2BP0B

M144l mutant of nitrite reductase from alcaligenes xylosoxidans
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGLSGTLMVLPRDGLKDPEGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Structural Studies of Mutants Provide Insights Into Catalysis and Electron Transfer Processes in Copper Nitrite Reductase
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
total genus 87
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2005-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00394 Cu-oxidase Multicopper oxidase
B PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bp0B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bp0B02
2XV2A 3NSFA 3RYMA 3WNIA 4DP5X 1NTDA 1E65A 1WA2X 1BEXA 3AY2A 4A67A 3NJIA 4BWUA 4A68A 1SHXA 3FT0A 4P5RA 4A2DA 4DP9X 1URIA 1JZJA 1L9TA 2PPDA 4W9ZA 1PAZA 1KCWA 2DWTA 2XLLA 2XX0A 3IE9A 3NSYA 3QJUB 4YSCA 4BXVA 1KGYE 4KNTA 3ABKB 1TEFA 1JZIA 1FWXA 2HX9A 3D12B 4ZK8A 2BO0A 1NIEA 3FPYA 5I26A 2UXGA 3X1GA 1TU2A 2BZ7A 4KNSA 1PNCA 3BQVA 4WTQA 1AZRA 1PMYA 3MBWB 3ABMB 2FQFA 1MZZA 4E9VA 1NIAA 6PCYA 5AKRA 3FSAA 2VW4A 5I6PA 1J5CA 3OMNB 1HAWA 2FTAA 2OJ1A 2IWFA 1ASPA 1JZFA 1MDAA 4JHUA 2IDUA 2TSAA 1GS7A 5B1BB 3CVBA 1AS6A 1CYWA 2Y69B 3FU7B 4YSAA 2PPFA 3UGEA 1J9SA 1AR1B 1L9QA 2VSMB 1FA4A 1PCSA 4KNUA 3UABA 3QPKA 4WKXA 1NIFA 2FQGA 1NICA 1A4CA 3X1NA 4E9RA 4GY4A 1JERA 1PLCA 4KO9A 2EIMB 4MFHA 3T71A 4NAJA 2HLEB 1AQ8A 1BAWA 4G70B 3TA4D 4JKNA 4YSRA 1KDIA 1IUZA 3FU7A 3ASOB 3T6ZA 4DPCX 1DYZA 4E9WA 1WAEA 2DWSA 2VMJA 2UXTA 1NWOA 2Y1AA 4KOCA 1SDDB 1E5ZA 1J9RA 3H56A 5PCYA 1EZLA 1A65A 2XUWA 5AZUA 1ETJA 2BHFA 3NJMA 4N4YB 1ET8A 3TASA 1W8EA 3PAUA 4L0PB 1VLXA 1AS7A 1XB6A 3FPXA 1A4AA 4DP4X 2HZHA 5B7MA 2PPAA 1AG6A 2NRDA 2HRHA 3NJHA 1W6LA 4GYBA 3ZBMA 4BDVB 3KW7A 3S8FB 3GYRA 4RH4A 1SF5A 4M4RB 2TSBA 1BQ5A 4YSSA 2FT7A 1QHQA 4GP8B 2IWKA 2PPEA 4YL4A 4AKQA 3CZUB 3OQRA 5EHFA 2QT6A 5AFAA 4A66A 2JXMA 9PCYA 1OCZB 3DKHA 2FQDA 1SNRA 2CALA 2HRGA 2YAHA 4GXFA 3TBBA 1BXAA 1NZRA 1KBVA 3AW5A 2IWEA 3EH3B 1ID2A 3UACA 2HXAA 4AZUA 2FT6A 3JT2A 1GW0A 2WO3B 3N55A 1JXDA 1WA0X 2OV0A 2XXFA 2CAKA 4P5SA 4YSUA 1NDTA 3AG1B 3TU6A 3OD3A 1RKRA 3X1EA 5I6OA 1JXFA 5D4IA 4NB7A 4E9YA 2ZONA 1L9SA 1SDDA 3UAEA 2EILB 1A4BA 1L9RA 2UX6A 3WIAA 1ZDQA 5I5IA 1SFHA 1PZCA 1JZGA 1ZIAA 2Q5BA 3PLYA 1NINA 1MG2C 2YAQA 4GP4B 3H4FA 5B7FA 4KO7A 2XV0A 3HEIB 1AOZA 4CSPA 1KYAA 1ADWA 2XX1A 2IH9A 1ILUA 1BYOA 1JOIA 1NPJA 2H47C 2BP0B 3FYEB 1BQRA 2AZAA 5B1KA 1AACA 4E9QA 8PAZA 1WS7A 3BVDB 1R1CA 2UX7A 1PZBA 1KDJA 3WKPA 2GB2A 2PP8A 3OM3B 1N68A 1V54B 1NIBA 4DP1X 1GS8A 3N2JA 3AG4B 4BWTA 4A2HA 1TKWA 4DP6X 4QLWA 2IH8A 2VN3A 1CUOA 1HFUA 1XMEB 2GSMB 2PCYA 2AVFA 2UXVA 1AZNA 3EF4A 5PAZA 1SFDA 2VSKB 2AZUA 1PF3A 1NIDA 5B3SB 4HAKA 2IDTA 3X1BA 2LLNA 3FQ1A 4PCYA 4YSTA 5A7EA 3WKQA 4A2FA 1QLEB 1GY2A 4EF3A 1ET5A 1NWPA 1OE2A 1TEGA 1V55B 3PXLA 2OCCB 2YARA 2X87A 2YAFA 3WNJA 4E9XA 3ZX1A 2HX7A 2BP8B 2QPEB 2AFNA 4CSZA 4BWWA 1X9RA 2YXVA 7PCYA 3DIVA 4YSOA 1ASOA 3CVDA 2AANA 2BP8A 2QDWA 2VM4A 2XWZA 4UF7C 2WSDA 7PAZA 1OV8A 4Q8BA 1GSKA 5TK2A 4DP0X 2P80D 3ZDWA 4G71B 4YSDA 2J5WA 1WA1X 4G72B 1WS8A 2IDSA 2CJ3A 2PPCA 2PP7A 2BWIA 1YLBB 2GBAA 3AG2B 1OE1A 4YSPA 1X9UA 2FWLB 2B08A 2BZCA 3S3CB 5I5JA 3ZIYA 1CYXA 1RZPA 1IKOP 3FU8A 4HALA 1N70A 4G7RB 1MZYA 4A2EA 2CBPA 2R7EA 1MG3C 4UANA 1PLBA 3IN0A 5I5MA 4DP8X 1W6WA 2EIKB 3SBRA 3CG8A 3NP3A 1GS6X 1HAUA 2H5UA 2WO2B 4BK5C 2PCFA 2MTAA 4DP2X 3G5WA 1NPNA 3AZUA 3NJGA 4G7QB 3S8GB 1BXUA 3CDZB 1AANA 4YVNA 1BYPA 2GIMA 3FQYA 4HHWA 2FQEA 4TXVB 4KO5A 2XU9A 1AS8A 4AI7A 4HCIA 1JVOA 1ET7A 4BXSV 2QPDB 1QNIA 3NP4A 4A2GA 3NSCA 1B3IA 2A3TA 2IAAC 3NJLA 1PY0A 2XYBA 3CVCA 5IY5B 1M57B 2I85A 2N0MA 2I7SA 4BDVA 3H4HA 2DV6A 2EINB 3X1FA 1GYCA 5B7EA 5I28A 3ASNB 2DY2A 1E30A 1RZQA 5D4JA 3T6WA 3QJTB 4GP5B 2PLTA 3NYKA 2B3IA 3FSWA 5F7AA 3S3DB 4UAHA 2PP9A 3PAZA 1I53A 2JFCA 3NSDA 2IDFA 2JKWA 1L9PA 3EH5B 3GXUB 2R7EB 2IDQA 1PLAA 1EHKB 3V9EA 1OOWA 5B1AB 6PAZA 3IBOA 2YAOA 4F7KA 3QJSB 1E5YA 1JZHA 3DTUB 1L9OA 2GC4C 3MX0B 1AIZA 4QKTA 2GHZA 4E9SA 3TBCA 1OE3A 1OCCB 4M3HA 2Q9OA 2BP0A 3QJRB 1ZV2A 1ZIBA 5I6MA 1M9WA 1ZDSA 3FSZA 3NJFA 1FFTB 3SBQA 5I6KA 5TK4A 1CC3A 1IBZA 1IBYA 2XXGA 4NERA 2P80A 1XB8A 1DZ0A 2HX8A 2FNWA 2FT8A 2XV3A 4AKPA 3NT0A 2ZWNA 2DYSB 4PAZA 5I6LA 3EH4B 3HB3B 4AX3A 4HCFA 2X88A 1A8ZA 4Q89A 4DP7X 1J9TA 3SBPA 4DPBX 1CURA 5FC9A 1ZPUA 2YQBA 5I6NA 1AZUA 3JTBA 2BW5A 3IEAA 4ENZA 1AG0A 1AZCA 3NJKA 2GI0A 2UXFA 1JXGA 3UAAA 4F2FA 4KOBA 3ERXA 1T5KA 1PNDA 3PCYA 4AKOA 2MRYA 2VW7A 3WG7B 2RACA 5LDUA 3ABLB 3FQ2A 4YSEA 3EHBB 2I7OA 4HHGA 1SHWA 2H3XC 1KV7A 1J9QA 1BQKA 1M56B 1SF3A 3OMIB 3QJVB 4G7SB 3IN2A 3ABGA 3SQRA 4E9TA 1JVLA 3GDCA 2YAMA 3QQXA 4DPAX 2CUAA 1PZAA 3FS9A 3T6XA 5B1JC 1A3ZA 4HCGA 1AAJA 2FJSA 2ZOOA 1KCBA 3V9CA 2ZXWB 5E9NA 3U25A 2YAPA 1V10A 4X4KA 3T9WA 2EIJB 3PAVA 2VM3A 3FYIB 2J56A 1RCYA 1ASQA 3CDZA 2J55A 4W1TA 4FAAB 2YAEA 1SJMA 3X2QB 2W88A 4HIPA 3C75A 1F56A 1OF0A 1JZEA 4YSQA 3UADA 1ILSA 2BWDA 1GR7A 3FU9A 4KO6A 3NJJA 1BXVA 1GY1A 3S3BB 3AG3B 3KW8A 1IC0A 1J5DA 1KBWA 2XVBA 4YVUA 5F7BA 5ANHA 2GC7C 2YXWA 5B1JA 1OCRB 2W8CA 4JHVA 3WI9A 4K9JA 1AZBA 3QJQB 1UATA 3NJNA 2QDVA 3L45A 3PPSA 3FSVA 1OCOB 4F2EA 2DYRB 4N8UA 4HZ1A 2VW6A 2E86A 5D4HA 2BW4A 4FA7B 1E67A 1XB3A 2J57A 2CCWA 3T6VA 3OMAB
