1YMMB

Tcr/hla-dr2b/mbp-peptide complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
187
structure length
178
Chain Sequence
TRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Unconventional topology of self peptide-major histocompatibility complex binding by a human autoimmune T cell receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 178
sequence length 187
ec nomenclature
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ymmB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1ymmB01
4N0CD 4OLZH 1FORL 3UCRA 4GLRI 3GI8L 5CGMA 5FKAB 4N1CA 5F1OB 5T3ZH 3JUZA 3WE6B 1WV7T 2CLVA 1D6VL 2DQHL 4IRJC 4N8CL 4WI7A 1QSEA 5MI0B 5F8RC 1PG7W 4RSVA 1P7KB 4FG6C 3H7BB 4G43B 4RFEA 4XX1E 3U9PL 2B5IB 3WN5C 4JFDD 5GXBB 3MOAL 4PG2A 4K3GA 2X1OA 5FYKU 2AV1B 4KFZC 4HEPG 1G7QA 3LKSA 3QEGH 3MXWH 5EO9B 4LLMB 4HAFA 3PHQB 2JELH 1A4JB 3BO8A 2V17H 2YRZA 4Q6IC 4CVUA 3KYKL 1C16A 1JNNH 4XVUD 1KPRB 5GGVY 3IDIB 2J2ZA 5FYLL 4U6VL 3IGAA 1CXLA 5IVXE 1MQKH 3CNKA 3O4OC 3FRPA 4JKPL 5DMGD 4DN4H 3PP3H 2IQAB 5SX4I 5SX5K 1RZIB 2DQDH 4K3HA 4DWHA 4NZUL 5DWUH 1BAFL 3VH8G 2Y72A 1SEBB 3O6LL 2RFXB 4L4VD 3OWEA 3QFDB 3IJHB 3MNVA 4XWOD 4Y5YA 4F7EB 1D5XB 1ZGLM 1CTOA 2FIKA 3HUJE 2NXYC 1A1OA 1UKQA 3SY0B 2A6KA 3O3EB 4HQQL 1XGPB 2AGJH 4NYLB 2DTML 1HINL 2W0PA 5IOPA 2D3VA 3ARDD 5ENWB 1KIPA 2NLJB 5BQ7B 1K3IA 1CR9L 1MJ8L 2IPTH 5J11C 1JGEA 5D6DC 4YEEA 4YHMH 4V1DE 5DLML 2RR3A 4JR9H 2FX8H 5D7IE 4HJ0D 2AEPH 2FO1A 2VDRL 4LCIH 1LMKA 4Z7VE 1X7QA 5IFJA 3RVXC 1UWXH 2X5PA 2ZCLH 2AJ3B 4L29B 4PS4H 5E2UH 2MCG1 4J4PC 1CIUA 3KYMB 5D1ZC 3EDJA 1U8IA 4CGTA 1PVHA 4G9FA 4GAYA 5KVGL 5DHYB 5I1DB 4J3VA 3QIUB 1N64L 4O02H 3VDBA 3LPWA 3GIVA 1RMFL 5J1AA 4KI5C 2EXWD 4MS8C 2KL6A 1CE1L 3O3AB 2XV6B 1FO0H 1H15A 3WLBA 3L5HA 4F7MA 4FQHA 5DJ6A 1UCBH 5FYJD 4YAQA 4I18B 1BIIB 3QDMA 4GAFB 4X9GA 3ARBC 4ODUA 2F8XC 5I8KH 3CK0H 4F9PC 4BH8B 1LNUB 5IBLC 1OGAB 4JFXA 2IH3B 1T83A 1CWVA 5CHNA 3OG6B 1FNSH 2BNRE 4TVSa 1EO8L 2Y6SC 3BQUD 3D2UA 3H9HA 1FYTA 4W6XB 4HHAB 4HKZA 2PR4H 1CFNA 2BOBA 4KVCL 2WINB 3FZUC 4ZTOL 2GUOA 4PV9B 1Z0MA 1T2XA 3AS3A 1N0XL 1MAKA 4P23D 4OGYL 5T1MA 3SN6N 1JZ5A 3KJ4B 1PQZA 2E7LA 1EX0A 1MH5B 1Q0YH 3GSXA 5IHBA 3VXSE 3EYOB 2W65A 2EDLA 3MV9D 1T22B 3Q5YA 3Q6FB 4XAKD 3ILQC 4QRRE 2XTJE 5JMRA 3GKZA 4TQEL 2BHZA 2IALA 3VWJC 3L5WB 3OKNB 4F2MA 2C1PB 3G5YB 2HVJB 5DA0B 1GXEA 4AL8L 1LK3H 4JQIH 4ZXBB 1LK2B 2JJVA 4GQPH 4NQDB 2FB4H 2PW2B 3N50A 3K7UA 3FTGB 4ODBD 3SE3C 1A7RH 2OJZH 4M7JH 3TVMD 3WFBH 3QISA 2OTUA 1JYWA 4Z7NE 2GTWB 2UWEE 5L8JB 4YWGL 1UACH 4Y1AD 4X98A 5JTWA 1LO5A 1QLEH 4UQ2A 3BZ4B 2DD8L 1K6QH 4ZO8A 5EH1A 5J56B 3MYJB 5D1XB 4O2EA 3DURA 3NTCH 1GOFA 1RHHA 3SBWA 3HZMB 3ARRA 1SMAA 1A6VH 4MMXC 1IFHH 3S7GA 3UYOD 4EVNA 1B0RA 1FH5L 3RL2B 4UDTA 3BZEA 1BF8A 3CJJA 4EUPA 4FXGA 1AD0A 3HI5L 4K9EH 5EOCH 5EUOB 1E4KC 2CKBB 3QJFA 2V7NB 1FZJB 3WJLA 1D5BA 4NGHL 1NSNH 3F5WB 4BFIB 3W11C 5I6XC 4PJBB 2YD9A 4XVSH 3UTSD 1XIWD 1SM3L 3W82A 3G6AA 1G84A 5D9SB 3DETC 1NCDH 1LEKB 3O2VH 3T08A 1BJ8A 3SDCB 3D6GA 1RIUL 2XY2A 3ZYJA 1JF6A 1OTTC 4DW2L 4IBLT 4PTUB 1E6JH 5D72H 2DQIL 1HIMH 1EEYB 2VDLH 5IUSA 3ZYIA 5FYJH 4WCYL 4Z7UA 2NNAA 4DVBB 4JLRB 2MHAB 4FQJL 4PR5A 5TPWH 4GQ9H 1IAKB 3JVGC 3QO0B 3FT2A 4JM2D 4UV7H 1KLUA 4D0DB 4ONFH 3TC9A 2F8OA 2RCSL 1ACZA 1RK0A 4M1CD 4HGMA 5B38G 3O3BA 3OJ2C 1UH2A 5HHPB 1IGCH 3M8OL 1X5XA 1IEAA 1DLHA 3TWCL 2QHRL 5IVXF 3JXAA 3K80A 3F7RA 1JPFB 3AREA 4R90L 3VFNB 2YKLH 4NNYA 4WUUA 3P0GB 1KB5L 3O6KL 3T0AA 3NFSH 1Q0XL 4H0GA 1F4WH 2DMCA 4EQ2A 5SV4A 1YEIH 3BZDA 2VQUA 4KI5E 3RP1A 3SGDI 4PJFA 1EHAA 1FNHA 2APVA 3HUJF 3THMH 1HK6A 4GFTB 5TDNA 4JZJB 4C83B 3RTQA 4E41E 1KG0A 4YX2L 1DQJB 4M61A 1VFBB 3QRFM 4KJQD 3GDBA 4NM4H 2FBJH 3FB7B 4YDLB 3QA3B 4YQXH 3HZKB 3GI9L 1BBJA 2A77H 4X4ME 5GSRB 5DR5H 4Y4HC 3PV6A 1HH6A 3FOLB 4LOUD 1SVCP 1IC1A 1RJYA 2L7UA 3KPRD 1Z2KA 2WUCH 3QAZC 1MCKA 3MX0A 3AUVA 5D7IF 1T03H 4NO0A 1YEDA 5FO8A 3G6JE 2CK0L 2MWCA 4Z7VF 1P9MC 3G08A 4POUB 3VA6A 5CEYB 4N0YH 4LHUG 2JCCE 3IDYB 1QFUH 3STLA 4Z7VB 2HT4C 3MV7D 4ZFFB 4B41A 3H2WA 2DRUA 1N59B 2DLFL 3QCVL 5LBSH 2BNQD 4LSDA 2E9WA 2HKFL 4XPBH 2C1OB 1IKNA 4DAGL 1TIUA 1IM3A 1AE6H 3OB0K 4ZDHB 3CX5K 5CJ5A 5FUCE 2YPVL 4G8EB 1OAZL 5MEPB 5FUZL 4EBQL 1RJCA 5IVZA 2ARWA 5CEZD 5GZND 4M4PA 2CUMA 1ZLVK 5AG9A 5D2LA 3VXRE 3TZVC 2FZ3A 3T0BA 4PTTA 1KF9B 4PJ7E 4PJ8A 4NFDA 1R5VA 4Y5XC 5MP6L 2FGWH 2VLJD 3BPNC 3HE6C 7FABL 4L3EE 4I2XB 5DJDB 3GRWL 4LRNH 3UJIH 3QWRD 4JY4A 1AH1A 1MVUA 4IJ3C 2I27N 1JHTA 2J8UB 5E08L 4PRAB 4XP6L 1RY7B 3RNKA 1B2WH 3VRJA 4XNZC 4J7RA 2NY5H 5HI3C 3BKCL 3UXFA 2NPLX 3DO3A 5GGVH 3D3VD 4P46D 4MVBC 4X6EB 4G3YH 4P3DB 1R3IL 3HNSH 5CKAA 2NTSP 4L9LA 4HMDA 3QDGA 2I60L 4QXTB 4POZC 3LY6A 4ZS7H 5GGRA 1S5IL 1RJLB 1CLZL 1KT2A 3KPMA 4G8GA 3H3KA 1WT5C 3KPLA 1N3NA 3RWIA 2HTKC 3EYSL 4OUUB 1FBIL 1JK8A 5ID0A 1T20B 5IHLB 4XBGA 4HKJA 4MD0B 4N0FB 4OZFH 1CFVL 5CFHA 4PGDB 1UC6A 3X12B 5HI4D 5EFIA 4DKDC 2EEBA 5EU6D 1GGCH 4MJ6A 4R97B 3WSQH 5LQBH 1G7MB 1UA6L 4JO4L 2CIIB 5EO9A 4LLMA 1OQOA 1UH4A 4BK4A 1ZHBA 1F5WA 4OF3A 3H42L 3MV8B 4XNQA 3ULUC 1DBJL 2UZYB 1TJIH 1EGJL 1MREH 3GMPA 4LCWB 2CRZA 1I7TB 25C8L 