2BP0B

M144l mutant of nitrite reductase from alcaligenes xylosoxidans
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGLSGTLMVLPRDGLKDPEGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title High Resolution Structural Studies of Mutants Provide Insights Into Catalysis and Electron Transfer Processes in Copper Nitrite Reductase
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 87
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2005-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00394 Cu-oxidase Multicopper oxidase
B PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bp0B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bp0B02
2AFNA 2H47C 1JXDA 1WA0X 3H56A 2PPEA 4GXFA 4YSTA 3QJSB 4F2EA 2IWFA 4HAKA 1PZAA 2PPAA 3S8FB 3SQRA 3FSVA 1JZGA 4HHGA 4DP1X 2UX7A 4CSZA 3TASA 2PP9A 2XLLA 5B7EA 2IDTA 3HB3B 4DP6X 3FYEB 3V9EA 2FQDA 2Y69B 2ZWNA 6PCYA 1PLAA 3FSAA 1ILUA 4Q89A 3MX0B 1JVOA 3PAUA 3AW5A 2YAMA 1T5KA 3EH3B 1J9TA 3NJJA 2J5WA 2HX9A 3QJVB 4Q8BA 4BWWA 1ASOA 1OE3A 3FPYA 4BDVB 1GS6X 3T71A 2NRDA 2AVFA 1A4AA 1JVLA 1AR1B 1R1CA 2GSMB 2FT7A 3IBOA 3ZX1A 3X1FA 8PAZA 4UANA 1A65A 4DPBX 1OF0A 4KOBA 4DP4X 1XB8A 1E65A 4QKTA 1QNIA 2FQFA 4G71B 1ZDSA 1M57B 1V10A 1BYPA 1SF5A 1GYCA 5B7FA 2FWLB 3OQRA 2PP7A 4NAJA 3CVCA 3V9CA 4AKQA 2OJ1A 4KO6A 4F2FA 2BW5A 2UXVA 1AS6A 1E5ZA 2AZUA 3FU9A 4DP9X 2CBPA 1ZIBA 1ADWA 4KO9A 2CCWA 1JXGA 1ZPUA 2VW7A 1AZUA 1TEGA 2BP8A 1AS8A 1NIBA 1PAZA 2FQGA 2X88A 2X87A 5LDUA 4FAAB 1XB3A 1WA2X 3S3DB 1PF3A 1DZ0A 1KV7A 3NSYA 4P5SA 1HAWA 4A2HA 2JXMA 3S8GB 2EILB 1RCYA 4P5RA 1ET8A 3ERXA 3TBCA 3NJHA 3TU6A 4HALA 1A4BA 1ID2A 3BVDB 1SDDA 1J5CA 2EIJB 2YAPA 4YSPA 2HRGA 4GP8B 1ET7A 5I6OA 2ZONA 1KCWA 1ET5A 2FT8A 1NIAA 1L9OA 2TSBA 3DTUB 1J9SA 1J5DA 4E9RA 2IDUA 2FTAA 5EHFA 2XVBA 4A67A 4HCIA 4FA7B 3EHBB 4A2FA 2GIMA 4K9JA 1L9PA 3WIAA 2W88A 3GDCA 4YVNA 1PZCA 1NICA 2PPFA 3MBWB 3S3BB 4WTQA 3JTBA 3NSFA 1SDDB 1UATA 4CSPA 1AS7A 1XMEB 4GYBA 3T6XA 1BQ5A 2IWKA 3WKQA 4WKXA 3H4HA 3CVDA 2GC4C 3NSDA 5F7BA 1AQ8A 4HIPA 1KDJA 3QJTB 2EINB 1NIEA 4DP0X 1L9TA 2GBAA 2I7OA 1GY2A 4A2EA 7PAZA 1AAJA 3WG7B 4YSCA 1SJMA 5I6LA 5I6MA 2AANA 5B3SB 1BQKA 3WI9A 4DPAX 2XU9A 5I6PA 1NTDA 1BYOA 3FSWA 4AKPA 3OD3A 1JZFA 4GY4A 3FU8A 3CDZA 4UF7C 4E9TA 3NJGA 1NIDA 4EF3A 2OCCB 3UABA 1N68A 3NJLA 4F7KA 1WS7A 2J56A 4YSDA 2CJ3A 4KNSA 2VW6A 1KYAA 4G7SB 1IKOP 2VW4A 2DYSB 1OCZB 2DY2A 2VSKB 3FQ1A 5B1BB 2JKWA 3X2QB 4BXSV 2BW4A 5I28A 1BAWA 4YSOA 2AZAA 4W9ZA 5I5IA 2CALA 3PPSA 3NT0A 1BQRA 4BXVA 2IAAC 2PPDA 2GB2A 5I5JA 1WAEA 1ZDQA 3S3CB 2PPCA 1GS7A 4YSQA 3PAVA 3CVBA 2JFCA 1PNCA 2B3IA 4PAZA 3CDZB 1KDIA 1CURA 2GHZA 3AY2A 4M3HA 1I53A 3ASOB 3UAAA 3UACA 1MDAA 3NJKA 1PNDA 4KO5A 2QDVA 5B7MA 1KGYE 3CG8A 1NPNA 2HRHA 1NIFA 4E9XA 2N0MA 3GXUB 1EZLA 6PAZA 4KNTA 1MZZA 4BK5C 1OV8A 2XX0A 5I5MA 2Q9OA 1JXFA 2CUAA 1BXUA 3ASNB 2PCFA 4G70B 5AFAA 2WO2B 4YSUA 2UXTA 5I26A 2PP8A 2YXVA 4W1TA 2BO0A 2UX6A 1PMYA 1QHQA 4A2GA 1TEFA 2VMJA 3T6WA 2MRYA 5ANHA 3AG1B 2BP0A 3IN2A 2ZXWB 1CC3A 4GP5B 1SFHA 4QLWA 1ASPA 4YL4A 3DIVA 4DPCX 2HX8A 3QQXA 1PLCA 2H3XC 4HHWA 3KW7A 1J9QA 2XV3A 3SBRA 2DYRB 1F56A 3N55A 5B1KA 1RKRA 4E9WA 1NINA 1RZQA 1GS8A 3PAZA 1CYXA 1N70A 1JZIA 3RYMA 3C75A 1ZV2A 4UAHA 1SF3A 2J57A 3FU7B 3FQ2A 4DP5X 2BP0B 1M9WA 3EH5B 5D4JA 2QPEB 4YVUA 4JHUA 9PCYA 2YXWA 3TBBA 1V54B 2XV2A 2EIKB 2P80D 3AG2B 1JERA 3QJQB 4X4KA 4E9QA 4AX3A 1MG2C 3T9WA 1SFDA 3ZIYA 1GW0A 1IBYA 1URIA 3NJFA 1AG6A 3PLYA 4HZ1A 4DP7X 3X1EA 1W8EA 1IBZA 3FS9A 3PCYA 1TU2A 4E9YA 2VSMB 2PLTA 2B08A 1NWPA 4AI7A 5I6KA 4BWUA 5F7AA 1AIZA 1AZNA 3QJUB 3NSCA 3T6ZA 4N4YB 3N2JA 1OCRB 1B3IA 2TSAA 3X1NA 7PCYA 1WA1X 2CAKA 4KOCA 2A3TA 4JKNA 4KNUA 1AACA 1QLEB 2MTAA 3FPXA 3U25A 1OE1A 2R7EA 1L9QA 3HEIB 1AANA 1KBWA 1E67A 2XXGA 1YLBB 2YAFA 2BWIA 5IY5B 1ASQA 5B1JA 3WNIA 4DP8X 2FQEA 3NP4A 2YARA 2FNWA 3NJNA 2E86A 2Q5BA 1A3ZA 3G5WA 1OE2A 1A4CA 2YAHA 4YSSA 2ZOOA 3EH4B 5PCYA 3AG4B 2HZHA 3WNJA 1FWXA 1PCSA 2FT6A 4AKOA 1NWOA 3FSZA 2HLEB 2J55A 5I6NA 3NJMA 1IUZA 2I7SA 2XX1A 1L9SA 3ABMB 4NB7A 1W6LA 1J9RA 1FFTB 2RACA 1NPJA 2R7EB 4L0PB 5AZUA 2EIMB 3QJRB 1JZHA 1RZPA 4JHVA 3ZBMA 3AG3B 1NZRA 4M4RB 3PXLA 2QPDB 3OMIB 4ENZA 1TKWA 1GY1A 1KBVA 4E9VA 4YSEA 2XXFA 1MG3C 3NYKA 2WSDA 1L9RA 1AG0A 5FC9A 2WO3B 4A68A 2P80A 4PCYA 4DP2X 5AKRA 4E9SA 1NDTA 2IDFA 1DYZA 1PZBA 1GSKA 1AZCA 3SBPA 1E30A 4G72B 4HCFA 3OM3B 5A7EA 2IH8A 4N8UA 2OV0A 2VM4A 5PAZA 1A8ZA 2UXGA 3FU7A 3X1GA 4A66A 1HFUA 3AZUA 2HXAA 2BZ7A 5TK2A 1E5YA 2UXFA 3QPKA 5B1AB 2YAQA 5TK4A 2I85A 2FJSA 2DWSA 2IDSA 3ABLB 2LLNA 3BQVA 1HAUA 1BEXA 1BXAA 1KCBA 1ETJA 4GP4B 3JT2A 4ZK8A 2BHFA 3DKHA 3FQYA 1V55B 3FT0A 5D4IA 1WS8A 4MFHA 4YSAA 1IC0A 3ABKB 1JZJA 2DV6A 3FYIB 2XUWA 2GC7C 4BWTA 3H4FA 3KW8A 4G7QB 5E9NA 1EHKB 2BZCA 3ZDWA 3UGEA 2GI0A 3IN0A 1JZEA 3NP3A 1SHXA 3UAEA 2QT6A 4TXVB 1SNRA 3NJIA 1CYWA 2PCYA 3GYRA 2IDQA 3EF4A 4A2DA 1FA4A 1XB6A 2BP8B 2XYBA 1CUOA 1OOWA 1ILSA 2W8CA 2Y1AA 1VLXA 4HCGA 4KO7A 3ABGA 5B1JC 1W6WA 5D4HA 4G7RB 1AZRA 2VN3A 3TA4D 1OCCB 2YQBA 1M56B 2YAEA 3SBQA 3UADA 2DWTA 2IWEA 1BXVA 2XV0A 1X9UA 3OMAB 1PLBA 2IH9A 3X1BA 1PY0A 3D12B 3T6VA 2XWZA 1X9RA 3IEAA 3CZUB 4NERA 2HX7A 2VM3A 3IE9A 1SHWA 1AOZA 1ZIAA 2BWDA 2H5UA 4YSRA 1OCOB 1GR7A 3L45A 3WKPA 2YAOA 1JOIA 4RH4A 4AZUA 2QDWA 3OMNB 1AZBA 4BDVA 1MZYA