chains in the Genus database with same CATH superfamily
5GGTH 1OY3B 1YAZA 2D8KA 3E9TA 3MJGX 5CCKH 4Y8AA 2YBGA 4M9OA 5JA9A 1LE5A 4LRIA 2WZ5A 3TA3A 1JHTB 3C5ZD 4NNXB 5DFWH 2DQTH 3NCYS 4J5VA 4BZ2L 2NY7H 2NR6A 4ODVH 4V1DB 5F7KC 1TG8A 4LE8A 1W8OA 2AGJL 4QYAA 1VGEL 5D7JA 3QUMH 3QIWD 3GSQA 4NQDB 1NC4D 2UXGA 2YEZA 2A2QT 3X1GA 2VL5B 4HC1A 3VG0H 1RQ5A 1U4FA 3AU0A 3R4RA 4I13B 3PHQB 5D71H 4PJHB 4LHUG 1OK0A 3I6KA 3VI3A 2C3GA 5I18L 2P3YA 2VLMD 1ZGLM 1Z9OA 4C4KT 3OKMA 2EDRA 3MREA 2YC1B 3SKJL 3TF4A 4YXHL 2K1MA 2HG5A 1IEAA 2O6EA 4KFZC 2Y1ZA 1W80A 5IVZA 5DFTA 4AIXA 1SOSA 4JO5A 2GFBA 1P6FA 3BMWA 3O3UN 1HCYA 1NICA 3KWWB 1S7WA 4M5ZL 1VADA 1AIFA 1WICA 3EJYD 1Q9LA 1WFMA 4I0PA 3TIDA 3NCEB 1AQMA 4MAYD 1BG9A 3QHZH 4U3XA 3VAEA 5DCCA 4M1CC 1KOAA 1VHPA 2ODHA 4WGKA 3MMEB 4H8QA 2DKSA 4PGEB 4Q0XH 1M6UA 4OCRL 1DYZA 2IALA 4JZOB 2WQAA 6TAAA 3WFEL 1RMFL 4GW4B 1LO2H 3IDYB 3MUZ1 4NJAL 3FK3A 1KEGH 3PL6D 2A6IB 2G2PA 2QQKL 2ENPA 1EZLA 1RZGA 3WMSA 3FQ4A 2XWEA 1QFUH 1T83C 2QEJA 3WKNA 3FTUA 4HPYL 3NQIA 3OGCB 1AP2A 3C9NB 1R5VB 3WSQH 3IJEA 2ARWA 2EDMA 2Y06L 3BKCH 2CZNA 4OJAA 2VXUL 3RBSA 2X6VA 4P2CG 1SXZA 5KSAD 5ABAA 2O30A 2HLFC 3QISA 5C0JB 1AY1L 1ROWA 1M53A 3FTZA 5C8JA 1A6UH 4JG5A 5D5MB 4ICWA 4RMWA 2UZYB 5AVUB 4PWJA 2G30A 3ZBMA 1RFDL 1WCBB 4MZIA 4IS6B 5HY9A 2DPKA 3CFDA 4G9FD 1QHQA 3V79C 3MRJB 1SVZA 3QCUH 2D7OA 2H8PB 3DYMA 3FB6A 1HZKA 3GSWB 2ZYRA 1TZIB 1E2WA 2AS5M 2J2ZB 5KS9F 4F7EA 2AJYL 3QDMB 3WNNA 1FIGH 4ZOBA 4JDEB 1H0DA 2PWDA 3ULUH 4L18A 1U92A 1IFHH 3LEVH 2FLMA 1SEBA 1NFDA 1TTGA 4GPVA 4NZFA 3O2WL 4P59H 3VFTA 1J0IA 4UINH 4A7UA 1G7HA 3IDGA 5CCJA 2FT6A 1A7BA 2DZEA 3ESMA 3LKSA 4PJXE 4XMKL 4YHPB 3S96B 3VFOB 3P69A 1MFMA 1BMGA 1IV8A 2OMYA 4MNQA 1K4CA 2F61A 1Q0YH 4HJJH 4QRSA 3HE6C 3FBKA 2DQGL 1OM9A 4WJ5A 1DVFD 1I9JL 4OFKA 1DJXA 3UAEA 2A6IA 5GPRA 2BVUA 1NCAL 4X6DA 1S9WA 3T3ME 4PRHE 3WFBL 1RZKL 3V52H 1JZGA 1XMWA 1P5UC 3PNWB 5AZ2H 3BVXA 1U8IA 1ZTXL 2PW1B 1PX3A 4PGBA 4W4OC 4ETYA 4OLZL 3B9AA 3W9EB 1IE5A 1SHMA 1U58A 4XO9A 3VFVB 1BYOA 1Q1PA 4HK3N 1INEH 1NC2A 3QEHA 3WIIL 1OF2B 1IM3A 2RBLA 3HKFA 5ES4B 3O9WA 8PAZA 1BBJB 2ERJB 1BAFL 4R4NC 4KJYB 5GZOD 2A99A 5ITFB 1H3PH 1EDYA 2EYSB 1GYWA 1E4XI 5AZEH 2ZG3A 4HXBH 5F8RC 3RRQA 3HS9A 1HE7A 4OM1L 3OHXA 3LPOA 5TD4A 1DUZB 4J3OD 1LO5A 4CNIB 2EC9U 1T03H 5ISZD 2E47A 1LYQA 2B59B 3FC8A 3GDBA 3HR6A 4XHJC 2M83A 4P99A 4DP6X 5ANME 4EUPG 3SPCA 4QLWA 5JLZB 3PS6A 3SGJA 1QNZH 2GSMB 1F58L 2E7CA 2JMRA 3S0PA 4S1DC 1HYRC 4OJFL 3QUGA 3US1A 5JLZA 2WLLA 3LKNB 4MSWB 4KTGA 3UOAB 4R96A 1TYRA 4ZMPA 4H88H 3DC0A 2MCPL 4BCYA 4YSTA 5KBMA 3TJEL 1FHNA 4PD4J 2FGZA 1ET5A 2Z8WC 3APFA 4APQD 2A1WL 1OAJA 2DWDB 1FL5A 1O0VA 4ZFOL 2CDGB 3MRDB 4L8DA 2BP8B 2VDNL 4MS8C 5A16B 4HUWA 1OHZA 4X7TA 1JHTA 2FATH 2Y7NA 5C09A 1X5GA 2GPZA 5D5MF 2OK0H 4G2AA 3V10A 4KKCC 1CDJA 2PO6C 3FOMB 4HLEA 2FWOB 4KJQD 2J25A 1CI3M 4G71B 4YNYB 3U1QA 3WTUA 2VN6A 3BDXA 5ANMB 4HBQA 2F2HA 4FX5A 3SY0B 3FRPA 4N0YL 5CWSB 1M05B 4NNPL 1OKEA 2YPVH 4MMYB 5T1LA 4AOFA 4KUZH 1KJ3H 5E1QA 4ZMAT 4N24A 5EOTA 3S3CB 2FBJL 2EDHA 5DJYB 3C5ZB 3HG0A 2VDNB 4BINA 2DQFB 4XP4L 4FEMA 4FJ6A 3QDME 1B2WL 2BSTB 2NR6C 2LABA 3GSNL 4J27A 5EG6C 4IK7A 5DJYA 3H9SE 4OCRH 1DANU 2CK0H 3CG8A 2WKOF 2WO2B 4HS6A 1G7PA 1W8NA 2MH4A 3QUKB 5AVQB 2YFNA 3ZR6A 4Z7NB 5IOPB 4NDMB 3TF7C 4FQIH 4RNRA 4Y19D 5EIVA 3L13A 2A77L 4Z7AA 1TENA 4YVNA 3RL2B 4NI6A 3IETA 5SWQB 1J8RA 4LPTA 4Y16D 3VG9C 3Q6GH 4ZNEA 2EKJA 5KSUA 4M1CD 1G6RA 1BMZA 2D3VA 3BCFA 3EZ8A 4U1JB 4DZBB 3KPSE 5JXAL 4A2GA 1D2PA 3IDNB 4NUPA 1E9QA 2KYIA 3K4AA 3JTTA 3UTPE 2I85A 3QDGB 4M61B 4A6YH 3KXFB 5MP6L 3H9SA 3QORA 3C08L 4AQ1B 3H0TA 2FWSA 1P1VA 4JQXA 5B7EA 2DWXA 4QMEA 4YDVA 1UYWL 4L9LA 4J4PA 5HJBA 1XTLA 1EANA 1MQ8A 3NOIA 3BPOB 1R0AL 4G6FB 5I1AB 4GKNB 5AYQA 4DFIA 4K3EL 3DPDA 1ZJBA 3OZ9H 1HX0A 1RIHH 2VQ1A 2F9BT 4RAUB 3NSDA 3K5RA 2VLJA 3LN5B 2WYZA 4R7XA 4AM0Q 5I1JL 1LEIB 2X3BA 1EHKB 4M29A 3LNFA 3NZHH 4DN3L 4LGSB 3QIWB 2ENQA 3KPQB 1LEIA 3BCDA 1IC4L 3N44F 5E8OA 5HVHC 2WXJA 2VAAB 1QWUA 2EIZA 3TYFA 1QPPA 1BBDH 2CKBH 2QKIB 5KYYA 4OGXL 3STZB 4GS7C 1CD9B 3VVWA 1AGCB 2EJ1A 1UH4A 3JVGA 4X6DF 1F4WL 4FNSA 1EFXA 5JIIA 1KXTB 2WIIA 1ZDSA 5BV7B 2BNRB 5AWNH 1GTFA 5EZPA 4HPHA 4YDVB 4IJ3C 4HJEA 3UJTL 3ZE0B 2AV7A 2JB5H 4NPYA 4X7EC 5LN4A 2Y5QA 4AYID 3JWDL 1S9VA 4A1RA 2KLTA 1DVUA 1ZANL 2DYSB 3DV6A 2Q3XA 3HRPA 4NUJA 4PLJD 4WNJA 3RLSA 7FABL 4PGCA 3AXLA 4PJDA 5EOQL 1FZKA 3ESUF 5E56A 2ATAA 1RUQH 3LN4A 3DHJA 5FYKD 5F9OH 5L2JA 1DL7H 3T1FA 3ML8A 4DPBX 3FFCD 12E8H 1UH2A 1H3PL 5KS9A 2FSEA 3IEAA 1KYUA 5CEZD 3L4TA 1P7QD 1FPTH 5T1KB 4RNRB 1VIWA 3ECWA 4YL9A 4GBXC 1OGAA 1J1XH 4ZBJA 3JSSA 1CT8A 2IGFL 1RJYB 2X89D 3ATEA 3RUGF 2J6EA 4X9IA 2IG2L 1KV7A 1E2VA 4NQEE 4BUHA 4U1GC 3OZLA 2X53A 2F53D 2RA1A 1OGSA 2WXOA 3C08H 3K72A 1CR9H 3I74A 3GLZA 5B3NA 1QLEL 2KDGA 3HBGA 4Y19A 2J12B 5K69A 1ZLUK 1R24B 4GG6A 3D08A 4L4JA 4P2OD 3CSYB 1RUKH 3QUXC 1ZGLA 3ARGA 4PWIA 3EJZC 4PJCB 2Z7UA 1I7UB 4PV1C 4EEEA 3CLFH 3APNA 2O5ZL 3I6SA 1A7NL 2L7UA 1U8OA 1Q1JH 1DFBL 3MNMA 