3GSNL 4QTHB 4JKKA 5JPNA 5K9JH 2DYPB 4HIIA 4YDJB 3DX9A 5E95B 1OVZA 2IQAA 2QQKH 1WF5A 1I4FB 5F1NB 2VJXA 4PRDB 4JFPB 4RRPA 5DQDL 5ILTL 2E9JA 4JHBA 2VXSH 3Q1SL 1D5XA 1RUAH 2ATKB 32C2A 4ZO6A 4Z8FL 3L3HB 3OKDA 4W6YB 1XGPA 3VG9C 5E9DB 5EZOH 5TF1H 1QO3B 3MRHB 3VXUD 2F5BL 4LIQH 2H2SD 2Y7QA 4JG0H 4MHHI 4KXZH 4OZ4A 3ZO0A 4OGXH 1MFNA 3REWB 3LS4H 1P7QD 3EO0B 3AU1B 5CEZH 3SE4C 4OFYD 2D7TL 1FNLA 1V5JA 4M6AA 4X9FA 5F9JA 5MEQA 4NN5B 2C3GA 4RZCB 3UMTA 2A9NH 1XF4B 2YD6A 3AGVA 5IB2B 1A2YA 4UU9B 3OAZK 3PWNA 2YEZA 1NGZA 5DT1L 2FATH 3VFMB 2DM4A 1YECH 2P5WA 2WNGA 2K1MA 2XFXB 5SX4H 4E42B 1NJ9B 4XCNA 4K71C 4XP1H 5E2TH 3V5DA 3BMWA 1DQMH 3OX8B 2EKSA 2F9BT 5D93C 5HHVH 1X5LA 4E5XB 4X6BB 5IB4B 5FHBH 1S78C 4XBPB 5C09E 1NGXB 2XTLA 5C9JB 5ITFA 2BY2A 3U83A 5EPMA 2GJ6E 4ODXB 4P5TB 3ARGB 1R3HB 3DI3B 1JN6B 1FNEA 1T2JA 4OM1L 5GJTL 1QFWM 2VAAA 3HRPA 3MRJB 4Q9CA 5FGSA 4ODVH 4FQXB 5EU4A 1OGAA 4YHPB 1OLZA 3KR3H 3JBG7 4K8RC 3LEVH 4PJ5D 2K3TA 3ARBB 4YHKL 4BKLA 4G80B 4RDQF 4KKBD 1I1FB 1PG7L 1TVBB 2HN7B 4UT9L 5DK2A 4F7CA 3QI9A 1T1XB 4C56D 3VGAC 5FGRA 3F7YB 2AI0L 4NKQB 4GAJL 4PV9A 4PRIA 4YHIB 1E6OH 4U1KA 3NABH 2KH2B 5F89A 2VTFA 1YNLH 3W9EA 1A7NH 2N56A 5CMAB 3MRKB 5CEXB 3BEWA 3HMXA 2JCCF 4U33A 5JIKA 1YMHA 4Y2OA 1D5IH 4O4YL 4KUZH 4S1RH 2I25N 2VE6A 1BOYA 2W9EL 5FM5O 2B4CH 2PUQT 4X0KA 3QCTL 1C08A 2OK0L 4U05A 5JZ7D 3EIFA 1YMMB 3KJ6H 1ZEAL 2AK1H 4ZSOE 4LKXA 2X4SA 3VWJB 5GGQL 1ORQA 3NH7H 2Q7YB 5ACMA 3MGOA 1UXWB 4ZTPH 2AERT 4EIGB 4R4BA 1I3VA 3PABA 3TO4B 3D39D 4YHZL 5L2KB 4J3OC 1T4KB 5CCKL 5BRZE 5EZJA 4QRTA 2A73B 3WFCH 4PJ7F 4QYOB 5T33H 4PJCF 2XPGA 1AR1D 5IBUB 3JTTB 5GRJH 4CJ0A 4X9BA 5LXGL 5K33A 5FCUL 3BZ4A 1IAOB 4WEBH 2WANA 4WENB 5I74B 3HC0A 3W39A 4PJCB 1MCQA 4MAYA 4ODHH 1H3PL 1FNGA 4F37K 3UTTA 4ZPVB 3ULUE 5DJ8A 4FZ8L 3NPSB 3B8YA 4PFEA 3DX6B 5GGUA 3RAJL 4DUXA 3K0WA 1BLNB 4HWEL 3LKPB 4FXLA 4LARL 1C5BH 1QLRA 2ZZUT 3QEQB 4NN6C 2BVOB 1NAKH 2OL3H 4Q9QL 1MELA 1FZMA 5D7SH 2DWDA 3VI3E 1Q94B 5DHVA 1T0NB 3C87A 4N90E 3RX7A 5ADOL 3F5WA 4BFIA 4OJFH 2FEDC 4I3SL 2PTTA 4JREC 5T1KA 1VGKB 1T7VA 3FKUS 4P57A 3OR7B 3L6FA 4OCYH 1DBAL 2ID5A 3E8UH 3SDYH 4G6JL 2IPKA 1W2KT 3TJHC 1AGFB 3VG0L 3UJTL 5H94A 1G7JB 1AY1L 3QJHB 3I6GB 1J7VR 3P4MB 3WS3B 2NY1C 2MKLC 3O0RL 4MNQE 4JZNA 4WWKB 1N0LA 4WJ5B 1J1PH 5HI5D 4F57H 4QXUH 1BGXH 1YNTB 5CUSH 2CUHA 1NCNA 1RIHL 3BUYB 4GOSA 2DIJA 4TN9A 3F65A 4YXHH 3WNKA 3RPIA 2IG2H 3MRGB 1J86A 5B39A 3VI4E 4QHLA 2W0LA 3P0VL 5DUBA 1JPFA 4XRCA 5MENB 5D7LD 4P2CG 4WFFD 2XA8L 1QD0A 1DUZA 2CK2A 2X2YA 3K1KC 2GFBA 3BWAA 3TJEL 4A2LA 2CO7B 1BQHA 2WQ8A 3PWVB 4DTGL 2NQCA 1NKRA 5IVXA 4HJGA 1JMZA 5IROA 1JZ2A 4HK3J 4P2QD 4AQ1B 1AGBB 4WI8A 5E4EC 4HGKC 4UOW1 2IMNA 3RZCA 2YD1A 1S9VA 3WMSA 3T1WA 3NCFB 3MFFA 15C8L 1FGVL 3E2HC 4OF8A 4MD5B 5D2NB 4KKAC 1W8OA 4OFDA 1FIGH 1UM5L 2R23B 3J8F7 3KPSD 3C5ZC 1JYXA 1RVFH 5TQ0L 2UZIL 3QHFL 1SY6A 4Y4FC 3HUJA 5IB5B 4U6XB 2ESVE 1DP0A 3DMMC 3QB7C 3FOLA 5CZXD 3B9KB 1YN7B 5F88B 2OX5A 1VERA 1FHGA 2F54B 5FV2A 5KTEH 1OWWA 2Z8VC 4KJYA 1KB5B 3KYOA 3U7AA 4JQXC 1QYGH 5I1IH 5GS2D 1JWUB 1G9ML 4XPHH 5I75B 4V1DA 2VLKE 4WFHD 5CP7A 5D7IA 4JO1H 4L4TD 4IMKC 4NOFA 1CFQA 5TE4H 3MUGB 1CBVL 4GAGL 1I1AB 4WNQA 4Z7VA 5HYSB 1P2CB 4MAUH 2PYED 1FNFA 2FD6H 2V5MA 2WBJB 4OCRL 5ICZA 4LVNC 2EO1A 1S7VA 2VDKH 2GAZA 3SGDH 4OLVH 3CDFA 1WBYA 2YA0A 1MY7A 1ZANH 3GNMH 4M93C 4R4NC 4X6FB 5D8JL 3M45A 2X4NB 3WKMH 1GCFA 4AH2A 5LKNA 4JM4L 5K93A 2VDMH 3LRHA 3HB3D 2ICCA 3DIFB 4JJ5A 4WUKL 1MLCB 1T5WB 1OW0A 3LDBC 2HT2D 2ZWLT 1TETL 3O6ML 3G6DH 4R6UA 4Q0XH 3MREA 4I2XA 2CLZA 5DJDA 1SEQH 5DEGA 3PQYD 1WZMA 2E6QA 2EH7H 4ZUSB 1JL8A 1KJ2A 4GBXB 5CZVL 3NA4A 1XF3B 3RWFB 4PGCB 4ODTL 2O5XL 2XWJB 5I66A 5GRUL 3S6CA 4IRSC 4ZOEA 4IJ3B 4GRLA 3PL6A 3BJ91 1VFAB 1G9NH 3ALWA 2DWEA 3U0PA 2H6PA 1DVFC 1HKFA 1FG2A 5A2KH 5BOPA 4J8RA 4QOKE 3WFEH 4XCYB 5T3ZL 3VXSA 5HPMB 2YPLD 4WFED 4BQ8A 1RZFL 1DQDL 1V8HA 4FXKB 4ZAKD 1JZ7A 1RJLA 4QRRA 1N4XH 4XXDA 5L2JB 1CCZA 2G9HB 2MOVA 3FO1A 3PIQA 4GXVH 4P2RE 1KCSH 2BSTB 1RZKC 5MERA 4PGBA 5KVDL 1K2DA 2WZPD 1I9JH 3DUUB 4IDLA 4IRJA 1QQDA 5JA8B 1SQ2N 3D85A 2MPAH 2CIIA 3S88H 4YBLB 1A6UH 1FDLH 4RFOH 3WN5A 3UDWC 1J05B 1UB6A 1U3HB 1OPGH 1A1MB 4POYA 1PJ9A 3W0WD 2VXUH 3HC3L 3KWWA 4TSAH 4S1QH 1HYRC 4OKVB 4TTDC 3GB7B 1YEEL 4P4KB 3DXAE 5HBBA 5GS0L 4Q6IA 5GS2H 1BD2B 3QNYA 3WV0A 1ONQB 1KFAL 4LLYB 2VDNL 4D0BA 3DOSA 3QZWB 1HILB 4LGRB 4UUJA 3VI3F 1WTLA 1AFVL 1RD6A 4I0PC 3EAKA 4JFPA 3H3PH 5F9WC 2JIXD 2B1HH 3RBGA 2VZ1A 1AIFB 4HV8A 3WHXA 2Q20A 3S36X 3TBSA 1UM6L 2YD4A 4JVPA 3QUZC 5FDWA 3G5XA 4HK0A 3MRPA 4K23H 3IU4H 3FN0H 2CXGA 5J06A 1EO5A 1QO3A 3GGWA 3AB0C 2FNBA 2IPTL 5T3XD 3MTRA 2EE2A 5F21B 2OS7A 4P5MB 1J1OH 4Z76B 3TCLA 3BW9A 5IM7B 4YHML 5T5FL 2WAHA 3VG9B 4LVEA 2RAMA 4NUGL 4HUKB 4RIRA 3IDNA 1J5OL 1PW3A 2PXYD 2KDGA 2R69H 4FFZH 1B90A 1VEMA 4Z77A 4NQVB 1FRGH 5H35A 2ZCLL 5D6DA 3DRQB 2NW3B 5I76A 3RIAK 2CJUL 4GG8A 3RX8A 3S4SB 1WISA 4XCFL 4MNGE 3VI4F 3HKFA 5IF0B 1NEZA 4KRPC 4NSKA 1IL1A 4G9DA 1JIBA 3WEXB 3WUWB 3EYQC 2K7PA 5IBTH 4AIZB 3MBEB 1JNJA 2OM5A 4G42B 1R3JA 2Z35A 2XZQL 4J4PA 5JNYB 1PLGH 1NGXA 5D1ZA 1HHKA 2VN7A 5E94A 2EDJA 