chains in the Genus database with same CATH superfamily
2AFNA 2VDKL 2WLNA 2EP6A 4LCYA 3WUWA 1TO5A 3LMJH 1K6QH 4G2AA 4PRHA 4N8CH 5T1DL 3QR0A 1QBAA 2F74B 1X3DA 3D85A 3RLSA 4NP9A 2ZJSL 1IBDA 3MRKB 3U1SL 2OQJA 5CGYD 3BYTA 4K8RC 1CFTA 2D4DA 5IWLA 4N3UA 2YKLH 1DBML 1EGJL 1PLAA 1HSBB 5IJDC 2PXYB 1B2YA 3PAUA 2HJKA 2WBJB 2J5WA 2R56L 3NJJA 1YYLH 2IAMB 2ZXBA 5HDOA 4YDNA 2Z4TA 4WDIA 1KJ2B 4RRPM 1CGUA 1USZA 4LSTH 3H2QA 4PH8A 4I9WE 1GS6X 4PS3A 5LNGA 2LE9A 2CDEB 4LHUG 2GSIA 3ROLA 4DQOL 3FTWA 1QTSA 4UANA 3QNFA 1KPVA 2X6UA 4I77H 1NGYA 4FXLA 1CN4A 4YDJB 1I8LA 4YHKH 1GGBH 3TA3D 5I30H 3L3KB 5D2NA 4QKTA 1G4MA 4JVPA 2X2YA 3QZPA 2V9QA 4QF1B 5C08D 1ZANH 3C60B 5F89A 3OTTA 3WTUA 5EUOB 2JJVA 3FQRB 2N56A 3SD5A 3H3PH 4XH2B 1YNTA 3BKCL 2BW5A 1INEL 4CUCA 5KYYB 7TAAA 3VQLA 5I19H 1TCRB 3HNTH 4GOSA 4ZMVA 4KO9A 5E2VL 3BDYH 5EUOF 3WEXA 1AZUA 4L18A 4HWEL 4ZRGA 4OM0H 1PAZA 1TCMA 2K70A 2OJEB 2X88A 4GKZA 4MA1B 5E4EB 1HQ4A 3RPIB 1I8MA 3I9GH 1PF3A 3MREB 4Y2DC 2UZYA 2D31B 1I4FB 3VFMB 3GXIA 3VFPB 1K5NB 1I9RL 1OVZA 4GAAA 1BVKB 2BSEA 3GHEH 2EILB 1RCYA 1Q72H 4QXUL 3WD5L 4ZMPA 4AJ0A 2W38A 3P0GB 4A7GF 1TQUA 2B4CC 3NJHA 4KI5C 2VABB 5E8PB 2YXMA 1KWKA 4K7FA 4GRMB 5FLUA 4QT5B 5FM5M 3KVDD 4F3FB 1FGNH 2OMUB 1GZQA 3RTQA 1BFVH 1NMCB 1DFBH 4QRPE 3NCMA 5CBEA 3TBWB 4BGLA 4XNZB 1W8NA 1ZK5A 2XWJB 4WU5A 4HUVA 1U3HC 2FO4A 2DYPB 1DL7H 3MCYA 3NCBB 1U93A 2D7PA 3DPBB 5GRWA 3T4AB 3FUKA 3LV3A 4OFQA 1BQHB 2C9XA 1U4FA 4H20L 4JDZA 1ZHNA 3H0TA 1U8HA 2O1AA 5M7QA 2HCZX 4HUUA 4N2EA 1DDHA 1NDGB 5A1AA 3DSFH 1G0DA 3IPEA 1MQKH 2ZUVA 4LBEB 2PPFA 1WQVT 4ZFFA 4PR5B 4ZFOL 4ZMWA 3QFJE 2QHRL 4FCHA 3GF8A 3U46A 2X42A 2H3KA 5CEXB 5FAAA 2OXGA 2X4UB 5I2IA 3LEVL 3FHEA 4BSVA 4WKXA 1UASA 5GPRA 3VD7A 1FV1A 3MFFB 5T3XH 1OAKL 3HI6H 4LU5L 3GSOB 5KOMC 4XNMA 1AFVL 1T2JA 2EINB 1R0AH 4UOW0 1EO8H 5HGBA 3PGFH 2K1MA 3C87A 5H4ZA 3CMOL 3R8BB 1SEQL 3FT3B 3G3LA 2VDNH 5AWNL 2WWMC 1R5WA 4K5PA 1EUTA 2C3VA 1ITCA 1BQKA 4X5XA 3ZQWA 2YPLE 3QWRD 5L4JA 3QNXB 4QHMA 2ZSVB 2PWFA 5KVDL 3O6FA 4IRJC 5DJ2B 5F3BB 3CDZA 2O6FA 4MNQD 3VD4A 5DFVC 4WGVB 1MI5D 4MB5A 4ZUWA 4Z7VF 1MXGA 2NY3C 4O58H 5AD0A 3L3HA 4P3DB 2H2PD 4LP8A 4FZEL 4LNVA 4G9DB 4G7SB 4W9EC 4AYFB 4FXKA 3DOSA 3QUXA 4PJFF 1U91A 2VZOA 1I7TB 3MV01 4N25A 4U6HB 4HIHA 5GGSY 1WCBB 2OSYA 3SPIA 3DHPA 3VAEA 3O3DA 4LCIH 4P8QA 2X6BA 4JZOA 3X13B 3KPPB 4IBYA 3ROOA 4V1DE 4P99A 3QFJB 2KMWA 3BUYB 4FHJA 1J10A 2EYSA 4AV0A 2YD1A 4WTXA 1MOEA 1T1XB 4PS4L 3VXRD 1T83A 4OTXL 2AK4B 4HGWA 2B3IA 2YD9A 3IBEA 3FONA 5AL0A 1HILA 3RWJB 1I53A 4G9FA 1WPCA 4TYUA 4YHMH 2APWA 3TJHC 4GSXA 4HWZB 3S36X 1ND0A 3LRSB 2OX5A 3BAEH 5HYQB 1BFSA 4WFGD 1M6UA 4P2YA 1UFUA 3GI9L 4PLKD 1OK8A 2ZCLL 3U1QA 3O4LE 5DVNA 4YDKH 4H88L 4LSVH 2F19L 1J87A 3VMNA 4F7MB 1P9MC 4R5VA 3B2DC 4N8VA 5FV1L 1LDPH 1S78C 4YBQC 5TE7L 1E27A 2WKLA 2GT9A 3DA0A 3DV6A 1A7PH 2YPLB 4OH2A 4JFXA 4RX4D 1RIVH 2H0EA 4NX0A 4P4RA 1AQHA 1FYTD 3BC9A 4L0ZA 2GJZA 3UBGA 4N0UE 4ISVA 1HZLA 2DMHA 2CLVA 2BY1A 1MFNA 2IBZX 5D7IA 3T6WA 5HYJA 1WYJA 1T04B 5DFWH 3ZKND 2OM5A 2ZXWB 4MS8C 4RIRA 1DANT 1CMOA 4FJZA 1CFNA 1IQDB 5J89A 5DF0A 4RZCB 2X4RB 3OLEA 1FZMA 1AE6L 4PY8I 4MMZB 1UUSA 1UD8A 2FEJA 3DOHA 5B1KA 2WW8A 4V1DB 4XBEL 3KPSE 1WBXA 2BZDA 5ID0B 2O61A 1GS8A 2LGNA 1F4YL 4YS4A 1UTDA 2XBZA 4ZAKD 1T7ZA 3RE0A 3C75A 3DDGA 4P46C 4L9LC 4U1MB 3W5MA 1FVEA 3MAWA 2ED7A 5CIPB 2AQRA 4NUJB 3LRKA 4YVUA 1ZLWK 1R6VA 2UYLA 4OUUA 3O4LB 4GKLA 4QXTB 2AI0L 4N90D 3HZKB 3AG2B 4UQCA 2R83A 5T8IA 4YO0B 4WW2C 1N5YL 1HKLH 2BSSB 3TA3A 5CBAA 4NZJA 5B38G 4GMTH 4LKCB 4JY4B 2VDMH 1OM3L 2NY5C 1OPOA 5KVEH 2V2XB 2XZAL 4BZ2A 2NUTA 2XN9A 1T03H 3CBRA 4PJ5A 3SE3A 4E9YA 2C7FA 5IHWA 3MRJA 4N0UB 4OAWB 1XL6A 1OW0A 3UBXB 2F53A 5F7AA 2EVIA 2P5WB 5DJYA 3P3TA 2WB7A 1A6ZA 2AJVH 4FJ6A 1OSPL 5CCKH 1G7QB 4FYTA 1B3IA 4OLZH 4PCKA 3RB5A 1U8KA 2ZG2A 4JG1L 4XCYA 2MTAA 4G59C 4LL9A 5CAYB 4G6KL 3V4VB 4FFYA 2R7EA 4OLVH 4X5RA 4E42B 1IC7L 3MJ8A 4FFYH 5C09B 3WJLA 4WWNA 1OF2A 2XXGA 4AIZB 1CO1A 3KPSB 5DJCA 5B39G 2QQNH 3MROB 4KK5C 4LNRB 2FNWA 4CSSA 5J11B 2YA2A 4PJ7B 1S7SA 3FT9A 1XEUA 1I1AB 4XMKL 4DKDC 2VDRL 5I66A 5MENB 3HBZA 2FJFA 1E8ZA 1LILA 3WY1A 3T1FA 2OCJA 5MHSD 3WFCL 4HIXH 1CXFA 5AZ2L 1F5WA 5SWSD 4MB4A 1NM4A 5LUMA 1JGIA 1RPQA 4PJ7F 1Z7JA 1IGMH 5T1LB 2OMWB 1AI1L 3BSZA 4KKAC 3DYMA 3BSZH 3HBQA 1YYMH 4U1HB 4NQCD 1WAAF 1WFIA 1BJ1H 2ENPA 3NCYS 4MYPA 3GMLB 4B5EA 4NN5B 1T4WA 3ZKXC 1RI8A 1ACYL 3QEGL 5DJ8B 5FOBB 1F45A 1RK0B 4XE0A 2VC2H 4Z7IA 3VM5A 2CJTA 2EIDA 5FB8A 2NYYC 2HPTA 1YY9D 2OK0L 2ITEA 3IU3B 3FN0H 1ITBB 3HB3D 5C0DA 4IGBA 3C2SA 3GNMH 4DK3A 3WOVA 3DIFA 4NQDA 4E5XA 4U31A 5LAPA 4HH9A 2E7DA 1YEDB 3BAWA 4L1TA 3RGBA 3OAYH 2IPUG 2XTSA 2GBUA 5EBLB 4CDHA 1BMWA 2AGJL 2YFOA 4IDJL 4Z7UF 1EJOL 3EOAB 3SDDC 3KJ4C 2UXGA 5KYXA 4OLYL 2PTUA 4XNQB 3QJFB 1IT9L 1O0VA 4GIPD 5C8JA 3E6FB 2EKSB 4QO1A 3Q05A 3T8MA 3GSNL 3VH8B 1JZ4A 3AITA 5DK2A 3QQDB 3E8UL 1MCLA 4YE4H 5GJTL 4ZK8A 2X0UA 2C1PA 2BHFA 2Z31A 5AVQB 3FO2A 2CO4A 3KHOA 3JSSA 3TCXA 2O30A 4U6YA 4C47A 5BV7C 3A23A 4ZD3L 