1IAII

Idiotype-anti-idiotype fab complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
218
structure length
218
Chain Sequence
EVKLQESGGGLVQPGGSMKLSCVASGFTFNNYWMSWVRQSPEKGLEWVAEIRLNSDNFATHYAESVKGKFIISRDDSKSRLYLQMNSLRAEDTGIYYCVLRPLFYYAVDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSTWRPSETVTCNVAHPASSTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (immunoglobulin igg1/igg2a)
molecule keywords IDIOTYPIC FAB 730.1.4 (IGG1) OF VIRUS NEUTRALIZING ANTIBODY
publication title Crystal structure of an idiotype-anti-idiotype Fab complex.
pubmed doi rcsb
total genus 35
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1993-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaiI02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaiI01
3QXDB 1MCSA 2NY3C 2X89D 3O6MH 2AJUL 2DQJH 4XCEB 5K9OB 3C09C 4JDZA 2MKLC 5CP7B 4EQ2A 1ZA3A 3FN0H 1H15B 3VFTA 2KDGA 4EDXB 4PY7A 4YXLL 1YDPA 2XQYG 4Y5XA 5EUKB 2F74B 3EOAA 4OLUL 3IJSA 5KAQG 1FORL 1O5DT 2X1WL 4NQEE 1CDYA 1N8ZA 3NIFF 1A7OL 4QXGL 4JR9L 4YO0B 4ZFOB 3UX9B 3SJVD 4FABL 1H8NA 4LLQB 4BH7A 1CFBA 3JWDH 3O8XA 5IQ7L 3TWCL 5IBUB 3UPRA 4M6NH 4ZS7L 4YBQD 3LEYL 3O0RH 4CMMA 1A02N 4PJXE 4C59B 5H37G 2ADIA 4HFWB 3VXSD 3PWPE 2G9HA 1QR4A 2NY0C 4CVZB 2VR5A 1BD2D 2DWEB 5IVXA 1QBMH 1K3IA 4MZ2A 3NFNB 1P7KB 4Z7WA 1J88A 1KPUA 1ZGLB 1FAIL 5DQDL 5ICYB 1I4FB 3DVFA 2A6IA 4IDLA 3GSNL 3BEWA 1UJ3A 4N8VG 1J0JA 1IT9L 1IM9A 5DJAB 1A7PH 4L3ED 3PE9A 1J87A 1EH9A 4G6KL 5EBGA 4Y4HB 4H1LG 1GYAA 2AEPH 3OTTA 5L2JA 1HSBB 3U36A 4WRLA 5EOTB 4ODTL 3RL2B 5BS0D 1KFAL 3QHZL 4W4NA 1LO5B 2X2YA 1K3ZA 3NACL 3LOWA 4JPVH 4N0UA 4OZGA 5GZND 5GRVK 1A64A 3VD5A 1JNHA 1DEEB 2F53B 4MXWH 4A6YB 4C56B 1QRND 4DZBB 2BRRH 1N7MH 3FB7B 5KVFL 2H9GA 3L5WA 5MEQB 1G7JB 4PB9L 3NCCB 3WLWD 4BFEA 5B3JF 1D9KD 3ARUA 3HZVB 1J7VR 2ZJSH 3OB0H 2R29H 4WUKH 5TDOB 3WLWC 2ZPKL 4O02L 1GCFA 1WTLA 2QTEA 3SO5A 1DVFB 1GVIA 4JO2L 5D7LB 1QLFB 2AJXL 4IDJL 1CF8L 5FYLD 5I9QB 1RZFH 5ACLA 4OF5A 1GAFL 2CXGA 3UTQB 1KLUA 2BZDA 2X7LA 4FXLA 3OR6B 2IG2H 1ACZA 1EJ6A 5HGBA 1EFXB 1NC2B 4PJ5B 3F7RA 5IHZA 2VABA 1PG7L 43CAB 3RWFB 2GTZA 4ZUWA 4B7LA 4G6AD 5KTEH 2YHGA 4YPGA 1YN7A 3RZCA 3NA4A 4Y0GA 3TPKA 5HYJB 3MR9B 1UQSB 1H9VA 4MCYA 1YMHA 3BPOB 4XXDB 5ICXA 3DO7B 2AXHA 4IJ3C 1K9TA 4DKFL 2FGZA 1JV5B 1RIVH 2FD6L 1EAPB 2AABL 4Z5RB 1T2XA 3IU3A 2FX8H 3IDGB 4M1DL 4J8RB 1I7UA 5AYUL 2GK2A 3MXWL 4IOFD 5FKPB 4D3CL 2O5ZH 1X4ZA 4EI6A 5AD0A 2OL3A 2P8LA 3G5ZA 1Z9MA 3BE1L 2FX7L 3WE6B 3AXLB 2YBRB 1AXSB 1VFAB 2LU7A 4HWUA 2FIKA 1HQRA 3DRTA 4LPVA 1BOGB 4Y19B 4WWID 5F89A 1ZAGA 3HI5H 4DKAA 3FN3A 2W1NA 3G5VA 1LNUB 4DWHA 1A1OB 4QKXB 2AP2A 2A74B 2BMKA 4O2EA 3EHBC 1NCNA 1HEZA 4OF6A 1RK1B 4M61B 4YGVB 5E8OA 3JTSA 1J8KA 2VISB 5JIPA 1P4LA 2PYED 5B39A 5C6TH 3I02A 2H8PB 2VLKE 2GAZA 4XNYH 5IR1B 3BKCL 4YQXH 2X9WA 2ZOKA 2YEZA 3EO9H 5DHXB 1HE7A 4K07A 4J12A 2MPAH 2KZWA 1P84J 2JJSA 1MFDL 5LWYL 1U8HA 3LPWA 4LCUB 3V0WL 2JB6B 3T2NL 1CICC 5ICZA 2ZZUT 4HS8H 2RGSA 1MQKL 1XIWA 1RUQL 4QWWD 1HKLH 5GIRB 4TUJB 1NGYB 5IROC 3NAAH 1NDMA 3PWJA 3IS1X 5IW1B 3F5WA 2XY1A 4U1NA 3FRPG 4Z0XA 1KJVA 4RZCB 2IQ9L 3HZKB 4MJID 3FQXA 5DRXB 5KSUB 5JORA 2ZUQB 3IB4A 3LQAC 4CVUA 4JKMA 2NY7L 2EE2A 2UUDK 5HDBF 5BV7C 3RIAK 3O4LE 2E6PA 2NY2C 5H35B 2EO9A 1IJ9A 3KG5A 1FV1A 4QHUB 1FNFA 2X4PB 5E2VL 1U8PB 1EO8L 4DCQA 3ZHDA 5DS8B 4CAGA 1KB5B 3IDYC 3O2VH 1SQ2N 1JPSL 4P46A 1AFVL 1WT5A 2UZYB 3LDBB 3HN3A 4WO4B 2LAGB 4Y1AB 2ATKB 4FP8H 5IW6A 4JZJB 2DLTA 3LVEA 2WUCH 2XZCH 1C5BL 3VXPB 2B4CC 3SO3C 4U7KA 1T3FB 2H45A 3NVQA 2B0SL 4QRTB 5CD3A 1HDMB 5E8NA 4PJ7F 1UB5A 5JOFA 1R5VA 4RQQA 3Q5YA 4CN4A 2ATPA 5DFTA 4CKVX 2BXYA 4YDLB 4FNLH 4R4FL 4Y8DC 5JUEL 4XHJD 3RA7L 4LLYA 4Y7MA 4ODSH 1V3KA 3QDMD 4APQD 5DUPH 1DSFH 1T2QH 4UT9L 1NMAH 2HVJB 1CLZL 5JNYA 5T33L 1Z9OA 3P11L 2ZUUA 3HE6D 2WINB 1T4KA 1A6ZA 1EVUA 1I1FB 1I1AD 1GSMA 3C2AH 3IRZA 4MAUL 1FGVH 2CIKA 4NQCD 3QH3A 3RNQA 4GW1B 3BP5A 4GUPB 1UM4H 2VDPH 1M7XA 5DK0A 1KXVC 2ILLA 2EKSA 4ONOA 4HZLA 4UDUA 4P3CL 5L2KB 2FYYA 3MRNA 4WTWA 1KN4L 4NP4L 5C0BB 2OMBA 3WNNA 3U0TB 4OZFB 2NLJB 4FFVD 4FXGA 4FS0A 4X99A 4FQIH 4RGND 5KSAD 1NFKA 3ECBA 1F97A 4F7PB 2Z35B 3REWA 2Z93B 3C8KA 4NDMB 1HWGB 1OAQL 4AQ1B 4ZFGH 3MLTB 2O5XH 1P2CA 3IDJA 2FWOA 3QEQD 3BD3A 4XTRC 1JMZA 1RMFL 1P6FA 5GGUB 4GAYA 5JLZB 1FCGA 2DQTL 3CVIL 1CL7L 4U2YA 1ZS8A 3AAZA 4HK0A 2Z91B 1X5GA 4X98A 4J3VA 1IAIH 2FLRT 5IHUH 1KEGL 2CSPA 1CGSH 3MLSL 2FECI 5I1GH 1Q38A 3OV6A 4F7MA 3TJHD 1WZLA 4L4TB 3ZYIA 3ALWA 2A9NL 4HUVB 4KQ4L 4YHYB 3VXTA 2CRYA 1GZQA 4WY7H 5FA4B 1W2KT 1DQML 1JNLH 3B9KB 4L4JA 1UWGL 1S7UA 2E6JA 2P5WD 4N90E 4XPFH 4GG6F 1ZA6A 4POYA 3BEVB 4MMZC 2VSCA 2BVPA 3EO1A 4J4PD 2WIIB 5ALBL 4FA8A 1C7SA 4L8SA 6FABH 2JKXA 5GSRB 4Z7UF 1V3JA 1CGUA 5FHBH 5E2WL 2R1XA 4UBDC 2BFVH 4ZO9A 4LLWA 3V4UL 1HI6B 1S3KL 2VLJE 2X4OB 4NKDB 2MJWA 3SE9L 3GIVA 5HDQL 2AK1L 1PYWA 3D39E 3BI9X 2X70B 2E7CA 3ROLB 1SJXA 2W0KA 5T1KA 3VXME 4NO2A 4X6EA 3VFSB 1AP2B 5KANG 1RUAH 4MWFB 4P2QD 1X6LA 2CLZB 1WIUA 4P2CG 1D3CA 4JFYB 2FZ3A 3GSWA 4QHNA 4MX7A 1BIIA 1QSEA 4JFDA 1CBVL 4PGEB 1IRAY 5E8PA 3QO1A 3SCMD 3F12B 3ILQC 4MHHG 4PRHA 3WLBA 4P2OD 3OKOA 3H0TA 3FB5B 2HH0H 2HWZH 