2BP0B

M144l mutant of nitrite reductase from alcaligenes xylosoxidans
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGLSGTLMVLPRDGLKDPEGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title High Resolution Structural Studies of Mutants Provide Insights Into Catalysis and Electron Transfer Processes in Copper Nitrite Reductase
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
total genus 87
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2005-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00394 Cu-oxidase Multicopper oxidase
B PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bp0B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bp0B02
3FT0A 1OE2A 1AZBA 3HB3B 1X9RA 4F2FA 6PAZA 4UAHA 3X2QB 1SF3A 2PCFA 2XV2A 4HCFA 3OD3A 1WA0X 4TXVB 2IDQA 2ZWNA 1A8ZA 3NJFA 3TU6A 1BQRA 4A2GA 2FJSA 3C75A 1HAWA 4NB7A 3T6ZA 5B1JA 4DP5X 5B1AB 3FQYA 3CG8A 2OJ1A 1OCRB 4L0PB 3DTUB 4CSZA 2MTAA 1I53A 1JVLA 3NSFA 1TKWA 3PPSA 3OM3B 2J5WA 5PAZA 2PP8A 3AW5A 5TK4A 4E9TA 4W1TA 3AG4B 2IDUA 1N68A 4W9ZA 2PP7A 4DP7X 1ASPA 3FU7A 4AKQA 3FU7B 3SBPA 2BWDA 2OCCB 4G7QB 4DP1X 3IEAA 1NPJA 2XV3A 2HX8A 3NSDA 5PCYA 2FWLB 4BXSV 3PAUA 1NIBA 3UAAA 4MFHA 1NINA 5F7AA 2I85A 1FWXA 1AACA 1X9UA 3V9EA 1ID2A 5B1KA 1FFTB 1PAZA 2HLEB 1KCBA 2VW7A 3ZIYA 2PP9A 1ZIAA 1TEGA 1DYZA 1BAWA 3QQXA 3NSYA 2BW4A 1L9TA 3IBOA 1QLEB 2PPCA 4YSUA 2IH8A 3FU8A 1ASOA 2PPFA 4WKXA 1J5CA 3QPKA 1MDAA 1E5ZA 2QDWA 2YAEA 4BDVA 5I28A 4BDVB 1OCZB 4DPBX 4G71B 3JTBA 2R7EB 2UXVA 4ENZA 2AFNA 2XXFA 2H3XC 2I7OA 1GW0A 4JKNA 2BZCA 2VSMB 2IWKA 2JXMA 1RZQA 3TASA 2YXVA 2EIJB 3ABGA 4A2EA 3S3DB 1AS7A 4P5RA 2AANA 4EF3A 3X1EA 1E30A 2CCWA 5LDUA 3FSZA 2FT6A 2XLLA 1XMEB 1M57B 3H4FA 2VW6A 3NSCA 3SBRA 1GY1A 3V9CA 1CYWA 4DP9X 1XB6A 1ZDSA 3AG1B 4HALA 5I5JA 3ERXA 1PCSA 2X87A 2FQGA 2UXGA 3ASNB 2QPDB 1GS6X 3FYIB 2XV0A 1IKOP 3NJMA 3NT0A 5AKRA 1PZCA 1W6WA 3QJRB 3JT2A 8PAZA 2P80D 2BP8A 1AOZA 1MZYA 4UANA 4ZK8A 2GSMB 4A2HA 1AQ8A 4A66A 2VSKB 4P5SA 1HAUA 1ET5A 4X4KA 4HAKA 2E86A 4DP0X 5B1BB 2YAOA 3UAEA 2Y1AA 1IBZA 2NRDA 2DY2A 1OE3A 4GXFA 3ZDWA 4DPAX 2FTAA 1KDJA 4BK5C 2FNWA 3GYRA 1SHWA 3WNJA 1JXFA 1JVOA 2CUAA 2GC7C 1J9SA 1PMYA 1AR1B 2YAFA 2ZOOA 3WI9A 1M56B 1ET7A 2IDSA 4DP2X 2VMJA 3U25A 3IE9A 2CALA 1IC0A 4NERA 3NJNA 1BXUA 3NJKA 2CJ3A 1JOIA 1PY0A 2FQFA 3NJLA 1PF3A 4E9RA 1UATA 3IN0A 1JXDA 3EHBB 1MG2C 1TEFA 2VM4A 4BWTA 1A65A 1OCCB 1ZDQA 2GB2A 3AG3B 3FPYA 1AANA 2OV0A 2XUWA 4M3HA 3HEIB 5AFAA 4E9WA 1KBWA 5I6KA 3DKHA 1E67A 4UF7C 3UABA 4YL4A 3TA4D 1ET8A 1WA1X 1NWOA 4E9VA 2DYSB 4G70B 1ASQA 2B08A 3KW8A 2YARA 1XB3A 3NJGA 2IWEA 1SHXA 1SJMA 3ABLB 2JKWA 4G7SB 4BWWA 4DP4X 4FA7B 1GS8A 3X1FA 2PPAA 1L9PA 3RYMA 4K9JA 2TSBA 4DP8X 5I6MA 2CAKA 1BYPA 3N2JA 3N55A 5I26A 3T6XA 4KNSA 5I5MA 3CDZA 2UXFA 3BVDB 3AY2A 1EZLA 3FS9A 5B7EA 2W88A 4AKPA 4E9SA 4AI7A 2BO0A 5AZUA 1A4CA 1NIFA 5I6OA 3NP4A 1R1CA 2PPDA 9PCYA 3FSVA 1AAJA 1M9WA 3CVCA 3G5WA 4GYBA 1OF0A 2HX9A 4HIPA 1AS8A 2UX6A 3S8GB 1A4BA 1AZNA 4KO6A 1W8EA 1KV7A 2MRYA 3WG7B 4BXVA 1CURA 1V54B 4JHUA 1GR7A 3L45A 1OOWA 1RKRA 2GBAA 2A3TA 3QJVB 4GY4A 3ZX1A 4E9XA 3MX0B 1N70A 4KO7A 2Q5BA 4YSEA 2VM3A 4KNUA 3S8FB 4Q8BA 3WKQA 5B7FA 1YLBB 3AG2B 3NJIA 3X1GA 1L9QA 2XVBA 3ASOB 4YSSA 1SFHA 2YAMA 2BHFA 3FU9A 2XX0A 3SBQA 2DV6A 1GYCA 1L9RA 1ZIBA 3D12B 4JHVA 1T5KA 1JZIA 2BP8B 2QPEB 2J57A 2HX7A 5A7EA 4N8UA 2BWIA 3UACA 4GP4B 2GHZA 4A67A 2UX7A 2ZONA 3QJQB 4G72B 4E9QA 1V10A 1GS7A 5I6PA 5E9NA 2WSDA 1AG6A 1NZRA 1SNRA 2EIMB 3WIAA 2GIMA 2W8CA 4PAZA 3S3BB 1RZPA 1AZRA 2XYBA 1SDDA 2IDFA 1SDDB 3X1BA 2QT6A 4AZUA 4YVUA 1J9TA 3NJJA 1VLXA 4YSDA 2YXWA 1OV8A 3UADA 3EF4A 5I6NA 2N0MA 1KCWA 1ILUA 1F56A 2QDVA 2JFCA 4A2FA 4G7RB 1IUZA 2IWFA 3NJHA 2DWTA 3PAVA 3PCYA 1GSKA 1NWPA 3UGEA 4RH4A 3WNIA 1PLAA 2DYRB 4YSCA 3GDCA 2I7SA 2DWSA 2HRHA 5B3SB 2PPEA 4PCYA 4BWUA 2LLNA 1A3ZA 1PLCA 5IY5B 3PXLA 4NAJA 1DZ0A 1L9SA 1WS7A 4A2DA 4F7KA 1MG3C 1ADWA 2EIKB 2GC4C 1JZHA 4KO5A 1XB8A 2YAPA 7PCYA 4E9YA 2FT7A 2EILB 1AZCA 3OMNB 3OMIB 3FSWA 5D4JA 5I5IA 2UXTA 4YSPA 1CC3A 1NIDA 3CVDA 1BXVA 4AKOA 4F2EA 3EH5B 1PNCA 2YAQA 3FQ2A 3QJUB 4QLWA 1ZV2A 1MZZA 4WTQA 5B7MA 3GXUB 3WKPA 1WAEA 2VW4A 3CDZB 1TU2A 1WS8A 5F7BA 1IBYA 2VN3A 3QJSB 4YSRA 3IN2A 1V55B 2PLTA 1SFDA 3OMAB 4N4YB 1KGYE 1ZPUA 2ZXWB 2J56A 3NYKA 4HCGA 3T6VA 4YSQA 2P80A 2J55A 3OQRA 1NTDA 4GP8B 2Q9OA 3EH4B 1CYXA 2PCYA 3H4HA 2X88A 3S3CB 2IDTA 1EHKB 7PAZA 3KW7A 1NIAA 4YSAA 2TSAA 1QNIA 2CBPA 5TK2A 1AZUA 3DIVA 3H56A 1PLBA 1AIZA 2GI0A 2XX1A 4FAAB 3ZBMA 4YVNA 3FQ1A 1BYOA 1L9OA 5D4IA 2R7EA 1A4AA 1QHQA 3EH3B 2HRGA 3AZUA 2RACA 3SQRA 2IH9A 5D4HA 4YSOA 1GY2A 3T6WA 3ABKB 1WA2X 2WO3B 1J5DA 4GP5B 3PAZA 1URIA 4HHGA 1NDTA 4KOCA 4A68A 1CUOA 1NPNA 1ILSA 1KBVA 3MBWB 2WO2B 3X1NA 2FT8A 3FYEB 2B3IA 2H47C 4YSTA 2H5UA 2EINB 1BEXA 1JXGA 2BP0A 2YQBA 2BP0B 4HHWA 4QKTA 2XWZA 1BXAA 1JERA 3FPXA 1PNDA 3BQVA 3PLYA 1JZJA 1AG0A 1OCOB 1J9QA 1JZEA 1PZAA 1W6LA 1B3IA 3FSAA 3NP3A 5B1JC 4CSPA 4HZ1A 3TBCA 6PCYA 1AS6A 2AVFA 2BW5A 1JZGA 1KYAA 4M4RB 2FQDA 2HXAA 1OE1A 3CZUB 1BQ5A 3T71A 3CVBA 2AZUA 1E65A 5FC9A 1NIEA 5ANHA 2YAHA 4KO9A 2FQEA 1E5YA 2Y69B 1ETJA 5I6LA 1NICA 3ABMB 2BZ7A 1BQKA 4AX3A 4DPCX 3T9WA 2HZHA 4HCIA 4DP6X 1JZFA 4KNTA 1KDIA 3TBBA 2AZAA 1RCYA 2IAAC 1SF5A 5EHFA 1J9RA 1FA4A 2XU9A 1PZBA 1HFUA 2XXGA 3QJTB 4Q89A 4KOBA
