3UOAB

Crystal structure of the malt1 paracaspase (p21 form)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
378
structure length
364
Chain Sequence
MLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the mucosa-associated lymphoid tissue lymphoma translocation 1 (MALT1) paracaspase region.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
total genus 100
structure length 364
sequence length 378
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00656 Peptidase_C14 Caspase domain
B PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uoaB02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uoaB01
1RWWA 3H13A 4EHLA 3DEJA 3NS7A 4N6OA 1CVRA 4ZVRA 3IBFA 5IAKA 4ZVSA 1CP3A 2DKOA 2H51A 2H54A 4EHAA 4EHKA 5LU8A 5IAGA 2QL5A 4QU8A 1SHJA 4JR2A 1RHJA 5K20A 3UOAB 1NMQA 3PD0A 4JQYA 2FP3A 4NOMA 4NOJA 3R6LA 3D6MA 1M72A 4NBLA 4EJFA 3KJQA 2H48A 3NKFA 4N6NA 2CJYA 3EDRA 3GJQA 4NBKA 5LUAA 4QUEA 4QUHA 2QLBA 3ITNA 2H4WA 2Y1LA 1NMEA 4IYRA 1RHMA 4QUGA 4QUJA 4DCOA 5IBCA 2CNNA 3UO8B 4AW9A 5LUBA 5JFTA 4QTXA 4N5DA 1BMQA 2C2OA 1RWKA 4EHFA 3V6LA 4QUDA 2CNOA 1RWXA 4HQRA 1SC4A 3GJRA 1NMSA 2WDPA 4FDLA 4JJ8A 5IC4A 4JB8A 4D3YA 1QDUA 1RWPA 2J32A 3GJSA 1GFWA 3DEIA 4PRYA 1QX3A 2FQQA 4QU5A 4ZVQA 4ZVPA 1JXQA 1I51A 1I3OA 2HBZA 2J30A 2QL7A 2C2MA 4EHHA 4JJ7A 4N7MA 1KMCA 4AWBA 3D6HA 4PS0A 3S70A 3PD1A 2P2CA 1I4EB 2J33A 2QLJA 3SIRA 4AWAA 5IBPA 3P45A 2K7ZA 2Y0BA 5I9BA 3R7BA 3V55A 2H5IA 5LU9A 3SIPA 5IABA 1K88A 3H11B 4ZVUA 1F1JA 2AR9A 4ZVOA 2H4YA 1RHUA 1RHRA 5I9TA 2HBRA 3H0EA 4FEAA 2C2ZA 3PCXA 5IAJA 5IC6A 5IANA 2HBQA 3KJNA 4D3XA 4NBNA 5IASA 4QUAA 4FXOA 5IBRA 1F9EA 3OD5A 2C2KA 3R6GA 4M9RA 3RJMA 4JR0A 4I1PA 2QL9A 1IBCA 1RE1A 4D3ZA 2H5JA 2H65A 3IBCA 1GQFA 4IEFB 4QTYA 4QUBA 3BIJA 1NW9B 1PAUA 3GJTA 4N7JA 4LSZA 4QU9A 3EDQA 3H1PA 4JQZA 4QU0A 3P4UA 4FGUA 3R7NA 2HBYA 1PYOA 1SC1A 3D6FA 3KJFA 3NR2A 4JJEA 1K86A 4N6GA 4ZVTA 3V6MA 1SC3A 4DCJA 1RHQA 1QTNA 3K7EA 4PRZA 2C1EA 2CDRA 2XYGA 1RWOA 2NN3C 2XZDA 4QUIA 2XYPA 2XZTA 1ICEA 3S8EA 4I1RA 3E4CA 4EHDA 2CNLA 3QNWA 4NOKA 3V3KA 4DCPA 3V4OA 3R5KA 4EHNA 1RHKA 2CNKA 5IARA 5IAEA 3DEKA 1SHLA 2CJXA 3DEHA 4PS1A 2QLFA 3H11A 2XYHA 5H0IA 1RWNA 1I4OA 3R7SA 3V4LA 1RWVA 4HVAA 4HQ0A 4JR1A 1RWMA 3R5JA 2J31A 4NOLA 4QULA 2FUNB
chains in the Genus database with same CATH superfamily
5GGVH 4JREB 3WTCA 2IAMB 2HTKC 1EEYA 2E89A 3T2LA 4I4LA 4P9HL 2IANE 5GRYA 2APXA 4BECA 2AN3A 3ZWQA 1K5GA 1OA0A 1J1ZA 5G2OA 5ERWB 1CL7H 3AF6A 4F2EA 1E2JA 3RFVA 1RUQH 1II8B 3UH0A 3ZR6A 3GCZA 4LRXA 1CDCA 1VL1A 2D62A 3ARFD 3VGAC 2OZLB 2E4UA 2Y0DA 4V0NA 2FO4A 2CM5A 4LYGA 5JW4R 2FQQA 3DX6B 3QITA 2H3NA 1XT5A 5I01A 3ARDB 3C8KA 3CFBA 5D1QC 3GBNL 1UKAA 1XZWA 4O4JB 1U8NA 2X6VA 1R74A 2AABL 2RGSA 3OQ3B 3TH2T 1EGVB 4BAUA 4Y9RA 1RZGA 1GZUA 3PEUA 4XCQA 1RYEA 2WUDA 3JVGC 4X24A 3R8CA 2J0SA 2OCJA 4QUBA 5GGRB 4Q3CA 3T08A 9LDBA 2IH1B 5L51A 2P5ED 4XHQA 4FJ1A 2HU5A 4JVOA 2O50A 2I2XB 1KN4H 4IMJB 1SEBA 1JEQA 1GU7A 4IDLA 3KQMA 1E7SA 3EF1A 3OZFA 5ALZA 4EJSB 2SECE 1PQZB 1CJMA 2XBMA 1B3RA 5DK6A 5I18L 4E6EA 5A2QA 1YRBA 3IDGB 2J1ZA 3TG2A 1T6XA 2XRMA 2KSQA 3E0XA 5B1IA 2LGNA 4N2DA 2Y1OA 1PLGL 4M36A 2PWGA 4X6DB 1U3TA 5ESRA 1W5EA 5DE3A 2E8ZA 4MA8L 1E3DA 3RVOA 3MMEB 4IAOA 1VMEA 4UU9A 5IAKA 1E4WL 3BVNB 1DAFA 2AFIB 3CLVA 4W8OA 1OL0A 3JARA 4NABA 2IH3B 4HW6A 4JO1H 3QELB 3K46A 1QV7A 1QB8A 4RMGA 1MY7A 4G07A 5C07B 5JHDE 3ARQA 5DHYA 2COVD 1B3JA 1ITBB 4MA0A 4IRXA 1NJ1A 4R2LA 3M9LA 4D9RE 1V9SA 5D6NA 2ADIB 3D5OF 1HFWA 1KQ3A 4B3RB 5TF1H 4GAJH 4AQAB 2ZJ2A 1BIIB 3MYZA 3AEUB 1Y42X 4L4VD 1Y0LA 3MOGA 4YSTA 2PO6D 5KVDH 3JZYA 4IHKA 4JHVA 4TTDC 1J9CT 2ATKA 5CFPA 3HHRB 1KPVB 3L40A 4ZPTB 3WYBA 3F46A 5BSTA 4BB6A 1QM5A 1CG9B 2ZX9A 3GCXA 5AK6A 3B3AA 3ESDA 3PHBE 5KJRL 2V4ZA 5BXFA 2C3YA 1G8HA 2GN4A 2GN1A 3LQAC 4LSTL 2OQJB 1IGML 4TV8B 1RABA 3THYA 2FUG6 3R8BB 3VTTA 5B1JC 3BRWD 3AFLA 5IHPA 4KQ6A 2VP5A 3DFZA 3P9WB 3NWJA 1O97C 2AXFB 4IHOB 3W1VA 3ULVF 4KO7A 3BGMB 5DN6D 4CSTA 4HAGA 3QWNA 2AZAA 3MLTA 4FFZH 3D8NA 4F46A 5ALNA 1Q9KB 3SD5A 3O7MA 3X12A 2LVEA 3U1SH 5IFHH 1UM9A 1ZI6A 4LJKA 5J2UF 4LQFL 3UT6A 4DDVA 2EHDA 3CY6A 3AR3A 4NBSA 4KKNA 3QDMD 4PVBA 2NZUG 4PG6A 4UPVA 2DZEA 3A25A 5ADPH 4JV5B 5F71A 4NNYB 4ON9A 2VLKD 3V3TA 5IVXE 3GQFA 4OBBA 2GSMB 2PVCA 2X53A 3L0DA 4EUHA 3FOFC 4PPYA 1UWXH 5DJDB 2FR8C 5CEEA 4RD3A 3LS4L 2Q1SA 5EIHA 2H2DA 1V71A 2ZZKA 5JZSA 3F4KA 1HZZC 1ECGA 1QLEL 3HA3A 3ARBC 2Y77A 2QL1A 4MV6A 1J05B 3BH8B 1LLUA 4C3ZA 1NF3A 3H5WA 3PL1A 3W1ZA 1JNJA 1E3TA 4JBIA 5HYSA 3HMXH 2W4IA 2G9HA 3KKPA 2GSWA 1FPTL 4JA0A 2QUIA 3ICQB 3RC3A 3EOBA 3SR4A 4JLDA 1HZLA 4CM8A 2WHVA 4HUCA 1KJ2A 5EBWB 3D0VA 1FY2A 1ZM9A 1SJHA 4UCXA 4EN3B 1MKYA 2GK4A 1P2BA 4N9OB 1YTUA 2IEGA 3LQZA 1J9ZA 4ECAA 4KRMB 4PO8A 4FERA 1OU4A 4XPTL 4N9WA 3GZNB 1F38A 2CJXA 3WKBA 2IIQA 3TGPA 2YFYA 4X42A 4XD7A 5ELMA 2MINB 1MHPL 3W2FA 3DEZA 2XAAA 1ZLDA 1Q1PA 5ITZA 3KWUA 3HXTA 2Y8EA 3ELWA 4WJ5A 1A76A 3MAGA 3RWIA 1SQMA 2Z2IA 3AWDA 4BFOA 1GMEA 1OGTB 5C0FB 3JWOH 3R6WA 3MCWA 3DKRA 1XJQA 2XTZA 1MP0A 5JSFA 1NXSA 5BSRA 3V0IA 1UQSA 3IO3A 3KBEA 3MLEA 3MROB 3OMXA 2WIAA 3SEZA 1K72A 2ADJA 1L1RA 5BWBA 4CC4A 2E6UX 