2BP0B

M144l mutant of nitrite reductase from alcaligenes xylosoxidans
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
335
structure length
335
Chain Sequence
b'DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGLSGTLMVLPRDGLKDPEGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
molecule tags Oxidoreductase
source organism Achromobacter xylosoxidans
publication title High Resolution Structural Studies of Mutants Provide Insights Into Catalysis and Electron Transfer Processes in Copper Nitrite Reductase
pubmed doi rcsb
total genus 87
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2005-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00394 Cu-oxidase Multicopper oxidase
B PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bp0B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bp0B02
4KOCA 1IBYA 5A7EA 3DIVA 3AY2A 1N68A 1NWOA 2XU9A 2DWSA 2IH8A 5I5MA 2YARA 1L9PA 4E9SA 2ZONA 1ASQA 1PNCA 1PLCA 4YSEA 1ASOA 3IBOA 3SBRA 3EH4B 1E67A 2EIMB 2YAFA 5B1JC 4UF7C 2WO3B 3OM3B 3PAZA 2CJ3A 2CUAA 1JZIA 1AR1B 5B1AB 4GYBA 2UXVA 2BZ7A 3DKHA 1OE2A 1SF3A 2Y69B 2HX9A 2OJ1A 1SF5A 5LDUA 1A65A 4Q8BA 1NINA 3TU6A 1NDTA 2GIMA 2B3IA 2WSDA 3V9EA 3CVCA 1PY0A 1KCWA 3FSZA 5I6KA 4G72B 4P5RA 1HAUA 3WNJA 1OE1A 1J9SA 3NSDA 2GC4C 4YVUA 4DP2X 1GR7A 4M4RB 1J9RA 2FTAA 1JOIA 1J9QA 1RCYA 2EIKB 4DPCX 1MZYA 2XVBA 1JERA 3S3CB 1QHQA 2XX0A 1XB6A 1OV8A 1AS6A 4N4YB 3D12B 2X88A 3NP3A 2VN3A 4E9YA 2PLTA 1TEGA 2PPFA 4RH4A 1HFUA 2R7EA 1BQKA 2I85A 3AZUA 5B7EA 5TK2A 3IE9A 4KNSA 3PCYA 3ABMB 1SHXA 4KO6A 1AANA 4KNTA 3PLYA 2BP0A 1NIBA 2YQBA 2XYBA 1OOWA 2FQFA 2PP7A 5D4IA 6PCYA 2J5WA 2PPAA 2YAQA 2VM3A 2UXGA 5I6LA 1V10A 3FYEB 2I7SA 2N0MA 1RKRA 1KBWA 1ZPUA 1SFHA 2AANA 2FWLB 4E9TA 2UXFA 1ID2A 4DP4X 2XUWA 4W9ZA 1XB8A 5IY5B 1A4BA 1M56B 3FU7A 1QLEB 2BP8A 5D4HA 2PPDA 1CYXA 1XB3A 3V9CA 1NIDA 1GSKA 3X1EA 2YAHA 3SQRA 3FU9A 1RZPA 2XLLA 3UAEA 1PLBA 3X1BA 5EHFA 3FSAA 2VMJA 3EHBB 1TEFA 3ASOB 2UXTA 1AAJA 1PAZA 4HAKA 3T6WA 5B1JA 1ILUA 2H3XC 4A2DA 4F7KA 3QJQB 3CVDA 3S3BB 1AACA 9PCYA 4HIPA 1AS8A 4YL4A 4BXSV 3AG4B 2X87A 4KNUA 3QJSB 2PCYA 4YSRA 2XV3A 1AG0A 1GY1A 3H4HA 4E9VA 2FQEA 4ZK8A 5I5JA 1GYCA 3TASA 2HXAA 4L0PB 3MX0B 2GC7C 1IC0A 2IWFA 2DY2A 3OD3A 4CSZA 4DP6X 1MDAA 3NSFA 2AZAA 3NP4A 2P80A 4HHWA 4A67A 3SBQA 1A4AA 4ENZA 1ADWA 2IH9A 2FJSA 3NJNA 4YSUA 1I53A 4YSOA 3NJKA 4AI7A 2UX6A 3NT0A 5PCYA 1GS8A 1BYPA 1JVOA 1W8EA 4HCIA 1BQ5A 2QPDB 1ZDQA 2XXGA 3WIAA 4GY4A 1J5CA 3CVBA 3ABGA 2H5UA 4G71B 2FQDA 2IDFA 2QDVA 3GXUB 5B1KA 4NB7A 1WS7A 3FU8A 3ZX1A 1CURA 1OE3A 4E9RA 4DP0X 3WI9A 4AKQA 1JXFA 3FPXA 4YSTA 4G7RB 4YSDA 5AFAA 1ASPA 1TU2A 4HCFA 1EZLA 1TKWA 4E9XA 1A3ZA 1NTDA 2JFCA 4QKTA 2PPCA 2XWZA 3X1FA 4JKNA 2NRDA 3X1GA 4A66A 1GW0A 1PCSA 2HRHA 1R1CA 1FA4A 3G5WA 1J5DA 2QDWA 1YLBB 3NSCA 4HCGA 1OCOB 5I26A 4DPAX 3FS9A 3BVDB 1ETJA 1A8ZA 1BEXA 3PPSA 1NIFA 2VW6A 3ABKB 5B7FA 4YSCA 1KGYE 2LLNA 3S8FB 5F7BA 3FQ2A 3WKPA 2YXVA 2DV6A 3FSWA 2GHZA 4F2EA 4FAAB 1NWPA 1E5ZA 2HRGA 1BQRA 3HEIB 3AG2B 4K9JA 1WS8A 3PAVA 2BO0A 5D4JA 3UAAA 3TBCA 3NSYA 1ZIAA 4BDVB 1J9TA 1GS7A 3AG3B 5I6OA 4DP8X 3QQXA 2BW5A 1SJMA 4KO5A 1PZCA 3WKQA 3CG8A 2DWTA 2PP9A 3JT2A 3OMAB 4X4KA 3TBBA 3GDCA 4G70B 3C75A 2GI0A 5I6PA 3NJHA 3NJGA 4UAHA 2BWIA 4DP1X 3ZIYA 2P80D 3OQRA 5I6NA 1XMEB 1NPJA 1AG6A 1BYOA 4WTQA 2IAAC 3MBWB 2BHFA 1NPNA 1ZDSA 2CBPA 3H56A 2AFNA 1UATA 3NJMA 7PCYA 4HZ1A 3EH3B 1W6LA 3FPYA 3NJLA 4A2EA 2R7EB 2A3TA 1IBZA 4E9QA 2GB2A 1SNRA 4M3HA 4YVNA 5TK4A 1KDIA 4GP4B 1L9SA 3RYMA 1FFTB 4W1TA 4A68A 1OCZB 3UACA 3EH5B 3ERXA 1NICA 1AZUA 3ABLB 2BP8B 8PAZA 1E5YA 4DPBX 2YXWA 3ZDWA 3QJVB 4HALA 4KO7A 1QNIA 1MZZA 2RACA 3NYKA 3QJUB 2W88A 4PAZA 3OMIB 1IKOP 2XXFA 5B7MA 2YAOA 5I5IA 1M57B 2J56A 2QT6A 3T71A 1GS6X 1PMYA 5AKRA 1E65A 1HAWA 1OF0A 3L45A 1OCRB 1KV7A 2W8CA 3WNIA 2HX8A 1AZCA 1NZRA 1N70A 1F56A 3QJRB 3S3DB 3X1NA 3GYRA 1MG3C 3ASNB 3N2JA 1X9UA 5B3SB 3NJIA 1BXUA 1JZEA 1URIA 3KW7A 1L9RA 4GXFA 2EILB 3DTUB 4HHGA 2HX7A 2PCFA 3QJTB 1V55B 3IN2A 2CALA 4KO9A 1BXVA 1WAEA 3JTBA 2OV0A 1KCBA 1VLXA 1L9TA 2J55A 4AKPA 4BDVA 7PAZA 1JZFA 2CCWA 2Y1AA 4A2FA 1A4CA 2AZUA 1B3IA 3UABA 2BZCA 2H47C 4BK5C 3CDZB 3FQYA 3IEAA 1ET5A 4AZUA 1JZGA 2Q5BA 1JVLA 4GP5B 1MG2C 4CSPA 2BP0B 1DYZA 4UANA 3UADA 4GP8B 5B1BB 2I7OA 1FWXA 4P5SA 1CUOA 1JXDA 2ZOOA 2GBAA 4YSQA 5F7AA 1GY2A 3NJFA 1KBVA 3KW8A 3OMNB 2IWKA 1AIZA 4A2HA 2PP8A 4BXVA 4DP7X 3NJJA 4KOBA 3PAUA 1SDDB 3FU7B 3EF4A 1E30A 2GSMB 3ZBMA 2EIJB 3T6VA 4YSAA 1PZAA 1ZIBA 2JKWA 3IN0A 1L9OA 1EHKB 2OCCB 4TXVB 2YAPA 3N55A 5FC9A 2XV2A 4Q89A 4YSSA 4FA7B 1CC3A 4E9WA 1ILSA 3H4FA 3T6XA 4F2FA 3CZUB 3FSVA 3WG7B 1SHWA 4DP9X 3SBPA 2YAMA 3FT0A 4A2GA 2FQGA 1NIEA 4EF3A 1T5KA 3S8GB 4BWUA 1PNDA 1DZ0A 1PZBA 1PF3A 2VW7A 5AZUA 2BW4A 1PLAA 1W6WA 1M9WA 4G7QB 4DP5X 1WA1X 6PAZA 3T6ZA 5I28A 3BQVA 2CAKA 3HB3B 2IDTA 4AX3A 4PCYA 1V54B 4NAJA 1AOZA 4N8UA 1WA2X 1JZJA 2FNWA 3U25A 2DYRB 1KDJA 1BAWA 2ZWNA 1ET7A 1OCCB 2VSKB 2XX1A 2B08A 2TSAA 4MFHA 4BWWA 2XV0A 1ET8A 1L9QA 2IDQA 1KYAA 3T9WA 4QLWA 2WO2B 2TSBA 3CDZA 2BWDA 1AZRA 4G7SB 3FQ1A 2FT7A 2IDUA 2HLEB 5I6MA 4BWTA 2QPEB 2FT6A 2UX7A 1WA0X 3AW5A 4YSPA 5ANHA 3TA4D 2DYSB 2VM4A 5E9NA 3QPKA 1AS7A 1ZV2A 2IDSA 1AQ8A 1SFDA 2VSMB 2J57A 1AZNA 1JZHA 2FT8A 1NIAA 1X9RA 3UGEA 4NERA 2HZHA 2VW4A 1CYWA 2AVFA 1BXAA 1SDDA 2Q9OA 3FYIB 4JHUA 3PXLA 3X2QB 4AKOA 1JXGA 4JHVA 2ZXWB 2IWEA 2MRYA 1IUZA 2PPEA 4WKXA 1RZQA 2YAEA 2E86A 1AZBA 2JXMA 2EINB 5PAZA 2MTAA 3AG1B
