3UOAB

Crystal structure of the malt1 paracaspase (p21 form)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
378
structure length
364
Chain Sequence
MLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the mucosa-associated lymphoid tissue lymphoma translocation 1 (MALT1) paracaspase region.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
total genus 100
structure length 364
sequence length 378
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00656 Peptidase_C14 Caspase domain
B PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uoaB02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uoaB01
3KJQA 4NBNA 2CNKA 5I9TA 4PRYA 1I4EB 4HQRA 2CNLA 1RWWA 1GFWA 2Y1LA 4N5DA 1M72A 1RWOA 3H11A 3DEIA 1IBCA 4QTYA 5IBPA 3R7SA 4QUAA 1NMQA 3OD5A 4N7JA 4FGUA 5IC6A 2HBZA 1GQFA 4JQZA 4NOJA 3PD1A 4EHKA 5IAJA 3V6LA 1K88A 2QLJA 4QUGA 5IC4A 2HBQA 2Y0BA 1RWNA 3P4UA 4ZVUA 1RHUA 4QUEA 3H0EA 1QX3A 2H54A 1RWPA 2K7ZA 4M9RA 3R5KA 4FXOA 4FEAA 4JJEA 2H48A 4PS0A 4QU9A 4DCOA 1CP3A 4DCPA 1PAUA 2QLBA 3H1PA 4QTXA 2QL7A 4ZVSA 3R5JA 4ZVQA 4EJFA 1F1JA 5IAEA 2J33A 2QL5A 3NR2A 4EHFA 1RHJA 5LUAA 5LU9A 1NMSA 2FP3A 3K7EA 4IYRA 3D6HA 5IASA 4I1PA 1PYOA 4NOMA 3IBFA 4QUHA 1SC1A 3S70A 4ZVRA 1RWXA 3BIJA 4QU5A 3H13A 5IARA 3D6MA 4D3YA 4FDLA 4JQYA 1SHJA 4N6GA 2C2MA 5IBCA 1RWVA 2AR9A 4QUIA 5LUBA 2QL9A 4EHDA 1SHLA 2H5JA 1K86A 3S8EA 2FUNB 4AW9A 1RWKA 1BMQA 2C2ZA 4D3ZA 3GJRA 1RHMA 3PCXA 3SIPA 3UOAB 4EHAA 3DEHA 4NBLA 3GJSA 2J32A 4LSZA 1I51A 1F9EA 2WDPA 4PRZA 4HQ0A 4ZVOA 2XYHA 4EHNA 4QU8A 2H4YA 3H11B 4QU0A 1RE1A 4JR1A 2J31A 2CNOA 4N6OA 3R7NA 3SIRA 3DEKA 3KJFA 4IEFB 4I1RA 1QDUA 3KJNA 5IANA 2P2CA 3GJTA 3UO8B 4NOLA 2J30A 1ICEA 1SC3A 1KMCA 4DCJA 3NS7A 5H0IA 1SC4A 3V6MA 1NMEA 4EHHA 3V3KA 2H51A 1I4OA 3EDQA 2XZDA 5K20A 3E4CA 3V4OA 4QUBA 2CNNA 1I3OA 4QULA 4ZVTA 2NN3C 2HBYA 4PS1A 4HVAA 4QUJA 4AWAA 3D6FA 4ZVPA 4NOKA 2XZTA 4D3XA 2CJYA 1RHRA 2C1EA 4N6NA 1RHKA 3NKFA 4N7MA 2QLFA 3R7BA 4NBKA 2C2KA 4JR2A 4JR0A 2XYPA 5LU8A 3P45A 3ITNA 1RHQA 5IAGA 2DKOA 4AWBA 3R6GA 4JB8A 5IBRA 3DEJA 3V55A 1CVRA 2HBRA 2C2OA 2CDRA 3GJQA 5IAKA 4EHLA 2H5IA 2H4WA 1RWMA 3QNWA 4JJ8A 2CJXA 2H65A 5JFTA 1QTNA 1NW9B 3IBCA 3V4LA 1JXQA 2FQQA 3PD0A 3RJMA 4JJ7A 5IABA 2XYGA 4QUDA 5I9BA 3EDRA 3R6LA
chains in the Genus database with same CATH superfamily
4HQ6A 5SY6A 1JR3D 3MQ2A 3FN3A 3MJ8B 5CYOA 5CSZB 1DB3A 4GWGA 4IIJF 3VFSB 1S2LA 2MKWA 2Y3AA 2PD4A 3NDIA 4FFYH 5D1XC 2Y5QA 2V2WB 3WDMA 4YVUA 4PJEA 2IH9A 3WKBA 2E4UA 4JL2A 2DE0X 2AS5M 3WNCA 3OJDA 3MREA 1MO5A 2Q9CA 1UD3A 2UZAA 3STXA 4B3MB 4WWOA 4YNBA 2LIVA 1HSBB 3HI6H 4YLQT 3Q5GA 1FU8A 1YA5A 1UWXK 4URZR 2ZJZA 3QORC 4MWSA 4AENB 1IZJA 3K2MC 3UPRA 5E0KB 4RAOA 3C4VA 1NGXB 3BJIC 2R56H 4MNHB 1IWPB 1GL4B 1RI1A 1UBMS 1Z7YA 3VHRA 2H1LA 1SGWA 4YUWA 1ZVJA 3GK8L 4GG8A 1BWQA 3L06A 4YT8A 2CHZA 3W37A 2D4DA 1Z5YD 4PSDA 2X4SA 4WCFA 1XCLA 2JH3A 2B35A 3ZCUA 1F4WH 3ENQA 4E9WA 5E2BA 3FT3B 2J8UE 1JCKA 4IEEA 4RHCA 3QJYA 3HLKA 1R8SA 3JQRA 3MLUH 1YIDA 2CVQA 4ETMA 1U11A 2B4QA 3ENZA 1Z8NA 3CBGA 2PWGA 3S1LA 1NAMH 3T0EA 4S24A 1O95C 1JYXA 3ICCA 4BNMA 5HHNB 1VF5C 3EC1A 4BN0A 3ZZ0A 2FW0A 4DGIL 3DX0A 3GP5A 3V5HB 4LVNA 5FYKE 3F5WB 4XCCL 4UBJA 8PAZA 2CO7B 3WEMA 4KRPD 2RB8A 3VH8B 4A2FA 1GMIA 1MO6A 1UATA 2DMCA 4D9CA 3IA2A 1I9JL 3AI1A 3BPNC 2E7DA 5CFMA 3GUTA 3S99A 5H3HA 1GAWA 2PMDA 3U13A 3K70B 3FB5A 5DD3L 1AF4A 4O1IA 3WNJA 1GKUB 3VU9A 3W5MA 1OM9A 2FH8A 3IT2A 4O2BA 3F7YB 2GZHA 2F1RA 1O7DC 1UB5B 1R4ZA 4MR8A 1VI6A 1YFKA 2W38A 1J99A 2PYZA 5IXJA 4M7LL 3KKPA 3I2KA 5F9JB 4OV5B 4HGQA 1M1NB 3MK31 4BLVA 1FO0H 4ZEMA 2IUYA 3TP4A 1UD6A 2A5JA 2H2GA 2CBQA 1A5FL 1GW6A 4HVTA 4AN1A 1E4KC 3UGUA 4ZTUB 4LMPA 4X66B 2DKMA 2Z31D 1JFTA 4QPNA 4RGMB 5AW4B 2XKSA 4R8RA 1W47A 4P4GA 4QXGH 5BSFA 2BYTA 4R3NA 4WNQB 5LZ7A 4GI5A 1NICA 4KR6A 4MGHA 2ZTVA 4Y2HA 1N6OA 1Z8FA 3NHFA 4O00A 4EY4A 4BZWA 3BGDA 2XA2A 1R50A 3D8NA 1R75A 4K15A 4KWHA 3CFQA 2NXCA 5L7TA 4CUCA 2P5EB 2AJVL 1VLVA 4MUBA 4W1QA 3F73A 3B2EA 3B2PA 1XNRB 4ESVA 1UGNA 2QVCA 3BH9B 3LOWA 25C8H 1FP6A 3QCTH 3GMQB 2CCLA 3G17A 1E27A 1ETHA 2Y23A 4W9DC 3DNMA 4I5BA 5LYYA 2OB1A 5AMXA 1AXSA 1THGA 2BZ7A 4CCAA 3E7FA 2MKLC 3UJDA 2FZKA 3BRWD 3UMFA 2DIJA 2DY1A 5AVVB 2M9MA 4LSPL 3PNOA 4DP5X 1MCPL 5ICYA 1T3ZA 2AXHA 5KS9B 5AVYB 1YC2A 1ODCA 2QNBA 2QDVA 3P97A 1FYTD 2C9ZA 3GLHA 2R1ZA 1EFKA 1E1MA 4OZGE 2P3OA 4C4OA 1OP9A 5EJ5A 4PY2A 5CT8A 4Y5VC 2ETXA 1NN0A 4JN2B 4L1LA 3NBAA 3UMYA 5JAQA 1S4IA 3KJFA 1O6VA 4BGDA 1RC0A 3GFOA 3U2IA 4YDNA 1NVXQ 2GN9A 2ZKWA 5JFOA 2PSJA 4FMCB 2EEFA 3SE3C 4W5HA 5AB9A 4DIUA 5K99A 4HNGA 1B23P 4Y2DA 4IBWA 2VYNA 3STVA 4GMDA 1T0PA 4L4JA 3GOHA 4JVWA 4BDVA 2HT4D 4I77L 4OA8A 2HG5B 2F9FA 1KTKE 4POZC 1DBBL 4OLZH 1NX9A 2PV0A 4ON9A 4HJ0D 4FCVA 1UTDA 1QLRB 1AGYA 1NIBA 4PJEF 4YAFA 3EGWA 1INLA 3OY7A 2RK3A 1Z34A 1DLFL 4D9KA 1EK5A 4RD1A 3FOMA 4TXVB 4S2UA 3ST7A 3GKWL 3RPEA 1PX3A 1J8HA 1E42A 4NFDA 5HVHC 4HR7A 10MHA 3N0TA 3P77A 3N7AA 1U8NA 5ADOL 1S0UA 3V6LA 2W80C 3M9WA 1V7ZA 4HKJA 3VAEA 3P7MA 5F7NC 1QFUH 4Q89A 3IAPA 1AKNA 3WGNA 3IOMA 5L4IA 1LB1B 3ULKA 1U41A 2Q3HA 2YS4A 3PC7A 4FNLH 4NPAA 1T2QH 3RWFB 2RHTA 4LSQL 5K9OB 