4PGMA 2BOBB 1R0ZA 3DTYA 3DQZA 3FN0H 3EUDA 2PZFA 5HYSG 4ABYA 1DEEB 2PUBA 3WFHB 1RKUA 2NPFA 3JWGA 3W77A 4IDOA 5BJTB 2VP2A 1WETA 2AEPL 3H16A 1TMOA 5CP8A 4NPYB 4TLLB 4KBGA 2X6VA 3BZEB 1RZRA 1I30A 4ARSA 3DZKA 4R1NA 3TO4A 4NOLA 3LPOA 4K7PH 1AXTH 3GLVA 1TYRA 1W80A 1TT5B 2WLKA 2YFOA 4YUEH 1ZITA 5EZJB 3EC2A 4DCPA 2QQKH 2D6FA 5IQNA 3UTSE 3C3WA 3AHJA 1OASA 2KLTA 1OGTB 2AXWA 2EC9U 2E2WA 4MIEA 3UGKA 3VQMA 5CLFA 5MEOA 3PQ5A 5JXHA 3IFLH 3L2LA 4QXGL 3N7AA 5AWFC 4OT1H 2WPDD 2CLZB 4HD8A 3RASA 4P3XA 4MLSA 2MMXA 1JDDA 1RC1A 3M6MD 1D9ZA 4K4KA 4TN1A 1YGYA 2XV3A 2DGDA 3PEEA 1WMSA 2EG9A 2RI1A 3E4DA 3TBHA 2ON6A 4B3SB 2PXHA 4P34A 5ALJA 2P69A 1ICTA 1I8MA 2BFFA 3GSNL 4KGXA 3HGQA 3GQBB 3HFJA 4B6SA 1U9IA 1KTRL 5HHOA 2I5PO 3C8UA 5JJKA 4EJSA 2WOJA 2V7NA 3VD2A 3FPFA 7REQA 4F46A 3NBNA 4OG2A 4G5QA 3U6BA 3I0NA 4WASA 4MA8L 3V8QA 5FYJU 5DU2A 4LDEB 2J1KA 1U2GA 3RTQD 4DVBB 4XRGA 3HS3A 3AROA 2ADJA 3TQSA 5LDDC 4ESKA 2E9IA 1YEKL 2E0IA 2I87A 5ICUA 1SG6A 5HDBE 3G2PA 2AV1B 3NTXA 4MA3B 4Y4FC 1XX6A 3PYLA 1B4RA 4NQEA 1QSFE 2QPLA 4QYIB 3BRWD 3B51X 1J2YA 3EYQC 4UJ3A 3BZFB 3TIDA 1JHKH 2XBZA 3CRNA 3NBKA 1AG0A 3T0WA 4WJ5B 1CF1A 1RY7B 2EKDA 2E7BA 3ASWA 3CMGA 5I75B 5KQSA 1MW8X 3MFFA 4L7VA 4LPWA 2IPAB 1DI0A 1NVEA 4KUCF 2PS9A 1XZEA 1E9DA 3FRHA 1UH5A 5K09A 3DE7X 4HRXA 2J1WA 4IVQA 4BXVA 4BVHA 5KSBF 1H1DA 1OTHA 4CMIA 5DMKA 1FNEB 1X6NA 2RARA 5D2LF 3HNOA 3RFFA 4YSRA 3VFGL 5I0YA 5SY6A 3IJEB 2O6HA 1QBML 4NNXA 3KJXA 3PWTA 1W72A 2G8LA 4QDOA 3UAXA 4RDIA 5FCSH 2PRZA 3F5WB 4MSWA 1T5SA 2Z7WA 5KPDA 4CVNA 1GT6A 1G5GA 4ODBD 4AUMA 25C8H 2IDKA 1E2ZA 4Q7LA 2GCIA 5FFLA 3QNWA 1SXSA 4X6CF 5E2JA 4K81B 1XUOA 2J7KA 3IEKA 2WLIA 3EGXB 4MHOA 4E5UA 1SC6A 1KGJA 2CNWA 2XSKA 4PO1A 5ACMA 2ZXGA 1XALA 2GY5A 4N7BA 4O2FA 3TR6A 4P6VF 1T3FA 4K15A 3PWLA 1X3DA 3VPHA 4UASA 4OU5A 3VGAB 5EUKA 1ETHA 2MCPH 2HIAA 3FH0A 5F64A 1WA2X 3MPOA 1QVOB 4ND4A 4AO8A 2JKYA 4QU8A 3G85A 4WI9A 2N0MA 3MJ9A 1Z39A 4WBNB 4CZ2A 5HZKA 1ZJBA 1PAZA 4M9ZA 2OOKA 1KAOA 2XH8A 5EIWA 4MAFA 5D7EA 3PZRA 5K9OA 1E1CB 2CBTA 3PIRA 3AXLB 2WTEA 3IFOA 2Y6SC 2J4WL 5FUZH 2DI9A 1BVNT 2YRLA 3L4BA 5IHWA 4L8LA 1XMEB 4J7AA 4HUWB 