1IAII

Idiotype-anti-idiotype fab complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
218
structure length
218
Chain Sequence
b'EVKLQESGGGLVQPGGSMKLSCVASGFTFNNYWMSWVRQSPEKGLEWVAEIRLNSDNFATHYAESVKGKFIISRDDSKSRLYLQMNSLRAEDTGIYYCVLRPLFYYAVDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSTWRPSETVTCNVAHPASSTKVDKKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IDIOTYPIC FAB 730.1.4 (IGG1) OF VIRUS NEUTRALIZING ANTIBODY
publication title Crystal structure of an idiotype-anti-idiotype Fab complex.
pubmed doi rcsb
molecule tags Complex (immunoglobulin igg1/igg2a)
total genus 35
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1993-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaiI02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaiI01
1SMOA 4E42A 5DJ6B 4M5YL 1XGUB 2ADJA 2ZUTA 2EH8H 4HC1L 3FQTB 4MA3B 3WNLA 4QKXB 3EW3B 3P4MB 1U8KA 3UTQA 4DGVH 2Q6WB 3WIIH 1U6AL 4MS8D 2HFFA 3PGFL 3FOMB 1YC8A 2XN9D 4ODSH 1AO7A 1CDCA 5MEOB 2A83A 4NO0D 3V6ZA 3GJFA 2HLAA 1HSBA 1E4XI 1FFNB 3KLAA 1E27A 1AJ7L 1MFAH 4JFPA 1FVCA 1IQWH 1A6VL 2ED9A 5MERA 5D7IA 5D2LA 4NBYB 4ZO7A 2BP3A 4KDTA 5FO9A 3QWOB 4P2RB 3DSFL 1KTRL 4ALAL 3SE9H 5GGUB 4Y1AA 5F6HJ 1DDHB 4EI6A 4MNQA 3CPLA 1R3HB 5HHQB 4JJ5A 3RKDC 1RVFL 4BK5A 1CI5A 5DFVC 4PR5B 4S1SL 4LU5L 4DKFH 1J0YA 2BNUB 3VFTB 1QFUL 4LBEB 1IGFH 3K8LA 3HZYA 4PJ9D 2HTKD 3ZTJH 2EIDA 5FYJL 4ZO9A 4L29B 3FQNB 1G0YR 1BBDL 4WUUD 5HHVL 5D1QB 2RFXB 3I6GB 4UNUA 3QISA 4ORZC 4OBRA 3M17B 4CN1A 3P9MB 4UILL 3W82A 2HTLD 2NX5D 2NXZD 4NYLB 4YAQA 5BW7C 2EDDA 3QNXB 4OQ1A 4IOFC 4J3UA 4BQBA 2AXGB 3JUZA 1A3LL 2AVGA 3S4SG 1KJVB 4K7PH 3ILPA 4FMFA 2D0HA 5JORB 2DWDA 2RB8A 5HGAA 5FDYA 1SJEB 4G7VH 2JIXA 2NY2C 3CVIH 3O11A 4Q7DA 4PJ7E 2IH3A 4M8VA 3T4AA 5DVKA 2NY0C 4LLWB 1BD2D 2X70B 1HINH 2NLJB 1NMAH 2LV4A 5JA9A 2E7LC 2C7UA 2HVKB 1BF8A 1D9KB 5FF6A 3VFUB 3IDMA 1BMGA 1FH5H 5AYQA 2IBZX 4PFEA 3HZVA 3OKEB 5D71L 5C09A 4N0UE 2I25N 1EH9A 1KCSH 3OB0H 4OF6A 4NZRH 3INUH 1I1AA 2E6PA 4ZFOA 3HMXA 2VWEC 3LQAL 4PBXA 4BSVB 3C2AL 3N1GC 3LQAC 2V9TA 5E5RB 3GRWA 4N0FA 4I9WE 5IEKA 3VI4E 2V5MA 4M8QB 3SCMA 1A7RL 1G7LB 3H3KA 4N9GB 5DEGB 5JW4M 5MI0C 4HF5L 2J1KA 3STBA 5IMKB 1M4KA 1ODAA 4JG1H 3ZKMC 1FL6A 4L4TD 1F58H 3ZZ1A 3IF1A 1S7UB 5C0IA 3UJTL 4GRLC 5GHWH 1U8JB 4NJ9H 4FQXB 2EC9T 1KULA 5JLZA 1FPTH 3VGGA 1NUGA 4HKBA 4PJ7F 5L7XH 1B0GB 3QG6A 3VXRE 4JKKA 5GJTL 4JVUA 3G6JE 