4H0IA 1RPQA 2PTUA 4M5YH 1TZIB 3T0EB 3FO9A 1HHHA 1R3HA 2F53B 4PJGB 1MJUH 2PF6A 3CK0L 5IK3A 5KSVA 4LLWB 1OAQH 2J12B 3HNVL 3RDTC 4FQXA 4RFNB 1N6QH 3L7FB 4M6OL 1FNSL 4PRPD 4E41A 5BS0E 2VLRB 3ZTJH 3ARBA 3SCMB 4HC1H 1CF8H 4MDIA 1D9KC 4G80A 4F9PA 5C0ND 3TYGL 4F15C 5KZCB 1NGWA 1ZHKB 4N0CC 4X4MA 5ELIA 1FL5B 5C0CE 2XI9A 3GO1L 5L9DH 4IIQC 2ZOKB 3Q3GA 4FQIL 2VLLA 1WZKA 4IRZL 4NO2B 3RJQB 3G6JA 4KH2A 4N8VA 1K4DB 4NJAH 1ED3A 4JHAH 1IAIH 2FL5B 4FQLL 4JN2B 4E9LA 4RQQB 1J87A 4OD2B 3L3OA 2FSEB 1O7SA 2JCCA 2EIBA 3JWOL 2G75B 2WP3T 4X6DE 5C0FB 3QCUL 3U4EB 2FB4L 3FCTA 3PGFH 4QHMB 1U8OB 4MHHG 4MXWH 3CVHH 3R0NA 4NHUB 4OB5H 1R6VA 2VH5L 1NLDH 1A7RL 1MY5A 3VWJA 4R96A 1A22B 3IDMA 1A9BB 4XVUC 1WWWX 3IVKA 1EAPB 1YJDH 1Z9OA 3BKMH 1KC5L 4X7FC 3I2CH 3ZTJG 2LTQB 1QLEL 5EC2B 3C08L 4JO3H 4NT6B 5FDYA 5DD0H 1JP5A 4UNVA 2NZ9D 5T3XH 3VXRA 3LEXB 3SE3A 3NTCL 3TIDB 1ZGLB 2VR9A 1IAOA 4PJ7A 4RCAA 3MLYH 4XWOC 1V7NH 3RKDD 1WBXB 2KPNA 4L3EA 1HQRA 5JPMB 5C0AB 2BSRB 1I8MB 1CLOH 3RA7L 4RISH 3ARDC 5DMIH 5EOCL 2HTLD 4FMKA 2DL9A 1QFWL 1QBML 3K46A 3TBVB 4NO5A 2QSCL 4EI6A 4NKIH 1GGYA 1D5MB 1AQDB 1MHHA 1P53A 1QEWA 3MJ8B 2Z9TA 2X4UB 3GSRA 4NKDB 4HJ0C 1NMAH 5F9DC 1ETZA 1IC7L 5D70H 1E4KA 5D72L 1HIML 2X1PA 3FRUA 5DZNA 5GGSA 3SE9H 5JHLH 4YBQD 5DURD 5FYJL 3BPCA 2VMFA 2J5LB 4HF5H 4M6MH 5E4IA 5TPWL 4FABH 1JPGA 4K9EC 5F7EH 2XN9B 4RGNB 5DK0B 2LQRA 1AGFA 4UV7L 3I50H 5TFSH 5TDPB 5EC1B 2J88H 3P0YL 1LE9A 1H8NA 4BZYA 1X5AA 4WFGE 4HWBH 2VABB 3IDUA 3MLTB 4PJ9D 4CRPA 3OJVC 1TQCC 1UXSA 4WJ5A 1YEKH 1FGNH 3ZDXF 5B8CB 1YNTA 3S37X 5ISZD 1CDGA 1AKJB 2EXWC 3JVGA 2IAMD 3LIZH 4JG1L 2P7TB 1CXHA 3IAGC 4MA3A 4HH9A 4BSVA 1HOCA 5MENA 1B9ZA 4JFEE 3KS0H 1N5AB 2CDFA 3U0WH 4HCRH 5E2WL 2ZCHL 2Y36H 4JAMA 3K8LA 1DQLH 1YEIL 4OZGE 1CDUA 4NQCD 1I75A 4PV8B 4PG9B 5C08E 3BQUC 2BVQA 1M71A 5KSAD 4Y2DD 4UQ3A 1EPFA 3SGKC 5TH2B 4PYGA 1CE6B 1JWMB 4NM4L 2BSED 2FBJL 5C70A 2HRPL 4QHNA 3BKJL 1J1XL 4P23C 3IDGB 3D18B 4LQ1A 1G0XA 1XGUB 4OIAA 2NY6B 5J6HB 2QQNL 4JVWA 3E2HB 5I1EH 2V7HB 3DTXB 4RGOL 2R39A 5C0IB 3UTZB 3SJVE 1JGUH 5JOEA 3QXUA 3BN9D 1L0XA 4PGEB 3UZQA 4YEFA 1JPTH 4PJDB 3VFWA 1T1YA 1OAKL 2AV7B 3RIFF 2CD0A 4XPFH 3QNXA 5DFWH 1KB5A 4B7IA 4Y4HA 2XWBA 3CC5A 5F1IB 4F33B 5IFHL 1ROWA 3GUTB 3QG6B 1U8KB 3IFOB 3QXDA 1GZPA 4KHTH 3HN3A 1N2RB 1TLKA 1L9MA 2OMNA 3CPLA 4DN3H 1P9MA 1P2CA 3TVMC 2VXVL 1F6FB 2LFGA 4JFDE 1B6UA 1UG9A 2YD7A 4LPWA 1D7FA 4FTVD 3RFZC 5HGDB 4I9WD 3MBXH 3CUPA 3MJ9A 5FO7A 5E5MB 4QTIL 5DMJB 4LU5L 3QIWD 1OTUD 2X4OB 4NNXB 4X6FA 1N6VA 5C09A 2F74B 3ISWA 4HUVB 2VQ1B 5C3TA 1E4XL 5DFTA 2GJ6A 1LEGA 4BZ1H 3VD5A 1EEUA 1MLCA 2FGWL 3F12B 5F6HJ 3WHE1 2HJLA 1ZGLP 1EXUB 4H26A 1F45A 4DJMA 4R0LB 4GKZB 4JDTL 4G6ML 4K3JL 2A83B 4L4VE 4X5WA 1YY8A 4YUEH 4ZUSA 3FONA 1B6DA 4Y5XA 4QRPB 2Y06L 4L3AA 3RWCA 2XKNB 3MRMB 3HE6A 5IFAL 1XIWC 2V2WB 1VGEH 4O58L 4NC2B 2QADB 4TUOB 12E8H 3ARXA 2OXHA 1JZ6A 1OARH 5I9QB 3MUHL 4WW2C 3L3GB 3T3PE 3EYFA 3SPVA 3HR6A 2A74B 2ORBL 5IB3B 2M1KA 2EDDA 4X6DF 3DARA 3A67H 3L1OH 4FXKA 1L9NA 5IMOB 4JM2C 2W0FA 3HG1B 5L2JA 1DLFL 4M1CC 3AAZB 1AXIB 4ZFGH 1N6UA 1R5WA 2NY5C 4LAQH 1WT5A 4JANB 3DO7A 5GGTL 4ZSOA 3VFRB 5JW5A 3WSQL 1XEDA 4OZIE 5DO2D 1UWGL 2HJKA 3P30H 2X4QA 1R24B 3V6OC 2VISA 4XC3L 5C6TH 4PRNB 4FHBD 2FJGB 2HFTA 2JB5L 2R1YA 1HI6A 3NIDE 3VH8B 4Q9RL 4AEEA 2DQFB 4EN3C 2NX5D 2UY7A 1IARB 3SOBH 2E9BA 3FQTA 2J6EA 3LKQA 5DI8A 5D71L 4P4KA 2QQKL 4OLXH 1AP2A 3HLAB 3NCYP 4HWUA 5JUEL 4NCDA 1EZVY 5AWNH 1ZWIB 4OTXH 1QHPA 3S96A 4KJQC 4BM7A 3D87B 4JFQA 5DC9B 4LSRL 5AZ2H 3HS0A 4NJ9L 4XMPH 3ESVF 4NFCA 2AKRB 1YEFL 4GMTL 2EDEA 5FA4A 4LOUC 1AIFA 2DQGH 5EZOL 5DHXB 1YEGH 2XWTA 4Y4KD 4KQ3L 3DVNA 1QRNB 3O2DA 5F9WB 4JRXB 4I4WB 3QEUB 4OGXL 2CDGA 3LS4L 4NKOA 5HHMB 5EULV 4P2OB 5JXEA 1IEBB 5EB9A 5HSFA 2JJSC 1T3FA 2P42B 5DRXB 2CGRL 5DD3H 2DM3A 4XAKE 3WIIL 3UJJL 1GGTA 3DX8B 1F90L 1CGSH 4PJHE 2DBLL 3JWDH 4NQVA 2UVEA 4U3HA 3DRQA 3SE4A 3V79C 3VGBA 2X7LB 3ZHKA 5C2UB 3SGEI 4MNQA 4YDVA 2EEAA 5E2TL 2R2CA 1LO0H 1LWRA 5GZNC 5FHBL 5CD5D 5DD5L 2PW1B 1A6PA 1Q1JH 1MFBH 3BH8A 4OZGF 3CFDA 4JFFD 4JCLA 1NAMH 4MX7B 5F7WC 3ZL4L 2XA3A 4Y1AE 4XBEL 2X42A 5IKCA 4MSWB 1PEWA 4LBEB 3QUMH 1NC4B 1CVSC 3I3BA 4ODVL 4LLVB 2X70A 3PDDA 2YBRB 1J8HE 5J12C 4LLWA 2G2RA 4XZUA 2ZCKH 3KR3L 5IR1A 4KZEH 2UYLB 1YPZB 4FMFA 4X7SL 3CDCA 4X80L 1HSBA 3T2NL 2APBA 2ZUYA 1KCVH 5J13B 1V7ML 5TGBB 3RGVB 1Q72L 1II4E 4U1GB 2HH0H 4YGVB 1U8NB 2ESVA 5TDOB 1ZT7B 4OCNC 3WS6C 1FL5A 5EOTA 1A7NL 3BPOB 3LRSB 4DZ8B 3BSZH 3BIAX 3ET9F 3UTSE 1IQWL 3VMPA 4YHNB 4LASH 3NCYS 4QHKJ 4JY6A 4P49A 2VLKA 4WV1B 5LGJB 2B4CL 3U6RA 4MQ7B 4S0SD 4RRPG 4NZRL 4RQQA 4RA0C 1IGMH 2FSEA 4P5KB 2XNAB 5A2JH 2GY7B 2B2XL 5C0FA 2DKUA 3TN0D 3GJFA 5DRWA 5I71C 3NH7L 4QHMA 4AEFA 3MR9A 5EZIH 2DTSA 1XCTB 2YUVA 3FFCB 2AXFA 1JRHH 1YN6A 5JQ6H 1NDGA 3DGGA 1MAMH 2AP2A 2FWOB 4CAGA 2A2QT 3R0MA 4MQXD 1MCRA 5DEZA 1QUNA 4XHQA 5DJXB 4NT6A 5FYKL 3V6OE 4WEBL 4CUCA 4NRZB 2Q6WB 3ROLA 1CI5A 3O4LB 2OTPA 2DDQH 1ZGLA 3ARFD 4ODHL 3UEZA 1VPOL 5IEKB 3EO1A 4GRWH 1WGOA 1IAMA 5SWZB 5C0BD 2Q8AL 3MQIA 1CICD 1IM9B 4OZHB 3S3SA 1DFBL 4NQED 5DYOB 3K2UH 4LPYA 3HMXH 2RHEA 2H2SC 1QG3A 2FJHA 