5EF2A 5D96B 1JK8A 2Z93B 4UQEA 5DJCB 4G9DB 4CMMA 2JV6A 4TKWA 3FT4B 4AV5A 4ZMYA 2F18A 1PGRB 4UAOB 1JZEA 1U6AH 2WWMD 4IKJA 4UV7L 3PQYE 1MFUA 5CGTA 1AFVL 4QRRD 2DQTL 3L4WA 3S5LB 5C70A 2LE9A 2LR4A 5DUPH 5CU5A 4PJBF 5IZ7A 4KK6D 3QB7C 5GSRA 3WXWH 4O02A 4FN0A 1OCRB 2IBBA 4NIYE 4PGEA 4HG4K 1WAPA 2EE6A 1R3HB 3VH8G 3CUPB 5I1DB 3ZKXC 1QQDA 1CWVA 3FT1A 3VXQB 5F7DB 4YDIH 5LNEA 4JZNA 3L9EA 3UDWA 1NGWA 2BW4A 3SKNB 4YHOL 1T0NB 1XB3A 3SPHA 5ID0A 1LILA 1O6SA 3OR7A 2VE6A 1SY6A 4WWID 1RY7B 1JDCA 1ZVSB 4N2NA 4XPGH 2OZ4A 1IQDA 5GGUB 1CFNB 3OR7B 3ME0A 1XF2B 1QAWA 4XZUA 3PDDA 4PS4H 1OLLA 3G04B 1QSEB 2R27A 2G9HB 4JCWA 4KZ0A 4ANWA 3NSYA 2RFXB 1BVNP 2J71A 1LM8V 3ABKB 2UZXB 1JZIA 1HEZA 1MXGA 1MFVA 1RZ8B 1PYWB 2I9LB 5HP5A 1QUNB 1XZ0B 1TQBC 3A4DA 4YFEA 2BZ7A 3ECUA 4XPFL 4BRVA 1LQBC 3GXIA 2V2WB 5LAXB 4NENB 4DKTA 1NIAA 4BFIB 4WHTA 5E00B 4A55A 4PRIE 4PRNB 3MRQB 2FK9A 1KB3A 2HN7A 4U3SA 1FBIH 4OZFG 3VGFA 3NRQA 3KCWA 4CKVX 3BH9B 3FT4A 3VXMD 3S5LG 1RIVL 3P3RA 3F04A 4NWUL 3PXJA 3QUHA 1IKNC 2Q6WB 3QDMD 2VLLB 2P52A 1FA4A 4EMZA 4FJYA 3GSOB 5IQ9A 3WXVH 1AYRA 4KKCD 2E59A 4TVSa 1UM6L 3TPUB 1KB5A 4E9RA 3H6JA 1AMXA 1FFRA 1IAMA 1PLCA 4MJ6B 4D0CB 1YZZA 1PD1A 4HSCX 1ZLSH 3GXNA 3T71A 2ZJSH 2OX5A 4Y2OA 3K6IA 5L7XL 5DRXA 1TJHL 3TA4D 3K72B 1J8KA 1IUZA 2R59A 4YJZL 3HE6A 3GKWL 3NVQA 5FB8A 4U6YB 1JZ4A 4QLRA 1ZKAA 3Q8BA 4G9FA 1CF1A 3WIFB 5F0JB 4IGBA 4TM9A 4XWOC 3BUPA 4PJ5D 4DH2A 4U7KA 1ZPLA 2DTMH 2YPVL 4PRPE 1CMOA 2UZYA 4PV8B 3EHBC 5FO2A 4RMSA 2I9TB 1JFHA 3BKCL 1AHWA 3DPBB 4TUKL 5EN2A 3PAUA 1A9BA 2ZCLL 3LXBA 2OP4L 5DD0H 2COQA 4NT6A 1OSEA 2MQCA 2X05A 3TJHD 4S10A 1KCVH 4ZMVA 1HTYA 4RRPA 3RTQD 3FB7A 4KTEL 3H9HA 4RFEB 4O5LL 2X4PA 4NRYB 2XN9B 3CFKB 5D8JH 4AKQA 3L1EA 1PKQA 4AM0B 2XXMB 3OQRA 1EJ6A 2NY4D 3DRQB 1G84A 1LO3L 2G5BB 1PZSA 2IG2H 3Q2CA 3WE1A 3MMEA 2YS4A 1OCZB 3WJLA 4TUOA 5MENB 4GB9A 1EIBA 4M93B 3A6BL 1BCIA 1R3LB 2P5ED 2CIIB 2ZOLA 3FQTA 4GXFA 3GEWB 3H2QA 5AW6B 1X44A 1KXTA 2CQVA 3QZBA 4UMSA 4KY1L 4AYMC 4AL8C 4Q97A 5BQ7B 4N2IA 3IS1X 3GTVA 2BS9A 3T65B 3TYFB 3ULUF 1GW0A 4Z7IA 4PY8J 3K7UA 1DJYA 3MNZA 4GI9A 1DL7L 4P5KB 5CN1A 4JFEA 1UOKA 2CK0L 3HPLB 2FVNA 2VERN 4ZW7A 4X6CF 3VWKA 2GSGB 2WXRA 4PB0H 1CK0L 4ANVA 1DN0B 3GXFA 4XP4H 5I6OA 1JXFA 2Q8BH 3NGBB 2BLFA 4S1QH 3SCMD 1U6AL 3L3IA 5E2UL 3ARBD 4JFZH 2VDOL 1F6AA 3DX3A 4OTXL 5KUMA 3PUUA 1NCIA 1IGJB 1LGVA 1XIWB 3AB0C 4N8VA 5I1AA 1MJ7L 2NUTB 2YSSB 1M7DA 2X0WA 4M7LT 4LPUA 3G6DH 4U1MB 1FE8H 4J39A 1QR4A 3JVFC 3WEBA 2O5YL 2X7LA 2H47C 2DMKA 2ESVD 2BH0A 1QA9B 1EHLH 1JV2A 4WSJA 2ZSVB 1F02I 4PY7A 3O4OC 3RDTD 2ZUYA 4Z78A 3QEGL 2RMNA 1PZBA 5GGTL 1YYMH 1AO7B 1P5VA 1SJEB 2D7NA 3FTXA 4FG0A 3D0LA 1H5BB 2CO6B 2F7RA 2YOAA 3HN8A 5MEQA 1KPRA 3DVNB 3IE4A 3EOBA 2D03L 4YHYC 3KGSA 1J0YA 4X9GA 4ZAKD 1OIOA 1YC8A 4UQDA 1KC5H 5SWQA 2PR9A 2YPLA 1BZ7B 3OJVC 1JPFB 1FRGL 2J6EH 1AVAA 1NCNA 3WO4C 1K8IB 1BQHB 4N85A 3L6FB 4LLUB 1HH6B 3RKDC 4APQA 3TLRA 3P4MA 3IAPA 1MCPH 4N0RA 2G75B 1EAOA 1GAFL 2CXKA 2XZQH 3GXPA 4P0DA 4WW1A 1NCBH 1LO0H 4OVUA 3WKQA 1NFAA 1IKFH 3NFPB 3SDXA 1Z5HA 3PXLA 4W9IC 4OGXH 5MENE 1COBA 4CGUB 3SGDI 4IK6A 3SGKA 3ZX1A 2HX7A 1JGIA 4LL9A 4KDWA 2DDQL 3L3OB 1PL3A 2AQRA 4PRAB 1MVYA 1MKFA 1DBBL 3CQPA 3CN4A 3ZDYF 5IEHB 3APDA 1O6VA 3H9ZA 1TLMA 3EBGA 2XN9D 3FFCE 4OQTL 3DXAB 3NEEA 4P5MB 3SJVA 1MRCH 4MAUH 4PJFF 5D6CA 4M5ZH 2RAMA 3VI4F 3OVUB 5GZNC 3ZO0A 3BE1L 1G0XA 5DXWA 4FFZH 2J5WA 5EB9A 1T20A 5FA3B 2A9CA 2X1PA 1TCRA 5CKGA 3OC5A 3WNPA 3EH2A 3F7VA 1D9KB 4TL4A 3I9GH 4KJPD 2HPOA 2JLPA 5I5JA 1RXLA 1F11B 1LK2A 4E41D 4L8DB 3V6OC 2QQKH 3LQZB 3ZDXE 4XODA 4HALA 4LPXA 4EZMA 2DTSA 4DVRH 3ARPA 4MLIA 4QRPA 3TIEB 3ZT6A 4AK2A 3EJTA 4YQXH 1U3JA 5E6ZA 4RMBA 4CU8A 5GS0C 1LHZA 32C2A 1SDAB 4PJFA 5DJDA 1DR9A 4TVPH 5C08E 2ZAIA 1CXIA 5A6IA 4AGPA 1RURH 3SPIA 3V0HA 3QHFH 4JY4B 2X4OA 2DB8A 4ZX4A 2JI3A 3BIBX 3HVDA 4MDIB 1J1OH 3KXFD 3IMWA 3R0NA 3O45B 5FW6A 1RZIA 3V6FB 5E8DH 1TO4A 1M6OA 2KC0A 4PJIB 1V7NL 1E6JL 2XWXA 3NP4A 4KVCL 2V9TA 3L3HA 1TTBA 5L9DL 1KGWA 1A2YB 3N43B 3U7WL 2VZ3A 2ID5A 4Z7QB 5LCVL 3ZDXB 3GJFH 4LNRB 1KXVA 3AM8A 3E6FA 5EUKA 3QQ4B 1RLBA 4LEXL 5E5LA 4OF5A 4F2MB 3VGGA 4N8CH 3QUZA 4JG0H 2XPZA 1JP5A 4QXGH 4APXB 3FSWA 4PB9H 1BOYA 4NP9A 5C0BE 5IW6B 1CICC 3LHPH 7CGTA 2OULB 1QVOB 5CSGA 4MJID 3SDCC 1BPVA 3G5XB 4LEOA 3FO1B 3BQUB 4U1SB 3JZ7A 4Z18A 1L9NA 2OMYB 2R69L 3IU4H 3VFOA 3HS0A 4F7KA 1RUQL 2Z1PA 4PJGA 2O5NA 1X5FA 2C34A 1EZUA 3IXTA 4Z77B 4XC3H 1YECL 5C0FB 1SN0A 3P0GB 1OOAA 3UBXG 4G5ZL 1QO3B 4U2ZA 3T0VA 1F2XK 1W0VB 3FSZA 5EC2B 5IB1A 2BVTA 4PG9B 4W6XB 2ODIA 3VXUD 4C4KO 1XO8A 4NERA 3FXIC 2HT3D 2CUMA 3AACA 3UYRL 1A3RL 3LNGA 3U4BH 2E56A 4UQAA 3W38A 3BO8B 4ONHB 5LLIC 3H7BB 3ULUC 1YYML 4Z0BH 2FO4B 5I6LA 2J6WA 4BK4A 1T1WB 3JQOB 4HCFA 2D7TL 1HU8A 4PBVC 4TTDD 5D1QA 1WBXA 3VH8A 1F8TL 1T4KB 2WLHA 5DK2A 4GQQA 3BIKA 4F80A 5C0JA 5I6NA 1AZUA 3JTBA 3NK4A 1VGKA 5E9AA 5I16B 2QR0B 3BIAX 5E95B 3LEVL 2FL5A 5HI3C 4POZC 1JGUH 4Q2ZB 5JHMA 1VFBA 5F3BB 2EVFA 3HHMA 4ZW3A 2P8PA 3A3YB 3QARA 2H3NB 4I85A 5C07E 4OLWH 1BQLH 2VWEE 4K8RH 3J07A 4XCNB 3APCA 1M2VB 3WNKA 5HD8C 4TSBH 2DYPD 1CGWA 4HFWB 3QJVB 5EU6E 4X7SL 5C3TA 3RDTC 2X0UA 4CW1A 1HZLA 