4ZZKA 5J4VA 4NQDA 2ZCLH 3MLRH 3Q0HA 2QV7A 2FFAA 1UC8A 1H23A 4DLUA 1ZDMA 4YALA 3CIFA 2WQZA 2R4QA 4DNXA 4K6KA 3I6BA 3DZFA 4R26H 2ZBDA 4WDIB 4YEFA 1J87A 4RK0A 2JDID 4KPHL 3WELA 1PTKA 3HCCA 4E5MA 3DZKA 3T0DA 1KCVH 1DQLL 2Q62A 2D2VA 5CJ5A 1IE5A 1J1UA 1QLFB 3ECBA 4H7EA 3QM1A 5D7IA 1I3GH 1CD5A 2GFBA 4PJEB 4HX5A 2UZXB 4PS1A 4TWIA 3PAYA 3UT5A 1E7VA 4K7PY 2DTEA 2CWDA 4W4TA 1H6UA 4K4KA 4DRZA 2BVPA 4YSCA 5EKDA 3WYFA 3GTVA 3AUUA 3BLPX 2KM1A 2JCVA 1IG3A 3EH1A 5E4YA 4TS3A 3CO0S 1D2CA 3GZPA 3KQNA 1KJ9A 1QIKA 4UZGA 2JB5H 4ZU3A 4Q4CA 4X6DE 3KXFB 4INZA 1NAKL 4ZQTA 1W7AA 5FPQA 4ZZFA 1RP7A 4KGLA 4PQFA 2R751 3WGVB 2HN7A 1AS3A 3K2BA 3KPLB 3PXUA 3IR7A 3OJWA 2A73B 4H1UA 3K9NA 3IRCA 3USES 4H27A 3LW8A 2EL7A 3RIFK 3RVNA 4OCWH 5D7EA 4BVKA 4EMTA 1IJ9A 4H8WL 3HB9A 5E7QA 1XHEA 1WEJL 4I3RL 3G5TA 2OZ4A 4MV3A 4H8QA 4TQ9A 5E2VH 4Z7UA 5C2BL 4N8CL 2WVTA 5DXFA 4TOYL 3G7UA 5AD1A 1E60A 2OCFD 3OPUA 5CR9A 4BFGA 4MZXA 3FO0L 1E9OA 3WLKX 3NJGA 1DIBA 3TUIC 2XFXB 2YJTD 3A9UA 2PIAA 4X1IB 3GN2A 4W8GA 4RC9A 4U6XB 3QDJB 4DC0A 5EBMB 4EYGA 2W1NA 2DB8A 3TFKD 4CQMA 3R0NA 4FN0A 5IHBA 3RVTC 1JYWA 1H5QA 4K6MA 3KGTA 4R5XA 3JQAB 3ZGVA 4JEUA 1SQ5A 5EKXA 3QF7A 5CGYC 5MERB 2YXBA 3OR7A 1ISHA 5FOUA 2GY5A 3VNYA 3G2NA 2ZAGA 3U9WA 2GLTA 5D1HA 3A9CA 3FUWA 2JBWA 2FHSA 3GSNL 4NM4L 4HFNA 3ABLB 3LA8A 1ZIDA 3FB6A 3LXAA 3A6ZA 4RADA 1XA3A 2H4ZA 2HJRA 4X8XA 3TBFA 5D00A 4C9BA 2PPLA 1JNYA 2BL4A 3LE8A 2J6IA 3M9XA 4BO2A 3TW8A 1NCNA 4QDTA 1KOAA 4H7JA 2AV7A 1R6VA 3GHPA 1DKMA 3D5QA 4K71B 2A4CA 2Y69B 2Q20A 2FZLA 3W6UA 3A24A 3P3RA 2LE0A 1Z6JT 3ILSA 3ZBUA 1DJLA 1P1FA 4IQFA 1J1XH 3WFBL 3A1UA 3MTXA 4WCYL 5E6IC 4DTCA 1B3BA 1FYFA 3D8RA 1RQ7A 3IAUA 4Y67A 4YCSA 1OLSA 5LQKA 4ZT6A 2ZX6A 3ESUF 4GX2A 5JU6A 2QM8A 1LLUA 5HNKA 2XYHA 1KN4H 4NKRA 1NNLA 1MJ7L 1GTMA 2XT6A 4FQIL 1Y8QA 2G9VA 4GXVL 4KQ9A 3MREB 2VJQA 3A9VA 2R69H 4RLDA 3W11D 2QTVA 3U5TA 2O8CB 1K5WA 3OM9A 4UUQA 1TNNA 4HSCX 3IXAA 2PYFA 2QOEA 4UXIA 3ZHBA 1G17A 3C7CB 2BSSA 1ZT4A 3HC0A 1F90L 3H18A 3FBWA 4X9FA 1UH2A 1QFHA 4OZFH 1Z47A 1IKFL 1CTMA 1COBA 2ED6A 1URPA 3LZDA 1BOOA 4PYOA 4M1CD 5EIWA 1XGTB 3G5YB 2H1RA 4NI3A 3A2MA 4MWTA 3NEYA 4XOEA 3PHGA 3BSZH 3CSPA 5EOTA 3P9WB 4A7QA 2PT7A 2ZSVB 3FUVA 3QG1A 1ZXQA 1CD0A 2O7NA 5CSGA 4XAWL 3N0AA 5FM5O 1SMOA 1D6MA 3UZEA 4C4XA 1PT9A 5EU6E 1TZGL 1W6WA 3ARGB 1DDHA 4XP6H 2FSSA 3T12A 1KI7A 4OLFA 2VG8A 4JKPH 4QDUA 3TURA 1GL6A 1ZI6A 4YBRA 2JK5B 3AR4A 2XI9A 2O0JA 2F08A 3A27A 1GSKA 2GEEA 2WN2A 1EXWA 2JD1A 4GPIB 5F7EH 1MWAL 2WTPA 1GOTA 1WPXA 1UZAA 4M83A 4URHA 1N19A 4BK5A 4YGAB 3ZT5A 1VYVA 2HJLB 5T64A 3O47A 1ZITA 4WCFC 5GRUL 2NQ2C 4PMEA 5EJ7A 3C2SA 2ZIZA 1JIJA 5A6VA 1HTTA 5IM7B 4QG3A 1P4IL 2NQCA 3L17A 3ULVD 4PRIA 1P17A 3LT1A 1WUHS 4ELME 4X0NA 5T5NG 3CJRA 3D7MA 2ORBH 2IWFA 3HY4A 3G9UA 2YZ2A 1A3LH 5D71H 1I7RB 5CCXA 1T2QL 2HF9A 2V2WA 1YQWA 3WYCA 1ZS8A 3UXEA 3SC6A 1TQCB 1ZGBA 2YX1A 3ZHOA 1MHPL 4R2GC 1FRFS 1F17A 1MCZA 3MQ4A 1UG9A 3DSNB 1NATA 2EIEA 5ITWA 2CK3D 3OKDA 5CA1A 1P4RA 4TNFA 3K4QA 1B2WH 1C0IA 2GUWA 3U6BA 2Y1FA 4MX7A 1E3MA 4QLOA 2JIXD 5D7IE 1B0RA 2PNJA 1I7ZA 4I2XE 2HHHB 1NCJA 4ZTPH 3MLBA 2X9GA 4OZHA 1L9MA 2VQDA 4LKXB 4LCWA 1QRTA 3DTXA 1UKYA 2WU0A 5J1TC 1FQWA 5BMFH 3WNPA 3WLMA 5F23A 2DQCL 1Z37A 4YDJA 1CLCA 3SGDH 2Q49A 3DZBA 2ICWJ 2HVJB 1E6UA 2UVFA 1E7YA 1EHCA 4PV7A 4W6QA 1MNNA 4JSYA 4NQDB 1TAGA 5A2GA 3S5LA 4AGLA 3UG6A 3EZ9A 1ZXXA 2MR6A 3JWIA 3TO4C 2D13A 3O8XD 4L8YA 5IMKB 4JM2F 1BE8A 3CCFA 1PV2A 3NA4A 1D4AA 3QX8A 4N2HA 4DREA 3HHEA 3ATDA 3T71A 1NJGA 5AYUL 4K23L 2HKFH 3TXAA 5B1CA 1P72A 1JR4A 2WDPA 2F9MA 1XXHA 3QDMB 3SDAD 1VZGA 4D44A 2VZTA 4PJ8D 1IATA 1QNZH 1TQ6A 1LJ8A 3G5MA 3T2QA 1U3YA 4Y0VA 4L1TA 5TQ2H 4R90H 1VL1A 1Z9BA 3ZCXA 5BUAA 1BHJA 4RJJA 1VMIA 3RVQA 5IYZB 3V5DB 3C2AL 5GZOA 2HUPA 1DBMH 2LGJA 1XZAA 3S4SB 3JD1A 3P2BA 3Q7JA 2OHJA 4J0CA 5I6MA 4K3DH 1JDZA 4AXBA 2A92A 1IEXA 4Y5XA 1NC2B 1TLMA 3MO1A 1A8ZA 4L37B 4WI8A 3VWKC 5CZVL 4FDVA 3TT3L 3V7FA 4AM0B 4IOIB 4ISBA 1BXUA 1X9IA 2QZPA 4F56A 4P23A 2Z3ZA 2CMHA 5KVDE 3UN1A 5CG2A 4H3SA 3FLAA 2K78A 4MGZR 1V11B 4XP1H 4E36A 2V5TA 2EKSB 4UTOA 3UKOA 1H69A 3VPCA 4W5RA 1LP9E 4GEJA 2OL3A 3QEHB 3GRYA 1RY7B 2ZZUT 4H1HA 1DQQB 3RF7A 1KMHA 1X1EA 4FUTA 1AY0A 3VTMA 2XNJA 3GAFA 2JFUA 3V4FA 1XTUA 2CUTA 2D5LA 1X7ZB 5J06A 1X5ZA 4HEJA 1ATZA 1QLHA 5A3IC 2AWNA 2EYTA 4H15A 3VB8A 3VVBA 4S0HA 2YD6A 4C43A 1T0NA 1FG2A 4ANWA 5C0IA 1LQTA 2HH0L 5HMMA 1ZD6A 1U2ZA 4YO7A 5HA5A 3IEXA 2WR8A 1NEZG 3GFSA 3BKML 3WL9B 3IDNA 1R4MA 3T7DA 1N5IA 4CFSA 2JRLA 3SQWA 3S8GB 1P44A 3HCBA 2VJOA 1PJQA 2W07A 1X6VA 1P62B 1MFEL 4JPWL 3E4CA 1G9XA 4A0RA 2KBEA 4BJ6A 1I4FB 3DROA 4U6HA 4MS3A 2XPGA 4B85A 4HVAA 5C08B 1O57A 5FNVF 3NM5A 3QUMB 1TTUA 1KTDA 4PX9A 4G6KL 3QHZH 2EVHA 1M7IA 3O9MA 4AQAA 3OWEA 1MDBA 4PG4A 1DAHA 1JLMA 5IAKA 1PLGH 2R6R1 1QG3A 5F21A 3UMJA 1X9HA 4X7TA 1D5MB 3S3JA 2PX3A 3DB2A 4B0PA 5K8IA 2HT6A 3N8GA 4PJ8A 3AABA 4QECA 3UGXA 1HI6B 1T22A 1TJHL 1SHMA 1YZZA 2EICA 1E2PA 2NU8B 3BWUC 4OQTA 3MLZL 1CU1A 4KNQA 3CUPB 4OUDA 4OAQA 4AM8A 5CFOA 3HVKA 5FGCE 1JEDA 2XE8A 4TKLA 2VP6A 5JAUA 2FG5A 3DT6A 4OQEA 2FWAA 1Y18B 4NPHA 3HC0B 2ZPTX 4MNQD 3BMQB 4FG4A 5FA5A 2WKWA 4COKA 3LBIA 