5G1OA 1BVLB 4D0DB 5C1PA 5CCDA 1Q9WB 3D05A 3ALWA 5MEPB 3E3LA 4ZTOL 1S01A 1T4MA 2RGNC 5JOFA 4XGIA 5KDLA 3RTGA 4PNEA 2W8BB 4RENA 2FN8A 3PX3A 3D85D 4FQXC 3NOXA 4X7PA 2IMMA 1QCDA 4M5SA 1PFQA 2C03A 2H18A 4JIMA 4MAYA 3TPUB 2I03A 4R7LA 1R3IL 4NXSA 4G83A 3I6KA 3GOHA 1PIGA 1H2BA 1KJIA 2WJVA 3PWJB 2I4OA 1BSIA 4PJCA 4Q16A 1NANI 2DQFA 3SJUA 3AM8A 5D8JL 2XIQA 1SHUX 2VDQB 3EHEA 4OMUA 3ETJA 5AM2A 4M9QA 5K05A 2DBLH 3TZQA 1QQ7A 10MHA 3RVPA 1OARH 1M34B 5GZ6A 3ICWA 3B5JA 4GW5A 3V52H 4PJEB 2P9TA 3TRFA 2PUAA 5FDYA 3V4SA 2XTNA 4AQDA 4YUYA 3TBTA 3B6EA 1V7QA 1XRLA 1LO3H 4WWOA 2PX4A 3O2SB 1C8LA 3O4JA 1V16A 4Y4HD 2D0HA 5IS2A 4HT1L 3HJFA 1J5EB 4X98B 3WZ2A 2CHGA 2GLUA 2NO9A 1H0RA 1SBNE 1WBBA 2DIJA 2D73A 4XP5L 4OO3A 2OL3H 4LDZA 1OTUD 3NTCL 3WHPA 1KN4L 3AM1A 9ABPA 4PG9B 1E69A 4N6RA 4I5GA 1OP5H 4W93A 1I1NA 5CT8A 1W1IA 4J8PA 1UCBL 1VZ2A 4MH0R 4YRLA 2OMWA 2Y9RT 3MV7B 4MGEA 5LZ5A 4DAOA 5DD1H 3I04A 4DR1B 2P1RA 4TWAA 3MOBH 5HQJA 1P4LB 2P42B 3T9WA 1CUYA 2ID8A 4ZYTA 3C74A 1XBDA 3C08L 1QI4A 1U3GA 2CK0H 3PJSA 1N6IA 2HGSA 1PNOA 3WHXB 1UPAA 2H0JA 3PCRB 2BSCA 4LMPA 5IDQA 35C8H 1UM8A 4P84A 5COQA 2OZVA 1WLYA 1CO1A 4NI5A 5EE5B 3P2YA 5IUKC 1US8B 3MNWA 4MA7L 4RWHA 4MCAA 1SXAA 2YAPA 1FJ2A 1XSIA 3R5FA 2E5WA 2AJXL 5E6SB 4JRYA 3KYCB 2LLGA 5H37A 5JHHB 2Z2KA 2I6UA 4QHYA 2J43A 2P47B 4DERA 2OBGA 1I3MA 4Q6KA 2VJMB 1QFJA 4D98A 3GFBA 1QRUA 3UBMA 3DHWC 1AD0A 3VXNA 4XYEA 4HC4A 3QTBA 3L06A 4IO1A 5FTLA 3ZRCC 5HS6A 2FPMA 3NGXA 2A8YA 4YHZL 4EB6B 4I2XE 1JAIA 4PCLA 3IVXA 1NC2A 4A2PA 1GKKA 1G0DA 2XG5B 2CXKA 2XWJA 1DN0B 4XJTA 3A6FA 1GKYA 1C7FA 1Z2AA 3WKPA 1USZA 4LRWA 4WBNB 4PJBB 5JMPA 4HH9B 3FI9A 1I3RA 4HJGB 2QUKA 3AQDA 1UPUA 1P1ZA 2XG5A 3FAWA 1ORWA 2VK2A 5D6CA 4NBNA 5JAZA 5CHNB 1CS0B 1N1EA 4MNGE 3EJQA 3WFIA 4JPIA 4JEUA 1GCOA 5TQ2H 3TQRA 2J5RA 3BSWA 1U0JA 1HY3A 1GYVA 1GKUB 4ZQCB 4ESEA 3FTZA 4Y0VA 1E6LA 2OQVA 3GGJA 2VK1A 3MTJA 3WKEA 5B7FA 1NXVA 3NBFA 1HWGB 3DLQR 3PWUB 2A9FA 2WSIA 3OSKA 4H35A 4ZNEE 4FA6A 2ZXEA 4BGLA 4MLIA 3U1BA 3WI9A 2XUZA 1LI7A 2BZDA 5M04A 5JALA 3G23A 1E0AA 4RK7A 4X64B 5A6IA 1E1CA 2JQZA 3HKEA 4CN4A 3NHSA 3SJ7A 3AEXA 4X71A 2M2IA 1CZUA 1RQNA 3ENWA 1UBGA 3RY6C 2XT6A 1EK0A 4F4CA 3RX5A 5E1MA 1NI5A 5EWLA 2FJPA 2AOTB 3LRPA 4BQPA 5GRZA 4L22A 1NW4A 3JTSB 3WSQL 3C3KA 4IDDA 4OF6A 3CF4G 4R8LA 2BIMA 1XP5A 3SDXA 4HCIA 1ECZA 4DJEC 4UT7L 1RWKA 3EAKA 4I81A 4O29A 2EEXA 1KOFA 3ETHA 5CFMA 3U7FB 4EY5A 2QD1A 2O8BA 1G19A 1E61A 4HHGA 1RPTA 5EZOH 1JHMA 1P2GA 4KX9A 3MBIA 5E2UL 2OB2A 2AV1B 1D0SA 3FROA 4JRXD 5F6IC 3AU9A 2C3VA 3GI8L 4XP6H 1V1JA 3EW9A 3TAUA 3IGAA 4LKCA 4J76A 5DLDA 1GZ5A 2Q45A 1BIFA 3QNZB 1WQ1R 5T8KC 3VDNB 4IZIA 1XC7A 1Y63A 3IJ5A 2C58A 3ONWA 4U6XB 2QADB 2QQNH 1XZKA 2QXUA 4EYSA 3MRPA 3NXKA 3NR2A 3IHTA 3G6JF 4P2GA 1ZJ6A 1JKFA 1S7CA 4MS3A 5EIQA 5DJ8B 1BCRA 1Z6JT 3KLAB 4YMPA 2IUSA 4ZHSA 4M99A 1R24B 2N1MA 3HR4A 5AB9A 1LTXA 4F1ZA 4YT5A 2Z1KA 1V4VA 1D5CA 2GWHA 1NVMB 2JLUA 1D5RA 5I9QB 2CJUH 1EFUA 4PJ7B 2ZBFA 4FC7A 2XOKD 5AW6B 1JDPA 4M3HA 4GRLA 4RETA 2X0EA 3K72B 2GB4A 1OPOA 3RWOA 1DAIA 2VBIA 3WGVB 1VPVA 1Y7TA 3DXXA 3VFWA 1ZA6B 2BTQB 3TPUA 5CNMA 5DLPA 2XXAA 4ICIA 2PT9A 4YUZA 2D7PA 2VDKL 3W5JA 3NN8A 3V5DB 1JLKA 4OHWA 3GA7A 2I6QA 3MV8B 1FS5A 5IUNC 5D5PA 3VFPA 1WQ3A 3P9XA 4YAWA 4Y4HC 2O59A 2Q8AL 1IT9L 3ABRB 4IEEA 3TFKD 4YXHH 1MNQA 4P53A 5SWZD 4L73A 4JB2A 2XXGA 4EG6A 3QJYA 4ACBA 3E2IA 1C8PA 2F00A 3MRNA 2WT9A 2EJBA 4F12A 4NUJB 3LH9A 2X4RB 2VDLB 4O3FA 4POOA 3I2YX 2HWWA 5DVMA 3HBGA 3DV0A 1T03H 1E4OA 2X4OA 1R3KB 1TAUA 5F97E 1MCHA 3WJJC 2GHIA 1X7XB 3H1FA 4MV5A 4QMEA 2ESRA 1EVYA 1KJWA 3AUSA 5I8KH 1ZGLM 1AFVH 4NBXB 3UAJD 3NA4A 3VFUB 3C5SA 3DTXB 2BSTA 1PWXA 1T7WA 2D3NA 4BSVB 1ZD4A 3I8OA 1BCSB 1Q50A 5DO2C 3D7RA 2FLBT 4U7FA 1PY9A 2CKBB 1Z66A 1E5VA 5IJ9B 3LDGA 2DOCA 1ENOA 3VGAB 4M6WB 4PV1C 5P8WA 5EIIG 4LB8A 3U44B 1IDN1 2ZIDA 2K6WA 2J6EL 3B2XA 4OFKA 2ZYIA 5FGCB 2C7FA 5AVYB 4PJHE 3P5BA 2L19A 3PQ7A 2X8BA 5KWIA 2V8LA 2XUQA 1Z33A 3HU2A 3FBGA 2QRLA 1VHTA 3B89A 3DJYA 5KBYA 2AN1A 4IMLB 3F6LA 4KXDA 2FDRA 3MOBL 8FABA 3VNBA 1KXQE 1O5TA 2OXIA 4ZYYA 5HYSB 1BA3A 1SHKA 4BX8A 2EBUA 2VO8A 5TDHA 3FB8B 2ORWA 4KQHA 3LI2A 4EJMA 1U8OA 1ZRHA 1V26A 3QRLA 4MW1A 1J22A 1CFSB 4HNGA 3NGBC 2WP8J 5F8QC 2PA3A 1KTJA 3O90A 2P48B 5DQDL 4NRYB 1TZJA 2N01B 2JK1A 1L0YA 3ECQA 3O0RL 3D2UD 3F5SA 5AVQA 5EC2A 2V6IA 2QQKL 1DADA 1XAKA 5DPMA 2YUWA 2AFNA 2BBSA 1DQML 3AADB 3A04A 4HS4A 2VXQH 1TQVA 2KI5A 3M82A 3PP3K 2NTVA 1PZDA 2V7NA 1P7ZA 2J5BA 2JC3A 5U9CA 3DLIA 4GKNA 4WW1B 4GAYB 2O8VA 3JQAD 5DZJA 5F9MA 3S28A 5I1EH 5K8UA 3IETB 3LQMA 5J6GA 1A66A 2PX8A 3IAHA 4F11A 3CDZB 3AJDA 5C9KA 4AQ1A 4KVCH 5K9JL 1QH8B 3NM6B 5HF6A 1Y1KE 4PPTA 4Q1AA 1J5OH 1A3LL 1T5TA 1R0AH 4MW0A 5CB8A 3H9GA 4QAMB 2NRDA 5EBMB 5IARA 1LD9B 1R66A 3Q8FA 2QAGB 3HNRA 4LCYA 1GYPA 1INQB 3FFDA 4M00A 1IK4A 4HAZA 3QXUA 4S1DD 2B6HA 2VZOA 5IRCD 3LN5B 3ANLA 4PJ9A 1Y18B 1WG3A 2XTJA 1XKLA 4RVSA 3VXQB 5DHFA 3U31A 1AGBB 2QV7A 3I2KA 2LE0A 2DJSA 2HRQA 1H4TA 3UG7A 1CD9B 3H5VA 5CWSA 3GLQA 1I6MA 5FWDA 4M02A 3Q8KA 2VM3A 3TEYA 2H1PL 4LF8B 2OAAA 2I29A 1P75A 2F54A 1K89A 1TUEA 4FIDA 3D18B 1P6XA 3O73A 4EGCB 4HNAB 3ATEA 1OAAA 2G1KA 3G9XA 