1ETB1 5EBLA 5IB5B 1LNUB 2JVUA 1JD9A 4PVMA 4D9QD 5B1JC 3SZKC 3BT2L 1FFOB 2DLEA 5DEFB 3V0GA 1A1NA 2R23A 2RIKA 3G3LA 2Q3ZA 5BS0E 2V4LA 3NQKA 4XNZB 4F15B 5IJKC 4ZJ9A 4LFHG 4QT5A 2NTFB 2IV8A 1UZGA 5SWSE 5IIEA 4NYLB 5F7YC 3KDMB 4OAWA 4HPYH 3LSOB 4PTTA 1JPFA 2DTML 3C60A 3KPSB 5IHUL 3HZVA 4PWEA 4R83A 3CSPA 4EDXB 4F5CA 5H4ZA 2XICA 1KEML 1ILSA 3EOBB 5FOJA 5LJYH 4DGVL 2XBDA 3UX9B 4G1EA 4S1SH 5CLWA 2AK4D 2EDNA 1KBWA 3JXAA 3MRFB 4P5TD 2QADC 4GLRH 2QSCH 1LO0L 5M95B 1NCHA 4CSSA 2ZKWA 3P4OA 1AZBA 5DZVA 2BZDA 4LCUA 2XTJE 3WNMA 3TWCL 4RMRA 4PRDA 1BJ1H 2G0LA 2MCAA 1KCSH 3UAFA 3IK2A 1A7PL 4NXSA 4F2EA 1C5BL 4N8UA 3VD9A 2ZX7A 4LOUC 3AREA 4J3XA 1KN2H 1L7IH 4QHUA 1YYCA 1E67A 2WCSA 2HPTA 1EGJA 4AQAB 1OAZL 5GS1B 5HVFB 3ILQC 2NXYB 2F7QA 3QCVH 3FUIA 1CVRA 2IAMD 4TVPE 1LO3H 4Z3GA 1E65A 4M8QB 1WA2X 4LVHB 1F1DA 5DHVA 5I17B 4HW6A 2HWZH 1LE9B 1SHXA 1QG3A 1GTNA 4AE0A 3CXFA 1UFUA 2XIBA 1FO0A 2XLLA 3QEGH 4QJ5B 1KGYE 4U4BA 4Q6IC 3Q3GA 3GBMH 1IEBB 3IPBA 5FUCE 1QZ1A 5IB4A 1FIEA 1ZK9A 4UDUA 4JM2D 5D7SL 4GKSA 4M6NH 1FNEA 1IGIL 5E1GA 3IYLW 4Y1TA 1YYLH 1MSPA 3RY5A 4GUQA 4XXCA 5T1DL 1D9KD 2WMPB 3BWZA 4N8CL 3N42F 5HHOE 4MXVE 5AL0A 3I6LD 1HYSD 1JZFA 3JV4B 2H32B 2UY7B 4Z0XA 5A2KH 2XN1A 5MHSD 1GS7A 4ZNEE 4ODUB 2NLJA 4YIQA 2AXFA 3BKMH 4L4TB 1EZVX 3QIUA 4X4XB 2MOGA 2L7QA 1IBHA 5DJ2B 1J9SA 1T89C 4K8RC 1P2CA 3OSKA 4RGNE 4AEHH 5C6WH 5E1AB 2AABL 2H0EA 1ZWIB 3WHE1 2QQQA 3ZQWA 3IJSB 2W07B 1JV5B 4UT9H 3CQQA 1YC7A 2V37A 3EYVA 2HRPH 3RTLA 4XP6L 3VU1A 4YIQB 4NQCA 1AH1A 1SOKA 3GC3A 4PV8A 4UM9D 2V17L 3F58L 1ETZA 1QFOA 4TQ8A 3KCPB 5LDSA 5DJZA 3F65A 1GRWA 3QYCA 2DIBA 5AZUA 3IB4A 3OXSB 1NUNB 2NT1A 1J86A 3PQYB 3QWOB 1CDIA 3GI8L 2WN2A 5B21A 4F15C 4P2RD 3WFCL 2NY3D 3GPSA 2VXVH 2DLIA 4NKIH 1Q0YL 3BFQG 5AUMB 1FV1A 5F7EL 1N19A 2XHNA 3QQ3A 4NQDE 5B7MA 3U7WH 1DQMH 4JNXA 1QSFD 2PTUA 5CEXB 4JQIH 3BSZL 4HP5A 4NKDB 2EEXA 4Q9QH 1BEYL 3T3PF 4MTMA 4XOAA 4XNMB 3CHXA 4TSAH 3BGFB 4FMFA 2ZUVA 3V7AG 5DC2A 3HG5A 2Q7NA 3NPZB 4ABVA 3SD2A 1TMQA 2V3FA 5I66B 4DQOL 2DKUA 2XOTA 3D69A 2EACA 3BAYA 4GNKB 2WAHA 3ZTJH 1G1CA 3QBTB 4CMHC 5MERA 4QXTB 2ZXAA 1O75A 4IMKC 3GMMA 3RHWK 1CGTA 4KI5D 1XGQA 4DO6A 3C60D 4PJDF 2JJSA 3VB9A 4WTWA 2P28B 1B2WH 3GSNH 3BT2H 4XNUH 3U1PA 5AW5B 3SDDB 3QRFM 3JT2A 5HDQL 2EAEA 3N55A 2N7BA 3N06B 4G1EB 4JY5L 4WUKL 4Y4FB 4CC0A 4F2MA 5JIDA 4CRPA 4J8QA 5F9WC 4XVSH 1YEJH 4NBYB 1NDTA 5F6IB 2NZIA 4Y5XB 2UV3A 1WC7A 2PWEA 1LDSA 3QJHB 2WUBH 3A6OA 4PWKA 3D51A 4ADIA 3NIFB 5C3IA 3WDIA 3MRBB 4QTIL 3MFFB 4YXLL 4P9HC 4FQLL 4ZXBB 3HZYB 1BX2B 1WFNA 1PZUB 2A0LD 2NTFA 3UEQA 3G6AB 2WOBA 1XL6A 1KYAA 3NCCB 4BSWB 4EI5A 3UTZB 4C47A 3E2HB 2W07A 2A9NL 3ZHFA 4MAZA 1QLRA 3EJQA 4KK9D 3TVMD 1C1EL 4MD0A 3LS4H 4ODTH 5CS7A 3MV7D 1FZJA 4ATTA 5BUAA 5E08H 1LO4H 1JCKA 4HIHA 1X4XA 4GRLC 4PRPB 4XRCA 3RDTA 4AC4A 4CW1B 4C8XA 1E6OH 3ESOA 2ROXA 2UYLB 4HWBH 1N68A 4DO4A 3F7RA 4ES8A 1TQUA 1VZGA 2EDXA 1UEMA 5D93C 5JMRA 5LGHL 1OAQL 1PKQE 4J3TA 4PG2C 2CDFA 2OAAA 2P49B 2WTRB 3LH9A 1R5IB 1FRGH 1NFDE 1BD2A 1D5MA 3WD5L 5L2KA 1CLYL 4J3OC 3IJ9A 1G4MA 3KPOA 1FJ1A 4O02L 2AZUA 5G4NA 4ETQA 5BNXD 1D5MB 5D7SH 5B3SB 4QAMB 3DI2B 4OZIF 3FQ1A 4L3FA 3ORJA 4XX1G 2R2EA 4Y4HC 5IOKA 2OQJB 2J8UB 3L5XH 3CPLB 3MC0A 3OXRA 1U8MA 1RSFA 3SJVB 3TNNA 4V33A 5TDNA 3WLWD 4JJ5B 4JHZA 4BCXA 1HCZA 2K6WA 4UV7H 1H9VA 4C58B 4EQ2A 1G9HA 3OB0H 1KXVC 1YNLL 3W0WB 4Y7MA 4YEFA 4XVJL 3S88L 2WKOA 1I4FB 3NFNA 3SQBB 5EH1A 1Y0LB 3BPOC 3VXMA 2BNRD 2APVA 3ESPA 3U0PB 4WW1B 3W11C 1KPVA 4K2UH 1MCIA 1PJ9A 3QRBA 4URKA 2EC9T 1R75A 3FONB 4JS7A 5C0FA 4ZUWA 3D9AH 2R4SL 1HXKA 5D7LB 1CDUA 3AVEA 4KDTC 1A1MB 4O9HH 1X5YA 1URLA 4PIBA 1SUJA 1A25A 4K8RD 2BZCA 1G0DA 5J1TC 2JELH 4HXBL 1KCRL 2X2YA 3O2DL 2MMXA 3MR9A 1RZJC 2CBPA 2CHNA 2DD8H 3AM8C 5LBVA 2PW2B 1KJ2B 1PLBA 2FYYB 5HVHB 2GJ6B 4HWNA 3V6OE 5IG7B 1HAUA 3IDIA 4I3GA 2HMIC 4WU7A 3VGDA 4WDIA 3E6HB 1U93B 2F8VA 4XNDA 2PTVA 1G7IA 4K3EH 3FFDA 1AANA 4HF5H 3CFIC 3AS0A 2IV9A 1CFVH 2QTEA 5ESQB 3FCUB 3D8MA 4QXUL 1YEGL 1N4XL 1XIWA 1MDTA 4G80B 3STZA 4XE0A 2XNAA 2DLHA 1T5XB 2EH8H 2LV4A 3DV4B 1CYGA 1WZ1H 2FIKB 1QWHA 2YD0A 1HN1A 3L3IB 4KZDL 5DMGD 3L08A 4JJ5A 3V7MA 3KR3H 4MS8D 4MCNA 2I7SA 2WTOA 4ORGA 2XXCB 2DV6A 5T1DH 2ARJQ 3S5ZA 4JN1L 3JWDH 2X6CA 5FCSH 3U7YL 3T6WA 3OX8A 3P3YA 1NCDH 3II3A 4JW3A 1WV7T 4QYOA 5I1LA 2FJHB 4GSQA 1FJ1B 1R3KB 3PWPD 3QWOA 4Y7OC 3SSGA 2OSXA 2CR6A 3KWXA 5I1KH 2J1XA 1QATA 2JLLA 4PR5B 2H6PB 3SGEH 3TEUA 1Z5YD 3GKWH 1IC7L 1PLAA 4DGVH 5AW1B 2QVKA 4JJOA 5T5FH 4M3KB 2VSCA 3UG3A 1CI5A 2ICEA 5GGSB 5EU6B 1QRND 3BRFA 5IESL 1ANUA 2N01B 2X4PB 3PYCA 4Z7VB 3MX0B 3P4NB 5GRYA 1OE3A 3JUYA 4NO0D 3VFMA 5GIRA 4FQCH 4X80L 4DGIH 4DCQB 3ARWA 3QNYA 3ZHDA 4JBSA 4M6ML 1XL4A 2IOIA 2YPKA 2F5BH 4AVHA 5C0EA 1LL1A 4WI6A 1V05A 3HNVL 4XVUD 5F0MB 5C0AA 2WBJB 5IW1B 5ECJE 2P80A 1XXDC 1ECZA 2FT8A 5EBGA 3EGSA 4PM1A 1QLEH 3I3EA 4IDJL 4IEFB 3AXHA 4KMQA 1JSYA 3HC4L 1KTLA 2LAGB 1QPKA 4WFED 2OW6A 3K4DA 2LAAA 4H1LH 4HS3B 4BA8A 1I3UA 4XPFH 3DBXB 3VD0A 1MI5D 2WQXA 2GBVA 5ESQA 4JREB 2YQBA 1EEYA 3G5XA 4OD2B 2VZTA 4NQEA 3BN9C 3TO4C 1AZCA 3G5ZB 2X4TA 3NA9H 2NY3C 2UXFA 4JM4H 1UXMA 3ZZSA 2E9IA 1U93A 5IW6A 4J3OH 4PJIE 4WIQA 