chains in the Genus database with same CATH superfamily
1K9TA 3HN8A 4QXGH 5ITBL 1UGKA 4BZYA 3BVUA 1M7XA 1PZ5B 2YSTA 3E1F1 3BPCA 3NJFA 3RL1A 3ULUL 4EVNA 4KQ3L 1UWEH 2WIIA 3TN0B 3GPEA 4GINA 5C6TH 4AG4L 1MAKA 3T6ZA 1FGNL 3LEXB 2ICES 1R46A 1VPOL 1E9OB 5L4JA 1DQLH 4TLSA 5FF6A 1ZY9A 2P5PA 5IFJB 1IM9D 2HLAB 3JV5A 2JLLA 3GIZL 3CFNA 2DQIH 2DD8H 1IFHL 2IQ9L 4WW2A 4ZOEA 4LVNC 4CA4A 3SOBL 4Q9QH 1CZ8H 1HL5A 4LESA 1MFBH 3C6SB 4Q0XH 3UPCA 3IDNA 3BP7B 4DIXA 5F7DA 3P02A 2UWEA 3Q2WA 1ANUA 2G60L 3DVGA 4I89A 5KSBF 5DEFB 1ASPA 5ADOH 4ZFGH 3SBPA 1D7FA 2ZCZA 1Z6JT 4LCCB 2C3WA 4N0CD 2LABA 3V0HA 2JKRM 4L3EE 4BXSV 1AXIB 1NIBA 4MJIA 1M42A 1GC1L 3KLAA 5HHXH 1XGTA 1KIQA 3LQMA 2Q7YB 3F01A 3U1QA 4OLZL 3Q1EA 1SJHA 3ECQA 3HW7A 5SX5H 4PV8B 1J5OH 2NQCA 4LPTA 2J25A 1U8QA 4WI0B 1FGVL 2CO4A 2AQNA 3D0VB 5AVVB 5AVSB 2FRGP 2D0HA 3Q01A 4JGMA 1M3JA 2B4CH 4JM4H 2P28B 2ZCLH 1X7QB 4L1HA 3RWHB 3ZGIA 5GGRY 3VWKC 3QPKA 1U8CB 5FYJD 3H9YA 4JM2C 4BDVB 2ZXQA 5JNYB 4HJUA 2JKXA 4N9OB 2R7EB 4UT9L 3V8OA 4XMVA 5CU5A 2WKGA 3FMGH 1UASA 1E8ZA 4NQVB 5IQOA 4XMZA 3OZ9H 4NKDA 3AM8C 2V5TA 4PR5B 4U6XA 4WI3A 2P46B 4QRRA 1T5XA 4LPXA 5DRZA 3L9RA 2F9BT 3MA7B 1T80A 1ZGLA 3SHSA 5AUMB 5K39A 4KPHH 2AANA 3EKCA 3WHXB 1EWHA 2VJ0A 3FSZA 3ESVF 2ORBL 5DHMC 3D18B 1YRKA 3RPKA 1JPGA 1U8PA 4FEMA 5FECB 4U3XA 3N1GC 4Q6IB 5AW4B 4PY8J 1F4XL 4PJ8A 5MEOB 1T7YA 5T3XL 2GBUA 2XBTA 1A7OH 2N7AA 2IALA 5IQMA 4UQEA 5EZLA 3GXDA 1U21A 5HHNB 2J6EL 4FQXD 4DK6A 3ZU8A 5CEXB 1QLFA 4G43A 4I3SL 5GSRA 4WW2F 4J12A 3RWIA 5B8CA 1MHHA 2PABA 5MEQA 3EGSA 1AHWC 3BE1L 3MRIB 4U3HA 4M8VA 3WKYA 2LQRA 4F2MB 4N2LA 1AOZA 2G30A 1AQ8A 4BSWB 2V7NA 3OWRA 2UWEF 1B0IA 1NAMB 4B9CA 4DO4A 4ILDA 1FNLA 1T22A 3F7YA 2Y5QA 1QFWL 2BERA 4U1SB 2BHYA 3LRGA 4FQHB 4KMQA 2OI9C 3OVUB 4YIQA 4FTDA 1CDHA 2Z7UA 1PMYA 5DYOB 2ZOOA 3GQFA 3IS1X 3LN5A 1QPKA 2R4RL 3VMOA 4DGVL 2LAAA 1YJDH 2OR8A 3BESR 3QH3B 2KZ1B 5CGYD 5EO0A 4LCIH 2X42A 35C8L 3DXAD 5CNHA 2XPYA 4JPWL 4NN5B 3RDTA 2NQ3A 2WXMA 3LS4H 4GKOA 4G1EB 4HBQA 3TL5A 1Q0EA 3DMMD 2QQLH 1FIGH 1HQRB 1BXUA 5TQ0H 3EJRA 3GSRA 5AAMC 2D7NA 2ODHA 3UZEA 1EHLL 4KJQC 1OCCB 4X98A 1NGWA 2OV0A 5ABZA 3GTTA 5K9KB 4MWFB 3FQTB 3D08A 3VVWA 3DUSB 3Q6FA 2BIHA 1YMMD 4JN1L 5TH2B 1LEIA 1H0DA 4B9JA 4R90L 4ZJ9A 2ZX5A 2IXQB 1SRDA 3IPBA 3WDHA 3LVTA 4NDMA 5JQIB 4G9FE 3DJTA 4X5XA 5E00B 1OTUD 5KYXA 5TF0A 4HV8B 3NJGA 3SKUD 4ODUA 4KKBD 5CJOH 1H3TA 3GSOA 3RRQA 4H0HB 1OARH 3AU1B 4BWWA 1KNOB 1L3NA 3B1TA 4FQQA 4P2QE 4HQQL 2DF3A 3ARGC 5CS7A 5HHPB 5J11B 2PPAA 1PQZA 4KXBA 1L9PA 2OMYA 1D9KA 4BFRA 2DMKA 2B9AA 3MROA 4P5MA 4ANXA 4FQCL 4Y4FC 5CP3A 2ZG1A 1YEKL 1Z9PA 5BXFB 2YMXH 5I5MA 3DVFA 4IBYA 1NGPL 5CJBA 5DGQA 5E2TL 3N44B 4APXA 2N7SA 1A7BA 5E2VL 4BH7B 4AKPA 1WBYA 2OMWB 3Q5TA 4HETA 1MN4A 2H26B 4MMZA 4OVVA 3U0TA 4AI7A 3OR6B 3GBEA 1FLRL 1YN6A 4PRHB 4WV1C 4A2MA 5D7IE 2HP4A 3A6BH 3BVTA 1J05B 2IEPA 1BECA 4KXAA 5AOIA 3S3SA 1NMAL 4TQEL 4EI5C 4R5VA 1MCOL 4NZTH 2F58H 5DQJB 4UV4L 4XMLH 5SWQA 5HHOE 5FR3A 1DVXA 1BF8A 4ZXBC 5FX3A 5H94B 3SKJL 1EJOH 2WC7A 4X6DA 4KI5C 5DWPA 1MFDL 3U4EA 2AEQH 2BC4A 1WIPA 2MRYA 5F7HA 2QKSA 3FO2B 5DHEA 3PWJB 4CVZA 3ARRA 3FOLB 1CGXA 1G1KA 4L8CB 4UT9A 3WYRA 2P4AB 1PY4A 3PQYB 2A3TA 2XTSA 3VXTB 3QEUA 1W0WA 2ICWA 3FJTA 2YKLL 4E5XG 3NIDB 4ONFL 4P4RA 2AJXL 3TZVC 1VKXA 4H8WH 4M7LT 3NRFA 4Q8BA 2GJJA 4W9LC 1TSHA 1N12A 1L7IL 3VXRD 2HG5B 4JRYD 1N3NA 2NXZD 2R8SH 2Z4TA 5HGDB 5E56A 2DV6A 2CIIB 1FJ1A 3RPIA 3ULUF 4PRAB 2EDXA 3IMTA 1G7LB 1N19A 2IAMD 2VNCA 3SKNB 1T1ZB 5DC9B 3V4UH 2G4GA 4K73A 3QNZB 3QFJB 3QNXB 4QRUA 2J6EA 3EFDH 4PJCA 5HYEA 4V1DA 2MCAA 5ALBH 2V6HA 4PJEB 2XXMB 4KMTH 1SDDA 3UTTD 2Q2LA 3QQ9C 4JG0L 3MRRA 3VFVB 1Y6MR 4H25B 1YCSA 3UGUA 1II4E 1X6LA 2WVVB 5EO9A 5IZ7A 2YXWA 3OKEB 5F9OL 4YEFA 1QW8A 2X2YA 3NIGE 1S5HB 3QWOA 4MAYC 2HFFA 5EFIB 4CDHA 4RQQB 5IK3B 3BUYA 2JIXD 4B5EA 2FUQA 3KDMA 4QGYA 2J1ZA 2L7QA 5EO1A 3STZA 1QKZH 1J8HE 1BA9A 1KBPA 2OYKA 2LU4A 2A9NH 1OGAA 2COQA 4OCSH 5TJWK 2IWFA 3VDAA 4ODVH 3RFZA 4TTDC 2Y4SA 1BCIA 4P4KD 5K9JL 2GK0B 1HIML 4F58L 2D7TH 4GKZB 1X6NA 4FFYL 4Y19E 2WXGA 3SY0B 2CKBH 1YDPB 3KWUA 4XBPB 5A2KH 2VJXA 1YMHB 2RIKA 3ZDXB 3OKKB 4DEPB 4GAAA 5JO5B 3V52L 4I0PA 1EV2E 1MFCL 1QWUA 4X6DF 5TTRA 1FZOB 3ZKND 3HBZA 1XCXA 1BG1A 4IIQA 2YAPA 1OOAA 1MHPH 2QFPA 4LSPL 4RISL 1BLIA 4LKXB 3VA6A 3ZR6A 3AREA 3FSWA 5I5IA 2PN5A 4ELMA 3CZLA 2FEEI 3CVDA 3LMJH 3D69B 1P7QB 2W81C 4AKOA 5L0QB 1BAFH 2EVHA 3S3JA 3RY6C 2KDYA 2WNXA 3BKML 4ZAKB 3QC5X 3FCSB 1VGEH 4P46A 1WAEA 2VN5A 1UZ8A 2WGNB 2B2XH 2VW4A 4OJFH 4XMKL 2NZ1A 4ZOAA 1ZTXE 3D2TA 3T77B 3U9UB 4DSYA 3MCG1 3OPZL 2ZXCA 3QVAA 3CFEA 4PP2B 3CFDB 4W9IC 2QVFB 2Y25A 3TFKC 2JKIS 4HCGA 3IKKA 4YC2B 5E6YA 1RURH 4PJCF 4KVCH 1ZVYA 1TUPA 4S1QH 5BJTB 1ZLSL 3H42L 4YFLF 4OQTH 5IROC 2WKLA 1OEZW 3VFRB 3GJEA 5D4QA 1AJ7L 3RX8A 4YWGL 1JK9B 3V2AR 4QXTB 3KPSB 4CNIB 4C58B 3GMMB 4L2YA 1XGYL 1M71A 3FQ1A 3P2BA 3WUZA 1U3YA 3EH3B 2H32B 1KV3A 1TFHA 4ZUTB 2IH9A 3LZPA 1A3QA 4XCCH 4IS6B 3WKMH 1S9KC 2VLKA 2YZ1A 2R1XA 4O2FA 4YQXH 