chains in the Genus database with same CATH superfamily
1G6RL 1X4YA 2R83A 4H2AA 4Y5XC 5E4AA 4OGYH 3N43B 3QAZB 4MTMA 5AB9A 2EDMA 4Z0BL 4WUUB 4OI8A 3MYZA 1LWHA 4LLMA 2CRYA 3W81A 2FL5B 3FCUB 2F53A 4WY7L 4OLVH 4Q14A 1DBJL 1E67A 5AZEH 3N3EA 4ZRGA 1Q94A 3D9AL 1V5JA 5H2BB 4ODWA 1ICTA 2DKSA 4G6FB 3VQ2C 2P8LA 4HG4K 4YN3A 2F7OA 4Z7IA 1KTCA 3KPSE 4AYSA 1Q72H 4NHUB 1YQVL 3RU8L 4H26A 3PS6A 4OW6A 5D96B 2JJVA 2MPAH 1R4XA 3D18B 1YMMA 5D71H 3F7VA 4TTGA 3HZYA 3E9TA 1XGRB 1RZIB 3TBSB 1QFWL 3L8QA 2AXGB 4PJ8C 1N9PA 1R0AH 5HDBF 1QRNB 4RFEB 2Q10A 5C0CE 4X7SH 1DBMH 1T1WA 1B90A 3DVFA 5H4ZA 3KLHC 3VFGH 3S3CB 5TDOB 1T22A 3UTQB 3VFUB 5DWPA 3T65B 3U7YH 2J8OA 2QR0B 2Y2YA 3NP3A 3VWJC 2VN3A 4WAFA 2YLHA 4J27A 3F62A 2WLLA 4J8RA 3RAJH 2ZG3A 5IJBC 1FZOB 2XTJD 3DXAA 4LIQL 4JK0D 4XN2A 4RAVA 2G75B 1WDAA 2YEQA 3LHPH 4I1RA 4PY8I 3P2BA 5I1EH 4HFUH 4OZGA 2YQBA 4QRTB 5HHOA 4PG9A 5D6DC 1NJ9B 3AT8A 5B3NA 1N10A 3OWRA 6PCYA 2PPAA 1ADQH 4IW4C 4ONHA 2YN5A 3EGSA 2WWMC 5A16B 1L3WA 4GKSA 5E4EC 3BFQG 2QKIA 4YBQD 3HI5H 5BOPA 3ARPA 4MGXA 4EVNB 3ZE0B 1IBGH 1ZT4B 1MJJB 2AV1B 2CO6B 1VADB 4MJ5B 2O30A 2BMKA 1TO4A 3QUYB 2N1TE 2MMXA 1HHHB 1AGCB 3FUHA 1FNAA 5DWUL 5HDQL 5K9OB 4S2SA 1QATA 1TJHL 3ULUD 3HNVL 4FXGB 4M02A 1PLBA 3IVKA 5DFTA 3EHBB 1JHKH 2C9SA 4M43L 1AAJA 4F7TA 1WHPA 4KVCH 5FK9B 3QK0A 4S1QH 2A9DA 2IH1B 1XF5B 2CIIA 4XXCC 5I2IA 4YHZH 3FKUS 2X6AA 3CN4A 1YDPB 3KR3H 3QR0A 3IXAA 2CCVA 1VSCA 1J8KA 1G6VK 4D2NA 4PVMA 4RMBA 1FGVH 4NI3A 4BA0A 5CEZE 2ZCHL 3ILPB 4WJ5A 2XTLA 5KBKA 1AG0A 4ZUVB 1NEZG 4U6VL 4A6YB 1CS6A 1DCEA 1QVOB 1XEUA 2ZNWA 3OXRB 8FABA 2ICWB 3MKGA 2ADJA 5A3IC 2JMRA 4PJFB 1JHLL 1S6NA 3EH2A 3C6SB 3KHQA 1ZJBA 5I8KH 4EUPB 2VLLA 3KCPA 4YIQA 3VXRA 2DY2A 1QLEL 2Y07L 1YEFH 3OG4B 4AMKH 4JM2F 5DR5H 1LP9F 2Q7NA 2X4QB 4URTB 4WV1B 5EN3A 4WI7A 1RLBA 4LVHB 3QFJD 2A6KB 3RKDC 2HFEA 3K71A 1BG1A 1LE5A 4NAQA 2E6PA 1QI5A 5IEHA 3WIAA 4JPWH 4ZFZA 2X2JA 1SLXA 4MB1A 2NR6A 4M4RA 4WFGE 1NGXB 3VFNA 1Y07A 3TEYA 4Y8AA 1WS7A 4U1JA 5D1ZI 3FU8A 3GMOB 5IJVA 1A9EA 1EXGA 2HSIA 1JNLL 4M48H 4APXB 4JFXA 4HUCA 1GXEA 2K7QA 4OLZL 4R26L 1A6UL 4QNPF 2Z91B 3CFDA 5DU7A 3PNWA 1ECYA 4NQEE 1NTDA 1YN6B 1IB5A 4NIYE 1OD9A 3BW9A 1FI8C 1VFUA 4PP1C 3GMRB 3FQRA 3ZE1B 3RVXC 4OI7A 1M42A 4OCRL 1S7XB 4PJFF 1HEHC 1U8LA 2V7HB 2YEVB 3CH8A 4AZ8B 3HFMH 4IM8A 5DTFB 4K2UH 1MDTA 4X9BA 4M7JH 4X6CE 1LE9B 5CJQL 1XF3B 2BHUA 4DPAX 3K74B 5I18L 2JCWA 1A1OB 1BEXA 1PU0A 2P8LB 1DVFB 4QHPA 1G5GA 2M26A 1JDDA 5K39B 1CFBA 1T21A 1RMFL 4G82A 2ROXA 3RGVB 5IG7B 4KC3B 1S7SA 4QEGA 1ZANL 1M1XB 4ENEC 2BSTB 2FWOA 3AG2B 2GJPA 1KJVA 1FC1A 1MCRA 1WTLA 3PAVA 3ATEA 1ETZB 4KKBD 2X4SA 5C0CA 1G1OA 5D4JA 3RIFK 2YD1A 2AI0L 4ISVB 1NDMA 5IW1B 4AYFA 5CO1A 4Y16A 3UTPE 4FZ8L 5JOPE 2VUYA 4TNVF 4YQXH 5FIEA 1OQOA 3ZW3A 1ZHKA 3B3BA 5MERA 2DQGL 3QUZB 4JKMA 4F8QA 4NEHB 1SEBB 1X9QA 5F7KC 1OGAE 4G6FD 2CIKB 2HT2D 1D5ZB 3SKOB 3GM0A 3ZTDC 4BQBA 4HJEA 5EOTA 5IJKC 4EQ3A 1QEWB 3VYNA 3HCVB 4HUXB 5E00B 1ZLDA 2H1PH 3QXDB 4WENB 4B0MM 5LUMA 3UTTB 4J23A 1KNOA 2EICA 3N9GL 4HX1B 4HKZA 1M05B 3UTZB 3LQAC 1JI1A 3IETB 2H8PA 3OR6B 3KJ6H 4DOHE 1JK9B 7PCYA 3QDAA 3P4NB 4A2EA 3EYVA 3QA3A 4FLRA 3EO1A 1N59B 5I8CB 1HEZB 3V0WH 3BH4A 4WWKD 3QXTA 4Y4FC 1GL4B 4M3HA 4HD5A 4NQQA 4TS6A 4W1TA 3V7AE 4N5UA 3SKNA 3LB6D 3MJ9A 5BMFH 1F4AA 4MYPA 1H9DA 3ABLB 3BZ4A 2X2YA 2HG5B 5FYLD 1MVUB 1WFMA 1YY8B 2B4CL 3I3BA 4FQCL 4WK0B 1AKPA 4MQXC 4OSUL 1CVRA 1HS6A 4GNKB 2B59B 1OSZB 2V9RA 3JWDC 2D4DA 1NCBH 2R2HA 3L9BA 3TFKD 1G6RA 2KI6A 4BGLA 4LXFA 4HCRH 1RZKL 2BDNL 4OUOA 4ANXA 3MX0A 2OMVA 3MFFB 2HVJA 2DQFB 3QUKA 2GUOB 4N28A 3CDCA 1YN7B 5BZWB 4ZFFA 3ASNB 1KCSL 3VH8A 2KBGA 4MA7L 4B9CA 1MOEA 3Q6FA 4JVUA 2X4UB 4XBMA 2HT4C 3QEQB 4RGMC 3CFEA 3V6OC 1RK0A 1URIA 4FKEA 5C6TH 2EKSA 3TA3B 4XXWA 5DYFA 2HVKB 1A7RL 3HC0B 1DBJH 1NGWA 1JWMA 3KAAA 1IFHL 4Q2ZB 3VX0A 1SJEA 1Q0EA 4OUUA 1FV1B 1DQQA 1T3FA 1LHZA 2IH3A 1BXVA 1UFUA 4N1EA 2DJ4A 5J89A 2ADGA 4U1IA 3CSTA 3SQBA 4QXTA 3QHFL 4GRWH 1X5YA 2BSCA 1BD2E 2OJEA 1A4CA 2PCFB 3VFMB 4YX2H 3I9PA 1KB5B 1BX2B 1H3PH 1TLMA 3HE7A 3IF1A 3IJSA 3ARBB 4YHOH 1YEIH 1AFVH 1YEJL 3VG9C 2CDGA 4OJFL 3ZKQD 5JPMA 2EDRA 1TTAA 4GO6B 2MPAL 5B4MC 3ARZA 2VXQH 5DYOB 3BAXA 3DX1A 1GA2A 4YJZL 5EU6B 1FORH 1MG2C 4P2RA 5CLZA 3MGAA 4Y5YC 4DUWA 5L2KA 3UTSD 4M1DH 3ZE1E 2F74B 2X4PA 1R0AL 3G9VA 4GI8A 2X0WA 3ZT6A 2D7NA 1F6FB 3HG5A 5C0JA 2EVHA 4MNHA 3AS3A 2Y6SC 3WNPA 4N0RA 4WI8A 43CAA 4G5ZH 1JXKA 3BFWA 3OGCB 4DN3L 2W60B 2N7BA 1KB5H 4A2HA 4BXVA 2CBMA 4HT1L 4EBQL 4U1NB 3SO5A 5CFHA 1LMIA 3FU7B 4PPTA 3NZUA 4WEMB 3MODL 1NSNH 3IKCB 4AQ1A 1N8ZA 4JUSA 4NZRH 4C58B 2FYVA 4KQ4H 3PQYA 4KH2A 4JJ5B 1IFRA 2I60H 4QHLB 1IQDB 4CC4C 4EZKA 4F20A 4CU8A 5BVJB 2WXFA 4PJGB 3NQIA 1FFRA 1R33A 3ZRFC 3MRPA 3SKMA 3HZKA 2OMBA 3G04A 2WAQA 4ZMZA 3AM8A 4WUUE 3QULB 3SZ6A 3V52L 1F3JB 4I0CC 1YHPA 2XRAH 2E6JA 4BK5A 1O9VA 1NIEA 2D8KA 4FRWA 3DVGA 1S46A 3U48A 