4W70A 1U90A 2VSFA 3FF4A 1V95A 1G7HA 1ZL2A 3PWJA 3MODH 2CSUA 4J0IA 3QO0A 5A5DA 3L54A 1GGCH 4GLRI 5IMOA 2CU9A 3S2AA 3MTAA 3GAMA 1QFUH 5DUBA 2DQUH 4JKNA 3FU9A 4B6GA 3VGBA 3IXTA 4BO0A 3BYTA 1GA6A 1CDGA 2UXVA 4I5IA 1UAYA 3WIHH 2YJ4A 4LMAA 3H5OA 5B64A 5EOTB 3I2IA 1Q9WA 1FGVL 2FG6C 4V2UA 4ZI7F 1K4DB 1KGXA 3LM8A 3IDMB 2ZB3A 1SC1A 1SDDA 4QR7A 4KXVA 4MV0A 1G66A 1OWWA 1K3UB 4W1SA 5JCXA 2OYCA 3HO1A 2VLLB 4RWYH 3TLMA 2PJUA 5L4NA 1UQSB 1IGTB 4O4IF 3I5UA 3EA4A 1QBAA 3TI7A 4UTAL 4OAWB 3LNIA 3P4OA 2IYEA 4TNFA 1PG5A 5M2QA 4M0KA 1WA5A 3FB6B 4LASH 3ZJ4A 3OL2A 1NBYA 2IZZA 5F5NA 2DYSB 5AM0A 1SQ2N 1T2XA 1IBRA 4LDQA 5B4TA 1FZOA 4KWTA 4LE1A 4R16A 4HK3J 2CBXA 1GS7A 3PENA 1RIVL 3LN4B 2QVMA 2PCJA 2JD0A 4H15A 4LG1A 1ZHOA 2XWDA 1XJCA 1Y6ZA 1OT1A 3KTOA 1W72A 4R54A 1V6AA 3HWSA 4CKQA 3GUTA 4RBPH 4B6QA 3ZXAC 3ARGA 3PFGA 3MAJA 3FO9A 2OR7A 3JATB 2BTEA 2VNJA 4R2GD 2EYRB 4IFTA 5IVDA 2XOKA 3MS2A 3LQ4A 2FMIA 5E56A 1Q2UA 2AHOA 4JJ7A 4IWNA 1HQ4B 4XUCA 4KXLA 1DBJH 3C1UA 5IWLA 5J13C 2BS8A 5EOTA 1E3QA 3L1KA 3AL0C 4QXVA 2H2AA 2Q6IA 5A0VA 3L1JA 1CWUA 2Y1XA 3LIIA 2B3DA 4Q6IB 4J1UA 1YFZA 1UZAA 2IH9A 3MV8D 3QF4A 3BUBA 4LPSA 4ACAA 4OQ4A 1KTLA 1QHPA 2E9BA 5IEBA 5ERWA 2ZE0A 2PBZA 3CQFA 3HYLA 1G9EA 5FULA 4XB3A 2EJWA 1YEFL 5B7MA 2BRUC 3A0RB 1E9RA 1DIRA 4M9SA 4KJWD 4PBDA 4MAAA 3GMQB 3K9HA 4ZODA 4N0CC 5JCOC 4XGZB 2D8AA 3FULA 5BV7A 3HN2A 3LSOA 2XYPA 3BPNC 3ESMA 4OCYL 4PTTB 3WENA 3IAAA 1KN2L 2HADA 3VH8B 1Y8QB 2YFQA 2VLJE 1KTRL 4E41D 1CF2O 1LRKA 4U7HA 2A2ZA 2R6AA 3IPAA 1ZVJA 2IGLA 1SCBA 4ODXA 4GUPA 3LAWA 4BX0A 3Q2WA 4L07A 2VLJA 1P62B 3DUUB 4BZYA 4YFVA 5AVXB 2DWEB 1MH5A 4TVPL 3WTYA 4M0FA 3OFNA 4RSYA 1S2EA 2IADA 1H3UA 1ZMXA 4HWRA 3BGMA 3Q9LA 2GYYA 1SVIA 1INQA 2DJUA 2R68A 5HY9B 4K9JA 3LEVL 2LFEA 1JWAB 4N9QA 4OZIE 1T22A 1H3VA 2OMVB 5DUJA 2EIXA 1NW3A 5DNAA 3OJMB 2RHOA 4ZQFA 3WJMA 2EFJA 3IFNH 1F1GA 1YA8A 3T3MF 3FNBA 1DQQB 1JS1X 1G4UR 4PZZA 1EE2A 1EVIA 2XTJE 1MX3A 2IX9A 4GKNB 2PUFA 4L5CA 3OF3A 4ONGH 2IV2X 3JSSA 2FN3A 4JC8A 4BMXA 1AYOA 2PD4A 4FKMA 1NT2A 2F6AA 5I6NA 4XT1C 5DRZB 1LO5B 5CX1B 3EY9A 1RBZA 3AXLB 5TH2B 4CGTA 1G7CA 3RYTC 2XWTB 2GW5A 1GY8A 5GY7A 1N7ML 5FGBA 4Z76B 4QNNA 2R56L 4FEYA 1JEYB 4UU7A 4AVIA 4TVSa 3PABB 2IV7A 5K0LA 2WBXA 1JHVA 5F7KC 1TL7C 3MUOA 3WGYA 4CYMA 1RFLA 1TYEB 3GUUA 3HB5X 2Q76A 4JQXC 4Z6KA 1UJ5A 3NQ41 1UFVA 3GRBA 5C6TH 5DT9A 1Y6KR 1P5FA 3D07A 3JV4A 3IEVA 3VHRA 3H4FA 1E1LA 5A3SA 3IUEA 4GU5A 4BE7B 1MFBH 3DZ8A 1XALA 1FO0A 1Z7JA 4LOUD 3V9CA 4RTRA 2G9VA 3UX9B 4JN2B 1OASA 2KHAA 5I26A 5KUMA 4HX2A 1UXKA 2GTWA 4BX3A 1KAOA 3CZRA 4TWZA 4YLYA 1LDMA 4WA7A 2DIBA 2Y1FA 3ACBA 3JPYA 4XIFA 4F2HA 4DYHA 2QGNA 3B9KB 5THQA 3BPSA 3T1TA 2EIKB 3VWKA 3QWBA 4ABUA 3CYFA 3PPIA 4MKRA 2Y1YA 3DHPA 3EVTA 2IH1A 1P0CA 3HE7A 4LGSB 1CF9A 3AOEC 4ZUWA 4AROA 3N1FC 3FXAA 4PRPE 4J4HA 5B6PA 3QQ9C 1T7YA 5A71A 2ZXWB 5FYKE 2AG0A 4F4JA 2R9VA 1WPRA 2OSVA 4OYYA 1PDKA 5DGIA 4JOQA 1PGJA 1WPXA 4DSZA 2NP7A 4TNEA 5HYFA 1E2LA 2YWHA 3K4HA 1MXDA 1KPGA 1NM5A 3RUGF 3ZXXA 2CFSA 1KDPA 1L9NA 1A2YA 3SFVA 3OIUA 3SO3B 3ACDA 4F2PA 2PBRA 4G09A 4M7OA 1ZZGA 1ND0B 4M37A 1EHIA 3D7MA 3KP1A 4MQ7B 5DKFA 1WS7A 1H42A 3BMCB 1J5CA 3C1TA 1IQRA 3LUHA 1OAQH 3ED5A 4ZAKC 1YS6A 3F6BX 5CIQA 3HP1A 2WB2A 3KAAA 5TDOB 3F7VA 5FBKA 2OCKA 1SPXA 2H2GA 2QGDA 3AG5A 2NY1C 5L3ZA 4R0MA 1C30B 4MQ7A 1V39A 5HS4A 1EYZA 1ND0A 4AMXA 4Y2NA 32C2B 1HDRA 4B45A 4Q82A 3IXMA 1DWPA 4YJGA 5B3KA 1NMZA 2IH2A 3JWEA 2CO4A 5EU5A 3MJWA 4I50B 2NSDA 4ETNA 3TIEA 1WVZA 1KV7A 2W2MA 5HTKA 3ZTWA 5C0EB 4DWHA 3GZKA 1FG9C 1QYWA 1Z2EA 3AMVA 4ETMA 4XBEL 3VVMA 2FWIA 1QVOA 5J3HC 3L6EA 3QE5A 1XGQB 4DUZB 4Y2XA 3ULUC 4RU1A 1BCRB 5KTSA 2X4PB 4PYGA 4ZVPA 4TS9A 4OHYA 2C2BA 1YMHB 2UYLA 2P4AB 4UE6A 4WZZA 1HKLH 2X4UA 1P80A 4JUCA 1PL7A 1EAYA 2N1BA 5IDYA 2UKDA 4G5XA 2W5PA 3GA0A 2NY6C 2G6BA 2I4RA 2ZNWA 3FS9A 4ICWA 3UK1A 2HT4C 2OBBA 2VZ9A 4TZTA 3OIFA 5CKAA 3ARSA 1XMIA 1NRIA 3FTGB 1NQUA 4J0CA 4UTVA 3NUZA 4QU9A 4GWKA 1U1FA 4M4RA 3BYYA 5LP6C 1PS8A 3V48A 5CYPA 3T8XB 1OP5K 4DV2B 4UIKL 4BO9A 1UT2A 2V7UA 3QW2A 3L3OA 3OHMB 2NMVA 1HYSC 4DJJA 4E5XG 5FO9A 4E36A 3AP1A 4DANA 4AAYA 3S44A 3IQEA 3GD7A 2Q4RA 4JBSA 2FRGP 4QVKA 3THMH 3ZTJH 2O0JA 4ZJ9A 2B83A 3OPZH 2ZSWB 2JE8A 3VB9A 4U39A 3DC7A 4RFEA 3FWYA 1Z5NA 3L0OA 4XWYA 4L4YA 2QMQA 4WCFB 1RBYA 3NCJL 5EN2A 2BSEA 5K33A 3OJOA 1C0KA 1V7PC 4NKOB 5IW8A 2QSJA 3GFRA 1HDYA 2Q5LA 4YJ2A 3PFQA 3T95A 4QF1A 3L5WA 4R8SA 1Z26A 5ANMB 3SDZA 4QFDA 2YJ6A 1E0JA 2HKAA 4CT0A 4AK9A 4B6JA 2F53E 1F8GA 5T5NG 1WF3A 1NPNA 4OF8A 5BNFA 3S7ZA 4KRPB 5T1DH 1Q1GA 4PINA 2XCTB 4MQEB 1SUSA 3VH4A 1GR0A 3ZD8A 1H1DA 4OCYH 2VSCA 1PMYA 2FX8H 5IQLA 1FSFA 1F3LA 2HBRA 3RVDA 1QI5A 1CUDA 2GM3A 4Y16A 1WUTA 4PXSA 2WNXA 5I4CA 2YGPA 1J0XO 2ORYA 3SP1A 3BUPA 4BP9A 1YCSA 5DHEA 3SGJA 1GQFA 5A1JA 5LN1A 2B1JA 2CBMA 2B94A 4JO1L 5C0IB 1H4QA 2GESA 4G7YL 2VUKA 2E87A 3SQBB 2HP4A 1ATIA 2R39A 4OB6A 2OC4A 3MINB 1RLWA 1GR1A 2KH2B 5CIPA 2R8BA 2HHAA 3OJLA 1TQHA 2XA1A 4PTTA 5B39B 5B7PA 1L4MA 2XZAL 3MR9B 5CNHA 3BCSA 4D8WA 1T1ZA 1LW6E 3DF9A 2WUCL 3QFSA 2ADFA 3BMWA 5SX5H 2I62A 4QOEA 4YJGB 4OM0H 1QQAA 2V54A 4JR2A 1H2EA 4B8YA 2F53B 3BZEA 4DPCX 4YP0A 5I66A 1A6VH 