3VYNA 2FBOJ 3NGBB 3TA3C 3Q8AA 4FXKC 5GGTH 1KEMH 4TQIA 3UJTL 1OKEA 1GVIA 4G82A 1S3RA 2A9AA 3GXPA 3M8OH 3W0WA 4AGOA 1YYLL 3DHMA 3MN8A 4TUKL 3GSVB 3FYEB 1C8PA 4JO1H 2Z8VC 4CBPA 2YOAA 4ZS6C 3SDXE 5AYTA 4HFWA 5JQ6L 3UP6A 1AP2B 3HPJB 2VLJE 3R1GH 5B1JC 3UPAA 5MEND 4ELMF 4JVPA 1RZKH 4QXUL 3U7YH 4LVOC 4GSDL 5J1SC 4TVUA 3ZYJA 5CUSL 4NUGL 3NPZB 4U3CA 2UY6B 5EEUA 1KYAA 2GSGB 4L8DA 1JPTL 5DWUH 4IRJB 1CLYH 2HT2C 1ODUA 4OGXH 3EO0A 4HKZB 4WU7A 2C4FT 4XAKD 4RIRA 4TN9A 1KLGB 1MXDA 3PHOA 3QRFM 1NC4A 1F3RB 3BKCH 4JHAL 1OAQL 2B5IB 5JQHC 4I1NB 4BV1A 4UM9A 2UZYB 4LL9A 4OCWH 4W4NA 1FNSL 4P9HH 1IZKA 1EZSA 2IMMA 1G7QA 5EIIG 1H6UA 2FB4L 2JKLA 3L16A 5DK0A 3TESA 1KYOK 3QUXA 4KFZC 3PUCA 4J6IA 1UM5H 3UC2A 1EJ6A 1CD0A 3WGUB 2YSSA 4FX5A 4CVWA 1PZBA 4IJ3B 5E6IC 1P0SE 5T1MB 3UCQA 3GSQB 4QRFA 5DHXB 4HK3N 4AQAA 3HB3B 5IV2A 2YS4A 4W81A 2NY1B 4AENB 2XN2A 2Y2WA 1HHIA 3OD3A 5DTFA 1BJ1J 3MXVL 2ZP0T 5D1ZC 2AQRA 3ZT5A 4FFYA 5A7BA 1CDGA 1INDL 3AXIA 1RIVH 3HN3A 3U46B 4BFJA 3FN0H 5L2KD 3LKOA 5LXGL 1P4UA 2BSED 4AMKL 4GT0A 1N6QL 4XHJC 1HAWA 4JY6A 4JKMA 4WJ5B 4Y9BA 3FFCA 5ENWB 5SWSB 1THAA 3QCVL 3UBXB 3HZYB 5DT1H 3LD8C 5ACLA 4XMUA 1MCFA 3ECBA 5SWZB 5TF1H 4AIOA 2VQUA 2X6BA 4MNQE 3VXNB 5AZEL 3UEZA 4CSZA 1TQSA 5DC2A 1Q9KB 2B7DT 1JHTA 1ZJBA 3KM1A 1RJCA 5PAZA 1KJ2L 5HI5D 5E5MB 3VWJC 3C08L 5ANMB 2APBA 4NSKA 1JGEB 4FTVD 1UB5B 2PP7A 3BEWB 1THCA 3BGMA 1I7ZB 4HXAH 2QADD 4ONGH 2XV3A 3IFNH 5BVJA 5D93B 1Q0XH 3PAUA 1JZ5A 1XF3B 1EO8H 1WBXA 1JI1A 3IRPX 1AKPA 2X6AA 4KH9A 3F84A 3ARFD 5IFHH 5I74C 2I32A 2NR6A 1CTOA 5IEHB 2HLFC 1I1CA 1E2WA 5HGHA 1FG2A 2JLPA 4M62L 1TR7A 5KVGL 3BN9D 2XJKA 4RMRA 3A6OA 4CUCA 1BIIB 2A0LC 3NSYA 4XBGA 1AXTH 1TVHA 2IH8A 1YPZB 1JGUL 2NZ9D 3CLFH 3CFKA 2PPFA 2O5XH 4NS0A 4PJGE 5LN8A 3KYKH 1HZKA 3LRSB 1OHQA 4ZZKA 5LBVA 2WXPA 3V10A 4ODWB 2XXFA 4HGWB 3LXCA 5I1HL 5ECJE 1YEDA 1S9XB 3A6CL 3WL9A 1KN2H 3M86A 1VDGA 4IKNA 4XPTH 1DLHA 2QHRL 1RZQA 4MBRA 3GI9H 1F8TL 3FF7A 4DVRH 3HS0B 2BMKB 1HILB 3X1EA 5E94B 3HE6B 2R1WA 3GNMH 4YK4C 2JI3A 5LDUA 4HJEA 2X4PB 4U1JB 4XVTH 4TQPA 4LASL 2GVYA 5KTEH 4HF5H 1YEFL 2CO7A 1UA6H 4UBDC 4AXWB 1CFVH 1JF1B 3GI8H 2XY2A 5E0FA 3QDJD 3DGGB 2Q76B 5CZVL 3AGWA 5GGQL 3RUGA 1H6FA 2P8PA 2C1OA 2AGJL 4TLKA 4CMMB 2I69A 3V0VB 3P77A 4YAQA 3Q2CA 2DQJL 1KN4L 5JHDD 1ETZB 4NHUA 4PGBA 2VC2B 4R4BB 5AW8B 4HU8A 5CEYA 1P9MC 1Q9OA 3CVIL 3WTXA 2OP4L 1IKFH 1E8XA 1CFTB 1SYVB 1ZT4B 2E86A 1F3JA 5KSAC 4TYUA 4RGOH 1OPGL 3GZOA 5I8OL 4X6BA 1BBDL 5KUKA 2YLKA 2FGWH 4I3RL 3TWCL 3DHPA 3TNMB 3T0EC 2H3NA 3Q3GB 1BGXL 1T1XB 4N85A 1DCLA 1ET7A 2HB0A 5LWYH 4UZSA 4AZ8A 1RU9H 2AJYL 3NFNA 3MLXL 3MNDA 4JW3A 2V5YA 5J12B 4LB8A 5L4FA 4Z0BH 3CQQA 1IM3D 1DZBA 3PYCA 3S37H 3EDJA 2XUWA 1E90A 1MI5E 5DD5L 4M3HA 4MCNA 2XVKA 4XHQA 3AAZB 4KXZI 5C09D 2ZXBA 4UF7C 1DQVA 3MJ8A 2F18A 4BGLA 1OP4A 3ECVA 5C0IB 4TQ8A 1RIUH 3BX7C 3L1OL 2CU9A 3C9NB 1KT2A 2XN0A 5HHVL 3SDDC 4IKJA 4U6YB 5E1AB 3MRBB 2WLMA 1PZUB 4WEBL 5GS2H 2A77H 1XZ0B 3KCWA 4P2RB 5CEZD 5DZVA 1JZ2A 3AQXA 2Y5TB 2PW1B 5CBAB 4U1LB 2L7EA 5CD5C 1A6ZA 2JWYA 2Q86A 5TE4H 1SQMA 1KJMA 3RUGF 1KJ2A 1G6RH 5AOJA 4ABUA 4ZFZA 4QRQB 3Q2LA 4WW1A 5KJ7E 2NY2B 2OR9L 4DKFL 2H0JA 4F57L 1ECYA 5I16A 3OX8B 4HIHA 4L2LA 2QPSA 5CLTA 1UVQB 4PJ5B 3WFZA 3OL2A 4EIZC 3GS0A 3DOHA 5DJCB 1QI3A 3WJJC 1TJHL 4FMKA 1YEEH 1I3RA 2PW2B 4BBWA 1EAPB 1HXYA 3LOWA 2P5EA 4OCYH 4PJ9B 3EFOB 2IGFL 3CLEH 2IADB 2AABH 2XFXA 1U8NA 5HHME 4Z8FH 2JQMA 2VL5A 4PY7B 1MW1A 1VHPA 1SLWA 3K91A 2UZXA 5F88A 1N10A 1SXCA 1NEZG 5G2NA 1KTDA 4K8RC 1A3RH 4O58H 2JKTM 5AVQB 2CJTA 3MCYA 3EYFB 3D30A 3VD7A 2GJ6B 4C4KT 4TSAH 2Z91B 1FDLH 1UD4A 4GRLB 4NOFA 4CADB 3GBMH 4Y1AE 5HI3C 4GAJL 3MRCB 1K8DB 2E8ZA 2MJWA 2XA8L 3MRGA 4YFEA 3DO7B 1MDTA 1S3KH 3E0GA 3TLRA 5D7JB 2MNJB 1OAXL 3B9KC 2XIBA 3SODB 1U41A 3DIFB 3IK2A 3C5JB 1MWAB 3TPUA 3L54A 5D1QC 3UBGA 1T5KA 2IBZY 2XG5A 1VESA 4U7MA 2OTPA 2Y7MA 4BZ1H 2UZIH 3V4PH 4A55A 2BP8B 4U1HA 1MF2H 2KKQA 3DYOA 3HC4L 3BZDA 4A67A 2EIBA 4NUJA 4RWHA 1DVSA 3H0TA 1G9ML 3DRQB 3EBGA 2Q7AA 3S96A 3TEXA 4M61B 3P3SA 4RWYL 1AZRA 3R8BB 2G75B 4RMBA 1MCWW 1DP0A 4G9DA 5GISH 2J43A 2WZ5A 3MBEB 5I8EA 4ENEC 1NBCA 5K69A 4R7DB 5IBUB 1HZLA 4U1MA 4FQIL 3FT3A 5KN5A 2NY4C 3MOQA 1ZTMA 4JJOA 1KEGL 3F7QA 1MPAH 2K9FB 1B3JA 4OD3L 2OMVB 4JFDE 1IUZA 1SM3L 3JV4A 1GSKA 1QBMH 1P6WA 2FLRT 2V37A 3MOBH 4U6VH 3TO4B 4X4XA 5EZIH 2PXYA 2MCPH 2OW7A 2DM3A 4PCYA 3SD5A 3UZQA 2Q8AH 3S37X 5E9DE 2NNRA 3QCUL 4X0KA 3QO0B 1PVHA 3ZKXC 3RNKB 1J9CT 2BPBA 1MNUH 2RCSH 1KTRL 3RZCD 5I1KH 4ZMAT 4LEOB 1TPXB 1F6AB 4Q2ZB 2YEZA 3T0WA 1JFHA 3MUGA 5E4AA 5EU4B 3GM8A 4Y9GA 1AZCA 5GGRA 5K9OA 2DKMA 3KS0J 1XR8B 3CFCH 3MMEB 4X80H 5FYJH 1S7QA 3HZMA 3LQZA 1UT1A 2XTJE 1A9EB 2OLDA 3VFSA 4EDXA 3TT3L 3EJYC 4F2EA 5JPNC 3FCTB 4M8QB 1A6AA 1KXTA 1TZOA 4P5TC 1VEOA 2AJVL 3DI3B 3MJ7A 4JO4L 4ZPTB 2EDYA 2F5BH 3QULA 4QOKB 5DZNA 5C7XL 3B4NA 1M2OA 4TSBH 2ZPKL 1NCUA 3KL5A 2A73B 1E28B 1FZJA 1YHPA 2NTFB 4A7GA 5IHWA 4Y1SA 4HUVB 1D7DA 2K3TA 4XRCB 5DHVH 5EDXA 4N5ED 1SVZA 2RALA 2QBWA 3QJSB 2V17H 3KR3H 3QIUB 4GG8A 1FBIL 4Y5VA 3QIWC 3VGHA 4EDWH 5L6YL 1XGRA 1A7QH 3EG9B 4GXVL 3OLEA 3NEEA 2ZXWB 3X14B 3GMOA 1FVCB 4LLYA 4BQBA 5DR5H 2EEBA 4MQXD 