4GR5A 5K6AC 2EDRA 3D7KA 3LRMA 4IS6B 3ARFA 4XPIB 4EUHA 1XEAA 3OIYA 1DR9A 5K2MA 4MAAA 2OFPA 4CKQA 3CNBA 4B09A 4HZLB 1PJ3A 1E1DA 4HMOA 2D5CA 1Z75A 4H4DA 4NKOB 4BZQA 5KQRA 2EDTA 3VYSB 1YK1A 1F8YA 4IPTA 3BVUA 5FO8A 1C8PA 1XHHA 3SGEH 1UBFA 4N2MA 1OMOA 3BX7C 1C9SA 3PDCA 2QSVA 1QF6A 2APWA 5ALFA 1I94B 3ALWA 2PD6A 1O6CA 2Q0SA 1ZM9A 2EKLA 2XUFA 4FLSA 1S7CA 3EKCA 3OHPA 3ITDA 1EI9A 4D4KA 1OHHD 1TSHA 2PCYA 5F0MB 4IJ5A 4AQ8A 5GM2A 2PUBA 3ELYA 4MKGA 1GWNA 4MMXB 4ONHA 4RTSA 5J12B 1EDZA 4D97A 2OZLB 2GOYA 3IS3A 4FI3F 3EDFA 5IQ9A 4FVTA 4A03A 4GIOA 3IPXA 1A69A 1KVSA 3OXRA 4NQVA 1RQPA 4HRVA 4X94A 4DFDA 3KAJA 1ZHOA 1O5IA 4DB2A 1WBYA 3U7HB 2FY8A 5KHLB 3QNYB 1VKHA 4G67A 4HU8A 1QYDA 4YXWD 1E2HA 5L8KB 5A5EA 5E2AA 4EZLA 3CFJB 3AJ7A 4D9NA 4ODWB 2K6ZA 2W2LA 4GRAA 5F7JA 2Z2KA 4FMPA 3V52L 5B39A 5FXMA 1X92A 1D7AA 3ILDA 1NVUQ 4FDUA 1G20B 2RBKA 5EA2A 2HGSA 1I3RA 2UXFA 4PJ7B 3U0PA 2J43A 2F55A 3NG1A 2NXEA 2IV8A 4GW5B 1IAIL 1U7XA 4R4NC 4YFVA 2WPGA 5HI5D 2FTKE 3NWBA 1G7PA 1ISFA 1XUOA 3BUSA 2QLTA 3VFNB 5E2TH 2ZYIA 3GXFA 3RANA 3V2HA 2CRZA 3L3JA 3D3VD 2PDAA 2CD0A 2FCRA 4M5YL 1GA4A 2Y2VA 3WB2A 1GJWA 3AJ9A 4FL4C 2YWCA 3DZHA 1OD7A 2V74B 2EE6A 4ZT4A 2H85A 4WJZA 1HE3A 1XT6A 1MFDH 4ZALA 4I4LA 4BMNA 5BURA 4XMKL 4DDKA 5DD6A 3ZX5A 9CGTA 2QKSA 3DSFH 2P8JA 5KYWA 1C4OA 1AIFA 2UZ1B 1MWOA 3L8GA 3PVZA 3G6AA 1HE8A 3J27A 2DHRA 2JKTM 6YASA 1KNOA 2VLRD 2Y8EA 5EIAA 1WPRA 4I1PA 1MCIA 3HM9A 1AKVA 5TS3A 3GNMH 3GXTA 3G9AB 2WPDD 4TKUA 1G9TA 1ZZEA 2V7EA 5JZVA 5ED0A 4F8OA 2N46A 2CK0H 1XJ5A 1YEKL 3PENA 4JWTA 2KHAA 1F9EA 7FABH 1S2EA 2AJYH 4CMIB 4ZAYA 3GHYA 3S28A 4Y9CA 1RD6A 2HJSA 1HTYA 5KG9A 1Q20A 1A5BB 1YUNA 2KW5A 3H5IA 3KWFA 2CLKB 1RMFH 2JGRA 3X2SA 3GFFA 2PW1A 3QEMA 1M34E 3IO5A 3Q15C 1WQ3A 3ZCTA 5ALLA 1PV1A 3FZNA 1F1DA 4JDZA 3NBUA 4EGFA 1N3BA 4QAQA 1H3NA 2WO2B 4HISA 3PL6C 4U49A 4NATA 1JYFA 2OHIA 2NTJA 4N8UA 3UTTA 3IAS6 1FS6A 3HXOA 3H84A 3CHRA 5CUQA 4BQEA 5HYJE 3KOXA 5F6HJ 3E5NA 1MAMH 1ZHHA 1BWRA 2UYLA 2HAZA 2WF9A 4GC9A 4UU0A 3EDKA 2JLVA 1XF1A 1FUUA 3KZCA 3PGVA 4MNGE 5IVOA 5DGIA 3KCPB 5K2OA 3BT0A 5I8EB 3D0LB 3TRKA 3JYLA 4EHKA 2Z5LA 3AUWB 4QHTA 2VDOH 2H5LA 3FRUB 1UQUA 1PLBA 1P2CB 3WSWA 3ZLBA 3TAHA 3I05A 1S3RA 1E8NA 2FPGA 3NVDA 1IVLA 4HSAC 2P5WE 3VPXA 3F0TA 4QKXB 3D6GA 5I15L 2IIVA 3ONVA 3WNQA 2HSIA 4NMHA 2UAGA 4HHGA 4H25B 2VHTA 4JQYA 3O90A 3GSQA 1LNZA 2YN2A 1RJFA 4P3CH 3RVMA 4K3EL 3W2TA 5LYJB 4X80H 1ZAYA 3DK2A 1QG6A 1UM8A 2IGBA 3SNKA 3SBDA 1CXEA 2O5XL 5AI4A 4DYVA 2BEUA 4Z0HO 3KGUA 3QQNA 4AJJA 1KN2L 1YEIL 2ZSBA 3OKAA 5IKXA 4WVRA 2WE8A 4ZYXA 1M2VA 3FOZA 3V6BR 1ES9A 2ZXEB 2XECA 5DE3A 1KP2A 4ZQEA 4LCVA 5FYDA 4DVBB 4EUNA 1TQTA 2AR0A 1EERB 4KK4A 2ZAMA 1LX6A 1QPXA 5C5DA 4MYCA 1JSZA 4X4ZA 1FRGL 1H3UA 2IRWA 4X9YA 3ZIAD 3AQZA 3IBCA 4RIFA 3I53A 4NKDA 5IFJB 3T2OA 1VE6A 2I5PO 3CLVA 4TVBA 1Q2UA 1WJGA 1WQ4A 2C4TA 5FHRA 1E2EA 4GUDA 2V96A 2PWHA 1QQBA 3DMHA 3NFPA 3P9NA 4HJIA 4FGLA 3CEMA 4UV4L 1BE1A 5G4OA 4AJOA 5IHUH 1TCRA 1K97A 2BBWA 2YHBA 4FA7B 3ASZA 1YJ8A 4E2OA 1A9XB 3M17B 2ZKLA 4YS6A 5JNYB 2L17A 3SZOA 3EDYA 4PEEA 4HX9A 4R2HA 3UO1H 3PWLB 2VH5H 1F1JA 4ID3A 1F3JB 2GY7B 5DRWB 1HIML 2IOOA 5GZ1A 2VLRA 1PYOA 1FFNA 2FBJL 4G0PA 1K8DA 1XF4B 1EE9A 3RYHB 4PICA 4BBJA 2VWGA 1M42A 1DHRA 5EJIA 2OV8A 1GZQA 3R4RA 4KKLD 1Q9WB 4HTFA 3LY5A 4BFXA 3PDOA 2NUPB 1OJLA 3B43A 1TAQA 4FYSA 2GIMA 1MCSA 2V65A 3PGJA 2CBMA 3CX3A 1IN1A 2P6UA 1NDTA 1C1XB 4OCLC 4DGVL 4XNDA 4LYHA 1NJ8A 4WJ5A 4ZYTA 1AY1L 4G1MA 4QHUA 2E46A 4MRCA 3GQBA 3QKUA 1TF4A 1AI1H 4DEVA 5K8UA 1JW9B 4FQCH 3WK4A 4BB9A 3D3VA 4IDPA 3VXTB 5IUSA 3Q3EA 2Q99A 2IEAA 3I3EA 5E8DH 4GS5A 3D1JA 4XVTL 3LK6A 1KUMA 2ZBFA 1ULVA 4JJKA 5D84A 3NCYP 5D1XE 5CO1A 4YQXH 3W5VA 2WZAA 1D7BA 1Z5OA 3GNLA 4RX1A 3C4QA 4KQKA 1L9SA 3CMGA 1W36B 3BD9A 2HTEA 4GOJA 1P81A 3HV2A 1M7XA 3ORFA 3W6OA 4YZWA 3D81A 3FYIB 2UZPA 3N74A 4AOFA 1V6SA 3R0XA 3JVGC 2KL6A 1EFHA 3O0TA 1J0YA 4DNQA 3Q13A 4OHMA 1TEYA 3SE3A 1N25A 4BQCA 2VJYA 4MZDA 3PF2A 4Q9KA 2VAPA 1NIEA 1A02N 4OCNC 4D82A 4Y9RA 3C98A 3TX2A 1QP0A 4ZQIA 5GWXA 1NAIA 4MJ3A 3M6XA 1JE1A 3K0YA 1OV8A 3BFWA 1DJIA 1W19A 1D5MA 3JBG7 3QC6X 1U90A 1QIHA 4D45A 4TSRA 4N2FA 1SY7A 2DY2A 4GGOA 1WCWA 5CN2A 4PJEE 1MHCB 1KCWA 3VFRA 4PREA 2PIDA 4JGBA 5E1DA 2C3HA 3HHSA 4CSPA 4KGDA 4KZDH 4DLLA 4KQ3L 4QF1B 3WWDA 5FLEX 2XUZA 2FFQA 5HXMA 3NWPA 2AXQA 3QP9A 1HAWA 4AUKA 3O4OC 1J12A 1B2LA 4Y2UA 3EW3B 1WMAA 2DQIL 3CR3C 2ZBPA 5JDIC 2XKBA 3TJMA 2YUZA 4EF5A 1YE3A 1QSGA 5DS1A 1DQQA 2LU3A 3KQPA 5JNSA 4HDSA 3W39B 1OU0A 3KJGA 4KNVA 3Q6GL 5IABA 1EHKB 1K8XB 3AOGA 1ISIA 2VZSA 4CU5A 3IQZA 1NC2D 5HIKA 3QTBA 3I5YA 1MCCA 4QI3A 3X1WA 2I85A 1IJFA 1PY9A 1XZWA 3AG6A 3SE8L 4CMIA 5D4IA 1WQ1R 1YY9D 1LX7A 1QVWA 5C09E 3O6KL 3VWJD 4ITRC 2X86A 3R19A 1RULH 2PS9A 3LXMA 4HGNA 4Q7LA 5FBKA 1P9WA 4AN4A 2JI6A 4AUYA 4Z7VB 2UZYA 1XN4A 4L23A 3LS4L 5I7EA 4FYYA 4QLBA 4FFWC 3OZ9H 5BRQA 5L2KB 4PZ9A 5B6PA 5IUNC 3QHAA 3DZIA 4JZNB 1VL8A 4EHFA 4AQZA 2RR3A 1IN6A 1G4RA 2VP3A 5HFJA 5KNDD 5JDCA 5DZSA 5GV8A 4DADA 5AFAA 3K9CA 1MHPA 2C9AA 2FEWB 1AN0A 3PNWB 4JNCA 3FTYA 4QKQA 1JQKA 4LBWA 2GPNA 1EQ2A 35C8H 4QRPB 2BY2A 3QITA 4RLQA 3FF4A 3EFOA 4YRMA 3KPRB 3IMSA 1XKTA 