3GZPA 4W9FC 1KTKE 3CK0H 4Y1AE 2YEVB 5LQBL 3C8HA 3KD4A 2BNUB 4F93B 2GTZA 4YH6A 2NSQA 3QRLA 3ZKQD 3CX5K 1UM6H 1XCXA 3SDCA 2CLZB 1R17A 4G43A 1MWAA 1GGCH 5C6PB 1TJIL 4AQAA 1FLTX 1TVDA 2X2UA 4NZ8A 3UZEC 3TOPA 4JKPL 1YEDB 3VRLF 3ATAA 4X8JB 1Q9WB 5E7BA 4PJIA 2CH8A 3I75A 1V7ML 5CCGE 3ISWA 5BVJA 1M1XB 1OSYA 1XR8A 4WV1B 4D9RD 2R9HD 2MHAA 4WFGD 3D0AA 1NAML 3ZN6A 3VFUA 2AVGA 5K9OA 2VM3A 4JFEE 4F2ME 1RCYA 5K5YA 3CFTA 2VT0A 4GAYB 5I74B 2WGNB 3B1TA 4KHTL 3ZE0E 5IHBA 2G3NA 3GBNH 3X2QB 1GIGL 4UQ3B 3FHQA 4NPJA 3C75A 3QPXH 4JN2A 3QCUL 3UZVA 4YGVB 4Z8FL 1HINL 3ME0B 1NKOA 2K9UA 1TZ8A 5KUKA 2J8UA 2CGZA 3WJLC 1C5CL 3ENEA 1F11A 4Z23A 3KDMA 3L5HA 1M71B 4PVBA 1HI6B 2NY4C 2YUXA 1KCRH 2R1YB 3N1FC 4P2RA 3BSZH 4L05A 5TFSH 3WI9A 2YKKA 4ADGA 4JO4H 2VKXA 1ETA1 3B2UC 3RY4A 4EDWL 2IEPA 2IXQB 3MLTA 4N8PA 4ODWA 3HPJA 3GWJA 4Y5VA 3VO0A 4O2FA 1XSKA 1UD6A 2KLRA 5L6YH 4OH2A 5IQMA 4WFFE 3UYOD 4CU6A 3NIGB 3JTSA 3GXDA 2B1OA 5CEZH 4U05A 3FQWA 4MJ4A 4FNUA 4O00A 3HMWL 1SZNA 3SPVA 3BP5A 1FGVH 4YK4C 4X6FB 3IPEA 3EHBD 1AFVH 4LRIC 5ENWB 4A68A 4HKXB 2E9WA 3PWPA 1MN4A 2J72A 1JZJA 4W9ZA 4LGPB 1B0WA 2AK1L 4X6CB 1UVQB 4X8XA 4ODWB 5EZOH 2F54D 4FDWA 4DOHE 4QXGL 1BVOA 4NQCE 1I3RB 1HI6A 1M71A 2EYTA 4ELMF 4TF4A 2BS71 3TT3H 2DQHL 3L6FA 4LLUA 4TUUA 1J0KA 6PCYA 4JLRB 1BXXA 1IX2A 1BZEA 3D18B 2OMZA 4PYGA 5MEND 1FO0B 2EIBA 2IWFA 2IDUA 3C5ZC 5AZEL 1XF3B 5C92A 4I5BA 2O1AA 3ARYA 4L0ZA 5CIPB 2EH7H 4TUJA 1AR1B 1IKNA 5DMGC 3P73A 5INCB 3US9A 1MF2H 2CXGA 2AP2A 4PY7B 3CH1B 4K3DL 5H35A 4HQQH 4NO2A 4GY4A 2ORBL 5GZOC 3DX9B 5C6TH 4X80H 4DGIL 2ESVE 3GGWA 4QIRA 1YNLH 4ALAC 4Z77A 4NAJA 4F57L 5T1KA 3ZKXB 2BJML 1P7HL 5GJSL 1WAEA 3K8KA 4PJ7B 5D8JL 5DI8A 3SE6A 2I24N 2BMKA 2DWSA 2PWHA 2Y3AA 5F7MC 2RJMA 1IL1A 1ZXKA 3ARBC 3HC4H 4N2BA 2YKLL 3U2SB 1PZ5A 3Q2NA 5C09E 4XO5A 3AS1A 3CZSA 4LOVA 4OUUB 2PF6A 2ZF9A 2W60B 1ZOXA 4O9HL 1FVCB 3E2HC 3BOVA 1Y07A 1MCNA 1NCBL 5EDSA 4NKIL 1JHKH 1PJWA 4S0TD 2FHCA 3MLSL 1S8DB 4V11A 4NYLA 4Q4EA 4MA3A 4ZFQA 2BFVH 3ALPA 1DCLA 1A4AA 1QFHA 4JG0L 3T8MA 4BQBA 1AQHA 2WKLA 2NW2A 1A6WH 3ETSA 2WIIB 1IM3D 1CLZH 1HS6A 1MHHA 5IF0B 2CR3A 4BDVB 1O9VA 4XH2A 3PWNB 2OW7A 3RVXD 1EAPA 1NGQH 2GJ6D 5A2IH 4GP8B 2NSMA 3KLAB 5I6XC 3B5TA 1UOLA 3KWUA 4OD3H 4J3BA 4FG2A 5ETUA 3UTQA 4NQUA 3DROB 3LRSA 3VWJA 3BUYB 2B15A 1EHLL 4GEIA 3I6KB 5BS0A 4QRTB 3QJXA 4YLBA 1ULVA 1BA9A 4NP4L 3MOQA 3MNVA 4GKNA 1PS3A 3L1OL 3NZ8A 5CJOH 1I7ZA 3HCVB 3QULB 3QYMA 3TN0B 4YXKL 4LP8A 4K71C 1BAGA 4P8QA 2FYVA 1GOFA 4OCMC 1QSED 3QA3B 4Z0XB 3T2NL 25C8H 4MASA 3X1EA 5FO9B 1UTDA 5HI4D 3EH1A 3FZUD 4BYHA 3QI9B 4G7YL 4LCWA 1SDDA 3BESR 4FFYA 2MPAL 4UIKL 3B2VL 4ONHA 2WP3O 2BRRL 5KANG 3VXUA 4MJ5B 4ODBD 3V95A 2OFQA 4ELMB 4TTGA 3MLVL 4JRLA 5J11B 3VW3L 2FJHA 2H7WA 1UB5A 5HHXL 3SE3A 1T21B 2VR5A 3GHPA 2CJUL 3TGXA 4LCVA 3VG0L 4GG6B 2E3VA 2OI9B 1JGVL 2GBTA 5D1QD 1ORQA 3O3DB 4GAGH 3VXUE 3US0A 3DIDA 4OZFA 1OGAE 5B1KA 3NFSH 1ZA6B 2AJYH 2VB5A 4NQSA 1A22B 4Q4IA 1E4WH 2NCEA 4Z7NF 2VLLA 4PBWD 3TCTA 1EEZB 1KELH 2EKSA 4PCKA 3CZKA 5GS0D 5KVFH 1HWWA 4L4TE 4HU8A 3V4PL 1RZKH 3B7UX 4CVWA 4B97A 1GS8A 1ODUA 4K9EL 4QHUB 1CL7L 4YHIB 5HYJA 3EGXA 3MODL 4M7JH 3CFJA 1EZSA 3ZMEA 1KJ3L 2IH8A 4Z95L 5KTEH 3QDAA 3BN9D 5IFJB 5CWSA 1MQKH 2BOCB 1AXTH 2ATPB 3DETC 3KYKH 4PUBL 4TULH 3CH8A 3SY6A 3UIZA 4APXA 4MCZA 2FEEI 3KM2A 1LP9F 1EJOL 2WNKA 4JKKA 3HG1A 1E5BA 5DRNB 4PJEF 3TT3L 4HGKC 5JHDE 1Q94A 1CGUA 3IFNH 3M88A 2Y7OA 2BVEA 3MLXH 5B38G 3WTSA 5SV3A 2B2XH 4GXVL 3V6ZB 5JW4R 1FNAA 4FKKA 3HG4A 1G87A 3CZFA 1J5IA 4ZX5A 1RZ7H 3HZVB 4KZCA 1L9MA 4ZI8A 2IMNA 2IPUG 2WQUA 2C9PA 3LNIA 7PCYA 1CFNA 4JQXC 5A2AA 3TP4A 1D5BA 5BUPA 2VM4A 3B3BA 4ORZC 3HE7D 4HZAA 5IIEB 3LX9A 2LFGA 4QO1B 3O4LB 4YLCA 4KPHL 4ONGL 4JGUA 4DPRA 1FE8L 1PIFA 3ZDWA 3CSBA 3ZYZA 4MNGE 2G2RA 2EH7L 4G72B 5I1DA 1KTJA 2PPCA 4KRPB 5E94B 5KSBF 5KYYB 4BZ1A 4LSUL 1KCSL 4RGOL 4H1LG 4L4VB 2FZ3A 2VO8A 3GIZL 1XBDA 1PW3A 3QIWA 4HWEL 5C0NC 1A6TA 2WINB 2ZX6A 3UROR 4EXKA 1K6QL 5DMJB 2VMEA 1OSZB 4OZ4B 1ADQA 5DD1L 5J12C 1CXHA 3NG5A 1QP1A 2HFGH 3BEVA 2VR3A 2EIKB 4ISVB 4F58H 4Y9EA 4L5FH 4MNHB 4WEEA 4XC1H 4B9CA 4MVBC 3BLKA 5LAPA 4JO3H 4Z7WB 5DUJA 1LJMA 1S46A 4HMDA 4LSRL 4D9RE 3BRGC 1P4BH 3L3KA 1TZOA 4M7LL 3DARA 1JNHB 2PWFA 2QR0A 4XPAL 1BYPA 1U2CA 4MDJB 2CGRL 3FQYA 4Y9GA 3LEXA 4FXKC 3OR6A 4JGJA 2R0LL 3FH5A 1QW8A 4FQJL 2AXHA 4OLYH 5FGRA 2RCSL 1AS8A 2G5BA 2GG1A 4S1RL 4PJEA 5J13C 3QIBC 4A63A 3GJFA 4JREC 2BY3A 3H7BA 3U2JA 3L3OC 4YHZH 2APXA 2LFEA 4OV6F 2XYBA 1EDHA 4H8WC 1I3VA 4RFEA 2DRUA 1M57B 3KPNA 1G6RB 2K70A 1SY6H 3DVFA 1WBYB 1F0LA 4N0YH 1WF5A 2R83A 1D7BA 3S5YA 2XFGB 2E27H 4NAMA 3L2LA 4PJ8B 3OZKA 3ZE2F 1WHPA 2NY0C 4MA7H 5EN2B 3ZE1B 2WAQA 2I9TA 3VFTB 1ZGLP 2G3MA 4M6MH 4NDMA 3Q13A 5HDRA 2WWMC 4AT6B 5D1ZA 3CMOL 1RVFH 5JORA 4CADB 1MH5A 4XR8C 1TJGH 4WU5B 3WL9B 2IBZX 2HKHH 3MBXH 4JDEA 1OZUA 2BSTA 2WLJA 3SDXE 1XT5A 5DO2C 1JD7A 5DD3L 4OFYA 2AI0H 4J3OF 4NN7C 5FM8A 4LCCC 4RSYA 3L48A 1DLHB 4F57H 5AD0B 4AGOA 1AGDA 6PAZA 3MV9D 3Q8AA 3TS8A 3GIVB 4JRXD 5IHHA 2FIRT 3IDUA 3VWJC 3BD3A 4OUOA 3IS0X 4MB5A 4EUPH 4NZTH 2DAVA 1UUNA 1IBGL 4JANA 1MCFA 1YPZF 4NQCD 3SKOB 5TQ2H 1MFCL 1NMCB 1MPAH 5T33H 