2KL6A 4IRSA 4Y5YB 5D1XB 2J55A 5HJBA 4Q9RL 2O5ZL 4U0RB 2NYYD 4QAWA 1QI4A 2Q9OA 1B0RA 1A4JB 1JHKL 3MFFA 1ZS2A 2I07B 1G9EA 2ZCKH 2R51A 3NUKA 3KCPB 4ZUWB 1OSPL 5C9KA 4P9HC 4FMVA 4LLQB 1HESA 7TAAA 3VJ6B 3H56A 5IT2H 1J12A 1MCJA 2QKIA 3MRPB 3O9WC 5EU5B 3WUWG 1CBJA 2HJLA 3V7MA 3KPRB 3WSQH 4GI9A 3PHSA 1USZA 2CJUL 4QHNB 1U95A 2ATAA 5DEJA 1A4AA 3NACL 4HISA 2CBQA 1T83C 3W11D 4AITA 5AB2A 5IBLD 1WFNA 4FXLA 4MGXA 4TV3A 3QUMB 1AR1C 3BZFB 3O3BB 4IBTA 4YSOA 3GXIA 5JIMA 4LT7A 3RPBA 2NXYC 4AC2A 1WA2X 4DKDC 4RRPG 1NEUA 5ID1A 5FYLD 2E9GA 4F8LA 4BQCA 4UQDA 2QQNH 1HOCB 2Y7LA 2FT8A 4IU3B 3ZKMD 5AAWA 5ISZE 1I85C 5IQ9B 3N0AA 4OI9A 4UQ2A 1NUNB 3FUNA 4Z76B 4QHKJ 2AQ3A 1U92A 3BGFC 4JZNB 5E4EC 5I24A 1N64H 4LFHG 3VFMB 3PLYA 3V5KA 5BMFL 1EJFA 3K4AA 4G42A 4Z78A 5BV7C 3AUWB 4PRHD 4R2GC 1IT9L 4UDUB 1FNFA 1Y07A 4HKJB 2NX5B 3ETBJ 1UJ3B 5TDOB 5F97E 1NFDF 2HXAA 5IHZB 4NKMA 1TO5A 5HDBE 3ULSB 4AT6A 3CSGA 3KXFD 3TBVB 4A7GF 3QARA 5EV7A 1PW3A 4YHZH 1U6AL 4QHMB 1RK0A 1C12A 4I87A 4ZT1A 5HJGA 5HPMA 5I8CB 5J1AB 5C0RH 4GG6B 5IVXA 4I2XA 5HYSB 3QIBC 3RP1A 1ETJA 1OSYA 3KWXA 2BZ7A 2Q7NA 3L3OB 3D25A 1REIA 2R0LH 4HW6A 5E99L 5KVEH 5CLXA 4YHOH 2R1YA 5FUCC 4L4VE 1FFRA 1YEIH 1CD1B 4ZO6A 4YZFF 1HHJA 2X4SB 4EN2A 2DQTL 3CX5K 5K59E 3GB7B 5DMIL 5AVZB 4KOBA 4KK5C 1AZBA 3HE7B 3KPMA 1NMBH 1JTTA 5I1GL 4FQ2H 3DURA 4IK6A 4DAGH 3KJ4B 3MV7B 3UTSB 1BQRA 5KYWB 3L2LA 2EKJA 3ZZQA 3EGDA 3IJHB 5DSCA 4HDIA 1YNLL 1ZHBB 4BELD 4JG1L 2K45A 3EYOB 3LHAA 4QRPA 5AW5B 5HYJE 5DVLA 4OD2B 5AKSA 4DK5A 4KV5E 4WUUD 1U91A 3P4NA 3QZBA 5BRZD 2ZWLT 1PG7H 4PRIB 2VLRE 3U1PA 2Y36L 4XC1L 1JD9A 4MNGA 4MNHB 4UYQA 2PP8A 4UM8A 1BX2B 2IH1A 2CGRH 3FUIA 5FHBH 1KJVB 4D0BA 4ZW3A 2XFGB 3F7LA 4YHPB 1A6UH 3FU7A 3H8NA 2QQKH 4F9PC 5IKCB 2F8IA 1J0IA 4ISVA 3J2PA 2OJZL 2ILLA 3QUYD 2GJZB 4MVBD 4N2BA 3LN4B 3LV3A 5LAXA 2G9HB 3S34H 4DGIL 4O00A 4F7EB 2C3GA 3UAAA 2VN4A 4MFHA 1GKEA 2R2BA 1PDKB 5FW8A 2H7WA 4MQ7B 5FM8A 1INQA 4MKMA 2AW2A 2IH3A 3NK4A 3V9EA 2CKNA 3SE4A 1PTZA 1PAZA 4S1RH 2DQCH 2UVFA 3EDKA 4X8GA 5DMJB 1I8IB 1OQXA 2R0KL 4LPVA 4OFDA 4HH9B 4BCZA 5K1JA 3IBOA 1OF2B 4G5ZL 1PYWA 4YSUA 5HPOA 1R33A 4JO8A 2D2OA 4OKVB 1JMXA 2OKMA 1E5AA 3SPIA 5IVXF 3WO4C 3QXUA 1PIFA 2R39A 1GGBH 2Y0SA 1OAKH 5IFAL 3BKYH 3FUKA 2ADGB 2NDGA 4AQEA 4PB0L 3PG2A 1NM4A 1MCBA 1TQUA 1Q4NX 1QLEH 4ZSOA 1R0AL 3IDGB 2YD0A 1R3LB 4XXDA 3EYQC 3CDCA 4K9EH 1G7PA 1P7QD 3SO5A 2ZXDA 3QXVA 1EUTA 3W9EB 1IL1A 1GIGH 4ZAKD 5T1LB 2OCJA 3Q48A 2WTPA 1U3HB 3QYMA 3EHBC 1XMEB 3SE3C 3SZ6A 2MCMA 4DP9X 2X7LA 5AB0A 5CP7B 4XP5L 3IJSA 1OM3H 5C9JB 1GGTA 2FQGA 3IFOA 4UQAA 1GSMA 1PS3A 4ODSL 3HC3H 4K5OA 3RA7H 4F33A 3QPQC 3MRKB 5F70A 4ZX3A 1HINL 1MFNA 1JDAA 5C0BA 5FYKD 4G6FB 5JOFB 5FFGA 5FCSH 3DSNB 1IEHA 1OAUL 3MNVB 3T0AA 1NOFA 3VXMD 5LBGA 4KROD 4AMXA 2ED7A 2K70A 3VWKA 4JFEA 1AGEB 1DVFC 3BPNB 3FQUB 1P84J 4JM2A 1Z0NA 3WY2A 2FTAA 2QR0A 1R47A 2DQGH 2WSKA 1D5XA 2XY1A 4WI8A 4OFYA 1A9VA 1N2RB 1QBAA 2X6CA 3OZLA 4PWJA 5E8NA 1W72H 2MOGA 4UT7H 1FH5L 3AM8A 3N42F 4JDVB 4KY1H 2Y07H 2WAQA 3FQRA 3TT1L 1U8IB 2J2ZB 3GGWA 3FONB 3P54A 4BK4A 3CVHH 4X7FC 4QRRD 1JOIA 3QEQE 2X40A 3Q6GH 5ABAA 3VRIB 2Q10A 4HIXH 4E9RA 4G6ML 4OIFA 1S8DA 4G8GD 3OAUL 3WENA 2VWEE 2ZXAA 4OLWH 4XGZA 5HGGS 4O51B 3BT2L 4PJXA 4CVXA 3I3DA 3B6SB 3IVKA 3UTOA 4XC3L 2FX9H 4LNVA 3QZWG 4ZW6A 3KYMA 5C8JB 1YG9A 4M6MH 3LH8A 4H1LH 1UUNA 2EE3A 3LQAH 1ET8A 1WA1X 1MREL 3GZKA 1PG7X 4EXPX 4MJ4A 3OKMB 4XO3A 4Z7VA 2ADJB 4E9VA 1AHWA 4DO6A 4FQ1L 1MLBA 3OSKA 1I3GL 5GGUB 3U6XS 1F4AA 5DXWA 1CG9B 1OY3B 3II2A 4E5XA 4J3OD 3VI3A 1JTOA 4XNXL 2VYRE 3MV9B 3SGDI 5F7EL 3RYMA 3VCLB 3N41B 1G4RA 4FMFA 5FK9A 3N2JA 1I1AB 1O6SB 1S7XA 3CCHB 3ZO9A 5FO8B 3VFWB 4FKEA 1FO0H 1ZGLM 1MQKH 1K5NA 1NCDL 2CHZA 2RH0A 4J27A 4Y16A 4R96A 2DPKA 1GAFH 5T5FH 3SCMB 4RX4A 4S2SA 5F0LB 2ZWZA 1QRNA 3INOA 4YE0A 3MRHB 4TVPD 4MA1C 4G8FB 2ZQKA 3GJFK 4FNPA 1R1CA 5AAMA 5T3ZD 3RDTD 2ERJB 1QNZL 2FECI 3GKWH 3LH2L 3HB3D 4JM2F 4ZPVA 2GTQA 2NY1D 1EVTC 4HU2A 5MHSE 2Z7ZA 3HLKA 3QHZL 4PJAE 4HIPA 1PSKL 4IJTA 2VDKL 2X1PA 2X6VA 4KQ4L 3ARUA 5KYYB 1ROCA 1TETL 4BSVA 1AFVH 5SWSD 4N0CC 5I1LB 2VDLB 4YXKH 5I73B 4LLMA 3T8XB 1A6TA 4PIRF 1AQKL 2KHAA 3CC5B 4B9ZA 1UWGH 2YD4A 4GY4A 2KPNA 3GRBA 3I02A 4TKWA 3ZX1A 4JFZL 4CGTA 2HWZH 3ILPA 2FJHB 1RPKA 3RIFK 2OULB 4LRIC 4NWUL 4TSCH 2DQHH 2WYHA 4N0UB 3VFOA 4NUPA 3ARGA 4PJXF 2PR4H 1RUQL 1GGCL 4GRWB 3GK8L 3ELQA 4B60A 2BY3A 2XX0A 5HY9A 2D7QA 3EXJA 4Y4FA 4IKIA 2DQDL 4UINL 2KH2B 2ZZUT 4GKSA 2BHUA 4PRDB 2DTML 2XTLA 4Z7VF 2NYZA 3LKSA 4K3EH 2O26U 3PU7A 4XNUL 4WV1A 4Q6YA 4IYKA 3QJQB 1S4IA 1SMOA 2GABA 5I6PA 5C1MB 2WSDA 4JFFA 1KGCD 3VFTB 1QFOA 2PNDA 4EI5A 1NMCB 4PJHE 2BP5M 5EU7C 3VI3F 4XX1E 5BZDA 4JMNA 2DH3A 2EDDA 3FN9A 4ZXBA 5KG9A 3FB8A 4YSDA 3BH8A 3UADA 4QXGL 3L3HB 5ETUA 4WSGA 3P0VH 2N0MA 3VI4A 1O6TA 4H8PA 2RJMA 1MCRA 1UWEL 4IRZH 4G7RB 4YHIB 5C6TL 1U8HB 2Z0UA 4FQXC 1DVZA 1E5UI 2DYRB 2GIYA 4PWGA 1JZ6A 3IAPA 1AHMA 3TZVA 3QUHA 1QSEA 5DRXB 3VXOB 5DDHB 4AH2B 3BRGC 5DJYB 2DQIL 2DD8L 2QSQA 5G5DA 2GY5A 3RKDD 1MRDH 3GJFH 3GUTB 4M5ZL 1TF4A 1AQDB 1I1RA 5F1IB 5F6HI 1NCGA 4Q0XL 1ZLVK 1MFBL 5IB2B 3VD2A 3S98A 1XB8A 4MB3A 3CMOH 4HHAA 5I1EL 1N26A 1T1WA 