2H1IA 2I78A 1NGXA 5CA1B 1XB3A 2FUG6 1W1UA 4ARBA 3MB8A 1T5XB 3E8XA 2V8LA 4RH4A 4V11A 2UVQA 5IVHA 3PVCA 2AFHB 3EH3B 5D1XD 3FDIA 4M29A 2QLNA 4HFJA 4C03A 4HWTA 2CYBA 2G8NA 2QAGA 4ND3A 3EXEA 3EYFB 5F1OB 2DXIA 1XV5A 2V4UA 4JZKA 4NQDE 5CIPH 5BQPA 4DSOA 3LDHA 1MB9A 2C1ZA 5F7OA 2QVIA 4NDMB 4Z49A 1G7JA 3ROEA 1GR1A 2K87A 3GFPA 4NXMB 3Q1SH 3KJZA 1RZFL 4X97A 1H2YA 3LYLA 1AHWB 3OJFA 1T3SA 3ZV5A 2G0AA 1MX5A 2JATA 1T7ZA 3T0IA 1EUQA 2C9BA 1ML4A 1PG2A 4BN5A 1U6AH 3SBPA 3HBNA 3QLJA 1NW8A 4G9DA 4U1MB 2X3AA 2P5ED 5FK9A 3OFND 4GKAA 4Q9LA 4NBXB 1BZ7A 3DL4A 4DP1X 1XL1A 4BQQA 4PB9L 2AAVA 2WUGA 3E38A 2FPMA 4W1PA 4QT0A 1OAZL 1F2UB 4F85A 3QJFB 4QDJA 3A70A 3P2IA 2BELA 1OTUC 3TV3L 4EA8A 4ZVOA 4YV7A 7MDHA 4B31A 2ZRMA 5JYLA 1ZESA 3DTDA 4EKYA 1D9KA 1O95D 4KX7A 2Q4EA 1BX2B 2P7TB 2YMLA 4RZQA 1IO4C 3MB5A 3EGXA 5E8EA 4GZMA 1JZEA 4ZZ3A 3S98A 1RAFA 3SICE 1OH6A 1B74A 1K8IA 3Q6MA 2LFGA 4KKNA 1TZCA 4AJ4A 3WTYA 1DJWA 3ZLUA 3KCQA 3OG4B 1FYTA 4DQOL 5T3ZE 1O7DE 3GS7A 3CKLA 5BVPH 1TM7E 4TLTA 2X4RB 4PJ9C 2DKUA 4PBVC 2XTJE 1KFGA 4MB5A 3OQ6A 2OMVB 4IMKA 2P35A 1VLMA 3TAUA 2QTMA 3GLGE 1AKQA 2XTJD 4CC1A 4NQQA 3ZHRA 3KLMX 3BH8B 3VR2D 1BKSB 3KJ6H 4NO5B 3S34L 3SDAA 3DX8B 2Z8WC 4Y5VA 5BY2A 3FO9A 2HJWA 4MITA 4AKQA 1JWMB 2R2BA 5DXWA 1UKBA 3K94A 2HTKC 4OLHA 5FGSA 1MZYA 4J16A 5K09A 3NTXA 3OE7A 5C5EA 4NO3A 2VZ9A 2HKHH 3BKYH 3SAJA 4IBLT 5J4KA 4FBLA 3LLMA 4LLDB 2JFBA 2WV3A 3KH4A 1ZHBB 4U1NB 4EN3C 1FNAA 3CHSA 4PFKA 3WRWA 4RD6A 2BH0A 2R0KL 2P90A 3MRLA 2DV6A 5IF0A 5DN6D 4MS3B 2XQKA 2NPLX 3HI5H 4K1XA 2ZDHA 4HN4B 3SGEI 5JIHA 1L7DA 1N57A 3O38A 3PR3A 4MQTB 4OHWA 4ZGWA 4K0RA 1F6DA 3H2HA 3M4ZA 3BW9A 4TUJB 4EGCB 1U2GC 4ZAKA 4WBNA 5TE4H 4IGBD 4LIPD 4RTQA 2QE6A 5HF9A 4XGZA 4M4PA 4H40A 1FFCA 1FL3A 1N0LB 3I9V1 4JAMB 2CUKA 4PPFA 5HVNA 2V2XA 4ERNA 5C8YA 3QQ5A 1LPPA 2ZWIA 4N7MA 1E66A 1QFUL 5TGBA 2DL2A 1HH4A 2Z9DA 2ZOUA 2ODBA 1FXSA 2WKQA 5TLSA 3GLFB 2DY0A 4FTWA 1AKEA 4TMWA 4NNPH 4MB1A 3NCTA 3PE6A 1EBFA 4QBHA 1D7FA 1YYLL 3PWNB 2R2EB 1X38A 3VOAA 1QNZL 1GAJA 2NY7H 3ORYA 1FA4A 1NSYA 5I23A 4NQXB 5AW4A 5CH8A 2B5OA 5DDHA 2C83A 2P2LA 1P29A 1ASOA 4G6KH 3G3EA 1G84A 5AL0A 1OQOA 5FLXA 3P9PA 1DJZA 1NC4D 4WFED 2J72A 2P5EE 4NHEA 2BFWA 2JNZA 1OBCA 3VR6H 1MY7A 4W68A 3HC4H 4F7MA 4B5LA 3N8KA 1H5BB 3AM3A 3WFHB 5LA6B 3PWJB 1F86A 3GROA 5IVNA 3FXAA 2F58L 4WV1C 5C0JA 2EO7A 2VXCA 2E7LC 2GD0A 2J32A 2DWSA 4GPEA 2ZW9A 3LZRA 4UEOA 3WO0A 4MOWA 1GNQA 5I7VA 2IPTL 1XIWD 4ZTPL 2RBGA 1OJ7A 3SO3B 4A10A 1V5WA 2GNAA 3C6MA 3E58A 3MLYH 2BDNL 4YXKL 1D3CA 2D1SA 2ZBUA 4EZEA 1U8JB 2X3FA 2Q7XA 4UQPA 2Y1OA 4IHQA 4CM4A 2DWCA 1Z06A 3NALA 4TYMA 2GF9A 4NIMA 1R5VB 4BIKA 4HOXA 2AITA 4RS3A 4GAEA 5EWIH 4R4BA 4XVOA 4WTQA 1TA9A 4HV4A 4XN2A 3TO2A 3N6RA 3PRYA 1M05A 1JZDC 2FYVA 1OE2A 3KYBA 4H44C 3L7EB 1Q0XL 5IT0A 1FRZA 4OXYA 3EC7A 1Q91A 2O6CA 3PQCA 5K6TA 2G9ZA 4P54A 4OFBA 2OB2A 1UBLS 1GR0A 2IAMB 4FXOA 3RSHA 4ROTA 4MV7A 5L4NA 1QAOA 2ZWPA 4ODIA 1BA3A 3ADPA 3UBHA 2ZUDA 3OB8A 3O7WA 5EJFA 2OYRA 4JFTA 4JAVC 2XB9A 2GC4C 4GINA 1XZBA 3X12B 4Z4EA 3E6HA 4AKSA 3UCEA 1MIEH 3HGTA 3AM8A 4BX8A 2BRQA 2CNWA 4LDRA 3EEIA 2CPCA 3S2YA 1CJSA 2CA3A 4GNKA 4H6XA 3L7NA 1TADA 4TTJA 1WP4A 4GO8A 4QT4A 9LDTA 1L6PA 2AQSA 2EARA 1N67A 2QN9A 1CF2O 1UT2A 4FMKA 1I6KA 4FQ7A 2BP3A 4M6ML 2ODIA 5AZUA 3E3MA 3DP9A 4BQFA 1UWCA 4CTJA 4JM4L 5K01A 3KR1A 3GH1A 1A9ZA 5D1QB 3UB2A 2VAAB 4HIIB 1CFQB 1KEML 4MBRA 3AR5A 2PUDA 1XRSB 3ISYA 3WKML 2NPOA 1LTKA 3WGQA 4M9PA 3IRZA 1RRPA 2R6GA 4F97A 3RK0A 2OQ2A 5FI0B 3GXOA 3MUGB 1EX7A 2XKAA 1Y0LA 1QUPA 2BM3A 4CL2A 4MYHA 5KYWB 3GJZA 5CUSL 2RHOA 5EBMA 3T6ZA 3OAUH 3K8ZA 1DAPA 4OFZA 2ASVA 5KUKA 4I4IA 1DEAA 2E82A 1BEYL 5IBQA 4F2PA 5T5FL 4CF7A 5HHME 1XZMA 3G2LA 1ANUA 5G3ZA 1WT5A 4U0QB 3US1A 2ZVDA 4PS4L 3K05A 4OZGF 1RLTA 2V98A 3UC0H 1WOYA 4KWIA 4XVUC 3X11A 2CBOA 2A4ZA 3FN0H 4QYTA 3ZK9A 2MHCA 5H94A 3BX1A 3BRSA 4F9PC 4XWAA 4HAGA 3IXMA 4OQDA 3ZTJH 4IUYA 4AVJA 4WBSA 5B4VA 3INUL 3KE0A 2AKYA 1OF1A 2BFEB 3LPMA 1R4NB 3I01A 2ZEJA 1XNJA 3WGIA 4RHFA 2HO4A 1WVZA 4I9NA 5FYQA 2XZAH 3RFFA 4MVJH 1Y6FA 1U8IB 1U4FA 4NHCL 1GRCA 2YARA 1UC6A 2XNHA 5LQCA 3R0JA 1QSEB 3THWB 1OGIA 3WGVA 4CMEC 1E94E 3TJEL 5JS1A 1KBVA 3MACL 2DWDA 2P30A 2G9HA 4AEIH 5DCLA 5KOVC 3EEFA 4DEXA 1AJEA 4RCYA 5HGBA 2QM0A 5KNLA 4F27A 3FXIC 1G18A 4FLRA 5EWMB 5DDIP 1FAIH 2DPLA 4FG6C 3AUSA 3ARUA 3QS2A 3U2QA 5CJQH 4OYYA 1PT5A 1MFAL 2XOKA 4IJQA 1DXQA 1M3JA 3HPLB 3FPLA 3WHXA 2HIGA 1TT5A 2C2OA 1U28A 1E1RA 5J5CA 5K4AA 3RAPR 5HI5C 1UPXA 5JAHA 2LKCA 4TX1A 1IXKA 2DT5A 2E1RA 2NZ2A 5KS9A 3EQ9A 2AE2A 3VGEA 2DLEA 2KB0A 3FRJA 3B9VA 5G4NA 3QQ3A 1A0QH 2XRYA 3WNMA 5T67A 1CDHA 1EZSA 1NHGA 2RD0A 3DMMB 3VYTB 1B0PA 4N18A 2LGNA 2JDIA 3RVBA 4NXKA 3MR9A 2IP1A 3HC3H 2CXRA 3NQKA 1HOCA 1V1RA 3I42A 4DBLE 3S3BB 4QZVA 1MC1A 3ZDQA 4EYSA 5DF1A 3L3KB 2QLBA 3B9KA 3DO7B 3B2UD 4C6RA 4JP1A 1ISGA 4NG4A 3GJFK 5JARA 1DVTA 3ZY6A 4BELD 5BZWB 1ZLDA 5ECGA 4JROA 3Q72A 1QC5A 1HFWA 1EXNA 3PXJA 2YC4C 2R4RL 3EYOA 2WGNB 1FNSL 2D3WA 3O3OB 4QJBA 5K6RA 4CT4B 4YMVA 4I3GA 5EIOA 2PUHA 3RTCA 4NNJA 4CBZA 2JFZA 2C20A 5HUQA 2GCIA 4M6WA 3ET9F 1UOOA 5CXSA 1Y5RA 4G7VL 1Y6JA 1T8UA 4YMTA 3IJYB 1IGYA 2VDWA 4FYTA 