1LEGB 2EABA 4A6YL 3OF6A 2BY2A 4F8TA 4OGZA 2HX8A 5BJTA 4AKPA 5I15H 4X99A 4X7SH 4ISVA 4MKTA 5I1IH 1IT9H 2EIZB 5H8DA 5IQLA 4P06A 3LDBB 1OTSC 5F9DC 2DLGA 3RIAK 4H0GA 4AXWA 2VDKL 3M07A 4OZ4A 4FD0A 4BIKA 4DP7X 4WW2C 1KGCD 1A64A 1V3JA 4UOW1 3LYRA 5J7CC 4W4NA 2FZ3B 3MNZB 5DWUL 4AMWA 1UM4L 3NJKA 4BHUA 3LEYH 3DURA 3N85L 5ESVB 3G08B 3L16A 1KENH 3FHEA 5I8EB 5L8KB 1O7DE 2VW7A 5LDUA 3A4AA 1HSAB 2RFXA 1E5AA 5HGAA 2F68X 1ZLSL 1NPUA 1T22A 2GJJA 2I7OA 2GAZA 4KGJA 5AVWB 1X9LA 1M4KA 4DEUA 2B1AH 4JDZB 3RGHA 2PTTB 4WW2A 3ABGA 4R9HA 5AEAA 5CMAA 5DK0A 4P46B 4XB7A 2ZWSA 1GZQA 3ZE2B 1IJ9A 1WT5A 4ZPVA 2VTFA 2HLAA 3N42B 5C0DA 2EE3A 4IBVA 3TZVC 2IGFH 1KCBA 2CCVA 1QQDB 5ELIA 3U25A 4X7FC 1S7UA 3MROA 4LOFA 2YRBA 2EUZA 1IAIH 1DJHA 3B1UA 3KPLB 1T0PB 4XNQA 5GSRB 3QIBD 4LVNC 1JK9B 2J55A 4N5ED 5L8LB 4OJYA 4J1UB 2Y7LA 1BHGA 1BVLA 1U8JB 4HIPA 1ACXA 1NCGA 4YWGH 2YKLH 4OLXH 3JV4A 5H2BA 2DOCA 4YSQA 5A2CA 2EIEA 3DVIA 3BMVA 3H3PH 3G6JF 2ZP0T 2Z93A 3CPUA 2ZP9A 3PIQA 3F12B 4MX7B 5T3XH 1JZ2A 1HQ4B 2ICEC 4PJ9B 4QRBA 4OFYD 4TTDC 3NIGF 3DX7A 3CN0A 3HAEA 4Q9QL 2AJZA 4R5VA 2OMVB 3Q2WA 3FL7A 4EDWH 3P1VA 4BH7B 4EN3D 5T1JA 5DLLA 2A6JA 2OX5B 5DD6B 4U1NA 3HI5L 2JCCE 2CO4A 3FSVA 1H0DB 4JPWH 4ZMWA 1CLVA 4IGBD 1OCWL 4M00A 1DQIA 2IAMC 4QXWA 1P5UB 1T21A 2X5PA 2XC8A 2ESVB 3WFCH 3NCWA 5B39G 4PFEA 4UB0H 1FG2B 4ELMA 1FNFA 4F8OA 3VXUB 1MFNA 4DN3H 4F1ZA 5J56B 2D3JA 1XGTA 1CG9B 4IJ3B 4JFTA 1VFAA 4Z7VE 4DP9X 4EXPX 1M3IA 1BEYH 3OKOB 4I0CC 4XE5B 1PLGH 3GTTA 4ERSL 5B39B 1KCUL 5IUCA 1FWXA 3UBHA 2DYPA 4GS7B 3ARZA 2YRLA 1NIEA 3ROLA 4WCYL 1K3ZA 5D1XE 5D1XD 4KNSA 4WTQA 1ZLWH 5EZLA 2Q3AA 3QG7H 3QRGH 1H15B 2KPWA 3PJNA 1N8ZB 1MREH 4FFWC 4XOEA 3SE8H 4XAWL 3LKOB 4GI8A 1C16B 1LDPL 4U1KA 1INDH 1QSEA 3VWJB 3UFIA 1F13A 3KH3A 2AQTA 4LP5A 4LFHD 3M6DA 1INQB 3QWRA 1HSBB 3FO9B 3AWGA 4Z3FA 5CMAB 2K8QA 2XQBH 3C60B 4JHBA 4WW2B 2NQDA 2VN5A 4YO0B 1IAOB 2AV7B 3TPKA 1RJZB 4KVNL 5CJ8A 1D5XA 3MKGA 3TN0C 1IVTA 4HBCH 3AMKA 1AZZC 2J8UF 2YGOA 4GAJL 4DETA 4Y5YB 2R56H 2PN5A 3TVMB 3WUZA 4GSXA 5BRZE 3K6NA 4PI0A 1J1XL 3AJ7A 4BD4A 3VI4E 3ARDD 3MQIA 4NJ9L 3TJHC 1KDIA 4HJGA 1TF4A 4HS8H 1MJUH 1T7WA 5FR3A 2K3HA 2NY4B 3GI9H 3O6MH 4M62L 1IKFL 3ABZA 2FEEL 2HWZL 4MD5B 4BKLB 4XCNA 4ZMOA 3FSOA 1KCVL 2P4AB 1B4JL 1KYDA 1LTXA 1A65A 1NH6A 5EUOF 3C5JA 5LG1A 4Q74A 3FU3A 2AQ1A 5JHLL 1Q90A 1IT9L 1ET8A 5DVPA 5A2LH 4BKTC 4N5EC 4C56A 5DC9B 2ICWJ 4MCMA 1D7FA 1IGIH 1VGKB 3GGWB 2HZHA 5EO0A 4E9LA 5BRQA 5ICXA 2Z4TA 4LRNL 2A83A 3KBFA 1SF5A 3FUEA 3KPRD 2YUVA 3LCYA 3RAJL 1MRFH 3W5MA 1DQDH 1GGCL 3AGVA 1H6UA 2VUYA 4U6YA 1XF3A 2DIJA 5CLTA 1MAMH 2B8OT 4WQOA 2O5YH 4UTAA 4WK0B 2YLHA 4IBQA 4H8PA 1QMUA 3DGCR 2Z4QA 4NO5A 3VQMA 4FCAA 3RVVC 5EZIH 2JKTM 2LU4A 4OZHE 4AENB 3Q5TA 4HC1L 5D1ZI 2KZWA 4ELKA 3B9KC 4HEMA 2HKFL 3DLQR 2HMID 2GCYB 3I9IA 1G7PB 1XGYH 4HS6B 4YOKA 2J1YA 3NAAH 2J21A 4FNRA 4C56B 4OB5L 1CXLA 2HCZX 4IU3B 5T1MA 3T4YB 1ZS2A 1QABA 4NKMA 4LKXA 5FGCB 4OT1L 4V1DD 2V8MA 5I19L 3VD1A 2BIPA 1P0SE 1CLCA 1OAQH 3ZTNL 1QRNE 1ROCA 1MWAL 1VCBC 1YEGH 1ZDQA 3KVQA 3OLGA 5J1SC 5I71B 5F1NA 3AQXA 3IDMB 2D7MA 5CN3A 3LNHA 4XTRC 4ILDA 4XCCL 3ATBA 4KY2A 4WTZG 5EU5B 3AQZA 4ZTPL 4BHUI 2IBGA 2IH9A 2O6CA 1P1ZB 1OT2A 3QQ9C 4ZS6C 3WBDA 2WWKT 4NCC2 4OQTH 5F3HB 4JFZL 2B16A 2NZ9C 3C6LA 3JV6A 4TSAL 1G7LA 5T3XE 1QHPA 1KV3A 4HLZG 2XJLA 3DX4A 1NAKL 3ARDB 1EGJH 2YK1H 5CHNA 4A7VA 2Y2TA 2OA9A 2CDEA 3T2PA 4DP1X 1OB1B 4EOWL 4WUUB 4MSWA 5ADOH 2Z31B 5KW9H 1QZNA 4R6UA 5PAZA 3EF4A 1NMCC 3MRMB 5E8EB 3BKYH 4GQPH 4PJXF 3AS2A 5EZJA 4KMTH 3S2CA 5JYLA 3H6AA 4XX1E 4Q9RL 2QSVA 2N3JA 3C60C 5IESH 4BKSC 4ONFL 3RVUC 2ZUTA 2CO2A 1UB6B 2WKGA 2NY2B 4WNQA 1F4XH 4WO4C 3DECA 4UI2A 2R2CA 2EVJA 2YARA 4OBRA 3KL3A 4LDOB 4E42B 4RFOH 5KBPA 4FTVE 5ITFA 4FQ1L 1G7LB 4QAWA 1CB4A 4UF7C 2ZCZA 1J1OL 1HHKA 1Z6JT 1RFDH 3TBVA 1A9EB 4QHMA 4ZMTA 1U3HC 1MUJA 3OAZK 5TK2A 1DE4B 3UAJC 2ZX8A 1DTUA 4R90L 4W9HC 5DD0L 4PGBB 1C8PA 4I1PA 4HKZA 4JO4L 5FYKL 2R56L 5JO5A 2A6DA 2AJSH 1NLDH 3EBAA 2J5LB 2G5RA 3QUYA 4KZEH 2LGNA 2PP7A 2BWIA 2MWCA 4Z7NE 5D2NC 3RPBA 2AEIT 3GSVA 3KR3L 5AW2B 2C5DC 1X9UA 5KVEE 3ZRCC 1E9PB 5AD0A 2D4DA 3DTDA 1B88A 3O6LL 5JDJA 3D2TA 4PW3A 1DJSA 1IGMH 3F12A 3GMNB 2EIDA 4MD4B 4NKMB 2MCG1 4YXHH 3AAZB 1RUPH 3DJ9A 3NFPA 3SOTA 3DSFH 3C5ZA 4POZD 5GQBA 3MGAA 3O8XC 1NDGB 3V0WH 3S35H 1UWYA 4M8RA 5EMYA 3O6FC 4QRUA 3NN8B 1NANH 2VM9A 3PY9A 2VGLM 4XMKH 4HFUH 3SE8L 3WJJC 4IOSD 5C3LD 5I8CB 4NN6B 4FFZL 1MCCA 1SEBB 5DMIL 9CGTA 1PCXA 3ARGC 4KY1H 3BZDA 4XBMA 1N5AB 3N0AA 4KHXL 3EFDH 3C09C 4Q9BA 4XI5D 4ZQTA 2CO7A 2HTLD 1RU9H 2FX8H 3QDMA 4NQXA 4NIKB 4EIUA 3B34A 4NO5B 5FGCE 4UTBH 1U8PB 3MROB 1WBYA 1RK7A 3FOMA 1I1AC 1QYGL 2XKSA 3L5IA 1JF1A 4LVOB 4TVPL 5AZ2L 2OXHB 3IFPA 4G42B 2Q8BL 3FCSA 4IOIA 4I3RH 3O6KH 3QZNA 3MJ6A 2UVFA 5FM5O 3S34L 1RHFA 2ICEB 4I3SL 2L7EA 5FHAL 4C4UA 3WIHH 3KLHC 3JWNG 1OGTA 3VJ6A 4GRMA 4JDZA 2A83B 4W6WB 4XAWH 3H4HA 2X7LB 3S35X 2DY2A 3DTXB 5IQNA 5AB1A 2DQJH 4WSKA 3UO1L 5AW0B 1T22B 2BOBB 4GBXA 2PLTA 4P4KA 3GSXB 1R3KA 3LKNA 4OD1H 5D7LE 5JNYA 3ZZLA 3X13A 1E3FA 4HX1B 3BW9A 3PAZA 4QWWC 5E8EA 2F19H 3WDHA 1G7MA 2HKFH 1TTAA 4DZ8B 4U1IA 4QRTA 3TV8A 5BS0B 4FFWD 1T3FB 