3WN5A 1MEXH 4UB0L 3PGJA 4OV6F 3C3BA 4BBZA 3O3NB 4OLVL 4ZT2A 4ZYLA 2OY0A 4Q6IA 4MYRA 3AT1A 4L1TA 3Q4GA 4Q1VA 1TKCA 1N7MH 1Z16A 2WSSA 2QX9A 1T3FA 1M83A 1FPTH 3QNFA 3S98A 4TVPE 3GBDA 4HMOA 1EJOH 5LL6P 4BQRA 1N6LA 3OOWA 4FP8H 1D7FA 4I1SA 3WKNA 1E8WA 1SVOA 4KJZA 5IFJA 3C60A 2EBHX 1VKXA 4ENSA 4Y0NA 1DPFA 2FG5A 3KLKA 1NF2A 2C57A 2DU8A 3C70A 3P2OA 1M8KA 2OBMA 2BN4A 3M81A 4GUAA 2E27H 1ZXQA 821PA 3FRPG 3M07A 2PU5A 1CJCA 1P53A 3W04A 1XTBA 1AH2A 2P7HA 5HD8D 2R29L 1S7XA 2H1LA 2YLKA 3MOAH 5AVRB 4X1IB 2Z8WC 4EW6A 4UTZA 2HWXA 1OXKB 3KJZA 4GXUN 2VZLA 4WEOA 5MGBA 3P4OB 5JEEA 4R6WA 5ALOA 5DNDA 1N2HA 1TEGA 2ICWJ 4Y4FB 1I4DD 2ZF8A 2RCSL 3CDGB 5C3TA 4XQGA 1EBAA 2QGCA 4C5AA 3WNBA 1QOQB 3WICA 4TLDA 5T1LD 1YLBB 1Y1DA 3G9VA 3ET5A 4L4VA 4M9ZA 5IG7A 1C12B 1AM4D 3LDBC 5LUAA 2Q76B 2WEKA 4NNJA 4L2IB 4TQAA 3ULVC 3JYLA 4CTKA 2OP0A 3Q0IA 3B6SA 5IMOB 3TKYA 4GF5A 5LP1A 1CEEA 2GJPA 4I3HA 2D3LA 4G8GA 3PABA 3R6TA 1SUAA 3I3DA 2QKIC 2WZPA 1BN6A 1CBUA 2HIGA 3CR7A 3D5EA 1IZKA 5T1KD 4RDQF 3FYHA 1UD5A 1JPSL 2APTA 1U8EA 4QOJA 4M7ZB 3C9NA 5KN5B 3VR3D 3T0ED 5SZJA 2OILA 2JVKA 2W2KB 4M8VA 1CV2A 3QG5A 5E7BA 3D1VA 4ALJA 1QJCA 4YT4A 4TL7A 5FOXA 5FFOA 3D4IA 2HTLD 4R4ND 5ALIA 2BIHA 3QDGD 4J3UA 4AW7A 1FDWA 2HMYB 4GMFA 5I7AA 3RGVD 1VP3A 4JJEA 4PLHA 3R74A 5EJ5A 2RJ3A 3W8RA 1A4RA 1GT91 2EXWD 5ISZB 3W6ZA 1GUAA 1L7EA 5CH3A 5KSAC 4D43A 1N59B 1H15B 3U4BH 1Q19A 1TCBA 3STVA 3PCTA 3LX9A 3L5IA 4XPIB 3PL6A 1TK9A 3RKUA 3TECE 5AZ2H 1E0SA 4W7HA 1BD2D 2IADB 4R1SA 3BF8A 4AQ1B 3I9V1 5DBHX 4WNYA 1I1AC 3EEYA 4WHYG 2ZP9A 2IU3A 2QADC 4JOBA 1JYXA 1YS2X 2X38A 1ISFA 4R68A 1KPRA 4DZBA 4AS2A 2Y07H 5HHPB 3MGTB 2XTLA 3JZ7A 1M72A 4X84A 3RDTC 4IIVA 3NH9A 1CGVA 2R6GA 1GQSA 4F58H 4ETQA 4X9FA 2C3OA 3IRUA 3P32A 4MKMA 4H1TA 5FUZL 2MCPL 3OU2A 3EHBB 1V43A 3A1WA 4PVLA 3AG2B 2AJCA 1QWNA 1FTNA 1NJ2A 1VCIA 1LP9F 2VDNB 1XQYA 1Q0XL 1MRFL 1XWVA 2W37A 3N7AA 4Z7OF 3CGGA 1V8PA 4AJEA 4KKRA 3JWIA 4Y16D 2GAZA 3L1OL 3TN0C 1KTLB 4UQAA 1S7GA 4KZ0A 1S7VB 5DFWH 1UEIA 2J6WA 2VSNA 3V0GA 3TLRA 3I2CH 4OSPA 4JFEE 3X3FL 5E7JA 3CRRA 4HBGA 2WXLA 4Q9LA 5LBSA 5PAZA 1B2WL 5SX4H 1OZFA 1X1BA 2KQNA 3IDFA 2HMIC 3EZYA 2P90A 5AVYA 2PW1A 5SV2A 1Q0YH 2XZDA 4QPNA 5B4MC 1B6DA 4GZLA 3S8EA 4I1RA 2D5BA 5DJDA 1HOCB 1IBGL 3D25A 4POZC 4M6WA 3ABOB 3HC4L 3OO1A 4BNMA 1PZXA 5K9OB 5F3RA 3NIDB 1K8RA 4QRUA 1Y8RB 4XGRA 3L4EA 5FUWA 3X2FA 4BVKA 4EHBA 3I6LE 4BWGA 3RAEC 3N1MC 1ZOOA 1RI5A 1JIKA 3ALXA 4FXGA 2D0PB 2ZKWA 2PZJA 1BEUB 1HYSD 3DVFA 1N2XA 3P97A 2XIIA 3SPJA 3EJUA 2VM4A 5JCZA 4BK5A 4CR7A 1EBUA 4CGYA 3CZJA 4PJBF 3GNLA 1RFGE 2QQEA 4IIJF 4ZQTA 3U2QA 5A1AA 1G6Q1 4HH0A 2RHEA 2BEUB 1CY7A 4B0MB 2VF8A 3DV9A 2BM0A 3PQ2A 1X87A 4Z77A 3ERXA 3KPPA 1FDIA 3V8MA 1EX7A 1LTQA 1U93A 1XCWA 2QG4A 2ARKA 4QCIA 4XCNA 5DXFA 2H85A 4U1GC 3RP1A 1G7RA 1EX0A 3EGOA 4JM2B 4H8WL 1LV7A 1P4IL 2OCAA 3L9BA 4NC0B 1SOAA 3QS3A 4X66B 2W91A 1LDYA 4K9EC 5KBDA 4S0ZA 2EW8A 3AAZA 1UMBB 3D6NB 3SSAA 5EBGA 5KVQA 4L4JA 1KTCA 3AUUA 5AW6A 4Z18A 1O4WA 2EADA 2IOOA 1KGDA 2WT4A 3ETNA 4EMUA 3UBHA 1ZV2A 3NESA 1JUFA 4KNQA 1DZ3A 2J44A 3LPDA 4Z0BH 2EDRA 2JIMA 3KK0A 4YGVA 4P8QA 1MWOA 1ZD2P 1DDTA 5BN3A 1QEWB 2NT3A 2IQAB 3NETA 3L4SO 3X14A 5T3XL 1LLAA 1NGZA 2O5ZL 5DJ8A 5TMDA 1HG1A 4XASA 3VHXA 3IAUA 1R0XA 2POQX 5DHQA 2EAUA 1ZQ9A 2B98A 5EHNA 1EJ8A 5D00A 1N34B 2XITA 5DRNA 3X1FA 2EVWX 5MEQA 3EPPA 3RSFA 4IGKA 3ND6A 1CETA 3BZBA 3LMJL 3HC3L 3RWEA 5IVHA 4BEWA 4LVUA 5KX5B 2O5XL 5A9RA 4NDZA 3UHOA 3ZDAA 4IXMA 4D02A 2JJMA 5I4BA 2XCMC 1I3CA 4ZOLB 2WJYA 3AEQB 1RIFA 3BD3A 1I9EA 4DIMA 3OKKA 4AZSA 1JMXA 3I02B 1DJMA 3U82B 2Z91B 5C92A 1XKQA 1WWBX 1I6WA 2WLYA 5A7HA 5AJVB 3PWSA 1EHKB 3M89A 4PX9A 1FL5A 1P61B 1XIWC 4D3XA 3K9QO 5HQ3B 4CTJA 3TH3T 1FLTX 1RZGB 2D03H 3RB8A 1QDEA 4JAMA 2ZBRA 3ZQXA 3CVHA 1I8TA 1GEGA 3PWNA 1ZHLB 3IBOA 5EWLB 4ZW7A 1P6WA 1VIAA 4MI3A 3KZCA 5I8ZA 4F7MA 2WTMA 3T7RA 3SQNA 1OANA 5MENE 1EX6A 4AJHA 1S02A 5HSGA 1J70A 2OZLA 3K2MC 2EXWC 4EECA 2J12B 1CU4L 1SHLA 4ZJZA 5C7OO 1CRWG 1UYWH 1P3JA 3SCMD 5E6UA 1KBVA 1XTQA 1NG9A 1QZ3A 1GG2A 2Y1KA 3TM6A 4MYWB 4U2ZA 1MN6A 1HNNA 2FPKA 3LZCA 1TQ8A 2HAEA 3W5HA 3CVJA 1JGLH 4UM9A 1EEYB 1R64A 3V7AG 3QEKA 3WEXA 1CZRA 4UVEA 4HDSB 2XMQA 1YJDC 4L1SA 3O3MB 4Z78A 8ABPA 4PJGB 3Q8WA 3U44A 3H4IA 4XXDA 3ZXSA 3O3BA 3ICOA 3K3PA 1NJ9A 1KE1A 2NV2B 1CIVA 3GLHB 4PH8A 1P1ZB 1H6AA 2FHPA 1HKUA 2BSTB 4IJ3B 1D4AA 4FCCA 5E6ZA 4NL4H 4XPAL 3CCCA 4K9SA 1NP7A 3MLAA 2VH5H 3KB6A 5EE0A 4JZOA 3HI1A 3CX6A 3EYOB 2J9XB 2P41A 1YHYA 1FQWA 4ZVOA 5ETUA 5KJ1A 1MT3A 5I8KL 2JFBA 1NBEA 1ZGLB 2EKQA 4ZV9A 2AI0L 4B80A 3IFPA 1LP9A 2PWAA 4ND8A 5LSAA 2BFAA 1USWA 2HJHA 1RKRA 3PNPA 4D0BB 2Z8SA 2C42A 4U4IA 5B38A 4B7UA 4XSGA 2WM0A 3M86A 5B5SA 1PJRA 4DZTA 3GC3A 4YASA 4GJTB 2VMEA 3IFLH 5BMVF 5HGGS 3AUKA 3ZDCA 1WAEA 5I5RA 1NPTO 3TLJA 2VT7A 4H1LB 3EVGA 4W5NA 4FS3A 4G8DA 2NX5E 2A6KA 2JJTC 4YVNA 3FH8A 2DEUA 2RJOA 2O6CA 4KPYA 2IGBA 1GUYA 1KK2A 2HD4A 5E7IA 2WWKT 3OJDA 2QP3A 4C7BA 4G5YA 2E7BA 3EE6A 3SMQA 3OZEA 4F80A 4V39A 4HDIB 3SY0B 4S0HA 4PGHA 2GRJA 4BCBA 5LCXA 1PGQA 5EORH 4K0OA 3LY5A 3LKRB 4RPKA 3ILDA 4U6HB 4XRCB 4QWWC 1NDHA 4TS4A 1FIEA 1EHAA 2Q5QA 4PYMA 1QIIA 1TVBB 3RBGA 