4BK4A 1IT9H 1SYSB 1RSFA 1N6VA 4XPTH 1BFSA 2J12B 5JR1H 3S96B 1DUZA 3B9KC 1AP2B 3PDOA 2MTPA 3EOAB 3QDJA 4U3XA 4K94L 2QR0B 5E08H 1YECL 5E6ID 5IIEB 4Y16B 4K94C 4M6ML 4OI7A 1WT5C 3P30L 3PGCA 1XR9A 1I7TB 1KBGH 1Q38A 1ACZA 3HI1B 2FGWL 4KK8C 4WI2A 2F54D 4PREA 4YH6A 3FO0H 3I85A 1L0QA 4G43B 3VI4F 1RJLA 1DTUA 2O61A 2XXMB 2YS4A 4GG6E 4P4KB 3X3FL 1PLGL 4XBPB 1U8NA 4IIQB 3LSOB 3E1F1 1CFBA 8FABB 2YXMA 4C57C 1RIUH 1WICA 2VL5B 1CXHA 1MVFA 4MJ5A 3ARFD 1JHLH 1MCJA 3NFSH 3QDGD 3PWPB 3MOAH 3MRMB 4I3GA 5KS9B 1CTNA 4JGMA 3MGTB 1NBZB 2X89A 1D6VH 4JFEA 4M3JA 4WW2B 3VGHA 3GMQB 3JV0A 3G6JF 4LCUB 5B8CC 1IGCL 3DXAE 4Z95H 4FN0A 1X5GA 1GOFA 3PGDA 5DMGC 1I1FB 4NC1C 4NZUL 5CINL 3RIFF 2VKWA 5EZIH 1N3NA 2V6HA 3PABB 5D6DA 2CDFB 4IBLT 4K8RL 1V7NH 5JNYB 4K8RC 5C0FB 1S9VB 5EB9A 1TJIH 2B4CH 5IW6B 2D3VA 1OCWL 4RRPG 4CVXA 1X4ZA 5D6CB 5DTFA 4WDIB 4JRYE 3O4LE 2XACC 2QADC 2YUZA 3S98A 5M95B 3QCUL 2Z93A 1JNLH 4UIMA 5LBSL 3TBYB 3WEXA 4OBSA 4TSBL 3IAPA 3S5LG 1B4RA 3QB7C 2PXYA 2IAMC 4K3EL 3HNTH 2GAZA 4U1SA 4PRIE 2VDOH 4ZFZB 4IS6A 3I02A 3QG7H 2X4SA 3R06B 3BH8A 2FSEA 2GUOA 3QNYA 4OLZH 3VRJA 1BHGA 4YQXL 1MY5A 2KBGA 4NZJA 5ACZA 4CVZA 5T3ZD 2HRLA 5KW9H 4P5KA 4PLJC 1C5DB 3C9NB 5A16A 3LV3B 4KJQC 2G9HB 4GW4B 4JFDE 2FBOJ 4FQ2H 4GBXD 4FOMA 5DEFB 5CUSH 4S1DD 1GYAA 3K4AA 3S9DB 3IFPA 1RUQH 5DRNB 3CLFL 2FWOA 3QUXA 3L95A 3IJYA 5HYIA 1ACYH 3KDMB 1VPOH 4HK3J 4PGEB 4MCYA 2UV3A 3MCG1 1Q94A 2WBJA 3SE3C 1DLHB 1I1YB 1XF3B 3GHEL 5F88B 1GGTA 1A3RL 3O45B 2PO6C 3O3AA 3DX7B 3U48A 1CGSL 3RP1A 3JWDH 4OM0L 43C9B 2Z4QB 1HNGA 4XBEL 1T0NA 3BI9X 1KLUA 4KH2A 4GRWB 3MRRA 3FFCB 5HGGS 4OCRL 1YJDH 4FZEL 4YBHA 3ARPA 3S8WA 3FFDA 4FG6C 3V6FA 1SBBA 2ZUXA 1JGVL 4LOUC 1VFBA 4R3SA 4FTVA 1FG9C 4JPVL 1AQDB 3RZWA 2OL3H 1VKXB 2R23A 4F7CB 2NR6C 4HUWA 3VFNB 1T89A 2Y36L 2H32B 3GMOA 12E8H 1UACH 1D3CA 4NQUA 4QF1A 1TQBB 2BJMH 5B3NA 4PJIA 1YEDA 3G6DH 3VXTA 3SE8L 4NGHH 4X0KB 4F37F 4HQQH 2FHFA 4Y4KC 1I9IH 2CKBL 2F8OA 1M05B 4R2GD 5F72S 5FUOL 1IEHA 1NH6A 3HCVA 3OKMB 4QOKB 3VA2C 3CVHL 5IMOA 1J1XH 4DTGH 3FO2B 2CIKB 4MLIA 1T22B 2A77L 2VMFA 2BSED 3JTSA 3GI9L 5HVHC 1W0WA 1J0IA 1NAML 5I8OH 1NKRA 2NY4B 1RV6X 1JFQH 4TOYL 3E3QC 2FR4A 5D9SA 2I26N 1AH1A 1MCCA 1KLGB 4RGNE 3RVVD 2FZ3A 5JW5B 3BKCH 5I18H 3JXAA 4LPVA 3VRIA 4KPHH 4HGMA 2EDKA 5DJYA 5TDNA 2AJYH 1DCLA 4MAUH 4D9RE 4OZHE 1UM5H 1MQKL 5CZKA 1DUYB 1T5XB 4HULB 5JUEH 4P2QE 2R9HD 3ARGC 5DD0L 1NGQH 1I3RB 1RFDH 