1L9PA 3K71B 2OM5A 1YMMD 3MV7E 4MNGA 4LLVA 2IDQA 2BVPB 5DD3H 4FXGB 4IYKA 1DN0A 2VDMH 1JUFB 3DROA 1W72A 1A6TB 2OMXB 2WINA 3KYMB 3M8OL 5SWSB 5D6DA 4FKHA 4XHJD 3D39D 3OHXB 2BVPA 1K2DB 2F58L 4O51B 4RMVA 3OZ9L 1QEXA 3KLAA 3P11H 1QEWA 2W0PA 4RAUA 3SB3A 1VKXA 3C6LB 3JV6B 2NYZA 3MA7A 1E2ZA 3RAJH 3O3AB 2NNAB 2P26A 4X9HA 3DX8A 1MCPL 3APMA 5F6HJ 3DTXA 3DMMD 5JHDA 3SCMA 5DT1H 1S8DA 1AE6L 4JO2L 2JK5B 2B14A 2NY5H 2ZUWA 3H0TB 4PWGA 2R1WA 4MB3A 1FC1A 4QD2E 3VWKD 2W0FA 2ZWNA 4OFDA 4FLSA 4IRSC 2XTJB 3DJRA 5CJQL 4NM8L 2PW2A 2OXHA 3IFPB 4G42A 5T5FL 3SDDC 5DRZB 4JRYA 5D2NE 1F3JB 1WCQA 3D07A 3LKOA 3MRLA 4YK4B 1BVKA 1NMAH 1IL1B 1WIPA 4RX4D 3QEUA 3F6IA 3NH7H 4NQXB 5G5DB 3P0YL 1UG9A 3LD8C 3QUXA 4CMHB 3RX9A 1AG0A 3AADB 3BH8A 2GI0A 3JBG7 1JXGA 3UAAA 2JCCB 5D7JB 4L5FE 2ZQKA 1ECYA 3JWNE 1MXDA 4HOMA 1FHGA 5F88B 3DX9A 4B41A 3CFJB 3T0XA 1U8CB 2J1ZA 3EHBB 3DA0A 4HHGA 1DVFA 2V2TB 1D5RA 4E36A 3NK3A 2CA4A 4K3DH 2JKNA 3FQUB 2WXHA 5E2WH 4G11A 4ZS6D 5INCA 1FNGA 4YUEH 5GRUH 5J9PB 1UYWH 2NY6C 5GGTA 1SJHA 4JFUA 3KPNB 3VACA 2JB5L 3ETTA 1RULL 1ZA6A 2WLNA 4CBZA 1TIUA 1PZAA 3ZE1E 5EF0A 3R7RA 1AD0A 3QP3A 4GMSL 2FJSA 5F89B 4UQ9A 3DX2A 3RUGB 2O6DA 2XPGA 3EYQC 4Y88A 3W5NA 4X4KA 4X50A 4TLTA 2CHZA 2VLKE 3RZCB 2BM3A 5ICXB 1CQYA 2XRAL 3OR6B 3OKDB 3SO3B 2EYTB 5I1EL 4D2NA 3IF1B 4LESA 3RWEB 3CDZA 1YHPA 1BSIA 3L4XA 4H0IA 3PIQB 4Z7WA 2V5MA 1ZHLB 4HCRH 1FLRL 1I8LA 1EO5A 4X7TB 1MCKA 3KM1A 3VTAA 3LXCA 4HUWB 5GHWL 5EZOL 1O7VA 3FB5A 1HILA 1NGZA 2VDKB 3H3PL 3UH8A 3GRWA 5DD1H 4NZRL 1UKQA 3B3IA 1BM7A 4LIQL 5JXEC 1TZGH 1J11A 5TPWH 4WRLA 5EU7C 2VYRE 2IANB 5MEOA 5TDPB 1Q1JL 4LKCB 1MFDH 2ICWA 5CEYB 4AYGA 4K5NA 2W8CA 1EHAA 3KYOB 1S7SA 5BZDB 4LQFH 5IMKB 3JVGC 3RUGE 3SN6N 2I60H 4BFBD 1JN6A 1G5GA 1NKRA 5C0BA 1FCGA 3QXWA 2LVCA 3W3BA 4GFXA 5DUPL 4K15A 2XA8H 3VSTA 3LZFH 3AREC 3MV7B 4X5PA 3TV3L 3NABH 1RK0A 1IAOA 1NLBL 2PTTA 3LIZH 4LHUD 3TX4A 5C0GB 1ZT7A 1F6FB 1ZAGA 3MV7A 4GLRI 1T83A 3AY2A 2VMCA 4NO3A 1WAAF 5BRZA 3MLXL 1WVZA 4LL1A 3ZKND 5IKCA 2XX0A 1GCFA 4PGDB 5FYLD 2YOCA 3B6SA 1EH9A 2J88H 4ZPTA 1PIGA 2OTPA 3D25A 5C7ZA 5JTWA 2VN7A 4Q6IB 3G08A 2VXSL 5DRNA 3RNKB 4XCEB 4GAYA 2RR3A 3BSHA 4RA0C 5JW4N 1ID5I 4FEIA 4FOMA 2OYPA 4P23C 3I02A 5AVYB 2IO5A 1L7TL 3NCJH 1FVCA 3INOA 3SKMA 4E9VA 4OFPA 5AKRA 4PP1C 5F8QC 3LV3A 1J5CA 2AJXH 2FX7L 3OMNB 2A4EA 5E99L 3EGXB 1TPXC 3EO0A 4KDVA 3VI3E 2WGXA 3Q0HA 4QRSB 1NGYA 1E6OL 3CVBA 5F9JB 3EIFA 1AS6A 3PU7A 1G9EA 5BJTB 3PWUB 4YSAA 5JQIB 4YHOH 5DURB 4WLCA 5CINH 2GTWB 4KXDA 3NFSL 4B96A 4L2LA 3IF1A 4OZHB 3E80A 5LCVA 2YD7A 1FNLA 1KWKA 4A7TA 2GSIA 4IRJD 2EDTA 3SPGA 4RDQF 4K07A 2WQ8A 2XPGB 1JTPA 4LASH 1XGUB 1JZ5A 4BCZA 1HJCA 3L4ZA 5GISH 1IGYB 2RALA 1I9RH 2X4TB 3VW3H 5D1ZC 3S35L 3DETD 1DBJH 3N50A 2KMWA 2DQIH 4EN2A 1Z3GL 4JX0A 2BHZA 1RIUH 4ZYKA 3U6RB 2O6PA 5HGBA 1H6EA 4YAQA 1SDDB 3H56A 2KZBA 3K1KC 3MLWL 1HQRA 2QVIA 3REWA 2XUWA 2P5PA 5KZCB 2Y6TE 3A6CL 3D3VA 2CBQA 4P2RE 2NXZB 1A4JB 3I2CL 1VF5C 3PL6B 2ERJC 1ESOA 1HNGA 4I8DA 5ICYB 4DEWA 3SJVE 3P2TA 5LBGA 1AQDA 5I30H 1C08B 1TQWA 3KEDA 3S9DB 1AYOA 3NAAL 3GYRA 1QBMH 1GYVA 1AKJD 1DUYA 3AQYA 3RZCC 2OZ4L 5C0CD 5JOEA 1FZKB 3AXLB 4PJDB 5IP4A 1R6VA 4FQ1H 5CFHA 5TE7H 2XIIA 5DYFA 1LMIA 2XA3A 4PJEB 5FS5A 4PN6A 3CFCH 5E6IB 3ZIMA 3QORD 1QFWM 2CG9X 3DGGB 3IFNL 2LT9A 1JYWA 4Y4FD 2HTKD 5BW7C 2O61A 4U6XA 4XCCH 3VXSE 2Q86A 3NACH 1JGVH 2I07B 4D0DA 2FAUA 3V5DB 2F1AA 1YUHA 5I1LB 1X5LA 3VRJA 4YPGB 2WWNA 2Y5EA 2EICA 1FC2D 4FQLH 5HI4C 4X6BA 1WE5A 1USZA 2QMKA 2OV0A 4WNSA 4IIZA 1JPSL 4OT1H 1MJJA 4JM2C 4Y89A 1BM3L 4RRPG 4MQ7A 5AW8B 4FTVB 4OUUA 2KUTA 3CIQA 5DHMC 4Y1AA 5FECA 4HIEB 4K5OA 3H9SD 1BOGB 1P7BA 3RPIA 2Y07L 3QZWA 5FOBB 3WIAA 5C7XL 4Y2DB 3EO9H 1M1SA 4JDVB 1A14L 1NINA 1ZHNB 4JY5H 2BVQB 4N90D 4PJGF 2Y0SA 5G4OA 1JWMA 2XZZA 4HZLB 5BCAA 1LO2L 2CRIA 2YA0A 3S36X 1JTTA 1XR8B 4L9LB 2PUQT 5IBTL 4PRDB 1T1YB 4EE2A 3F00A 4M5SA 2QHLA 4POUB 4BZ2H 4F8NA 4OGYH 1M42A 4Z7WF 2MEJB 4YDNA 3FYEB 4M61A 1UT1A 2UVEA 3R1GH 1CXFA 4WDIB 1WS7A 1WFTA 4NNXA 3MSPA 2WXGA 3C6LD 3M17B 1MJ7H 5IFHL 4KKBC 2H4EA 2XTSA 3QG6B 4FS0A 3RVXC 3EYOB 4RFOL 3TYGL 3L3DB 4JPKL 1B6DA 4NN5B 3OKYA 4U3HA 3EYFB 1WHOA 1PG7L 5DTFB 3H1ZA 2HG0A 5AYTA 4A2HA 2FO1A 3Q6FB 1NEZB 3WL9A 1DP0A 4JVUA 1TTRA 4YC2C 2DJSA 1XMEB 1IGFH 2BOCA 4JUTA 4OD1L 1OP5K 4UQCA 1HC1A 2UXVA 3VYNA 1SFDA 4WWKB 4ZUWB 5HJ3A 2NUPB 3MYJA 4TS6A 3KVDD 2IDTA 4LLDA 2Q2LA 5EFIA 1V27A 3QR0A 5ERWB 1ZV5A 3S97C 4I1RA 3PJLA 2YUZA 2ADYA 1JBJA 3MRNB 1GY2A 3M86A 1UT9A 1V55B 3D3VE 4YLQT 2BSBA 2EKSB 3OAYK 4I48B 4CGTA 3I84A 4MXWH 5D55A 1HKLH 2Y7QB 4CSZA 1E6JH 1EWHA 1KELL 3CFEB 3TONA 3VXSB 1X9RA 4PJAF 5KYWA 2YXVA 3BVTA 5DMKA 1R47A 3FQWB 3SHSA 1N3NB 4MYWB 2F7IA 1AQKL 2XZQL 3D4YA 5AOLA 1OAYH 3QUYB 3U0TB 3MRHA 5HPMB 5DHYA 4Y5XC 4HCRL 2H26B 2Z9TA 4GAJH 4JL1A 3STLB 4DP0X 3QCTL 4HSQA 4QCIA 4P5TA 3NABL 2P80D 1QR1B 2E8YA 5F21B 3NIFF 5FO8B 3CZGA 1BZQK 4D8PB 3D50A 3B56A 4HEPA 3VGHA 3CTTA 5I71C 3ATFA 5F1IA 2VDLL 1CE6B 4NN7B 1HXYB 4AE1A 5C2BL 1YEJL 5HGHB 1UASA 3TTSA 3BFOA 4X5QA 1A4KB 4PMFA 2R39A 5HI5C 1SXSA 2FBJH 2VLKB 4WI5A 3RGBA 3BZEA 1ZVNA 4MRCA 3BAXA 2J1KA 3BXNB 3IN0A 4WFHE 3VI4A 3KNBB 4LCIH 5E2VL 