3I6GA 1XCTA 3GXMA 4OB5H 4OJCA 3STZA 4UUJB 3N04A 2NY4D 3AFLA 3BEVA 3LEXA 5E03A 4IKNA 2VITB 4URKA 4KDWA 2A1WL 1J8RA 1A1MB 1G7PB 4QWWD 4X8CA 2CAKA 3HB3B 1G9NH 4KDTC 2XNAA 4ZUSA 3S37H 4KKBC 4E41A 1EO7A 1H6FA 2DYRB 4U7SA 3V6ZA 4HPHA 4KVCL 2I24N 3HI6L 3QJHB 4ZFOB 4DOHB 4XVTL 2ADYA 1BFTA 4NP9A 3PREA 1H3GA 5B1CA 4HH9A 1KYAA 3L95B 1CICA 4AQAA 1KPUB 3DO7B 3IF1B 3IJSB 4HK3N 2LHAA 3QC6X 4PJEF 5DK2A 2FIKA 2AQNA 4NP4H 2ED9A 3GMPA 5DJXB 1T2JA 2GITB 3FNKA 1UXSA 25C8L 4I3SH 5T1MB 5EOQH 2J57A 1AZNA 4OUUB 1HL5A 1X9RA 3O3BA 4JEGB 2HZHA 3GK8H 1E0OB 2AVFA 2X44D 2VDRH 2XICA 3SBWC 2AHIA 2O5YL 3M86A 4PBWD 1TZGH 1PCXA 4LGSB 4ZUUB 2X70A 3RTQC 4ATWA 4WTXA 1FSKC 3HRPA 5DEJA 3CFQA 4B96A 2BVQB 1O7DE 3OKKA 5D70H 2V17H 5HGHB 2I32A 1N6VA 3BPOB 4YPJA 1NLBH 3GLDA 2UVFA 3NZSA 1HIML 3IBOA 3MJ9L 3VD1A 5CSZB 3O8XD 2V2WA 3QIBC 3B7UX 5DT1H 2F1EA 4IIQC 4O02B 5K33A 3RBSA 3ZE0E 1GKOA 1AGBB 3D4CA 4LSRL 1UWGH 2CHZA 3ARVA 4GYBA 5AOLA 2BZ7A 1UOVA 2OJ1A 4NCDA 2GK0B 4XCNA 3V8OA 4IIQA 3NZ8A 3NTCH 3O8XA 4RWYH 4XVSL 5DJ2A 1BQLH 4NUJB 1Z2KA 1RUPL 2KC0A 3NDZE 1CBJA 4BFRA 43C9B 4JFZL 1KCWA 4Y4KA 2VZ3A 5ITFA 3O3AA 5EZJA 5FR3A 1J9SA 5EU6E 4BZ2A 2QZ5A 4NOFA 4JG1L 2AJUH 4XAWL 1H0DB 1U3ZA 1XIWB 4K2UL 5IWLC 1HNYA 3BKCH 3ULVF 3BQUB 4NM4L 4J3BA 3FB6A 3SIKA 3TL5A 2CLZA 1KJ3L 5M7QA 2I69A 3LKSB 1D5BB 1AS6A 2XZQH 3I6KB 4WV1A 4B60A 3IDYC 3PIQB 4HIEB 4NO2B 4UU9B 3VXPB 1CFVL 5M95B 3LEXB 4L4JA 3WDJA 4KZDL 1X5XA 1LVEA 1DJZA 1U8QB 5TK2A 4KZ0A 5CGYC 2CO3A 3LD8B 4PJAF 2MEJB 3HMXH 1WWAX 3G08B 1MVYA 4MJ6B 3KYOB 3Q01A 2AXHA 1JPEA 3FQUA 2B5IC 2DJMA 2N7SA 1NAKH 5IHUL 2V9UA 3VRIA 1F2XK 3L3IB 5EV7A 2J5WA 3V55A 3NFNA 2MSPA 4PJGA 3T3PF 5H94A 3L1OL 4LT7A 4XBGB 4FERA 3FRPA 2R0KH 3QWOA 3NIFB 2H32A 4TRPH 1EAJA 5JQ6L 4ZTPH 3DBSA 2ITDA 1S9YB 2OMWB 4YDLC 3SGJC 1DE4A 4K9EH 1T1XA 4J3WA 4QAWA 3TYGL 3BUDA 4AH2B 2HAZA 1P7HL 3MLPA 2A38A 1G7JA 3IWVA 4QOKD 4HGWA 5EEVA 1M56B 2A6IB 5FUCC 2Q6WA 4HSAC 4KMTH 2X9ZA 4MNGB 1FNGA 3S5LG 3Q05A 2COQA 1O7DC 3CN2A 1TTRA 2XQ0A 1KXTB 2Y7LA 1JV5A 5CP7B 2D4FA 5HGBA 1V7NH 3WHXB 2F8XC 3FSAA 4XR8C 5ELIA 1ZE3C 5I1KH 5C9JB 3KJ6L 4X2UA 3NK3A 1DBKL 4YDLB 3C60C 1CMOA 4OGAC 4NAMA 2OR8A 1GZHC 2BK8A 3UO1H 3KMDA 1RU9L 3HNSL 4XP1L 3D39D 1YEWA 2B7DT 4UNVA 3CMOL 1CFQB 3ZDXF 2HB0A 2XZAH 1NBYA 2L04A 1UA7A 3GGWA 2B4CH 3LEVH 2XKUA 3JWDL 4FQCH 4J2QA 1MSPA 4Y7OC 1J88A 1LYQA 1WIOA 1JVKA 3DSFH 3MLZL 2WIIB 3CZFA 2YD4A 3IJYB 4FN0A 5A2IH 1BM3H 1MCDA 2VMFA 4JRYB 4HHAB 3BSGA 5HYQA 1JHTB 2QSCH 3UBGA 5C0BA 2J44A 1Y18B 3OD3A 1JNHA 5L7XH 3NSFA 3SDXF 4A2MA 3Q8CA 2AXWA 2HMIC 4Z7OB 3LOWA 2DJUA 1I7UA 3SPCA 3SO3C 1LNUB 1MELA 2FJSA 2ZUVA 5D6CA 1A14L 5J57B 2R27A 1J0YA 4YSOA 3BP4A 4JO2L 3PXJA 4KHTH 5FCUH 2V9QA 3N40P 1XIWC 5JUEH 3BIKB 2PYED 3M1BA 2Z6FA 4EUPA 4QYOA 5DVLA 3MRQA 3FOMB 1E4KA 4FFZL 2R1YB 1GGIL 4RNRB 2Z64C 3SHSA 4D9QE 1H0DA 1XIWA 5JW4N 5C0AE 2VR8A 2OAAA 1KCUH 3K8LA 3FO9A 3ZX1A 3BAKA 1DL7H 1IIIA 4PFEA 1CFTB 4E9RA 4A6YH 5EIQA 1S7WB 4BKSC 2RCSH 3VXQA 1PZUB 2D7PA 3TV8A 5AFAA 2HG5A 4JO3L 1CGUA 5F7EH 3K4AA 2Q76A 4PS7A 2WZ6A 3MYJB 3SKNB 4YDNA 2GCYB 4HC1A 4L1TA 1QWNA 3ZE2E 4Z23A 4IIQB 3MXVH 1QMUA 5IMKB 4YK4B 1VZIA 4KU1A 5EA0H 2NYYD 4GO8A 1WYJA 2LGNA 4OM1L 4OIFA 4MD4A 4K3DH 2XC8A 1ZHNB 4PLJC 5IB4B 1S7RA 1CVSC 3NSCA 4HFWB 3GS4A 1R6VA 1FZJB 4FDWA 2L7UA 4X6CA 4OFPA 4WW1A 1TLKA 4X5WA 4N2NA 4R0LB 4EBQH 5F9JB 4LSQL 5L8LB 2AK1L 5DURB 2IIJA 2BH0A 5I9QB 3RWEA 3OZ9H 1KYOJ 3FT2B 3LKQA 2XWEA 4GKNA 3ROLA 5T1LA 5FO2A 1SDAB 5KS9B 4HIEA 4NO2A 1UM5H 3ZL2A 3ULVL 1YC8A 2CKNA 3FW6A 4IBLT 1XBRA 2EEBA 3MR9B 3QXAB 1FF5A 2BJML 2DWDB 3I2CH 2OR9L 4GRMA 1INDL 2DQHL 4Y1AE 1JWUA 1ETZA 3F64A 3F6JA 4G3YH 1MCPH 5IV2A 3SPVB 3BH9A 1SDYA 3OR7A 4NBZB 1DQJB 5HHNB 4ODVL 3W2DL 5I16A 3Q0HA 3TBBA 3OMAB 1LQSR 2WYHA 3C75A 4EZMA 3T65A 4DH2A 1LDPH 1UD2A 4NZ8A 1PY4A 3L54A 4M7LT 5E1IA 5AVRB 5FYKD 4DP1X 2P80D 5K9JL 1C1EH 3W5MA 1CF1A 1MFUA 3GSNL 3X11A 5HHVL 2VXSL 5ISZB 3MBWB 5AG9A 4JPKH 3H9SA 3GHPA 1MWAA 1MCIA 1RIUL 4HYTB 2F5AH 4BH7B 1R3LA 1Q9KA 3NJMA 2D73A 3D39E 3FPYA 2G2RB 4ICXA 3D4GA 5H37G 3B8YA 2ZSWB 2E5EA 4PRHB 1K4CA 2RA1A 1BVZA 2ZCLH 2OW6A 1DVQA 5AAWA 3RA7L 1P6AB 1UH4A 5AKVA 4ZX6A 4Q0XL 1G7JB 5DLLA 3PWNB 3ERXA 5DUPH 3NRQA 1NICA 1F90H 1LGVA 4L37B 3FRUA 2O26U 1MHHA 2BVUA 3L1GA 2ITDB 5GGSB 2ITCA 3BISA 3QJVB 4HALA 5EA0L 2YD3A 5C07A 3OKLA 4Q6IB 4MNQD 1MZZA 2BNQB 4FXKA 3D85D 3BUTA 1ZVHA 1F8TH 4M9OA 4CRPA 5I6XC 5CD5C 2QV4A 3OC8A 2COVD 4MKMA 3VXSA 4HK0A 2BPBA 5D2NE 4OD1L 4OIAA 3OJMB 5DUMH 2AJVH 3F6LA 3I85A 1HU8A 4BCYA 4ZFGH 1BFVL 4XTRD 1JS4A 3JV5A 4JRYA 1F18A 2Q87A 5DHEA 3RUGA 2YUZA 1AE6L 3NABL 4JFFD 5MEOA 4LPTA 1DQLH 4F2ME 4EDXB 1KCVL 4CMMA 3NJIA 1A6PA 4N86A 2GBTA 1U6AH 3AQYA 5I0VA 1XGPB 2IOMA 3APFA 1DVFC 1SMOA 4G6JL 2EILB 4NNXB 3FT2A 3LKQB 1L6XA 2O6PA 5E7FA 4MRBA 4BE5A 1K3IA 4GW1A 3QJTB 4JGMA 3WXWH 3TPKA 4ZNCD 2WWNA 3OV6A 1CI5A 2IFGA 1A7NH 1R3JB 3GMQB 1VLXA 1KFAH 1KPVA 1SLVA 4UT6A 4M7KL 1CGSL 1QTSA 4XCFL 3IU3A 2Z7UA 4B9PA 5C08B 4ZMNA 3QQ3A 3PWLA 5T33H 3L4WA 3C2SA 4RWYL 1EUTA 3NCCB 4Y19B 3GSOB 3GMNA 1RUPH 4MQSB 3KPQB 1W0WB 2WQ8A 3PABB 4NWUH 1D5RA 3BX7C 3MOAL 5JPMB 4M8VA 4QTHA 3NCJL 5E5UB 3VJ6B 5KSAB 1RXLA 12E8L 1KC5L 