1KPUB 4CNIB 2YR3A 5F6IB 1HSAA 1UT9A 3ZT7A 4OJFL 1QSVA 3QDJD 3F8UB 4OCXH 3T77B 1TVHA 2R0LH 3LKNB 1IT9H 4PREA 1A7QH 1AO7D 1WEJH 1F3JA 2ARJA 3VD9A 3KPRE 1RU9H 4KKNA 4Y16C 1TJHL 1H8OA 4R4FH 1A0QL 3SDYL 1UJ3B 4MCYB 1OT2A 4S2SA 4HFUH 4PJAB 4FQ1H 2YXMA 5A3ID 5I8CB 4OZIF 5B38B 1RUQH 4OLUH 5B22A 5F7UA 4P2RA 2GSIB 4Y19D 5I18H 4PP2B 1L7TL 4BUGA 5TDPA 2R2EB 3MV7E 5EC1A 1OT1A 3IFPA 4LPVA 3SE8H 1UQSA 1HHIB 3M1BA 4D3CH 3K4ZA 2NY3B 2BNQE 3SO3C 4OZIB 5BCAA 2R4RL 1BFSA 5CUSL 3DSFL 4N1EA 2W91A 1I8KA 3BGMB 4CU8A 2IBGA 4H1LA 4JRWA 5J0BA 3Q0HA 3NIDF 3M17B 1S7WB 4LIQE 5ICYA 1UEYA 4YBHA 2SEBA 4R8WH 4NCC2 2JK5B 2MQ3A 4Z7OF 1R3KA 4KUCD 5CEZE 3CCHB 4HX1A 1N5AA 5IMMA 3ZHLA 5HXMA 5JOFA 4Z5RB 1U8PA 4LLUB 5AD0A 1TQBB 4OF5A 3QWQB 4N0UE 1ZAGA 3CSYA 2EDOA 4PG9A 5DJYA 5DVOA 4KKBC 4XMKL 1FIGL 2WBWB 2DJUA 1XH3A 1BOGA 4BZ2H 3INUH 3VGEA 2NXZD 1RVFL 5IHUH 5E00A 1CE6A 3VFTA 1LQSR 5IVOA 3ULSA 5EU5A 4TUJA 4WI9A 1T1ZB 4LFHG 2XIDA 4LF3B 4OLWH 1FVDB 5C0EB 1CFSB 3UTZA 5C0IA 1BPVA 1GIGH 1R5IA 5IB1A 2WUBL 4LHUB 3VWKD 3EOBB 3C5ZA 3D3VE 5J7CC 5IW1B 1QYGL 4OBRA 4Y4FA 1RI8A 2BNRD 3M07A 5CIPA 1T2QL 4GUPB 3V0AC 1F2XK 3DMMA 3MV9B 5JZ7C 3QQ4B 3DV4B 2AK4D 5MHSD 4UI2A 5IHZA 4F33A 1KXVC 1MRCH 3GSOA 5SV3A 4JQXA 5DMKA 4OV5B 4LSVH 3U9UA 3MNZB 2XKUA 1X6LA 4MNGA 3BVNB 1NBVH 1TNNA 1ZANL 1D6EB 5EU6E 3QNZA 1AR1C 4HS6A 1FFPA 4AM0A 5CP3H 3BRGC 3CFCL 5JDSB 5DRNA 4JKWA 4Z0XA 2DI8A 1L7IL 2Y07L 3VGGA 1V3KA 5SWSB 3NGBB 4OCWL 2HA1A 3MLWL 4K3EH 3T2OA 5I1KH 1FPTL 5GS1B 1ZXQA 2EDHA 1S3KL 5DJCA 4ZNCD 1SEQL 4P9HH 1KJMB 4BH7B 2EH7L 4DFHA 5C0GB 2Q1EA 5C8JB 1LVEA 2XQBH 5B4MD 1MHPH 1U8HA 5HGAA 5EBMB 5ECJE 5BS0A 1CGUA 3MLUH 1WC7B 4PJEF 4AYFA 4JRYE 1MIMH 1OAXH 3EYVA 4OCMC 5DF0A 1Z3GH 4O9HH 3B43A 2PYFB 3NZHH 4DKFL 3FO0H 1FAIL 5C0CA 2IH1A 8FABA 4DKAA 4PJEB 3VXUE 5GIRB 4YDKH 1LP9E 4NZDA 4WW2F 4P3CL 5HJ3B 3UBXB 1KJ3L 4TOYL 5HHNA 4XP4H 2FX9H 5EIIB 1DANT 3BI9X 2MQ0A 4G6AD 1A9EB 3OAYK 4LVHB 2D31A 2QQLL 3I6KA 4GXVL 3V5HA 1DVFA 2PCPB 5HI5C 3PHSA 5HDOA 1CG9B 4X6DA 2AJYL 1BZ7A 1I9JL 5DSCB 1U8LB 3LKRB 1I7UA 4OIIH 1G9NC 3VFRA 2EYTB 3QUXD 4ZUWA 4GG6E 4TPRH 3P9MB 3S88L 4ISVA 1FDLL 2BHUA 4F80A 3P4NB 3H9SB 1I8IA 3QEHB 2EDXA 2ZOLA 1JZ4A 3BMVA 1FE8L 4FQCL 3VJ6B 1MI5D 2VR5A 4YC2C 3RPKA 3U30C 5EO0B 4GMSH 1OSZA 3VH8A 3FOMA 4NZTL 1VFUA 1GC1H 1X4YA 5BVJB 1Z5LA 1CU4L 2AEQH 4W70A 1M7DA 4U1MB 3UDWA 3GSUB 3RVXD 4WHTB 3T2PA 4H88H 4G6KH 5BMFL 2J8HA 1ZWIA 1KCUH 1MWAH 1IJ9A 2AKRA 5DD1L 3DUSB 4PJ5E 5CZXC 3IU4L 1WCQA 1XCQB 4FS0A 1MIEH 3C2AH 3WIHH 3LAFA 1G6RA 4I0PA 4KV5F 5HGBB 4C56E 1F4YH 3SDDD 1F4XH 4LSUH 1QRNA 1VEOA 3QUYD 4LEXH 3V5KA 2PETA 4M43H 2CLRA 4O2CB 2XICA 4LCYB 3RWJA 1KCKA 4PRHE 3QUZA 3OKYA 5IBLD 2VB5A 1U8MA 1WZLA 5JORA 1HKLL 4HMEA 1K8IA 1DDHB 4D8PB 4ZO7A 1XGQA 3LN9A 3NZ8B 3L9RB 1LD9A 1BVLA 1Y6NR 3QULA 5DDHB 5ID1A 3JV5A 5EIVA 2P5ED 1Z0NA 1VCAA 3MUZ1 5EBWB 1CGWA 1IKFL 3BP4A 2VZUA 3CDGA 4UDUB 3EO9L 3HB3C 1PLGL 3D39E 1BBDL 1P4IH 3TBWB 3GHBH 2HT2C 4JFEA 2UUDH 4KDVA 3RKPA 1TCMA 4YIQB 1PD6A 1NFDB 5HHOD 4U6YA 4WI2A 3KGRA 3MGTA 4OZGA 2Z93B 1W0YT 4D9LH 5HHQA 4N9GB 1ZTXH 5C08A 3SQOH 3QXAB 4HIEB 3X14B 2VLJB 3BT2H 5DEFA 5LAXA 1ZA6B 1G9MC 3C60B 5ICXB 5DVMA 1XR9B 4L8BB 1DBBH 1MFDH 1CF8L 2X4TA 3MJ7B 3ROOB 1QA9A 4HUXB 1MNUH 3T65A 1E4WH 3RDTA 3MRBB 4HUNB 1EFXB 5L9DL 1ZT7A 3RWHA 4ZAKC 3SJVA 3GJFK 3SGEH 1VEPA 2J3SA 4P46B 2P1YA 1D9KA 1NLBH 4M7LH 3LV3A 1MJJA 4WY7H 2H2PD 1RZ7H 4PLJC 1FO0A 3MV11 4I5BB 3T1FB 5LGKA 5CBEA 4IIQA 3REVB 3LQZA 2YPKA 3RRQA 4J1UB 2O61B 3QH3B 2V5TA 3HA0A 1KPVB 4OB5L 1QSFD 5E8OB 4APQD 5C07B 1YJDL 4PB0H 1H5BC 3CFJA 3CSPA 3HFMH 4KPHH 4Z7QE 4LPUA 5BV7L 4XNXH 1U92A 5CSGA 5ESVB 4YHYC 4L8DA 4JO3L 3MLZH 3OF6D 4LEOA 4EI5B 1PYWB 4ELKA 1A4KB 1MCOH 5K9OA 4NP4H 1IGTA 3EYUH 4HBCH 5JO5B 4WFFE 4DCQB 3MLYL 3FT3B 3MRLB 1V7NL 4N0RA 1H3GA 5IW3A 1QPPA 3OHXA 2O5ZL 5B3JF 4P2QE 1YEJH 4YE4L 3SDAD 4L4VA 5LGHH 4RISL 5DYOA 3BKYL 3C09C 1N5YH 1UEMA 4XNUH 3WNMA 3KPSE 2H1PL 2NY0B 3DLQR 1LP9F 1WWCA 1BFVL 1IC5H 3DROB 4H8WH 2BMKB 3STBA 2AXJA 4ELME 4RBPH 3LKNA 1TCRB 3QG7H 3FQRA 3ARDA 5FAAA 3P77B 3MMEA 3LEYL 5EBGA 3W2DH 1ZHLB 3U7YL 1O5DT 1JTPA 3BE1L 2P44B 1Q9OB 4AK1A 3FB8A 3CGTA 4HPOL 4FABL 1T7YA 1U8JB 4UV4H 4WFHE 3UPRB 4I0CC 1P69B 3I50L 5TFSL 4JHWH 4L4TE 2J88L 5DUMH 3LKOB 5ACLA 1KXTB 1NANI 1NMBL 4NWTL 3ZE2E 1K3ZA 43C9B 3UZEA 1JJUA 2DLTA 4YJZL 1QFPA 3FT4B 4OZIA 4MGXA 1QKZH 5ESAB 2PYEE 3QWOB 3OKKB 1FSKB 1W72H 4WU5A 3TFKD 2AJSL 1ZS8A 1BECA 1NCWH 5D96C 3M17A 2B1AH 1KBGL 3NAAH 1FAKT 4N8VG 2LVCA 1KGCE 4UOW0 3P73A 5JLZB 4TVPL 4EDXA 2AABH 5INDA 1EHXA 2GTZA 1VFOA 3VXMB 2IAND 1RZ8B 1T89C 3PV7A 2CR3A 3QIBD 1JYNA 1XGRA 4CADA 4YPGB 5C2BL 4LMQE 3BPLB 5C0NC 1NBQA 5F7HA 3PQYE 2ZUXA 4XAWL 4B5EA 3S36L 4X7EC 1ZT1A 3MJGX 3BQUA 3VFGL 2DMBA 4V2CB 3TZVD 3HC4H 3SGKA 4X99A 1EJOL 1JPTL 2H32H 4PY8J 4HDIB 4P23A 3EOBA 3KYNA 3TA3D 4XPTH 4YR6B 3FMGH 3WKNA 2BNUB 5I17B 3RWEB 5IT2L 3LZFH 3RWDB 2CO6B 4WFEE 3QXTA 3MV9A 4CN4A 4PRBB 4GW5A 5I1HL 5INCB 4PJHA 2F8VA 4OD1H 1ZSDA 5CILH 5E99L 5IW6B 1JHKH 5HI3D 3PNWB 2YA1A 5CD3A 3MBXL 2CMRH 2EDBA 3PWPD 3EZ8A 2VKXA 5C92A 2GCYA 4X8JB 4NRXB 2NZ9C 3I6LE 3WNOA 