1TVBB 3KYMB 2R1WB 4BQCA 3Q48A 3ALPA 5LAXB 1A4JA 4PTUB 2YD4A 1NAMA 1ZHNA 3T0XA 4MSWB 3VFOB 4YO0A 4FQIH 4ZMAT 3SQOH 4P9HL 3JV6A 4RFOL 3W2DH 4P9HC 4ZXBD 1C5BL 3MACL 3TV3H 4JFZL 3ROOA 2BSRB 1HHGB 1BZQK 4L5FH 2FLRT 4Y5YB 4ZUSB 1YEEL 4X7CC 1FGNL 1UJ3A 4RFNB 2ADJB 1A0QL 3MRDA 2X05A 2DQCH 4WU7A 1MLBB 3BEVA 4ZUUA 5F3HB 3CMOH 2HFFB 5C08A 1EJOH 5GGVH 2IGFH 4UT9H 2A83B 3L3IA 4JFXA 2FX9H 5I1JL 2CGRL 1HYSC 4WWKC 5J0BA 4PJEB 2IFGA 3SOBL 2ZSVA 3ZHKA 4JKPL 2XWTB 5A43C 3BP6B 3KLAB 4ENED 4G6KH 4I0PC 4YZFE 3U36A 4TRPL 1WZ1L 4YGVB 2UZYB 5GSVA 1FVCB 4NWTH 4W6WB 5T1LA 4J4PC 1JHTB 5MERB 2DMCA 5EIVA 1YMME 2HT3D 4J8RA 4WIQA 5D2LB 2P46B 1XT5A 1U95A 3N1PC 3TWCL 3TA3C 4JGUA 4PJAE 4YGAB 1MSPA 1TPXB 3CPLB 1N5YH 4IRJA 4G8GB 2DN7A 2WP3T 4RBPK 5J11B 4P5TC 4XVTL 4FA8A 1G6RA 3RVUC 5C0BB 4OZFA 4TTGA 2YRLA 3HZYB 5CIPH 3EO1A 3TZVC 4D8PA 1AXSB 2KQMA 4PJGA 2OK0H 4EUPA 4AG4L 5HYJA 2FX8L 1KN4H 2Z92B 1MRCL 4HBCL 2EO1A 35C8H 3NN8A 3RDTC 3WYRA 2ZNWA 4A6YB 5ITBL 3S88H 2X6MA 2FD6H 4NCC1 2ARWA 1IM9A 4FQJH 4TQEH 3RZCA 1DBKH 1T1ZB 5DA4A 2DIBA 2OI9B 3ULUL 4RMRA 1T03H 3IJHA 3RAJH 3ULUC 4RCAA 5K9QG 1LQSR 4LGRB 1YDPA 2DWDB 5HGAB 1V7ML 3HMWH 3RX8A 1NCWH 3L3JB 4EJ1C 4XNYH 1ZGLM 5FYKD 3N06B 3T4AB 4X6EA 4BELD 3CDCA 5F9JA 1HKLL 5BOPA 5J6GA 1INDL 3ARYA 3H9YA 5CEZE 1OSZA 2ENYA 5FF6B 3IDMB 3ZT7A 2F19L 5B3JF 1KOAA 3K7UA 4HKZB 5IVXB 2ZUUA 2NW3A 4ONHA 2ZOKB 3U46A 2NY4C 1I1AB 1RHHA 1OM3H 3GSQA 3HUJA 2F58L 4JM2F 1EIBA 1OL0A 3N1MC 4JDTH 5I1EH 2EECA 4HS8L 1D5IL 1JMZA 2W9DL 3FHAA 3BYTA 3T77A 2VLRA 2NXYD 4WFHD 5T5FH 3V8OA 4RSVA 1G7HB 2W0LA 4ETQA 4EI5D 3P73A 5EORL 3IF1B 1PZ5B 5H94B 1QLEH 3GJFK 1OAUL 2JLLA 4Y1AE 5AUMB 1KB5L 4TNVF 4BQ9A 4ZPTA 3LKOA 5LXGH 1U2CA 5DMYA 3S35L 5J1SC 4JO4L 3AXLA 4UBDD 3BKJH 3FL7A 4PP1C 3BESR 5F89B 3ZLQC 3WD5L 5I1KL 1J11A 4PB9H 3QHFH 3QUZB 5GRZA 3RHWK 3UTZA 2D7TL 4OFVA 1LO4L 2P5EE 3HI5L 3GM8A 1NSNH 1XFPA 5C0DA 1W72L 1KJ2H 3V0AC 4KI5C 5GS1B 1ZLVH 4G7YH 2ZCHH 1MCPH 1S9XB 4CNIB 1KB5A 1XR9B 4KTDL 3EOBB 2PETA 3D0VA 3EZJB 4YK4B 4DK6A 4XPAL 1FNGA 2GJJA 3H9HA 3QIBA 4PREB 3AS2A 3BDYH 5HHXH 5HHPA 5D1QC 2FCBA 2O61B 2K7PA 2VUYA 4UTAL 2YD9A 3V5KB 4PJ5E 5DVLA 5FYJE 4YHKH 5ANME 2VXTH 3SDAD 5KANI 2ICCA 2DQJH 4O58H 1F11A 3OR6B 4PD4K 3PWJB 2BSTA 4F9LA 1KENL 5BRZA 3BP5A 3NTCL 4MJ5B 1AD0A 1W72A 2EDXA 4M7LH 4NT6A 2EDWA 5EOCL 2XQBL 4HMDA 1RJZA 4G9FE 3IRPX 4H20L 4D2NA 3T04D 1ZVSA 4Z78A 4JFEB 2N7AA 3FQUA 