5EIVA 1DYZA 4FABH 5L2KE 3HR5A 3EADA 3MV7E 5J6GA 2PCPA 3IT8D 1SN5A 1Q38A 4NQDB 2W5PA 4NYLB 4LB8A 5LGYA 4JW3A 5BXFA 2C7UA 4XX1E 1CFTA 5T3XL 3QORB 2R51A 3FQNB 4HCRA 4LCIH 3SPIA 1T7YA 2UVEA 3AMKA 4XNQB 1NBVH 5CS7A 1U4EA 2IAMA 2BC4B 1CFVH 1CE6B 3FQUB 4ODTL 5DVKA 3EF4A 4FYTA 2XWCA 3BKJL 3D5OF 4GI9A 4LBAA 4WV1C 1QBMH 5C8JB 2IPTH 1I75A 1BZ8A 1WGVA 1KB9J 3L4VA 3T8MA 4FNTA 4X7TA 3UG4A 3ULAB 2W60A 2CR6A 2L7EA 5FC9A 4B9IA 3D2UD 1QZ1A 4TUKL 4X8JB 4EI5D 4UQ3A 3TZVC 2VDQH 5GGUB 5IFJB 3FSVA 2E9JA 4DP9X 3C5JB 1E9PB 2HFTA 3HG1D 2GPZA 3MBED 1QLRA 5C0AD 2F8OA 4MS6A 1U8JB 2XVGA 2OYKA 2VN4A 1RUQH 4KMTL 4WO4D 4QF1B 3JV4B 5AW8B 1I4FA 2PTTA 2UWEE 1E27B 2KPWA 4NQVB 5CUSL 4RMRA 3RWFB 2VE6A 4KI1A 4NUJA 3EFDL 1E3FA 2YFNA 2ENPA 4YHML 1T1WB 1R46A 1WBZB 5A2CA 1FSKB 1RP8A 4O2CA 4AQOA 3RUGF 3QNZA 1QI4A 1Q1JL 2VWEC 4WO4A 4L8BB 2EE0A 1PIFA 4JHZA 3MLSH 4UOQA 4X4XA 1MCLA 5BRQA 4IOSD 1FJ1B 3F7VB 4EMZA 1MCKA 4ZUTA 1RY7B 2XA8L 1KN2H 1NGPL 4UM9A 3CDZA 3BKML 1XR8A 4LIQH 3FQ1A 4EXKA 2X1PA 2QHRH 4DFHA 2O6FA 4FFVD 4AYID 4NUMA 3T1FA 3WE6B 1KELH 4TVUA 3MBWA 4C54A 4YLQT 2AEIT 2BVQA 1JZHA 4GRWE 4LSSH 5DGRA 2F19L 1JGUH 1FZKA 2GG1A 2JELL 3LTVA 3X2QB 4JHUA 4IOFC 4MAYA 2OSXA 2NY6C 4IKLA 3GC3A 1NCAL 3GLEA 5IIEA 1CTNA 2BY0A 2LU4A 1N18A 4N5ED 3BVWA 4DVRH 2PPEA 4G59C 4LLYB 3IMTA 5BXFB 4P2CG 4F7CA 2BS71 3VRIB 1IBGL 3S97C 2YO3A 3HB3C 4NM8L 4JPSA 4NIKB 2DBLL 1IBYA 4PV9B 2C5DC 3F6IA 3QIWC 4KAQH 3ZYJA 2P49B 5INCA 3UYRH 1JZ3A 3A4EA 1CDUA 1N4XL 1AQDB 2DWSA 2IH8A 1CD1A 2YARA 4MA3A 1S7UB 1DEEA 1L9PA 3UFIA 1BFSA 3AREB 2QLYA 1ASOA 5D2NA 3HZ3A 4PBVC 3KPLA 4PV8A 3HB3D 4QGTA 2CJ3A 1UT2A 3DMMD 2DLHA 4A6YL 4XBEH 5B1AB 1AC0A 2Y69B 3QIBA 3WJLC 2X6VA 2BOCB 4Z3EA 4R90L 3FT9A 4PJIB 5LDUA 1NCCL 1DFBH 1WZAA 1U8MA 3EJJX 1NOLA 4OM0L 4BFOA 5AYUL 4L1HA 3K91A 1YAIA 3KLAA 1ZHNA 2WUBH 2B3IA 3QUHA 3U4BL 5HPMA 2R2BB 5IEKA 3NPZB 4K8RC 2FGWL 4LDCA 4AT6B 3H55A 4FTDA 3ARBA 1OE1A 4XPGH 3OSVA 3BI9X 1LWRA 3TJEL 2IGLA 1SM3H 5JW5A 2AJXH 4XVOA 4ZTEA 4U1IB 4GLRI 5K5YA 5KVMC 5F1NB 3TZVB 5B39B 1OTTD 5IKCA 3HG2A 4FF9A 5TDPB 3HLKA 1MZYA 4K94L 3MRLB 1XB6A 5LB1A 3VW3H 5GSRA 3EO0A 3L4ZA 4MA8L 3U6XA 2DM7A 5IG7A 1KXHA 2AK4D 2PPFA 3K4ZA 3X13B 2HYMA 1MNUH 1PD0A 4JCWA 5C2UB 4Z7UF 2IPKB 1OAUH 2DH2A 4NNPL 3O2WL 3VGAC 2A83B 4E68A 2PUQT 3G5XB 1IM9B 2ZYHA 2PWFA 3MRMB 2VSCA 4GAGH 5L88H 4GEJA 2XYBA 4AIXA 5GS0D 2DQHH 3G7TA 1I8UA 3K2IA 4X6BA 1P5VB 1ETB1 4JZJC 1LO3L 3F8UB 4DKFH 4GIOA 4RRPG 2FWLB 1OGAD 1AP2A 1BBJA 1C5CL 3K6SB 1UASA 3ULSA 4AEIH 4E9TA 3V0JA 1LDPL 3R4DA 5D7IE 1AY1L 2BX5A 2H6UA 1XCQA 5K9JH 1EERB 1W2KT 3PRZA 1S9VB 1GHFL 1JPSH 2XN0A 3ZSSA 3ZGHA 3TX4A 2XVKA 1XB3A 1CGYA 3EJCA 3KWTA 1R9FA 4OCLC 3MLTA 4MCMA 3NFPA 4N2CA 2QVTA 2P4AB 5CJQH 5AVYB 2F5AL 1H8OA 2Q8BL 2VDOL 5MP6H 4LLUB 3LY6A 4FQ2L 5B1JA 1ZS8B 2CO2A 1ADQA 4PW9A 3QVAA 2VMEA 3O4LE 3BWAA 2AC0A 1AGEA 5E1AA 3QNXB 1MIEL 3BP6B 1FO0A 2X6CA 2EYRA 1EJFA 5FDYA 1Y6KR 3T4YA 4DEPC 4FQPA 3CFEB 5DZLA 3WTYA 4POYA 3JT0A 3PL6C 2DWEB 3B7SA 4MD0B 4V2BA 3CLEL 2CRIA 1PFOA 3F01A 3WFZA 1T2XA 2WW8A 2MIZA 3BSZH 2DMKA 4OGQC 3ML9A 1UZ6F 2GC7C 4HETA 4NRYB 2Z7YA 3E8UH 2AJVL 2ICEA 3ET9F 5GGTH 1MHPL 4AV5A 2WXGA 2ED8A 3BKYL 4MX7A 3UZVB 1Q0XL 3WUZA 1ROCA 3QZMA 2LVEA 1IGCH 4HWBL 4KRPB 4BFKA 4ENZA 1T5XA 3MRDA 4AQEA 1ADWA 3SGKC 3WNLA 1SN0A 1P1VA 4A7SA 3O3DA 5DEGB 4IBUA 3G5YA 2X28A 1BQ5A 3QDME 4JG0L 5JXEC 4JFUA 4R4BA 1CT8A 1WFTA 3MYJA 2IBGA 4P49A 4OY9A 1LM8V 4U1NA 3CPUA 2J8UA 3OZLA 4QIRA 5CJXC 1MWAL 1N59A 1RUKL 1HHJA 3O45B 4L8DA 4JBSA 35C8L 5I8CA 4PWFA 3CZKA 3VM7A 4A7UA 4OCYH 4RDQG 5DLML 1GSMA 4IIZA 4OZ4B 1ZHLA 3GD1C 1IGTA 2VLKA 4QRSA 3FTVA 3GMRA 1B4TA 1TZ8A 1AO7E 1I7ZB 5BS0D 3FRPG 1J0JA 5MI0B 2AGJH 1ZT1A 3UIYA 1YYML 1A7PL 1OOAA 1RK1A 5HDWA 4F1ZA 4NT6A 1SY6H 5TQ0H 3OKDB 2GY7B 1GMIA 1KC5H 2MKWA 1OZUA 2FZ3A 4M03A 4PS8A 3RB7A 1PD1A 2VAAB 4X5XB 2EXYC 1FA4A 2D9QB 1PKOA 1ZLSH 1OL0A 3OKYA 2QDWA 4NO0A 2CK2A 4W9IC 4JO4H 1RUAH 3UP6A 2HKAA 4YO0A 5IZ7A 3SSGA 3QJFA 2G5RA 1KIQB 4TNFA 5MEOB 4LLMB 4OGAD 3NZ8B 4MJHA 3RFZA 5D1ZD 5INCB 1GIGL 4YFDB 3HKZA 5EIIG 3T5WA 2RMNA 3C2AL 2ETWA 1KJVB 1HWWA 3CDGA 4Q58C 2FECL 4UMGA 4FNUA 3SDYH 4X6DE 3CIAA 4R2GD 3MJ6A 1R5IA 1VESA 2HRGA 3K72B 4I4WB 4P5KA 3ULVD 3AWFA 2WXOA 3HI1A 4N2KA 1E4HA 1E4KC 3JWNG 2V0AA 3C8KB 4S11A 2YGVA 2YUXA 4P46A 4AGNA 1YNKL 1JPTL 1JWSA 3UTPD 4KNQA 3D0LA 4HWEH 3QNFA 2ADJB 2G4GA 2V5YA 4N3UA 1INQB 4RGMB 5KVEE 3L5WA 3VI4F 1H5BB 5GRUL 3WKQA 2YK1L 3CG8A 3BYYA 4ONFH 3TXAA 1DANT 4XH2B 3VYPA 4X4KA 1UH3A 4HC1L 1IJNA 1CZ8H 4ZUTB 1AMYA 1D9KD 1EJOH 2J3SA 5HHMB 4YHLL 1F4WL 4ODXA 1F0LA 4GAJH 5LBGA 2QSVA 3O81A 4WKZA 4PRDB 5EEXA 1MFMA 5CXPA 1PL3A 1NKOA 3PNWB 3LQAH 2ARJQ 4KRNA 4G5ZL 3H56A 5SWZB 1L7IL 5I1DA 2DW5A 1UOKA 1KB5L 1S7VB 1WUZA 1ZJAA 2GAZA 3F00A 3V5HB 3IVKB 5CMAB 3IJEB 3GPSA 4KBPA 2A3TA 1GZHA 4JQIA 4U1JB 1E5AA 4NBYB 5CCHE 3NFNB 1KTLB 3IE4A 3MRDB 5AW1B 2MCAA 1BMZA 3BKMH 3O4LB 1FN4B 2PXYC 4B3VA 3SDDC 5JO5B 4WHTA 2Y23A 3UEZA 4L2LA 1JPST 1ZT4A 3JXAA 4MNQB 1FVCB 1YMMD 3TVMC 1L6ZA 1MI5E 1KN4H 2CKBA 1F4HA 2N01B 3EO9H 1KEGL 2RFXA 5SV3A 4GG6A 1P0SE 4NWTL 2W88A 4TL5A 2JELH 5B7MA 4MD0A 1E42A 1MCOL 4GKZB 3VI3E 4AIEA 3IDIA 2XV6B 4PB0L 