2VXQL 3TVMA 4ZYKA 2A6DA 4HS8H 5DGRA 3NCBB 2NR6D 2YXFA 4TSBL 3OTTA 3RL1A 1G7PB 2HTKD 5ETUB 3RKDC 1CD1A 4Y1AA 3UTQA 4BZ1L 5JHDD 1T7XA 4LP5A 3OKOA 3W0WE 1DEEA 2DICA 2R1WB 4R7DA 1IVLA 4PD4J 5BRZD 1GGBH 1EJ6A 1ZHNB 3MXVL 3BD4A 1MCHA 1RUMH 2HTLC 4WI6A 5KAQF 3VW3H 4K7FB 4KQ4H 1QTYT 5D1QD 3GK8L 1HDMB 4HFWB 4YK4C 2X1QA 5I73C 4WTXA 1Z9LA 3P11L 1LHZA 1OARL 2APWA 2YN5A 3G04B 4KROB 4QGYA 2DI9A 3B6SB 2EDTA 1KIUA 3QRGL 4PJEA 4LNRA 4YDIL 3JUYA 5GIRA 5CJQH 3UTSA 4TSCH 5T3XE 1P4LB 1S7UA 1XIWA 3OKLA 3L1OL 1SMOA 1MCEA 1PG7X 5KJRL 4PGJA 5I30H 5T1LD 3V2AR 3O9WD 4MJID 1JNHA 1KULA 4WW2A 2AJXL 4PJ9C 2Y25A 4HGWB 4E0RB 3U4BH 3ZKXC 4Z7QF 3DGCR 5ADPL 1A3QA 2Q86A 2XZAL 4XB8A 2IAMC 1U8LA 3RUGE 3FQXA 4JM2A 5ERWB 1CXEA 3X3FH 3CMOL 3TIEB 4H5SB 3AMKA 1OB1A 2NY4B 4X83A 3P4NA 3OJDB 4X7TB 4NDMA 5A40E 1FL3A 2OLDA 4ZUVA 2I9TA 3KNBA 3BP6A 3GSWA 4BSWB 3O41B 3U1SH 5HYJD 3PWJB 5D7LB 5EO0A 5DRZA 3V6ZB 3V6OA 3WNPA 3G5VA 2VSCA 4RAUA 1B0GA 4OLXL 2A6IA 4XGZB 4Y5VC 5KSAC 1TZHA 4MJ5B 2D7PA 3RVUD 5AWNL 1V05A 3QO1B 3GSQB 4ZOBA 5I1LA 2XZCH 4OZFA 3HPJA 4XMPL 4DEPB 2FR4B 2AJUH 2A9ML 2EYRB 1G7LB 5KSUA 3PP3K 2V9RA 4PRPE 2DQGL 5HYQA 4WO4B 1ND0B 5HGHA 3WNLA 3BN9C 1YEGL 1UWEH 3IJSA 1XCQA 2HFEB 3C6LB 4YHLL 4JN1L 3TGXA 4F3FB 1CS6A 2PTVA 5HGBA 3W5MA 1BM3H 1ZK9A 2ICWA 1OP5H 1Y6KR 1BWWA 4X7CC 5CSZB 2FECI 1BVKA 4HKXA 3KPRA 2B20A 4HXAH 2ATPB 4Z7WB 2X09A 1KEGL 2Z31B 5E1AB 3V6BR 1GPOL 3TNNA 3ZE2F 3EFFB 4K8RD 5DUPL 2HG5B 2R8SH 3V4UH 1EEZB 4UIMA 3GMMA 2VKWA 2VZOA 2JJSA 3MV7A 3UROR 2W92A 3O8XD 2BNQA 5JXAH 3FB5A 5D7JC 3BRFA 3QIWC 5LVEA 3OXRA 2J6EH 1OTUC 1DQQB 3NA9H 4P2YA 2CLVB 1MFBL 3C8KA 3IAPA 1KXQE 2CXKA 1ITBB 3QFJD 1UWXK 5E2VL 4UTAL 3ULUH 5TE6L 4RFEB 3NMEA 2CDEA 1J0JA 2Q76B 3HE7D 5LCVH 5L7XH 3GBMH 3JWDC 4AG4H 4ZUUA 1MCWM 4LSPL 1G7QB 4M1GL 3LKSB 2CR6A 4GXUM 3PXJA 2PN5A 4RAHA 4N0UA 3UO1H 3SKOA 3BO8B 1ACYH 1C16B 3O2DH 4HIEA 3X14A 5IEHA 2VLJA 5ITBH 3WO3B 1I7RA 4L8BA 3B9EA 3O2WH 3IGAB 2YHGA 3QWRA 1KN2H 2PO6D 3CFEA 5AUMA 1EHLH 2ITDA 3ZLQC 1MHCA 2AXHA 3L7EA 3SKUD 3LD8B 2VUYA 1VFMA 3MNVB 2N7AA 3D3VA 4P46A 1Q9LA 3I02A 4M8QA 2P24A 2FIKB 3HCVA 1A1OB 2YPLB 2A6KB 3T1FA 3WS6A 1RULL 1CK0L 3MROB 5HDQL 3V4VH 5IOPB 1IGML 5FYJU 3TM6A 1I9EA 5DO2C 1KIPB 2XY1A 1OM3H 1T0PB 4XXCC 5L0QB 4QOKD 4CW1A 1JGEB 5EZIL 4QRQA 2OZ4H 4JFYB 2JTDA 5EU6A 4EXKA 2ZPKH 1X44A 1MAML 1U9KA 3IFNH 5ISZE 2HRLA 4P9MH 3K8KA 1X7QB 3WD5H 5IFJB 5KSBE 4CMMA 1F3DH 3LQAC 3MLSL 5HVHC 3UYRH 4K7PX 1EAJA 4DCQA 1U8IB 4LLDA 5E56A 4G9FB 4GAYB 5HY9A 4P4RA 2HWZH 3HZYA 4NQCE 2YSSA 3VXQA 4K8RH 1EK3A 3GIVB 2VL5A 1EFQA 1QNZH 4GKOA 5J1AB 3IXAA 3K2UL 3HMXL 4Y4KC 3VE0A 1H15B 3WLBB 2F5AL 4F7MB 3TO2A 1MF2L 3DXAD 4YAQB 1AQKH 3QDMB 3T0DA 4BFBD 4ODUB 1XF1A 1IT9L 1D5ZA 2BOCA 2NCMA 5BV7B 1WEJL 3TEUA 3QUKA 4DGIL 4JFXB 4NO3A 5HHXL 4WW1A 3QIUD 3VXUA 3BP7A 1TCRA 1NCBH 5CHNB 1LP9A 5F7FA 4UT7H 4ONGL 1A6TA 3UC0H 3H9HB 3D2UB 1FYTB 2GKIA 4HKZB 1CFNB 2BOBB 1OGTA 1P7QA 2GUOB 4S10A 4OFYA 1PGRB 4HZLA 5FM4A 1YYLH 2PXYB 5I18L 3TCXA 1EUTA 5DJAA 3V7MA 1OGAD 2EE6A 4PJXE 1PQZB 1ITCA 4HIXH 3GSXB 5KS9E 3KLAA 3V52L 4CL7A 5CD5C 2W65B 4OM0H 1U95B 2OL3A 4ODSL 4GG6A 2R0ZL 1BVZA 3JZ7A 3OKKA 1JVKA 4FTVE 4QF1A 2NY7H 2AJVH 1DBML 4F2MB 3RU8H 1HHJA 2YD2A 1DQTA 4KK9D 4M3KB 3LPFA 4LHJB 2GT9A 3IDXH 5I1JL 3EHBD 3O81A 4XVTH 4R7NA 1HQ4B 3MC0A 3UPAA 3NCEB 35C8H 5M95B 4MJ2A 2OTUB 3KHOA 3GBNL 1OWRM 4N68A 2AAVA 5GRVK 1JWSA 2XOTA 4YPGA 4X98B 3OXSB 1CXKA 1LO5B 4UQ2B 4ZXBD 4NQDD 4OQTH 4O2EB 3DURB 4PJ5A 1RHHB 4KHXH 5D5ME 2AVGA 2BCKB 2YMXL 2Y4SA 4A6YA 1GIGL 3PJSA 4C56A 1KB9K 5HVGB 3LS5H 4AENA 4EVNB 5ALCL 4KTEH 1B0RB 1VSCA 1WIOA 4UDTB 3R4DA 4FXGB 1AD0B 5IQ9B 2BNUA 2R4SH 2ERJC 2GJJA 5D1XD 5JW3H 2WM0A 4MYWB 3TN0C 1D5BB 4IEFB 2X4RA 4B0MM 5EIQA 1MRCL 3V7AG 1RIVL 5INCA 2X9XA 2R29L 4WGWB 1IGJA 4IRSD 4KVNL 4PB9L 5DS8A 4LVOC 1AGDB 2VDOH 4MQXC 2JF1A 5J6GA 4X8JA 4NQSB 4K94C 4Z7UB 2NNAB 3WHE0 1VHPA 4KMQA 4PR5B 3D39A 5E8DH 3ARFC 3FT2B 1WK0A 1KLUB 1J88A 4K3EL 4XMLH 3EUUA 4X6CE 3V4PH 5I2IA 2XXCB 1RK0B 4FN0A 1A6ZA 2YD8A 5KBNC 1SY6L 1LO3H 1CICC 3SDCD 4XNYL 1KEML 1ZLSH 2NX5E 3LSOB 2QBWA 1M05B 3CVIL 2GI7A 1IEAB 1DLHB 3PUCA 5H2BA 4P9HL 2DOCA 2MJWA 3VFPB 5I19H 2YK1H 3AREB 5EORL 4NNYB 1MHPL 5BVPH 2V2XA 1BJ1J 3CX2A 5TE7H 3MLUL 3L3DA 1LE5A 43CAA 1A02N 2AS5M 5F1KC 4HFWA 4M1DH 1NDMA 3K4AA 1Z3GL 5J9PA 1YA5A 4MA8L 4U1LB 1KELL 3LMJH 5CS7A 4TTDD 1KTKE 5EU3A 5TDNB 2D4DA 3TT3H 4P99A 5I73B 1YNKH 1JUFA 4W4OC 3BGAA 1OL0A 4KGLA 1KG0B 5ESQA 3RTQB 4XP4L 5A3IC 4M61B 4FZEH 4OFKA 4JPVH 2G60H 1WICA 4D0CA 3IB4A 3N85L 3ABZA 1U58A 3T8XA 4D9QD 1BBJB 3PV6B 1HH6B 1RJYB 1Y6MR 1F8TL 4RGMC 2YOCA 2W0KA 3W5NA 2CKNA 4NO0B 1YEDB 5FO8B 4MZ3A 4UINH 4ODWB 1MCPH 1B4JH 1FLRL 4KK8D 5GRZA 4HT1L 1Z9MA 4ZQKB 1MQ8A 4CVXB 2W9DH 5KSBF 1DL7H 3RHWF 1AD9A 5C0RL 1XR8A 4H5SA 5EZLA 3STLB 1GRWA 1P4BH 3MODH 4X7TA 4GMSL 2W07A 4DUWA 4WTWA 1KJ2L 4BSWA 1GC1L 1UH3A 1H3XA 4JFFE 4JY5L 5D7LA 2AEQL 4WDIA 4AJ0A 4HWZA 1OSPL 1IM3B 4NNPH 4G6KL 4UNUA 1J12A 1IMHC 3KVQA 4G7YH 2NXZC 3EZJB 1MPAL 3QO1A 5EBLA 1BQLH 4FQ2L 4P2QA 3NCJH 4IOSD 2FR4A 4L4JA 4Y2DB 5D2LB 3MA9H 3ZKSD 3IFLH 3IRZA 2Q8BH 2FZ3B 4XC1L 