4F8QA 3NGBB 4QRRB 5IESH 4KRPD 1ZLUH 5C0AE 1F6AA 5FGRA 4LAQH 5LG1A 3N1FC 5HBBA 1CWVA 4JN1L 3RL2A 1MJ7L 1D9KC 4PRHE 4TSCH 5IB1A 1IZJA 3M07A 1Y6MR 4YHMH 3QCTH 1SEQL 1PEZA 1AGDB 4FQ1L 4PPTA 4KQ4H 5HYSG 3D69A 3KYKH 3OKYA 1QSFA 4CVXB 2A38A 4E0RB 4XAKE 3H9SA 2BOBB 4BQ8A 1NCDL 3UZEA 4NQEA 3IU4L 3ZE1E 1HOCA 3V4UH 5C92A 4FFWD 2VH5H 3MUJA 2PYFA 4OLXH 3LHPL 2Z93B 1L4IA 2VWEE 4MQTB 4G6FB 4H5SA 2HT2D 1LEKA 2QHLA 4IEFB 3EDEA 3SGEH 4LLQA 2R69H 1BF2A 3FRUA 4L8DA 4XP6H 2WWMD 3GSNB 1FYTA 5T3XH 1DBML 5SWQB 1MAKA 3QJHA 1QBMH 2KDGA 5CGYD 3QEUA 4NKQB 4IS6B 3FONB 2XWBB 4MVBD 1LILA 4DCQA 5FYKH 1MQ8A 2FSEB 3VRJB 4FQXC 1FAKT 2DYPA 5GRUH 4CVZB 3U30B 4QHMA 4RX4D 3UBXA 5CJOL 4ONOA 5D7SL 2A9MH 3N9GL 4J23A 3RNKA 2GIYA 2J7LA 3RVXD 4JQIL 4NNPH 3TYFB 3V52H 1FORL 2Z8VC 4XCFH 4I9WD 2VQTA 1IBGH 4OQTA 1T6WA 4N0CD 2W59A 3IFPB 3E8UH 3QUXB 3GO1L 4YXHL 5T5NF 5IMLA 1W8NA 4Y16C 1WIUA 4OF7A 4S1RL 3ARED 5EBMA 2ZG1A 1Q94B 2WBJB 1T21A 4Y7MA 4WJ5A 2ITCB 1TENA 2A6DA 3UAJC 4P4KC 3QI9A 2EDTA 4P23A 2AQ1A 4NNYA 3H2WA 4IIQC 1T0NB 4MAYD 3EYOA 3VXRD 4X6DE 4BJLA 2HKFH 5L2KE 1DBAH 3MNZB 4DN3L 5CJXC 5ESVA 1FO0L 2VLKE 1MCFA 1OAZL 1N6QH 2VXVL 2HN7A 4ELKB 2GJZA 3WFEH 3IYLW 4OCMC 1VFBB 4JO3H 4R3SB 5F9DC 4WW2C 3WXVH 3I9GH 3GGWB 3C5SA 2C4FU 5D1ZD 3HAEA 3BEWB 2OQJA 3EJYD 5L6YL 4L8CA 4PS4L 4JLRB 4QYOB 5TGBA 4LSPL 2JELL 1YEDB 2ED8A 3VXTB 4OI9A 4GAYA 4PG9A 3RWEA 4ZYKB 5HI3C 2EDQA 3B2VL 3FAWA 2NY3D 4B50A 2WUBL 4O5LH 2XV6B 1T5WA 3HCVB 5DUPH 5E03A 3QYCA 4Y89A 3TT3L 3IAGC 5BZDB 3IJSA 5I9QB 3JTSB 5AZEH 5DJAA 1S7RB 1W0WB 4I3SL 1GOHA 1A7OH 2HMIC 2UY6A 3G6AB 4KZEL 1PG7X 5D9SB 2FR4B 5FYKU 3DV4B 4PRDA 1P4BL 3L9RA 4X6DF 1VGEH 1V3MA 3DXAD 2FBJH 1RZ8A 1U8QB 2B1AH 5JHDA 1GPOH 1IC7H 2R1YB 4LCYB 4JO1H 1G6VK 1MCRA 1TZGH 1I3UA 3QHTC 5JQ6H 5KAQG 4ONGH 5C07A 3FCTA 1MI5B 4XWOC 1KCUH 3BRFA 4NRZA 5DFWH 4JR9H 1EEUA 1Z3GH 3BW9B 3HC3L 1RK1B 3S37L 4JO2L 2FNBA 1J1OH 4DVBB 4TUKH 4JRYD 3O4LD 5C0CE 2DBLL 1BLNB 3BX7C 1QSEE 4YO0B 4HDIA 2ZSWB 3SDXE 3JV6B 2GK2A 3BIKB 5DRZA 4OIBA 3MRJA 1BM3L 4PRID 3ES6A 4I48A 2ARJA 1DQDL 5IFAL 4N8VB 3W9DA 3PWUA 4XXCA 5HGBA 2Y25A 3SBWA 1X9QA 3BEVB 4ZUUB 2O5XH 3BRDA 1VHPA 2DQEL 5E95B 4OB5H 4KGJA 2BNQA 5E9DE 1CK0L 1CD8A 1F2XK 1UZ6E 2CQVA 4XAWL 5BCAA 4Z7OF 3DETD 4JFDD 5GIRB 5IEHA 4G6JH 2OYPA 4X80H 3KPLB 4JHAH 2OP4L 5EDXA 4GKSA 4JRXA 1X3DA 1R24B 4NO5A 3U36B 4XMKH 5GSVB 2VO5A 3I6LE 1TETH 1MJJB 1ZWIA 3EFFB 5T1KD 