2I60L 1AGBA 4KX7A 3M45A 4JDEA 4PJIB 4PJ9D 4Q4EA 5DMIL 1I9JL 2GUOB 2IG2L 4DO6A 3EDEA 1BLNA 1I8UA 5F9WC 4YHPB 4HK0A 3ZO0A 5EEXA 2VXUH 3VI4E 1RJCA 2F5BL 3IPBA 1BJ8A 7FABL 3QQ3B 2MNWA 5DUPH 4Z0BL 1VADB 1Y7VA 2CKBB 2WIIA 2PCPB 3MU3A 4Y9FA 2H32B 3EFOB 4PJIF 4GMSL 4HCRH 1MUJB 1FI8C 2X0VA 4M7KH 3S5LA 3HI5L 1G1YA 2IDQA 1FO0H 1CWVA 2AJXH 4WTWA 1UG9A 4X80H 2D2OA 2VMFA 1B0WA 3DJ9A 5MI0B 3U0PB 4QHUA 1S7VB 5IB5A 3GBMH 3MLYH 3BVNA 2KI6A 2AHIA 1NDMA 2VN6A 3J07A 4KJWD 2NOYA 3TESA 4MB3A 3P4OA 4AIXA 2G9HA 4KQ4H 3BAXA 4H0IA 1ORQB 3FQWB 4JM2A 5I6XB 4OB5L 5DXWA 4J3OG 1VFBB 2X4PB 1UVQA 2BCMA 4FTVD 4K3DH 2GPZA 2HX7A 4NFDA 1DCLA 3JQOB 3K6OA 2AQ2A 2ZX9A 5E5MA 5D7IF 5IOKA 4ABWA 3L6FA 4LDLB 3BGMB 2BP5M 4K2UL 4YFLI 4WW1A 4OQTA 2YAOA 2WAQA 1CU4L 4OQTH 1FH2A 4Z3HA 1JDCA 4R4FL 4RX4A 4YEFA 2OPCA 3EGDB 3QRGH 2HFFA 1B4TA 2H47C 1AKJD 3KR3H 3D0AA 4U6VH 1MRCL 1XH2A 3IDYC 4AMXA 3VI4B 5E1HB 3NFPB 4UTCA 1JK8A 2DQJL 1QBBA 2UV3A 3ZOAA 2IWFA 2H2SC 2PPAA 5KSAC 1QYGL 3FSVA 2ADFL 1B4RA 5L88H 3RJOA 4CSZA 1ZHKB 3X14A 4XCNB 3K46A 1T7YA 4GG6A 4U1LB 2Y69B 1Q1JH 1W16A 3BPOB 1J86A 2QFRA 4GW1A 3KYKL 1EJFA 3RY6C 4L0YA 4XPBL 3UBFA 3BT2L 2VZ1A 1T1WB 2AV7A 2HKAA 4QOKA 2F1EA 1PG7L 1UZ6F 2ZP0T 4FXGC 1M05B 2K0RA 4TUUA 4W4NA 2Z0UA 1J05B 5DQ9A 4JB9H 5INDB 4MJIA 1X5ZA 2FT7A 3MRBA 5GS3A 1QZNA 1DN2A 2EQDA 2ZG1A 4H1LB 1U8LA 2F18A 3QXVA 1A7RH 3U6XA 2FHCA 2OYLA 1DQIA 2EC9U 4FABH 1HHKA 4L2LA 3MN8A 4MSWA 3ULVE 4M7ZB 1QNIA 2FQFA 2BHZA 3UO1H 5ADPH 3M88A 4U3SB 5LGYA 4XGZB 2N01B 2WXJA 3ZZ1A 3LY6A 3CFDA 3G08A 1CLOH 4XMWA 3P30H 4RMBA 5GZNA 3SKMA 1JBJA 4JGMA 1M1SA 3PHSA 3VRLE 1WD9A 1YNKH 2ZOLB 3ZTEA 3FU9A 1S7WB 4OFYA 4YXKL 2I9LB 2A0LC 4KV5F 1CD9B 2R1WA 3I6KA 2IXQA 3GKWL 1K8IA 5L7XL 1KIUB 1RU9L 5L2KA 3IFNH 2VYRE 5K9OB 5KTEH 1DZ0A 3M1BB 3ELAT 5I8EA 2ICEB 3RX9A 3SGKC 3MMEA 2DJMA 3L54A 4FQ1L 1IAOB 4L4VA 4PSRA 3IJ7A 4DK6A 1YEIH 2Z64C 4EEEA 5E2WL 2UVFA 4B9JA 3DYOA 3NDZE 4ODXB 1DVQA 4LF3B 4ODTL 2VR6A 3QULB 2LTQC 1BW8A 1IGIH 3EJYC 5LXGL 5DZ9A 4M6AA 3M7OA 2KYIA 5KSBF 2X53A 4BEIA 3JT0A 1Y6MR 5TQ0L 3FDWA 3S4SB 5IJVA 2ZONA 3V6FB 1FORL 1NIAA 15C8H 1WUZA 3T0BA 2XVGA 3M8OL 3WN5A 3VXOA 4NZ8A 4A38A 3CDFA 1KGJA 4UQIM 2MOGA 1FFNA 4NQCA 2ARJQ 4GKNA 3LNDA 4FNPA 3PABA 4WWKA 1LE5A 1FZOA 2G5RA 4BQ9A 1L5GA 4OZHE 3KAAA 1YEJH 1IKFL 3VFVA 4DCQB 4B9FA 4L3ED 5IWLC 1GVIA 1IGCL 4BKLA 3IE4A 2KZWA 2OTPA 2CLRB 1CIDA 3VTAA 1MHCB 2I69A 5I1AA 1G0XA 2AJZA 1YY8A 1P4IL 2VLRA 4FQ2H 4KROC 3I02B 3TOPA 3ZUCA 4IRSD 3QJHB 3U0WH 5D7LA 2FDBP 4LP5A 2CDFB 1XH1A 3P0YH 4MNQB 4NN7C 1JWSB 2ADYA 5MEPA 4NJ9L 1MI5B 1FL5B 4Z76A 1HT6A 3QJTB 4TVPH 4LRNH 3TH3T 5GGRB 2YGVA 3JWOH 3Q9QA 1G7IA 2YPVL 1I8LC 1P7KA 1LL1A 3IMSA 4PRPE 4TUKH 4NC1C 5D2NC 4ICWA 3P9LB 4AXWA 2KZBA 3ARBA 3RWGB 4D9RD 2VSCA 2ODIA 1EO5A 2CJUL 1IVTA 4MDIA 3CFKB 5HI4C 3H9HA 1NGWA 1VFUA 1CE6A 2GK0A 2R51A 3DGCR 1F6AB 4ZI8A 3VD3A 1R3IH 3VXRB 3NJLA 3NEXA 2BMKB 4KKNA 4YBQD 4N0YH 1DUZA 4YSDA 4BFEA 3ZHDA 4KHXH 2VR4A 2VAAA 1JPFB 1NFIB 2DYSB 1KN4L 1XIWB 2CU9A 2JKNA 3CXHK 3V5KA 4BXSV 2VDOL 1QI4A 1XGUA 4K71C 5I28A 5HJBA 2PF6A 3E3QC 3EUDA 1JRHI 5JA8B 4LIQH 3MRIA 3TBTB 4EI5D 1SM3L 3WIIL 2YOCA 5T3ZD 1M9SA 2GB2A 2BSTB 1QBLH 1FLRH 4NZTH 4ALAH 4L05A 1HINH 4W4OA 2AAVA 4HPYL 4N5EC 1QX1A 3HG1D 3X3GH 1E2WA 4AGLA 3LJ3A 1ZGLP 4OD2A 1X5AA 3A6CH 2AJYL 3R18A 1JMXA 4M3HA 2H6PB 4N28A 5B8CB 1U2YA 2EXWC 1D5ZB 1T6VN 5DHYB 1J11A 3EYQD 1KIRB 2XTLA 4NZRH 1SY6A 2GITA 2FYVA 4U1KB 4S1QH 4E5XG 2R0WH 3T8VA 3OAWA 4JFHD 1OTTD 3QJZA 3TL5A 1I1YB 2X7LA 3DO4A 1RULL 4NHCL 3FBQA 1EZLA 1SN2A 3TZVD 3U30B 2Q8AH 3LD8B 4O2FB 3QDME 5F3FA 5F9DC 4YZWA 4MXWL 1HSAA 2CUAA 2VUOA 3WFBH 5H8DA 5DMKB 3R1GH 3VD9A 1EHLL 4MX7A 4S0TD 5IVXF 2UXTA 1KCUH 3JV6A 2BO0A 2UZXB 1DJXA 2CUMA 5IB4A 1H15B 5JHMA 1FJ1A 2W94A 1ZTXE 4LP4A 1NSNL 2VZ3A 1IBGH 2HJLA 4ZTPL 4X9HA 5ECGA 4J3OC 4YFEA 2F1AA 1U92B 2L7JA 4WEBH 2JJWA 1I9IL 4OT1H 1JTOA 1MFDL 3GSXB 3BZFA 3MO1A 5FHAH 4D0DA 3ARPA 2NX5D 3H7LA 4E9WA 1KXQA 2HT2C 1CDBA 3TIEA 3KPNB 1NBYA 1MLCA 2DMKA 2OW7A 2ERJC 3LRLA 4IJ3C 1IIIA 4NNPL 3WENA 5HVWA 5C0BD 3O4OC 1SJVA 1SF3A 2J57A 3FU7B 5L4IA 3MRRB 2NR6A 3UAJD 1KELH 4FA6A 5F0LB 1F41A 5AKSA 4O02L 4A7QA 5I16B 2QKSA 3MRQB 1S7QB 1E9PB 2F58H 4PP1C 1J0IA 3KL5A 2A73A 5A16B 3GTNA 5FECA 2DZEA 2WQXA 3IJHB 3LKNB 3LPFA 1E9OA 2FX8H 4TRPL 1ZEAH 5A2BA 1QD0A 3QJQB 1AMYA 2VDQL 4CVXB 1TVHB 43CAB 1X5MA 2AF2A 4DN3H 4BH7A 4FXKC 4HUKB 3QUXC 1W0VA 4MJ2A 2R2EA 3B8YA 1JTTA 4KRMB 2WTRA 5F7MC 1HKFA 1MCRA 4WNQA 5IGXL 1JPTL 2V7NA 3N5AA 2A9MH 3FUHA 4UIKH 2KQNA 4Z0XA 4U3CA 4OZIA 2XIDA 3QJUB 3NSCA 4Y2NA 3PDOB 3BX7C 1ZSDB 3DOIA 2FHFA 2C26A 3HLAA 5EZOH 1T83C 1Z9OA 1JG9A 1OT1A 1Y6KR 2OR7A 3I50L 3K6DA 2A3TA 4X8GA 1QR4A 4IBTA 3U0TB 4LSRL 3ILQD 1KOAA 1UXSA 1OP5K 1VCAA 5TE6L 2A74B 2M2DA 3T0AA 3US9A 4QTFA 1BSIA 1OPGL 1WIUA 1WP6A 4G43B 2F08A 4ORGA 3X12B 2IADA 5JXAH 2QBWA 5L0QB 3BP5B 1E6JH 4DFIA 4N22A 3SDDD 3KLKA 3RQ3A 4W9HC 1P4UA 5AUMA 1PCSA 1FPTL 2HLEB 1MF2H 3GUTB 4NP4H 3SGJA 4OGYL 3WFEL 1AXTL 2PYEE 1J8SA 1M2OA 5E7FA 1FFTB 1EUUA 1A6WL 2VITB 4HJIA 2BRRH 4IOSD 3MRPB 2B7DT 1FE8L 1A1MA 3TM6A 4ZUSB 3D08A 1F2QA 3VFRA 3SPJA 1NANI 3GTTA 1Z5YD 3JTSB 4M7LL 