4Z95L 3UAJD 1GJIA 4PTTB 1JCKA 1M6OA 4PJ8B 1HWGB 3KPSA 3RNQB 1R5VB 3R1GH 4K07A 5DD6A 4BK5A 2FH8A 5GHWH 1KTRL 4X4YA 4U3CA 1M7IB 4ELMA 2VN4A 1T04A 1NCCL 2CKBH 4MA7L 4EDWH 4ZNEE 4PUBL 4JY4B 1S8DA 3EBAA 3KXFB 1UZ6F 1MVUB 1BEYL 4XHJD 4R3SA 5A2FA 1JHTB 5FGCE 3RNKB 4YFLI 4QNPE 4OCSL 3VRJB 3EFFA 1TPXC 2OYPA 4L4TA 1I3RA 2HT3D 4IDJL 2VO5A 5KOVC 4L9LB 3QDGB 1G7IA 1YUHB 1U41A 5GGRB 2X4PB 1EVUA 1VADA 2W59A 1KT2B 3KPMB 4G8GB 3KPLB 1INDL 2PYEA 5IIEA 3B5TA 1N3NB 4WHYH 3RWIB 1DQQA 1JK8B 5E2JA 5ID0B 4RMVA 4XBGB 2G5BA 4HKJB 2CPCA 1A3LL 1SYVA 5FHAH 4MA1C 1R0AL 1WJ3A 1WZ1L 1UFUA 1B88A 4OQ1A 5EFIB 5F9OL 2Q76A 1WFUA 4KXZI 5I16A 5F3HA 4I77H 1K8DB 4MJ6B 3V8OA 4M5ZH 4D9LL 3DX7B 2C7UA 4TNVF 4OFPA 3H8NA 1ZTXL 4U4BA 5BXFA 5B4MC 3S97C 1BFOA 1ZHBB 3LQMA 1G6RH 1VENA 5HVFB 4HJJH 3GIZL 3X11A 4M4RA 1H3WM 5C0BE 4AMKL 3T0VA 4DOHE 4EIZC 5D5MF 5E70A 1CLYH 4XNQB 1AGEA 1I1YA 3GMPB 3H7LA 3PQYA 5EA0L 1L0QA 1INEH 2D03L 4NQEE 1NCUA 5JPNB 4PP1D 5H37H 3ARSA 1C5DA 3DX9B 4HIIB 1EHNA 3RX5A 3WXWH 2FIRT 4F9LC 3QDJE 1A6AA 1N26A 1NLBL 3LCYA 4O51A 4QXWA 4G6AC 4V2BA 4WHYG 1RZ7L 1AO7E 3B2VL 3MV8D 3ULVD 4A2MA 1S9KC 3QUMB 4YXKH 5KN5A 32C2B 4LCWD 1FYHB 3OKDB 2QLVB 2GJZA 2YPLA 4ZAKA 2DYPD 1A14H 3MROA 4WHCA 2JJTC 4HIHB 1TMCB 5I15H 2Y7QB 1MRDH 3QUXC 1EV2E 4KMTH 4OZ4B 3MRFA 1RUPH 1RHFA 2J4WL 2HFFB 4Y19E 3TESA 3PHOB 1EERB 2ZUWA 4DZBB 3FHQA 3VMOA 4M62H 4HC1A 4PB0L 4P0DA 2IFFH 4KPHL 2IPUG 4JFYA 1MFAH 1UM4L 5F9JB 5MEQB 5GISH 5E9DD 1A7OH 4BJLA 4XH2A 1A2YB 1I9IL 1U2HA 5HYIA 4LSSH 3PWNB 4U31A 2YEZB 1NGZB 5H37G 4PGZA 5T1DL 1AGCA 1U36A 2P5WB 3C9NA 5KVEL 1H5BA 4ZD3L 5FYLD 1AXTH 2F58H 3W0WA 4XCNB 3HI6H 3NIGF 3CH8A 3V5DB 2MMXA 1YEJL 2EDNA 2EKSB 3LH2L 1IGIH 3RIAF 2C9AA 4QWWD 4X5LA 1IGYA 1S7QA 1KN4L 4AT6B 5MEOA 5ITFB 2OR7A 5EPMB 3MUY1 3CVHA 3SDDC 1L6ZA 3QUYC 1FNEB 1CGYA 1IC5L 2JIXA 4XNMA 4LCUA 1GOGA 4G8FA 2VAAB 4JB9H 4DGVH 5EU4B 4DQOH 1KV3A 1DANU 4GRWF 4ZFZA 3GZKA 3AROA 1F00I 1JF1A 4FFVC 3W2DL 4LCCC 4BKLB 2ZUUA 4M7KH 5DK2B 4GRWB 1AHWC 4P5TD 4F7CB 3QI9B 3ARGD 3AS2A 1KCRL 1A7PH 4M7LT 4GRMA 4PRIB 3RY6C 1OAUH 2AK4E 4U1KB 5MHSE 3GHEH 4H8WC 2PXYA 5BW7C 2YUXA 4MNHA 5F89B 4WU7B 3W9EB 4UAOB 5I1AA 3BEWB 1QKZL 1YMHB 4J6RL 3RUGA 3KPOA 4UIKL 5JW4M 1U95A 2GITA 4AEIH 3L5XH 2VE6B 3NAAL 3EOYG 4X0KB 4PLKC 1C08B 1PKOA 4HD9A 2IMMA 5L88L 2NYYD 2LAAA 5FUCC 5D7KD 5FA3B 3SDXE 4LKXB 1NL0L 5JIHA 4NN7B 2X4SB 1IQDB 1ORQB 5LG1A 3BIBX 3MGOB 2NTFA 3ULVH 1HQ4A 3WYRA 5E24E 4R4BB 2ZSVA 3PABB 2APFA 3MZGB 1FORH 3GI8H 5EZJB 4QRTB 4ZFOA 2OSLB 3QHZL 4ZPTA 3K2MC 2XPGB 2FJFA 2DQHH 1D6VH 4N8CH 4HWBA 3OXSA 3CH1A 2IC2A 1YMMD 4PRPA 1T89A 3TYFA 3HC0B 4MB5A 4QHUA 3QDAA 3U9PH 3W39B 3MRDA 4MAYB 1NCAL 5FB8A 1J8HD 1FNGB 3UTTB 3MOAH 3L95A 3WJJA 3PDOA 5DJ8B 2BCKA 2H2PC 4K55A 1C5CH 3TO4D 5L2KD 3IDJA 1ZLWH 1S7SA 4QNPF 4LKCA 1X6NA 5GGUB 2APXA 1QLRB 3LZFL 4YGAB 5KW9L 4HCRA 4IHOB 1VACA 1FZMB 2ZUQB 2DWDB 5IQ9A 2EDWA 1IBGH 3SO5A 5FYLH 4EKXA 3I75A 5DHVB 4DGYL 4FNLL 4PY7A 2E6PA 4APQC 5EOQL 4JKPH 2A1WL 2PTTB 1Q9KA 2ZKHH 2HP4A 5T1KB 1WLHA 1P1ZA 3PG2A 5GJSH 4NZUH 1P6FA 5H8DA 1BAFH 4P57B 3JV4A 3L6FB 3O6LH 3QEQD 1AGDA 3FHAA 3KPNA 5JR1L 2IPKB 1FZKA 3DUHA 4G7VL 4HPYL 1I3UA 4NQSA 5H94B 2OJEA 4HQQH 2E8ZA 2R0WL 1MI5E 4JZNB 3FFDA 1U2CA 3KDMA 3VGHA 3AC0A 2BSSB 1BF2A 1IC4L 4M48L 4QXGL 1XF2A 3LSOA 3MZTA 3ZE1E 3SDAC 1M05A 3RPIB 2NY2B 2K9UA 3MRQA 5B39B 3VFPA 4QHLB 3S3PA 5DLMH 5DUBB 2AW2A 1WIPA 4XRCB 1DUZB 1VKXA 2VDRH 2GFBB 3BWAB 1BQHB 1DE4A 4LGPB 5IVXB 4BELD 4WWKD 4HJGB 1G0DA 2HFGH 4FOMA 3MCKA 1NC2D 1C7SA 4U1LA 4EN3D 3RZCB 1S9VB 4QLRA 4TULH 3MFFB 4TSCL 2DQCL 4JPWL 4KMLB 5CKGA 3CXDL 5MEND 1N64H 2ADGA 3V9FA 3HUJB 1RMFH 4GKNA 4UMGA 2IEPA 3MJ9L 1CE1H 1WWBX 3RVWD 4QCIA 5KVFH 4JFZL 4AZ8A 2VAJA 3TFKC 4M7ZC 1HHGB 5I0ZA 4KJYB 3KYOB 1E28A 4ODWA 5DVNA 3X3FL 4V1DB 4ZQKA 3WO4C 4CVXA 5CP7B 4PJ9A 1YY9D 3B83A 2P5EE 5D7IB 1TTFA 2EE9A 1CFQB 4NRYA 2C4FT 5ISZA 4KUCF 4WNQB 2IAMA 5KSBA 4KVCH 3B9KD 4ZTOH 2OI9C 3VFUA 2F54D 2HVKB 4IMLA 1URLA 5ICZB 1N0XH 1PKQE 2I5YH 3GSVB 3QIBC 4OGYH 1S7VB 4YXLH 2GAZB 2DQEH 1WBYB 3ZSTA 5HHOE 1YQVL 3G9AB 2D0GA 2XZCL 4NQCA 2AJUL 5EN2A 2X6MA 1HXMA 1QSEE 1I1AD 4AH2B 4TQEH 4U1HB 2EE3A 4Y5VA 2OP4H 5KSAA 6FABL 4NWUL 4Y2DA 3RBSA 5FO9B 4JJ5B 2JE8A 1EO7A 2WBJD 4NIKB 1Y0LA 4AL8H 1UVQA 2JKXA 3HI1A 3RNQA 4DVRL 3VXPA 3TA3C 4R2GB 1I9RL 2WIIA 1M7IA 2ENSA 4PIRF 5E8EA 1OF2A 3MREB 2CLZB 5DEGB 4HXAL 3VWKB 3WDHA 1KJ2B 4XP5H 3NACL 2WWKT 3KXFA 1WWAX 3BXNB 2BNRB 4YWGH 4ORGA 2XRAL 5I66B 3V4UL 2DD8H 4GRLB 1MWAB 3PL6B 3U0PB 2DWEB 2V5SA 2H6PB 4PJXA 1FG2B 5JXAL 2I07A 5KS9A 5A16B 4J8RB 3HRZA 3TBYA 3VXSB 1YUHA 3L3KA 3WJLC 3DWTA 2J6EL 5FECA 4H20L 4GBXD 4HG4J 1QPXA 1QSFE 2X4PA 4NPYA 4QRRB 2NR6C 2XTJB 5BZDA 3EOAA 3SDXF 4XXDB 4NHCL 4FTVA 2NZIA 3ULUL 1TFHA 4U3XA 3FO1B 3PIQB 4QT5A 4U2ZA 2OXGA 5L7XL 5MERB 4FFYL 4PGBB 1BX2A 3QIWA 1K2DB 4NGHH 4J3TA 4IRJB 1QQDB 4Z7NF 5TQ2H 2BVUA 1K8DA 2UWEF 3DX7A 3D85B 1XGTA 4KRLB 5D1QC 3O2DL 3O3DA 3WN5B 5FF6B 1O7VA 1UB6B 3TP4A 2UWEB 4QRSA 2DQIH 4M9PA 3CD4A 5DJ0A 2E7MA 3KWWB 5AEAA 2X89D 4WCYH 4BYHA 2DKMA 3S98A 4FQJH 4LMQI 4Q6IB 3QNYB 1IGFH 1NGQL 5D5MA 4XCCH 4W6WB 4D0BB 