3FZUD 3BRGC 5KVMC 4IRSD 3TBVA 3M8OH 4HJJH 4RMQA 5I19H 3B9EA 4APQA 1Z9SA 3F6IA 2YR3A 4DZBA 4Z77A 3SDXF 1TQBC 1R5VA 5I30L 2L7UA 4PYHA 4PLOB 5IG7A 4ZQKB 4JZOA 5HHOE 2LU7A 5D2NA 1MIEL 3VFMB 3P2TA 3O6FD 5DD6B 3LY6A 5HYEA 4S0SD 4POZC 4LGSB 5F8QC 1NLDH 3IXAA 1UYWL 4LQFH 4EUPB 2E9IA 5HYJB 4U1KA 1XEDA 4YWGH 5H8DA 5IHZB 3NN8B 4PRAA 1BBJA 1MFDH 2AP2A 1WWAX 2YD3A 5IB2B 1DFBH 4IM8A 1PSKL 1UZ6F 1X5HA 4HK0B 4YFLI 2QQQA 3LRSB 3CXHJ 3OAUH 1ZOXA 3IJHB 5EBGA 4FFYH 3I75A 3IKKA 5EA0H 3IETB 5B4MC 4ZOAA 3TBSA 1ZV5A 5MENB 1NGWA 1V3LA 2B1HH 4IDJH 4QRSB 1KPUA 1YDPB 1PG7H 3KXFE 5EZOH 3P0VL 5FCUL 1T2QH 5K9JL 2IG2L 2YD2A 5CEXA 4LRNH 4Z7WA 2R8SH 2XZZA 3IFOA 2Y7QB 1BOYA 1JRHL 4W70A 1KNOA 5F21B 3M1BA 1UZ8B 3BD4A 1RUAL 1OSZB 4P3CH 4NQXA 4HUVA 4KDWA 3SKUD 5DGRA 1IC4H 1CT8A 4XP4H 3OG4B 2YA0A 4MQ7A 5E6YA 3K2UL 4LKXB 4BSWB 5BVJB 4P49A 1IARB 2CLVB 2GCYA 4RGND 1BOGA 3WFBL 4Y5YC 1G0DA 4YXKH 4XHJC 2VXQH 5E8NA 5IB4A 4O51A 1RHHB 1MCOL 3GSQB 1S9KC 1OAYH 1RPQA 3HC4H 4RFNC 1JTPA 4I2XA 4D9RD 4UV4L 5FDWA 2Y23A 3UJIL 3HA0A 3EYSL 4P2QD 3MLZL 1F4YH 2VLJA 3KYOA 2VLRB 1SEBB 3MRCA 1EHLL 3EAKA 1KUMA 3P73B 4OGXL 2RHEA 5D7LE 1G1YA 4O2FB 5EULV 4CMHB 1P7QD 4PJCB 4XWGH 4X6CE 4ZPTB 1M1SA 1OGAE 2FHBA 3DSNA 3LKQA 4H1LA 1J0JA 1FDLH 3RWJA 3AXLB 4P59H 4YE4H 2BY3A 4HEPG 2JCCA 4ACPA 4XXDA 3WO4B 1DQLH 2ICWJ 3C5JB 4WHTB 1UB5A 1MJUL 4M7JL 1FYHB 1VADA 1XGYH 1KELH 3PHOA 5CBEB 3BXNA 2VDLH 3O3UN 1FG2A 4GRMA 1LGVA 2HJKB 4P2OD 1TPXC 1BZ7B 4OF3A 2AK4B 2FB4H 3DX8A 3MJ7A 5J11C 1U8LA 3K46A 1JP5A 2IMNA 3CSGA 4M00A 3BSZH 1JWMB 2OL3B 2QSCL 1KYOJ 4OV6F 4JE4B 5BVPH 3ABZA 4M48L 5ITFA 2AQ2A 2YPKB 4E41E 3ZMRA 2XY1A 1F4WH 1YEKL 3DI2B 3WHXA 1FNGB 2XFXA 3H9HB 2A74A 3QIBB 1JL8A 1Y6KR 4JFFA 1MWAH 4GJTB 5HHPB 1CIDA 3GMNA 1ZLWK 4YHOH 2QQKL 1FL5A 1HXMB 3IDUA 1YMMD 1HH6B 5KVFH 2W07A 1RQ5A 5I1HL 1J8HB 2XPGB 5CKGA 1GGYA 1DQMH 5FGBA 2BSTB 2OI9C 4P48A 5BRZB 2H9GB 3BP5B 3CUPA 4HV8B 3PIQA 1JPFB 3GB7A 4X6CF 4NT6B 1C1EH 1WLHA 5LQBH 2PTTB 1B6DA 4R8WL 2MCG1 1EPFA 4LCIL 4ZUVB 4YJZL 1RJZB 1EFQA 3ULUE 3VXMA 5HHMB 1IKFL 4RGOL 1P2CA 1RULH 3HC0A 4Z78B 3U7YH 2VDQL 2VDNL 3O6LL 3MFFA 3QUMB 3VDAA 3S3SA 3BFOA 4JM2D 2DICA 1OW0C 2NYYC 3RL2B 1K9TA 2L0DA 2V5TA 5IB1B 1YEGH 4R96A 1TNNA 4NRXA 1GGIL 3FN0L 4PGCA 4YHNB 3IFNL 5KSVB 1QSFB 4C56B 4KK5C 3RTQD 1I1AC 3L5HA 3H9SB 5TDPA 4OZIE 5DK0B 4KVCL 4XHQA 4KQ3H 2G5BA 2EH7L 3HNSL 4UQ3A 1MEXL 3QPXH 4U4BA 4ORGA 4H5SB 1LEKB 