2VWPA 3APDA 1IAKA 1EB9A 2IDMA 4HWBL 4QXAA 4XI5D 2EBWA 3KJZA 4ESOA 2R59A 2QRPA 3FMGL 2HJKA 3BWSA 4OZFA 3SEPA 4FMCB 4W82A 4JWKA 1MD9A 1KK3A 3VFPA 1QYDA 2AXHA 3AX6A 5KWIA 2AXQA 4M9XA 2HX8A 3T77A 4LC0A 4YDRA 4GSDL 4C3OB 3WRVA 3MRJB 1HNFA 4RY0A 4BNDA 4W5WA 4ZPXA 2ECPA 4A68A 3BT2H 4PRBB 3HPQA 4BKLB 1SQ0A 3N05A 4ZIRA 4A63A 5MEPB 4GG6B 4ZI7A 1X7YB 4W1TA 4QXQA 4MDYA 3LTEA 4EAEA 4ZC8A 1H4SA 4CMGA 2XPCA 1JHRA 1G7IB 3FJYA 1DELA 2I9PA 5TE4L 3RS0A 3M82A 3GPCA 3VR3D 5BV2P 3EZ9A 5F21B 4NUQA 3C5ZC 2WUCH 3RK1A 2BMFA 4XASA 3RROA 5TPWB 2XCIA 2BP0B 4BFOA 3LJKA 5IVIA 1O3YA 3EYUH 3QUTA 4PJXA 3ML8A 2FL5B 2YV4A 4TV3A 3ZN2A 1EAQA 4GOSA 1ZL2A 2CJFA 1UVQB 5KTEL 4HJJL 3MRSA 4ATWA 3MV7A 1ESZA 1Z8NA 3TL3A 4OV5A 3ARDC 2NX2A 1B2YA 4LBVA 4FHCA 3H0CA 3LKOA 4P9HC 4MXQC 3SQOL 3A24A 4S1SH 2HREA 2HIGA 1UC4B 3N8KA 2PK3A 4GAJL 4MKZA 5IG7A 1J25A 1NTRA 3Q3VA 2R9HD 2QUIA 4JI6B 1KO4A 2NADA 2H9AA 4OMDA 5C1DA 1XCTB 4ND2A 1SVBA 4PJGA 5C0IB 4LXXA 2PJZA 1TNMA 4ODHL 4OEHA 3W11C 4EEXA 2BTQB 1JP7A 2VR7A 4GLJA 1GAFH 4X99A 3GJQA 4ZVKA 3LCYA 5D1XC 2A4MA 1RJ9B 3M7IA 5J11C 1R7RA 4PJBA 1B26A 5D7JD 3H3PL 4OHPA 4RD1A 4MVCA 5K01A 1XDGA 1RQ7A 2GFQA 3KJIA 2IK8A 5H4ZA 1FE8L 5FW7A 4PV8A 1X0XA 1QIDA 1Y1DA 1P3JA 2C0QA 4QRDA 4DFIA 1LKZA 2Q7AA 3ID6C 3X3GL 1HH6B 1ZSHA 5BW7C 2NG1A 4Q3AA 2MPAH 4UQPA 4LSPL 1W0CA 1UZ8A 4FOOA 3IE1A 1TZOA 2C7PA 4QLOA 4UEJA 4RE6A 1NMAH 3H1PA 4DPMA 5J5AA 2OR8A 2WIKA 2A74B 3LZFH 2ODAA 2PZGA 4CT0A 4CKEB 2GWHA 1QRUA 3TEWA 3K0EA 5G2OA 1CUHA 1JR3A 2NY0D 5INDB 1W29A 2D2OA 3X1JA 3PJSB 1U65A 3DC2A 1KOJA 4G1BA 2J3HA 1M83A 2GBFA 4R96A 1KR5A 1JB1A 1AF7A 4IGFA 2DQUL 4H0NA 1KP2A 1DSFL 4WW2B 3MKKA 4YREA 3DTNA 4AAYA 2HJLB 3U82B 1ILUA 3JQEA 5E2TL 4Q9NA 3SF8B 5BW8A 4PVLA 5IB1B 1FNNA 1J33A 4G80B 4IGBB 1KQGA 1K0UA 1HDIA 4IHJA 4TT3A 3F2LA 4WXPA 1ZAGA 5DI9A 4WZBE 3V8CA 3FT1A 2XACC 3M1OA 5G41A 2JQZA 3GGWB 4FOSA 2XHNA 1S5PA 4A7GA 5MENA 2Y8EA 3DO5A 4QHNA 3DXAE 1Z2EA 3PRHA 3E84A 1XEXA 5IUKC 4P2GA 2RHLA 1O9BA 2IITA 5HS4A 3GO1L 1RIUL 2JIQA 5CCJA 4TKMA 5TNXA 3PFGA 4ZHQB 1UWYA 2XXGA 3L02A 4XPIB 4OKIA 3PP3K 2QZ4A 1QFUH 3G6AB 1NX9A 2O5NA 4PJIB 4CIBA 1QLFB 