3GHPA 4XP9L 3B3IA 4WZ9A 3QS2A 4RAVB 1UCBH 1SQ2N 3A4EA 4C4KT 1BZ7B 2QQLL 5DJZB 3V0WL 1GGYA 2HFGL 1DE4B 4TSBL 4Y5VA 5KYUA 1EFXB 4PB9L 5EOQL 3D39E 4CNIB 4DP2X 1HEJC 1PZBA 4JRXD 1EJ8A 4HLZG 3L3OB 4OCLC 2P8MA 4FQXB 1P6FA 4GUOA 4LLVA 1MFCH 3TPKA 3ZPDA 2EC9T 3H7BB 2VM4A 5EU5A 5PAZA 3FCTB 3CXDL 1HFUA 3C12A 1R3JB 5FEBA 3UZEA 1FIGH 3MUJA 4PGJA 5IB3B 3GBNL 1WIOA 1U8QB 3U2SB 2A1WL 1UYWL 1A9EB 1ZRUA 5M95B 5AYTA 1BZQK 2R0KL 3AWGA 1V55B 4JRLA 4RSVA 5E2UH 3SE3C 2YWYA 4FG6C 4WI0A 1MWAA 5FYJE 2ATPA 2PYEB 1MWAH 3WXVH 1MELA 1RZGB 5HHME 1D5XA 3CBJB 4OJEH 4O2EB 2W07A 1C08B 4Y5YA 5E9NA 4UOJA 3VXSD 1JXJA 4QRTB 4CADA 2ATKB 3LZNA 3AQYA 3W2DH 2DDQH 2OMXA 3E38A 4TS6A 4NCC2 5EO9B 3J2PA 1CYWA 3NJIA 5IBTH 3V52L 2K7PA 4FTVB 4KI5E 3WJLC 2XYBA 4WI9A 4PLJD 5ICUA 1WBYB 4JPKL 2XZQH 3P02A 5KSAD 4CC4A 3GJEA 3FW6A 4UB0H 4HIIB 3WHE1 3S88L 3K72B 1JRHH 3SOBH 2X4SA 3O41A 1XGZA 2OZ4L 1UCTA 2CRMA 4BFIA 3I84A 2X89D 3GLAA 1QBML 4PJGE 3WDIA 3Q01A 4CSTA 4L4TE 4B9IA 3F7RA 4LDEB 2QADC 2BS9A 2XA3A 2Z8WC 5JOEA 1LEIB 3RURA 2FUQA 2V9RA 1R3KA 1T3FA 3PGCA 3RTLA 4YFLF 4KI1A 1J8HE 3R06B 2VLME 1LWJA 2IO5A 5LXVA 5C0RH 4N0FA 3RI5K 1I3VA 3C5JB 1U8CB 1Z1WA 4FZ8H 1T0NB 3H56A 1J1XH 4IGBC 4NPJA 1UGNA 3HG0A 4ZUTB 5HHMB 4K7PX 4YDIL 3S35H 2DWYA 2UZIH 4PGCB 3D1MC 4Y2DB 5DRXA 1N6QH 3QJSB 1MIML 2CUIA 3QUMA 5CZXD 2NQCA 4A7SA 3QUMH 3U6RA 5HYFA 1MH5A 2FGZA 3LAFA 1QA9B 1RFDL 5DC4B 4QY8A 1UH4A 3BUBA 4ZW5A 3ECUA 2VRQA 3K0WA 3WE6A 3V0GA 4ODBD 3A5VA 1LD9A 1CDCA 1TYRA 3DROA 4K9EL 3FFCA 2BVOA 2E4FA 1C9SA 2C9VA 3ARGD 3DDFA 1OD9A 4EZKA 1DDTA 3EG9A 3QNZB 1G6VK 4LOEA 2VUKA 5AL8A 4JO4L 5BRZE 1KTJA 1U3HB 3QZNA 1P2CB 1U8IA 4A55A 2Z31C 1SOQA 2P47B 1O5DT 2AVFA 1OSZA 2BOCB 4PJGB 4X6DF 3Q1EA 2NY6D 4L4TB 4B7LA 2R4RL 1IM9A 5E8OA 2HTLC 3BQUD 3GGWA 4AK1A 3GK8L 2WO4A 5CCHE 1JV5B 1M6OA 5GGVL 3IF1B 3DVNA 1MCWM 2EZ0D 3NDYE 1RIUH 2WLIA 2WUCL 1FVCA 5IEKA 1FNAA 1R47A 2Y7QA 1PTZA 1CGSL 3CN3A 4FNLH 5E6ZA 3VFOB 2FGWH 2YK1H 2O5YL 2PP7A 3QXDB 3QZWA 2ZXQA 3PQYE 4N2LA 4PP2A 3IDJA 4RFNC 4ODSH 1OP9A 4FG2A 2FZ3B 2DQHH 2UXVA 5EB9A 4LSUH 4TPRH 3QDJD 3FH5A 3APDA 3GO1L 1M1XA 3S0PA 1I1FB 3ETBJ 4APQA 2VW7A 3EYVB 1WZKA 2AITA 1RERA 3HG3A 5BRQA 1NLBL 1LE9B 2ITCA 3D9AL 3I6LE 3VM7A 4CJ1A 1RZKC 3BRDA 4ZW3A 4X6CB 4XOCA 4JM2C 3IDXL 4JRWA 2FK9A 4XVSH 1SDAB 4A2HA 5MERB 2QVIA 5D5ME 4U1NB 5IOPB 1UENA 4IJTA 4AQ1A 1DLHA 2KC0A 2VQ1B 3LVTA 3FO0L 4J6RH 1A7NL 3TBSA 1U6AH 4GXVH 3EOTL 4IRJB 4Q9QL 4X6CF 1ZE3H 4X8CA 4MNHA 2EIZA 4YNYA 4C4UA 1NOLA 3QXAA 5BPPA 3VI3A 2DN7A 2E8YA 5D55A 2NY3B 1N0LA 3V6BR 3OKOB 2IPTH 2YAPA 2WNGA 2BSRA 5KSVB 4NKIL 3MNWB 1Z2KA 3QDAA 1QO3B 3DTUB 3C2AL 1VERA 4AENA 2MQ0A 4E9RA 3MV8A 4ZPVB 2BC4A 5HDQH 1D9KD 2A6KB 2FTAA 1ML0A 5HI4D 1P7HL 1ODUA 43C9A 3PQYB 5EU3B 1E8YA 5DRWA 1BM7A 1R17A 1BWWA 1RIHH 3MBWB 3SHSA 5T33L 1I75A 2J71A 4IDLA 1NANH 3ZT5A 5DT1H 2YQ2A 5CSGA 5JQIB 3P9WB 2OMZB 5I1JL 3FQXA 1BGXH 1MCDA 3MLSH 2QPUA 1YUHA 2WVVB 4UU9B 5J5EA 4IBSA 4X83A 5D5MB 5GSRA 4E41D 4UINH 3ENEA 4ODVH 3NAAL 3MPCA 1T7VA 3EYFB 4JFVA 2QZQA 4KK8C 4Q9BA 5D72L 3KLAB 5EOCH 5I1LB 4HWNA 1AKPA 3OJDA 5D70L 3CTTA 5B1CA 1Q0EA 1TLKA 4XX1E 1JWMB 5SWQB 1A4JB 4PRID 4EI5B 1BYOA 3OGCA 1NL0L 4G11A 1L6XA 1N7MH 2M83A 1JZFA 4JKPL 3FU8A 3NCYP 1GL4B 3KPLB 5GZNC 1XGQB 3HG1B 1FYHB 2AK1H 3MA7B 5BUGA 4UQ3A 1JNHB 1GOHA 3DXAD 3SDAD 3ZE1F 3DO7A 1E5CA 2DTMH 3B5TA 3MOQA 2R2HB 2VSKB 1MNUL 4HJJL 3L4YA 3HLKA 4HOZA 4ZPTA 2BW4A 3ZE0F 1Z5HA 5H35A 5EORL 4N6RA 1A7OH 3ECBA 3ZYJA 1MHEA 5D4QA 4P46B 4L9LB 3TZVB 5GZOD 1JYWA 1JCVA 4KJQD 1QR1A 3OF6A 4Z7WF 1J8KA 4HUWA 4YN3A 2VQUA 3ARZA 4FKKA 3RWHA 1ADQA 2DWDB 3UAAA 1IM3D 5KAQG 1G9ML 1BD2D 2OULB 1HHGA 1ZXQA 2D7QA 4PQXA 4BRVA 3CG8A 4YLBA 1NPNA 4RGND 2VLLB 3UTTD 1IARB 4F80A 3FUMA 1NBQA 5EZIH 1A6AA 3F7PC 2EEDA 3NFNB 4IHOB 1MZZA 3WN5C 2J25A 3FRPG 4MZ2A 3CFJA 1NFDF 1S9XA 2BNRE 2E47A 2PCFA 1JVKA 1P5VA 3IDNB 4WWKC 1D5MB 4YSUA 5GSVB 5KWYC 3K3QA 3CH1A 3REVA 5F6HJ 1DQVA 4KH9A 4MLIA 5CXPA 1PMYA 3LNIA 4LHUB 4A37A 4AQZA 3U9PL 3Q2LA 1XTLA 3P4MA 4MCZB 3T2LA 1IL1B 3MJ9L 3TN0C 1ECYA 4NBYB 3AG1B 2BP0A 4P2QA 5C0BB 3IRPX 3Q2NA 2Z3FA 3QARA 4EOWL 4TKWA 3MLRL 4I4WA 1YEHH 4QGYA 5JHLL 4IRZL 1NCUA 4OKVB 3HS8A 1UB5B 4FNTA 1S7XA 1F4HA 4HHWA 3W11C 1H0DA 3RWDB 4HFWB 5C0JA 4NJAL 5C7XH 5AVTB 4TUOA 1JE6A 2EH8H 2BJML 2HRLA 3JWOC 2ZKHL 1RZQA 2IH1A 4D0CB 4FFZH 6FABL 4N2HA 4JY6B 3ARGA 3BJ91 4M9PA 1ACXA 4N2BA 2KLSA 1VZGA 2IOIA 1I82A 3ARBC 2Q3XA 4TLUA 3CQPA 4HKXA 1UWEL 5J1SC 1CGWA 3ARED 3CFNA 2WLLA 4HKBA 4ZOBA 5AYQA 1X5IA 1LYQA 4LKXA 4WI3A 5I17A 2YXWA 1BMZA 3ZKXB 1DBAL 5E2TL 1I8IB 1QWHA 1CXKA 3GMPA 3KCPA 4M7LT 4NO2A 1QPPA 4XO5A 3QIBA 2VISA 2ZX7A 3T0EA 4E9QA 2BNRB 5IF0A 1PD0A 3T9WA 3W9EA 2YMOA 3IMUA 1URIA 2N1TE 4F7TB 4BSWB 3PCYA 1UXWB 1R24B 1QOKA 4J3SA 1AP2A 2PYFB 5CINL 4WI7A 4X7EC 1ZLVK 5JNYB 4YAQA 2G5BB 4X9IA 2DLGA 4ALAC 2W65A 4YIQA 3G5XB 5I8CA 4PVNA 4O9HL 3MLTA 4KTDL 4W4OC 1F4AA 3DJRA 3Q9PA 1QWNA 3ATBA 2JI3A 3LKOB 1WZAA 5IFHH 4NRXA 1ZT4B 1X9LA 1JF1B 1JGVL 3HZVA 3SDDB 3WKMH 1IEHA 3OB0K 4I3GA 4HWEH 2EEXA 2GIXA 1CICA 1JSYA 1Y0LA 1Z32X 2YWZA 3D0LB 3MFGB 4XAWL 4UM8A 3GXTA 5JORA 3OJMB 1P7QA 3HE6A 2BWIA 2WV3A 3NZ8A 5B1JA 