5JPMB 5E8DL 5DMGC 5EIIA 1WWCA 1XH3A 2VXSL 1MPAL 4QHLA 4U6YB 1T7VA 5C7XH 4PRPB 4ZQKB 4OGXH 4XI5C 1XGRA 2A0LC 5D2NC 4DQOL 4YIQA 4W70A 3D85B 4PJAA 1R0AH 1DLHB 4ALAH 1Z0NA 4OIIL 3QUZC 4NZUH 5J6HB 3CD4A 3KPQA 3O4OB 4C4KO 4OLZL 3IDIB 1NSNH 1I9EA 4GW5B 1FLRL 3X3GL 4G8FA 4GW4A 4I4WB 3DX6A 4QRUA 2ZKHH 4N9GB 3Q48A 3KLAB 4XBEL 5DTFB 1HOCA 1NMBH 2BNQB 3VGFA 5EU5A 1MAML 4NQVB 1OF2B 5DJ6B 1A6UH 4PJFF 4H88H 1QFWM 3IXAB 2NCMA 3PQYD 1JZ3A 2JELL 3C08H 4J3UA 1R3JA 4GBXD 2OZ4A 3CFKB 1FC1A 2HT4D 1EERB 1IC4L 4L5FH 1MIML 4WHCA 3ZMRA 1HH6B 5ESVA 5IMOB 3T77B 1ZT4A 4OD1H 1CLCA 4G43B 1M6OB 3DURB 4WJ5B 1MLCA 4UIMA 3TBYB 3OKNA 1KB9J 5HHXL 2WBJC 5DK3A 3SJVB 3MBXH 2Y6SD 4XH2A 3DUSA 4PJ7E 3MLRL 2R69H 3UPCA 4LNRA 1IGCH 1LEIB 2XWTB 1ACYL 1F8TH 3U4EA 2D4FA 4ZUVB 1EZVX 5IB1B 4KUCD 3MRJB 5HPMB 1M05A 5FV2A 1T6WA 1NCCL 4UUJA 2RAMA 1BD2B 2CQVA 5CP3A 1G1CA 3MFFB 1KYOJ 1VADA 2RCSH 5EO0A 5E00A 2FBOJ 4WFHD 3MRKB 4KXZI 3VFPA 1J0ZA 2BERA 3MUGA 3QUMH 4R4NC 4L3EB 2W9LA 5CD5C 2VDOH 3F58H 5E08H 2R0WL 5B22A 1DJSA 4OZIA 2I9TB 3U9UA 1II4E 5D6CB 2Z9TA 1U3HC 2D4DA 4TUOA 3TO4C 1XF4A 1ZLSH 4M1GH 2VLLB 2FATL 4OGZA 4F7EA 2ZOLB 3GJFH 2M8XA 1F6AB 1ONQB 4P2YA 1SMOA 3HLAB 5E2TH 1QRNB 1ORQA 3HZYB 3IDUA 4EN3C 1YEHH 1LK2B 5GJTL 4HJJL 4OM0H 3S5LG 1Q0XL 1KOAA 1A3QA 1D9KB 2CDEA 5CILH 4YK4C 4ZFOL 4NNYA 1JJUA 2DQIH 1KPVB 3QCUL 3KPLA 4Q58C 2ARWA 2VLRA 5HHPB 5JDSB 1NEZB 3DETC 3VH8A 3DPBA 4RFNB 1WCBB 3OAUH 3BGAA 3PUCA 4Q6IA 4YHNB 4EVNA 4PJ9A 1ZSDB 4X4YA 1GOGA 2P8MB 1VPOL 1IFHH 4L4VB 4LIQH 5DDHA 1LD9B 2P7TA 2I07B 1K8DA 2IQAB 4NWTH 1GH7A 4HV8A 5DJYA 1PJ9A 5DHVB 1N0XL 1CDJA 2ZCKL 5F96H 4HJ0C 3KJ4C 5LG1A 1MCOL 1XAUA 4G80B 4Y5VB 3DI3B 4LHUA 4GG6E 4F57L 5D1ZA 2J8UF 3W9EB 4H5SA 5T3ZL 4X7SH 1NGXB 3WS6A 2V5TA 4OLYL 4BA8A 3MGTB 1TZHA 25C8L 5I8CA 1CD1B 4LIQE 3JSSA 3HRZA 3K4DA 3VWKC 4DOHB 4I5BB 3R06A 1RJZB 2ADFL 1V5JA 4XAWL 1K2DA 4GRLC 4G7YH 4A6YL 2CLRA 1NCBL 2PYFA 1T5WB 5J1AA 1UFUA 1WC7A 2LQRA 1J86A 5EUOB 2XPGA 3T0EC 1HHIB 1GIGH 4WI5A 3BH8B 2AKRA 4N0CC 3IDNB 1QO3B 3BIBX 5DC4B 4N5UA 1DBMH 3H9SA 3IJYA 2BOCA 2CKBL 3QIBC 4BQCA 4TTGA 2QR0B 2O93L 3LKPB 2DLGA 4JQXC 2O5YH 1RIUL 5L0QC 2IAMA 4U7MA 4ZXBC 2WP3T 5LGHL 2Z31C 3ETBF 4CRPA 2PYEB 4FFYH 4TNVF 2VERN 4HIEB 1MCNA 4LSVL 2NW2B 2NY5L 1NKRA 3CMOL 3IGAA 4QT5B 5IVXE 1RUKL 1ZV5A 3TT1H 4Z7WE 1AO7D 1S7SA 3NCJH 2QKIB 2QSQA 5F9JB 2VAAB 3WNLA 1TJIL 3FO0L 5MENB 1WZ1H 3O41B 5I1DA 4D9QD 3WKMH 5IMLA 1XGPA 4LEXL 5F72S 1W0VB 3NCYS 5F9WC 5D7JA 5AWNL 2RBLA 4R96A 4WFED 4ORZC 1VEOA 4KU1A 3OPZL 2FSEB 3NFSL 3RFZC 4ERSL 3H3PL 3BIAX 1FVEA 4DZ8A 1BVLB 1KIQA 4N0UE 4NGHL 4OZGE 2BVOB 4MJIB 5DJZB 4R4BB 5K9KA 2VQ1B 3FQUB 3MRDA 1MCEA 5DJXB 3BAEL 1LDSA 5HBBA 2VC2L 4JE4B 5FEBA 4JQVC 4KVNL 1DBJL 3BUTA 1MSPA 5HHVL 3RVUD 2XKNB 1QZ1A 1NAMB 1QSVA 1MFBH 2RFXA 2ZUVA 3FONA 1HN1A 3MROB 4XZUA 2C4XA 3BWAB 2ZUSA 3IETA 3GRWA 4XNQA 4GKZA 4V1DA 1FNHA 3U7YL 1J9CT 4OLXL 4ZFZA 1IM3B 1FFNB 4W6XB 1T1XB 3HUJF 2XYCA 1IQDB 4ZUUA 3ZE2F 1BZQK 1C16B 4GJTB 2Y7QB 1AQKL 4ZS6C 1DQLL 2DBLL 4QRSA 1MRFL 3FAXA 4X0KA 2OL3H 5JW3L 3UAJD 5D93B 4OKVA 2X40A 2GT9A 5D96B 1YYMH 4EBQH 1BFVH 2W60B 5EFIA 4FN0A 3WIFB 1BJ1J 3SGKA 1NBZA 1UM6L 3MRHA 4JY5L 5DA4A 2CUHA 1S7TA 3H7BB 1NBVL 3T0BA 3P4OB 1U93A 4W4OA 3QDMB 3ZLQC 4P4KC 4APQB 5EORL 5D1XD 3N0PB 2MNUA 2HRLA 4R9HA 4ODVH 1ZTXH 4E0RB 1J0KA 2YK1H 5EO9A 3RTQA 2EDOA 5F93C 3HE6B 1OW0C 1AGFB 3I6KA 1OLZA 2ADGB 2HJFB 1I1AB 4F7CA 3MJ8A 3QJFB 1E27A 5EOCL 2Q76A 3VA2C 3BKYL 4NQCB 2W91A 1TVBA 4Q9RL 4KKLD 3VXOB 1NFDF 2W9DH 2YN3A 3FT4A 4ONGL 2IPUK 3WHE1 3OJVC 2FNBA 3HC4H 4MD0B 1KB5L 1M71B 4LCWA 3WXWH 2R23A 3HR5A 2XZQH 3V6OC 5B21A 1IGML 2EDRA 3QDHA 2DWDB 3MGOA 3BGMB 3PWVA 2XZAL 5E7BA 2EIZB 2KPNA 4M7KH 4PJCB 5KSAB 1O0VA 2P8PB 2XWJA 2OCFD 4UZGA 3ZL4L 2FJFB 3PWLB 3QEQB 4K23L 4NZDA 3LQZA 4FHBD 1JVKA 4YGAB 1ZHBA 3NFPB 1HILA 4KMTL 4D0CB 3V4VH 3P2TA 1BFSA 4OJFH 2J6EL 1JK8A 4Y5YB 4AH2A 1NANI 2W59A 2ZNXA 1I8IB 1NLBL 4FTVE 4NQED 5F7FA 4GLRH 5D2LA 5D71L 3EJZD 5ITFA 1QHOA 1RZ8A 1SY6L 4PP2B 2FLBT 1I9RL 2X4QB 1JGVL 5EBWA 3DMMA 5I1CL 3BZFA 4HPOH 5GISH 4PJDF 2JK5B 4JFZL 5TDPA 3GGWB 5FHAH 3U0WL 2J8UE 3C6LC 3VFNB 1SHMA 1MREL 5IJKC 4PS4L 3QULA 3MYZA 5HY9A 3PWPD 1V7NH 3QHTC 4QOKA 4AQOA 1Q0YH 4XP4H 4BSVB 2BVUA 1H5BC 1LE5A 1U8MB 2JB5L 1WAAF 1V7MH 5EA0L 3QWRD 4KHXH 3EGSA 1X7QB 1L7IH 2MCPH 1IBGH 1U3ZA 3P0VH 4XP9H 1DR9A 3QCVL 4GXVH 4P2QB 5E2UH 5C0IB 2XN9B 4K3EL 5HHME 3P4MA 4AM0A 1BHGA 5CKAA 1U8LB 3QYCA 3WFBL 5ALCH 4X5LA 4P2OB 2JIXA 1P1ZB 2LABA 3GM8A 3OXSB 2BHUA 5D7SH 5D2NB 1F3JA 4GG8B 4WW2A 2IH1A 4M62L 1K85A 4MAYC 1B0GB 4HKJA 5D5MA 1RUMH 4AL8H 4R90H 1U8OA 4NQDE 3O45B 4ACPA 4YHPB 4NKIH 4FQ1L 5CZXD 1TTGA 2NXZC 4Z95L 1MCHA 4TUKH 1NAKH 3HR6A 3VG0L 3TF7C 5F8QC 2PCPB 3PGCB 2OM5A 5EZJA 3L7FB 4M00A 1INEL 2G2RB 3QUXD 3PHQA 5A16B 4ETQB 5T3XL 1SYVA 4O2CA 1K6QL 3PQYB 1ZLUK 4GBXB 3RIFK 3D2UA 2OR8A 1SVCP 5MP6L 4YHOL 1JTTA 4KJYA 3O11B 1T1YB 2FECL 1NH6A 4MD4B 3ZT7A 4OBSA 5KVMC 4EI5D 2E8YA 5C9KA 2I24N 3MLYH 4F3FB 3V5DB 3M8OL 1KN2H 1KJMA 3MXVH 1ZT7B 2WBJB 4XPAL 3GSOB 3RVWD 3TZVC 4PJGB 5C1MB 1MJJA 1Y6KR 4HBCL 1SBSH 1CFNA 4G7VL 5D72H 1UEMA 3HPLA 4XVUD 3KR3L 3GBMH 1I3RB 1UZ6F 4WV1A 