3CTPA 5ALPA 2K9UA 2GR9A 3ADKA 4DG8A 2CLEB 3PXDA 3BKCL 5G4KB 3QA3E 2HLFC 2QTLA 1KJYA 1IONA 2BY4A 2E7DA 3AVXA 4DR6B 3D2UA 1RXEA 2G5PA 2VWQA 4I55A 3FZGA 5K0EA 3BMNB 3TFWA 1A9OA 1L5OA 1T0UA 4XM0A 3TS1A 4ZT7A 1FL6B 2Y1AA 1JR3A 1SUWA 3R5TA 1JV5A 1FBNA 1QLRA 5T64A 2YBGA 3SDCA 5I6LA 4M62H 4IDGA 1MRZA 3A0OA 4QRBA 4B34A 1IGJA 3Q3GE 4BKMA 4QUIA 3AHFA 5J59A 1LI4A 4II3A 1AMYA 1M71B 4FFDA 5C09E 2FOXA 2IIBA 3BDIA 2XTJD 4PJ9D 4KKCD 3Q98A 2OHVA 3HFML 2HEGA 1EP2B 1DBAH 1F0NA 1AA9A 5B4VA 2P4EA 1U2YA 4LP4A 3MWEA 3BQUA 4U1NA 1A9BA 2FW1A 4E07A 3VGDA 3EQ8A 2HT6A 1F51E 3QH3A 3LKPB 2VR6A 5G53C 4NOJA 2YXFA 2B4KA 4M0PA 4GQIA 3TD2A 2ZYVX 4IJ5A 5AW0B 2WXRA 3KGSA 4PLWA 1MIOA 5KANI 4XJVA 4AH2B 2CVFA 2VQTA 3BXNB 1CL7L 2BHYA 5DI9A 3N2EA 1N8OE 5DQ9A 3EXG1 5FD8A 3H9HB 4W5TA 1UT8A 1J8HD 3QS2A 1FDTA 3V4FA 2WLJA 2EH8L 1C7QA 3ZZQA 4DP0X 1XA4A 3QU5A 4Q6BA 4KIJA 1HTBA 1E4KC 2DQUL 2DWDB 2FJSA 3V5NA 4N0YL 1CDYA 4TV3A 1S3IA 2V7HA 4AQOA 1OIXA 1A4BA 2ADOA 4JVLA 3SIPA 4OCLC 4D1YA 2QHLA 4GMHA 1HORA 1RI8A 2AABH 4J3OD 1GZPB 4ERSH 3VC1A 3MHPA 4IGEA 2JHAA 3TM4A 4PJIA 3KLLA 5LLIC 1NLZA 3PDUA 3RFCA 4X8JB 2ZUYA 5HI3C 4HBQA 1R6DA 4X6EB 2GFQA 3MJCA 4PJIE 4HAWA 2INGX 3GFUA 3CH1A 1BREA 2D0IA 4EIWA 2NQTA 3B2UD 3NG5A 1C9SA 3EGXB 5KMGA 3DBIA 3RJQB 3V1UA 3E3QC 4ESOA 5DU7A 5HYQB 3DZKA 3WI7A 3T2NL 1RJYA 5AICA 1G18A 3KXKA 4Y5VC 3KAPA 4RD6A 4JFUA 4EHKA 4HLNA 2O72A 3CWGA 3KE9A 4K7FA 1ID1A 3D0VB 1Y1PA 4PG4A 2IBZX 5KW9L 4Y2QA 1RFDH 2BWQA 3ROEA 3G04B 4XM2A 4OUDB 1MVOA 3B9RA 2YV5A 2V45A 2LU3A 4EMBA 4YAIA 3CLSD 3WOHA 5JPIA 1NMEA 2RH0A 5IVKA 4Z7VA 1CQPA 2IKSA 2Q07A 4E9VA 3T3IA 2B69A 3I9FA 4Q7MB 3IWVA 5EXTA 2G0KA 2IFFH 3MNWB 3L01A 1XTZA 1NH6A 1ML3A 2FEEI 1JNHA 2O3SA 4CL3A 5LYJF 4P98A 5D7SH 3TCXA 4P3XA 2GZAA 2JAHA 4TGLA 5I8OL 1DEOA 3P69A 2SICE 1F4YH 1T0NB 1VE9A 3BWBA 4QNPF 5F70A 2CXSA 2AMFA 1K3IA 1TRKA 4DK6A 2BGUA 4QD3A 1CHNA 1YS9A 1KPUB 3GVCA 1DXYA 3IJSA 1RADA 1OX5A 5AW7B 2O14A 3H1PA 4Q48A 4G9BA 2VR5A 4YPGA 5J2TA 1MCSA 1KDVA 2I25N 2CEKA 2XUIA 4DUYB 3LKQA 4Z7QB 1UM9B 1ES0B 2YVKA 3X12B 2NO5A 1EA9C 5FLUA 5EVJA 2H2HA 2P9JA 2QENA 4G6MH 4XMXA 3SC6A 1WKVA 1EAOA 3VTAA 2CGYA 1ODFA 2GJ6E 2QSVA 4RESB 1UM5H 3DGGB 4TLBA 3URKA 2DQIH 3CX2A 2YIMA 3FOAA 5DHXB 1MF2H 2G06A 2N4IA 3M4NA 2F3QA 4M1TA 5LD2C 1L0QA 1AE1A 1ZM7A 3MAWA 2QJDA 3C6XA 3KYOA 5B6JA 2VSQA 4H1WA 4KI1A 1ENPA 3TR6A 2ZUEA 3MTRA 5GJWC 2H06A 1VSCA 4DA4A 2Z8YM 4JUTA 2CALA 3WB2A 2FPUA 2VPIA 1W36C 2F9BT 1H0DA 4O63O 4AM0Q 5KSBE 4FFVA 3MRSA 2O05A 3BP4A 2EXYD 3EODA 2CM6A 4AP6A 2LTQB 1IPHA 3H2HA 3FB5B 5GS3A 1XKTA 4HLZG 5ALSA 1BIIA 3OECA 5JCJA 2RI0A 3PR3A 4HWOA 4J6FA 4L72A 5DASA 2YY6A 2Y7SA 4ENWA 5B36A 2DW5A 4GFTB 4ND4A 4C7VA 5JZBA 1VLVA 3KXDA 4WTZA 1IUZA 5BN4B 1VQ1A 4L4TD 1HHIB 1MI5D 2BFGA 3CEMA 5BJTA 1KMGA 1U8JB 1E4XI 1NZDA 1PTKA 3GT4A 4FYKA 1W7AA 4KG7A 3FFCA 1DO6A 2BGIA 3F2VA 5D7IF 3T3PF 5TE4H 4X6LA 3BS4A 1Q94A 3EAGA 3F4LA 1KULA 3OXSA 3S27A 2VQ1B 1ZEJA 5EORL 4HNVA 4GXQA 1CK0H 1BJ1J 4IQGA 5JU6A 2HPOA 4DV4B 3DBSA 1UP7A 5J12C 2PZKA 5HPOA 4DDUA 4TPRH 4F2GA 2JB5L 2Q3MA 5BVHB 4W5HA 3D2TA 5AW3A 4YQFA 1UEYA 5FBLB 5KKAA 2CQVA 1E0KA 3DSNB 5IB1A 4WJ5B 3NCTA 5L4FA 4DKFL 1VENA 3V7AE 5FM4A 3R4DA 3A70A 4YWGL 4YC2C 3RWHB 4CVZA 4GY4A 4IIHA 2VAAA 1PHRA 4OU3A 3TURA 2HT2C 3MLWH 4OHRA 3L16A 4NI3A 1D1PA 3H9ZA 2R0LH 5FIEA 1D2EA 4P3DA 2Z31B 3DB2A 2J5LB 1J86A 5HHMB 3F84A 1IXYA 2DM2A 1AZCA 5F7FA 1VAHA 3HPLB 1AO3A 5HHOA 2G9RA 1TEYA 2BDEA 3DULA 3OFKA 3PWPD 1WO8A 3HZMB 2AJSL 3LW7A 3STHA 5CVCA 2ENJA 4MMYB 1NGSA 3UTTA 1ZJ4A 4D5GA 3JWDH 2XKKA 1MV5A 1VB9A 1YSOA 3M4XA 2PH3A 1W0YT 2Y72A 2WXIA 3KHTA 1H0HA 3OQPA 2FX5A 3MLRH 4HDCA 4B7IA 1WABA 4KMLB 4RULA 3QWOB 4FXPA 1XTVA 5MEOB 3LNHA 1DSFH 1RQPA 4AVJA 5C0AD 1E63A 1NA5A 2PJRA 4ZUUB 1G9SA 5IW1A 2Y1CA 4NHUB 3UBXI 1EINA 4GIPD 2ODHA 2IS2A 1JNXX 4O2EA 2BERA 3RK0A 3LECA 5SICE 5C3IA 3OFND 4GI1A 1L5KA 2NOYA 4W5OA 3S29A 2DKMA 1S9KC 3M6MD 2VF7A 1YPZE 2NSYA 1NCIA 3UIYA 1RIUL 1DG9A 5FQOA 3S4SA 5F9OL 2G80A 4I4NA 3LUGA 4U2EA 5LVEA 1Z9MA 3I9LA 3DLCA 3DUSB 1MB0A 1M57B 1L3IA 4O02B 4LF4B 2GUGA 4UT6L 4F7KA 4OKVA 3V0AC 4AEHL 2ZSUA 1SU8A 2PNDA 4NCNA 1C3VA 4PG7A 2AXJA 2HJKA 4BRZA 4JLRA 3GFVA 3TO2A 4XI9A 1UDRA 4AMVA 3PHOB 3KL2A 1CZ8H 4M8UA 5JQ6L 2NXZB 1T1YA 5MI0B 3WMPA 3SIXA 1THCA 1UB6A 5CR8A 3ZNPA 3RQ3A 4AZ8A 3OI7A 4PM1A 2JBHA 2Q3LA 5KYYB 3W38A 5B12A 1TM7E 1I1YB 4AMGA 3UV7A 1CVSC 3P9NA 4RNDB 3OZWA 4P2QA 2O8EB 2ZANA 5LFAA 3IXQA 3TJHD 1QQTA 4LAFA 5I30L 2A6PA 3LDBB 1KPVA 2EYTA 2YR3A 2BFVL 2F3UA 2XWPA 1Z08A 4ZCSA 3IEPA 1PFYA 1NN3A 4U3HA 4YB8A 5BW8A 4NQQA 2WOJA 2WNIA 3U4EA 4O4HB 1R2QA 2FB4L 1U11A 2GILA 2HV8A 1K0FA 1VB3A 2DERA 1TCRA 4ND2A 3JT2A 4QXAA 1YUHB 2JAXA 4EFDA 2JD2A 2EXSA 3F5FA 2UZPA 4EGAA 4U33A 3ZWCA 3U6KA 4ZAWA 3FTVA 3Q6GL 6GPBA 1D6JA 2GA9A 3RGWS 1UB5B 2HFFB 3PQYD 1PV1A 1DUZB 2DZDA 3UC5A 4YVUA 5D55A 4MROA 5DEOA 2GKGA 2HG5A 4RAUB 2GF9A 1WBZA 3EUFA 4XNQB 3ZCVA 2X4SB 3H04A 1MG2C 1O5OA 1ZIYA 4RMRA 3GGGA 4UPEA 3RNOA 1T4KA 1VJ0A 4YXWD 1YZ3A 3T7AA 4P2RE 2ZT9C 2YIHA 2JMRA 5SZIA 3O7WA 1XQVA 3DBHB 4MV7A 4AMYA 1I32A 4LLQB 4L75A 4ZCMA 4GMTH 2JCXA 3AUVA 2OG2A 3QVUA 5TF1L 4BO3A 1GLNA 