1AQKH 4LLQB 1J0KA 3QIWA 1SY6H 4L8DB 4MNGE 5DK3A 4M5ZH 1J10A 3TN0B 4PRPB 5D1XA 1IAIH 3D85D 5CEZD 1V8HA 3QEUB 1VERA 1JWSB 3WNPA 2AGJH 2EYSB 5LWYH 3X13B 3ULUF 1ED3B 4Q0XH 3QHZL 4O2CB 5HHNA 3LN4B 2AJZA 4ODXB 4QXUL 3RWCB 5AZ2L 1JRHI 3UBXB 4PLKD 3UC0H 4F2MB 2FATL 3HRZA 5FYLE 3C5ZA 4NM8L 2YBRB 2AXJA 1CN4A 2BZDA 1A6ZB 3QUZC 1U3HD 1G7PB 2HH0L 4L3EA 3MUHL 2X4QB 3GSUB 4Z0BH 1QLFA 4P0DA 4RQQA 2CJUL 5GS1C 3CFDA 3AAZB 4ODWA 1UG9A 3SKJL 1JZ6A 2NZ9C 2FGZA 3BVNA 5IW1A 4KI5E 4OZIF 5EBMB 4Y1AD 4YK4C 2BVYA 4HH9A 1J05A 2NY6C 1F3RB 3R1GL 4L3CB 4TSAL 3SGKA 4AYFA 3ARTA 3ARRA 3EGSA 1KCVH 2I07B 2HYMA 4QTIH 5HVWA 3BGAA 1JNNL 1P84J 1TCRA 2GTZB 1E4XH 3QI9B 3PWLA 5CZXD 2FLBT 4JPIA 4MXWH 1J88A 1QOKA 5MHSE 7FABH 1BX2A 4HS6A 4M43L 4BH7B 4KKAC 3IDNB 2VSCA 3W0WB 4NC2B 3STZA 4AEHH 2C1PA 3V79C 2P5ED 1NCCH 5B38G 5K9KB 1RZIA 2YSSA 3RL1A 5C0RL 3I6KA 4ZSOB 4BZ2H 3NGBC 4KGLA 5T5NG 4QRPB 1NAKH 4MD5B 3HAEB 1EXUA 5CD3B 4L8CB 1DN2A 5J1TC 4ODVL 4Y19E 5MP6H 3O0RH 3MJ8A 1KACB 2Y5EA 4GUPA 1J5OL 2WIMA 1OARH 2JIXD 4PJ5D 5FYJD 5D6DC 4J1UA 1JGEB 3EOYG 3UTSB 1W0VA 3SKOA 4KI5F 4LK4A 5I2IA 2BVOA 1T5WB 4HJ0C 2P7TA 5DYOB 4Q9QH 1R5IA 1T6VN 1FZJB 2I9TA 3G04A 4LHQB 5DJAB 4HIJA 4G9FD 3CFCL 2GJ6B 3CFIC 3IRZA 3JWNC 5DD3H 2ESVA 1Q9OB 3GSNL 5C0AD 4Z7QE 4FABH 1RZ8B 1P9MA 5JHDB 2EH8L 5E8PB 2WAHA 3AC0A 5F7FA 4PRHD 4XTRD 2BSSA 2KQNA 4DGVL 3DMMD 3WIIL 2J8OA 3GSRA 3FCTB 5F8RC 3MRHB 4ODSL 3U30C 3SKMB 3F7VA 1D5ZA 4XAKD 2V2XB 3AU1B 5L8JB 4HWNA 4H26B 3IU3A 3MLTB 3GSOA 2J88H 2L4OA 1MFAL 1NEUA 1IQWL 4LIQH 2WLYA 4X9BA 5EZJA 2W9EL 3GZKA 1KCKA 3QT2A 5FHBH 4QHUB 9CGTA 3D25A 2W1NA 4GXVH 5GRVL 4NQVA 3SE9L 2YEZA 4FXKA 1CQKA 5FB8A 3FQXA 2WBJC 5ERWB 3ZKMD 1OAQH 4Y5VB 3C60B 1JHKH 3W9DB 2FO4B 3SQBA 4HMCA 3T0EA 4L9LB 4DKFL 1R3IH 3UTTA 1MHCB 4GRLD 3EDFA 1IGFL 3WFZA 2IPTH 1S5HA 3JUYA 1JPTH 1EO7A 2OMNA 2AJSH 1IM3A 3PE9A 3BOVA 5AD0A 5BXFA 3STLB 3KGRA 4WTWA 1XGTA 3QPQC 4XCNB 4IOIA 3X14A 4PRNA 3SDYH 3RIAK 3LKSA 2FL5B 4OZ4B 4X6FA 4P3DA 3A6BH 2GTWA 5CJBA 3D18B 5T1MA 3I2CH 4QT5B 4K7PL 3TBVB 3KWWB 1MAJA 1S7VA 2HT4D 5F1IA 1AXTH 3VGEA 1NEZG 4Z77B 3A6CH 3IXTA 4G7VL 4UT6H 3VXUA 3WJJA 3CVIL 4KK9C 3RY6C 3F65A 4HZLA 3IDIA 5I1GH 4JZOB 4OV5A 3SY0A 3ELAT 3PL6A 2WW8A 5L2KD 4WNQA 1BFTA 3V2AR 1YNLL 1NMAL 4F57L 1CD1B 2VLKD 1I8IA 2DRUA 5DC0A 3KJ6L 3TIDB 3QRGH 4XNQB 2Y4SA 5I9QC 4HFWA 4OZGB 1A6VH 1KCSL 4M7LT 1NGYA 4JKWA 4NZRL 3INUL 4F7MA 4Z7VA 1MCWM 