1QYGH 5ADPH 3L3KB 3AM8A 5C0FB 5IJVB 1D7FA 1MELA 1JWSB 2FEDD 3D0LA 4HGWB 4U05A 4YHLH 5CEXB 2GSGA 2VLKD 2XIDA 4FQXD 1IC5H 4XMLH 5D7IF 3AREC 3UTZA 1F3RB 4IS6B 3LEVL 4WHDA 1V3LA 2R4RL 4WU5A 5EIVA 3IXTA 3EIFA 3CLEH 5F1NA 1MEXH 1A4KB 3DRQB 3U6RA 3CSGA 2YA1A 3GMRA 3WNMA 4I0CC 1E4WH 1U92B 2E9WA 2NY1C 1IGJB 4YXHH 5CINH 1LE9A 4MQ7A 1BJMA 4NUGH 4D2NA 5I74B 3LKQA 4M93B 1QSEE 4JFDE 3TESA 3TPUB 3GUTA 4MJ6A 2LFGA 5C0RL 4PRHE 1UZ8B 5IK3B 4GFTB 3W0WA 1X5FA 4URTB 2ESVA 1NJ9B 1REIA 2ICWA 2VXUL 4QY8B 3QNYA 3BMVA 3DUUB 1HINL 2DM2A 3O6FD 4CGTA 4LSUH 3O4LD 2CUMA 3NA9L 3HZMB 2HP4A 5DUML 4TVPH 1A4JB 2XNAA 3ESVF 1FRGH 2VZ1A 2OR9L 4Y4KD 5DC0A 3S98A 4PB0H 1MRDH 4JM2A 2DIBA 4G8IA 3HI1B 1IGTB 4O9HL 3QG6B 4UDTA 2C7UB 3CFJA 4OFKA 1FNGB 2J88H 3BQUC 2OZ4H 5L8LB 4GRMA 1QVOB 4U3CA 4LSQL 1OAZL 2B39A 3L9RB 3ZTJG 4TVPE 3JUYA 3P9LA 4LQFL 4D0BA 2Q6WB 4LSTH 4P48A 2X05A 1A6VL 4A2MA 4RIRB 4LSDA 3KJ6H 1N4XH 1S7QA 1C7TA 2LAAA 3BPLB 2DQFB 5TE4H 4XGZA 5CUSL 3KPNA 4I3SH 1A5FH 5CEYA 2AJSH 4NC0B 4OCYH 3CXHJ 3MCLH 1N59B 1F42A 2XKUA 2EDQA 3S96A 3VI3E 3MACL 5CGTA 2OK0L 1U8KA 3O2WL 2FCBA 3BH9B 1AR1D 4LVNB 3WJJC 4HXAH 3TJEH 4RFEA 1G7HA 1GGBL 4MDJA 1BVKB 3DBXB 5CP3H 2Y23A 3CFEB 2R56H 1MCRA 3TN0C 2DQGH 5IGXH 3QDGA 4M7ZB 1TJGH 3AMKA 5LCVH 2MCG1 1BJ1H 2ZG3A 4N8VA 3NGBB 4Y4FD 4JPIB 3BESR 4LKXB 4S1DD 4H8WC 3B2VL 4LCIH 3GM0A 5ACMA 4H1LA 4TSAH 1VENA 4IRJA 4OGAC 5KW9H 2D31B 5IBLD 4QYOB 2DKUA 3QP3A 4LDEB 3WL9A 3BP7A 1FVDA 2Q86B 1AO7B 4FFZL 1M7IA 4LLDA 4Z7OE 4YHZH 3ARBD 3ULUH 4LPYA 1OM3L 5IOPA 3CFCH 3A6CH 5KG9B 3S35H 1HXMA 3X12A 5IFAL 1F45A 3D0VA 4KK8C 3KS0H 4G6JL 4OCWL 1E6OH 4JJ5B 4FFWC 4J3OC 5LBSL 1KCKA 4OZIE 4NN5C 3DXAA 4ELKB 4WI2A 4OZHA 1T0MA 4DTGL 2HJKA 2JF1A 1FDLH 4PRNA 4L9LA 3ULUE 4P0DA 5I2IB 4LCYA 4XMKL 4OLVL 4PG9A 4PREB 3RNKA 3HB3C 1H3WM 4OCXL 1RAMA 5FIEA 1QKZL 3QPXH 3C9NB 1JIBA 3STZB 1Y0LB 3U4BL 5D1QC 3VFMA 5KVDH 3RHWF 3VU2A 3GHEL 1Z3GL 5HHQA 3S34H 4N90D 2YXMA 3S3JA 1YMMA 1DL7H 3S88H 1QACA 4BZ1L 4WENB 4W6WB 4RFOH 5DLMH 2LU3A 3VD7A 4TVSa 4N1CA 2OSLB 1JRHL 2AJVL 4U49A 3QQ4B 2PO6D 1LP9A 4IOIB 1N64H 1YY8B 5FUCC 5BQ7A 4KJQD 3DSNA 3QWQB 2VLJD 1NBQA 5IF0A 1PD6A 3D39D 32C2A 1CZ8L 1A1MA 5B38G 1VKXA 3ARGC 3VFGL 1FO0L 4PGJA 3MQIA 2GY7B 4OF3A 2WWKO 4OQTL 5TQ0L 2X4UB 2AERT 3DO3A 3QUKA 1E6JL 1UYWL 2QQKH 3DX7B 1CLOL 3LMJL 4P4RB 1A22B 5GJSH 5TF0A 3RY6C 2OR7A 1P4BL 2DL9A 1DEDA 1KACB 3QI9A 4X8JB 4QRQB 1W72L 1HHHB 2UZIL 3Q6FA 3OAYH 5E03A 3EAKA 3UTOA 1EO5A 5FCSH 4MS8C 2PW1B 3GSXB 5IMMB 3PDOA 2MFNA 1T0NA 4YBLC 3LQAL 5D8JL 5DYOB 2AS5M 3UDWA 3ARPA 3EYSL 1IAMA 4GSDL 1G7LB 3VDCA 2G60H 4L8BB 5BV7L 5DR5H 3T0VA 2OTWA 4C83A 3IVKA 4KDWA 4OSUH 3NIGE 4ODHL 2PETA 5E56A 3NCFB 2ICWJ 4QHKI 4N0FB 1XF2B 4XNZC 3VXSA 4LARL 3H9SE 3PL6A 4XVTL 5CHNA 1TTUA 2BY3A 1OAKL 4UV7L 4GS7B 1FGNH 1OAXH 4B50A 1DQQA 3CFDB 4PLNC 1LO3H 4YXKL 4QTHB 3O9WC 3JTTB 4JY6B 1KPRA 3UBXB 4DN3L 2B4CL 3TLRA 3QWOB 5FM8A 4JQIH 1KJ2L 5HYSB 3K8KA 3FRPA 1YY9D 2BY0A 2X5PA 3SKUD 3V0VA 4PD4J 5JHDA 1BX2A 4I0PC 3QIUC 3QNXB 4J3WA 1OTUC 5BS0A 5JQ6L 1U8QB 4NCC2 5I76B 3QPQC 2VZ3A 3HAEH 1T7WA 3BPNB 5CZKA 5SV3A 5M95B 3TBSB 4O2FB 3MNWA 3MODL 1V8HA 5SWQB 4LRNL 4OD3L 5JXEA 5C0JA 1DQJA 4OFVA 5FO7B 1G9MC 5TH2A 5J9PB 4NQEB 1DLFH 2UYLB 1RULH 1VB9A 4AIXA 2GYSA 2DYPD 1P7QA 3GRWH 3OF6D 1A7BA 2GK0B 5DRWA 1OPGL 3SDCD 5BZWB 4ZTOH 1N5YH 4P9MH 1A7NL 1LEKB 1NC4B 2C1PB 3ROOA 8FABA 4PJXB 5EB9A 1OT2A 1GRWA 2DF3A 1WWWX 3B9DA 5D4QA 1CE1H 2F58L 3JVGA 3PWPB 2AJYH 4Q2ZA 2FJHB 3FQRA 5DD6A 5L9DH 4RMVA 4V1DE 1OSZA 5A2FA 2Z8SA 4P23D 4K2UH 4S2SA 3AB0C 3DYPA 1ZWIA 4JG0H 3OHXB 4P23C 3SKOA 3CCHB 1NCTA 3RP1A 4ZAKD 1H3PH 4KK9C 1FFPA 3TV3H 3VD9A 3VFOA 1F58H 4L29A 4ZUTA 5C9JB 5HHNA 4HCRA 1MJ8H 2ZCHL 1F11A 4ODWB 1CR9H 4NZRH 4IM8A 5FYJH 4HEME 5EN2A 1U8IB 5E6ID 2G5BB 4Y2OA 3BWUC 4KK5D 1WZMA 4UIKL 5DQ9B 4OF0A 1Y18B 3MLWL 4Z7VF 5DD1L 3SOBH 4DW2L 1QD0A 4YHIA 2R8SH 2HVKA 3C60C 1JGEB 3OKDA 1HIML 2YD6A 1C12A 3MRBB 3GEWB 1UA6L 2NZIA 4HS6A 4KKBC 4XPGL 2WNGA 4FZ8H 3ARFA 1CLYL 4NO5B 3S37H 1EDQA 4XRCA 2YS4A 5JOPE 3L5HA 1BJ8A 1XF5A 3GB7A 1CDBA 4PP1C 2IMNA 4NBYB 3VFWB 1EHLH 1BBDH 3HNTL 1KG0B 4LCWE 3RDTC 3CZFA 2GJJA 4HXBH 4P5TA 1TXKA 3Q2CA 3TBVA 2FHFA 3GO1L 2LTQC 2IALA 2DD8L 3QUXB 4M7JH 3MJGX 3MJ9L 3VGAB 5DSCA 4MJ5A 3BSZL 1ROWA 3BKJH 5J89A 1LHZA 5C8JB 4WVRA 5FKAB 1VFBA 1JPTH 3BDYL 1T04B 4WW1A 3JWNC 1Z0MA 3GK8L 5E0QA 5CGYC 2I9LB 5E99H 5INCA 1KXQE 2EEDA 5ETUB 2YD2A 4RGMB 1HZHL 3ARSA 3WDJA 2XRAL 1MJ7H 4HQQL 4PGCA 4EI5B 1G0XA 3EDDA 3G04A 3WN5B 3WHE0 1TETH 5JW4M 4Q0XL 3CLFL 4DVBB 2DQHH 3DVNB 2PXYA 2FO4B 3TZVB 4LFHG 4UQ3A 1J0IA 3RWDB 5I19L 1YEFH 3ZT6A 5LQBH 4HKBA 5D2LE 3TH2T 3FJTA 3QZWB 2R1YA 3I85A 2RQ8A 3BISA 3GFUA 2BJMH 3V5HB 3LZFL 4NZJA 3PDDA 3O8XD 4NN6B 4X6BB 4OFPA 4KI5F 1SYSB 5LXGL 4XNXH 2RJMA 1IAKA 5KSVA 3BHBB 5CS7A 1NL0L 4ZOAA 3PNWA 3CH8A 4M7LL 3L3OA 2YKLH 4JGJA 1DE4A 4QOKE 2AGJH 2VLKB 3F7YA 5GHWH 4FQXB 4KI5C 4Q7DA 1OWWA 1Z5LA 4KRPC 3L3JA 2VDLL 1CI5A 1G7MA 4MA1B 4RMRA 1K4CA 3MRCB 1UKTA 1I7TB 4YFEA 1QR1B 3D9AL 3E8UL 3MREB 3RWIB 4IMLB 1IM9D 4LRIA 4DEPC 1A3RL 2YD4A 1NEUA 3BO8A 3FAWA 4LGPB 3RAJL 4PGDB 3MUY1 2F54A 3ISWA 5DJDB 4HUUB 4YAQB 3KYMA 1S9WB 2CDGB 