1CGTA 1S8FA 1XDSA 3D6VA 3U7QA 4ENUA 3HRPA 3FO2A 1VBFA 2ZFUA 1QFYA 3RFTA 4NJEB 1UBRS 4U7FA 3HUJF 3DKVA 1D5IH 2GA9A 4XP9H 2Q1EA 4NWIA 3NT2A 4C3VA 1WV7T 4HJRA 1M6UA 5EGNA 5ALCH 2IOHA 1G21B 3I0ZA 4DV1B 1NGQH 1T1WA 3PGDA 5IVXA 3FU7A 4P92A 1NGYA 4TVPL 4JBHA 3ZBQA 3ZG6A 1S2OA 4JP2A 1DQKA 3PL6D 1LK2B 3SZLA 3ES6A 1HSZA 1E4HA 2AI0H 3FB4A 1T9KA 3ILXA 2JIZD 1KDVA 3Q5DA 2OZPA 4YYEA 4QXPA 2YWEA 1ZNXA 1I14A 3CC8A 1Z7GA 3K71B 4W4OA 3GS4A 2XGJA 3L40A 4R9VA 3IMRA 2R8EA 4ODHL 1K5GA 3NBNA 4J90A 1WA0X 1OROA 1OKKA 2IOYA 1E5AA 4BAZA 4UPVA 4B6JA 3L8YA 2F7SA 3U6KA 1VEMA 3R3XA 3VR6D 2Q21A 3GEDA 2O0KA 3B2VH 1ZANH 3HTLX 2O2XA 3OKPA 4YI5A 2JQZA 5J8OA 3IEUA 3FCTB 1V3UA 2OHGA 4ETQA 3K2IA 1VB5A 2R68A 2OP1A 4RH1A 4Y6GB 1E5UI 5JHAA 2AEJA 4CFZA 2X88A 4MDIA 3INYA 3PSHA 3RT9A 3VG0H 1VPWA 3OPYA 4J1UA 1RQRA 3D2BA 5CJJA 3EDOA 4FX2A 3SKNA 1YJAA 2BM0A 2VERN 1OXBB 4HAKA 1U8XX 3TEUA 5C0FB 2FJ0A 4CLRB 4YHHB 1F11B 2XNDD 1ITZA 3DPDA 3EFFB 1EX0A 3P27A 4WTZG 1XMIA 2RAFA 1KDOA 1TC1A 3PQYB 4BKPA 1TO4A 1S7UB 2BFCA 4PBWD 2NQDA 1JZSA 1KZ4A 4CKBB 1C08B 4DNOA 3R6TA 3OZCA 5AKZA 5GGXA 3PUWA 3IDJB 4M61A 2L7EA 2FO4B 4BB0A 3FNQA 3MCYA 2MYPA 3FJYA 3NAQA 1P6UA 1IBKB 4EB6B 4PVLA 4HLCA 2FK7A 3VD9A 2FQWA 3BPLC 1LK3H 3UWSA 3RHWK 3I3OA 1HXYB 4L1HA 3GZNB 3NZSA 3OESA 4JYCA 3CK0H 3RBAA 2GLUA 2ZCJA 4WO4C 2W2KB 3T3IA 4QM6A 5FYLH 4AT6B 3IVRA 5M34A 1HCFX 2W60B 4ES9A 1B6DA 1NYRA 1DVYA 2QTGA 3N3BC 3MRVA 4RA6A 5LUBA 2NLJA 3VWJC 4L8SA 1OPRA 3F04A 5DRNA 1KCSH 2ED9A 1U8KB 1PNTA 1KZYC 3CBQA 2YRLA 2LPMA 5EA0L 3RL1A 4D9LL 4OJFL 3D3KA 1IC5L 4O5LH 3GVIA 2D54A 2B82A 4NYJQ 3ZK8A 4OHVA 4QT5A 3B70A 1T2AA 4NHCH 5FAXA 3FPJA 1U9IC 2R8ZA 3HYRA 2XXFA 3FMOB 2PFKA 2MSNA 3D4GA 2WM8A 4N1EA 2OBBA 3BKJH 2Z1PA 1CVLA 3F7QA 3AEYA 4JPKH 3BHJA 3WXBA 2QTBA 3K2UL 3FAWA 1BJ1J 2PSHA 2PLFA 5FYLL 4WDQA 1W85A 3OX4A 3V10A 4G97A 3L9WA 2AHOA 4QPDA 1AMOA 2B14A 3UFIA 3A04A 4YCBA 2EX4A 2WINB 3BHIA 2DIAA 5I5RA 3QH3B 4P38A 1TYEB 1SOMA 3MACH 1EM8A 2WQWA 4JFDB 3ZZNA 3BPOB 3P4UA 1VL0A 4OQ1A 3P2OA 4YR6B 4KTTE 5HGAB 3BZ4B 4HADA 5A3JA 1S46A 5BNZA 5FA3B 1HDMB 1H6TA 4NZRL 2CSUA 1N0UA 3TX4A 3RFVA 4G1CA 3QVSA 3QUKB 1T22B 2WYUA 1IKFH 2WRZA 4J4PC 4HCFA 4X8JB 3LL7A 3GW8A 2EIXA 4JN1L 3EZ7A 4AW9A 2HTLD 3V52H 3M82A 4J28A 4RX4A 1RFDH 2BM8A 3DOSA 2IK8A 4HWGA 4MRVA 4M0MA 4C07A 4AQ7A 5F7EL 1DEOA 3HBFA 5F3WB 1PT8A 5FC9A 1YG9A 2I9KA 2BGRA 4BH8B 3BEDA 2VKWA 1SAYA 3H2QA 2FNWA 4BCCA 2KI6A 3GFGA 3K46A 4PR5B 1CW2B 4FOTA 1N70A 1BVNP 5HM6A 1ADWA 1HOCB 5BQDA 2I1LA 4MVWA 3MNVB 4D81A 4BSVB 2G17A 5HBGA 5BSVA 4GRLB 1UCTA 1JI0A 5SX5K 3TTSA 2ZUWA 4E70A 4EEXA 3NRPA 1EJ2A 2UX6A 3EVGA 2KT6A 3MV7E 3HHPA 3W8NA 3RWFA 4CG1A 4BNKA 1EX9A 3MRCA 3MC1A 4HBCL 3P71T 4FW9A 4U8HA 3BWDD 1EINA 3R75A 3PWJA 2ZROA 2YRPA 3LNEA 3N1QC 3Q48A 4K71C 3NHLA 5H4GA 2LRHA 2E4AA 2W94A 2CVOA 5EFIB 5HKKD 2X19A 3F9RA 1DG3A 1I7RA 2CCVA 1MCOH 1TDJA 3S96B 1BQHA 4LLAA 5KSYA 3RKSA 4TTPA 3E18A 4KDTC 4U6HB 2VAAA 4HIIA 4ESKA 4CBPA 1NAHA 1ECJA 1R0WA 1CU4L 3EZFA 1XDTT 1V8ZA 3WWOA 4HO1X 3M6FA 4KH0A 4MUYA 4Y6QA 4KK8D 3VCLA 3BAYA 4FQLH 4J0HA 5J59A 3HG1B 1XVUA 1QHHA 3LH2H 5FR2A 2EDJA 3C5SB 1H3FA 4I18B 4ZQKB 4JHAL 2CXTA 2YOGA 4LOKA 3RWIB 3TIEB 1I7SB 1CETA 3OC6A 5ALVA 1RXLA 1DUVG 4BMXA 4YH1A 4XNZC 4MW2A 1JVOA 1YMME 2GNOA 4RWZA 3ABOB 3T0EC 4L5YA 3VI3F 3LIZH 4FTVE 3CDZA 3C6ZA 4IRXA 2XBDA 3V3KA 2QUJA 4ZMPA 2NYUA 5TE4L 2QVGA 4X99B 5LVAA 2OCGA 3KLAB 3MRRA 4I0CC 1Y7PA 3ET5A 2W65B 4LNVA 4ZAXA 1RZRD 5DCUA 1UBTS 1VJRA 2HCFA 3OEYA 2PWAA 1C9DB 2FDBP 1JF1B 5IMKA 2ZJ5A 3L82B 2PWYA 3BSYA 4RNDB 4YXLH 1GARA 2OCLA 1II8A 1ETZA 3F98A 2Q3DA 4ILKA 3VXUD 3LBAA 4JFQA 1N18A 4QRDA 5BSUA 3VXSD 2Q6WB 1F2TA 4ZPVA 4J16C 4YAQB 1G38A 1E61A 3PGKA 1JZ7A 3LIZL 1LO3H 3N3EA 4TRPH 3PHQA 4KTEH 3MOBH 4H0CA 4AJPA 7ADHA 2B39A 5BVPL 1JJVA 4MCJA 5JR3A 1T9DA 1OGAA 1PZFA 2NUTA 5ESXA 2NPFA 4G86A 4HAVA 1JGTA 2X8LA 3IGAA 4J49A 4Y2VA 1PG7H 5EOQL 3D1VA 4V0KA 4O4YH 1M6YA 3VPFA 3MQIA 3IKCB 3ARXA 5FYJE 4MI3A 4FD3A 1T20A 1BEUB 3IUYA 3SX2A 5KJFA 2F43B 3LVFO 1RSZA 2G04A 3V8VA 3CVIL 1WU7A 4QPEA 1X8KA 1DINA 1VLXA 3AG2B 4A0FA 1N59A 4P5MA 3AKDA 5D86A 5A2QA 2W4QA 1D5CA 5DTMA 2P5WB 4WO4B 4KPUB 1A82A 3I6GA 4GLLA 1BEEA 1DC7A 1M7UA 3QUGA 1ZLSL 4ZDHB 1JH9A 3D0AA 4CU6A 3F7MA 4P3YA 2KE5A 4BHUI 2R65A 2VYVA 4A67A 4G0UA 4P34A 5F1SA 4WV3A 2QGDA 4I0PB 4KAQL 3A28A 3W9UA 3K1KC 4NN6C 2WKSA 1HCZA 2Q3CA 2EKQA 4CL0A 5IHUL 4HIHA 1I33A 1TMKA 4X80L 4PLKC 2OW6A 5JD5A 1BQEA 1UKEA 1DO5A 5EXPA 5AW0A 5AQ1A 1RT9A 2QMOA 1P9MA 3JATA 1Y89A 3MJ9L 4G4GA 5DLPA 2PKQO 4BKLB 3W3ZB 1OT5A 1R17A 2WC7A 1H0SA 4KN6A 4HZUA 5IG2A 2QMYA 1H93A 1CZHA 3GRWL 1YYML 3ZKND 2Y0PA 1GGCL 3QDJD 5C0NC 1ONPA 3A6LA 1G9MH 2AZUA 1VHTA 3UNXA 3WE1A 4JLOA 5HYSA 1EEQA 4OBWA 2XRMA 3JWDL 3RIMA 1WJ3A 3HG3A 5ADPH 3ND7A 1NNUA 3GIZL 4RIRB 1U0BB 3GOQA 2V5VA 3FR8A 5ALCL 3FTEA 3TPKA 1NGWB 3SU8A 3EPPA 4Z1PA 4PP2A 1JSXA 3IUEA 3DBHA 3LOUA 2IPUG 4HK0A 3OR6A 3CURA 4LF4B 2OMTB 4B3RB 3ETCA 4B9GA 2QRVA 2P9RA 3TR5A 1T6ZA 3C6BA 3AXHA 2VQ3A 1HK6A 4RTOA 3I2CH 2WP3T 1XO1A 5SZIA 5I45A 1M71B 1M10A 4O5AA 5F2KA 1PU2A 2CBXA 3U9UB 4CVXA 3ZLJA 3MVEA 3QIWB 2ZB8A 5AJVB 2E37A 4M03A 5KOYA 