4WFFD 2ZSWA 2IQAA 5ADOL 4ZFGL 1TVDA 5GIRB 3ES6B 1SY6H 1RH8A 3FT2A 5HTSA 5E5RB 1CC3A 5CGYC 1B9KA 4AUYA 5HHXL 1NGXB 3FK3A 3R18A 2WZAA 1UM6H 1SQ2N 2E8YA 1FYTA 3PQYE 3DMMC 3NMEA 2BSCA 3TYFA 1J5OL 2P8MA 5I0WA 2V7HB 1JXKA 3NIDE 2Y9RT 1J1OH 3RWGA 1K4CA 3O2WL 2B4CL 4MA8L 1MEXL 4JM4L 3CUPA 2EDLA 5A2LH 3FQNA 3WNKA 1XIWB 3B56A 1BZ9B 5CJXC 1AI1H 3FRPG 4EIGB 2PYEB 3CWGA 1LE9B 3DBXB 5I2IA 4OZHA 3LZLA 1S7WB 1ZPLA 1MLCA 4Z7WE 4EMZA 4G8AC 5BO1H 4XMPH 4P59H 3I75B 3FMGL 3ZDYF 1HL9A 4D0DA 2Y7NA 3JQOB 2AJZA 1OGAD 1IGCL 3OZ9L 4ADJA 3O4OB 4QHKI 1OTUC 4QUOA 3SGKC 3APNA 1KJ3H 4L0ZA 2W0FB 4OR1A 3D8MA 4UTCA 1GOFA 1MIML 1UB6B 3QFJE 4KKBC 1ZHKB 4MD4A 8CGTA 3HIZA 3KW7A 4N2OA 4Y2NA 1R3KA 4KI5F 4PJEE 1KIRA 1AZUA 5IW1A 1KBKA 2VSDA 3LKNB 1RK1A 3VI4F 2GI0A 2XX1A 3H9HB 1FZMA 5IM7B 1X4ZA 3JTTA 4I0PD 4TPRH 1I4FA 2Y23A 2XSKA 1CWVA 4U1KA 1JNJA 4YFDB 3C5ZB 1A7OL 5B39B 1DDHA 1DDTA 4WK0B 2BNQA 5EIIA 5GHWH 5HP5A 3CTTA 3RY6A 3X11A 4TNEA 3E3QC 3HRZC 3V5DB 5EBLA 7FABH 3AT0A 4NZJA 1NFKA 1DVYA 4CC0A 4B95C 2C7UA 1PD0A 1QFWM 4RAVA 5MEPA 1E43A 4ODTH 2Q3XA 1BEXA 5ADPH 1Z9SB 2HFEA 2EIDA 1PNDA 4TNWK 3HBPA 1ZLVH 4BH8A 4GMTH 1KB9K 1UD3A 1Z9NA 4KHTH 4PJ5D 2WBWB 3Q05A 2AK4B 5IJCC 2VTFA 2AJ3A 4UZGA 3VAEA 2ZSVB 3VMPA 2HN7A 4HFUH 4Z7NE 1QWNA 5IROA 5EBGA 4PJ9D 3QR1A 3CDGA 2QQLL 1FIGL 3ATFA 5TQ0L 4P3DB 2DWYA 4OLXH 3BAXA 5TDNB 1IBHA 2MQGA 2WBJD 5I8KL 5TE7H 5JTWA 1F58H 5J56B 2VZ1A 4JDZA 1WIUA 1EHXA 2NXZC 2XBZA 2VDNB 3ECUA 3MRFA 5KVFE 4LSVH 2L0DA 5L88H 1C16B 3P73A 4DP6X 3F7VA 3N50A 1KBGH 3MNZB 1I8MA 1GTNA 2QMKA 5I1DA 5H37H 2IAMC 5C0GB 4UQ3A 2GITB 2B15A 2N59A 3TA3A 3OLGA 4HSQA 4PJIA 1Q9WA 3EUUA 1PBYA 4OM0L 4NQDB 1MJUH 3E9UA 1BM7A 2DH2A 1O9WA 2HJKA 3HNVH 5CMAA 1BF5A 3DPBB 4X5RA 1NL0H 2EVIA 2XN1A 4MX7A 2HPTA 1QSFB 4LVHB 5I15H 1OARL 1FG9C 2AMUA 4KK8C 1GL4B 43CAB 1TCRB 3H7BA 3FUJA 4BUHA 4YXLH 2AEPH 3W0WD 5B1JA 3IXTB 2ESVA 4KKCD 4F7PA 3VD4A 2ZOUA 3KPSE 5D2LA 1IAIM 2OJ1A 2IPKB 2YMXL 4WHTB 5HDQH 2A6IB 3E7JA 3B7SA 1I53A 1JVLA 3NSFA 4P4KC 3GFUA 2VXSH 3HR5A 3EBIA 4UU9A 4FLQA 1EVUA 3QDMB 1P69B 4AIZA 3MBED 3A6BL 1Y1DA 4JHWH 4XN8A 3CZNA 1XGPB 2B3RA 2NSMA 3SPCA 2AXGA 1O9VA 3ARWA 1H3GA 1FNHA 5JIDA 1M05A 2J20A 4HK0A 4NZTL 2F58L 3FZUD 5MERA 4XMLL 4HS8L 3ZKNC 4NRYA 4D9LH 5KBKA 3OXRA 1FVEB 1BWMA 3J27A 4PGDA 1Z66A 1HSBA 3C6LC 3L2NA 3G6JB 1U8MB 5SV4A 3RWJB 5I0ZA 3TO4D 1DN0B 5E6IA 3REWA 1N59B 3ZIYA 4JMXA 5C0CD 5CJQH 3FU3A 5INDB 5C0EA 2N0KA 5F96H 1BPVA 1ETB1 1DJXA 4IDJH 5D1ZA 3FU8A 2NW3B 3CHOA 3IRCA 2DLEA 3EDEA 2ZKMX 3TPKA 4Z77B 3BLKA 2QDWA 3MACH 4OJEH 2BIOA 1X7TA 3IF1B 2YQGA 3U1SH 4ENZA 4HXBH 3PWLA 5EZJB 1IJ9A 2Y7QA 2YC1A 4KTEH 1F6LL 2WMPA 3VQLA 4ELDA 3BWZA 1JNHA 4N6QA 2AXWA 3KPTA 4H20H 2D3JA 3ILDA 4YDNA 2SEBA 3FFCD 3BKJH 4PJIF 2ZOTA 1GZQB 3PNWB 2QGCA 5A40E 3VWJA 3HMWH 3ARVA 1XF1A 3BI9X 3V4UL 2GAZA 4UWQB 1SXBA 3MLZL 1M57B 4F80A 4JKPH 2DLFH 5DK3A 2CLZB 1NGZB 1F1DA 3HKFA 4KMTL 1FC1A 1Z3GH 4GW5A 1RZ8A 3GRWH 4P9MH 3ASNB 4M7ZC 5D2LF 2ICWJ 3F64A 3NVQA 2XV0A 3QEHA 2YOCA 1ND0A 3DHJA 3JV6A 4LSUH 5D96B 5FO7B 1HU8A 3RX5A 5D1XD 4HUCA 1QKZL 3DV4A 2BFVH 2ZUUA 4MTMA 2A6DB 1EAJA 2A9NL 3EOTL 3JWOC 4KK9D 3LNIA 4OCSL 4DKEH 4ODVL 4RGNB 5LBSH 4IBQA 1ORSB 2NR6D 4PG9B 4YBHA 2W59A 4AV0A 3QXTA 3HS8A 2FIKB 2D7TL 3HUJB 2J5LB 2CKBL 3WTVA 2EYTA 2OQJA 1DFBH 1KDJA 2ZD0A 3DTDA 3N40F 2BVOB 4BYHA 4UOJA 4A7TA 1P7KB 1NAMH 3KPRD 4MXWH 5ESAA 1NFIB 3CK0H 2K8MA 3RWDB 3K2KA 5C7ZA 2CSPA 3V0GA 3NCCB 3B43A 4F3FA 1G7IB 1MHPL 5CJ5A 4U33A 5E5UB 4F7MA 4X2UA 3IE9A 3N85H 4YNYA 3DSFH 5FA3A 4IBUA 1U3JA 5I30H 4M03A 2D03L 5EEZA 4UNVA 3HZKB 4TVSa 5IIEB 5DLMH 3BPCB 3LMJL 2ITCB 4JZJC 3RL1B 1JXDA 4GW4A 1BAFL 4X9YA 3O2DH 2APVA 2DWDB 3UPRA 4M5YL 5E2UH 1T0MA 3HG5A 4U6TA 5JORB 1YPZE 1UACL 2HMID 5I6KA 1UYWH 2B2XL 1PKQA 4OJFL 1FE8H 1G87A 3PGDA 1IBBA 4F9LC 1KTKE 1ZK9A 2RFXB 4WW2B 3MXWL 5AL0A 4HG4J 5I66A 2YFOA 2F1BA 1YNKH 1NEZA 1SEBA 3KLQA 4ANUA 5ESQA 3OB8A 2CMRL 3INUH 3IDNB 1P9MA 4GNKB 2WP3O 3VM5A 1DO5A 2B1AH 1CICB 1K8IB 3PWUB 5KSAA 4W9DC 1Q72H 1RURL 2O30A 3RU8H 4KVCL 4JCWA 4UAOB 4P2YA 1U4FA 3L3IB 4S1QL 4Y4HB 4B50A 2VZSA 2GUOB 3ASWA 2FO8A 2Z64C 3GF8A 4PRPD 5J6GA 2E46A 2IWGA 2R2EA 4NNXB 4PJDA 3IU3A 5GRUH 2RGSA 4X6EA 3NFSH 1NLDH 4IEFA 4JFQA 1U8QB 2FEEL 5DF0A 4L8SB 3L7EA 3C09B 3HC0B 1GXEA 5JHMA 4JO3H 5CD3A 1E6JH 5BZZA 2BY0A 2JE8A 4ATWA 3POCA 5M94B 3CMGA 4H1LG 2O5YL 1C5DA 1YZZA 4LK4A 4WFGD 3P4OB 1G4MA 4XCCL 3KM2A 3MGTA 4YQXL 1AXSA 3MRDA 1QSZA 2DEYX 3MV7D 2ITDB 4GUCA 1UXMA 3MV8A 3QXDB 1B0WA 2C9QA 5GGTL 3UTSD 4U6XB 3U83A 3KBFA 2QADC 1T5XB 3M8OL 3WG7B 4I9WD 15C8H 4JO1L 1GR7A 5FS5A 3EOYG 3ZXAC 2D31A 3ARFC 3R1GL 3VG0H 2CM5A 1U8PB 2G5BB 3PV6A 3U7YL 4EUPB 2VDRB 1MVUB 2A9CA 2R2HB 2FO4A 3BN9C 3ARBA 5EBMB 1TTCA 3LZQA 4QO1A 5DWUL 4MKTA 2VR8A 5A1AA 2NZ9C 3GMPA 4JFHE 4OGXL 4PGZA 3G04A 1DVQA 3CZFA 1EIBA 1MCNA 4QWWD 4O2CA 2D2CC 5I9QB 5TFSH 5MEQB 3VGAB 2ZUWA 1Z1WA 3EGSB 5T5NG 5EU7E 5J9PB 1BVZA 3IAQA 3IJEA 2V7NB 3KPLA 4K07A 5IHUH 1YECH 3OHXA 4P9HL 3VFPA 3WJJA 5C08A 3DX4A 4HWBH 4RDQG 3SJVD 2ZOLB 2XZAH 3H9SD 1E8YA 2XQ0A 3S3BB 3IGLA 1UM5L 1DBKH 1E3FA 1P7BA 1OGTB 2EACA 3MNWB 5A16B 2VISA 4GUPB 1V3MA 4J8RA 1LO5B 4YIQB 