4M02A 5FF6A 4HKZB 4G8EA 4R26L 3MRIB 1EJOH 3ILPB 4HGMA 4X5WB 3AY4A 1G9NC 4M6ML 2Y07L 1ZT1A 4F7TB 2DI9A 5CSZA 3WS3B 5DEGA 1U2HA 3OX8A 1FSKB 5EU7E 3O4LB 4I3RL 4JFPB 5D5ME 4JB9H 3JWOH 1PZ5B 2OTUA 3FRUA 2GJ6E 2V5RA 1AY1H 4KZDH 5I16A 1X44A 3U46B 4XC1L 1JYXA 2X4NB 2VIRB 5AEAA 1QFPA 3ULVF 2H2PD 4LKCA 3K2MC 5LGJA 1EUUA 1GHFL 3LRSB 4ZFFB 5J3HC 3PHOB 3WIHL 3PJSA 2P42B 2W9EL 2XFXA 3HMWL 4JPWL 4I77H 3NPSB 4X6DB 1KXTB 3MBEA 5EZIH 5CBAA 3ULVC 1D5BA 4I13B 3BP4A 4E41A 3I3EA 2ITDA 3T1FB 3RZCD 2VDNH 1QQDA 3RIAF 4JDVB 5DVOA 3D48R 4Z77A 5IB3A 5FOBB 2EIBA 2VDQH 5IB2A 1DUZB 3K4ZA 5DK2A 5F3BB 3ORJA 2GTWA 5FYKH 2R2BB 3BFOA 4PV8B 3RU8L 1IGYB 5IWLC 4KHTH 4AMKL 5I73C 1AR2A 1Q9WA 2XV6B 3L95B 3QAZB 4JG1L 4IRSA 4OLWH 2P5WA 5E4EB 4F9PA 1N5AB 5JTWA 3CVHA 3GSRB 5JPNB 1VESA 4J4PA 1F4WL 2EECA 3EYOA 4OLEA 4FG6C 4XAKE 5FGBC 1ZANH 4JFXB 1N6VA 4ELMF 5BZDB 3OKYA 5E6ZA 5BRZA 3VRIB 4XCCH 4Y4FB 3EOBA 2UV3A 2NY6C 3RWHA 4U1KA 5ACZA 2OJZH 4LOUD 2VMFA 4NKQB 1NDGB 5GS0D 4PJ8C 2HTKD 2DTMH 1R3IL 2Y36H 3TNMB 4QF1A 1DBAL 1NUFA 3ARBB 3CSYA 4GXUN 1DBKL 5EH1A 4FQJL 4EKXA 3RJQB 1AJ7H 1AGDA 3IDXH 2B1HL 4UTAH 4MQXC 4KY1L 1XIWD 3Q3GA 1NUNB 2PR4H 2YPKB 4NN5B 4UAOC 1F6FB 3SCMA 3NZHH 4QGTA 3S5LA 3T08A 3LEXA 3QUYC 1UWXK 2QQNH 2VLME 5B8CA 4RAVB 2K9UA 3EFFB 1ZGLM 1WFNA 4FTVD 1JHLH 5CMAA 1TNMA 5D1QB 2AK4E 3S6CA 3W0WE 4Z78B 3G08A 4WWKA 3UROR 2ESVE 3BP6A 1MFEH 3I9GL 3CFBB 4TULH 1U6AH 2WUBL 1XR8A 2EICA 1FL5A 3ZKND 1HWHB 3IDMB 3RX7A 3MRGB 1URLA 2AI0H 3PWNA 4HEPG 3FO9B 4HF5H 2PO6B 4P46D 4POZC 5JA9A 1IGIL 5SWZA 3ZTNL 2EYSA 4LBEB 5JO5A 1MCPH 2VLJB 1CFQA 4LPWA 1GGTA 3ZYOA 3D39B 1B4JL 1OCWH 3HC3H 3KPPA 4PLJC 5TFSL 1FLTX 5EWIL 2ICEA 2BSRA 2Q8AL 3WFEL 4YE4H 1FZMB 3ZDYE 3F7VA 3SDDC 3UC0L 4X5XB 1A14H 1B0RA 3RBGA 3SDXF 3Q5TA 2AV7B 5H37H 3MCKB 2J8OA 4U1GC 5HHMD 1I9IH 4YDIH 3JUZA 3L3HA 3DOSA 5KSBA 2G75B 5JHLH 5D6DA 3IS0X 5I17A 4I18A 5CJQL 3NN8A 1MFCH 4M8VA 2P43B 4ZDHA 1BQLL 1CFSB 2ZSWA 2FB4L 4PRAB 2L4OA 4PJHA 4JM4L 3HFML 2HT3D 3RVXD 4KUZH 2L0DA 4K7PH 4NKOB 2VXQH 3GJEA 1MHHA 5F9AC 4H1LH 3WJLC 4WEBL 5DMIH 5FDYA 2Q8BL 5IP4A 1A6AA 3PP4L 5C2BL 3X17A 1KNOA 3OB8A 4UINH 4JO3H 1YUHA 3MRFB 2AQ2A 1MWAA 4Y16A 3QDGE 3GBLA 4RMUA 3BGFC 2VDML 4PJBA 4X4ZA 1MJUH 3FMGH 2VYRE 3CUPA 3OGCB 5CAYB 4X4XB 4M9OA 5IMKB 4L8DA 5KBNC 3QQ3A 1XGUB 2O61A 3UJIH 1EEZA 3LRGA 5GS1B 5FO9A 4TNWK 4KK6C 3TA3A 5FECA 3FHQA 4O5LH 3VMPA 4KC3B 3V7AG 3IF1B 3EJJX 5AG9A 2NZ9D 5GGSB 4I0PB 3AS0A 5FO8A 1PFCA 4D8PA 2R2CA 3VI4E 1RD6A 3OBAA 4X6CA 2FR4A 4PGBA 3BIKA 1I8LC 4XVSL 2M2DA 3ULSA 1NGPH 2IPTH 4R7DB 3TBWA 2DDQL 1I85C 1WEJH 3RPIB 3DXAE 5TE7L 3WNPA 2V7HA 3N50A 1YEDB 2C3GA 4ZPTA 4PJIF 4M8QB 2R2HB 5FCUL 4POUB 1QPPA 2DYPB 3RUGF 3S4SA 1LEGB 5KS9A 3SDCB 2NTFB 3IFNH 1CDHA 4HFUH 2C1OA 3LN5A 4UI2A 4KDTA 3KPOA 2HRPH 4L3CB 5DJ0A 1OP5H 4AEHH 1YMME 1X5HA 5DD5L 5GGRA 1TZGH 4U33A 2K7QA 4X9BA 5ELIA 2FX9L 1OAUL 4I3GA 1FNSL 1F4XL 2XQBL 2MKWA 1D5IH 4JHWL 3ARZA 1KCSL 3H9HB 1BQHB 3AMLA 5I1LB 4KJPD 3X3FH 1BZ7A 1RZKL 3EZJB 4ONHB 3ARRA 4P23B 5FA3B 2VWEC 1NGQL 4HK3N 1KELH 3GBNL 4ZAKB 5DUBA 4YWGH 3AS1A 1CFVH 1DN2A 1S9VA 3MO1B 5HD8D 1L0QA 1U91B 1UCBH 5DI8A 5EZLB 1GC1C 1U58B 1H3VA 4HIHA 4HX1B 4LVEA 3RWGB 4GAGH 5HD8C 1ZLVK 1FORH 3E2HC 4R3SA 1QSED 4JFDD 5E6IB 1KIPB 1WICA 4QXGH 1F4YH 1OT1A 2VRAA 4PRHD 1FVCB 3KNBB 5DFWH 4HC1L 4IRZL 5INDB 2F19L 2NY4D 4MVBD 1SM3H 4NHUA 5DT1L 1E4KA 3G6DH 4IIQC 1SEBA 3D1MC 3QUMB 4QXTB 5DF0A 3T65B 5BJTA 5JXAH 1FZKB 1A6TA 5I75B 1GL4B 3O6ML 1MHEB 1J12A 2DQJL 5IB4A 1NCWL 2EDEA 1UVQB 3SKJH 4DGVH 3T4AB 1R3KA 1OHQA 3FN0L 2BSSA 4NQXB 3VFVA 1RZ7L 3GJFB 1YEGH 3DWTA 3LIZH 4I9WE 1HHJB 1JP5A 4I1NB 5IW3A 1KLGB 2YN5A 3QQNA 4M5YL 3UTTE 2ID5A 1IL1B 2CKBA 3A67L 3G6JA 3DVGB 4QXWA 1EA9C 1I7ZB 2V7NA 5E1HB 4F9LA 3ZKXC 3MRRB 1S7WA 5IB5A 4TVPD 1OB1B 4G6KH 1ZHKA 2HFFA 3JWDL 1NQBA 5HVWA 4TTDC 4MDIB 4ZSOA 1FNAA 2Q7YA 1MUJB 2N1KA 4ODTH 4U1JA 3O0RL 3QHZH 5JHDE 2IFGA 5KOMC 4JDZB 1ZA3B 1RVFL 1IEHA 3VFTB 4JO4H 4NO3A 4KRNA 5HGDA 3J8F7 4PY7B 1T83C 1QBML 3NCMA 1YDPB 1UQSA 3QDAA 4Y5XB 1S78C 3EOAB 1WITA 3IJSB 3IT8D 4O02H 2GITA 1QNZH 1N8ZB 4OCNC 1A7PL 2LV4A 1VFOA 4BK4A 2HLAA 2OS7A 3VXRA 2EDHA 4BH7B 5ITBH 4NWUH 2AEPL 4K3DH 3O8XB 2A6DA 2CJUH 1T89A 2FH8A 1GAFH 5DO2C 3UPRB 4KTYA 4CMMB 1UKSA 5I15H 4JPVL 3VWJC 1PG7H 5JW4Q 2Q3ZA 4MXWL 2ADIB 4HCRH 4XT1C 5C0GA 2G9HB 5H8DA 4XHQA 2NR6C 2BRRL 1HCFX 3UJJH 1N7ML 5IVXB 1BLNA 2D0FA 5HVHC 3V6ZA 1JI2A 4Z7WB 3WIIH 2GI7A 3LCYA 7FABH 3H42H 1KPUB 3TVMC 3BZEA 2A6IB 2AABH 2ZJSL 4NSKA 2R29L 4Y2DA 4WUKL 3BEWB 1UJ3B 1IM9B 1YEIH 3CX5J 1IMHC 1RZFL 5IFHH 5L2JB 3FFDA 3U36B 1JGUH 2D7QA 2GQHA 5D1XA 3BE1H 2XTJE 1KIUA 4KKCD 4N0UB 4OZGB 3ULUD 5IVNA 1JNHB 4PG2A 1P9MC 5HGGS 5DQJA 5KTEL 2R1WA 5TE6L 1JN6A 3LKRA 1S7VA 2H9GB 3BKMH 3L5WB 1QLRA 4D9RE 3QNZA 5F3HA 4UT7H 4R0LC 1G1YA 3V6FA 1R24A 3BKCH 2X1PA 1E4XI 2UWEF 4PRIE 2O5ZL 4GMTH 4CUCA 1KLUB 4PJ9D 2JE8A 2X7LB 1HK6A 3X11A 5LWYH 5HGBB 3B2UD 1MI5A 4G3YH 5IHZB 2VABB 2YUWA 4BSJA 2GTZB 4ZUWB 3UYRL 3HI5L 4YPGB 4MZ3A 1YN7B 3LB6D 1B2WH 3L7EA 4RAHA 4PGZA 3RZCB 4H26A 1KCUH 2V9RA 4MCYB 1YMHB 1RIHH 4LHUD 5ICXB 2AVGA 2PKDA 5D1ZD 5BMFH 2IBBA 2IQ9H 4ZMAT 1PQZA 4KMLB 3FFCE 3QIWC 