4CAGA 2ZJSH 3TSOA 1B1AA 4PNPA 2WXMA 4IJ3B 3JWNH 1QLEL 2BBOA 3CS3A 2A57A 2ZR7A 4ZEVA 3EYSL 3CF4G 4KRLB 4HN9A 4IRMA 4Y0NA 5GISL 1IC7L 5J89A 4F1WA 5L7WA 5DC9B 5KSWB 2ZYAA 1ZSNA 4G01B 4OJFH 1T2UA 1VACB 3UJ3X 3CSBA 1OGTB 2R83A 3B13B 1NSTA 3CXRA 2E27L 2ICAA 5ITZB 4A7TA 1WO8A 1E3EA 5JIMA 3QW9A 1P7QA 1VFUA 4LNUB 4DIKA 2ODHA 5AAMC 4MCNA 5KC8A 2JZNA 3SQOH 2OO3A 1EVUA 3NBFA 1TJNA 5E2UH 3PCTA 3ZWBA 2QLVB 3MSPA 4IMKC 4RH0A 2XF2A 3DL0A 4ZRDA 4BNYA 3MNVA 4OJKA 3WA7A 1Q9WA 4PJXE 2VAJA 2JKLA 2BNQE 4MI1A 4RTMA 5TH2B 1QIEA 1AZCA 2OX5A 4LCWB 4XAWH 2DH6A 4G8GE 1ZQ1A 2OQRA 4DVRL 3DUUA 3SPVA 1SIBE 2GS9A 4GEIA 4TMZA 2ZREA 2ALJA 2N0KA 4B9JA 4B7ZA 1FG2B 2PKQP 4IFIA 3FBKA 2EDNA 1GN9A 3ICEA 2YEQA 3QJRB 3T4YB 2Z2JA 3V7WA 4RNCA 4L1DA 4Q6IB 1MNUL 1PFVA 5IHLB 4R3WA 1J97A 4LPWA 1M8PA 1KPUA 2IALA 2YPKA 2C5EA 1SCBA 4J8RA 4YT2A 2L19A 1KEGL 1IM3B 3CPHA 1ZK4A 3P1JA 1UMKA 4HZAA 3Q4GA 5D2CA 5F7XA 1PJTA 5ILOA 1G5QA 1ESMA 5JYDA 2XB4A 5MN4A 3RZCD 4HLUC 5CBEA 3VFVA 4EE2A 2BGWA 4XX1E 4TTQA 2KYRA 3IUPA 1BZOA 2FUEA 3KPOA 4D2NA 4OK6A 4I66A 2UUOA 2EDOA 1U8IA 3NIGE 1JIVA 1QR6A 3P0VL 1W52X 3OWHA 1PWHA 3OQ1A 4L02A 4Q9JA 4N68A 1HCYA 3V4VA 4JE0A 4RORA 3EGCA 4APQA 3RAGA 3WTSA 2P9BA 2P3LA 1KB3A 4QRIA 5HGBB 5FGBC 2N4IA 3ZDWA 4I55A 2MYUA 3DETD 3UAJD 4X4MA 3LUBA 3L5XH 2XITA 1DEHA 3CXDL 4MW6A 3OLYA 5JJIA 4OSUL 3DKPA 3RI3A 1SXQA 4RHXA 4CU2A 4OI7A 4NBKA 2RHEA 3LTVA 2BMWA 2IHKA 5CLQA 3MPCA 1HE8B 3DDWA 1TTFA 2E9BA 5F9MA 2Q6VA 4IH9A 5I48A 1UOPA 3QR2A 1TPYA 3RVRA 2LDBA 1SVNA 4HMQA 1FS5A 3RSSA 2Z2XA 1SCAA 3CVHA 1RYNA 5HVHB 1DQNA 3L0IB 2KQNA 3S37X 2NNCA 4OD2B 3LQ1A 1F7VA 1DL5A 4HJJL 3M7FB 3C24A 1OAYH 5FBZA 5H4YA 2XMSA 4B9KC 5EXDA 3SBOA 2V6GA 2XG5A 1RKQA 4LHUD 3W39A 4DV3B 2CC2A 4FQ5A 2OOKA 1ZPUA 4A15A 3DV0A 1DTUA 4CTKA 3AT9A 3JUZA 1A66A 2MCPL 5THQA 5IAEA 4A8PA 4ODHH 4NN7C 3RUGF 2JEZA 1SC1A 5KBPA 4I50A 4WY5A 1PLAA 2P2ZA 1E2ZA 1QMGA 1YE8A 3CFKB 1Z6AA 1MJHA 2JFNA 4X65B 2FE4A 4LYAA 1A4XA 4ZI7B 2FWMX 3VZBA 4XE0A 1TYDE 3AR8A 1B4JL 5K45A 3H3PL 5ER9A 2WVJA 2L2QA 3HVIA 1BWWA 3CE1A 4PVMA 1BLIA 4IWXA 4MJ6B 1F5NA 1V3KA 3TWCL 1UT5A 5I0ZA 1P4UA 2WHEA 5SX5H 5IDXA 3RWHB 2PFGA 3GGWA 4XYBA 3SE6A 3TLZA 3DMNA 4I5DA 2C3VB 1EM6A 4KRYA 4G6FB 1NRJB 4MJLA 5BT9A 5FFLA 5TJWK 3CSYB 2VF4X 3P5BA 3O6FB 4YBZA 3TGWA 5EH1A 5GZNC 3EEOA 4UILL 1ADQL 2PX5A 1TTAA 3RC7A 3IEAA 5T33H 5LWQA 2IAMC 5KDLA 3BZWA 1EVLA 1KLFB 1FYVA 2D0DA 2Q8AH 1FNHA 1M9SA 3EMDA 2WJWA 4G1VA 4YRLA 3TK1A 4LXXA 1WDAA 4J3BA 2INGX 3QXSA 3UTZA 1YZKA 1HEIA 2G8LA 3SEPA 1OAAA 4NRZB 1X2BA 4EF6A 1INEL 3VR5H 4DLZA 2M6LA 2FQYA 3PIIA 4QUGA 2D5AA 2QRQA 1MCDA 1AO0A 4X6EB 2VYND 2LR4A 5HHTA 4V24A 3QQXA 3RARA 2ORED 2GJSA 1GS8A 3DDOA 3OJDB 2LDXA 4A7PA 5ARCA 4GPTA 5CXUA 5JHGB 5FEBA 4AF7A 3UQZA 4KRGA 2PT9A 1MW2A 4FFZH 3IQFA 2VJAA 2IWEA 2LTAA 1AOHA 3OKKB 5HHOA 5JHDB 1GZHC 1CXZA 5KWVA 4LYEA 2CDBA 1I3KA 2GN6A 1NN1A 2FI1A 4PLNC 4AQOA 4P5RA 4IV5A 2GXSA 4CI9A 2Z98A 3RS9A 4RK4A 1AO7B 5GS0C 1NXSA 1I1NA 3WJJA 1N92A 1TKRA 3KEGA 1BXKA 3O3DB 1WTGT 2XKJE 3WXMA 5IW3A 4GP7A 3TPUB 2VXTL 2FN4A 3BVNA 3AG3B 2OSLB 4B2YA 1Z7EA 4IWYA 3MUUA 3JALB 1LJMA 2L4OA 3FB5B 2QN2A 4HUMB 1HILB 1KLGB 1CT8A 5LO7A 3V4UH 2G60H 5TE6H 3Q8FA 4KMOA 3SHQA 3AINA 2EERA 1JHPA 4BEWA 4BX2A 3KYNB 1INDH 4MR8B 4R0LC 3LKOB 4WW2B 3U56A 1KOLA 4KUCD 1D1SA 4G63A 3C0KA 3LWBA 1OTYA 2HBQA 3D5OF 1QCYA 3TNDA 1FJ1A 2MSKA 4Z0BH 1FH5H 3MV9E 1TKWA 2GARA 4OU3A 3A3NA 2WLIB 4GBMA 4JCWA 2B16A 4RPGA 2ZRAA 4YP0A 2CJPA 4P46D 4NN6B 1Z63A 4M7ZB 2MOKA 1OAZH 4FYIA 1I3NA 3AC0A 4XX5A 3CWGA 1NI3A 1R16A 3PGXA 4G0YA 3S2UA 1N5DA 3Q44A 5HHNA 3CUUA 4MA4A 5DXJA 2WSSA 3ARYA 4JQSA 4BINA 5K93A 2CHQA 5FEMA 1ZM7A 1RIVH 3BZEA 1HH6B 3O8XB 3S35L 4QYWA 3UENA 3GK3A 3ELDA 4ER6A 1F5WA 5JSQA 3ICOA 4P4KA 3MV9A 4X20A 2MMCA 3UP6A 5EERA 1SH7A 3DVGA 2XWBB 4AUEA 1ORQB 3TTWA 3M6WA 5IXSA 1BH6A 4EA9A 4R1QA 2VXUH 3D39B 4XO8A 5KSZA 4WUUD 2YZ7A 4XXWC 4LRXA 4P5DA 4A2WA 1W6LA 3MCZA 1UZUA 4XDHA 2PETA 4ND4A 2I4LA 4KJYB 3WLAA 2OD2A 2PZFA 4L2YA 3AR6A 2AB0A 1BZDA 1ID1A 2WQRA 3T4YA 4AD8A 1E3WA 3BAEL 1N0LA 1T2VA 3TOZA 2GVZC 4KO4S 2WJ7A 2LOEA 4JRYD 2FHPA 3OKNA 4HKBB 2IBGA 5DRZA 4JM2D 3WIIL 1EAOA 2J07A 5EFOA 2P91A 2GCGA 4POOA 3EYUL 1BOYA 1DBAH 4PJGA 1VKXA 4AJIA 1O5DT 3K0CC 2OD9A 1A47A 4EG8A 2O1WA 1TKAA 2QVYX 3EGXB 3KWMA 3OZDA 4DPLA 1N36B 2N9UA 2TSAA 4YUEH 4S10A 4KH9A 2JIPA 4I9WD 3VFVB 1NAMA 1BSIA 4DQLA 5DUBA 5SX4H 4HV8A 5B7FA 1B00A 1WS6A 1K63A 1G9ML 2Q76B 1N1DA 1T3HA 4E6EA 5K05A 4L4TB 1JPSL 2QVZX 4OG2A 2PS0A 3WDIA 3VVMA 5JW4R 4QXOA 4H26B 2FUNB 3C4JA 4N6RA 4I5IA 3IJRA 3M3DA 4ZW7A 3QI2A 2IU6A 5KSBB 2OV2A 3IQHX 1UURA 1AZTA 5C70A 1HOTA 5J1SC 4YHZL 1DFGA 2YQZA 2GSGB 2VT6A 3FR7A 3W34A 3DX2A 4TLUA 2XX0A 1IZYA 4YP6A 5AM5A 2R1YA 1S3KL 1MFDL 2ENWA 3DGFC 3G49A 2V7QA 4N39A 2QPLA 2I8CA 4GOSA 1QE3A 5AJWA 1PAMA 3JV4A 4AWAA 2CLVB 4J2OA 3JYPA 4I0PD 3O3AA 3QJHB 4WFIA 2HSJA 4DMLA 3KV3O 2JHFA 2ITDB 3CX5J 4U1LB 4ZPTA 4KYVA 4X7PA 4X45A 1MFBH 3UZEC 1SUSA 3PPSA 3R6GA 4PJ7E 4H1LB 1LLCA 1MT0A 2F8MA 2UYHA 1KK3A 2J8ZA 4IEIA 2GT9B 4GHWA 4A8JA 5FKJA 2WT8A 3EMKA 4OSOA 5CURA 3VXOB 4KJQD 2PZ8A 3JQOB 2QG6A 3M6UA 2JCCA 4N5DA 2G2PA 2AK3A 4RV5A 