2J56A 2YD5A 1BVNP 1OPGL 3DRTB 1BIIA 1GS6X 3OAYK 2CKBB 5K69A 3LPPA 3HVNA 1AQDA 1HAWA 2DZEA 1O7VA 1KZYA 2ARJB 3X1NA 4LDLB 3ZU8A 3EZ8A 4HWUA 3CFBA 4NJ9H 3P9MB 3T0BA 3GSNB 4GBXD 2OTWA 4U6HB 3S37X 2EABA 5CEYA 4AJVA 3B5HA 1FFOA 5EF0A 4DCQB 1UACL 4OCSH 4H1LA 4I2XE 4LRIA 4HHGA 3HS8A 1OLZA 1G7LA 4X7FC 3B2VL 4PJBE 5LG6A 3NACL 5BO0D 4FFTA 3MRJB 1ZXKA 5KBNC 4NXKA 1XF5A 3RI5F 4JN2B 4R4BB 5IVNA 2Y6TE 1P5UC 3AADB 2NY6D 5MENA 3DTXA 1KLFA 2C1OB 4GRLA 4M6ML 1HQRA 1X5JA 5DHVB 3IJ7A 4L5FE 3SKJH 2DKUA 3CDZB 3F7YB 4XBGA 4XC1H 4DGIH 5JOFA 3CSBA 5HJBA 3PWLB 4NUQA 5E8EA 3QEGH 5FUZH 3L3IA 4IRSC 4PGDB 3LNIA 4UANA 1XVSA 2O5YH 2B1OA 2IANA 1BMGA 1CD9B 1G1YA 3I74A 1OGSA 1IM9A 3MRMA 1QUNB 4N22A 3BUPA 3JUYA 4YSQA 2WVUA 4F58H 4TVPH 2CA3A 3PIQA 4UU9A 2AXFB 3ZDYF 3U0WH 3OPZL 3VW3L 3R7RA 3BVXA 4PJ7B 2Y4SA 3WBDA 1YEHL 5IB2A 1S5IL 5IQOA 5DZ9A 4OZGB 5I1GL 1VERA 3ZBMA 3WS6C 1A4JB 2K6YA 1I9IH 5IFJA 1FN4A 3BZDA 2A9BA 5ENWB 3AM8C 5LXVA 5EBMB 5GXBB 1HH9B 3DLQR 5DZPA 4EKJA 5BRPA 5FW7A 3P30H 4X7TB 5T1LB 1CC3A 4G8GE 5GGSA 3L3KB 3W9EA 2WVVB 3LX9A 5DC4B 3TZVD 1KY6A 1UC6A 4PU2A 5A6IA 2IFFH 1G7MB 5GJSH 1XH0A 2IADA 4XRCB 1TTBA 2WBJC 4DGVH 4MXVF 3D0VA 1RZIA 4W9LC 1ITCA 1W0VB 2BVPB 3DX6A 5ECGA 5AUMA 1DJWA 3PQYE 5DHDA 4UT6H 1I3GL 2NCEA 4A39A 4OT1H 5I28A 1OGPA 1ZGLA 2ZOWA 1CXLA 2D9CA 4JDEB 5EIIA 2F5BH 4NQXA 5FO9A 5KVFL 1WA2X 2RTTA 5C92A 3QRGL 5KJRL 1M7DA 4KV5E 4M1GH 5F88A 2FEJA 4B9YA 1M2VB 2X53A 1A0QL 5HXMA 3GHEL 4KUZH 3B2UD 2E8ZA 3BUYA 2OXHB 3GSOA 2ZG1A 2YWZA 2MTPA 5E6IA 1DQJA 5HHNA 4ZFQA 2ZYRA 3N1PC 1T5XB 4OFVA 2WXNA 5EFIB 5I6MA 3R0NA 1HWGB 2UX7A 3T77B 2I07A 5ANHA 2OX5B 4Z3FA 3KPRD 4OZIA 3D0LB 2NDGA 4YBLB 4UM8A 3VFPA 4OGYL 1N0LB 1J18A 1BF8A 2XQBH 3N42F 3HZMA 3P0VL 1JTPA 4M7LL 5TDNA 4M93B 5C3TA 5GGTL 3LEYH 1R5VB 5JQ6H 1LNUA 4J3OF 4Y1AB 4LARH 4YHNB 3KYMB 3QXUA 5BJTA 4G6AC 5F6HJ 1J9CT 2WNKA 2VDRB 3L4UA 2MTAA 5IROD 1YEDA 3GTNA 1BYNA 1TO5A 4PG2C 3SCMA 1IBDA 5DJ6A 4F8PA 6FABH 3V0AC 1OY3B 1UKQA 5FAAA 3RE0A 3KE0A 3TYFB 1W91A 5EU6A 3GO1L 3QISA 1FVDB 1PLCA 3UEQA 4YSEA 2D31B 4YO0B 3MROA 3E6FA 3QDMA 3TWCH 4N0CC 2YPLD 5C07B 1NBQA 2VITA 4IRZA 3X3GL 5BRZD 1RZKC 1SXBA 3H42H 3D25B 1FE8H 4NSKB 4NT6B 4UCFA 2R4RL 3T3PE 3ZOAA 4AM0A 2VZUA 1QBLL 2K7PA 3MLYL 4KZCA 2DL9A 4NQXB 4PRHE 5E8OB 4QR7A 3V0HA 4DZ8B 3WDIA 4AEHH 4CJ1A 3HZYB 4X6DF 4Y2LA 4JHBA 2WBJB 1P7QD 4OKDA 5EU5B 5AUMB 5GISH 4A38A 4JFSA 4CL7A 3SJVE 3ZY7A 3UZVA 3VH8B 2A6JB 2XFXA 2R1YA 4FI6A 3TNMA 2ICWJ 2X2IA 2QPSA 1JF6A 1J1OH 5E8PB 2JIXD 1R75A 4JN2A 3RY5A 4HG4J 4DPCX 1FNSH 4EEEA 4JFOA 5CU5A 3G5XA 5JQHC 4IBWA 1EO5A 4HAGA 2A6JA 2XFXB 4PSRA 1XCWA 3FCSA 4FYSA 1FFOB 1LO0L 4W81A 4XX1G 1NGXA 1HHGA 3AZUA 4NS0A 3OLIA 2TAAA 3SDYL 5CLYA 1FJ1A 5EEZA 1GZQA 4XCYB 1JHTA 1I7TB 1HZKA 1NEUA 4W6XB 5D7JC 2WWKO 2VLJD 3PLYA 3HI5L 2DM4A 4G2AA 2C7FA 3RGVC 4BQ6A 4QJ5B 1MJ8L 4XXWC 3NEEA 4AYMC 5CCKL 1NDGB 2V4LA 5K9QG 2A6KA 1DL7L 1LMKA 2HJFA 2FJGA 1D5MA 2RCSL 2O5XH 3ARYA 3HR6A 3FU0A 5K59E 4FQXB 3R8QA 3HE6A 5DWUH 3RFRA 1X5KA 2R1WB 2VQ4A 1CTOA 1RKRA 1JK9A 3V10A 2ICWI 4KV5F 3MROB 1SFHA 4AIZB 4P3WA 1C8PA 1GCFA 1YPZF 2FO1A 5GRWA 2XUWA 1XB8A 4Z0XB 1ED3A 2UWEF 3TO2A 3PNRB 1WFJA 3MV7A 5DJ6B 1IGIL 4MXVE 5BUGA 4HEPA 3X1EA 4RFNC 5J3HC 3FUNA 2PYEE 4KWUA 3WEOA 3QDJA 4YUEL 4PI0A 4LDEB 2ZUYA 1A3RL 3GUFA 3RL1A 2J6WA 1PAZA 1O0VA 1O6SA 1X9LA 4IKKA 2VDLH 5FYJU 4H0HB 3HN8A 2FHBA 2XSKA 4JFTA 1V3MA 1IAKB 5I75C 1RZ8A 3KM1A 5D2LB 3BAEH 3C6LC 1TJGL 1X4ZA 1QLEH 2Y07H 1YNTB 2X87A 4ZPTB 2QELA 4M62H 1UENA 4UAOB 2BJMH 5E6IB 4BH8B 4K3JH 2FJFB 3WV0A 2QQLL 1AXSB 4PGCB 1T83C 4N2EA 3WMPA 5F89A 4CADA 3IMWA 2ARJA 1ZCRA 4Z7NF 3WFHA 2R29H 2KZ1B 2V3EA 4N8VG 4XWOD 3HR5B 5IKCB 5ES4B 5HGDA 2ZUQB 1L3NA 1JGVH 4LMQI 5GRZA 1MDAA 4DGUA 4QTHB 3DX7A 4TMPA 3HG1A 3CXDL 3MBEA 1A4AA 3N44B 4O4YH 5DI8A 4YSUA 4KK5D 1OF2A 2Z1KA 4UM9B 2Q20A 4ELME 3WFDH 4GW4A 3IETA 3AGWA 4G6AD 4CDGC 3VNZA 4IMKA 2K8QA 3G5ZB 3HUJE 3CVBA 3ABGA 3GI8H 3KL0A 4WEBH 4WY7H 3IMVA 2JKRM 3Q5YA 5A2FA 3KEHA 3PWPD 5B1KA 4NPKA 2ZYSA 4H8WH 3ZDZE 2WTPA 1T0MA 3WD5L 2BY1A 4KI5C 2R9HD 2JF1A 2PF6A 4AKQA 4AQAB 4DP0X 2CBOA 4UIMB 2QVMA 1DUZB 2VAAA 1XGZA 1AJ7L 3TN0D 1HVXA 4D9QD 3O4OB 5DD3L 3T3PB 3HC3H 3KPPB 4KRMB 3EXJA 5IK3A 5IBLD 2AS5M 4UOW0 2GK0A 5DHVH 4WGVB 2PXYD 2J88H 4GUCA 32C2B 3QIBB 4ZW6A 2WN2A 2A9AA 5DFVC 2ZKMX 3A6BL 1Q9LA 3ALPA 4BGDA 3L2MA 3VTAA 4J4PC 1ZV9A 2V2WB 1V3LA 2W92A 3EOBB 4GKLA 2VXVH 4JRXE 3A6CH 4X8JA 1UZGA 4R7XA 1RPQA 2NY2C 2OSYA 1BZQK 1ZK5A 3L81A 5I26A 3U6RA 3ISWA 3FTSA 4L4TB 5E4EB 3I6GB 1JGLH 4L37A 3A4FA 3IDXL 4YEFA 5C8JA 1GYVA 2EDLA 4P46B 4Z7WA 4YEEA 4PJ9B 2IOIA 3MOBL 3U6RB 4I4WA 3MUJA 4NC0B 4UT9A 1DQTA 5F7DA 4KMLB 2BS8A 2DMHA 3L5JA 4XNYH 3VXRE 2WB7A 2W0PA 3IFNL 1E5ZA 3UZEC 1LTXA 3RX7A 1FPTL 3T2OA 2NY5L 5JW3H 3AU1A 1HQRB 5LVEA 2QLVB 4ORZC 4MJ6A 3DPBA 3CX5K 2DQEL 3DMMA 4N2AA 1H3VA 1NFDB 2GHWB 3ZZ1A 5IVOA 3T0EE 2VXUH 3N9GH 4JFHE 1OSPH 2PP9A 1PZDA 4PW4A 1EAOA 3L95A 2VGLM 1JF1A 3NJGA 4I87A 3AUVA 3IGUA 4UAHA 3HC2A 2QGEA 4PIBA 1HK6A 5JDSA 1I3GH 1XMEB 3V4PA 4HKZB 4R96B 2WQUA 1D2OA 3F05A 2R69L 2FHFA 2FLRT 4PIRF 1ED3B 4G7YL 4EIGB 1I1CA 2ERJC 1TJHH 2CBQA 2MJWA 5IK3B 4QRSB 2NY1D 1G4MA 1MXDA 5DYOA 