4Z7UA 3I6KA 5DK2B 4P2RE 5HDRA 4ICWA 4PJDF 2R29H 3O11A 4QHUA 3LN5B 1LMIA 4WHYH 2N56A 2BOCB 2V3DA 2WWNA 4XP6H 5IESH 3D39B 4LBEB 2H9GB 5EWIH 3W9DB 3KPOA 3OV6A 1CXLA 1S7TA 2JFCA 2DMHA 2CKBA 4ECNA 3PAVA 3FTWA 2DLHA 3BUIA 3LPWA 3FN0L 2WQWA 1PLGL 2ADIB 4NQCB 2C1PB 3LS5H 4YDZA 1OSZB 2DI8A 3MREA 4N2DA 3ZTCC 1CYGA 2XJLA 3PPEA 4ZFOB 4BFOA 4PJFE 4K2UH 5HHQB 1NGWB 4BWUA 2WQAA 3PWPB 3K81A 4NBXB 1U3HD 5TF1L 3QJHA 5DUMH 1WS7A 3HN5A 4A2DA 3PDDA 1MHCA 3QORB 1FORH 3CSFA 3Q6FB 4EI6A 1XH3B 3B9KA 1Z9LA 4F24A 4ZUSA 3VXSE 2EIKB 3W38A 5D1QA 3SGJC 2J4WH 4N5UA 5I1JH 2EIZA 2O61A 4TUJA 4GQRA 4EN3D 2DKUA 4HXAL 3WUWA 4ONGL 1G7HA 1WAAA 3QA3A 3IFNL 1PX8A 1Q0XL 4HMEA 2BNRA 3ZOAA 1EO8L 4D8PA 5EEWA 3OR7B 2C7FA 4FQQB 1ZHLA 2CG9X 1M9SA 3S8WA 4UNIA 2XNAA 2BIIA 2GJ6E 3LNGA 2J6WA 1WUZA 3L95A 1VAHA 4N2NA 2J1YA 4RRPA 2P5WA 4APXB 1TU2A 4N28A 4L4TA 4QTIH 3CLFL 3U0TB 1BFSA 2O5XL 2C9SA 4FE9A 2EE2A 3KYKL 1SFDA 5EBWB 2HVJA 3WEBA 1E4KA 5FKPB 2BY2A 4HLZH 4ZFFA 4URKA 4L8BB 1A1NA 3WNPA 1WFMA 1KN2L 2DICA 1NTDA 1EEYA 2J1KA 5EOTB 4XPTL 5SWQB 3B7RL 2APXA 2VXTH 4M7JH 2CDFA 2IIJA 4QIRA 4F20A 4F37K 3O4LB 3CN3A 2IDTA 4Z7UF 4DVRL 1TJXA 3V4VB 2WLHA 4L1SA 3MGOB 2XACC 3GNML 1MRFH 5C3IA 5F1NA 3QBTB 4MDIB 4CVZB 4X7SH 5D7LE 5I1CH 3TO2B 4HF5L 3MLWL 3W3BA 4XE5B 5KTEL 3WTWA 4OB5H 4YVNA 1UA6L 1CFVL 4LU5H 1I8UA 4XOBA 5CBEA 1X5FA 3GI8L 3ENEA 5HGAB 4NQXA 2QQQA 2ICWB 5GGTA 1QHQA 1EZVY 3T3PF 4P4RB 2VO8A 1VKXB 5JPNA 5B3NA 5GRWA 3OXSB 4HKBB 4P5TA 4Y4KB 4PJ7E 1EERB 3WJLC 5JYMA 2H32H 2YPLA 3ZR5A 2LW3A 1BQLH 1QQDA 4KTYA 1U9KA 3HAEB 3QUGA 3G5YB 4E41B 4FZ8H 5I6XB 1IKFL 4NPYA 2B3IA 2K4WA 3F12A 4K7PY 1I1AD 4WI6A 4A37A 2V9RA 4RGOL 2EUVA 5AVYB 3QIWA 2FWOB 1FNGB 1WAAF 4UMGA 2MH4A 1PZAA 4YH6A 4QYOB 4N8VG 2F54E 4R3SB 1QR1A 4V1DB 1ZVNA 4P23D 3FO9A 4O4YL 4BRVA 1QFHA 3CFMA 3UTQA 1A1MA 3MRRB 3KL3A 1MFEH 4LDEB 4U1IA 4FZEH 2J1WA 2CDEA 2VABB 3DDFA 5EO9B 4XBEH 5SV3A 3UO8B 1RU9L 3QWOB 5AENA 1QI5A 2IANA 4ZMWA 5F9WC 2F7RA 3UG4A 4JRLA 4QOKE 3O9WA 5EO1B 3STZB 2P49B 3UG5A 3W39B 4UIKH 4Z0BL 2VERN 1NICA 4LCCC 5E8OA 4LSTH 3S37L 3G5VB 4Z9KB 3K6FA 3O3DB 3FTSA 2XCMC 1R3HA 4KZCA 1AD0B 3APCA 2WZ6A 1HXKA 2WZ0A 1K2DA 4I4WA 1JPST 5EULV 1M6OA 1ZS8B 3MRNA 1YEGH 1NDGA 5D2NE 1N6VA 1KC5H 5GRZA 2QFRA 3GWJA 5CR1A 5DURB 1N0XH 4EEEA 2NY3B 1TZIB 4AJVA 1RIUL 4JJ5A 4QNPE 3FT0A 4WWNA 2F8XC 4LARH 4RNRA 1FN4B 4IIQB 1CE6B 1SF3A 3SQOL 4TVPH 1I85A 4PGEA 4BKLA 2A77L 4K3DH 1CFBA 3P3RA 5DJXA 2VDMH 1TDQA 1JVKA 4GS7B 4NZUH 3ZDZB 3BAEH 2ZKHH 4D7PA 3LZFH 5TE4L 4LSQH 1JRHH 4PS3A 3HFML 1G6RL 1C9SA 1OCRB 4X8CA 4TQHA 3HG1D 4U49A 2C9AA 4GSXA 4NQSB 5C0AA 2MTAA 4BA8A 3BAIA 1YN7B 2M2DA 5DEZA 2DMBA 1Z5LB 3AW5A 2JB6B 5H37G 4ONHB 1JGLH 4W9ZA 5D71L 1SYSB 1T21A 1T4WA 2VXQL 2WXKA 2EC8A 1YEEL 3QIBA 1YVLA 3M17B 4Q6IC 3WGVB 2ZXEB 4NLHA 4OCYL 4NX0A 1BPLB 2ATPA 5DZPA 3RZCC 3CLEL 2AABL 3NPSB 1IC4H 2FSDA 4GRMA 4Z8FL 2QTEA 3LKPA 2XRAL 2YPKA 4X7TB 5F7AA 3U9PH 3JUZA 4N68A 1ID2A 3BXNB 3HHSA 3K6IA 4O58L 3S2AA 3BFOA 3FQWA 3FTGB 3FTZA 3GJEB 5DJ2A 4ZODA 2NX5E 2BW4A 1DQJB 3HTLX 2NY6B 4TSAL 4JFVA 5MP6H 1FDLL 4ZBJA 2OL3B 3S5YA 3GBML 1HJBC 1MFMA 1QMUA 2VXVH 2VR4A 4YHKH 3CSBA 1HCZA 4G9FA 4D9RE 1S3KL 3T1FB 4LOEA 4N5EC 4GG6E 3U9WA 5JXED 2VLKB 2R1XB 3GIVB 4WIQA 4OCNC 3M07A 4S1DD 3B5HA 3ARZA 3K72B 4NN5C 4JHZA 2R0WH 3TIDA 3TBYA 4BZ1L 2UZIL 1FFOA 3V4PL 1ZJAA 4MQXC 3CBRA 1MF2L 3DROA 4JCLA 4YE4H 5T1KA 2NYYC 4OAWA 1D5ZA 4Z23A 4NKOB 4XNZB 1CXHA 1DJSA 3D3VE 3IYLW 1XIWD 2X4OA 3L17A 4PJBB 3BZ5A 3X12A 1I7UA 2PYED 1U58A 4P2OA 4GSUA 2F8VA 3L3DA 3QZWA 4X6CA 1VF5C 2WLIA 4AC4A 3T2PA 5D55A 4L8DB 2X2JA 5AKRA 3DUUA 3QGVA 3W11C 5IBLC 4E42B 2QZQA 5KS9A 4NQEB 1HT6A 4IOSA 3T8MA 4QKXB 4YLCA 2WXOA 1QBML 3PHOB 4HUMB 4B9GA 2JI2A 3MLUH 1NC4B 3UC0H 5HYQA 3MOBL 3PXHA 5DJ6A 4M5SA 1HKLL 2FZ3A 4OZFG 3LDBB 3SKMA 1HJCA 2VC2H 5EZIL 2D0FA 5A2AA 2MCPL 1OE3A 5AQ0A 3AS3A 3ZDWA 4DPAX 5J11C 5E24E 1E4WH 3JWDC 5LKNA 4U31A 3CXHJ 3ZKMC 1RPQA 5DK0B 2WZPD 3EGXB 3QUXB 1MHEA 3CD4A 2IO5A 3C5ZD 2RCSL 2VUYA 1JSYA 3GRGA 1E7VA 2BJML 4OGYH 2X4TA 4UI2A 1DE4B 2YD6A 2QSVA 1SBBA 1IO4C 5DRWA 4XPFH 3CFCL 3BJ91 3RLSA 4X80L 5FYJL 1D5IH 4OZIE 3ZT6A 1IC5L 3ZE0E 2F2HA 3SE3A 2EDQA 1NANH 5FUZL 4JAMA 4DERA 2HKHL 4BWTA 1JV2A 1RZIA 1WGOA 2KS0A 3LKOB 4MJJA 3B2UD 4WDIB 4R4ND 2F5BL 5FM5O 1KG0A 4TSBL 1ADQH 3QDGB 4LRNH 2LU5A 2Q1EA 2NY7H 4O02B 1E67A 5KJ4A 1IARB 1TFPA 1NWOA 2R4SH 4HZLA 3GMLA 2NMSA 2XWDA 3PS6A 3MRMB 2IPUK 1A1OB 2AK4D 2JKJA 2V17L 3KR3L 5KYUB 2DLGA 1U8OB 5BS0E 5JHLH 1SJMA 3CPLA 3BGMB 1G6RA 5DR5L 1ZT1A 4BM7A 3AB0B 4AW4A 5BVJB 4LKCA 2YKKA 4NO0A 3P69A 4K9JA 2ZCKL 3T4AA 1ZVSA 3QWRD 4EE2A 2RTTA 4X6CF 4WUKH 2VXQA 5CKGA 2AXJA 1E5BA 5IT2L 5HGHB 1FG2B 1FAIH 2E7MA 3V6OE 3S9DB 4ZNEA 4E9SA 5KS9F 2BO0A 4GI6A 3WSQL 2DJMA 3OC5A 3T6QC 4MS8D 1TZGH 3GMQB 3ZIMA 1QABA 4Z18A 1TVHB 4QT5A 2WINB 9PCYA 2H4EA 3CFKB 3MYZA 3RL2A 1M3IA 3QT2A 3MLSH 1DUZA 4Y8AA 1CQYA 4JG9A 1YY8A 1VEMA 3ZN6A 1AO7A 4X9BA 1A4BA 3WL9B 4KO6A 1QVOA 2Q87A 1RZJH 4TNGA 3WEXB 2XN9A 2QQNL 1KV7A 3QUYC 4MVBC 4B53A 5GS0H 4A6YL 3WAKA 5AVWB 4NO2A 2VUKA 4HJ0D 6CGTA 2PO6B 4UQCA 2G0LA 1YC8A 3V7AE 1IAKA 1V7ML 4L9LA 4LAQH 3MV01 4HIJA 1HXMA 4KO7A 