4P4RA 2JJTC 2WWKO 3RPKA 4AIXA 5T33H 4G8FB 3CFKB 4YFLF 5DMGD 5CSZB 3VD4A 3MO1A 4JG1L 4NUJA 4S1SH 4Z0XB 1U91A 1F58L 2W91A 2HAZA 2WANA 4LU5H 5KS9F 1CFSA 4Z7WB 1KPVA 4K8RD 1S78C 1T7XA 1KNOB 2VR5A 1ZT7B 4WW2F 4X4ME 1T04A 5FYJH 3M1BB 5DSCB 5GHWL 5ISZB 3MREA 1PBYA 1LDPH 4NQXB 1NMCB 1FPTL 4ZFFA 1C16B 4H8WC 5IM7A 1CT8B 4R0LA 5FAAA 5L7XL 4X4ZA 4QRTB 1ETZA 4UILH 4G8EA 4LARH 4YPGA 1CFNA 1U93B 2DF3A 1IT9L 1Q9KA 1YQVH 4XPTL 5JR1L 1S8DB 4G6MH 1VDGA 4QHKJ 5AG9A 2XOTA 3WUWB 4R7NA 3HE6A 4TUOA 3OX8A 5E08L 2OZ4H 1XF5A 3RQ3A 4M6OH 4F8TA 1RI8A 1KV3A 1LP9B 4NBXB 3MRCB 1ULVA 3AFLA 3WV0A 3TJEL 2IALB 3PWNA 5C0CD 3U2SA 1QSED 4YBLB 4GRWE 4KJQD 4WY7H 5E1AA 1T1WB 4H1LB 5CKAA 3MYJB 4O02H 4PJBA 5A3IC 4WU5A 1RIUL 3CFJB 2H2PC 1WAAA 1XZ0B 2YPLA 1I7UB 3E6FB 1VADB 3M45A 3PHOB 3NFSL 1CR9H 3LQAH 2VDPH 5CCKH 3MOAL 3TCXA 2DLFL 4GRMB 2D7NA 4OKVA 4YIQA 3MJ7B 3ARZA 4LVHB 4MDJA 4F7TA 1U8LB 5E9DD 4PJFA 4R4NC 5BZWA 1PVHA 4Z95L 1B4JH 1Y0LA 2XN9A 4ZTOH 1XCQA 1CLCA 3R8BB 3U7AA 4NO0A 3WHXB 2J6EH 1S9YA 3MRGA 5EZIL 4JFFB 3VXNA 1FZOA 3Q3GA 3SKNA 1H5BA 3I6LD 3GMNB 3OAZH 5FA4A 3H7LA 3Q6FA 3MMEA 1TJIL 3U6RA 2B4CL 5E1HB 5IMMA 1REIA 2QV2A 4LOUD 3DBXB 3T3PF 4GRWF 4Y4FD 3J7HA 3EDJA 1WBXB 3PWVA 5ID1A 3UYOD 5F93C 1JNLL 2NR6D 5FYJU 3VD5A 3D2UB 4ISVA 1PKQB 1RZJC 5GGTH 3VXMB 4UNTA 5HHOD 4JHBA 3HNTL 2XTJB 5TJWK 2VDOL 5JQHC 2Y07H 5DJZA 3U83A 4WCYH 3CSYA 4MJ2A 4PJ9A 3QG7L 4Y4KD 5FA3B 5D5MA 4OLZL 5JDJA 4MB5A 4D0CB 4WUUA 2BVEA 4NRXB 5FUZH 5KW9L 1OP9A 2NQCA 2IQAA 1X6NA 5F1NA 2AK1H 1EDQA 3ZKQD 4PJXA 2NX5A 3HS0B 4ZOCA 4FQ2L 2AJ3A 1H8NA 3MROB 3TO2A 3G5VA 4NO3B 2EEDA 4LSSH 4PP2B 1IAOA 3O41B 2BY1A 1RUQL 4UQ3B 1UXSA 4X7SH 4ORGB 5KANG 3KXFD 4UQ2B 3QEGH 1ACYL 4XVUC 1VPOL 1VEOA 1KIUA 2EKJA 4KJPC 1IGJA 3WS3B 1BQHB 4CMHC 3ARGD 1JF5A 4QGYA 5D1XB 1NJ9A 1BD2A 1DBJH 4GMTL 3TESA 5IBLC 2PF6A 3JWDL 4NZUH 1RU9H 5CINH 3JWDC 2IBBA 4PJEE 1XIWB 1KB9J 3VI3E 5HHNB 3VD7A 1Z5LA 3DHJA 5EIIB 1YJDL 1U58A 3HRZB 1G9EA 3ZKSD 3MR9B 5A1AA 2A73A 5C2UB 1A21A 4KJYA 5ICZB 4K71B 2BVQA 1EUUA 2GFBB 3CFDB 2DQFA 2YA1A 2OL3L 1ZS8A 5EU4A 5D7LD 3MRLA 5IW1B 4G8GE 5E2UL 4ZNCD 1T80A 1HSAA 4WTZG 4L4TA 12E8L 1L0XA 1UACL 3WCYA 3PJSA 5C0BE 3S4SA 2MCPH 3QIBC 1M7XA 2BJML 1OGAD 4WWKD 3G6DL 3EGSB 4HS3B 2YZ8A 2ZG3A 3QEQB 1MJ8H 2LVCA 4HQQL 5IVZB 1I9IL 1WC7A 4I0PD 4JPIB 1NCTA 1SM3H 5TDOB 1KEMH 1NKOA 2CDGA 1F3JB 3DVGA 1NFIB 3DTXA 4J4PD 1J1XL 4DTGL 5GZOC 4TTDC 5J56B 