1CGYA 3NP3A 4J3OG 4O4YH 4BK5C 1WEJL 1RIUL 15C8H 2NNCA 5E6YA 1A3LH 3C5SB 3JV0A 2HT2C 3RX5A 1CD0A 3CXHJ 4LBEB 5CBEB 4BSWA 1AGBA 1JMZA 1QO3A 3STBA 4KO5A 3WU1A 1KGXA 5ETUB 3UTQB 3I50H 3MFFA 5D6DC 1U0QA 1IAIL 2OZ4H 2VR9A 3FQRB 3FAXA 5JPMA 2YD6A 4AQ1C 3IMTA 3HNVH 1P84J 3CGTA 2R4SH 5TQ2L 5JW5B 1LEGA 4HGWA 3SDCB 2DQMA 1IBGH 4WTZA 3DUUA 1E30A 4OLVL 1RZQA 4LLWB 1YUKB 2X6AA 4P4KC 5HYEA 2WSPA 3QJTB 4JANB 1F2QA 4OU3A 3ZTJG 3MXVL 4K7PH 3D39B 1JPST 5AOJA 5I9QC 5F1NB 5F3FA 1J5HA 1VACB 1TZGL 2BNQE 2E7BA 5EORL 4JFDB 1NMBL 2MKWA 2O4EA 2QL1A 2VXSH 1UXWB 3LIUA 1FVEB 3NTCH 4TNFA 2F74B 4MXWL 5KVMC 1CFBA 3FCTA 4A7GA 3VXME 3DBXA 1JGLL 1K4CB 2Q20A 3T4YA 2ICWI 3IBOA 1FFPA 4KMLB 3L3HB 3NDZE 5B4MC 3BAKA 2WVTA 1KTLB 5J12B 4EKXA 3ZTDC 2XQ0A 1KJVA 5JZ7D 2VZ1A 4GUCA 3RKPA 2GHZA 3X3GL 1NCDL 3P9MA 2Q9OA 1NGXA 4OZFB 2YD1A 3O4OB 1NBYB 5H35B 5HYJD 3BUDA 2G3ZA 5KJ7E 3EFFB 3VGBA 3RPKA 4AL8L 1N26A 2NY5L 3RGVC 1SXBA 4YC2B 5CIPA 1V7MH 4FQXC 4GW5A 3QDJB 4GMTH 1USQA 4MGXA 5KG9B 5E2WL 4XN4A 4PAZA 1T7VA 1RH8A 3BEWB 3FN0L 4QRPB 3TIEA 5M94B 4N0CD 4KWUA 4FADA 2NOYA 4FQHB 5FO9A 3GKZA 4NUGH 4YZFE 2JNZA 4U1LB 3M7FB 4LSTL 3K8MA 3ZKMD 5D5MA 2ENSA 3E1F1 3T4AB 4MDJA 3DOHA 1YNTF 1TPXB 2DQCL 4M3JA 1J1PL 4QOKA 3FUDA 4Y19E 4UV4H 3C5XA 3EUDA 1KIQB 1MLBA 2K6YA 1O5PA 2Y07H 1SHWA 3RVTD 2F1BA 2H26A 2PYEA 5HHPB 4MAYB 3OQ3B 1M56B 3SPVB 2VLRE 4Z76B 4L4TD 3TZVD 3SQRA 3S3JA 4E9TA 2XBTA 4IRJC 1RZJL 3QQXA 5IK3A 3MUGA 5LGYA 3MV9A 5DSCA 5L6YL 4XXWC 3BGAA 2ZOOA 4U6HB 3VDAA 1EAPB 4NWTH 5H4YA 1MCOL 2J8OA 3CAFA 4M4RA 2WLKA 3T9WA 2G75A 5KS9E 3VWJD 1IGTA 4X6EA 1S9XB 5EUOB 4UINL 2Q10A 2WB7A 4NM4L 3AQDA 1HT6A 3LPWA 3MRBA 3J2PA 1K8IA 1EEUA 4W1TA 1HXMB 4FAAB 1A14H 1SJMA 3W9DA 1JVKA 5HHVL 4PHZA 3MREB 2R69A 3LIZL 3UADA 2UZPA 1KEGL 2NR6D 2X09A 2HSIA 2DDQH 5HJDA 2HFFA 1EUUA 1GY1A 3BAWA 3V0WL 3TA3D 3ARBA 1OARH 5FUOL 1AO7D 2XVBA 4KAQH 4MQXC 2YXWA 5CGYD 3KWVA 4MBOA 5K39B 1Z9LA 4TVUA 2R9HC 4JHVA 4DHLA 2H9GA 2DYPB 4MQSB 1SEQL 4N90E 1CBVH 2WCPA 3QJQB 2VXQH 4JFFB 4Y0GA 5GZND 5BVJB 2P8MA 5AW4B 3OG6B 4NBZB 4DKEH 2DYRB 2J1WA 3QZPA 4HZ1A 1E3XA 4DWHA 2VR7A 3UDWC 3I6GB 2DM7A 3F2LA 3HZKA 4J28A 1H3TA 2Z35A 3K6OA 4K5LA 1U8QB 2OYKA 2OL3H 3QZWB 5FOBA 1ZT4A 5L9DH 4OM1H 1BEXA 5B8CA 4MZ3A 1W9XA 1JGUL 2ESVA 3K3QA 4JPVL 3QSKB 4AIEA 2XKUA 1MNUH 2KQMA 4WO4D 3I50L 2DWTA 4KBPA 2WK2A 2BVOB 4BXVA 4Z3JA 4QRRB 1MOEA 3KPSA 3PV6B 4GIOA 1RJLB 2ZYIA 1OP5H 1P4IH 1SYVB 1TQSA 4JRXA 4NQVB 3FU5A 3V4VH 1VEPA 1QFWL 5JQHC 1LK3H 4Y4KC 3L7EB 2MCPH 3ABMB 4H88L 3O4LD 3MXVH 3HUJF 2Q86B 2I32A 3ZHKA 4HU2A 5I8KL 4N5UA 3R7QA 1IBDA 3TL5A 2VW4A 1ZS8B 3FB8A 4QOKD 3L3GA 5DEFA 1UJTA 3GNMH 3LH2L 1KB9J 3Q01A 1MDAA 3V4PB 3HMXL 2VDRH 1XAKA 4ACPA 4XMZA 4GW1B 2UY6A 1CFMA 4DW2H 3BP4A 4Q9CA 4G8IB 3JTSB 2PPFA 1ZLUH 2DH2A 5ICUA 4NXKA 4XRCB 1M2VA 1QACA 1J18A 3VG9B 4WF7A 4MXQC 4HJ0D 2FQGA 4U1HA 2W5PA 5H37H 3BE1H 3TNMA 2JQMA 3RG1C 3TN0D 4KUCD 5KAQG 4AYFB 5GS0H 2JIXA 2QELA 5F9OL 5I16A 2CO3A 3I6LE 3ASOB 3T6ZA 1K5NB 4U2YA 3A23A 3T4AA 3OL2A 1KMGA 1A0QH 2NNRA 4GEJA 3K5SA 2BCMA 3VFGL 1A3LL 1HHGA 1ES0A 1G9MC 1WWBX 3AT8A 4YHNA 1C12A 2QPFA 1JGDA 4LCYB 5CO1A 4WUUD 2BVYA 4YEEA 2WOYA 1ZT1B 3AT9A 1TDQA 4XTRD 1BZDA 2ADIB 3FFCB 4Y5XA 1A7PH 2W91A 4P4RB 1OPGL 3U83A 4XO8A 4N4YB 4WFHD 3FFOA 5CFAA 3TASA 1C7SA 2AXGA 3T2NH 4Y4FA 2ZUUA 1UD4A 3QEQE 4GJTB 5EO9B 3KLHD 1G94A 1ZHBA 2D0HA 4HPOL 5IB4B 5DHXB 2RD0A 3FPXA 1WH0A 2YO3A 1AG6A 4ORGB 3BYTA 1WTGT 3M46A 2DQDL 3VI3F 5IVXB 4LT7A 1KC5L 1DQQB 2FT7A 1NJ9B 2W0LA 2YQGA 5E6RB 3VE0B 3X3GH 2CKBA 5ADPH 4FE9A 4NFCA 3QFJB 2FSDA 3E1ZA 3W0WE 1U30A 1NGPH 3F83A 4JB9H 1AQKH 1NGYB 4GAGL 4G80A 5FW7A 3HG1D 3HG1E 3ZZ1A 2AJVL 5FEBA 5T5FA 1WWCA 1JGEB 1KLUB 4JPQA 1PQZB 2GTZB 3VRIA 1H6TA 4IHOA 3W39B 3W37A 4F5CE 2FH8A 4LLMB 2P8LB 5IVXA 1JRHI 1NCJA 1R0AH 5HD8D 4YDLC 4DN4L 2CGYA 1QSFE 4WU7B 3IDIB 2UUDK 4JFXB 5ABDE 3GIVA 1IVLA 1XH1A 2VH5H 4LF3A 2VOTA 4ZPTB 1VFOA 4OBSA 2VLRA 5EU3A 4LEBA 3M7OA 3MBED 1CFSB 3SDCD 4F7CA 1NOFA 5AAWA 5KYNA 2ZCHH 1G0YR 5EN3A 1RKRA 4HV8B 4AQEB 5CJXA 1HIMH 5LBSH 3MLUH 4RMQA 2H0JA 5AALA 3A21A 3MPCA 4DK6A 1BF5A 2ZSWA 3L1OH 4OVVA 1NM9A 3CJJA 2K7PA 4OZGE 5J3HD 2C9UA 1UM5L 1Z66A 5AWNL 2OYMA 3HEIB 5B3JE 5KEZA 3G5VA 4PH8A 5CP7B 3K1DA 3FRUA 4KC3B 1GC1C 5DGRA 5D1QE 4DVBB 5FKPB 2QHRH 3BWAB 1NPJA 4HEME 1KG0B 2DF3A 1S7SB 2K45A 3KYOA 4NUGL 2P42B 3UEZA 3WXVL 4Z3EA 1BQRA 1Q0XL 3QNXB 4LCWE 1AXSA 3KPPA 2JI1A 1E4HA 5ID1A 4Z1PA 7FABH 5BVPL 4G7YH 5J6HB 5JUEH 3NPSB 1T1ZA 4ODUA 4YHYB 5DO8A 3FJTA 1MWAH 1RD6A 3KEHA 3PGDA 1JCVA 1T5WA 5CJ5A 3BSGA 4L48A 4BWTA 4YXKH 1J7VR 4NFBA 3FB8B 3ARVA 2YD3A 1PBYA 4YDMA 2VC2L 1WIUA 4X4YB 4ZTOH 5GGRB 5BRZD 3PGCB 1YEEH 2FH6A 4R4FL 1PF3A 3S37H 3BLPX 2NY5C 1FNSL 3WTWA 4FXLA 3IMBA 3K8LA 3A22A 4I0KA 4RAVB 3VD5A 3WYRA 3PHOA 4BQ8A 5LXVA 1NBZB 4C56E 4Y5VC 3WAJA 3PV6A 2C4FT 3CC5A 1NWPA 1OE2A 3OGOE 4HIXL 4LSPL 4R8WL 4UZUA 5LB1A 5HPMA 3BUIA 4YGVA 1AOHA 1G4RA 2DIEA 3TEWA 4HIHB 4PRPA 3RDTB 4FZEL 5ID1B 3I85A 1DANT 1IIKA 5FXCH 3DIVA 2Y7QA 3DRTB 4GW5B 2FIKA 1KBGH 3AFLA 3QXTA 1QLRB 2QDWA 4DT2A 1B90A 3HZKB 5BS0D 1U8HA 2LLGA 1KGJA 3P9LB 4JCMA 2AQ3A 2AAVA 1GSKA 2DBLL 3ESNA 4J3WA 2CNZA