4WHYH 4BCZA 3NP4A 3ECWA 4DFHA 5KG9A 2J3SA 1QLRB 4LHJB 1RUAL 4L1BA 5IR1B 1KGCD 1KTLB 2YGPA 1YPZE 4GAJH 4PS8A 5CMAB 5ANME 4F5CE 5BV7B 2AJSH 3ULUL 1H9DA 3L7FB 5IP4A 1K9TA 1KC5L 1TDQA 4QXVA 4X5LA 4JE0A 4CMMA 2EDNA 3EH4B 5F9WB 1ZVSA 3UC0H 2VXSL 1NC2D 1QEXA 2EUZA 5IQ9B 4OGZA 4K5LA 5BRPA 4MQTB 3MCLH 5I6NA 5LGJB 3UJTH 1Z3GH 2XX1A 5E94B 4NB7A 5CNHA 5DUMH 1SBBA 2RACA 4HULB 2A99A 2DL9A 4EI0A 2EIMB 4NKQB 4AWJC 3OMIB 4KBPA 1GY1A 3GEWB 1DQJB 4AG4H 2XPYA 3ZZSA 3FBKA 1ZHLA 3W0WD 2GQHA 3NYKA 3QUYC 4MA8H 1JFQH 3FCGA 1A9BB 1B0RB 2ID5A 1UWGL 2OMVA 2RQEA 3QORD 5FC9A 4D8OA 1G7HA 1QI3A 2GAZA 4OLXL 3WN6A 2Y06H 4NQTA 3D3VD 2KZKA 3FU5A 4APXB 4U49A 1NEZB 4J27A 3LOWA 4XNUH 2NR6C 1FRGH 3PUUA 3OM3B 4LEXH 2JK5A 2V6HA 1CTNA 2ENQA 2F8OA 3S37L 1AR1D 4QGTA 4XMLH 4K55A 2BZ7A 3L3JB 3L8QA 3VE0A 4OCWH 1AIFA 4LOUC 2VLKA 3ABLB 5E0QA 1L3NA 1YPZB 5ANMB 4ZG1A 3VXSB 2LLGA 1A3RL 1WHPA 5IHZA 5IW1A 3NSJA 5C9JB 4KQ3H 4OI7A 1BA9A 3WEMA 5CP3A 3L4CA 5HHOA 3IDYB 4JCWA 5C6TL 2DTSA 5CP3H 1IC0A 2P42B 3GBEA 3MUHL 2G0KA 2CBMA 3V95A 2Y36H 5HHNA 3KMDA 3ZVVA 4D7BA 3EJRA 5KSAB 1WWBX 1IC5H 3DJZA 1P4BL 3DV4A 4UT7L 1U8MB 4HFUL 3HE7C 3CFTA 2P5ED 1MFEH 4DGWC 4KFMA 2VDKH 1DVZA 2R8SH 1TLMA 1Z66A 2A9BA 5DR5L 2JIXD 2BS71 3F5WA 4R4BB 4QUOA 2V5TA 5T1DH 4JRYE 3POHA 2BVQB 5ERWB 3GMOA 3GYRA 2BFVL 4IMLA 4NENA 3RU8L 4PRNB 3VGEA 4AM0B 5C07A 5I18L 3DPDA 2D3JA 4FXGB 3U1SH 1VFAA 2HYMA 3MRNB 4KO7A 2BNUA 4UOQA 2V3EA 1EGJA 3QPQD 1DBMH 1EGJH 1TR7A 4NUGL 4PGBA 1MY7A 5ICXB 5GS0C 1CI3M 2R56H 2MEJB 2P8PB 3D4CA 1ORSA 1Y6NR 5C86A 2DWTA 3RL2A 1BXVA 1QSFA 4LLDB 2J8UE 4GW5A 1KENL 4A6YL 1F3DJ 1HH6A 4PRHE 5CEZD 3AADB 1DVXA 4C56D 3IEAA 2OCFD 3SQOL 3AJ7A 1FG2A 2WSKA 3UZQA 1HQRB 2HJFA 3LKSA 1EDHA 1K4DB 4LSPL 1OCOB 3AC0A 3MX0A 2APSA 3P0VL 4GFTB 3CSYA 5TTRA 1HX0A 3A3YB 3ZE2E 4KVNH 2DJUA 1SVBA 2HLFC 4JJHA 3QFDB 1TPXC 5IESL 4AEFA 1AZBA 4B9KC 2E0PA 4K5MA 4PWKA 2J5LC 1YMHA 4R96B 4BFGA 3O3BB 2MQGA 4N8PA 5C70A 1OP5H 1B3JA 2XFGB 4PREB 5FOJA 3WIFA 3FT4A 3BKCH 1JMZA 2RGSA 3IMVA 5FFOA 1INEH 1T66D 3RUGA 2TAAA 5SWZA 5B38B 1JZ5A 1IU1A 4JRYB 4NQQA 5L8KB 5E2VH 4MCYA 1FDLL 2QHLA 1JN6B 4GNKB 5JMOC 4M6OL 5D2NE 4KH2A 3P3SA 2EXYD 5BQ7B 3UZEC 2NPLX 2LTQB 3MV7D 5ABDE 2WXNA 3THMH 2PO6D 5CHNB 4JFFD 3UYRL 1I9RH 3BPCB 1PFOA 3VU1A 4QXUH 3U83A 4QRUA 1OIOA 1R5VB 4KKCC 5LDSA 2J8UB 2AJUH 3HKFA 2Y07L 1P1ZB 3BN9C 3NIDE 4I0CC 5FGCE 4PRHB 1MCKA 4WI4A 3KWWB 5EZLA 1JYNA 3F05A 4PJXB 4DPBX 2ARWA 1X7QA 5B39B 2OQJB 4DEPC 1CFTB 3BKYH 4Y5YC 4TNWK 4G8EA 5IUCA 3E3QE 2YO3A 4G71B 3O6ML 4BRJA 2VLJD 4AGQA 2C7UA 1WC7A 4JLRB 5FWQA 2HJKB 2JSFA 3ZE2B 4G6ML 4PJXF 3Q43A 1D6EA 4NAJA 4WDIB 3BZEB 4JGJA 2APFA 4H20H 4XMVA 4KROB 4P57B 5F21B 4NO3A 3V4PH 4P5TA 3BUQA 2JMRA 5LAXB 1SBSL 4NN7B 2YR3A 2CBPA 2N7AA 1NMBL 2CCWA 4UQEA 4I5BA 4WJ5A 4AJVA 4ZFOA 3ROLB 5HBBA 2Y7SA 3B9KD 3GB7B 2QHRH 2HVBA 1PIFA 4KWUA 2ZE0A 1QWUA 3MBEA 1CVRA 3LEVH 4I0PA 5D2NB 5FKAA 3C5ZA 4G1EA 5CF3A 4L8SA 1OAKH 3WJJC 3ERXA 5F89B 4L5FL 3GS7A 3EDDA 5FUCC 2Y24A 3K2KA 3TCTA 1B6UA 1AFVH 3NA9L 3JV4B 4RGOH 2J88L 3BHBB 3WNNA 3IKCA 3SIKA 3ZGHA 2XG5A 2KPWA 1TFPA 3CMOH 3NIDB 4OQ1A 1X4YA 5FGCB 5D71L 1Q90A 3ARDD 4OF7A 5AWNH 3D2UD 4GP8B 3KGTA 3WEXB 3HOGA 4KY1H 1S6NA 3QUKB 4B9ZA 5AAWC 2WQVA 1HQ4B 3IAPA 4GFXA 5DD6B 4FERA 2CBOA 1BAGA 5KVDH 5T3XE 2D7MA 2UZYB 5ESQA 1HK6A 2MIZA 3BW9A 3WLWD 2B77A 3HG4A 4J4PD 2JELL 3DSNA 4FZEH 5ACZA 4FFWC 3ZLQC 2ZOUA 4NBXB 4E41B 3GDCA 4PFEA 4GKSA 5MP6L 4A7UA 4K7FB 1NAMB 3SZKC 4WFEE 2J4WL 4I48A 4FQLH 1B4JL 1GZQB 3T3ME 1C5DB 3O8XD 4G5ZL 2XICA 2WB1A 3GIZL 4WU5B 2FO4B 3D3VA 3AWEA 3IJSB 1DO6A 1U93B 4OTXH 3P3YA 4GBXD 1AQ8A 2J1WA 3BWSA 3Q13A 5DYOA 2WWKO 1W72L 2DLIA 3CK0L 4Y16D 4M62L 1JNLL 5KYWB 4JVWA 4JDZB 4BQ6A 2VOTA 2KDGA 1KY7A 1U8HB 3H0TB 2L7QA 2W0KA 4HUUB 1PSKL 1DDHB 3GI9H 5AW4B 1EEUA 2D7TL 4M48H 2ZCLH 4JFEA 4A04A 1FZKA 4XR8C 4H88H 4ZFFB 1T5WA 2W91A 4UDTA 3HR5B 5TE7H 1A1OA 3L1OL 4NWUL 2JLPA 2OXGB 5I2IB 5IROA 2OCCB 4BSVB 2WLKA 1LK2A 2EADA 3PIQA 4G9FE 4ZS7L 5DHXB 5GHWH 1IM3B 4APQC 1M7DA 4PJCF 4XNMB 4Y19A 4L1SA 1V7NL 2UWEA 5HGBB 2JIXA 3DMMA 5CM1A 5D8JL 3SY0A 3GHBH 4DEWA 1JIBA 2ERJB 3TN0D 4IJ3B 4XNYH 1BZ9B 1BQRA 3HZMB 3MLZH 3O4OB 5DZJA 3TGXA 4CDGC 1C1EH 2RJMA 1YSOA 4X5XB 3T3MB 1A14L 4AQ1C 2FL5B 3IETA 4QHMB 2W9LA 3M17A 4JY5L 3CDZB 1QABA 4PS7A 5BUPA 1PKQB 3L2LA 4NPYB 1F4YH 4ZUWB 3C5SA 5HYJE 3MLPA 4ABUA 2XXCB 2IMNA 3KLLA 3NJKA 3ZIMA 4DN4L 2BSCA 1NIFA 3D33A 3QUXB 1QQDB 1AQMA 1U91B 4FXKB 4LFHG 3SCMA 4D2NA 5CEZH 4HIHB 4XVJL 1CGTA 3O3DB 1TEYA 4ZQTA 3LKQA 1UADC 2AI0H 2ZPKL 3EJUA 2V3DA 1BREA 2D3LA 2X4OA 2KZ1B 2VERA 2FSDA 2P3YA 3H9SD 1OM3H 1TNMA 4HGWB 1HL4A 3MCG1 1SJHB 2MRYA 1HILB 1A7QH 4G9FB 3CIAA 4QIRA 4I2XA 4Y1AD 2E7MA 1ND0B 4OJCA 4X7TB 2OX5B 3SYOA 4UNIA 2KDYA 3AREB 2WVSA 1A2YB 1D5IL 1OSPH 3KW7A 3B34A 5DQDL 5J6HA 3HPJA 4AY0A 2NSXA 2CDGA 2FJGA 4JG1H 2WQAA 2CR6A 4MS6A 1RSYA 2ZYRA 4JFXB 4FI6A 1IC7H 2XN9E 4HVBA 1TNNA 4P4RB 4PJ5E 2VWEC 2NUPA 3ZSSA 4B27A 5F7FA 4XXCA 4GSQA 4PGEA 2CA3A 2CLVB 2Q1EA 2F53E 4UMGA 3TO4A 4G8FA 4KJPC 1CFNB 1IO4C 5JIIA 1T7XA 4AL8C 1MQ8A 1CFMA 1QRND 1X6LA 4X4KA 3BVWA 2ZX5A 4HJTA 1MREL 1G9NL 5CLXA 1GW0A 1AI1H 2N4IA 1GAFL 