3K71B 1B4RA 4YE4L 5E9AA 5LO7A 4QYAA 1IILE 1URZA 4AVJA 3EH3B 2BWQA 2P43B 5FGSA 1NFKA 4M6AA 4OIBA 1GYAA 3SYCA 3VO0A 2DD8L 3CFNA 1SBSL 1LDSA 1D5IL 2CJUH 4LCUA 3DHJA 4L2YA 3Q43A 2YD6A 5ENWA 4K5MA 2WXQA 3LQZB 1S9VA 2A4ZA 1ACCA 1N0LA 3MV8A 1NCBL 2SEBB 3FB7B 2X1XR 1MFAL 4GS7B 4PP1D 4ETQB 4P05A 4M61A 4R0LA 4I48A 5F9JA 1N5YH 3UOAB 3MPCA 3UYOD 3SCMC 5E5LA 3BHBA 3AWGA 4QRPD 1ZLVH 4YHPB 4MJIB 4X5QA 3MV8D 4KUCF 3CQPA 1JHLH 2GTQA 4QJ3B 1PPIA 3HS0A 3BVNA 4L3AA 4U6XA 4LARL 4LP5A 2BVTA 1BWMA 3KHOA 5J4MA 1A6VL 2ADIB 4LL9A 4WCYL 5DGQA 4JKLA 5I1CL 2FEDC 1FBIL 4HJUA 4JPVL 1JN6B 2PYFA 5AZ2H 2QQKH 4A1RA 4JRLA 5EZOH 2OCJA 1RHFA 1Z5HA 3GO1H 3QDJB 4ZBJA 2AQTA 2CGYA 5B39G 1ML0A 1FRGH 2BNRE 3DTUB 3QAZC 5FM8A 4JPWL 5HYFA 1TZHB 2OMXA 3GSXB 2DRUA 4FEMA 2OMZB 1W0VA 2BVPA 4UQCA 4Y2DC 5C08A 3S2CA 4AUYA 4M8UA 3ABZA 4ZMAT 4JY4A 1NCNA 4X4YA 5KOVC 1FORL 2XA8H 3HS0C 2XWTB 4N68A 5DK2B 2IDCA 2AZUA 3F12A 1TVDA 1ZV5A 4ZSOB 1PS3A 3QZWG 3U9UB 4OLZH 4R26H 2QHRL 3FQYA 3LIZH 3LZQA 1BX2A 3HE7B 4QOKA 4F9LC 3FOLA 4FQLH 2APXA 1YCSA 5FB8A 3L7FB 1OB0A 4P99A 4HF5H 4DK3A 4LSSL 1ZT7B 3NIGE 4DK5A 1XCQB 2ZSVB 4JGNA 3TA3C 2FR4A 1NM4A 1QA9A 2DEWX 4UYPA 1CUOA 4A7QA 1JXDA 1FNSL 4PJ7A 5FYJL 4KI5E 3UROR 3QWRD 5ID1B 2VZVA 3LKRB 4IDJH 4W6YB 4YFEA 5BRZB 5TFSH 3NJJA 5ISZD 4J3UA 2CMRH 4PRIE 1SZNA 2K3TA 4PREB 1NCGA 3EKCA 3HAEA 4OCWH 5FXCH 2NY7H 2WTRA 2WQAA 2XFGB 3LRGA 4FADA 2YGPA 3PGDA 5D1XB 1P84J 5DJ0A 4MMZC 3Q7JA 1HCVA 3U82B 4BZYA 5FA4B 3HFFA 2NY4C 5J0BA 4LMQE 3QEQD 3FUIA 3KBHE 4LLYA 2QZQA 3W9DA 5JZ7C 2YAPA 1RLWA 3BGFB 3MLUL 4UBDD 4YBQC 5AVTB 2BNQA 3QI9D 4Z3TA 4HMEA 4F2FA 4B9GA 4JCLA 3OB0K 3NCYS 2ZX5A 4XHJD 5D2LA 5K39A 1SHWA 2VXQA 4Y4FB 2NW2B 2YAMA 3FT0A 2NCMA 2ITFA 5JLZA 3FQWA 3S8GB 3MLWL 1JWSB 2DQTL 3AXIA 2WAHA 1NC2B 2BNQD 1NQBA 5D96C 1Z9OA 3VMPA 2V5SA 3MCLL 3MFGB 4XPGL 2H26A 2ZWKA 2WBJA 1SXNA 1XXFC 3P9LA 4GG8A 1ZA6B 2WXJA 1P1ZB 3BQVA 4HOWA 4IGBB 1VFAA 5D7IF 2VUOA 3P9MA 5KVGH 1U8MB 2O6EA 4IS6B 4H1LG 1DFXA 2A0LC 2VR9A 1XD0A 4YHIA 1ZTXH 4R7DB 2AVGA 1UM4H 4OVUA 2OULB 2ZWNA 1ET7A 3V6OE 25C8H 1XT5A 2NTSP 1I1AC 3T0AA 1LEGB 4P4KA 1K5WA 3KPOA 4ACTA 3QUZC 5E1HB 3SJVB 4BWWA 3BP4B 3LS4H 4XPBL 5INDA 3TN0C 5CSGA 1I7UB 4OH2A 3O41B 2OJEB 5GRXG 2WQRA 1LEGA 4P4KB 5FYLH 5L8JB 1WT5C 3APMA 3R1GH 2BCKA 2XWJB 4PJAE 1Y18A 5CNHA 3CXFA 1ZV2A 4J3OG 5D70L 1S9XB 2VIRA 3N5AA 4WHTB 4ORGB 4S1RL 1CYWA 3ISRA 2R29L 3GHBL 1WFIA 2Q9OA 3CQFA 4P8QA 4PYGA 3TEXA 4ZOBA 5LQBL 2WPGA 4PD4J 2MRYA 4O2FA 2GJRA 2XBTA 2AXFA 4HCRL 3VI3F 1NMAH 1PBYA 4RGNC 3M07A 4AE0A 1LP9E 3O4OC 1SOKA 2ZCZA 1TMQA 2FZ3B 4H2CA 5ERWB 5F3FA 3MV9E 1BD2B 4KROD 1DO5A 1D9KA 3V0VB 1NWOA 1YQ2A 3BOVA 4P9HH 3I75B 3L4XA 3DI3B 4LCWB 4YHYB 4FNRA 4Z18A 1LE9A 1ASQA 1F2QA 4HPYH 1AGBA 3MJGX 4P3DA 4XXCA 3RZCB 3UTOA 3QG6B 3DUHA 3MBXL 5EZLA 4JFZH 3RG1C 3VWKB 1OWWA 1SHSA 4IRJB 1NFAA 3TFKC 5IMOA 3O6ML 5DRXA 5E8OA 3ETBF 4DZ8A 1YN6A 3MU3A 1XWVA 1OP5K 1CLZL 3HNTH 1MW1A 5E23A 4YBHA 5M94B 4Y4FA 4M8QA 3W9EB 5CSBA 3QULA 5IBUB 4JPIA 3D4YA 3WN5C 4NKMA 1DVXA 5I6KA 1UQSA 1ETA1 2FD6H 4Y4HA 3IGLA 1BVLA 3NSDA 4DP2X 5IHBA 3G6DH 3NA9L 1JNHB 1Y1DA 3I3EA 5D2LE 1UUNA 5AKTA 4Y4FD 4M4RB 3II1A 1AGEB 5E1AB 5IFAH 1R3JA 4OKVB 4WU7A 2H2SC 3AQDA 1UEYA 2CHDA 5E9DA 2LFGA 5EOTB 4FNSA 3M1BB 5CZRA 1Y0LA 5DF0A 4TUUA 1EEYB 1SEBA 3BSZA 4MVBD 3WO4C 2KH2B 5EPMB 4Z7VB 4ZSOA 4HH9B 2R0KL 5E9DD 4B3EA 4GUQA 2IANB 2XYCA 3BQUA 1AANA 1AIFA 5C71A 4Y16B 3DOHA 4XPHH 4MNQA 5CJBA 5D4QA 4ILDA 4X4YB 3GBLA 4MZ3A 5DK0B 3B6SA 1OOWA 1V7ML 3MO1B 4P2RB 2R2EB 1AP2B 1XSJA 3TWYA 4O2EB 1CGVA 1ZHLB 2YAQA 5HSFA 2F7RA 3CE1A 5J6HB 3IJEA 1QWHA 2N0KA 3KGTA 1Z9PA 1OSPL 3C9NB 1V7NL 2D7MA 2BRRH 5KJ7E 3FUEA 1OARH 2UXFA 1SVBA 4CU6A 2IBBA 3ZTEA 5LNGA 2A77H 3KGRA 1N19A 4CSTA 1L0XA 3TBTB 1DE4B 4AH2A 3AXHA 4BEIA 1IM3B 4F7MB 4FFWC 3CC1A 1G87A 1TZIB 4DCQA 3KZ8A 2KERA 4L23A 4YXKH 4YHPA 5BVJA 4P3DB 1KJ2L 1KXTA 1YNTA 4ZPTA 3QCVH 4WNSA 5HYIA 3W39A 2QGCA 4Z7AA 1E9OA 1INQA 4ETQA 2DJSA 1KBKA 3C2AH 3OLGA 2CJUL 3PGDB 5KUMA 4UV7L 3KGUA 1HSAA 2KKQA 3APDA 1G7LB 2O72A 2LE9A 3TNMB 4NNXA 4JDZA 5IGXL 3HI1B 3RL1B 5B4MD 1JTTA 4JY5H 3INUH 2QADC 2ZXDA 2F53B 3LDBC 5IEKB 4UTBA 1S3RA 4L8SA 2OW7A 3BH9B 3Q2LA 3C5ZA 5EOQL 1J8HD 2PO6A 2B2XH 4HZAA 5FKAA 2VDRL 3PWVA 4KROC 4HOXA 4ONFL 2IWFA 3TZVA 2HFEB 5ALCL 1X3DA 1WBZA 2PTUA 1M6OB 5CHNB 3C5ZD 4YHLH 3PGFH 1P4LB 3CHSA 1J8HA 1KCUL 4YXLH 3NJNA 5I1CH 3VXPA 4JPVH 4F8OA 2YPVL 1UJ3C 3ZKXB 3UERA 3PHAA 1U95B 5JHLH 5D2NC 3QZLA 1KACB 1GGBH 2X9YA 4HCIA 4JO8A 3T4AB 4F1SA 1MHCB 2FEEI 4U2YA 4YHIB 1JPFA 2FBOJ 3QFJA 5DT1L 5JDSB 2PO6C 1FGNL 1KTLA 3SGEI 1U3HC 3WKML 3MV9A 1JXFA 3FPXA 4OBRA 2AQSA 5A3ID 2JKJA 4HUMB 4X6BB 4TLKA 4K3DL 3EAKA 4OCNC 5CN2A 2J8UB 4UNIA 5IOPA 3MNWA 4OLWL 4PJEA 1SMAA 3IU4L 4XVSH 4GMTH 2GUOA 3HE7C 2IG2L 5CM1A 2HUEA 3IDNA 4UDTA 4H20L 3LB6C 5ADPH 2M2DA 3TJHC 3T08A 5CKAA 3LZNA 4WNJA 2YRZA 5KBPA 5I1JL 4U6XB 3IWUA 3HS9A 2ZKHL 3B7YA 3EJYC 2CUIA 3JZYA 4IEFB 5FWRA 4O2FB 5JYMA 3HC4H 3MLXH 1FLTX 1QPXA 3WNMA 1UHVA 1ROWA 4HCGA 3W9DB 1DP0A 2YHGA 4X5RA 3BVDB 5KZCB 1M3IA 4R3SB 4IDJL 2YOAA 4LVNC 1PZSA 3S3SA 3P3TA 3BDYH 1N8ZB 2CG9X 2XA3A 1IAKA 5IB1A 1KULA 4JKKA 1DSFH 5BVPH 4Y2DA 3S8FB 