4L48A 3RKPA 3SY6A 4JQVC 3AG2B 1NCWH 4MRCA 1BMZA 1YQVH 5AB1A 2XETA 4BZ1A 4BHUI 4YHLH 4L29B 3V4PA 1JYWA 1CXEA 3RUGB 3O41B 1IGYA 4CN1A 5DUPH 2DW5A 2EE0A 1AR2A 1W16A 1U93A 4YHZL 4L3EB 4ACPA 1XL4A 2PUQT 3KBHE 3LKRA 4PGBB 4UDTB 1GYUA 2ARWA 4NENA 5CEYB 1Q1JH 4YHYB 4I0CC 1UFGA 3GMRB 1IM9A 2ZWKA 5DJDB 4DESA 4DGYH 1MWAH 4Y16D 1F3JB 3C2SA 2R0LL 5JW5A 2YQ3A 5KVEL 2WLKA 4KUCD 1QRND 3QNYA 1D2OA 4YHNA 4YHOL 5ACZA 3P0YH 1YEIL 1RUKH 2F74B 2YD9A 3P0GB 3MKKA 3PJSB 4PRBA 4ZAKC 2YFNA 4E68A 4PFEA 5CSZB 1HYRC 3TGXA 3WELA 2H3NB 5E51A 3RAJH 5LDSA 1RSFA 2A83B 1NMBL 3HI1A 3MV9E 4FQ2L 4YXHL 4OF6A 5JHDE 3BH9A 5DMKB 1HI6A 4ESKA 4FF9A 3PCYA 1CGSH 3RURA 3UGEA 3FRPA 2QJDA 4YBLB 1H8SA 1PZ3A 3L81A 4N0RA 3D51A 4JFPA 5B3SB 3PREA 5EPMA 3P9MA 3RJQB 4JFXA 4WVRA 1HEZA 4KROC 2AJUH 2Z4QA 1ZANH 2VLJA 3MJ8B 5FHBL 3PWVA 1FV1A 3IPEA 3RTQB 5HVHB 3GTNA 5KBLA 1AGFB 1U30A 1HH6A 3IWVA 1A6UL 2QQKL 3LYRA 4JZOB 1VCBC 4F1ZA 1ZCRA 1CL7H 4JKKA 3S34L 4GOSA 4WHYG 3QEGL 1K4DA 1NC2B 3BQUA 5D72L 4KTDH 2YBRB 3QFGA 4RGND 2W9DH 4V33A 1PNCA 5AWNH 2WKOA 5DHVA 4NIKB 4X8JB 4B27A 5FOBB 2YN3A 4H2AA 4U3SA 3SGEH 1KJMB 2ZYRA 4P2CG 1CK0H 5MI0C 3ORJA 2DQCL 5IMLA 4JL1A 5FKAB 2WLLA 2V2WB 1DN2A 3KJ6H 4ZS7H 1BD2D 1DJWA 4HIHB 1KLFA 2VN3A 4GRWE 4HJTA 3E2HC 4J39A 3ELAT 1OAKL 1JWUA 3OMAB 4FQXA 2E9WA 3BKYL 4HS3A 2C9UA 5F0MB 4PJ8C 4IU2A 4XPHH 1QLEL 3KG5A 1TZAA 3ZSTA 2CCVA 2P5EB 1EEZB 1WFUA 5FO9A 5DVOA 3LXBA 3EH4B 1O7DC 2XFXB 1H9VA 4MS6A 4XCEA 3S3CB 3VXUD 3QI9B 4LLWB 1FFNA 1OCWH 1OB1B 2CLVB 1GIGL 3DO3A 3FH8A 5DJ8A 5GRVL 2J8OA 4IMLB 4J3OC 5HDWA 2GFBA 1JNNH 2B5IC 1JV5B 4OCRH 1V05A 3C8KB 2GYSA 5GS1B 3P9LB 2DYPB 3UBFA 1KIPB 1L6ZA 2YA2A 1O9ZA 3FU0A 3QNFA 2PWEA 1KGWA 3DXAA 3I3BA 3MRGB 1WZMA 3HC3L 5DRNA 3U48A 2QPUA 3RJOA 4XOAA 3RA7L 3DMMA 4A6YA 1N18A 5IR1B 3ABKB 1P6AB 4L37A 3ZYIA 3RDTC 2XWBA 3VFNB 1FVDA 4HLZG 1HWWA 3HB3C 4XNYH 2AXHA 2Q3ZA 2NY1C 3OAYK 3QUMH 4ZUVA 4GEJA 2F19H 4A04A 3D48R 4A7QA 2E56A 3OJDB 3UZEC 5CJXA 5FV2A 4K5MA 4JE4B 2W0KA 1YMMA 1TITA 4ALAH 2BS71 3MSPA 5C2BH 4NUJB 3OKDA 4OIBA 1AG0A 2OMBA 4OCLC 3COOA 3S96B 1GJUA 4XCYA 4IHOB 4UT7L 5EUOE 3N5AA 4IMKA 4KY1L 2WKOF 4I7ZC 3FXIC 2BW5A 5LO7A 4C83A 1OLLA 3HCVB 2YRLA 3SPVA 1DQML 4PJGA 3BRFA 4U1MB 4MCYA 2CRZA 3FT3B 2P24B 2RD0A 2AZUA 3K1KC 4FCHA 4HIXL 5HHOB 3MI6A 4H8QA 1JZDC 5ANHA 3ILEA 3ZQ9A 2HFGH 2A4EA 2NOYA 1OSEA 1UTDA 3QG6A 2KZKA 4M6OL 5FB8B 1LILA 3QQNA 4AK2A 4NO5A 5I5RA 3BAKA 2MEJB 5DA0B 3HJ0A 4YX2H 1KPRA 2APFA 2FX9L 2BSTA 4X4XB 1H6TA 2C3XA 2PXYB 4S11A 5CM1A 4M6ML 1F00I 2AERT 4XB3A 2F53B 1FA4A 2C4XA 3K2MC 1EMTH 1BFVH 2XKNB 5AL8A 3RX9A 3MLVL 2MCG1 3VH8A 3X17A 2BNQD 3WIFB 1HSAA 3L4YA 4X6FA 3OTTA 1C7SA 1NCJA 6PAZA 3P4MB 2PCFA 5D6DA 1GC1C 2YEZB 3D2UB 5JDSB 2XKSA 1HHGB 5LGHH 3MUGB 5F3BA 5K9OB 1W8OA 2DL2A 2WLJA 5INCA 3PRZA 4NT6A 3CC1A 1W0VB 1U42A 1WFJA 2VT0A 3AJ7A 4PYHA 3LQZB 5J13C 2FO1A 3NZSA 4BKSC 1N6UA 4EDXB 3FQYA 5C0JB 4KJPD 2GHWB 4Z0XA 1KXTB 3TBTA 1K6QH 2WLNA 3OAWA 1FO0L 1MQKL 3JXAA 3V5HA 1NFDB 1GAFL 4M43H 1TKWA 3PPSA 3VRLF 1SXSA 2ZUQB 3OM3B 4J3OG 1TTRA 4YGVA 1N7MH 2GSIA 3TH3T 2FR4B 3IMRA 5F89B 1GGIH 4Y5VB 4GG8B 1IGJA 3RKDC 3GKWL 4JRYA 4K7PL 3NIGB 1RZ7H 3BZEA 2HX8A 2DZEA 4J3WA 1KCRL 3MKGA 1L0QA 3OAYH 4YR6A 3UYRH 4IRSB 1LK2B 5GRXG 3PJNA 1C7TA 1U4EA 4NQCD 2IAMA 3B83A 1M2VA 3ZMEA 1B0RB 2JI1A 1AFVL 3MFFB 3DPDA 4YXKL 4M00A 1DFXA 1URLA 1XGQA 4WCYH 3K74B 1SZNA 4PJGF 3BLBA 1S5IL 3PWPD 3UZVB 5T33H 1TEGA 4Y19B 1LP9A 1UWGL 4AGMA 3QORD 3C8DA 4PD4K 3UTTA 4FEIA 1GYAA 2HWZL 4OLUL 2WUBL 3VGEA 2XKUA 4XR8C 4TSCL 1A14H 2DQHL 1QTYT 1U95B 1ULVA 2PR4L 3MR9A 5CHNB 3UBXG 4G8IB 2JIXA 3VXQB 4FYRA 1L7TH 2XQYG 3QUKB 5DD3H 2MKWA 5DFTA 2IBBA 3PGCA 4FI6A 4MHHI 3TBSB 1OAZH 2ESVD 5FDWA 3MV11 2EAEA 4P4KA 4ZX5A 3GSWA 5K33A 5TGBB 4K3EL 2JF1A 4XWGH 3KNBA 1RJLA 3GKZA 2ICEB 3RFZC 3QS3A 4AQ1B 3OSVA 3S2CA 3OWEA 1MVYA 2CHXA 1CYWA 4NQDE 1UXSA 3U4KA 5KOMC 5I1AB 5I5JA 4J3XA 4Z78B 3EOAA 4XN7A 5DQ9A 5K9QG 3NN8B 4I0PC 1OALA 2E5EA 4H13C 1IBGH 3P0VL 1OB0A 4U2YA 3M88A 2HVKA 4IRZL 4CU8A 3RWCA 1RUMH 4NPKA 1GZPA 1TTBA 3O4LD 2X2IA 3QWNA 1RK0B 3R06B 1C12B 4EOWL 5HPMB 3OAZK 2YAOA 5H2BB 3DRTB 4I2XB 2C3VA 2GT9A 3QZPA 3MFGB 3QDME 3BAJA 5BNXD 3D25B 4NM4H 3ESNA 5KJRH 2FNWA 4YJZL 1MRDL 1EHNA 2NNFA 2R1YB 3JWNC 3GMNB 3WLBA 5IB3B 2JVUA 1G7MA 3ULVE 1GCFA 1NCAH 2H8PA 4GMSH 1HHJB 5A2JH 3KWWA 4IOIB 1KB3A 1YNTB 1EGJL 3KVPA 4J2XA 5IJVB 2FX7H 4NN7B 4Y4KD 2CJ3A 3BVVA 1LP9F 3EFFA 4RA0C 5CILH 3EO9H 1SOKA 1E2VA 4H1LA 5LCVH 4E41D 1UM6L 4PJ9C 3QUZB 3LEVH 1JWMA 3SYCA 1DCEA 1ZWIA 1G7JA 2IOOA 4HDIB 2AV1B 2CLRB 1DQIA 1JGIA 1R24A 4H88H 2WBJC 2ZUVA 3G9AB 4XPAH 2OTUB 4XXCA 3SDXB 1KPUB 5BZWA 3BSZH 3P4NB 4N2HA 1LE5B 3G6AA 1WJ3A 3RIAK 3V8CA 2L7JA 4C56E 4XNMA 1LEKB 3ISWA 1JYVA 5ITFA 4MNGB 3QFDB 2EKSA 2NT0A 5EF0A 4HOMA 2XA3A 1KLUA 3CHPA 5C07B 1AKJB 1XB3A 1WRFA 2CDGB 4RAUA 4XMPL 5DVMA 4P59L 3CXDH 1RSYA 1TNNA 1FO0A 3HNSH 4IKKA 1EX0A 5F0PB 3CFUA 3GS7A 5CCJA 1BOGA 4E0RB 1KJ3L 1BQUA 5GRJL 2AQ1A 2A6KA 1RQ5A 5A2CA 3O3AB 5KSBE 4KDWA 4NFDA 4W4OC 4YDVA 5ALCL 4HUWA 2R2BB 3WFEH 1MUJA 5C97A 3W1ZA 2VMEA 3D09A 2EDBA 5IQ7L 2IH3B 1GOGA 2NLJA 4KAQL 2AXFB 1N8ZB 2QTVA 4EQ2A 2B59A 2N1TE 4KKCC 