1ZS8A 3DECA 4MA3A 5HGHB 1JI2A 2PLTA 4UZGA 5T5NF 4UQBA 1ACYH 3QEGH 3GMNA 5JIMA 3CVHL 3FB8A 3UZVA 5HTSA 5HHQA 3MNDA 4LPCA 2F54D 4G6JL 1MJ7L 1JV2A 3PXJA 3QEQA 2FIRT 5SX5H 3X1NA 1XH3B 3ZRSA 1PEWA 1JF6A 1QFPA 3KNBB 1U8JB 1D5BB 1NC2B 2UYLB 4H4NA 4JE4B 4OUUB 4NWTL 4HZLA 2Y7MA 4RGMC 3SKOB 3V2AR 4WTZA 5D6DA 3HC3L 5BZDA 1E67A 4PJDA 4F20A 2CO6A 4OF5A 1U2CA 1CJYA 5D1XA 5EC2A 2NUTB 3NCWA 5INCA 2AGJH 4IDJH 2J73A 1EJOH 1WGOA 3JTTB 2FWUA 4F7EA 5DJXB 3G5YB 2HB0A 4GRWH 2LR4A 2O6EA 4BH8A 3GSNA 1XF3A 3LKPB 1BVNT 3GSNH 5BS0A 5BZWB 3ESVF 1E4HA 3AG4B 1A6ZB 3E8UH 3B9DA 1HHJB 1QLEL 3MRMA 3GDBA 4Y89A 4NQDE 4LOUD 4DW2L 1YC7A 5D9SA 2X70A 5JZ7C 4JW3A 4FG4A 4HBCL 4UTAL 2R7EB 2EH7L 3MJ8B 5DMIH 2IG2H 4L3FA 3FFOA 4NYLA 1JZ2A 5DJCB 1IQWL 1DQTA 3DHUA 4M4RB 2BIQA 3RIAK 1DEEA 4TULL 3GZKA 3MYJA 3HE7D 1JHLL 2WSDA 3T1FB 4F24A 2MCMA 1GC1L 5J57B 5F1NB 4UM9D 2VN5A 2P80A 3RI5F 4XHJC 4F7CB 5C0AD 4QRSB 2QADB 3OXRB 3CSBA 3S6CA 5C0CD 5I1CH 1E30A 4HCFA 1HI6A 2XYCA 3FULA 4TTGA 4GBXA 5FYLL 3QI9D 5F72S 3X1GA 3C09C 2P5EB 1EHAA 4MTMA 1FHNA 2KUTA 1KZYA 5TK2A 1UM4L 3T0EC 4OB5H 3BQVA 3MNVA 3EGXA 4FF9A 5E7BA 5LNDA 2B9BA 3PWLB 5FB8B 3CZFA 1GW6A 2MMXA 4NN6B 5C0DB 1JGEA 4IGBB 4JL2A 1XZ0A 1YYLL 3N50A 4K2UH 2XRAL 4NQDB 3FN3A 4QYOA 5B21A 3UJJH 4E5XB 3KS0H 4V2CB 2UWEF 1CU4H 4HH9B 2A7BA 4UI2A 2HKFL 3NCEB 5JHDA 4JK0D 1TVBA 2XIIA 2XDHA 3EO1B 1EHKB 2BZCA 3VGDA 3KYOB 4YEEA 2GI0A 1MRCH 2HLFD 5E56A 5KYXB 4JG5A 1F3JA 1JGDA 2X3BA 4PTTA 2DQJH 1CICC 4QO1B 5C8JB 3QRFM 1FHGA 1GIGH 3QYCA 3H1ZA 4FADA 2J20A 2AABL 3GSWB 1BQSA 2ADFH 3N1FC 4HSQA 3HE6C 2WIMA 5B1JC 4HCGA 2C1PB 1VLXA 3ABGA 2NCMA 3FO2B 4PYGA 3UPRB 4TNVK 3K6NA 2VN3A 3KPMA 3KYKH 1RJLB 3K71A 1AGBB 1T1ZA 3BT2H 4YOKA 2NY4C 1R34A 4Q6IA 4R7XA 3IJEA 4WUUA 3GS0A 3OWRA 5I19L 3HNTL 1E9QA 5F9OL 1AHWA 4I7ZC 3F7YA 4YGAB 1E2VA 4JUTA 2WIIB 1NPUA 3IK2A 4NERA 3HC2A 2Z91A 5F88A 3KXFA 5E1QA 4GG6E 4RFNB 2OR9L 3BOVA 3GMQA 1BFOA 1XF4A 3GHEL 2JJTC 4J28A 5IB5B 4QHUB 2EE0A 4ZMTA 5I1KH 1YCSA 4KMQA 1S9VA 2O6CA 1NDMB 2YD0A 4QOKE 3OB0H 4E36A 3T2PA 4IYKA 1UZ8A 3Q5YA 4RMTA 3SKNA 4F7PA 1BVOA 2MOQA 4GO6B 3B5GA 5EMYA 3RZCA 4MJIE 4JM2B 3WS3A 2Z9TA 4OM1H 4XRCB 4F37K 4G8AC 4U7KA 3N85L 1TTGA 3OKNB 1VAHA 4N2MA 3DRTA 1UVQB 4GXUM 2E8ZA 3W39A 1X7SA 2IDTA 2OFQA 1W2KT 1QZ1A 1BDYA 2G0LA 5E5MB 4DVBA 4A2LA 5L7XH 4M8QA 3QPXH 3L6FB 4HS6A 4P2RD 4WW1B 4XXWA 1MCPL 3QJVB 4R2GC 2VLJB 4BWWA 3MTRA 4XB7A 3NG5A 5CWSA 3RX5A 1RK1B 1PD6A 5E2WH 2ZCKL 1H3TA 1JK8B 3QEUA 4X8JA 3X1FA 2F2HA 4ODTH 3HR6A 3RB7A 4G80A 4LPWA 3I3EA 1WFOA 2F1BA 2XWCA 4FNRA 2XG4A 4GPVA 4JFDA 5L2KE 1V8HA 4AT6A 4X42A 3X14B 3B9KB 1WIPA 4MMXA 4OJFL 5TQ0H 5EF3A 1YAZA 1FORH 4QLRA 5D6CA 5AALA 4DUXA 2V2TA 4GW1B 2XCMC 4J7RA 3FUEA 3VXME 3M8OH 1BYPA 4P9HL 4Q9RL 4L4VE 3PGFL 3PJNA 2NNXA 4QOKB 4JHZA 4M29A 4Q14A 3HNVH 4QD2E 4GT0A 4ADIA 3LNHA 3HUJE 4F92B 1IKFH 1JNNL 4KDVA 5EO1A 3V0HA 4YBLC 1IGCH 4MJIB 4AM0Q 4B95C 1H8SA 4AGNA 4ELMA 1AC0A 2P26A 2WKOA 5LDUA 1U8LB 4FL4C 4FTDA 4MJJA 1P4IH 1KXVA 1LQBC 1NCDL 1GZPA 1THAA 3HA0A 4O58L 4WJG3 5AVXB 3QJOA 3RFZA 1HHKB 3NSYA 4FNQA 5GGTL 2O6DA 4MSWB 1ED3A 3KH3A 4N86A 3KM2A 2SODB 3AT8A 3EADA 2O5XL 3FQUB 1KULA 1I7UA 5FGBA 4P4KD 4QRRD 4UWQB 4FCAA 1E5UI 3G08B 2GCYB 4LCIL 2YPVA 4RMUA 2X6VA 3DTXA 2YPVH 1ID5I 3BP7A 4LCWA 1SDDA 4QTHA 3WSQL 3LH2H 1XFPA 4MHHI 2VLRE 3L1EA 3GPSA 2O72A 1NOAA 3MV9D 2CJUH 2IXQB 2XTJC 2YD3A 3I6KB 3O8XB 5KYNA 5L2KB 1NC4D 4DJMA 5D7LE 2JI1A 3DX6A 2TSBA 3IS0X 5EBGA 4JAMA 2IOMA 4XBPA 3BAEL 3MMEB 2HVJA 3N42B 4TVPE 2EDLA 1IJNA 3VXMB 3VWJD 5FO8A 5HGGS 2CKBL 4GKOA 4KKLD 1CFVL 2Y5TB 4HCIA 4MAUH 4QRAA 1RD6A 1H8NA 4LSVL 2NTSP 1NICA 4N0CC 1KN4H 3QDGA 3TEZA 3HUJB 3S96A 2VDOH 4QRFA 5HGDA 4L37B 1QLFB 4KMLB 1YJDL 4JM4L 1CBVH 3NSFA 4AEHL 1SM3H 3WIIH 3ZDXF 4GYBA 1A1NA 3V0VA 3T0WA 3H4HA 4HPYH 4ABQA 1TIUA 2GHWB 3C5XA 2ILLA 3RGVA 2N3JA 3VXOB 3WN5B 2X40A 4P5MA 2AJYH 1H9VA 1FFNB 2HT4C 4GKNB 1LE5B 1FZOB 1MJUL 1Z6JT 3VFVB 1KTBA 3GPEA 3ATDA 2DB8A 5J6GB 2JJSA 4HS8L 2OP4L 2AXFA 1ZT1B 2OSLA 3ECQA 4NHCH 1RULH 1E5BA 2HTKC 1DVFD 1NTDA 3CPLA 3HMWH 3TN0B 4X4YA 5IMKB 4NQEA 1F42A 2EABA 2F68X 1YY8B 5IT2L 2VLRB 4E9TA 3NJGA 3STZA 3UABA 5D7LB 3INUL 1KJ3H 2J56A 2DWEA 2VW6A 4U33A 5MEPB 5AVWB 4Z76B 2VW4A 4PGZA 4ZXBA 3ZTJH 4ELDA 1NSNH 3X2QB 4ZTPH 5DO2C 1G7IB 3TT1L 1P7KB 2ZICA 2GJ6E 4NFBA 3NESA 4I0PC 3NPZB 3RVXD 5I5IA 1HKLL 3ARBB 3C5ZC 2VDLL 1ZDQA 4L8SC 4YSQA 3COOA 3K2UL 4MDIB 5J8OA 5H94A 4R5XA 3WL9B 3H9HB 1CE6B 2GK0B 5IEHA 4PG9A 2RB8A 1BAFL 1TQWA 3HBPA 1JD9A 3H9SB 1L3WA 1CS6A 3K4ZA 1DUZB 1KBBA 2EO7A 5IW6A 2HRHA 4ANKA 4Y1AB 4OLZL 2YHGA 1LO4L 4O02A 1JZ3A 3LPOA 3V5KB 4O02H 1XGUB 3VQ2C 2YGQA 2Q9OA 3V0JA 5ELIA 5I71C 2EDEA 3MRIB 5TPWH 1BXUA 4G70B 5ISZD 4WK4B 4KJPD 2JKTM 1KXQE 3KE0A 4WU7B 2VDQH 5ITBL 1MNNA 4HIQA 2OKMA 3BGAA 4HUXA 3INOA 5ANHA 1S9KC 5JOPE 4HIXL 4L1DA 3UTZA 2GITB 1CC3A 4GP5B 1MFAH 4RMWA 3FB7B 3L4ZA 4FEIA 1C7TA 5DHVB 1HS6A 3I3BA 1LWHA 2R0ZL 1F2XK 2ZUWA 2GJPA 4X7CC 9CGTA 1D7FA 4EXPX 4GLRH 2GJ6B 1CT8A 5FO9A 2DYRB 1ZWIA 3I50H 4PW3A 1DVYA 1JZ8A 4PJ8A 1IEAB 1NINA 1HDMA 4LSRH 3BP6A 5IG7B 3VWKA 2JQMA 4MX7B 4Q4IA 5FM8A 2GW5A 1JZIA 1RHHA 3JV6B 4O4YH 3VFSA 4NHUA 