1INQA 3QQ9C 3U30C 3IU3B 3JV4A 5C6TL 2J8HA 4XNYL 1I7UB 3UYPA 4YQXL 4LCCA 1XZ0A 4PJEF 3EO9L 3MV9A 4EI6B 5AD0B 3TNNA 2OL3B 2P8LB 4BM7A 3G5ZB 5IBTH 1CGVA 3EDKA 3NZ8A 5E2VH 1BWMA 2FIKB 4HS8L 1HQRB 1PSKH 3DRTB 2OXHA 4PRBA 1AFVH 2CR3A 5F89B 3FO2A 1HKLL 2Y72A 1SY6A 2EIDA 3G5VB 3NAAL 1KJ3H 3H9SD 2BMKB 4O2EB 5IVZA 1S9KC 1HEZB 2NPLX 2IAMD 3ARDC 5E8OB 1P4LB 5B39B 3I02B 2Y1VA 2GAZB 5ERWA 3GZKA 5EBMA 2ZOKB 2YEZB 5K33A 5BXFA 3K4AA 4PLKC 2MMXA 1U8HB 1PBYA 5JUEH 1WFOA 5ICZB 3KHQA 5C08A 1TMCB 2F54E 1XIWB 4UT9H 5D7JD 1A9EA 2CRIA 3SBWC 1CLZH 5T33H 4FP8L 3DV6A 2YA2A 1NDMB 3PWJB 5D7JC 1HH9A 4RCAA 3F5WB 3P11H 2XZCL 4U1NB 4IEFB 2KBGA 4Z0XB 1UGNA 1KJVB 4WEMB 1Q8MA 3FQXB 2Y4SA 4XP5H 4JFEA 1YEEL 5IEHA 1J0HA 5JORB 5GSVA 4FQCL 4CVXA 3R8BB 4W81A 1I1YA 4RSVA 2JCCA 3CJJA 1LK3L 3SEPA 3QFJE 3SE4C 4NRXA 1T2JA 2EXYD 2H1PH 3ALPA 4P3CH 3E3QE 1FV1B 4X6FA 3UTSA 4CNIA 4FXKB 3MLUL 4ENED 1FFRA 4DCQB 3PGFH 4ODSL 4KJWD 5DUPL 3QEGL 1RPQA 4P46B 3FT3A 2HMID 4LLMA 4U6XA 4V1DD 4YUEL 1PZUB 5IW6B 3GIZL 4HUMB 1OY3B 5C0AA 3ZE1F 1CTNA 4KKNA 3TYGH 1FGVL 5T5FH 5DVNA 3CVIH 1I3UA 3NTCH 5CD3B 5E8NB 4E41E 1UB5B 5JOFB 1R5VB 4RQQB 5LJYH 1YN6A 3TBTA 3X13A 3X14A 2DAVA 2VDPL 3L3IA 3U2SA 5HHMB 3KLHD 5TPWL 3S36H 1ZHLA 3H3BC 3BN3B 1MLBA 3CVHH 1BFOA 4LLYB 3L3DA 4RMTA 3H3KA 3V2AR 4P57A 4U6TA 1DQMH 4FQIL 3QEUA 3T4YA 5JNYB 1A9BA 3RTQD 5I30H 4U3XA 1CXHA 4ZFGL 2EDTA 2O5XL 2E7LA 2ARJA 1EZVY 3W39A 5JZ7C 1JGDA 1T4KB 2ENSA 1A6ZB 2CXKA 5FYJD 1FG2A 2CIKB 2NXYD 2C3WA 4LASL 2CDFA 3QH3B 2FDBP 2DQDL 2FJGA 3RNQB 3T09A 3BGFB 3BP5B 1KCRL 5FB8A 2F15A 1CGSL 5JOPD 5I1GL 1BGXH 1EK3A 1WFUA 1FPTH 1ZGLP 5DK0B 3SE9H 2EKSB 4S10A 1X5JA 2AK1H 3Q0HA 4HZLB 5BRZE 4QTIH 4UDUB 2R0LH 4GQPH 4LCWD 1H8SA 4TPRH 2FYYB 3MRNB 5DC9B 3RGVA 4AEEA 1AXTH 5EOCJ 1YPZA 3D25A 1F00I 4FXGB 4R7NA 4WY7L 4X99B 4X9FA 1JNLL 3ECBB 3REWB 3RKDD 1AGBA 3C8KB 5I0ZA 1FFOA 1P2CB 3IDJB 4D94A 2FWOB 1J1PH 1GXEA 2J2ZA 3UCRA 5CJOH 1L4IA 4Y4HC 4GAYB 6FABL 5I1JL 1Q9LA 1JNJA 4U7SA 1ZS8B 3AAZB 4HK0B 4M6OH 4OI8A 2IANA 4X98B 2UWEE 3G5XA 4FQ2H 4OD2A 2VXSH 2BFVL 4OV5A 4XP1H 4F7MB 3C5ZD 3G6JF 4CN1A 3HI6L 4JY4A 4AIZA 3O6FA 1XF3A 1JZ6A 3VXTB 1GZQB 1W8OA 1RUAL 4Y4KA 4OLZH 3V8CA 3FZUC 3DMMD 1S7UB 1ZA6B 3MC0A 1DVFC 5B38A 4AEIL 2BVPB 1AC0A 3EO1B 2B20A 5E5UB 4NKMA 3RIFF 5I8EA 4L8SB 3D18A 4JHZA 3GSUA 2AXJA 3I3BA 4QOKD 4BQ8A 2HWZL 3BJLA 2R1XB 1JZ7A 1IKFH 5SWZE 5C7XL 4LLWB 1Z6JT 2YPLA 3R0NA 1WWAX 3GIVB 4OF7A 1PYWB 3BN9C 1ZHNA 1R0AL 2R39A 4ALAL 1UACH 1QEWA 2Z4QA 3H8NA 5T1KB 4NC1E 1T21A 4NO2B 4X6EB 4NZUL 2ICCA 1MIMH 2D7NA 3HTLX 3ZKSD 1NSNL 2VL5A 2QSCH 1FL6A 1KCVH 5K59F 2FZ3B 3GSWB 1AE6H 4QHNB 4MX7B 1BIIB 1QSEB 3BMWA 4JFDB 1KGCE 2B1AH 2ZKHL 5E8PB 4K8RC 3ZDXE 1KTDA 3OJDA 3QO1B 1UADC 4UILL 3VGBA 5HHXH 4PRHB 3WLBB 5F7DA 3NMEA 1NMBL 3OKOB 1MWAH 3H0TB 2JIXD 2NY4B 3MLRH 5AZ2H 5TDNA 5EIIB 4PJHE 1A6UL 1ACYH 1XH3B 3OKLA 4QHLB 4JFQA 1G7PA 1NMCB 1JWUA 3UPAA 1XGRB 3C08L 2IEPA 4YIQB 4PJAB 4HIXH 1KBGH 5EU3A 2GJ6D 5AZEH 3V0AC 2AV1A 1JYWA 4MA7H 4G9FA 3K81A 3EW3B 4XXCA 5F1OB 2V5MA 4TOYL 3KPQB 3K2UL 5GZOD 1S5HA 4G8FB 1UWEL 2HTLC 4GW4B 5DWUH 3ZKXB 1TPXC 1GGYA 3DX6B 4QRUB 4BSWA 2D9CA 4EDWH 2CO6B 1HOCB 4XBGA 1PAMA 5EU5B 1X5ZA 2R69L 4NIKB 3JWOC 1IGCL 2R0WH 4LU5H 4ZNEA 3LKSA 1F8TL 2P45B 3PF2A 4OFIA 1JPGA 3S97C 1R3JB 1JHTA 3D2UD 4JREB 2V5SA 4X6CE 2R4SH 2EDNA 3ARYA 1LMKA 4OM1L 4FMKA 4PTUA 2BP3A 2BVTA 2MQCA 4NQUA 5ESVB 1ZT4B 5GJTH 5J6GA 3STLA 2VE6A 4NO0A 4YDKH 1Q0XH 2RCSL 3T3ME 2N7BA 4PTTA 4AJ0A 1WVZA 2ZUQC 4J23A 1MLCB 4UIMB 1UB6A 3OKNB 5DFVC 1U3JA 2C3VA 3EYFA 1T20A 3MJ7A 3QUML 3FO1A 4XH2B 5EO1A 3DUSB 2YSSA 3P73A 5IG7A 2VDOL 4E42A 3F58L 4LNRB 4XAKD 1CGWA 3RVVD 5E08L 3UEZA 3PXJA 5KN5A 5F1SA 2BCKA 1MIEH 5C0NC 3U4EB 5I8OL 1VPOH 3NCEB 1P7HL 4M1GL 3JXAA 2GJZA 3LDBC 4GRWH 3L5XH 4WO4C 4UNTA 3ZT5A 1M05B 4JZJC 4UUJB 4LGRB 3VW3H 1MCOH 4HH9A 3VXMA 1VADB 1ZK9A 4OM0L 5EO0B 4LSPL 5CILL 1MHPL 5E00B 2OP4H 3MRPA 4OLYH 1KULA 3VFPB 2DQIL 2FBJH 3MUGB 4WUUA 4GRWE 4YHKH 1TITA 1A6WH 1FO0A 5HI3C 2EDKA 2M26A 3OAUL 4YDLC 3VFUA 4OZIB 2E3VA 2VLMD 1CICA 3U9UB 2PN5A 1MAJA 1YNKH 1KCLA 4TUOB 1IFHL 1XF4B 4LIQL 3LRHA 4OAWA 1NCBH 5F1KC 4F7EB 1CK0H 2ZP0T 3RVTD 1BEYH 4NWTL 2QHRL 1M4KA 2AK4D 5IROA 1W72A 3W0WD 1ORQB 5F96L 2ESVD 1P5VA 2J7LA 1DANU 2AXFA 3QFDA 4ZD3H 3EYQD 2GKIA 4LEOA 5FM5O 2PW2A 2CDEB 1RIUH 4NNYB 2UVEA 4X7SL 5LGHH 3E6HA 4YX2L 4JFFA 4JM2D 5DD0H 3KPLB 2VLRB 5FM5M 3WO4C 3Q6GL 3CMOH 3VH8B 1AQDA 4ZG1A 5F44A 1HXYA 1NCDH 4Q6IB 5F7EL 4PJ9B 1RSFA 4N8CH 4EVNB 4X4YB 3WEXA 3FB8A 4G7YL 3G6JE 4AT6A 5DDHB 1VACA 2P7TB 1FBIH 1K8DB 3MRQA 1ADQA 3OKKA 3EYVA 4HV8B 5DJYB 1R3LA 5MEOA 5AWNH 5EZOH 5A40E 2EC8A 1EIBA 4ZTPH 2GFBA 3NFSH 2DMCA 3H3PH 5F6HI 1KJ2A 2X09A 4LHUB 4NC2B 3T0DA 1CDGA 5D1ZB 3KYOA 2O5YL 3U30B 3K8MA 1R6VA 4H5SB 4NUJA 1C8PA 1TZIA 3UTPE 4HS3A 4UU9A 2CLVA 3V8OA 4FFYL 3UYOD 1TZHB 4XCFL 5I8CB 3HRZB 1INDL 1NCAL 3BAEH 3TT1L 1VEPA 3K7UA 3R06B 2E7MA 1CG9A 3B83A 5IIEA 2F5BH 4PJ7A 4KVNH 1WZ1L 2D7MA 4YHYC 1K2DB 5HHVH 3MYJA 2V6HA 2CLRB 4QRPA 2PYFB 3MOQA 3B9KC 4LSSH 1CDIA 3WKML 5J1AB 1WC7B 1MNUH 3QCTH 3VXRE 2Y5EA 4QNPF 2XPGB 4E5XA 3U7YH 2AKRB 3QDGD 2BC4A 3H9SB 3IU4H 3IJYB 2BOCB 3MLXH 2XXMB 