4L8SC 1GGIL 2RCSH 1KLGA 4U1JA 4BQCA 4UUJB 5ABDE 3Q5TA 3O9WC 1NAMA 3O4OB 1U3HD 3TWCH 2QHRH 3A6CL 5C0DA 4HV8B 3WHXB 3TBSB 4R90H 3VFSA 5FDWB 4JRYD 3QUMA 3G5XB 3A6BL 3V4VL 4HK0B 4ETQA 3QP3A 3MRPB 1SHMA 2YRLA 3U82B 4OZFG 3O6KH 4HWNA 1BD2D 2UV3A 1TTUA 3ARQA 4ERSH 3GGWB 4HIHA 1Q0XH 2VSDA 1QBLL 2OZ4L 2AQ2A 3TCLB 2NXYB 3BW9B 1DBKL 2HFFA 2Y9RT 2DAVA 3PHOA 4DZBA 2C3XA 1INQA 2ZPKL 3QUXB 1PX4A 2BDNL 1A3RL 3IDNB 2FO4A 4KI1A 4RIRB 4RX4D 2EECA 4FA8A 1CFTA 4XXCA 4Y16D 4YX2H 4Z77B 5K9QI 3B8SA 3OR6A 5J11B 1UB5A 5H35B 1HH9A 5I76B 3RVUC 3N1QC 3GI9H 3ZE1F 4GG8B 3OGCA 1BMGA 2MFNA 3AY4C 4X6CA 1NEZB 1G9EA 4NSKB 1IL1B 2HWZL 4G9DB 2NX5A 3EW3B 3B3IB 2CK0H 2XG4A 4KRMB 4O2FA 2IANE 3N9GL 5L6YL 1IAII 1QNZL 1R3JB 2Z35B 4XWGL 4M02A 3ZKMC 5D1ZB 4Z0BL 4AT6A 1HHKB 5E94B 5EWIL 4BA8A 4RAVA 4KI5F 1CLCA 1NMCC 3HPLB 3FO9B 5IESL 1HHHB 1FFOB 3OBAA 2MTPA 2ADIA 5IK3B 4U49A 2HKFH 5KSVB 3AXLA 2EYSB 3QQNA 3SQBA 2IQ9L 1NCBL 4Y4KA 3MBED 4DAGH 5HYSG 1AJ7H 1PDKA 3DRTA 4E41B 5IG7B 1KIQA 4MDIB 5FUZH 4EBQH 4U1NA 3T0ED 4U6HA 3BDXA 1BZ9B 1NGWB 3VXOA 2F53D 3G6JF 3OAUH 3O8XC 3Q3GB 3TT1L 2VLLB 1FP5A 5F9AC 4PRHD 3ARWA 1MCNA 4WU7A 2WBKA 4OM0L 3G6JB 3H6JA 4QY8A 3OZ9H 2QSQA 4N8VB 2VXTL 1ED3B 1F11B 4ZG1A 1S7RA 1F3RB 3BZFB 4GS7C 4RMTA 2VLRD 3GRWH 3SCMD 2P8PB 1KTLB 3MCLL 1KLFA 2NY7L 5E8NA 4J2XA 1QRKA 3HE7C 3PWPE 5KZCD 3L3OB 2JCCB 5E08H 3BDYL 3IDXL 3FCTB 2P8LA 5FA3A 2YUZA 4PJIE 4JFFA 1UYWL 5I0DA 1IQDA 5MI0C 5JHDE 1GZQA 4R96B 3IDMB 2BZDA 4U1SA 1R3IH 4KKCD 1KENH 2A6JA 3IVKB 3ME0A 1YEHH 3STZA 2B5IC 4ZUTA 1S5IH 1NGPL 1CLZH 2PO6C 4MD4A 3V6FA 1SVZA 5M7QA 4KKLD 2OSLA 3I9GL 3EYSH 3LVEA 3VXRB 4GSDL 2H26A 1HNGA 4KHXL 1Q9WA 4OSUL 2MNUA 1CFVH 4PJ7B 3DVGA 3E6FA 3T2QA 3E1F1 2BY1A 3MOBH 1GL4B 4JQVC 4L3EB 1HQRB 1UA6H 4I48A 4JO4H 3ES6A 2ED9A 2BXYA 1ADQH 1X5KA 3CLEL 3KYAA 4HULB 2R4SL 4WUUE 3S35H 4IHOA 5JW3L 3H42H 4NO5B 5I1GL 4EI6B 1DBJH 1SJEA 1EGJH 1ZOXA 1MHHB 4MJIE 1W0VA 1QEWB 25C8H 3GSNH 2BVPA 3GSRB 4PJFE 4TNWF 5IGXL 5C0AD 1ETZB 1JZ3A 1FN4A 3TN0A 2XT1B 4XB7A 3FRUB 5GGSB 5I6XB 5FM8A 5DQDH 3BPCB 3DSNA 3Q1SH 1FVEA 1JPGB 3MLXL 5F96L 4MB4A 3QZWG 5LJYH 5I1CL 1MFEH 2HLFD 3NCCB 1LE9B 4U7SA 2WSKA 4MQSB 1LO3L 2F5BH 2D7QA 5HYJE 1UXSB 3NPZB 2VWEC 1XZ0A 4XT1C 2BSSA 5TF0A 3ARFA 3CFIC 3L3IA 4UNTA 5IVNA 3U48A 1F02I 2YK1L 1QVOA 1RZJC 4A6YH 1YQ2A 5C7XL 2D7TH 5C0BA 5EO1A 4MA3B 4CDHA 1AR2A 2XN9D 5TE7L 4HH9B 4BSVB 1HOCB 5ALBH 1CICA 5IJVB 4FP8L 2CDFB 4UBDD 4XPGH 3I3DA 5I8EB 3S34L 1MEXL 5K9KA 4NQEA 3QIUC 2IGFH 4JAMB 4LNVA 3C8DA 5DT1H 5CP3A 3LMJL 5K59E 4HIJA 1AKJD 1KTDA 3C5JA 2BVQB 4C58B 1M71B 2R2HA 3P4LA 1ZT4B 3QDJA 4UQ3B 1OHQA 2W60A 3VCLB 1JFQH 1AO7A 4I18C 3S4SG 2G60L 1J10A 4QHNB 4Z9KB 1CFBA 2CRIA 3PGDA 5E6ID 1T0MA 3IYLW 1MAJA 1OP3H 5F7KC 3LN4A 3FAWA 4W4OA 3RHWK 4UINL 4OM1H 5GJTH 1MCPL 1B4JL 3VFWB 1T1YB 1HHGA 4Y19A 4TTGA 4U0RC 3QT2A 4JJHA 3QNXB 3AMLA 4NM8L 2RB8A 1WVZA 4UTBL 3PWLA 4Y4HB 4KK9C 2XWBB 1RK1A 3CC5B 3F7VA 3MO1B 5CLTA 3KJ4C 3QAZB 2R9HC 1QR1A 2E9IA 3CLFH 2NY6D 3EHBC 2VZTA 3QXDB 1GZPB 4UT9H 1I8LC 4HKBA 4CBPA 3QFJE 3MACL 1RJZA 3F7QA 1SBSL 5ANME 5I8OL 2Y23A 2AI0H 3CPLB 5FUOH 1DN2A 2HVKA 4K7PL 4MCZB 4NNPL 2W38A 3FQUA 2OQJA 3GSVA 5KOMC 1MLBA 5B3NA 3CUPB 2H3NB 5FO7B 3NCJL 4M03A 4ZXBC 4HBQA 3KG5A 1KGCD 2C5DC 3WFHB 5C09B 1H3UA 4AEHH 5C6WH 1P84K 4G6FB 4LLAA 4U1HA 2W9EH 1WQVT 2GJ6B 2BERA 3VRIA 5FO9A 1LEGB 2OK0H 5GHWL 2ADJA 3TH2T 1LDPL 2HJLB 1UZ8A 4H26B 5HD8D 4QKXB 1KJVA 2DLGA 4KK5D 2RIKA 3TZVB 3QBTB 5D1XC 3V7AE 4X5WB 1T7WA 1YY8B 2R56H 2VC2L 5CCKH 3VWKA 3FONB 4Y5XB 4WHDA 3BXNA 2BNRA 3RWCB 3BPNB 3HE6B 3P40A 3ILPA 4Q7DA 5LXGH 1RZKL 5FCUH 3W81A 2QL1A 1DR9A 2AK4A 2JB6A 1NGYB 4X5XA 1S9XA 1MWAA 2FHBA 1H3PH 3HAEH 4OLZL 4OF6A 3EYFB 3SPVB 3Q2CA 4FZ8H 5A16A 5KAQG 4XNZB 3OL2A 2QKIA 4QRPD 5DC0A 2CIKA 3WIHA 2W0FB 4PJIF 4HWEH 4LARH 4PLJD 4F58H 2QADD 1WUNT 3SDCC 4TNVK 1R5WB 4I77L 3DO7B 4OAWA 4MMZC 4ZSOB 3SDXA 3IU3A 5ADOH 5JW5B 5F8QC 3QQ9D 2HJKB 3QEGL 3MXWL 4I3SH 2ED8A 1LO4H 2X4QB 2VISB 3I6LD 1G6RL 2JELL 2FECL 4YFDB 4HJJL 2V17L 2ICEA 2R1YB 5BRZB 1JNNL 3NCMA 3HG1D 1DBAH 2BP3A 5FF6A 1QR4A 2UWEA 4LGSB 3RY5A 1HI6B 4G6JH 2VWEE 3ULUF 1MQKL 3VG0H 5D1QB 3FQTB 4DN4L 1MUJB 3LKQB 5DI8B 5ACZA 2Z0BA 1AY1H 1AP2B 3E3QC 2DQDL 5E5UB 3HAEG 3O0RH 5D4QA 3P3YA 2Z92A 3HR5A 5DWUL 4LDEB 3S96B 2XG5A 2GY5A 3BHBB 4JFQB 3QQ3A 3HS0B 1RIHH 2QV2A 4LLQA 1RFDH 1MCJA 2H8PB 5FA4B 4YXKL 3HZVA 5T3ZD 4LQFH 2AGJL 1A14L 2XA8H 2MCPH 2XWTB 5I15L 3TJEH 4DTGH 3DVNB 4JZJC 4KK8C 2VDQH 2E5EA 1L6XA 2CDGB 4YDLC 4NKOB 1OGAE 1MFAL 3BISA 1BZQK 1T3FB 4JR9L 2FX8L 4OBSA 15C8H 1FGVH 2AEPL 3QUXA 5FM5M 5GISL 1ZVSA 2QR0A 1UM5H 1FV1A 4LCIL 4DKEH 3DVFA 2DIAA 2UZIH 1E4XI 1QRND 4WTZG 1E27A 3UBXI 4JRXD 4PS4L 5E2UL 5A43C 1MI5A 3DBXA 4MNQB 4YDVB 5HHMD 3RWGA 4P2OD 4M8VA 4WRLA 3IDYC 4L3CA 1X5IA 2YWYA 3B3IA 4O02L 2DM2A 2GIYA 5GS0D 1G9MH 3BH8B 3UAJC 5IV2A 2BY3A 3CFDB 5JMOC 1OCWH 5K59F 5IKCB 4K71B 1CL7I 1FCGA 1FO0L 3UTOA 1DUYA 1CBVH 4GAGH 5D93B 1UCBL 3HPLA 5DTFA 4N5ED 3KLHD 4NQDE 1FFOA 2ZG1A 2X70B 5I8KL 4XTRD 1BHGA 4XHJC 4DQOL 4OCRH 2G2RB 4XZUB 5IR1B 2EYSA 3EGSA 1JRHI 2CQVA 3SDDA 1RZGA 3QUYA 4J3SA 1HSBB 2WWMD 