5TE6H 1FL6A 3M1OA 3RP1A 4AKQA 1OTUC 1MJ8L 4Y8DC 1FJ1B 1D5RA 1G6RH 4OZIE 1OPGH 1I7ZB 2YC1A 3FN0L 1CGXA 3EH5B 2HJLB 3GNML 1G0YR 4QAWA 3U48A 4B60A 1MEXH 1S9YA 5FYKE 2ZXDA 3WY2A 1SXBA 2CXKA 4MJ5A 1FPTH 3BZFB 3NFSH 4D0DB 3E80A 4HJ0D 2OL3B 3QUYB 3WFEH 1W8EA 3FS9A 2P7TA 3DMMC 3OXSA 1A6WH 4LLMA 1MLCB 4WI8A 4TOYH 2P48B 3G5VB 1R5IA 4YFDB 4Z5RB 2VL5A 3DX4A 2NXYC 1KGUA 1L0XA 2EDWA 2H0PA 3HI1A 1MW3A 3DHMA 4ODWA 5F7DA 4DKFL 5JYLA 1GZHA 3IFPA 4GI6A 5FECB 4TQEH 1DJZA 1TOXA 3V0WH 1WV7T 2HFGH 2VJ8A 1NJ9A 4PJEA 1KTDB 5D7KE 1GOFA 1E8WA 2WYZA 3CFBB 1ZKAA 4BH7B 1ASQA 3WNIA 5DUPL 3IJ8A 3SCMC 1H8LA 2ZSWA 2JB6A 1L0YA 2R2EB 2WZAA 2APVA 4L29B 3KPQA 3MRHB 4HCRL 4Z0XB 1FO0L 3D4YA 3GBNH 3SBWA 2K8QA 3HE7B 3TF7C 1PG7X 2HZHA 1UYWH 1OAJA 2E27L 3GBML 3MLYL 2VXQH 3RGHA 5IV2A 2BK8A 5DZLA 3M86A 4PJHF 2R1YA 4LLWA 3UG5A 1W6LA 3BIKB 3RVUC 4ZX6A 3IVKA 2IH3A 4LESA 1UXSB 2DQCH 1J1PH 5C0CB 1JZHA 5I74C 2WQ8A 3NOIA 3OR7B 1T0OA 3BKJL 2G30A 5CD5C 4GSDH 4K3EH 2ZKMX 4M1DL 5E0FA 4ORGB 4ONOA 3V52H 1SYVA 3UEQA 2WXIA 2NZ9D 3TLRA 1NM9A 5IVZA 2KLRA 1ACCA 4XXCC 3QRGL 1AZCA 2ADJA 4JPKH 3LKRA 2EVHA 3TO4C 4QHNA 3S88H 1P1VA 2P4AB 3IFOB 4XTRD 2OZ4A 2CHWA 4A66A 2JKSA 4JCLA 4X6BB 2HXAA 3U36A 3VFRB 4UV4L 3EBAA 3KL3A 2YBGA 3OJVC 3QWNA 4AYMC 1QSEA 2LW3A 1TPXB 4YXLL 1HAUA 2YJLA 3QT2A 5EFIA 5IKCB 2J5LB 4OBSA 1KSRA 2P24B 5HDBB 3KJ6H 1MVYA 1AD0B 2VR8A 1UC6A 3VFWB 3T4YB 3B3BA 3ILPA 4JHWL 1EEYA 1PJWA 1N0XL 3L4TA 2GKIA 2HN7B 1X6NA 2WZ6A 5KAQF 4M5YL 3FRPB 4MZRA 1RJZA 5HDBF 2G75A 5EU5B 4CKQA 1R46A 4ZMZA 1CL7L 4YDIH 4DVRH 1XD0A 1MIMH 5TDNA 5GRUL 7CGTA 5I1GL 5DMJB 1EERB 1WWAX 4JX0A 1ZS2A 4HJ1A 4TNWF 1RFDH 3VTTA 1OOWA 2DQIL 2W8CA 3PGDB 3RY4A 3W9DA 3RVTD 5D1XC 1GTFA 2CCVA 3TA4D 5HYSG 4KAQL 5D1QD 1CG9A 4OZGB 4DZBA 4Z7QB 2F8IA 1MWAB 4ZSOA 2K3TA 3QCUL 1MCHA 3D09A 3FZUD 4DEPB 3PWPD 2RH0A 2W07B 4Y5YB 4WFFD 5E6RB 1ESOA 4Y4KA 4BM7A 5IHBA 1S9WB 4F8QA 1OK0A 3T1WA 1BZDA 4Y9GA 4CADB 5EV7A 4OZGF 4Z7QF 2OMYA 2H0JA 2Q86A 4CW1A 2R4RH 3QB7C 3LZRA 4KMTL 3FOLA 4QMEA 3GK8H 5JO5A 3QQ9D 5EEZA 1R3HA 3D2TA 3BUIA 3FFCE 4AZUA 1DP0A 3O2WL 2WUCH 3FUFA 3QIWD 4H26A 4UUJA 1GTNA 1CGSH 5IB2A 4M1CD 3CIQA 2O5YH 1F11B 4NQUA 4BFIB 4PRAB 1IGIL 2NSQA 3WBDA 2QJDA 4XWOC 1KNOA 3VDBA 2CHXA 1OAXH 3QS3A 1TENA 3GO1H 5EA0L 1R3KB 4ONGH 15C8L 2Z65C 3PGCB 4WENB 4JJ5A 3AS1A 4BK8A 1AHKA 1NLBH 2VH5H 2YKKA 2GTWB 2ZAGA 1DBKH 3RX7A 2J12B 3HMXL 1VFMA 3IFLH 3IDXH 5LWYL 2YOAA 1N26A 4FQPA 4PG2A 5DUBA 3FPYA 3MXWL 1E7VA 3GXNA 1XF5B 2IBGA 3VSVA 1E7UA 1HHHA 4EIUA 1A7NH 1NUNB 2A9AA 3EOTH 4KDWA 5DRXB 1HZKA 5FKPB 1YN6A 3RNQA 3QUMB 1N2RA 4PWEA 2IMMA 3U6RB 4DP4X 1ONQA 3GINA 3KWVA 4HF5H 3IMRA 3WE6B 5A2KH 2Z35A 3KPRA 4K94H 4Y4HD 2K45A 1LD9B 4BUQA 1KJVB 2BVOB 1ZD6A 3FFCB 4LRNL 1IAIM 4P9MH 3C2AH 2FWLB 4J3BA 1NCBL 1DHKA 3B6SA 4YHZH 3HS0C 3SDCA 4QRRB 4EUPA 1U8IB 1E90A 2Q76A 2XY1A 4N1EA 3RHWK 4EUPH 4DP9X 3BXNA 2WNXA 1ADWA 2JKRM 3VI3E 1JXGA 1TO4A 3W1ZA 2FEDC 2IQAB 2GVYA 1LNUA 3GMMA 4AUUA 4WF7A 1IM9B 5T33H 1SLXA 4FAAB 1IGJA 1XB3A 3GGWB 4Q6IC 3TYFB 1WZ1H 4IKLA 4N0CD 3MV9B 1BJ1J 3UTSD 2C3XA 4NNXB 5IIEB 1KWGA 3W37A 3DVNB 2YBRB 1AHWC 2VRKA 2YJQA 1Q0YH 3B2VH 1FVCB 3TP4A 1LDSA 4H13C 3MV8E 5B4MC 5F2FA 1ET8A 2FE0A 5CR1A 3UFIA 3QZWB 4YZFE 3JWDL 4PP2B 3QFGA 5G2NA 1R75A 4M00A 3TV3L 4LIQL 3CFQA 1UD2A 2AQ1A 3PV6B 3HAEH 1F90L 2VN4A 1FLRL 4WEEA 3AXIA 2VZSA 4NZTL 3AT0A 5D72H 1HINL 1M1XB 4YDMA 2W0LA 1IBHA 3X3GL 2HMIC 3LRGA 4MD5A 5C3IA 2ITCB 3WEBA 3RVVD 1T2QH 1MFUA 1SMAA 5EOTA 4NZRL 5DQJB 4S1QL 5HJDA 1XD1A 3B2MA 5A2AA 1OWWA 3D0VB 4AQ1B 1DLHB 4JBSA 3TBSB 3KPOA 3SPHA 2BXYA 2NY1C 4PBXA 2VWEE 5MEOA 4PJAA 1KYDA 5M94B 1CLZL 4XXWC 3WFBL 4YNYB 4HGKC 3JTBA 3L3IA 1L6ZA 3VI3B 4WFHE 5CCJA 1UATA 1N0LB 1KCUL 1DLFH 3KYMA 4HG4J 1BVNP 1LXMA 4MGXA 1LO3H 1BQ5A 2BSRB 4NQSA 2J2ZA 5FDYA 4POZD 1N8ZA 1OO2A 3EJPA 4FHKA 4WO4A 5K1VA 2DH2A 3CXFA 3W38A 4R5TA 4RMVA 1BVLB 4FHBD 1IBGL 4AENB 1A6VL 5JIKA 1XAUA 1XGTA 3MV8B 3L4WA 3PWJA 4DP0X 2GBAA 3UP6A 3WG7B 1HH9A 3DX7A 2CK2A 2O26U 3DRQB 4OLUH 2OSXA 43C9B 4MMXC 3K2IA 1FL3A 4S10A 5DRWB 1RY7B 4G42B 5C2BL 4KITB 3NIFF 2N0KA 2CGRH 2Q7AA 4ZYKB 5K9KA 4ODUA 1OGAD 3CZGA 4MXVF 5IM7B 2WVTA 4XVUD 1I3UA 3QEHB 1DQMH 3ARXA 1AH1A 3FQXB 5LNEA 4ZFGH 2L3BA 1HEZA 4HEPA 1KELL 4IBQA 2V5YA 1ZY9A 4OCSL 3MJ9A 4JPVH 4DETA 2YUVA 1S46A 3PUCA 4EOWH 3RIFF 2P49B 5JHLA 3RFZC 2FX8L 3MLRH 4IRZA 4XB3A 4XXDA 5JHLH 2CALA 4IRZH 1E0OB 2XQBL 2HH0L 5IJBC 4W68A 1WAEA 1UD3A 2YXFA 3ALWA 5F7LB 3ZR5A 5FGBC 2IGLA 5JW5A 1AO7A 1MSPA 4I18A 2D7NA 4NJAH 2WXRA 4K5OA 1E6OL 5FO7A 3WEAA 3VDAA 3SE6A 2G3XA 1YMMD 2ZKHH 1CLCA 6FABH 2W0FA 5FWRA 2X2UA 4UQ3B 1N10A 2MKLC 3DETD 4J1UA 4P2QE 3DO7B 5EU7C 2PETA 4H8HA 1K8DA 5AW5B 3T2QA 4ACPA 4BE6A 2WQRA 1HZHH 1V27A 3ARFA 5GGSA 3WFDL 4D8PA 1OTUD 1Z9NA 4ZPTB 4ELKA 4NC2B 2ZKYA 2YSTA 5H35B 3FO1B 1F1AA 3ECBB 1MHEB 1DBAH 5E2TH 5AFAA 4PY8J 5E51A 1QR1B 3AXLA 2ODHA 5BXFB 5JXEA 3FTXA 4G3YH 3QZBA 4U4IA 5EU4A 4W9GC 3RWHB 5FYJU 2FUTA 1QFWI 4FQHB 1S7RA 3CSFA 2DH3A 1HHGB 1WTGT 4RGMB 4JN2A 3Q8EA 4O9HH 4B5ZA 1TMQA 4KTDH 3ET9F 1LTXA 3A4AA 4CU8A 5JW4R 2H3XC 5IMOA 4DIXA 4S2SA 1YAIA 3RGVC 5A40E 3T0EE 1JGVH 1Z5LA 3CFJB 5KS9B 1S9XB 2M8XA 