3QULA 3UAJA 1TNDA 2VDQH 1HEJC 3GF4A 3F6PA 3DX9A 4TM8A 5DK6A 5ESWA 1L0QA 3UH8A 5INDB 3IKLA 5DLYA 3WTXA 4G5AA 4FEAA 1TU3A 3W8EA 1YLBB 3BT2L 1E0SA 2JCBA 4ND7A 5I1EH 4QOKD 2OFQA 1XYGA 5HIAA 4ME6A 4IGBB 3T9DA 4LBEA 4P2GA 2OL4A 3NN8A 2BD0A 1LO4L 3VE0A 2XWJI 3DRTB 1AZBA 1BXGA 3ZE2E 3KW8A 2UX7A 5FHBL 2SECE 1XDWA 3DEHA 5HHQB 2YNMA 4A6DA 1X86B 3IT3A 3SJBA 2HW8A 5C0OE 2AG0A 5B12A 1RIFA 3ZJAA 2K7QA 1M71A 3HA7A 5DWVA 2P42B 4JO3L 5CPFA 4Y88A 4M48H 1Y1UA 1BROA 4N9OB 4G6ML 2ADOA 5L7XL 4WGWB 3CX4A 3HI6L 4BTEA 2HHAA 4LE8A 4J3JA 4D9IA 1BVYF 1PDKA 1PGQA 1MP0A 4R2KA 1CUWA 3THXB 4JI8B 4NAQA 5T3ZH 4OKDA 5I15H 1PGNA 1HT2E 3LKSB 4X5RA 4AGQA 5IGXL 5IJBC 3EIFA 4EVSA 1SY6L 5C0CD 5A16A 4YHKL 5KANG 3OEWA 3WKYA 4LKXA 4BZYA 3GSRB 3BMXA 2JW5A 2MCPH 4MXVE 3DAHA 4ARVA 2ZWMA 5EXTA 3TRIA 1MVLA 1RHUA 4U3SB 5CCKL 1MT3A 5AKHA 1CDBA 4ZJ9A 1Z4QA 3EA4A 4W5NA 1BE6A 1GYRA 1MLBB 2ORVA 4LDAA 1MIOA 3AROA 1ZIBA 2XYVA 3H1PA 1BOGA 1N9GB 4IYKA 1W88B 5L7XH 5AKJA 4DKJA 4QUHA 1CUEA 2HFGL 3WY9A 2OX5B 2IYFA 3I9GH 5TDPA 5I7AA 5ALXA 2OVBA 4UZEA 3E8MA 4BO1A 3TBKA 2WXQA 3IAGC 1NKTA 4PJBB 5DCWA 3E9CA 3OJXA 5CD1A 3U4DA 5A3QA 3LQZA 3QF4B 3SYCA 2YA1A 4AMGA 5ALIA 2I4NA 3MYZA 1JPNA 4DCVA 1X8XA 4W1TA 3NU1A 3QX3A 3PQFA 4HUUA 3T0ED 2PWPA 4U1IB 1AQDA 2XACC 2GAOA 4MROA 5K6AA 4BWUA 1YS4A 3V8CA 3S8MA 1I7UB 2YUIA 1XWIA 3PTLA 1JHMA 3ARFC 2Z6QA 5M7EA 1MHHB 1EJ6A 1S7GA 2AI1A 3OMWA 3II3A 2A1TR 5ECWA 1XVVA 1PX4A 2VRWA 4G36A 3K0KA 5D71L 1PUIA 2NXYB 1R0SA 2XWJB 4K3GA 4OJMX 3CUVA 4G24A 3I5UA 3ARGC 4BKLA 2Q3MA 2BNQA 2A77L 3HLYA 3AREC 5BYBA 2UY7A 3U0VA 2C9UA 3JD0A 2RCYA 5DP1A 5L2JB 4EPSA 1M6OB 5GIPE 1FFQA 3GRAA 3QVUA 4LAFA 1DN0B 4YZFF 1ST2A 3CDCA 1KYQA 2DLCX 3SY8A 2J46A 4Q4LA 1BFSA 4PHXA 1PGOA 3DKKA 4OXRA 4W70A 121PA 4JQIH 5LGHH 1SMKA 5IMOA 4D7PA 1KMHB 1LDPL 1PG5A 1EZZA 4XO9A 4JNXA 1T9CA 1M6EX 1CB0A 5IB5B 4KI5E 1X1SA 1R6TA 2VLKD 1Z3IX 3NSCA 5CXXA 5AVUA 3F46A 2BONA 5TC4A 5F3BA 4UQDA 3QQ4A 4RBNA 2OP4L 3GX1A 4XX1A 2ZYUX 3RWCB 1KGYE 1Z3CA 5F1IA 3FLMA 2WWKO 1DCMA 3WL5A 2EXYC 2CDEB 2XGOA 5GONB 4WN9A 2CQVA 4EAQA 1R5WB 1WB6A 1DDHB 2D3JA 3IIKA 3G9XA 3SDZA 1PG7L 3DMMC 1IGFL 3F00A 4YQFA 5FHAH 4EQ6A 4V2CB 3K0EA 5B1IA 3VI3B 4XNBA 5DGQA 1OXXK 2ZWOA 2WB2A 3I04M 1EV2E 3FRPB 2O5EA 4G9GA 3H6HA 3JASB 5AVWB 4PP1D 1TVBB 3F7TA 3TB4A 1S9VB 4OJQA 4UE2A 4HUWB 5HDQH 2IYPA 2ERJC 3PUYA 3IETB 5HYSG 3LQ4A 4WTZA 3KQUA 3GSWA 4HWKA 3R5FA 4OP1A 3K5WA 4MB6A 4ZS7L 3ABGA 1Y3FE 4JKWA 1XQ9A 3EAGA 3CLHA 3QHTC 1XFAA 3JQGB 3KYIB 4Z9FA 1KQ3A 3RREA 5ED4A 3IX7A 4UPDA 2VE6A 1CQKA 5EU6B 5KTNA 3L7JA 1XQ1A 2Y72A 4G2TA 5I76B 5IM7A 2ICEA 5EXSA 5C0ND 1XF3A 1VG1A 2QVFB 4A73A 4KXVA 5AVRA 2SCUA 1AHNA 1XF5B 2Y99A 3JPYA 1S2IA 3ZVRA 2DM3A 3S37H 3LZLA 1XF2A 4LMQE 3VO9A 1NMBL 3TYFB 2A84A 1VI2A 2H0PA 3GSOB 3O26A 4JM0A 3IAXA 3CHQA 1NUPA 3CF4A 5AUMB 4V1CA 1F8GA 3UKDA 2VHQA 3AONB 4H2DA 3UQYS 3O2QB 2FCBA 5JLZB 1J56A 4LOVA 3TBVB 1VJDA 4IK7A 1CIDA 3G0HA 1P73A 5FR3A 2A88A 2PLAA 1ZG3A 4F7CB 5DIZA 5FA6A 3TH5A 4TWZA 1Q1PA 3AW8A 2PK3A 4N9WA 4OZFA 3EHBC 3EHDA 4JUCA 4OGYH 5E95A 2GBFA 2JGDB 4J3XA 3CLEL 4I2VA 3VXQA 5J1SB 3QZNA 1O6FA 2LNDA 1DX9A 1AQUA 3B7YA 2CHGA 5LAXB 5ILTL 3DM5A 4IQ0A 1H2XA 2VPQA 4H5SB 2E85A 1FPTH 3U4AA 4DCSA 4D3YA 3D5EA 4X7DC 5I51A 3OKNB 5CJ8A 3QX9A 2H2WA 4FMCF 1V8HA 1LPMA 4LNHA 2Y7QA 1P5JA 5AVQB 4QTIL 4MJHA 1Y3IA 2HA5A 3I8SA 2EKJA 3MCG1 3Q2LA 4XCCH 4HDCA 4AT6A 1Y63A 4GRMA 2HPVA 4OLYL 3WYGA 4MQEB 2P0AA 5DNVA 1Q0TA 3VR6A 4WW2F 2V33A 2OCKA 4FLHA 5SV4A 3UTSD 5KVGE 4BRJA 1T21B 4PGCA 3MBKA 3U4QA 3VOSA 4Z77B 1Y3AA 1JPUA 4O2LA 4PRNA 2FR4A 3FTSA 1JQEA 3W1EA 3FSGD 4BL5A 4X62B 8MHTA 3G3LA 2BMFA 3NBYC 3C08L 1N9GA 1ZCRA 4B6ZA 4LWZA 4MCAA 1QQDB 1S3KH 1XXHE 4F2GA 3RVTD 3HBJA 1AMNA 4YUZA 1ZM3A 2EH7L 3TNLA 1U92B 3FX2A 5EYPB 3BRGC 1EXVA 4BNUA 4D5GA 4UUAA 4EY5A 4HFWA 4N7JA 4JFOB 2O6LA 4RWHA 5C3UA 2FZ3A 4GUAA 3WD5L 4IOMA 4NICA 3CPUA 2QXTA 2XN9E 3QNXA 5C53B 2QPEB 4OLYH 1GA1A 2ZKHH 4RE5A 4OXQA 2ZOLB 4P4KB 3ORJA 4R1PA 3ZDXB 3AQIA 2ZGVA 3OPVA 4ILDA 5D7NA 1NKRA 3HRIA 3KUUA 4JHAH 3PXGA 1VBMA 2JFOA 3TKLA 3VXSA 2VJ0A 3W77A 3FT4B 3JQPA 3I9AA 1BMGA 2FPXA 3OKOB 3LUGA 1X4XA 1GGJA 4NUJB 3ATFA 4AYWA 2APSA 3KXIA 2VERA 4WW1A 4B75A 1LK5A 5D7HA 3FYDA 3P0YH 2HIAA 3MR9B 3BRFA 4S1RH 3SDYH 1AQJA 4DUPA 1GY8A 4P99A 1N9PA 2IV3A 1MGPA 2VJLA 3T0VA 2HLDD 2OPBA 3JYBA 4IJVA 4MX8A 2YZKA 1O94A 2ZSWA 1JFHA 1UBHS 4BO4A 4NVRA 4HKBA 3QNUA 1NRIA 3BDYH 4U1IA 3ZXAC 4PZZA 4PFJA 4H7IA 2BNRB 3BZFB 2FZGA 2W6OA 1TU4A 1L9QA 1A1NA 4P4TA 2PX0A 4IJMA 2VRKA 3R9WA 4D0NA 4L95C 4BVFA 4N6NA 2CO1A 2X14A 1LSJA 1A0QL 2B6HA 3BH0A 1DJHA 3LKDA 3IIEA 3NM6B 1R8YA 2PZEA 1CUFA 2IH8A 4JPVH 2Y4SA 1GMEA 2XWJA 1R8JA 9MHTA 4OKVA 4YE4L 1OB1B 1Z07A 3KPTA 2A9QA 3BUYA 4L4VA 2H2SC 1TM5E 5KJ6A 4L50A 4GY4A 2BP8B 1RIHL 1QB8A 4A0GA 3ARSA 1JIXA 2CE2X 1OY3B 5ESVB 1PKQB 1U7WA 3ARDC 2VOTA 2W0FB 1QVVA 2ID4A 3F71A 5AOCA 2V0NA 5I8PA 2N56A 4UOQA 5F96H 3X1FA 4P7KA 2WY3B 4RM2A 3B9QA 1MCPH 3I6SA 4UDTB 4JPIB 1T3TA 4EBQL 4R81A 4PJXF 1PEWA 1D1PA 1JUFA 3HJ0A 3MWEA 3HCAA 2VDQB 4BO3A 5JI2E 2V7BA 1KOGA 3GEWB 5HHPA 5I1DA 3WLWC 4LLMB 2D7PA 2BTEA 4NGHL 1TE2A 2GTWA 2B34A 4P9HH 4HQQH 3HLAA 