2NY7L 4R5TA 1RFDL 1DLFL 2VN7A 3K6IA 1C16B 4LCCA 5IBTH 4XP9L 3RVWD 1EGJL 4H8VA 3T4YB 5EZPA 5C6WH 4LHUB 1TCMA 2FWUA 3KLAB 2PW1A 1A64A 2BP3A 2V5MA 3QDMD 5ECJE 3MAWA 4G9FD 4NRXA 3H2PA 4ODBD 1NCIA 1VCBC 3GBML 3I50H 2ZWZA 4GI6A 1PSKL 4PJIA 2VXSH 2Y2WA 3Q8EA 3QQXA 1CFSA 3UAFA 3QNZB 1DSYA 2AABH 3L1OH 3SD5A 3ECWA 3BMWA 3VXUD 3HN5A 1JBJA 2WBKA 4EQ2A 4YK4C 5T5NG 1P53A 3AQZA 4I77L 1XO8A 1KPUA 3L6FB 2J43A 2FX9L 1J8HB 2G3NA 2XTJC 3OQRA 1QNZH 5MP6L 4OFYD 2B1AL 2AEQL 5DEFA 1P7QA 2O61A 5JPNC 4C57C 3QCTH 3RA7H 4RDQF 1JD7A 3V6FA 1TKWB 2R23A 4LASH 4NQDE 4Q0XH 1BOYA 2VDNB 1HCZA 1ULVA 2IAMB 3U36B 4C4KT 5FGCB 3HZKB 2HLFC 5JXAL 2IV9A 2XBZA 5IB2B 4B27A 3NJLA 1JZ8A 3QORA 3BT2H 5HY9A 5GGTA 5SWSB 2EUZA 4N2IA 3JVGA 3D51A 4IBZA 2MQ3A 3LS4L 4PJ8D 3KNBA 2IQAB 3RYMA 3N43F 4XE5B 2A6IA 1BAGA 1EDHA 4OZFA 3EHBD 4IBTA 5E2WH 1XBDA 3HOGA 3FQTA 1T1XB 1RUMH 4XPAH 4DF9A 2UZXA 1VGEH 3N1FC 1IO4C 1T0PB 2DQIL 5HDBB 4Y9EA 1ZRUA 3T2NL 5F3HB 1FO0H 3NCMA 4K73A 2MH4A 4B9ZA 2UUDK 2ZICA 2VDNH 3ECUA 1KGWA 2A9CA 5IQ9B 5I5IA 5I1IL 4RIRA 5LHDA 1T66C 4M61B 1OCRB 1ZEAH 1ZA3A 3MRKA 3HPLA 4V1DE 1MRFL 3OTTA 3TH4T 4X9HA 5CEXB 3JZ7A 2DM2A 4LHQB 1G7IB 4PJ9C 5J11B 1X9UA 4OTXL 2FJUB 4OT1L 2F58L 2P24B 3U1SH 1HEJC 2F5BL 4AY0A 4DWHA 1SVCP 5KZCD 2PCFA 3W0WA 2CLZB 4XMKH 1GGIH 3EBIA 2OTWB 3M8OH 3QDJD 2WXKA 1JYWA 4IJ3B 1CLOL 1JWUB 3RDTA 5HVHC 4KUZL 2AJ3B 2DQUH 1EDQA 2CCWA 4A2FA 3HBPA 3OHMB 1ZK9A 2VR3A 3LKOB 4AIOA 5HDOA 2NZ9C 3RY4A 1RJLA 2YBGA 4JO3H 2W1NA 5EPMA 1N0XL 2ESVB 3UBFA 5BOJA 4JRXA 1YECL 2J1YA 4J1UA 3O0LA 3WTVA 5GQBA 2LLLA 1F1AA 4QOKE 4E42A 4ZZFA 3VFMA 1H15B 5DD0L 4OZFH 4OFQA 1AR2A 1UVQB 1RZFL 1NJ9A 3HE7D 4XMTA 2BP0B 2OI9C 4TUJA 1SLWA 5B1BB 4ODTH 2NZ1A 3EOAB 4N2FA 4RAUB 1JDAA 5EO9B 4ISVA 1FWXA 4P5SA 2IJ0C 3LEYL 2R0LL 4XN9A 2EO1A 2FWSA 3N0AA 5FM4A 2VDQB 1U3HD 5KVGE 5D5ME 5EBGA 3ENEA 2I26N 1P5VA 3HAEH 1Z9LA 2ZOLB 4PRNB 3V5HA 2WIMA 4MKTA 2ZUSA 4Y88A 5G5DA 3ZE1F 4GUOA 2X0VA 4TTDC 5HJ3B 2ZX6A 1P4IL 4M6NL 1A9BA 2ZAIA 4LCUB 3S34H 3TWCL 1SXCA 2A9NL 4IU2B 2HFGH 3PF2A 1BJ1H 2BHYA 3MV9B 4OFIA 1OPOA 3K6FA 3D7PA 3FFCB 3HBQA 2KLRA 3O4LD 4U1MB 5EB9A 3TPUA 1YUHB 3DX6B 3GSVA 1G9EA 3MCG1 4Z0XA 4FA8A 3BZFB 4B53A 1OARL 3CCHB 1JAEA 5CZKA 4L9LB 1PZBA 3O6FC 2BNUA 4Z7QB 4Y5XA 3S8WA 1CLCA 1I1RA 3GZQA 3IDUA 3RJDA 3RURA 5K9KA 5H2BA 4L4VB 1LEKA 2VKXA 2E3VA 5J12C 2JKIS 1C1EL 4ZAKD 1WIPA 1XGPA 5HHVH 4U3SA 5DZAA 3K72A 3CFTA 4KQ3L 1USZA 3WIFB 5JA9A 1J1OL 2YQ3A 3VD0A 1NDGA 1G1KA 1XSKA 1YNTF 2FJHA 1JYVA 5AVXB 2WTOA 1JFQL 5E4IA 3HA0A 4HZLA 1MIML 1KELL 1T3FB 4Q4EA 4NQDD 2VQTA 4ZUSB 1G5AA 4GSDH 3PPEA 1I8IA 3RGVA 2AQRA 1UZ6E 2P5ED 4LKXB 3GGWB 4JM4H 3DGGA 3K46A 3QO0A 3T3ME 3TVMA 1AOHA 3Q6FB 3W0WE 2HLEB 4DVRL 4RISH 3QUZA 4MAUH 4PRHD 1WA0X 1F90L 4POZC 3CFKB 4MZRA 1MJ8H 3NBNA 3VXRB 1GZPB 5K1JA 2A4EA 2OQJB 3CAFA 1O6VA 2BC4A 1N4XH 3ZDXE 3PXLA 5J1AB 1U3NA 1JXGA 1RHHB 1SYVB 2FEDD 4PRHA 5JW4M 2J6EL 1DDTA 1AHKA 4N6QA 1S7RB 4HS8H 4J39A 3TBWB 4AVHA 3RZCA 2CH8A 4WIQA 1Q8MA 4UB0H 1MEXH 3BW9B 3FL7A 1QUPA 4OLYH 1GYUA 2H1XA 2HMID 3GBEA 5FFGA 4E9SA 5AENA 4N85A 3B3IB 4YWGH 2FUQA 3E6HA 3VACA 1E2ZA 5LBSH 2YBRB 4OF8A 2JI1A 5D7KE 2G9KA 1KGJA 1OSYA 4UI2A 1S7XA 1HH9A 4FG0A 1W72L 1YVLA 5E99H 1FQ9C 2GJJA 3PFUA 3NAAH 1KCRL 3QQ9C 1SF3A 3RILA 2BIIA 3MV7B 2XZCL 3TCLA 1E9PA 1X7QB 4JVPA 1IU1A 5E2TL 4E41B 1JRHH 1NINA 4GMTL 3VWJB 1N8OE 1D6EA 2GIMA 5GGUA 3UJJH 3C5ZB 1HE7A 2ENJA 4WGWB 2JJTC 1OF2B 4NWUL 4Z7VF 1JZDC 3MGTB 5D93C 4K3JL 3MV01 4NZTL 4ZS6C 4MDRA 2BS9A 1OLLA 4XC3H 4MA8H 4FEIA 3O2DA 4JM2C 5A6LA 1EEYA 5C7ZA 2EEDA 1GR7A 1HYSD 3LDBB 2NX5D 1J9QA 1RCYA 2K0RA 4NNPH 4QRRB 4LL4A 3VD3A 4G8AC 3RDTB 3IPBA 2OX5A 2G75A 4JFQA 1E7VA 1RZ7H 1CXHA 4GAGL 4N1CA 5L88L 3SE8H 1OAJA 3DGDA 3JWNC 1XMWA 3BDYL 1F58L 3P11L 4U2ZA 1CQYA 3V4PB 1M1XA 2HKHL 1YAZA 3PP4L 3MV11 3G5VB 5IT2H 3HRZB 2WZPA 5DMJB 4WSGA 3WUWG 2DF3A 5JOFB 3P0GB 4IOIA 4FG6D 2QR0A 4FFYH 4XCEB 1UXLA 2C1PA 5DRZB 4W9KC 1AHMA 3N42B 4ZXBA 5FM5M 1MFCL 2CRZA 3IKCA 3QDJE 2QVIA 3SD2A 3ZZSA 5IOPB 1WT5A 4RRPM 4XNQA 4ODXB 3AB0C 3VUAA 4IRJD 5KYNA 3L5HA 2GK2A 1HSBA 1JGIA 2C7UB 3GZKA 4NN6C 3V4PH 2DLFL 3EJRA 2BZDA 5D7KD 2GT9B 1VADA 3KPSA 4JPQA 3UBXG 1BM7A 3KLDA 2WOYA 1RIVH 3T0DA 4L4VE 4EVNA 4NSKA 2IH1A 1OP9A 4ZMWA 4F8LA 5C0CD 4P2YA 4AIZA 1VPOL 3FU9A 4BFEA 4TLTA 3IDIB 4YHMH 4KKNA 5EHFA 2IQAA 4EJ1C 4K7PX 1XF2B 4LP8A 2JIXB 1VAHA 4PLKC 4R7LA 1BBDH 4JFEB 1ZKAA 1KLGA 1NL0L 4ANWA 4PJBA 4MJ5A 4TQIA 4C47A 2WKGA 4ZW8A 1KPVB 3WTSA 1NCDH 3T09A 1NM9A 4D0CB 2PO6B 5FKAB 3JVGC 4L3ED 3CZFB 3IFNH 1UFGA 4BXSV 2N56A 4XO5A 2VDLB 2B20A 1Q0XH 3E1F1 5JW3L 1SBBA 5D1XE 3WS6A 1O75A 4N0UA 2VB5A 4DAGL 2EDEA 3I84A 5INDB 2NNAA 2CDFA 3LMJL 3D69A 3N41F 1FO0L 4RMQA 5TDOA 1Y0LB 2J4WL 4L4VA 2JJSA 2HVJB 3KCPB 4OFKA 4YIQB 3WKNA 1HSAB 3VAEA 2EDKA 5DHXB 1AKJD 1N2RB 4WU7B 1ZD6A 1NCAH 5GSVB 1IC1A 4R4ND 3SE3C 4GBXB 3ULUL 3RWJA 3C08H 5I0DA 1IKNA 4HU8A 4NM8H 1MWAH 1QW8A 3ARWA 4P5TC 3U7WL 35C8H 4PP2A 3HG3A 5ICYA 4H7VA 2F58H 2P5WE 1F42A 4PHZA 4CW1B 5J6GB 1H5BA 2BY3A 3SDAC 1JZ4A 2Q86A 1JVOA 1W8EA 4BK8A 3QYCA 4GY4A 4U6YA 3CVIL 3TT1H 4YE4H 2IOOA 3KBPA 3MREB 4JMXA 4DKEL 2OXGB 3D3VE 1YYMH 4Q6KA 5F9DC 5IF0B 5AAWC 4ZNEE 3UPRB 