4OLWL 4KHTH 2BRRL 4GQ9L 4EMZA 2PCFB 2MCAA 1P5VB 2FECI 4NT6B 5JIHA 3CH1B 4U7SA 1CLVA 2JJSC 4JRFA 4XPTL 3TFBA 5IQ7L 5I1DA 1CBJA 1TSHA 3P4MB 5KS9F 4AQEA 3ZT6A 4YMPA 1UCBL 2BP0B 1M9WA 3PFUA 4P2QB 1SMDA 3ULUH 4LVOC 4G8GA 2AXJA 1KC5H 3TFKD 5I15L 1Q0XL 1TZIB 1VB9A 2XA8H 3DBXA 2YEZB 2G4EA 4RCAA 3TBBA 2QMJA 2VXSH 2CA4A 3ARSA 4N20A 3RDTD 3I6GA 1S7XB 2D9QB 3LZLA 3V9FA 4Z7OE 3HPLB 5LBSL 3L3DA 5C0JB 1MFCL 2JCCA 5AZEL 3ARWA 4YDLC 4ZXBC 4EN3A 1CDUA 1KLGB 2IH1B 1P7BA 1TU2A 2L7EA 3N41F 2QELA 2VMCA 3QRLA 5ESVA 3SJVD 3OPZL 4JFPA 3BIAX 2YRZA 1UWXK 1EZUA 1KXHA 2CIKB 3HRZA 5D7JA 4DAGH 5BVPL 3QUZA 3T6ZA 3ZZQA 4HKXB 3FU6A 4ATWA 4NKOB 4K07A 5CEYA 4X8XA 5E9DD 4HKBB 5ETUB 3CMGA 3QHZL 4Y9EA 3C09B 5JR1H 5I17B 2GEQA 2NY0D 3G6JA 1UEMA 1SLVA 2YD2A 2Q20A 3FPXA 3OAUL 4OLXH 3GMPB 1P4LA 3T0EB 2IGFH 2VISB 4FYQA 1SZNA 3ZDYE 1LEGA 4XP5H 3W9EB 5EIIG 4P06A 1IAKA 2XN0A 3OR6A 4W6WB 2EEFA 4LLAA 4X98B 3ZW3A 2EYRB 3IMTA 1A3ZA 3DGGB 1PEZA 4OCYH 3S37H 1F00I 1TJHL 1XCQB 2YAHA 2ESVD 4YSSA 4YAQB 2VKWA 3MLTB 3O9WD 5AOIA 1A3RH 1IKNA 5T3ZL 4L8DA 3B2UD 3VA6A 4TNVF 3MGTA 5EU6D 2FR4A 4NRXB 3HZVB 2D0GA 5C6TH 2XQYA 1WFTA 3SOBL 1L9SA 3U4EA 2X09A 4UZSA 5AVRB 1AVAA 1CICB 2OJZL 4XP4L 4Z7OB 2NNCA 3QG6B 1RV6X 1SXSA 4UM8B 1A6PA 4UT7H 4OKDA 4JHVA 3HE6B 1G7JA 2X1XR 4FOMA 1S5IL 3RG1C 1FGVL 4EAEA 5C1MB 4GG8A 2VLKE 4NQVA 4R6UA 4FDWA 5DR5H 1TQTA 4PJ8C 5HPMA 1UURA 1IFHL 2NY4B 3VWKC 4LPUA 3PL6C 2ENSA 1MFVA 1YZZA 2BFVH 4NAMA 5HHOE 3IXAB 4JFOA 4WHTB 4JFQA 3DHJA 4AYID 1NDTA 5JLZB 1BCIA 2IANA 1X7TA 2WPGA 1GSKA 3OAZK 3EJJX 4JO1H 4FZ8L 2BNQD 4NUGH 5AAPA 1J1XL 2CUHA 3S35L 1TJGL 3ZDYB 2UZIL 5D1ZC 4EZJA 1EH9A 3RJQB 1CZ8L 1EXUA 1OB1A 2EDMA 4F37F 2JTYA 1EFQA 3JVGA 3QPKA 4LEBA 5B1AB 3VD5A 4A6YA 2ZWLT 2FJSA 1KENH 3DX8A 4A6YH 4YWGL 2WHVA 4XI5C 1FQ9C 3D4ZA 3H42L 4FLOA 1SOXA 3SQOH 5C07E 3LN4A 5JW4Q 3F12A 1UKTA 5LGKA 1GH7A 2A6JA 3ZL4L 4YSAA 1T6WA 4JHAL 1G7HB 6TAAA 2GAZB 3ABKB 3C60D 5GISL 3SDXF 3P0VH 2QL1A 4UIMA 2JKIS 5L9DL 3RBSA 1UOVA 3AY4C 3LSOB 5BZXA 5C0IB 1KN2H 4OV5A 1QSFE 1FC1A 4N2KA 2JK5B 2NYZA 3UGEA 2NZIA 3IN0A 3Q2VA 2KT6A 1GZHC 3NP3A 1IGTB 2BCKA 1H3VA 4FXTA 3VE0B 3G9VA 1AIFB 4R2GB 4OFDA 2VLKB 1UACL 1C12B 3DI3B 5BO0D 2XQ0A 5B22A 5F0JB 2XWDA 5IHZB 5IW1B 1CUOA 1YEGL 1ILSA 3BFWA 5D2LF 3WFHA 2OYKA 1AZZC 5HHOB 3QO1A 4XWOD 3D69A 1JDDA 1AZRA 2FGWL 5TJWK 4M6OH 4BFNA 2ICCA 5JW3L 4XP6L 5HHNB 1G94A 3SBQA 4O51A 2CHZA 4POYA 2JXMB 2GY5A 2XTJE 3DV4B 3MLXL 5FIEA 3UYRH 2IWEA 4OV6F 3SBWC 4I9WD 2LAGB 3TYGH 4FNSA 3C6LA 1BG1A 3MRLA 3X1BA 3HHSA 2PWEA 4M1GL 3RUGE 1DZBA 1OSYA 2W60A 5SWZE 4GRLA 2Y07H 1SN5A 3F5WB 4JANA 1VKXA 2AS5M 3IE9A 2AMUA 1U8NB 2N7BA 2H5UA 3GMOB 2DYPD 3HN8A 4IMLB 4NENB 2MSPA 3LZFL 4EIGB 3QXUA 5C07B 3VXUA 3KLHD 1ZT7A 1VFAB 3GQFA 3CHXA 4XC1H 4HIEA 4YBLB 3O6MH 1YNLL 1WLHA 4BDVA 1MZYA 5ESAA 1IEBB 4G6MH 4FL4B 1ORSB 3HJ0A 4IEFB 1ZVHA 4OZFH 3FUDA 1HYSC 1SPDA 1EDQA 1FLTX 4I89A 3CQFA 1HH6B 4WV1A 3V5HB 1B0GA 3SQRA 2ZOKA 1MW1A 4YGVB 1ZJAA 3TASA 1PU0A 1FG2B 1QFWH 3QH3B 4K0OA 3T3PB 4HEPG 3FYEB 3LKSB 4PIBA 5TH2A 3QZOA 1EIBA 3MX0B 4CBZA 4HMDA 1J0YA 2YZ8A 4S0HA 2FBJL 3EDFA 1A4KB 2W9DL 3LHAA 5HD8C 3FKUS 3QIUC 3X11A 2XTJB 1OTSD 1YMHB 1RIHL 3S98A 3T71A 5E1AB 1MPAL 4U1IA 1OCWH 3WIFB 2HUHA 3MLUH 3ULVC 5JYMA 1WT5C 4QRPD 4AMKH 2WBXA 3MLWL 3RUGB 1A65A 2Z93B 1DN0A 4KOBA 5SWZB 3WAJA 3GMRB 4XMPL 2QSQA 1QATA 2EECA 3S36L 1BGXL 1NCTA 5AW9B 3MLSL 2E6PA 4N9GA 2C34A 1XF1A 4IS6B 4XB8A 3CFEA 3B43A 3MZTA 3PNWA 2G4GA 4ERSL 4ODVL 1EXGA 2HG5B 2JELH 5I76B 1U8PA 4ZFZA 1LP9A 1ZOXA 4QRUB 2XWRA 5KSUA 1NMAL 3BCDA 5H37G 3DVGB 1P84K 4K9EC 3QFJD 4Y4FA 2J4WH 4TF4A 3BPLC 2EVJA 5KVFL 3CFCL 4H5SA 1B4JH 4PJBF 2BVUA 1WA2X 4H44C 1BLIA 1X7QB 2LQRA 2MPAL 4H0GA 4YDVB 2NY1D 3GIZH 4R7NA 5KVDE 4CU6A 2LAAA 3VFUA 4G8EB 1TJXA 3IJYA 3S8GB 1KB3A 2DQDL 2DTML 4CA4A 1WC7B 3MC0A 4HEMA 3BWZA 1W72A 2AVGA 3CK0H 1W72H 1D6EB 1JK9A 4IOFC 4M62H 1JNLH 1O7SA 3VQ1C 4NO3B 1A7OL 5DJDA 1PSKH 2EIJB 4EPSA 2D7TH 2HRGA 5L4MA 4I5BB 2YPLD 2F7OA 4F91B 2YEQA 4ZFOB 1RL1A 2VO8A 5FDWA 4HQQL 3D3VE 3EBHA 3LXAA 5AW1B 4ZMQA 4PU2A 2YA1A 2XVLA 5F96L 3L1OH 4JGUA 2MH4A 2ARJA 5FKAB 4XOBA 3C5ZB 4G1EB 3LRHA 4L8SB 4X4ZA 1YC8A 4JZNB 2YRLA 4OCRL 2WSPA 5EZIL 3ILDA 4OCXH 1QNZL 3AU1B 3MRKA 5CD3A 1V7NH 3IKCB 1KV3A 4JFEE 5D8JH 2XG5B 2R0LL 2AJ3B 3S48A 4V1DD 2OI9C 1HSBA 4OGAC 3QJXA 1J18A 1OALA 1YN7B 2PXYA 4IOIA 1A7BA 2D73A 2WBJA 4PG2C 4KRPD 3VO0A 2IAMA 1OGAB 1JI1A 1A14H 1BPLB 5CGTA 1KJ2H 4JY5H 4JFTA 3FJTA 3QR1A 5I71B 2ROXA 3K1DA 2X9ZA 1M3IA 1CXLA 2IFFL 4Y19E 2VERN 2I7OA 7PAZA 1AAJA 3DSNB 4TVUA 3TPUA 3RDJA 1XCWA 2UWEE 4DN4H 3O4LD 4ETQB 2A77L 2X28A 4YDJA 1JPSL 5I6PA 3GZPA 4XVJH 3L3KA 4PN6A 2C9RA 3QZMA 3UBXI 4FFZL 3GM0A 4KK6D 3SDCC 3PXHA 1K3IA 3C60A 5EUOA 3FQRA 1N68A 3P54A 2J1KA 4IKNA 4C8XA 1HOEA 1Z0MA 3L95B 1P53A 3RKDD 5KYYA 5DYOB 3MBXL 2WZPD 2DD8L 4Z7NF 2DY2A 2Z4QA 1TCRA 4DOHE 4KVPA 1XGRB 1T20B 2OJEA 5LCVL 2AZAA 2DIJA 2NYKA 4M5TA 1RH8A 4W9ZA 4A7GA 3RPIA 2DBLL 4BXVA 3V5DA 4JFEB 3MREA 1D5IH 4JREC 5DQDH 4R7DA 5ICZA 1I4FA 1HVXA 2Q3AA 2JFCA 3KPSD 3VFPA 2ICWI 4RRPG 1PNCA 1BVKA 4TQIA 2ZUTA 4KKBC 3VD0A 1CURA 1Y1DA 2CO3A 2DQTH 4HT1L 1I1AD 3G04B 4OF3A