4DPAX 3SJCA 5DMKB 1MZZA 1OA0A 1BZEA 1JZ2A 5F78A 1QSED 2VJDA 4YJFA 3OJVC 4ZOEA 4CJ0A 2HRPH 3ZIYA 4X1OA 3I5MA 5FA3A 4NKOA 4WHMA 3R7LA 4TLMB 2ISDA 1W5TA 1ML0A 5AKRA 4TS9A 3CMOL 3H5NA 3P19A 3MJWA 1VJ5A 1YBVA 3QXJA 4WGGA 3VFWA 4ETQB 1ESZA 4X8GA 1LZLA 4IJ3C 1EEUA 1T1SA 2IH4A 1SY6A 3CTPA 1UA6L 1GGCH 5HGDA 3V4PL 5FIUA 2J3DA 3OU2A 4WFKA 1IHOA 4PR3A 3L0CA 3S2ZA 4UW9A 1G6OA 3IVMA 4QRAA 3HCVA 4KRXA 4YWGH 1J06A 1HSAB 3PXCX 4WJKB 5H70A 2OZLA 4XI5D 3U7YL 1HF3A 2WU3A 3NP9A 4XRRA 4XVJL 5F4ZA 4XNMA 1L5FA 3FRIA 1E2WA 2BMJA 1CZOA 3FNHA 4HOWA 4IDGA 4WH0A 5L3VA 3TQHA 4R2GB 2D2FA 3MWDB 5FWQA 3DNPA 2CRYA 2TRYA 4QQKA 4DBLC 4CIDA 5DJ8A 3B1ZA 3N50A 5DS8B 4I1VA 3WEBA 3DZDA 4NWUH 3MBWA 2R1VB 4CW7A 2Z09A 3ROOA 5DJ2B 2Q8BH 5EU7C 4E41E 4MNGA 4U7WA 4Z3KA 5HJBA 4YRCA 3OF3A 4NAHA 3BWAB 1DRJA 2DBVO 4JJZA 1OM3L 1GXSA 3GM8A 1QIGA 3T3OA 2LCFA 1PWYE 4FRWA 1BM7A 1V47A 3QKWA 3RRJA 1MCFA 2RGYA 4Z0XA 4UE6A 2BEJA 2VK8A 1FE8L 5EUOA 2O3UA 1YECL 3V1TC 1QAMA 3I39X 4LOAA 2EAUA 2H7CA 1XZHA 2XQJA 3AF6A 3TIEA 4Z7IA 1NBOA 2CALA 4J9VA 5EBLA 5K1ZA 3AR2A 2VHZA 4NQCB 3WMPA 4XASA 4FOOA 1NVMB 1NGZB 2ARWA 3DDSA 4M3NA 4I0PC 5C1OA 2XV6B 1NBZA 4XNQA 4YXKH 5CB4A 4PWHA 3PQ3A 2RBLA 1MVUA 3C60D 3MIIA 3ZE7A 3CUPA 4LDPA 4MB0A 5DNUA 2Q8BL 1AIFB 1ZA6B 4XARA 4YNYB 1EUZA 1G7QA 5DYYA 1G7PB 4AGNA 1T1WB 3PGDB 4AJ2A 4CMAA 4ZZ0A 4ATTA 5TQVA 4BQBA 4XP5L 4BWGA 5JW3H 1ECBA 1NVKA 4OFPA 3CYFA 3FDZA 3I6ZA 2GIYA 3AL2A 5C0AD 2AW5A 2ID5A 1CEEA 3ARFB 2CHUA 3THRA 4GRLC 3MRMA 2G1KA 3EOTH 2P9GA 4G71B 5GRXG 1JE0A 4GE0A 4S04A 4PJIE 4MVJM 5DCCA 4GRMB 4EECA 4DTGH 1E96A 2ZVQX 4KACA 5JASA 1E58A 1KSRA 3SXUB 4XVTH 4NPJA 5LQJA 1MHEA 1K3UB 1E8XA 1O08A 2YD0A 5DM60 3PQ7A 1UM9A 2R0ZL 4C4BA 4W9IC 2GJZA 1XZLA 3SDYL 2XVZA 3D6FA 2R0QC 5EZOH 4RMUA 2BFBA 2HT2D 4ZPTB 4C89A 2ZOSA 2F5AL 5KHOC 5DJAB 1U8AA 2X41A 3CH8A 2OHXA 2FBOJ 4ODSH 3T1FA 4B9EA 4I85A 3GLHB 5HY9B 3OKOA 1I24A 3TTXA 5ITFB 3ANMA 2EUXA 2OCIA 4ACPA 1A4JA 1ZKAA 1FRVA 1A9VA 2B21A 2REQB 2AQ3A 4MVJG 3HUTA 2WD0A 2WZDA 2JLZA 2I7CA 2IVZA 3BWZA 4ANUA 1LD3A 2E6JA 5TT1A 5G4MA 2OSVA 4XLZA 3TJEH 3U6XS 3LKZA 4QJ3A 3NUGA 4J1NA 4MAUH 3SB3A 2D7MA 4U2GA 1BGXH 1MCRA 3ILHA 3SKYA 4KO8A 3OHSX 4XN9A 2QFRA 3UTTB 1GNVA 1QBKC 2HA7A 4W9GC 3DC7A 1RM4A 3PP3H 3BIWA 4M7KH 2I27N 1COWA 5DUPL 3EPKA 4XB3A 3OAUL 4JY6A 1RYBA 5DRTA 5JJ5A 3LWZA 2P2SA 1GLGA 3PHHA 3AVXA 3EXFA 2Z83A 2UYCA 3LY7A 3RZCB 3CB4A 3OWRA 3LQQA 3B9RA 1CK0L 3BXHA 3P77B 3TXXA 1NPYA 3QMWA 1RTTA 1L2TA 4M1GL 5JPNB 1KCRH 3F7YA 1L6RA 3GGCA 1U30A 4DGSA 4RMBA 1Q16A 4UUJA 5EN3A 4H60A 5ALRA 3UGJA 5SWQA 2Z57A 4XB6B 2PUEA 4ZVMA 2WI8A 2P4AB 4X7FC 4N2EA 1U8HA 3QZOA 1AA6A 4MPDA 5C52B 4BEBA 4DOHB 1M7DB 3K4PA 3RI5F 3MLAA 4II7A 4EW1A 1MRCL 3ZIMA 5F7KC 1E7SA 2EYQA 3WEAA 1QCZA 2QR5A 2JELH 1RIUH 2NY5H 3ZZLA 1ZFNA 4F7EA 5CFPA 4JFWA 1A2KC 2WWRA 2XYGA 3UM9A 5CEZL 3ZDXE 1E79D 1JJFA 3P73A 2QP9X 3CO5A 1G20A 1MFUA 4BC1A 3C8HA 5C0DA 2ORYA 3WNNA 4MQEA 3Q2OA 3VHXA 4GG8B 1H3PL 5DFAA 1LO0H 1UZ6F 3G8BA 3TPCA 5F93C 3L3DA 2HVBA 3LH9A 3VH1A 2PQ0A 4BVLA 4RWYL 2BSXA 4C0AC 2YQBA 3EDMA 1OILA 4PS0A 4PHHA 4JEIA 1GPJA 1QRNA 4HCIA 3A0UA 3ZBMA 1U0GA 1A3RH 1P7ZA 3FQNB 1GUYA 1NZDA 5E9DD 5CMAB 4KZCA 4IZOA 2FXVA 1AGEA 1CI3M 2EQBA 2ZT6A 2ZXGA 1XD2B 3PYXA 2VN3A 5E2UL 4GP6A 1NT2A 3KW7A 1Z29A 1RWKA 3GMQA 3AGQA 4YRSA 3AVTA 4FP8L 4KI7A 1J0XO 4CADB 1U3JA 3FTUA 1XBTA 4EBBA 5GIRB 2OC4A 5JH7A 1BF2A 5AK5A 4EKEA 3ES9A 3BPCB 5E6IB 4HKZB 4NKQB 3RSOA 1WVMA 1U8PB 3IMUA 4ZA2A 4LY3A 1R27A 1XF4A 3RYHA 5K59E 2BNQB 3RV4A 4LY6A 1G8PA 4AH2B 3VWKB 2NW2B 4LPVA 2ZXUA 4TQHA 5F7BA 4JFRA 2DEXX 3K5RA 3VGAC 3R6WA 1G3MA 2ZNWA 4B6QA 5CB6A 1PL7A 1RXWA 4DKAA 1NM5A 2PW1B 3D07A 4XBEL 3Q05A 2YSSB 5D72L 3D6TB 3DX8A 1HG1A 5E6ID 2RBEA 5KOMC 1DHKA 3WEXA 3W2DH 3TEFA 3KDMA 3B1VA 5FPKA 5D2LF 1K7SN 1Q92A 1WR8A 2CMFA 1RTKA 4OVUA 4TRRA 3ZQWA 1BRMA 4U2BA 4QTTB 4FYKA 3FQXB 4NZTH 3BVVA 2Y71A 4PN7A 2V59A 5BQ3A 4FQ1L 5EOCL 5IJDC 5ALWA 1FDUA 1J23A 2QGZA 3KD3A 1WWKA 2A6DB 2A1UB 1TSRA 5TFSH 5GAJA 4E1AA 1UACH 2G4VA 1SU8A 2PR2A 4PYIA 1QHNA 5TPZD 1IZ0A 1J5XA 3KPPA 1QTRA 1JGIA 5SWSD 1S7RA 4MMYA 3Q12A 2VLJB 1F20A 3KZVA 1FFOB 4Z7OB 2XEDA 1AKJD 2FD6L 2FDCA 2DUMA 5DJ5A 3T3NA 3TZVA 3WDSA 5SWSE 3A25A 3DIVA 1C3EA 4AMWA 2E4YA 2IPOA 1GG5A 3FUNA 1NMEA 4UQ9A 1YEEL 4G09A 1U4OA 3TN7A 1J7KA 1EUDB 1OALA 3Q87B 4B7XA 4FHJA 4IRZL 5GONA 2WGXA 4FI6A 3WY4A 4ELKB 5JQWA 3O41B 4J3TA 3NC0C 1IAII 5IHPA 3AI2A 4MW0A 4I1NB 3BSZL 1A71A 2H4WA 4X8LA 2H65A 2PO6A 4OLWL 4KAJA 4K05A 5L0QC 3HMXA 2F9LA 4YP7A 1UD5A 2F8VA 2MINB 2CNLA 3N07A 1PD0A 1UD2A 1ACZA 3GL9A 2UUAB 1DUZA 2CNWD 1QPKA 1WXFA 1NG9A 5DJZA 2I2FA 5CGZA 1C7RA 2IXBA 3WLIA 4P9HC 2X2FA 4N2CA 3YASA 4BLQA 5DR5L 1JVBA 2BJVA 1KAHA 4LFBB 4DCPA 2V5UA 4FFYA 4TYNA 1FMTA 5EOVA 4BYHA 3WX0A 3OGCA 1Q9KB 2OMTA 4XUDA 4L85A 3TIXB 4XBGB 3IJSB 3VC7A 1EUTA 2GF0A 4BDSA 3T8XB 2X70A 4IFEA 1POWA 3EGEA 1UL1X 1THAA 1IT9H 2QAGB 1OSZB 3RSFA 3ZO9A 4EABA 5J1AA 3DM9B 5GS0L 2F00A 1ETZB 4YRAA 3HAEB 4JCMA 3SOPA 3IOBA 4PGDB 3U83A 4JRXD 4KNWA 1J11A 5BUPA 5IMMA 3VO0A 3L3OC 1K72A 2QTRA 3R7AA 3IFLL 1OLZA 3QO1A 2AFHA 3ZTEA 2AFRA 2OQJA 3AXLB 2Z56A 2FVNA 4IJKA 3GO4A 4XTCS 2EXYD