1J1OH 2IAMB 2F8XC 1LO4H 1YC8A 3KYKL 4JKWA 4LSRH 2DBLH 3VDBA 1JF5A 4IRJD 1DFBH 3IGAB 1R5IA 4JCMA 1S7SB 3B8SA 4XC3H 3O6LL 3W11C 5I1DB 4HJGA 4JY5H 4C57C 3MOAH 4F58H 3FCTA 3MV7A 5F7NC 1MFBL 5IMLB 4XCNA 1XGPB 3MUHL 5D7JB 5K9JH 3LKNA 4R96B 5C09A 4K94C 3NCBB 3AS3A 3DXAD 2ED9A 5F1IA 3EO0A 5E94A 3DARA 1L6XA 3VJ6A 1KC5H 1FVEB 2A73A 4DZ8B 1KIQB 1KSRA 3T2PA 3EDFA 5EOCH 3SKNA 5K9KB 5SX4I 3BKYH 3VRJA 5E5RB 5EBLA 3KLDA 4ONGH 2OL3L 3MRDB 4MYWB 3AU1A 1RHFA 4EBQL 1I9JL 4HW6A 1YMMD 5IQ9A 3G9AB 3EZ8A 4QGYA 3O4OC 1E4XL 4RWHA 5GGVH 1D5MA 5BVJA 2RFXB 3FONB 3TYFA 4YZFF 4XZUB 1F2XK 1OTTD 3IETB 2E27L 4JFHE 4XNQB 4ODVL 2XTLA 3SDAD 3MLVH 4GKZB 4V1DB 2VZOA 4ZFZB 1QPXA 2KKQA 1WQVT 1GGIL 1XCTA 4ZUUB 1MI5E 3CDGA 3EJYC 4GG6A 5CKGA 4GAJH 1ZLWH 1IKNC 1XGQA 1C5CH 3RI5F 3IAPA 4CU6A 1S9XA 4QRSB 2W9DL 4X0KB 3SDYH 4OKVB 3W2DH 3MJ9A 2GT9B 4Z7UA 5EFIB 1HYSD 1NBZB 2J12B 2XZQL 3MRHB 3QI9D 2ED7A 1S7TB 1XR9A 3I84A 1U93B 3HG1A 2EDXA 4IHOA 4KV5E 4RMQA 4M7KL 5ID1A 2IADA 2YUZA 3MV9E 4AENA 1OSPH 3RTQB 5EO9B 4X7TA 4M4PA 1GGUA 3I6KB 4LLVA 2ITCA 1ND0A 3P30H 2LVCA 4QO1A 4U31A 4F7CB 3MJ8B 1XF1A 3KXFA 1E27B 1CWVA 4PS4H 4EOWL 2Q76B 4YBQC 3WXVH 4LGSB 1TVBB 4NPYA 5LAXA 4OZ4A 3FT4B 4XMPL 5DURD 3V4VL 2NX5A 4MA3A 4OJFL 5I1HL 4I9WD 4O51A 3PL6D 2DM3A 2CUIA 1CXFA 1I7RA 3I75A 1CVRA 4H25A 3UTTD 4LCWB 3QUZA 2GSIA 2R23B 3HR5B 3MGOB 3GJFK 3VGDA 3O3BA 3PWVB 3ARWA 3VXUA 4HPOL 4K3EH 5GISL 4CU7A 2XWJB 5FHAL 3NH7H 4LPTA 1P84K 3OAZH 5JHDD 3BYTA 4DUVA 1W0YT 3LQZB 3GKZA 5C08E 1ZHBB 3MA9H 1HILB 4JAMA 1Q0YL 4XP4L 1HKFA 1TJHH 5GGTA 2DN7A 4X7CC 1EEQA 5GZNC 3N85H 3GHBL 1JK8B 4AH2B 4UTBH 5JXED 5CEZL 1V7ML 4KHXL 4PJFA 2HLFD 5D2LB 5ITFB 5JXEC 1RZ8B 4JFEE 1P7QD 5M7QA 2MCPL 5IKCA 1IBGL 3P0VL 3LV3A 3DSFL 4XP9L 5F6IB 4GXVL 3KPSA 1CQYA 1D9KC 5FM4A 1J11A 4K9EC 1P53A 3DMMB 2JCCE 5EBWB 3BZFB 3VG0H 3P4NA 3E6FA 5TDPB 3B6SA 2BOBA 3UTSE 2BVQA 3SGEH 1WBXA 4H0GA 4RFNC 5ALCL 35C8H 3QULB 5HY9B 4TRPL 1IILE 4QOKB 1UC6A 1X5KA 5A2KH 5HHOA 5T3XH 5D7SL 1LE5B 4O4YH 1K6QH 4XWGH 1DUYA 5C0AE 1J5OL 3BW9A 4G6AC 1RUML 3O6KH 3WIHA 4AL8L 2A9ML 1FNLA 4OCRH 3EGSB 4P99A 4NKIL 3EYUH 4Y5VC 2QHLA 3MZTA 4NT6A 3REVA 1JYNA 2EZ0D 4TUKL 5IEKA 3TFKD 3CC5A 3P4MB 4AM0B 1OLLA 5T3XE 2XTJD 3TFKC 1UENA 4IOFC 3CU1A 5L7XL 5H94A 1Q9KA 4HBCH 4CDGC 4Z0BH 5EUOF 2JIXB 4G5ZH 3QXTA 1U3HA 3GDBA 2QSTA 3TO4A 1F3JB 3C87A 4WW2B 2IH1B 2YZ8A 3DYMA 1WZKA 2X4RA 3T2OA 4HKJB 2CPCA 1CGTA 5D5MB 4D9RD 4NN7B 1U8OB 1MAKA 4EN3A 1AIFA 3ARFD 4JKPL 2Z8WC 5MERA 4PRID 5AAWA 3MLYL 2JJUA 1TPXB 1ZEAL 4FQPA 4MXQD 1KN2L 2R4RH 4PR5A 3MXVL 2HG5B 2QL1A 2IBGA 4P5TD 4RX4A 5T5NF 5EZJB 1YPZE 1SBSL 3PHQB 3NBNA 4TSCL 5D72L 1QA9A 4Q74A 1Y6NR 5MEPA 1FL3A 4X8XA 1U2CA 2K7PA 3LHPH 4RWYH 1SYVB 4O2CB 5GS3A 5BVPH 1A7RL 1BZ9A 1QYGL 2A1WH 2IPKA 3D2UB 4QWWC 1D5XA 3FFCD 1GC1L 4KJYB 3VDAA 4YHLL 3K80A 3HCVA 4HUWA 4F80A 2IANE 4U1SA 4FTVA 4ODXA 4XPHH 4TSBH 3N9GH 3IFOA 4KPHL 1G9EA 3NPZB 1UJTA 1M7DA 2PXYD 4Q97A 1KJMB 3CLEL 4O00A 2WQ8A 1MEXL 2CK0H 4LDOB 4CU8A 4OB5H 5DXWA 3VWKA 1MJJB 9CGTA 3GMOA 3K1DA 1E4WL 2J8UA 1CFNB 1N6UA 4RMSA 4KZEH 5HGAA 3HPLB 5CINL 3QEHA 4GRLA 4NUGL 5C3LD 4LHJB 4MB3A 3BUYA 1RQ5A 6CGTA 1F6LL 3ZHKA 4DGIH 4WV1B 3C8DA 4LSQH 3T3PF 2UVFA 3PXHA 3T0EA 5J12B 3D0LB 4LQFH 5C0DA 2GSGB 2VKXA 3QIBA 1FZOA 3JV6A 1I8KA 3NIFE 3M07A 4JQXA 4OGYL 3UTZB 2V2WA 2YPLE 3BVNA 4J1UA 4ZXBA 5DRNA 2Z31A 4Z18A 4WU5B 1TFHA 4TVPL 3IXTB 2X4SA 3NOIA 1FRGL 5F1NB 2CO7B 3U6RB 4NCDA 2VQUA 4FRWA 5D93C 1CCZA 4EXPX 1R5WA 3GMRB 4PRDA 5D96C 3TH4T 5L8JB 1WFTA 2F54D 3MACH 2OK0H 2HT2D 3O2WH 3FB6A 3GI8L 2J88L 4N5ED 1J10A 1LE9B 4MQ7B 4XHJC 2OZ4L 2PTVA 3LKQB 1IAOA 3M17A 1LDPH 3GUTB 4MJ6B 4UMGA 4APQC 1A47A 1DBBH 1A0QH 1RZIA 3LKOA 3GSQA 4U6VH 2ENYA 4R2GD 2H2SD 1FIGH 3AY4C 3W0WB 4LSTL 2V5YA 2ESVB 5DGQA 3HE6C 4NRYA 4L8CA 4NQDA 2ICWB 3QNYB 1I1AC 3KJ6L 4M1CD 5TE4L 3QFJD 4I3SL 4O58H 3VE0A 2QBWA 2R2EA 2XNAB 1A5FL 4EUPG 2AJSL 3O81A 3WO4B 4OCYL 2YWYA 1N2RA 4JM2B 4M43L 4MXVF 4G9FE 3U9PH 3MCLL 4G8IB 3PIQA 4PJCF 4G8GA 4JQVA 2GUOA 4UDTB 3S7GA 3T0AA 3CFJB 4ZOBA 4F2MA 1RZGA 4KXZH 4DGYH 4J6RL 5JQHC 2E5EA 4GRMB 2X41A 4HXAL 4FFVC 1OTSD 4BUGA 4LP4A 5J7CC 4RGNC 5KSAC 3MBED 4JVWA 5B3JE 1PY9A 3P9LB 1E0OB 3MSPA 4D0BB 5E2JA 4E41D 4XWOD 3V52H 2DQGL 5IGXL 4ZNEE 5LCVL 2O26U 3TC9A 1S7QB 3OWEA 1T1WA 4XGZB 4L4VE 3KPNB 2UZXB 3M1BA 2BY2A 4UV4L 5CEYB 4LCIL 1H8OA 4NFDA 2CD0A 3HUJA 5KW9L 2ZSVA 4Y5YC 3S96B 3TJHC 3VFRA 3HE7D 1U8KB 5CJ5A 2BK8A 4KKAD 4YHZL 4QLRA 3VD4A 3DVIA 4HAFA 4YEEA 3ULUL 1MHCA 3D69A 4X80L 1I3GH 4IRSD 1SJEA 3A6CL 1AGEA 1YNLL 4RFEB 4P4KA 1G7HB 3S35L 1KB9K 4MDJB 1EHXA 4X9IA 3LS5H 4MNQA 3RWEA 1E6OL 4UNVA 1YNTA 1OW0A 1T66D 3QDGB 2EE3A 4J4PC 4CN6A 1MCJA 1PY4A 3OZ9H 1T66C 3CPLA 5BRZD 4N8VB 1FDLL 1PKOA 1RHHA 5SX5K 1RI8A 3U79A 1FO0H 3QPXL 3CGTA 4H1LB 3TCXA 2HFGL 4IRJB 5KVDL 3DECA 4U0RB 1KYOK 3EOYG 3WL9B 3BP7B 1FVDB 1M7IB 4LLDB 3S34L 3V6OA 1UYWH 2ADJA 3LMJH 1DL7L 3WUWG 1P4BH 1NFDA 5IOPB 4G42A 1FQ9C 4KQ3H 2UZIH 4RNRA 1HXMB 3SPVA 3X12B 4WUUE 3D0VB 2VNCA 4B5EA 3IFLL 1AKJA 2DQEH 4HG4J 1OL0A 4M5ZH 4OT1H 1BM3L 5JA8B 3QXWA 4RRPG 5MENE 3LQAH 3DXAB 5T1DH 3SCMC 3WNKA 5AUMA 3TIDA 5JW4N 4OZHB 1T0MB 4P2OC 3TO2A 3MTRA 