1F3RB 4I3RL 3KQWA 3GXPA 3N40F 5DEGB 1FFXA 2WMNB 4LRTB 4ZDWA 3FKUS 1W6UA 2MHAA 2IEPA 1BX0A 3IDNB 4O2AB 4DC9A 3JWNC 5GGRA 3BVUA 2P9GA 5CMAB 1QRSA 3GT6A 1EVJA 2A92A 5CGYD 3UICA 2OB1A 3DOEA 4TS1A 4KQGA 3WL7A 4L8VA 2HLDD 3EYSH 4IBOA 1LDNA 4MZIA 1BE6A 4OF3A 3OQRA 1FFBA 4B81A 3FH7A 2OMXA 3EOYG 1K9VF 2H8PB 3C3PA 3RVRA 3TQSA 1KH1A 1ISSA 3BXNA 2Z5FA 1UODA 4WO4B 2GKIA 4PY7A 2FSUA 4PXYA 2ID5A 4OCRL 5HK8A 3U25A 2QUHA 1N9PA 1XBRA 1BPLB 1NZRA 2V5RA 4V2CB 5GS0C 5HYJE 1H2XA 5FYJD 3K9NA 4F15C 3PIQA 5DGCA 3QBVA 4RGNB 1ZJJA 4DNOA 1CFTB 3DXFA 2HRRA 4CNIA 2GI7A 4G5ZH 4U1NB 2XZOA 2CIIB 4FQ7A 5JIQA 4KRPC 3TVDA 1I3LA 5AVZA 2IAMA 3H17A 2MCG1 1P6QA 2VQ4A 3OY7A 1SXNA 3SF8B 3VGJA 4URFA 1VHPA 5LNK6 1L9XA 3F04A 3MVSA 1MEJA 2YWFA 5DIZA 3FY4A 5DP2A 1FVCB 1GNLA 2HQOA 1M7UA 5CMLA 1GNTA 3GLIA 1RIIA 2BGMA 3IVKB 3SBWC 2VYQA 3AFGA 4W9RA 4NQED 4FADA 2C9YA 2C8NA 1WS6A 5GS1C 2XMRA 4BHUA 5D2NA 3FTUA 1J0AA 2VO5A 2NW2B 1SXBA 1G60A 4XCVA 2DCMA 5B3LA 2IMNA 1WGVA 3ISTA 3RJ9A 1URIA 3PA8A 4FCAA 4N5UA 2XMBA 4PG2A 1S2OA 3IMKA 1NW7A 3WO4B 3NIFB 1QIGA 1U3HD 2MTAA 1CURA 2BGRA 4C7JA 4TNWK 4NBYB 4R0LB 1LD3A 2CHDA 2EDMA 4HD9A 5E1HB 3ICPA 4LL9A 3D4LA 2GKSA 3CX4A 5KINB 3CSYB 3E9RA 4X7SL 4XBGB 3P9MA 2WOOA 5FNZA 1TF5A 4CM4B 3UPUA 3UBFA 5LD2B 3O3DA 2MOQA 5DK0B 3SY0A 1CGSH 1QR2A 1BBJB 1HDOA 2WM8A 3ZGZA 1T4DA 1C3LA 3O8LA 1WCYA 2CFOA 4YDHB 4E0BA 4PQRA 3HL0A 1VRWA 5IHZB 5D6DA 3QXDA 4BOYA 5FO2A 5LIRA 1FV1A 3NBMA 1P45A 5LMZA 1A7BA 2R8ZA 4BNFA 4DKEH 2YGOA 4JSTA 2VJBA 5EE9A 4X5WA 3PI7A 3NSCA 5T5QA 4E42B 5LKNA 1QSFE 3NAGA 2WQ6A 4OUDA 4D99A 3R8QA 2GIYA 4DCOA 1SZDA 3HZYB 1L5FA 3JQBC 1WBYA 4N86A 2CFCA 1IOVA 1GMIA 5D1XE 3S4SG 3QIBC 2Z1NA 3HUJE 4J0HA 4UM7A 3MIZA 1ZXBA 1N5OX 3AIKA 3OE4A 1JE6A 5I51A 5KMGB 2VUYA 3CLEH 1KMQA 2IHZA 2LP4Y 3KYDB 5EUKB 4RC9A 3NTOA 4C0AC 1CWVA 1SHMA 5LP6F 2DQYA 4OLFA 4DQKA 2NT4A 1C3EA 2XZPA 2XGGA 1ORQA 3SDXE 4OLWH 1KEEB 4WWKA 2NNAA 3DMGA 3I3OA 1XEUA 1WTAA 2CLHB 3P94A 4JYMA 4BDSA 4RF5A 4G6FB 3W9SA 4ZXPA 5IK2A 3NDBB 4Q7DA 3FYSA 3QNMA 4FS8A 3FT0A 4KKZA 2WINB 2RHLA 3ZDXF 3V7WA 1KZ6A 3HMXA 3VFMB 4C56D 2BLNA 4LIPD 5EKXA 2FSIA 4KWUA 5FTKA 3QEOA 1QZUA 3C5ZB 5L3QA 1A0QL 2L82A 5G41A 2CMRH 3UTTD 2CCLA 4DSOA 3ZVNA 4JELA 4G1BA 3FRJA 3GEEA 4CIWA 4ZMXA 5B38G 2BMJA 1U95B 1FZMA 2GEKA 5JXIA 1FRGH 5FUZH 3ZT6A 1L4YA 3FQNA 1TQDA 4HATA 4X4ZA 1ZA2A 3NPSB 4BDVB 2EQAA 4DLBA 1T1JA 4LEOA 5B3JC 5AK4A 4HKBB 3AEKA 1J90A 4X1KB 1BJ1H 4NQRA 5THXA 3MRKB 3I0MA 3QWFA 3HB4X 1PJLA 1M3JA 2FL5A 2WNWA 2G3ZA 4HGWB 5IP4A 1GGNA 4LVCA 3TZKA 2PT7A 1N2IA 5GJTL 5KSAD 3T5GA 5CLFA 5M7QA 1Q4NX 4JCWA 4QPPA 4BSWA 2P52A 1BOOA 3SCMB 1UCFA 2PWDA 5H3LA 3GJ5A 2YC1B 1N2OA 3LNGA 3G5TA 1RZIB 3U3OA 5JJIA 1WLSA 1E2QA 2JXMA 5EZYF 3R77A 1UMKA 3FGOA 1E27A 1NUSA 2XA8H 1QVVA 4TOIA 2R6DA 1ESEA 5F3FA 2CCKA 4HDMA 5FJIA 3AYXB 1E42A 4FLFA 3SXJA 2V58A 3T54A 3S37L 3US1A 3FTNA 2CZNA 4J2TA 5D1QA 5ADOL 4RHUA 3QDMB 4N0QA 4UFNA 4GG8B 3GLKA 3VAZA 3F85A 1JHRA 3QPVA 1H9CA 1TQCB 2YRLA 3QYJA 2J8UF 4WIQA 2QWXA 3TO4B 1D6NA 3WMEA 1IM3B 3G8CA 4NUGH 2AV7B 3AHGA 1FFHA 2Z9DA 2XXCB 5JMTA 2Y27A 3TT1H 5EZ5A 1HURA 3RYHA 2R7EB 4HWBA 4DWVA 1WD8A 4Y6GB 4ZXBC 2VPYA 5EUMA 5AJHA 5K09A 3W0WB 4O2BF 1TC2A 4AKTA 1Z8HA 2EE3A 3GDOA 4BXVA 2WIGA 4UTPA 4M21A 1AXIB 5HZGA 1G5TA 5IC5A 3UJ3X 1FNEB 1HWHB 2I26N 5DFVD 4AG6A 1MIEL 2CW5A 4X8HA 2BDNL 2ZCVA 1TTPB 3MGOB 3F7OA 3W9UA 3TRHA 4LCCC 1ZK4A 4DYVA 2WMPB 3OMIB 5IF0A 5A2BA 4EVNA 1E79A 5HJ3B 1Z7WA 4MB6A 2OLJA 4MRAA 4BFWA 4GGPA 1ULBA 3UXEA 2ZJAA 4DP7X 4E5XA 4BEJA 4RLDA 4MNQB 1F45A 2BVOB 3MNDA 4JL1A 4YHML 1DBRA 4AIZA 4E5DA 1UJ6A 3IDJB 4ODSL 3F6CA 4R1QA 4L4XA 1T2NA 3ROKA 1ZGLA 2E9WA 4FE9A 2Z4RA 4K6GA 4UBKA 3IERA 2JFUA 1G7LB 3CW2A 5JBNA 4IIYA 5H0IA 3GVHA 3O3EB 4MZXA 4K86A 2X44D 2PKEA 1NATA 3C43A 4OFWA 4DY4A 3AG4B 3GSXA 1WZLA 3ESUF 2Z83A 4G0UA 2VJDA 3E7WA 2G4VA 4ZZ1A 2D54A 1QBGA 2OV4A 5BRAA 4RVUA 5BMVB 5I18H 5I1LB 3DUFB 3DVRX 3RX7A 1ECCA 3VNYA 1LBEA 2VISB 4YE0A 1U63A 2NYKA 5AM4A 1GXSB 5AB2A 2LAGB 2HMAA 1FXWA 5KYVA 3RSLA 1QKKA 3NVMB 1UDXA 1J06A 4JI7B 4IKOA 4XO4A 1BLIA 4J28A 2D03L 3QDJE 3JWJA 1VHJA 2QE6A 1IK6A 3T8YA 2R0ZL 4JZKA 3HKCA 3QDJA 4F5DA 3L6FB 2V17L 3TNFA 3R6GA 1QSVA 1R0KA 5A5FA 1D2CA 4ID9A 3OHXC 5I1HH 4KPHL 4A2QA 1Y6MR 4IDJL 1O0VA 3QR0A 2Q3EA 4ITRC 1NX6A 1EIZA 3TLCA 2O2GA 1CS6A 4UC0A 2W8ZA 3BW9A 3D3QA 2FGWH 4U1RA 2VUSA 4H3VA 4PPQA 2XD9A 1OSNA 2FWUA 3TIVA 2O5RA 3TR0A 4QREA 1ECLA 2DG2A 2IYRA 2H1OA 3JV6B 1EO5A 4LVOC 4G5SA 4MKXA 1THAA 5KSZA 1RZ7L 4LLUB 3EZ6A 1TVMA 5FP0A 4QHKJ 3WIOA 1UR5A 2PQ0A 2RAMA 4WHCA 3HUFA 3RNKB 3ER8A 3V5HA 1UD2A 4IBUA 1FO0L 4BO4A 3U4HA 1QFXA 2A9JA 5H8DA 5DDHA 4WFED 2BSRB 1IIRA 2MMXA 5H3CA 1T5DX 3LG2A 3SZRA 4OI8A 2HGZA 4AJYV 5AVUA 1JPSH 4Z0TA 3HLTA 4CMCA 3GRZA 4PZPA 2AQRA 4JZNB 2CNNA 3WTBA 4IL5A 1AE6L 3M8OH 1UACH 2ZKHL 2JIXB 1SO8A 3EVAA 4CL8A 2ZCHH 5IFHL 3QEQE 2J21A 1LDSA 3MGAA 3TNNA 1NFIB 1UGKA 5H7XA 3Q5DA 2QN1A 1NHWA 3DJTA 2PL9A 4I6EA 3AITA 2X10A 4L5FE 1WPQA 3LDFA 1SQ5A 5EU4A 3GPSA 5AVWB 3X1BA 1EUDB 4DC0A 4X83A 1PR4A 2P5WE 3BDAA 3QOYA 4P2OA 5K6AC 4DMFA 5ULLA 2C2ZA 2J9ZB 5L2KE 1SXJB 2WGNB 5EOCJ 4CBZA 1AI1L 2ZCLL 2WRZA 4KU4A 5K69A 