2XKSA 2PR4L 5IG7A 2BX5A 3H0TB 5D8JH 3LPGA 2HT3C 1NUFA 1NC4D 1OAUL 1PX3A 2ESVB 1S7XB 1BZ9A 3VFVA 5FKPA 3VXTA 5EOTB 5EOCJ 5C86A 4WUKH 2CRYA 4LCCA 4P48A 2RJMA 2N4IA 1Q0YL 4LK4A 1CD8A 1AHWA 3DI2B 1TETH 3O6MH 4ONOA 1QLFA 3VGAB 4OFIA 5J89A 2CSPA 2HLAA 1F11A 4JY6B 2VLKB 3RY6A 3BZFA 1F2QA 3RGVD 4D9RD 2P8PA 1KTLA 5BW7A 5J1SC 2P5EA 3U6RB 3MRRB 3NFNA 5F6HI 5EUOE 1LK3L 1V3LA 2FYYA 4JQIL 3DHMA 1HEZA 4ODTH 3TNMA 3GJFB 4PJBE 5DRWB 1K4CA 3MR9B 5CGYD 1PKQA 2J7LA 4H25A 2CRMA 1I85C 2OJZL 4M7JL 2AXFB 1N7MH 3WFBL 1YN6B 5HHOA 3LN5A 1NDGB 5DGQA 3DGGB 2ENYA 2C3VA 4JDZA 4CU7A 1RZFH 1DQDH 1S9YA 1UACL 2X44D 4WVRA 4F7TA 5BZWA 4PP1C 5FK9A 4R97C 5K9QG 1K6QL 4R26H 3ROLB 3EDDA 1RURH 1VESA 2IWGA 1W72A 1U8QA 3EO1B 2PO6B 5GPRA 4PLNC 1C5CL 5KVDH 1A6VL 3FFCD 2VUOA 1IFHL 4X7DC 4UILH 3ULVC 1JPSH 2AJZA 3WIFA 2X9YA 1S9WA 3E3QE 1KB9J 2FJHB 1IBGL 3O4LD 4K9EL 1LEIB 1HSAB 3MLPA 2YC1B 3O3UN 1NSNL 3HC3H 4XVSL 4D9QE 4I3GA 1TVHB 5SWZD 4PREB 1YDPA 2ZKHL 1YEEH 1F3JB 4NN6B 2ARJB 2UZXB 5GJSL 5GS0H 4CVZA 5HDLA 1NCDL 3NOIA 2NW2A 1KFAH 3O2VL 1MJ7H 2K7QA 2VDNH 1IM9D 1FL6A 4QOKB 3GM8A 3FO2A 1NBZA 3MNWA 1E6JL 4S2SB 1AFVH 3DV6A 1QSFA 2DB8A 1X5YA 2VDLL 4APQA 2P4AB 4JREB 3MRIA 5GSVA 2N1KA 4RWHA 1UM6H 4GQ9L 2WP3O 5A2LH 4P2RB 3SKMA 2H32A 4ONFL 3IFPB 1NUDA 1UQSB 3M1BB 3OF6A 3AS1A 5T5NG 4J3UA 4QWWC 5IMKA 4NN5C 1I8KB 1IGCL 4AQOA 4H1LB 3VU2A 4M9OA 5T5FH 5ICYB 2NY1B 2IFGA 2SEBB 3MRNA 4NUGH 2YKLL 3TH3T 1TENA 5GRVL 1J5OH 5KG9A 1K85A 1R3KB 2KQMA 3NFSL 5IJVA 1TZGH 4HX1B 5IMMB 5I8EA 3SDAA 2NY3D 5JOFB 2HFGL 1F4WL 1U8PB 3R8QA 1MCSA 2CJUH 3DXAB 5AD0B 2WQRA 4XCFH 3CSYB 3N1FC 3THML 3JV6A 4TULL 5DJYB 4IOIA 4P5TC 1XH3B 1BOGB 3ARGC 1ZT4A 3KLDA 3R06B 3D0VA 3UZVB 3VCLA 5E00B 1ES0B 3VFTB 3U7WH 3MA7A 1ZA3A 3ULSB 2XZQH 4YQXL 5E4EB 4YHOH 5EU5B 4FQXC 4TUJB 2A77L 2J8OA 5DR5L 4KDTC 5KVFL 4XVJH 1OAYH 1R5IB 1WFNA 2WUCL 5IB1B 1KIRA 4F7PA 1T03L 3C5ZB 2AQ3A 1WITA 4Y4FB 5CIPB 4HH8A 4I2XE 3HNVH 5AYQA 1A6WH 4JPIB 3DMMB 2YRPA 2NYYC 3GKWH 4N0YL 4M6OH 5IHZB 1QFHA 2J8UE 3MO1A 1QFUL 4IM8A 4U0RB 5IMLA 3GSOB 2OR9H 5LBSL 4MWFA 3TYGH 5DMKB 4XPBL 4LHUD 3U9UB 1A1NA 2I5YL 4MLIA 5F3BA 4Z18A 1H9VA 1K9TA 1WCBA 3DHJA 3GO1H 4MNGB 4YXLL 4LPCA 2DQEL 4FQIH 4MCZA 3IETA 4Q2ZA 4IRZH 4ONHA 1AE6L 1I7ZA 3MLVH 3QNZB 4HS6B 2EDKA 1FFPB 4AM0B 2H3NA 2P8MA 2IANA 2ZG2A 5D7JD 5DRNB 1IRAY 4LVNB 2OP4L 4Z0XB 3WFHA 3QIBA 4FQLH 3T09A 2BY0A 1ZMYA 5J1TC 2DM7A 2ICWJ 3TO4C 3JWOH 4M93B 2YWZA 1FNAA 3QCUH 2DJSA 2MQCA 3BP5A 2G5RA 2V5YA 3BEVA 1W0WA 1L4IA 4QHKI 4QRUA 5DJCB 4J3XA 2DBJA 3ZT5A 2VH5H 3ALPA 4LRNL 1PSKH 3T4YA 3UJIL 1C1EH 3TZVA 1CIDA 4XP5L 5I74C 1PAMA 1U8HB 3LDBB 5HGAB 3K8MA 4LL9A 5BS0B 5SWSD 1KC5H 2XACC 3UX9B 3MV8E 3ULVE 1B2WL 3TA3A 3GMQA 3WDIA 2L0DA 3C08H 3EYVB 3NPSC 2NY5L 4LCWE 3HHRB 4MDJB 5GGVL 5C0CB 2IH1B 5JIPA 8FABB 4M6NH 1NGYA 2IJ0C 4G3YL 3HNSL 4Z78A 3L5JA 3TBTA 1CDBA 4HS3A 4FQQA 4ZS7L 1E0OB 3IRPX 4X9HA 5EUOF 5HHNB 4IRSB 2D31B 3T0WA 3IJYA 4RWYH 3I6KB 2D9QB 4PJBF 5CBAA 2BVEA 3V5HB 3X3GH 3PWPA 1DVFB 2EIDA 3RA7H 2RQ8A 1ORSA 1QFWH 1QBMH 4X6DB 2QSCH 5E9DE 1BZ7B 3T0XA 3IF1A 4HW6A 5TQ2L 1I7UB 3VXNA 1GGCL 2ADFH 3FN9A 4PJIA 4J23A 4ZUWB 5LQBL 5FEBA 5JHDA 5CZKA 3VFOA 5J57B 5FYLE 4ISVB 1CT8A 5E0QA 2VITA 1I8IB 1IC7H 1MHEA 2ZOLB 4QEGA 1JGDA 2XQYK 5BRZA 2GSGA 2R1XB 4WWKC 2UUDK 1B3JA 1HXYB 1TJIL 3BJLA 5SWQA 2VZSA 1MREL 3EOTH 1OSZB 2EIZA 3FOMB 3GMNA 1Z5LB 3BFOA 3BH9A 5K9JL 3TLRA 1IGFL 2Z8SA 5D1QA 2B0SH 1MUJA 1M7DB 3P0YH 4XCCL 4OCLC 3JWNC 2E3VA 5DJ2B 2DQJH 3H9SD 2P48B 3IXTA 2GQHA 5C0JA 3BHBA 3CZFB 1A21A 1IZJA 3O11A 2VXSL 2H8PA 1RUAL 3RVWC 4JG1H 4L8SA 1PZUB 1FVCA 1IAIM 5TF1L 4IS6A 4ERSL 1G6RB 4I0PB 4LIQL 5D2NC 3FAXA 4NKMA 4JG0L 5T1LA 3O9WA 4MJIA 3V5KB 5E2WH 3WXVH 2ZCHH 2CLRB 4F8QA 3RWJB 1YY9C 3QUZB 3L3JB 5CEZL 1NUNB 1J0HA 1U8MB 1S7TA 1Y18B 5DC4B 3VA2C 5JORB 5F72S 4UB0H 3B9KC 3AB0B 1K8IB 2A9NL 4BQ6A 2HRPH 3MRCA 1XGQB 3P4OA 3U2SB 3BKJH 3D25B 1J1XH 1LD9B 1BVLB 1JMXA 1WBZA 3QULB 2FATL 5I75C 4RMSA 3B5GA 5ID1B 2QQNH 3KPQB 3V0VB 1YECL 4RGOH 5D7KE 3FJTA 3TPUA 4XP1L 5HYJA 2V2TA 1DQML 1GGUA 1I1AC 4RNRA 5J3HC 1OAKH 5HHVL 3BP4B 3CDGB 4JZOA 2WBJC 3AY4A 3IAQA 3ETBF 4HZAA 4KRPB 5E6ZA 5IFHH 4C54A 3X17A 4JFEB 2OZ4A 3MFGB 3KPPA 2X05A 1BWMA 1YMME 4U6YB 1JV5A 2C26A 3GMLB 4RMUA 3MGTB 4OZGB 2AXGA 3P2TA 2VXVH 4RMQA 5HHQB 5CJXC 1KNOB 3T4AA 3D0LA 5C08B 1AJ7L 2E27H 5DEFB 5LAXB 2GK0A 5L2KE 4ACPA 3CFBA 3LEVL 4I3RH 1T5XA 1H0DA 5E8PA 3KAAA 4QTIH 2X4TB 4LU5H 3CZJA 4LDLB 4BQBA 1QA9B 3H0TA 3T65B 5J4MA 1K5NA 3OAUL 3OV6A 3RDTB 1S5HA 1E4XH 4X4XA 1E6OL 4RBPK 1TDQA 1S7XA 3NABL 3Q48A 4PJCE 3RWHB 4GBXC 1YNLL 4DK6A 3SJVB 3DNKA 3VDAA 3OZ9L 2B39A 1D9KB 2J8UF 3LV3B 1MJJB 3C60D 2C4FU 4F15B 1FO0B 1D5IL 5JIIA 4KUZL 1EZVX 4S1RL 3O8XA 3CDYA 5CBEB 3I85A 4JDTH 4G6MH 4U2YA 4IIQB 3QEQE 2VIRA 3Q6GH 4K3JH 4NFBA 3LQZB 2YPKB 3IS1X 3MRRA 1EFXD 2Y06H 4YO0A 2I9LA 1CL7H 3LQAH 1JE6A 3QFJA 5IFAH 3KJ6L 3A6OA 2AK1L 5ANMA 3OKMA 4O58H 2Z91A 2Y5EA 4JFDB 3GEWB 4ZTPL 1FFNB 1QP1A 2E7CA 3C6SA 1KENL 3HE7A 3SKJH 4GW4A 1JNLH 1YEHL 2VL4A 3CFJB 5FKAA 1JZ8A 1U92B 5CJOH 2ORBH 3WFCL 4L8DB 2DJ4A 5T33L 3WE6A 4LEOB 4D2NA 5GRJL 2Q3ZA 4ELKB 1G6VK