5MENA 1IGIH 2IGLA 4TPRL 2LE9A 1HHKA 4BA0A 1HE7A 3HNTH 5L2JB 5HJ3A 1CLCA 4JZJA 4YDLB 2HAZA 1S6NA 4QRTA 2P43B 1TMQA 5AW9B 4R0LB 3G5WA 3CZKA 5DFVD 5GHWL 3TJEL 1X9QA 2WXJA 1EQWA 1U3NA 1LNUA 2CBTA 1AS8A 3MBEC 2NYKA 3GM0A 4NZ8A 3ROLB 3WFHB 3OAZH 2HKAA 1BZ7B 3TVMB 4NKQB 4F8TA 4F9LA 3FZUC 4K0OA 3MUZ1 4LVNB 1HDMB 4KJYA 3TBWB 3L45A 4ODTL 5ADPL 1EK3A 4Q4IA 1D6EB 4ABQA 1I9EA 1YEJH 2R23A 4GMTL 4MNQB 1R9FA 2VDLH 2Z31A 4WI5A 2EYRB 1N70A 4KHTL 3TO4C 1G0XA 1B0GA 1IEAA 2X7LB 5DS1A 3HHMA 1SEQL 3K6OA 1C08A 4Z3EA 2XVBA 4MD0A 3WN5A 4PWFA 4HFUL 1ED3B 2IV8A 2G9KA 1OL0A 5LGKA 2QLVB 4KX7A 4WLCA 5E5LA 4CU7A 2L8AA 5AOZA 3APMA 2RQEA 1IEBA 3D12B 4OLXL 2BSEA 5C0BB 5L2KA 5TE7L 1XF2A 1F58L 4FFTA 1JZIA 3KLSA 2GEEA 4GRWH 4HS6A 1ZKAA 4KX8A 5GZOD 4JB9H 4LSVL 1JYNA 5CEZL 4XCFH 4FOMA 4ZMNA 4E9QA 2FEDD 1IGTA 4JQIL 4JFEB 3VWKB 1KBGL 4FJYA 9CGTA 4JM2B 2GIMA 4TULH 1IQDB 4FG2A 5G55A 1RZPA 3MRLA 1J18A 2QR0B 4AM0Q 1Q9LA 1HN1A 2UWEE 2NY6D 4NZFA 4KZDH 1RERA 3VXPA 5E8NB 4IRZA 2CK0H 2HT4D 2Z93B 4FTVA 4WEEA 3MJ9H 4HIIA 4U4IA 3PP4H 2LV4A 4WU5B 1MJUL 1MCPH 5I6NA 2VAAB 3MYJA 3HNVL 4JPIB 1NL0L 4MJIE 5FYKE 5KVDE 5I15L 1UM4H 2VDPB 2OBGA 4P57A 2DWTA 3IGAA 4YXLL 5I18H 5DJAB 5IMOA 4R7VA 3ARFA 4KZ0A 4MMXB 1Z32X 4HH8A 1MQ8A 1T5WA 2OPCA 4Y5YC 5D1XC 4OV5B 2PPEA 4KK9C 1Z3RA 1TTUA 5HDQL 4GAYB 3I6LE 1EGJA 2NR6C 1ZOXA 3PABA 3MTXA 2VXSL 5D6CA 1H3VA 3ARBD 3DX8B 5IMKA 1RJYA 2GCYB 2IPUG 3JV0A 4JHWL 4OUUA 4MXVF 2GTWA 5SX4H 2EILB 1MLBB 3ZE2F 1WDAA 2OMTB 3OMIB 1V3JA 4QRRE 1C5CH 1XGUB 2UY7A 3NTCH 4JLRA 5F6IB 4D9LL 1JZ4A 3UTPE 4NQED 1EFXD 3KLDA 3WIIH 4E5XB 2XYCA 4WHDA 1I82A 1KFAH 5FXCH 5LGJA 3CX2A 3FQ2A 3MQIA 5ELIA 1X5LA 4N2CA 3DYPA 4QLWA 5IBUG 4WTQA 1B6UA 2X3BA 1S7XB 3K4DA 3A67L 4WFEE 1UD5A 1ACYH 3EJTA 1RUPH 3FOMB 3QG7H 5EB9A 5EIQA 1JF5A 3QDJA 1P1VA 4L5FE 3BP6B 5DUBB 1V55B 1A47A 3MACL 2HMIC 4Z3JA 2W5PA 3BC9A 4N4YB 5DZLA 3ET9F 5EORL 3U1SL 3A0OA 3VD9A 2DLIA 2CR3A 3KPNB 4XMTA 4ZPVB 4MCMA 2HFTA 4KTEL 4N8VA 5IGXH 3EYVA 1TZHA 2D3VA 2MFNA 4H20L 1Z0MA 3SPHA 4EI0A 1NOAA 3MAWA 3KZ8A 2BSRB 3GPSA 4NI6A 2TSAA 3TNNB 2CBPA 1NGYB 4LLDB 3D85B 3DIVA 5LQBH 1T3FB 3SGJA 1KCUH 1MI5B 3T09A 3PHQB 1U8KB 3O0RH 4GFXA 2GQHA 4AWJC 2FATH 4JKPL 5FWRA 1G94A 4RZKA 4QD2E 1BYOA 1J8SA 3I02B 3ROOB 3L3OC 3VQMA 4W9GC 1Z3GL 2YRZA 4N90E 3GRWL 4P9ML 4PRNA 4F15B 2QL1A 3VFOB 3ARGB 4CN6A 1UD8A 2HJFB 5IHBA 4MDJB 4LSUL 2WCSA 5KOVC 3PL6A 4DHLA 1A6VL 3CBJB 4DETA 2BFVL 4JN2A 5JLZA 4N2KA 2Q6WA 4Y4FB 5K5YA 1WWBX 1IM3A 1KBVA 1UKQA 1QUPA 2UYLA 3PFUA 4GKSB 5LBSL 3KJ4C 4Q97A 4OI7A 4MJ2A 3L4XA 2ZNXA 3F5WA 5C09A 1DFBL 4V2CB 4TUOA 3ULUE 3ZDYB 4FD0A 1AQHA 3JZ7A 1NAML 2YXFA 4JKWA 3CK0L 1R5WB 2XWCA 4QF1A 4D7BA 1QG3A 4XOCA 1Q1PA 4YDJB 1GPOH 1JZGA 3K8LA 4ZXBB 4ETQB 5A6IA 4IM8A 1WTGT 5I0XA 3IDMB 3N85L 3DSFL 3CFBA 5BVPH 5I30L 5T1JA 3VI4B 4JQIA 5DLML 3MODH 3BCDA 3L3KB 2YAHA 5H37A 3JTSB 3O2DL 3ABMB 1AGBA 5I71B 2FCBA 4O2EB 1BZ8A 3L3GB 2XWEA 4QWWC 2PO6D 4LF3B 3TZVB 1IAOA 1UYWL 2VDNH 2YD7A 1FE8L 5EEXA 1OPOA 32C2B 3WJLA 4TLTA 1YNKL 4UOZA 3PDGA 2X0WA 4UUJA 3ESMA 1OZTG 1X9RA 3INUL 2B1AL 4G1MB 2BOLA 1T1WB 2ZSWB 2IQAB 1T20A 5JMOC 4OY9A 1U8LB 3RU8L 2PTVA 4X6DE 3TN0A 1CXFA 4FGMA 2OMUB 1QASA 3FT2B 1ITCA 5FW7A 4L3ED 3LEXA 1E9OA 3CU1A 1JN6A 1MFAL 1F11A 2VGLM 5EOCH 1GGYA 5IFJA 1XHHA 2HLAA 5GRUL 3NFSL 3G5XB 2P47B 1NLDL 2ITEA 2P8MB 3B37A 3EYUH 1BVLB 1RHHB 3RWGB 4MAYB 1K4CB 4IDLA 2EIEA 4JO3L 2ZKYA 3C6SA 3NDZE 1E6JL 2G2PA 3BP7A 4HPYH 1DUYA 3WXWH 3GBDA 4UOQA 1U3HC 2WB7A 4ANVA 2B39A 1FFPB 5DEFA 1LYQA 2DQFB 2H0FA 5L9DH 2G3ZA 4LCCA 4RGMC 1SBSL 4J6RL 2E7BA 4HUXA 2FWLB 4L1DA 2JKSA 4IW4C 5FW6A 1TTFA 2Q7YA 4JFDB 4EN3C 1HQ4B 3AXHA 3QQ3B 5T3XE 2DQUL 4PV8A 3SDAB 1A0QL 1KB5B 4AUUA 2JKNA 1KCBA 3W5NA 2K7PA 4TM9A 5G4MA 1JZ3A 4V1DE 3SDYH 3D0VA 3HPLB 1BAWA 4YMPA 2FDBP 2I9TB 1SOQA 1X7QA 3VG0L 1ASOA 3S5LG 1U8CA 2YAEA 3WE6B 4BDVA 4PHZA 1B90A 5JNYA 3RTQD 4OZFA 4UNUA 3IS0X 1FI8C 1OM9A 5IB5B 1RLBA 3HZ3A 4WNQB 1DDHB 1IKNC 2I7OA 1GW0A 1OGAE 2E4TA 4PR5A 4QY8B 4DGUA 4ERSH 3BVXA 4MD5B 4WWKB 3MA7A 3X3GH 4C59B 2YXVA 5TFSL 5EBLB 1MCWM 4AQOA 1XD0A 5B3JF 2XTJB 4BGDA 4K5NA 1G84A 2XC8A 3WHXA 1MCDA 1E30A 3O6FB 5B21A 1AOHA 1YECL 3D18A 3A4EA 2BK8A 3NCYP 1IU1A 3GRWA 4RAVB 4HWBL 4POYA 5FECA 2E6PA 3FU5A 3UTZB 2XZAL 3V9CA 2HFEB 1VCAA 4Q6IA 2BHZA 2ZX8A 4BH8B 4H8HA 4X5WB 4PLJD 5IB4A 2YMTA 3D0LA 3F7KA 2X87A 2NSXA 4M8UA 3W81A 4F5CA 3RZCA 4GW1B 2EABA 4EZKA 2JJWA 1FRGL 3E6HB 2R29L 2YUWA 3CQFA 1SDAB 5LBSA 5CEXA 4XP6L 4Z7QF 5IESL 2HN7B 5EWIL 3NFPB 2OSYA 2ZOWA 4B41A 4YS4A 1SJVA 4F2MA 1P6FA 2OFQA 2XWXA 5HBBA 2R9HD 1EFQA 3U6RA 1FZKB 1NAMA 1VFAA 2XZZA 3QI9D 2FEJA 2YWYA 3L5WB 5TDPB 3B3IA 3JWNE 3JT0A 3GSXA 4FLSA 4K2UL 3VUAA 1BDYA 5FGCE 4U1SA 3WS3B 4NGHH 1CD9B 4KDVA 4TNWF 1FL5B 4FQHA 4J3BA 4BK5C 1KENH 3GYRA 4JDEB 1FUNA 2B16A 5EC2B 4F8OA 1FORL 1LWHA 1I1AC 2DAVA 3B9EA 3C5SA 4WKZA 2V5RA 4FABH 5DYOA 2XWJB 4YEEA 2DBJA 4FYSA 3QH3A 3TA3B 3CSTA 2J4WL 4G9FD 3WNMA 4FXKB 1WHPA 4PJIB 1CE1H 4NP4H 3O2DA 2W60B 2CALA 3HVDA 3S35H 4P23C 3U30C 3D0AA 4KBPA 1OQOA 3CZEA 2MWCA 5GZND 2ERJC 1UKSA 1W0YT 1ZHNB 4P2QD 1SLXA 2V5SA 3NEXA 5T1KD 1AANA 3M1CA 2Y7SA 3CHSA 3L9YA 3L3JB 4F7PB