1K4CB 2NX5E 5FV2A 5GZOC 4F7CB 3WI9A 2JB5L 3QIWB 1J0ZA 3MDJA 2H4EA 3RIAK 1RHHA 1SYVA 5KVDL 5KAQG 1Q0YH 2XXMB 1MY5A 5HHXL 5T1MA 4IMLA 4QKTA 5DJ0B 3RFZB 1BD2A 2X3AA 3V0VA 4F33A 3L3GB 4Z0BH 5FM5O 3MNVB 1EZUA 3VI3B 1R5VA 2YMXH 4KVNH 4Z7QF 1UEMA 2YQGA 3MTXA 5TJWK 5ESVB 5FGBA 4F33B 3BVUA 3D9AH 4WWKB 5JHMA 3U46A 1BHGA 3PPSA 4U3HA 2HKFH 2JNZA 5C0CB 1DVTA 4WFFD 1HINH 2KL6A 4LLUA 1GAFH 1CF8H 1NEPA 4Y4HB 4WHCA 3QJFB 5JTWA 3PWJB 3P9LB 1QOKA 4G9FB 5JORB 1GPOH 4NQVA 4WRLA 2HFGL 3RBGA 4NKMB 5EEYA 3UJIH 4Z9KB 1KB5A 3KPOB 5CHNA 1M2VA 3TV3H 2FX7L 2IQ9H 3ALWA 2XT1B 5JLZB 3IPFA 2ADGB 2AJYH 4I9WD 3GSQA 2KS0A 1QLRB 4R7DA 1GJIA 3PDOB 3GFUA 2BW5A 4X7CC 3RTLA 3GXIA 4A6YA 5IHWA 3S35L 1TCRB 4L1BA 3ARFD 4ZDHB 3ARUA 4KKRA 3HPJB 3TM6A 3SCMD 4GG8B 5I6PA 4KK9C 3NJHA 4DW2H 1UXWB 1Q9WA 3M7OA 3WN6A 4L8DB 1PZ5A 3QS3A 3L08A 1TJMA 1CE1H 1NPJA 1BYOA 4QXGH 3C5SA 5FA4A 2XQYK 5FGCE 3UO8B 2VLKE 4HKBB 4FL4B 2BSSB 1KEMH 2Z31C 2X0UA 1GZPA 3HE6C 1IBHA 4OZFB 2ZP9A 5GZOD 3N85L 4WWOA 5I1EL 5E08L 4FNLL 5BRZA 3IS1X 5K93A 5D1XC 2DH3A 3KNBB 1Q94B 3LN5B 4OR1A 5LWYL 1KZQA 1XR8B 5GRYA 2JI2A 4S2SB 1SNRA 1U3YA 2EKJA 4QHLA 3VXNB 3MQIA 5CJ5A 2AV1A 3K8KA 1OP4A 3EH5B 4LVHC 4F7MA 3KYOA 4HOZA 4YH6A 1EMTH 4QTIL 4RMVA 2FATL 4KX9A 3LIZA 4KO7A 3QQ4B 4MDIA 2DM3A 3HG4A 4WI0A 3QJUB 3RWFA 4PAZA 1FAIH 1MCQA 1FIEA 1MCCA 2Z31B 5IVZA 3RWIA 3CZSA 1RZGA 4M5TA 2VL4A 1T0MB 3E6FB 3QDMB 4WGKA 2GEQA 15C8L 1E65A 1W9XA 1MHPH 1OF0A 3JYBA 2AAVA 3FB5A 4NGHL 3VWJA 3QNXA 2DQTH 4CVUA 1AZCA 3TO2B 1F56A 1TR7A 4PWHA 2QKIC 3CVHB 1JIBA 3K2MC 2XXCB 3VXSD 2OMZA 1LK3H 1S78C 4XNBA 4ELMF 1AQHA 2FUTA 4M3KB 5HGBB 1A1MA 1E28A 3WFBH 3RB5A 2ARWA 4HJIA 2X4UA 3B9KC 5FO7B 4EIBA 4JFPB 2NXZC 3L2NA 1K5NA 3D2UB 2PWHA 5FUZL 3F7QA 4QCIA 5J5EA 1IEHA 1ES0A 3N6YA 4GH7B 1EEZA 3GMMB 3QCUL 3UTSE 3UABA 2BZCA 2X6BA 5TPWL 1JRHL 3REVB 3HC0A 4Q2ZA 3QAQA 4WEUD 2E8YA 4TVPD 2P7TA 5IQNA 5DR5L 4F58L 2VRQA 1UOWA 4C56E 5SX5H 2N4IA 1JNNH 1FZKB 4ODHL 3GKWH 3NJXA 2WXPA 2VXTL 4MJID 4P23A 3BH8B 4ZNEA 3MV8B 2EYSB 2QMKA 4BSVB 4FYRA 5BO1H 3BIKA 4O00A 4H0LC 2CLRB 2UV3A 2ZOOA 5GZND 1D9KC 3AS1A 2YMOA 3FO1A 3WE1A 4DO4A 5IMOB 2X70B 2YQ2A 4PB9H 4Q9RH 5SWSA 1G6RH 5CCGE 4MJIA 3SE9L 5DD1H 1R3IH 1EHLH 5F72S 3QYNA 2DQDH 3BGMA 4FFYL 3TO4D 1IV8A 1PX3A 3BO8A 4XCCL 4XI5D 4HPYL 2NY1B 3KDPB 3DETC 4K5OA 4HLZG 5AZEL 2JXMB 2LT9A 3KPPA 2VDML 2NQDA 5HHME 2CBTA 2IAMD 1TETL 3L3KA 3MCKA 3HZVA 3Q5OA 4MJ4A 3WY1A 4FA7B 2QV2A 1A2YA 1EFXD 1F00I 1OAQL 1YNLL 2WP3T 3K2UH 4JR9L 4AC2A 1Z9NA 1CLZH 4LOVA 3WG7B 1UOLA 4NCC2 3MV9D 2VSDA 3GJEA 3LNGA 4XCNB 1DQKA 4RSVA 2GQHA 1NDMB 1OT4A 1P9MA 2XTSA 4PJDF 4S0TD 1I3RA 2VW7A 2WHVA 1SJEB 1CZ8L 1RIVL 2LU3A 5F8RC 2E7LC 5C9JA 4G7QB 1A0QH 2FD6L 1VA9A 1WA1X 2B9AA 4NN7B 4NZUH 4LQFL 5CGTA 3MNDA 1NCWL 4E41E 1K8IB 2DEXX 4EOWL 3LQAL 4GKNB 4NHUA 4TVPE 4U4BA 3RL2B 4LPUA 5ANMA 2Q3XA 2FNWA 3DPDA 4DTGL 3DMMB 5I1LA 1KDJA 3A3YB 2ZCKL 1I1FB 3KVQA 4TOYL 3CXHJ 3WFHB 5K59F 1OCCB 4RGOL 2XX1A 3ECBB 3EJSA 2B08A 4KI5D 5DEGA 5A2JH 2L8AA 1F1GA 2EDNA 2FO8A 2RD0A 4IS6A 5C09B 2TSBA 4L4TD 4KPHH 3WMSA 1AYOA 2WYTA 4Y2DD 5CBEA 1H3TA 4BWTA 3LHPL 5HD8C 2F0CA 4MAYB 5IIEB 5DHVA 2NY2B 4K0OA 3PWPE 1IM3A 4QD2E 2OXGA 5JXED 2GITA 2O61B 1RZJL 2OA9A 1IFGA 1XZWA 4U6YB 1I9JL 5E4OA 2Z91A 3X11B 4DQAA 4PJEB 4ZOEA 2EDYA 2IWEA 3C9NA 3THML 2YMTA 2WKOA 5JDJA 2BRRL 5AOKA 2P46B 5AOMA 2BVOB 2V8LA 4FHKA 4GIPD 2YZ8A 3RIAF 3O3BB 4LQ1A 3T04D 2R2EA 1ZT1B 3HG0A 4JQIH 3WJJC 4BKTC 2WKLA 3E2HB 1FE8L 4BA8A 2Z4TA 2HWZH 3SCMB 4N2OA 4QRQA 1YUHA 3MI6A 1CDBA 3NRPA 1BLNA 3SBRA 2JQAA 2NY3B 2QKIB 5B1JC 4C55A 3VU2A 1KIPA 3NACH 1OGTA 3MLRH 3NZHL 4L9DA 5IHHA 1A7OH 2Z93A 3U6XS 3MCKB 2DLIA 3AREA 4FTVA 3P69A 4WI0B 5GISL 4BV1A 3US9A 2D03H 5CEXA 1PVHA 3RUGB 2JTYA 3BVVA 3DSNA 1OAYL 3BGMB 1PKQE 4LPYA 1S3KH 2XIBA 4AJYV 3EYOB 3QC5X 2HVKA 3D4ZA 1KT2A 4WSJA 3V9EA 1BF5A 4LAQH 2BFVH 4W6WB 2WLJA 4LDOB 5ABDE 4CGTA 3WNJA 4OGXH 5D8JH 2GC4C 3LSOA 1AMXA 3BP7B 3L7EB 3VXRD 3BEVB 3V6BR 3CHOA 4Z3GA 4TPRH 2ZXCA 3LRLA 3PY9A 3CFUA 3VWKC 4ZUWA 5GS1B 3IRZA 4HGMA 5JIDA 1SHMA 2EACA 4HUKB 4AMKL 4P23B 1M7IB 2RIKA 4PGDA 3AREC 1QLFB 3U0WL 5DS1A 5G4MA 3Q13A 5F89B 5CCKH 2FH6A 3KVPA 1Q9WB 2IPUK 4NO3A 3PE9A 3GMNB 3LZOA 2Y5EA 2Z4QB 2P7TB 2I85A 3FQ4A 1NAMH 4YHOL 5F0MB 1CXKA 3IE9A 1YMME 3DDGA 5F96H 2P8PA 3BN9D 4PJDE 1CGXA 4GT7A 4MASA 1MWAB 5F93C 5TF1L 2J1WA 3ARRA 3GMQA 4LCVA 3V6FB 4Y4HC 1XCXA 2GSIB 4OV6F 3W0WD 4RFNB 3WSQH 3SDCC 1D9KB 2FIKB 4WI3A 1BGXL 4P46C 2FE0A 1OZTG 3AACA 5E9DE 5I23A 5KW9H 2BIOA 4TULH 2C1PB 1V10A 3EYVB 3QA3B 5CGYD 3L6FA 2VZOA 4K3EL 3O6FA 5H94B 2IG2H 2Y06H 5IVXE 5IFHL 3TEUA 1AGCA 1HX0A 1R3KB 4NI6A 3L9RB 5DMIH 2M8XA 1S7QA 2ZXQA 5IREA 2VJ8A 2V6HA 3UTTA 2Y36H 1DUYA 1WPCA 2YEZB 2BP8A 4FMVA 4XNAA 3U30C 1BREA 1KG0B 3FB7A 1E4JA 4OIIH 4YDIH 1YEDB 3LRSA 3RFZC 5EU7C 2X10A 1RZPA 2WQWA 1QSFA 3UAEA 1RK0B 2WANA 5T3XE 1QQDB 2J5LB 4J6IA 1AGDB 4FXKB 4ZW5A 1ORQB 5EC1B 1GW6A 4ELMB 1U3HA 1GC1H 2H2PC 3MGTA 2VR6A 3RZWA 1NLDL 2H3XC 2WQXA 2ZX8A 3B9EA 3RQ3A 3ZMRA 3WAJA 4PWIA 1N5AA 4RZCA 1B9ZA 1AACA 4PV9A 4UQAA 2QSQA 3LNDA 1KGIA 4QRPB 4OZIE 1QVOA 2E7HA 4YL4A 1WG3A 2FJFA 2BSTA 2FWOB 4K3HA 4OB5L 5D7LB 1A1NA 4P2QB 4Y16D