1UJBA 4JFXA 1GW0A 3OLEA 5J1TB 3U4AA 4IOIB 2LWIA 3WQHA 3MUY1 1E7QA 4KY1L 2ICEA 2WQRA 3FTZA 2DXIA 5FYDA 4OZGF 1IOLA 1H3TA 2DQTH 4AKIA 4KUCD 1WPQA 5I24A 3DH0A 2WQSA 3FCYA 4DGYH 1AQHA 2YYAA 3LT0A 4K2UL 3AFNA 4JFZH 1QRAA 5DD6B 1R1CA 2Q2EB 4JAMB 4UXIA 4AG6A 4BU1A 3A27A 1H2HA 5C8YF 4PQFA 1T0PA 2FRDA 1NL0L 3UAJD 3VNZA 3ZG6A 2Q0QA 1MX1A 4QC2A 3NIWA 4A7VA 4ZI5A 1F17A 4AJ4A 4AJYV 3SDAA 4GYYA 2XB8A 1YOBA 3V2UA 5FHQA 1KC5H 1IGCL 4Q24A 4MRMA 3KXIA 3S55A 1M72A 2EEPA 3AU0A 1WICA 2CLDX 1DLJA 3OJFA 1PLJA 3Q01A 5EE5B 1XDZA 2CJUH 4NWIA 4MA4A 1O97C 3RWFA 1VGVA 5EHZA 5CSGA 2BVOA 3VGGA 3IB3A 1BVYF 3PQEA 4BO5A 4EY4A 2NTYC 5FGSA 2N1KA 2WHVA 5BUGA 4LIPD 3NFSL 2ESVD 4JHZA 3G9UA 4PGCA 1PDWA 4B9AA 5T3XH 2WFLB 1J0IA 2ZAHA 5F5LA 1YEWA 1A3ZA 3MUGB 5E08H 3WO4B 1T36B 4MJJA 5HGHA 3LZLA 1IDOA 5A3IC 2ZKMX 1FW6A 5DK0B 1R75A 1LA2A 3QCUL 3IJPA 1DV1A 4PB0H 3WGGA 2J8UE 1N5KA 3VA2C 3C1OA 5EO9A 4V0QA 3IMCA 3DO6A 4KXXA 2MEJB 2VLMD 3R0MA 2JCBA 1LQ2A 1HF3A 4K9MA 3OT1B 2UYLB 1U0BB 2GFBB 1QSEA 3HNSL 1T66D 4PJCB 3CPEA 4WCVA 1U02A 1SC1A 4F5CE 4NBYB 5KVCA 3VD1A 5DBOA 4PTYA 4FG4A 3J2PA 5DJ6A 1SO8A 5B58C 5F12A 2X53A 4PBVC 4HLNA 4ER0A 3RQIA 5GM2A 3QX8A 4V1DB 1XXFC 5CS7A 2H2PC 2EHJA 4JJ6A 3ZGHA 1CPUA 4AN4A 2VQ6A 3OH8A 5EHXA 2KBGA 3CFBB 4O0LA 3DPBB 4W4TA 4DY6A 1N68A 3DURA 3MREB 1KEEA 2X86A 1YBFA 3D39B 1PEKE 3GR6A 3UZUA 5DD5L 3CNOA 1T34A 3OPZH 4NMLA 1EHNA 4XYBA 1SFRA 3BCFA 3CVJA 1KDRA 1Q72H 2MQGA 3U6KA 5HDOA 2J5XA 4N5ED 1WD8A 3VFSB 3ARFD 4NL4H 1DO8A 3B20A 2FW7A 2J44A 3VXOB 3AEQB 5DXFA 4E5NA 4UTAL 5GINE 1I51A 1AZWA 1GTMA 5DYGA 5J5VA 3LZRA 3S3BB 2IG2H 4LP4A 2DERA 4LESA 3CFKA 1ZGJA 3OZRA 1EV2E 1KDPA 3UJIH 4FZEL 4BXOB 1O5TA 1JFRA 4ZX6A 5DGHA 4FFWA 2Q86B 5SZHB 1LS6A 4KXYA 3L7LA 3QVAA 4US2R 4UV4L 4UQ9A 1U9KA 1WD5A 4W6XB 2HWUA 1XA3A 4C0JA 4EFMA 4F4JA 1P44A 1TCMA 4JO2L 3NUGA 1TEZA 1H9CA 1IAVA 5EEXA 5AOCA 2C3OA 2QQLH 1T2UA 2YRFA 3M6XA 5IXJA 2DUNA 2GHRA 3HWSA 1IGFL 4YFLF 1WW2A 3QRGH 4HLZG 2OHXA 5BS0A 3IEXA 1TQ6A 2WZ0A 3UUGA 4JVMA 3NMEA 2C9VA 4LCCB 3MWJA 1MXGA 2J4CA 4QXMA 5FDWA 3T7AA 2QQ0A 1NCDH 3QXDA 1A1OB 4R2KA 1E1NA 1PG5A 2HADA 1KY5A 1C9KA 3RJTA