2HJKB 3EYSH 2GHWB 4PRNB 1F4AA 4GSDH 4L9LB 4LCYB 4NZTL 4PG9B 5FK9A 3RNKB 5BV7H 2EC9U 2HN7A 4F33A 2VZVA 3VFMB 1ERNA 4WWKD 4TNWF 2IFFH 2HJLA 4LARH 5HHQB 2WWMD 1R3HA 2QQKL 4LQ1A 1YMMB 2CIIA 1F90H 5GRUH 4UV7H 2C3HA 2EDBA 1NGZA 4HWBH 1ADQH 2R9HD 1ORSA 4I48A 4JFFE 5HTSA 5TF1H 2YD8A 3BDBA 1LP9B 4JPKH 3OXRA 2W0FA 3I50H 4QHMA 1KJ2H 3DGGA 5BQ7B 3C6LA 5SWZD 2W0LA 5IJKA 1CVSC 4JKKA 5IF0B 1MF2H 5HDBE 32C2B 3O3EA 4AG4L 1PLGH 5L6YH 4IMKC 1A1MB 4PJDA 2IH3A 1RK0A 5DR5L 5JQ6H 1H5BA 1VKXB 1VGKA 2YRZA 4OSUL 4B53A 5FOJA 4JLRA 3FOMA 1YJDC 1P6AB 4GBXC 5IHLB 3C2SA 2HT4C 3QUKB 2VR9A 4LRNH 3FL7A 4JGUA 4CMHB 1N26A 4P9HH 1FGNL 4PJGF 1KGCD 3QI9B 1LO3L 3Q6FB 3AFLA 1WAAA 1SEQH 4GMSH 5C6WH 1CGXA 5GPRA 5MI0B 3PDOB 4XP6H 5C2UB 1T0NB 3RZWA 1YQVH 2YD5A 1KEMH 3L3GA 2Y6SC 4WFGE 4KUCF 4QRPE 1ETZA 1EXUA 2OTWB 4C83B 4EZMA 3IVKB 3MA7A 5F70A 3OKEA 5LGKA 2FGWL 3DGCR 4Y16D 4MAYA 2J5LB 5I1EL 5EU6A 1TNNA 3VXSB 3PL6B 4FQQA 4LVHB 2OI9B 1XGTA 5CHNB 2H32A 4U1IA 2OTPA 3BT2H 1DQQB 3FQWA 4OCLC 1RULL 3GRWL 2R0ZH 3GMPA 1F5WA 1OARH 1KPRB 2IBZY 2ZCHH 4ZTOL 1TENA 3TA3D 1HHGA 4JHAH 3V0VB 5LVEA 3KPMA 5JHDB 4KGLA 3MV7E 3ZSSA 5B3NA 1BX2B 3VGGA 1B9ZA 5BS0B 1CE1L 4ODUA 4H20H 4BQ6A 3MLWH 5I74C 5L9DL 4M93C 5DD1H 5C09E 4DW2H 4JRXA 2WP3O 4J3SA 4K2UL 4K3GA 3MNWB 1HIMH 1OD9A 4JG0L 4L1DA 1JZ5A 3OG6B 5C0JB 3MLPA 1DQJB 5TH2B 5ILTH 1H3PL 3FTGA 3C6SA 2VH5L 3TV3L 2C4FU 1P7QB 3I6LE 1F58L 5DRWB 1MCWM 1MJ8L 3VCLA 2AEQH 4GKSA 5I0DA 3BZDA 1KTLA 1CR9L 3ES6A 4NZRL 2GIYA 5FYJL 3HNTH 1JRHI 2F8OA 3ROOB 8FABB 3OKMA 3GO1H 5CJXC 1OP9A 2A6JA 4JKLA 1CU4H 2RHEA 3MJ9H 4Q2ZB 5GS2H 3FQRB 5DD6B 3HHRB 4NRZA 5EULV 4M48H 1OSZB 1MCDA 4HK3J 4JRYA 2N56A 4S2SB 1ZVSA 1L7TH 3SKOB 1ZWIB 5JW5A 1H3TA 4LAQH 3GK8H 4YC2C 1FFPB 3QXAA 2WMPA 3PG2A 5E5MA 4P3WA 4LF3A 3VFOB 3AREA 2XRAH 4L29B 1EAJA 3B9AA 1EEUA 4ZUTB 3S37L 4P59H 3BPLC 1NANH 3PGDA 5HHNB 3KDMA 1F11B 4Z7UE 1DQDL 2P1YA 3VG9B 1EHLL 1BBDL 5EN2B 5D7IA 3MOBL 4HXBL 3MGAA 2EYTA 5ID0A 4M7JL 5DJDA 3HG1E 4X4ME 3WFDH 5BW7C 4LVNC 3BKJL 5GGSY 1CDUA 2XN9E 2AXGA 2D7OA 4YHIB 1F13A 2HVKB 1JPTL 3OKDB 4AIOA 5D9SA 1MY7A 5DZNA 2EEBA 4U3HA 4ZO6A 1C12B 4MNGA 1G7QA 3A6BL 5F8RC 3MNZA 1B4RA 3KXFE 4HS6B 1NL0H 1YYLL 2Q20A 4M7ZC 3ARFB 2QADD 1C08A 2H3NA 4XRCB 1IC1A 4B41A 3SE8L 3NGBC 5D2NE 2NX5E 4BZ2H 1TETL 1XF5B 1DP0A 2DQHL 3GB7B 2DJUA 1CIDA 3Q1SH 5HI4D 3RGHA 2VOTA 5LQBL 1YEFL 3CZFB 4NHCH 2X4TA 2FHBA 1RJLA 4P5TB 1A3RH 5ISZA 2IPUG 3TBVB 3RAJH 5GGTH 2IALB 3FQTA 4QHKJ 5JIIA 2BJML 2IGFL 3BQUA 3VXUE 5DSCB 4MJ5B 1QRKA 1Q72H 5ESAA 1VFBB 3O2DA 4XNXL 3I2CH 1DCLA 3HAEG 4WW1B 3KYAA 4NFBA 2D7TH 2UY6A 1WBZA 1U8JA 3MV01 3UTPD 1KTKE 3DIFA 5C70A 3HS0A 5INCB 5IM7A 2QQLH 2YKLL 2Q87A 2AGJL 5GHWL 4PGCB 4K8RL 3G04B 1OGAA 3EFDH 2X1QA 1NBYA 2PXYB 3QR2A 3WD5H 5JMOC 4OUUA 2A6KA 2EDYA 5C0EA 4UQ3B 1V3MA 1D6EA 4PJFE 1RJYA 4HKBB 1LVEA 5B4MD 2R1YB 2VB5A 4BZYA 1CQKA 3W9DA 5B4MC 3VXRD 3KPSE 5J1TC 3CXDL 3WJJA 1JPFA 1WGOA 3RVUC 1A1NA 3WIHH 1EJOL 3SN6N 3B43A 5KVGH 1IAKB 3HMWH 3B3IA 1P4IH 1U8NA 4PLOB 5KSVB 3TN0A 2DQUL 3PNWB 2BVEA 2XXCB 3L3OB 3NIDF 1DE4B 2J4WH 3HC0A 3F7YB 3OAYK 4NJAL 4YNYA 1Z5LB 5HHOE 3L3JB 4PBWD 1G7MB 1K4CB 1T6VN 4WHTA 4JB9L 3SE3C 3JWOL 4Y2DD 5I18H 1AY1L 4KZDL 5IBUG 3UAJC 1ED3A 3BO8B 2QSVA 2FRGP 2F54B 5TJWK 4YEFA 3BDXA 3KYMB 5FFLA 2HKHL 3SKMA 5FF6B 1Q94A 4G8EB 1E4JA 2WK2A 4JG1H 4ZOEA 1F02I 4KTDL 3I3DA 4CADA 4BFGA 4R97B 5D1XC 4I77L 5EZIL 1HHKA 4EIGB 1QTYT 4R2GB 3R4DA 1ZT1B 1F4WH 3AROA 1KENH 5CSZB 8CGTA 3E0GA 2BXZA 1IVLA 2P4AB 5GS0H 5DEGB 2VDNL 3OX8B 5DJ2A 2W92A 4PUBH 3LH2H 1HNFA 5JR1H 1TCRA 1VA9A 2WLZA 43C9A 2OTUB 3FRUB 4KKLC 5I16B 1OAYH 3INUH 3LS4H 4LDLB 1RZKC 5DJ8A 1NLDH 5FYKL 3V7AE 4JFHD 1R3IH 3DX9A 4GS7C 4LKCB 5LGJB 4KHTL 1CXLA 2L7JA 1W0WA 4XPBH 1UXWA 5BO1L 1DBKH 2F8VA 4Y89A 4RGNB 3PJSB 1ODAA 1KT2A 2XFXB 1MI5D 1IE5A 1CFTA 3MBEB 5CBAB 5A3ID 1D5BB 1XGYL 4QRRA 3BP4B 4E41B 2ITDB 4HUKB 3WFCH 5HDLA 1ZANL 1QQDB 2SEBA 1A3LH 3ZYZA 5J8OA 2FL5A 3ARGA 1QLEH 4Q9QH 4U1HA 4Z77B 5IB3B 5IB2B 3F7PC 5DK2B 1T03H 3BPNC 5J11B 3C5ZA 2OJZL 1DDHA 1S7XA 2GTWB 1S8DA 3KWWA 1J05B 2VDRL 3QHFH 3P77A 3RY6A 4D9LL 2PUQT 2DTML 2Y36L 3MV9D 4JGMA 2DL2A 1IC7H 3EJZC 1Q9WB 5KOVC 4IRSB 4PJXF 3FQNA 5DVMA 1AJ7L 2P5WB 3IDXL 4M3JA 4UTAL 3CVHB 3EOTL 5HYQA 2PR4L 1MFAH 4PY8I 3PABA 1ZOXA 3EYOB 4HUXA 5C92A 3NZHL 3ZTNH 3GKWH 3V5KA 4ETYA 5BRZB 3KHOA 1N6QL 1JHLL 4NM4L 1HSAA 3EOBB 4UOW1 3T0EE 5EWIH 3T2QA 5K9QI 1KUMA 3RWHB 4U1KB 1CD0A 3P3YA 3UC0H 5ACZB 3JWDC 1L9MA 1CDCA 1MFEL 5EU4A 1XMWA 4OIBA 4QF1B 3CSYB 3O9WA 1FN4A 5CLWA 4LVOB 5HI5D 2CGRH 1AGDB 2AI0L 4EQ3A 4QXUH 5C08D 5J13B 5SX5H 1BQLH 3Q3GB 1EUTA 3UJTL 2EYRA 5I8KL 3SCMB 2DB8A 5HYEA 3S5LB 3LEXB 2V17H 5TQ2H 1MCPL 1G6RA 1VERA 3QIUA 5B8CB 2QV2A 3HC3L 4WEBH 5CMAB 3F62A 2Q8BH 4JFED 4YE4L 3G08B 4WWKB 3SQOH 3BP6B 5EC1A 5CWSA 4LPCA 2GJ6A 5DVKA 3WHXA 1I9IL 5E9DA 4YDIL 1XR8B 1FL5B 4ZYKA 1Y6MR 5JHLL 5CZXC 3UTSD 1RFDH 2VN4A 3PWUA 1SJHA 3VA6A 4UB0H 3PWNB 2BSTA 2IJ0C 1MFCL 4S1QH 12E8H 4G8GE 1S7RA 4Z8FH 5JO5B 5SWZB 2EYSB 4KDVA 4KUZL 1CFQB 2VDKH 4K7PL 5C0AD 4MMXC 2VXQL 3QUXC 1O7VA 3VGAC 4GT7A 2RIKA 3IJHA 3KPPB 5DMIL 1JNNH 2ICEB 2BSRB 2DI7A 3D5OF 4XVSH 3VRLF 2AJZA 3F7VB 