3EF4A 1HV8A 2VHXA 4JEIA 3MRRB 2J4WL 4O2LA 1WP9A 2AKAB 1AQDA 1N5MA 1X0XA 4RAOA 4WNCA 2Y7MA 3WTWA 2P11A 2FPXA 5G4NA 5A03A 1JN0A 1IM9A 2D1RA 4IXDA 1XNGA 4FYMA 2RGBA 2HYIC 1MFCH 3BC9A 5FRDA 4GP4B 3SHSA 5IJWA 1JB1A 3FVQA 1JZEA 1E9PB 3NWBA 2J88L 1W73A 3R19A 1M74A 1Y6JA 1CXFA 4G7QB 5AKIA 4LJ6A 1PVHA 4UE3S 5EJ7A 1FRNA 4Y1EA 4OZIA 4ZT1A 4WU7B 1P6FA 3P3RA 2OCXA 4C0WA 3PD0A 5DGXA 1NLDH 5GVRA 4EI9A 2EDOA 1GJUA 3K8ZA 3HUJB 4HN9A 3JQGA 4UE2A 1R9JA 4KXZI 2LVBA 5FOTA 4X1IA 1WUKS 1REQA 4KQKA 4B3EA 2OV8A 3JY6A 3X1KA 1X9HA 2XNSA 3FTYA 2ZICA 6Q21A 4E41E 1EZVY 5T8IA 1AGRA 2BE7A 3MLYL 2QT0A 3FT3A 1SCUB 3EW7A 1L7IL 2N7SA 2RFXA 1PG7X 5H2BA 1W1WA 4MJ3A 1AGYA 2IUFA 1CFBA 1EXNA 4Q89A 4YDQA 4X6DF 4UANA 3V8EA 3VDMA 2PYEB 2P91A 2K6YA 2FPOA 3Q7EA 1L3BA 4CV2A 1UXMA 1O9WA 1FYVA 2ZIGA 4X60A 3NDPA 3CCBA 1ORVA 1QPGA 1OPGH 3N42B 3MRFB 1Z13A 4PC6A 4XSHA 2CRZA 5D85A 4JI0B 1QIMA 4RPHA 4MA1B 3N0TA 1R3JA 5HCNA 4FQQA 5E2TH 3IUQA 5L2KB 3VV2A 1U92B 2ICWI 4K9OA 5AESA 4J23A 2UZXB 2IPTL 2FX7L 2UZ3A 4ZAGA 4DDKA 1I4WA 3QXTA 5BZXA 1ISPA 1LK2B 1W19A 2ZI7A 3OQ1A 4OCXL 5AVSA 2BGWA 5KSBF 5FYLH 1KQFA 3HHMA 5KSVB 4J3NA 1SK8A 4DEXA 3C8DA 2M6SA 1FZMB 3REVA 5I7HA 1VG8A 4P7BA 2CJWA 3WWEA 1MWAH 3KU4A 3RU8L 4RVCA 3DEFA 5KTOA 4J2OA 1IL1A 4AUJA 4L3CB 3H2YA 4IOLA 4UAOC 2IPKB 5B7NA 3UZUA 5FA3A 2RG1A 3N1UA 3UQYS 2R69L 5BZWA 2CBOA 5KTPA 1KIUA 1SYVB 2BD0A 2FNAA 3PNKA 4AZ0B 1T24A 1K5DA 4JY4B 3TAHA 1HSBA 4DRXB 4UNIA 2JRCA 2DECA 3ARFC 1IGYB 1IQPA 4BIMA 3N2ZB 5JQWA 4GYKA 4DZBB 1D6SA 1CJKC 5LA6A 3MXVH 2OZNA 3DRQA 5I5GA 2YA2A 3FXIC 3BJ91 2VZVA 4HAOA 3P4LA 4K15A 3M1LA 4OZ4B 2WBJA 4P04A 4TSFD 3DT8A 3TGXA 4U7PB 5BQFA 4GNKA 1RP7A 3BWMA 4GKZB 4F7PA 1I7UB 2WYWA 4O0MA 2RGRA 3D4NA 3L82B 1KVRA 2WYTA 3F64A 5ISZA 3KTDA 1T2AA 3W2DH 5JDSA 3GBML 1IFXA 3NFNB 4WDIB 3A67L 2F3PA 3A4NA 5DJ2B 3A28A 4CV1A 3SJCA 3BHIA 2Z5LA 1TVEA 1HNGA 2EIEA 5J12B 1NUGA 4DGYL 3BFXA 4Q74A 4CMHC 3O2DH 3WE7A 1NC3A 1YC2A 1RAMA 2RD2A 3ESQA 3C14C 3QUMH 1GRNA 3K5HA 3F3YA 3WUWG 3PHQA 1JEJA 2VCEA 3NJVA 4J7AA 4NKOA 4ECEA 4HU8A 2B36A 3H11A 1N68A 3S3BB 2GBGA 5CFNA 4UDUA 1J1UA 5TQ2A 5HCIA 5DT1L 1V5IA 3HR5A 4A82A 3H9JA 1BVZA 3LLUA 3V7MA 3HDGA 2X4NA 4JQYA 4XR4A 3BEWB 4MXWH 4R90L 1C8VB 1T2VA 3WE6A 1KTBA 1TT5B 5FA4A 4OV5A 5DBEX 4EAAA 3CV3A 3V1KA 3GSUA 3MRBB 2ZRCA 4YR9A 2OSXA 1F2VA 2DUWA 1G38A 2ECPA 5I8OH 4M4RB 4ZOQI 1FORH 1HRDA 1TA9A 3SX2A 1FG2B 1NV9A 1I7SB 1X1QA 1RXYA 5TFSL 4EQZA 1KAEA 4LSSH 4FFPA 4UVIA 4L4SA 3IMVA 2O2DA 1U3HB 3C75A 1E5LA 3ULSB 3OUUA 2VQFB 3ZDWA 2H3HA 1J0ZA 3M7OA 2O6EA 2Z34A 3IQHX 2EEDA 2VHCA 3UENA 3CD4A 4OZFH 4K26A 2OR3A 4LKXB 1R5BA 1QNZH 3GJTA 1EM8B 3VJMA 3C8ZA 4B95C 2JGNA 4GPVA 3CJRA 5F33A 4U0RB 1O95A 1P18A 1E7YA 4IJUA 1MCKA 3OZSA 4BO5A 4W5WA 2WPGA 1D07A 3O8NA 4U6TA 3DDNA 3LWBA 3RS2A 4QLBA 2GNPA 5EU5B 3L04A 1HINL 3QUZB 2IFFL 4HXGA 2HU2A 1ADJA 4XPTH 1MB4A 4ZT5A 3U9LA 3O11A 4BZ2H 3G1TA 2FX3A 3TX4A 5DS8B 4M83A 3UPRB 1HYHA 4EUPA 3NVAA 3U7QB 5ALXA 3PGCA 5J1SB 3GLAA 3B56A 1VGKA 3LP6A 1J23A 4INJA 3OF5A 5GQBA 3M4JA 2C7OA 4LV6A 1BPVA 4OB5L 2FLVA 4TSBH 3VYOA 4TLCA 3F3SA 2OL3A 1RIHL 5EO1B 1KGUA 2CV1A 1T6NA 5BRPA 3PQYE 2ZJYA 2B5VA 3QUYD 1J1XL 2WNKA 2OXEA 1FP4A 1R8SA 1OU0A 1T1ZB 5HBRA 4XMVA 4GRLC 2Q3FA 1YJDL 3CMGA 3EXHC 1Y7VA 1A7PH 4R97C 5BUGA 3C6KA 4WHTA 5F35A 1XYYA 2MT9A 4TVSA 2EATA 2XHEA 2EWVA 5F1NB 1H2RS 3DTDA 4X9IA 1HRKA 1NBHA 2HJRA 3WMSA 3CT4A 3FD8A 3Q10A 1FSGA 4LEXH 2PUDA 2F1BA 5B2ZA 1AR2A 4EMSA 1MO4A 4HS8H 1VG0B 3CNNA 4HISA 4E7OA 4AOFA 3D2CA 4FEGA 2VXVH 1XQXA 2C77A 3AS2A 2IGFL 1XRPA 4WJLA 4MV3A 1QHHA 3ILPA 4QTHA 1M2FA 2AQIA 4WNJA 3GHYA 1DBKL 4D42A 4IRSD 1WITA 4Q34A 1C0IA 2PRKA 1IY8A 2EL7A 3GBSA 2CK3D 1CFMA 4AUYA 4FGKA 1A9EA 3Q5EA 3HR6A 3E80A 3FUXA 4MWFB 1K6IA 1S7QB 3KLHD 3AU1A 4KDTC 4XNYH 2FQWA 1TLMA 2X3FA 3HAEG 3OZDA 4HFMA 5CLHA 3AROA 4Y0AA 3WVNA 3NPAA 4F60A 1SIBE 3TVMA 3OJXA 5A6VA 4F9GA 4DHEA 2CUNA 1BKSB 1OPGL 1YQGA 4ZAZA 4MRBA 4PSDA 5C8XA 3Q5GA 1TJNA 4Z2YA 5JHDA 1RRMA 3S5YA 3K71A 1WV1A 1GUDA 2V9ZA 3MMXA 2IWFA 4X7EC 4F04A 2VOEA 1LO3L 4MX7A 1D7AA 2C2OA 1T21B 3IMBA 3PDDA 1L8OA 3RSSA 3SYPA 4AX4A 2AI2A 2BHFA 3QW9A 4HT1H 1ORTA 3WNJA 2V7WA 1F4XH 2GA8A 4DUPA 1XMPA 4A1RA 3INNA 3TBSB 4NZ8A 2DBZA 1SLVA 4UIMA 5F7DA 4PRBB 1JSRA 5U1PA 2Z09A 3KKZA 5FPPA 4PGEA 4KQ2A 1AZBA 4A9AA 3T4PA 2OULB 3HXLA 4OQFA 4QXGH 3M6IA 5D8DA 4IHJB 1W94A 4NZFA 3QHFL 3ZE1E 4GKSA 4M4PA 2G36A 3SEAA 2PSEA 1Y7IA 2HA5A 1JXOA 1A72A 4B3IA 3C5EA 2APJA 1NVVR 4P4KA 4IHQA 3MBOA 3T1YB 3A9CA 4JB9L 3LYLA 3G5ZA 4RA9B 4RFSB 4QXTB 3BVWA 1FBIL 3APNA 5FFMA 3KNBA 2JEYA 3B2QA 4LZJA 1TMOA 1KELH 5AJTA 1L7QA 1USVA 2LU7A 3HCCA 4F27A 4DSAA 1UZ8A 5GZ1A 4OZFG 3H42L 1MW2A 5BY2A 5DISB 4ZI3A 1DDHB 1E3WA 5H35B 4HZ1A 1EI9A 3VZCA 3IVKA 2J8OA 3T34A 1AQMA 5DURB 2BHNA 3LFTA 1RQXA 1CZ8L 5JQ6H 4OAPA 3HK2A 1Z7YA 2WZQA 4HSGA 3OQHA 4S2SB 4ZS7L 4MA4A 4V0QA 3ORHA 1Z12A 1QF6A 3HLYA 2HWKA 3BRFA 5TR9A 3ZQUA 4N5DA 4Z7WE 5C7ZA 5A04A 1C9NA 3ND9A 2V2XA 4QRPD 4KZCA 3PHGA 4RKWA 3NV7A 4JJIA 3NV9A 3QUML 1FNDA 4HADA 1YJAA 2JGRA 4DLSA 1T83A 3M17B 2IEDA 4EI5D 4RCAA 2V7TA 3UMFA 1JQJC 3ZKSD 2HXSA 3ZPDA 3STWA 3H0CA 3L1OH 4QEGA 4YRGA 2Z9BA 4YRKA 4F85A 4C55A 5E0OA 5JW3L 1RAIA 1AUQA 1EBFA 3MUZ1 5EKDA 1D5ZB 4A2GA 1O6VA 1I8LA 3U4IA 1A4IA 3QYPA 1UWEH 4U3CA 3C08H 4AS1A 3O0RH 1PIFA 1OKKA 4EPWA 5GIRA 5LR6A 5IAEA 5K8CA 3KPWA 2BFMA 3AM5A 1ZY2A 5ELXA 4MGXA 2YEZB 4CF3A 4MA7H 1JE0A 4B43A 5DTMA 1SXIA 2FWSA 3JVIA 3L77A 1KK1A 2BVPA 2TMDA 3WLOA 1S2IA 3FTXA 4JU9A 3NHAA 5BOVA 4J1NA 4KY2A 4IG4A 4HUXA 1NGXA 3OXRB 4DQDA 4PJ5A 3E18A 2FN4A 4CGUB 4N1AA 5KVGE 3DV4A 2QE7A 4PGMA 3DDFA 1R4MA 2IDKA 4JGGA 4JO3L 1U91B 3NDJA 1YEGH 2IS1A 3IDMA 4RCYA 3CFMA 5AKLA 1TEXA 1TTRA 2QSZA 5L2JA 1ORDA 4FCVA 4NZUH 2CMKA 3HA5A 3OX3A 4FHDA 1G0OA 3AJEA 1WFTA 4TYYA 1U8JA 1P5ZB 1M05B 2R6ZA 3FMGA 3SEQA 2G5GX 3KDMB 3RYCA 4DEPB 1NICA 5HYVA 2W2PA 1NYLA 3QLVC 2WKLA 3DBXA 4J07A 3R09A 3K1ZA 4TQIA 3TDKA 1SDAB 4LRIC 1E8XA 5IOPB 5KJ6A 1KI4A 2OK8A 1J2RA 1WETA 1X80A 5KYXB 3KPMB 3GMOA 2XQ0A 1A5FL 3BP4B 4N6GA 4L4RA 4C8XA 3EZFA 1OWRM 5T3UA 4MVCA 2XCSB 4HSQA 2N9UA 3TBVB 1RLIA 3VQ1C 4LCEA 1VFAA 5DF1A 3LN5A 4LHYA 1KVTA 3UEOA 1SCKA 3HE6A 4EFLA 5FPTA 5FF9A 5C0BA 4PZLA 5LJIA 3AKYA 2QW8A 1UCTA 4M89A 2D4HA 4PJAE 2R11A 4LW8A 3A6GA 3MZGB 5DJ5A 3VPDA 1XH0A 4ZS6C 3D0QA 5D1XA 5FGCE 3WXMA 2MSPA 4KK9C 2AXHA 2YD5A 3A32A 4ENQA 1ACZA 1IO4C 3KL3A 1W0JA 5L8JB 5JS2A 3TGLA 4YHPB 5ALYA 3TZVC 2P3QA 2A0KA 4U3XA 4YPGB 2VLJB 3EEIA 2O5NA 4B73A 4BH7A 5CLIA 5E0QA 1J87A 2QL7A 4L4VE 3ELYA 4HXAL 2IQ9H 3ADBA 4C2TA 1SXJD 1QK3A 3PVCA 1NP3A 3JQFA 1V8HA 4ZK6A 1LJMA 4NQVB 4MVJI 3LJ3A 4NWUL 3SZUA 1TR7A 4YROA 4XJSA 4U4AA 3LX4A 1LPOA 3GWZA 2FSGA 1ZTXE 3FQXA 4R7GA 1SGKA 1NSTA 1KI3A 3KYMB 3GI8H 4N0UE 5I74B 4P9HC 2JKNA 3MTBA 2Z3ZA 3OTWA 4BWTA 1YE3A 5CJQH 1OFHA 5JORB 3AK4A 3F6IA 4HF5H 1HDCA 1N2ZA 4RAQA 2IV3A 4D56A 2AXGA 3RBXA 1EAPB 1A7KA 3FG9A 3ZV3A 3P54A 2VXCA 2W9XA 3HOGA 4QLWA 2OMEA 4YMTA 4O1HA 4JRXA 2NW3A 4DXHA 1N3BA 3CCFA 3DXAD 1FWXA 3I50L 1A27A 2VS1A 1ZVQA 4D8YA 1KC5L 3FO9B 4GVXA 4ADIA 1SLWA 1OSPL 3KSUA 1D5BA 4KDCA 3SPVA 2R6HA 3VI4A 5FGBC 4MDIB 1XF2A 4ER5A 4YEEA 3G88A 4I2XA 5CT9A 1JHXA 3CRQA 5ESVB 1N6KA 4F2DA 4AKHA 1JHTB 5EMKA 3VI3F 1AKQA 3EDYA 4KNTA 1AJ7H 4DREA 1OLZA 4LJ9A 3DETD 2BCKA 2EIJB 3MQIA 3MELA 4IMIB 3SBDA 4WUKH 1IPEA 1L0PA 4GWLA 4WGKA 1FJGB 2HT1A 1KTDA 4MDFA 1Z5WA 1U30A 4K55A 1HHJA 3S7GA 1JKIA 2BNUB 2PCPB 1ETHA 4K9RA 3T5BA 3GJ7A 3OZBA 1W4RA 4PS7A 3EDKA 4PJDB 2C3HA 1FZJB 4L8LA 4E9WA 1TW2A 4KZDL 2V6HA 1K5PA 5D5MF 3SKNB 1IQDA 4NCBA 1FC0A 4DESA 2WXPA 1OKKD 4UUMA 1EPUA 2WZDA 1UUNA 1JI3A 1V9LA 3LFHA 4ZS7H 3WKMH 3VWKC 2LUOA 4UBNA 4QHNB 1PKOA 2X58A 1BFVH 3FSGD 2HSIA 3ARWA 5A7BA 1CRLA 1M6HA 4D0NA 2AI3A 4KKLC 2XXJA 5E4EB 3L7OA 1ZA6A 3QFJD 1JQ5A 2JB6B 3C6YA 1WVMA 2DBRA 5E1BA 4BVGA 4Q6WA 2BJMH 1JSYA 2V7XA 1DJPA 4JX0A 5C71A 1OGAA 3I23A 3UTPD 2PIDA 2IWKA 1FQOA 3QDHA 4H8PA 3QLTA 1PLAA 3AY4A 1U65A 2W9LA 1XR9A 4RGND 4B6EA 1L2TA 3K2IA 1MFEH 5IW6A 1PSDA 4XB8A 4L8FA 3CWQA 3H56A 2WTRB 2VPWA 3JVEA 4ZAKA 2C1OA 4OCNC 3LEVH 1BFKA 3GHEL 1CUJA 4UQPA 2JBAB 5GGVL 3TI9A 4O4LB 1C7SA 3DKPA 1F0LA 4OFBA 3IUSA 3ZGYA 2RBLA 5EG5A 3FO2B 5K0GA 1PL3A 1B0RB 3UJDA 1EWYA 4Q4AB 2P68A 2REXB 4O58H 3ET4A 1F0KA 3F5WB 1W72L 2KLRA 3BMNA 3LZPA 1KTVA 4IDNA 4MR9A 3CMMA 3T0EE 2H7VA 1Z4LA 3SOPA 4CQMB 4P0DA 3UC9A 1JIIA 1M1YA 3DAGA 3S37H 1TGVA 1JLSA 3IIIA 5AW7A 2DB8A 2QQKH 5CG1A 2WANA 2WVUA 3K8KA 1NV8A 2R6CA 1KDZA 1IC5L 1DNPA 1DQMH 3EOBI 1CYWA 4DE5A 4HNSA 2XQBL 2VYVA 3MUJA 2F18A 1YQVL 1J97A 5EEYA 4NYJQ 1ZBQA 1TIUA 3S3CB 3V9FA 3PEWA 2XVLA 3ETCA 1KRHA 4UHEA 1XKXA 1MRDH 5AI0A 2AOTA 4PU0A 1JUDA 4HXYA 3K2KA 1DEEB 2C34A 4PGCB 1AXSB 1FGNL 4CM9D 2OX5B 2WHRA 1WH0A 4EELA 2W95A 4GT1A 2WM9B 5EF3A 2J08A 2KS0A 2HT4D 1J8QA 1RE0A 1B7GO 4NO5A 4JO8A 5FCUH 3RWMB 1RLTA 3AINA 5ERXA 2VJYA 1Y07A 2YAHA 1W0JD 3HR8A 1TENA 2I60L 4G1EB 2EJVA 3QVLA 2RQEA 3HXPA 3E6HB 3QEQB 1A1SA 3CJJA 3ZYJA 1KV3A 4K71B 2G88A 1RCFA 1Z5LA 1FSKB 5FO7A 2BGKA 2P5PA 2EDNA 2MKLC 4ALKA 4KK9D 2NTFB 1UOLA 3TPCA 2ZWZA 1OLUB 1XYVA 8MHTA 2VO1A 3F47A 1MQKL 3ZU8A 1DFGA 4IUDS 1TDJA 4PMFA 6TAAA 3OT1A 1AGEB 1U2EA 2R6FA 2ZCKL 3MRQB 3SYRA 1X14A 4N0YH 5HRCA 5IUSA 3W1EA 3DP7A 1QPBA 4E5NA 4H4NA 1P5UA 2XOXA 5T6MA 4DSUA 1KP2A 3GEWB 1S5PA 4BSVA 1CUXA 1WT5A 3B2MA 4K0RA 4F4IA 4X6EA 5FF6A 3TMYA 4G36A 3H7BA 3OB8A 3AW9A 3O2DA 1M1NA 4JO2L 5CPFA 2XFXB 1UIMA 4HXFB 1U2CA 4HWBH 3NDIA 4IQFA 4Z5RA 1FXSA 1UL1X 1KZYA 2EVIA 1SOMA 1AZSC 2WGXA 5FM5O 1E2ZA 3EXIB 4B27A 3VXRD 4M7LT 2WQRA 4GRWE 1LPBB 2B59B 2GPAA 4OHZA 4MWDA 3GP8A 4B97A 2XF2A 5FXMA 4G6FD 3ZLTA 1Q21A 4Z78B 3UJIL 1V96A 1NMBL 4N2HA 2TAAA 1J8FA 1KJ3L 2PWEA 1GU0A 4AB1A 4Q19A 3BLPX 3OIGA 3GDCA 1MIEH 1BD2A 3Q13A 4L3WA 2HQBA 2BVYA 2Y2UA 4RTMA 4J9UE 4X94A 4TM7A 2I87A 1Q17A 1XXFC 4RQQB 4OD3L 3O8BA 1RUMH 3UPTA 3NH6A 3VVBA 4PONA 2A9OA 3T3NA 4JBHA 4L95C 4QHUA 3DROB 1HZJA 1AANA 1ROCA 1Z17A 5BV0A 2QZJA 4LZZA 5DSCA 3VHQA 1Z6ZA 1J11A 3MFYA 8AT1A 2Z6VA 4F71A 3DURA 2PPLA 2PS1A 4U1KB 1XCTB 5GRUL 1JG7A 1EFQA 4IBTA 1A7OL 3U0BA 1V8DA 4AY0A 3U1VA 3IXLA 3FB7B 3NCJH 5DGQA 5SX5K 1JI2A 1AZUA 5I1KH 3KCPB 4PJ7A 3IDAA 3Q3CA 3VD7A 1VTKA 3Q43A 3IQGX 5EA0L 3DTYA 3DEYX 1F3JA 3NAAL 3QNXB 3SD7A 5EF2A 3KLAA 1EE1A 5L4LA 5BYAA 4OXXA 5K0BA 4QDJA 1Q72H 4L0QA 2DV6A 3KPLB 2B4CC 3BGFC 4ONGL 2D3VA