3CIQA 4UINL 3ZYJA 4JVUA 4JO3L 4XNMA 5K93A 1B0RB 2X1XR 1H0DA 1CS6A 2XG4A 3ARXA 1MJUL 4N1EA 4K3JH 5T3XD 3L3HB 4RGMC 5KSBB 5FCUH 4K94L 4EI5C 5I17B 4I18B 3WN5C 3PV6A 4RGOL 3CXHK 3NN8B 3HUJE 3UJIL 3NIDE 3CH1A 1HYRC 4ZDHB 3UXFA 3ZE2E 3L6FA 2ZSWB 1V05A 2X9XA 4ONFH 1ZE3C 4PJHB 5H2BA 4O5LL 3A6OA 3RVWC 4YJZL 5DRZA 1EGJA 3GJEB 1MHHB 1F4XH 3OMZA 4NN6C 3G6AA 4XVUC 1A6AB 4MNQE 5C07A 3ZKMD 2FO1A 1RURL 1KNOB 3C60A 4XCYA 5I1KH 1NGPL 2IPTL 1YUHB 1MWAB 4Y16B 1WEJL 4OF8A 4PJBB 1WK0A 2FEDC 3CUPB 4Z7VA 4FQXC 1MH5A 5JW4R 3RGVD 3QQ3B 2BNRA 5CBEA 2O61B 4H0IA 1EEZB 4MA1C 5FO9B 3IFNL 4HFUL 1CE6A 3WV0A 3TA3B 5FECB 2YD3A 2HRPL 3BOVA 3RDTA 2LU4A 3G5YA 3V6OE 3LD8B 1TZGL 4CW1A 1NFDE 5FO8B 4YDJA 3U7WH 4HWEL 4D8PB 1D5ZA 3ARVA 4X6CB 4TQEL 2FR4B 1D5IL 4PGBB 3BIKB 4WHYG 3SY0A 2IAND 3ULSB 3X3FL 2NY3D 3TBWB 4GQ9H 2AK4A 5I71B 2V7HB 4OZFG 5FUOH 1NCWH 1JGLH 1KELL 4ZPTB 2OQJA 4YWGL 4RA0C 1BF2A 1CFVL 2JJTC 3S4SB 1FSKC 5EPMA 5KS9B 1NGWA 1RZ7H 4HT1H 1K8IA 3O6FC 2APFA 4UT6H 3MV8A 1MQ8A 2C1OB 3LN5B 1UCBL 3KPOB 5DJ0B 4Y4KC 4M5YH 4GAGL 5GGRB 1BAFL 3A67H 1OGTA 5IT2H 4X6DF 1F4YL 4JRWA 4HHAA 4LMQI 1QHPA 1SM3L 3G6DL 4N0YH 1BZ7B 1ITBB 2IC2A 1G6VK 1VGEH 1FZJA 5JXAL 2C9AA 2YPLD 3NPSC 2P49B 2PNDA 4YC2B 3MRMA 3D87B 3OJMB 1Q1JH 5J4MA 4BH8A 1YQ2A 4U1LA 5DUBB 4PJDE 4ZUSA 2NY0D 3SKJL 1TQCC 2EH7H 4DGVL 1RVFH 4HMDA 4LPUA 1K4DA 4GRWB 1S9VB 4U6HA 1YEGL 2M1KA 2VJXA 5F7UA 3LIZL 3FOLA 5DI8B 3HMXA 2BVYA 2NYYD 2Y5TA 4Z6AT 4HIHB 4K71B 4R3SB 1WLHA 2NYYC 4XBPA 4ZOCA 4K7FA 4OCSH 4MSWA 4BFIA 1XCQA 1WAAE 1AR1C 4NHUB 3F8UB 3QAZC 2V2XA 1SEBB 2H32H 2QQQA 2C5DC 3H9ZA 4YDVA 5BJTB 5E4EC 1QOKA 1A6TB 1G7IA 5IB4B 1ULVA 4K9EL 1R3KB 4AY0A 2BSSB 1IQWH 4G9FD 4JO4L 3V95A 1HNGA 3VFVB 2QADB 2P24A 1FYHB 5FYLL 1J18A 4XXCC 4Y4FC 5EU6E 4S1DC 3H6JA 4YLQT 5KJRL 2CKBB 3G6JB 1QNZL 2V7NB 5IBLC 1OP3H 1S7WB 5IB5B 4UQ2A 1CTOA 3JZ7A 1ZHKB 2A83A 3ARBC 5ITBL 2HFFB 4NWUL 4K3DL 3MLZH 2CJUL 4ZSOB 2Q7YB 1MCWW 4WNQA 2DRUA 4HIJA 2D2OA 4U1JB 5J1SC 5F71A 3QDJA 4P5MA 4PD4K 4L4VD 5I15L 5FDWB 3SGDI 1PEZA 3MRLA 2APWA 4WI9A 1GPOH 4HCRL 2XQYK 4NO3B 3WBDA 5HGDB 1LO0H 1EEYA 1TQBB 3UJJL 5TE6H 5I1AA 5IV2A 3QA3A 4JRXE 3WIIL 1KLFA 4NO0D 4KRLB 3H42L 7FABL 5GRJH 3QJHA 1Z9SA 4L1HA 3U1SH 3UP1A 2GITB 4HMCA 5D7KE 1MFNA 4BKLA 1YEIL 2HLAB 3VRLE 5IWLA 4F8QA 3VXRB 2VXTH 4HIIA 2A6DB 5IFHL 1JGUL 2IF7A 3AGVA 3LQMA 1G0DA 4WI8A 4KTEH 3SDAA 2XICA 4YH6A 2PO6C 5CCKH 5I6XB 2YRLA 4ISVA 3MNVA 4BQ9A 4KJQC 5FGSA 4F15C 5C0GB 5FGBA 4U2ZA 3OQ3B 3UYRH 2DMKA 4S11A 5IFJA 1ES0A 3EHBD 1BLNB 1S5IH 4RAUA 3V6ZB 3VXMD 3BKML 4JRYE 3UBXI 2XWBA 5I66A 3BZEB 4M3KB 1QFUH 4NSKB 4Y2DB 1MVUA 4PJ8A 4UT7L 4ELMA 2H41A 1UZ6E 4WUUD 5DJCA 3LN4A 1BWWA 2ERJB 4GMTL 3FFDB 4XVJH 1ZMYA 5MEND 1CICD 5D1XB 3HKFA 2XA8H 5D7IE 1BIHA 5M94B 4G3YL 3FT2A 3RY4A 1DTUA 1EMTH 3QUYA 5DQJB 4HDIA 2R1WB 1FE8H 1B2WL 1WISA 1QFWH 2J3SA 4S1RH 1KCUL 1JN6B 3LKRB 1S7VB 1RIHL 2DS4A 1GZPA 1PEWA 5BMFL 4MNGE 5DEZA 1QLRB 3HPJA 1SVZA 2X9YA 3QNZB 5F3HB 4WI3A 1NAML 3RX5A 4JFFD 3V6FB 4QEGA 3RWCA 3UTTA 1R24B 2ZCLH 1LO2H 3O2DH 2NY2D 1AGCA 3B5GA 4X9GA 5FAAA 2EIEA 1U0QA 5IBTL 3BXNA 3X11B 2DJSA 4FXKA 5GS1C 1MI5B 2PTTA 1C5DA 5ISZE 1PSKL 1YY9C 4ZPVA 1JZ8A 2A77H 3L7EB 3GSNA 4H26B 1KJ3L 1J1XH 4LFHD 3L5JA 3SGJA 1OP5K 5E8EA 2AJ3A 4LLUA 1NEZG 4NYLA 4FQHA 4X6DE 5DMKA 4P5KA 3SDDA 1PQZB 5ANMA 1IARB 1INQB 2RR3A 1YEEH 3JV4B 1BBJA 4S1SL 4FQCH 3DTXA 4NJ9L 3R1GL 4LCCB 3U0PA 1OGAE 1XZ0B 1MCKA 3MV9B 1LK3H 4DUXA 3TNNB 5DA0B 4DN4L 1GGCL 3SDXA 1NFIA 4WFGD 3TCLA 4HGKC 3SDCC 3MLUH 3NZ8B 4QRPD 3G9VA 3QEGH 4PRBB 5EOQH 3FO2B 4P9HC 2EO1A 4YUEH 4H8WH 4FZEH 2LE9A 3GIZH 1YZZA 3WJLA 4H0HB 3C5SA 5E6YA 1BF8A 3ME0A 3QRGL 5IVZB 3GMNA 1PKQA 3QXUA 5TGBA 4XP5L 4Z76A 1AI1H 3WUZA 4ORGA 1N3NA 3FKUS 5ERWB 5EBMB 4MCZA 4J3TA 4G9DA 4ZAKC 2B5IB 2BNUA 1P69B 5TPWH 5BXFB 3V9FA 3MZGB 3QO0A 1JUFA 2B2XH 2H1PL 3O3AA 5E1AA 4C58B 1RY7B 3MV7D 4PYHA 3PGFL 4HPYL 5C08B 2Z0BA 3GNMH 2ICES 1JF1A 2VN7A 3SGEI 3THMH 3U48A 1A9EB 5C09D 2XACC 3DV6B 1U9KA 2F5AH 2MTPA 5E6IC 1HH9B 4XTRD 5T1MA 5C71A 1IEBA 1EX0A 4KK5C 4EUPA 4WGWB 3O3DA 1QBLL 1I8LA 3TYGL 5ADOH 5T5FL 3NTCL 4LASH 1AHWA 2DI8A 4JFEB 5IEHB 2DQDH 3I6LD 5GSVB 1I85A 4CVXB 1KCRH 5I75C 3RQ3A 1IEAA 5KVEH 1I1YB 2R0KH 1FNEA 2JCCB 4PYGA 5T5NG 3S36L 2H6PA 4PRIA 4NRXB 4OTXH 3CVHL 3VXQA 4X6FB 3UTSB 3GMMA 4CNIB 4YFLF 2VITA 4PJIA 3STBA 1RU9L 3FT3B 4LLMB 4U6XB 4B0MM 5I30L 3RUGA 4LHQB 1DN0A 2EH8H 3QT2A 5C0AB 3WMSA 1MCLA 4XX1G 2WQRA 5I1JH 3GSVA 5FUCE 4UBDD 4QRRE 1YN6B 1YEJL 1QSFA 3TBTB 3FFCA 3X13B 5ENWA 3X14B 1AD0A 1BGXL 3L3IB 5GS2D 1FPTL 3U2SB 1ZHLB 4QTIL 1EV2E 4Q9CA 1MLBB 2R0LL 3N1FC 4TPRL 3HI6H 1BFOB 3L3DB 1AXTL 2OJEA 1EO7A 5AG8A 4Y5XC 1EFQA 4P2RA 3HG1D 3DROA 4P57B 2DOCA 3QEUB 3S8WA 2XN9D 2CR6A 3T4YB 1A9BB 3GI9L 2BHYA 1XFPA 3ILQD 5T1LA 2H26A 2ARJB 1J1PL 3W39B 4AEIH 1JGDB 2YPVH 5EC2A 5CJOL 4IIQA 1FG2B 3O8XC 3KXFD 5FUZH 2UY7A 2CDFB 1FC2D 5DMGD 1E28A 4M6OL 1I1RA 3DJ9A 2FJGB 4RBPH 5IVXF 5FB8B 2AAVA 4FQ2L 4XI5D 4Z7WF 2A0LD 2YMXH 4WI7A 2NX5D 4JVPA 3WUWA 2DLIA 4XP1L 1GOFA 2WAHA 1SJVA 3IKCA 5DVLA 2VZSA 3QUZD 5E7FA 1S9YA 2HFEA 3RGVB 1YPZB 2KL6A 3D25B 4R7NB 4L3AA 4JO1H 3VXUD 5CIPA 3IFPA 4RRPA 1G6RH 2DTSA 4JFO<