3STZB 3T0WA 2C1PB 1DJSA 3B3IA 5I8OL 3QIUB 3V8CA 4PJEF 1A1NA 2WBWB 2V17H 3DRQB 4H25A 3RWHA 3I6KB 5EO1B 4R97B 2E8ZA 1FNHA 5CP7A 4WV1A 3QUML 4P5TD 3BKCL 4E41D 5I18L 3RUGB 5E6IA 1G9NC 3GK8L 4KPHL 4LHUB 3W11C 3UXFA 2AJYL 2VE6A 4BH8A 1LO0H 4MAUL 1UM5L 5LGJA 1IJ9A 3FT4A 3TZVD 3MJ8B 4DJMA 3GHEH 1WFOA 4K7FB 5JUEL 2OXGA 1A3RH 4OTXH 1AGBB 3D39E 1NGQL 3N50A 3RDTD 1RFDL 2D4FA 1W0VB 3OHXB 3TF7C 5E7FA 5EC1B 2UUDK 2BVOB 2SEBB 5IVXE 5HYQA 4FQIL 3SQOL 3ARFA 1R5IB 2WINA 1A9EA 3DO3A 3W2DL 3JVGA 4HIJB 3QDGA 3ULUD 3MGOB 5FO8B 2ESVB 4L5FL 1P53A 4U1MB 3L1OL 3ZKNC 4NQDE 5ESQB 2EIZA 3N85H 3TN0C 2DLGA 3RGVB 1K5NA 4AK1A 1YEFH 1YNTB 2NZIA 3CMOL 3DO7A 3V5HB 1EJOL 3ISWA 4POYA 5GGVL 2IGFL 4UT9L 4ZFGH 3V6OA 2FX9L 3G5XA 1XH3B 4I18A 5C0JB 3BQUD 2X4PA 4WO4B 4UDTA 4Q2ZA 4HWBA 1QACA 5FO7A 4G6KL 1UM6H 3QQ9D 1X5KA 4HKJA 4NWTL 2Y06H 3GMPA 3MJ6A 1A7BA 3NCYS 4MWFA 3O8XD 5J8OA 1U8IA 3BKMH 1VB9A 4LNRA 2YEZB 5HDOA 5IVXF 4M6AA 3FQXB 2XKSA 3NCJH 1QVOA 4ELME 2R2HB 1N5YL 1DQQA 3SGDH 2DQUH 3KPRB 5C0NC 2F74A 3T0EB 5JXAH 1P6AB 1MQKH 3QI9C 1UT9A 1BQUA 3D1MC 4M9OA 2YD7A 1CXLA 3DWTA 1DANU 1F6FB 2X1OA 1FNSH 5D96B 5FYLD 1MRDH 5F7WC 4X5XB 3BIBX 2OK0L 4ZS7H 4P2CG 5BXFB 4DKAA 4HAGA 1KN4L 4NPYA 3KNBB 4PP1D 3S88L 2VL4A 4IOIB 3X14B 3QFJE 1YA5A 4GBXA 4PRNB 1IQDA 2FD6L 4NNXB 4P9HH 4Z7UE 4FQJL 1NUFA 4P3DB 4TQEL 4X6FB 1DBKL 3MRKA 2GTWB 2FEDC 5HY9A 4NM4H 5EU3A 4KI5D 1T03L 4RRPA 1V3JA 4EEEA 1BFVH 1B2WH 3L6FB 3HPJB 1QFWL 1S7VB 4QRRE 3HG1B 3HMWL 2Y72A 3PP4H 3C6LA 3KPNA 4PIRF 1NCWL 4XNYL 5CIPA 3VXUB 5L0QB 2IJ0C 5MHSD 1MHEA 3S5LA 4OV5B 3D3VE 1D5XA 3PL6B 1CFVH 3FB8B 3WIHH 5BV7H 2YZ1A 4BUGA 4ELMF 5H2BB 3DVNB 1EMTH 2CGRH 2XNAB 3OXRA 2P4AB 1I8IB 1EGJH 2HJLB 2JK5B 3SOBH 4XRCA 2VITA 2VN4A 3OAYK 2UY7A 5E5UB 5SV4A 1LE9B 5IFHH 5EU5B 1Z9MA 1DE4B 1FC1A 1HCFX 1NGYB 5DVOA 3ZT6A 4HIIB 4F7MB 4Z7VB 4YUEH 4GKZA 2LQRA 1MVUA 1IC5H 3MV01 4URTB 1OM3L 3TWCH 5I6XB 3CFBB 4Y19D 1S9WB 4JDTL 1GRWA 5I1EL 1OTUD 3P4NA 4Z7UF 4JAMA 3U9UA 5T5FL 4XVTH 1D9KD 3GKZA 4H88H 1P7KB 1QLEL 4Z9KB 4L1DA 2DDQH 3P4OB 3OKDB 4CKVX 3TBTA 1T04B 3EIFA 1ZVHA 1FP5A 5LXGL 3QRFM 4NQCA 5AYUH 5IJKA 4ZFFB 3O9WB 3VFRA 4P3WA 4JZJA 5DI8A 1BZ9B 3KJ4B 3BKJL 2AQ3A 4F33A 1Z9LA 3B83A 4LSDA 1CFNB 4PB9L 3QHFL 1WFUA 3ULUH 1JZ8A 2BHUA 1PX3A 4Y5VC 3C60C 3U0PA 2VZ1A 1NSNL 4MDIA 3ARDB 1OLZA 4Y2DD 3CCHA 1KJ2L 4M93B 1IGMH 2FDBP 5MEPA 4L9LC 1WTGT 3LIZH 4G7YL 5IBUB 1FE8H 1MCPL 3UMTA 5JMRA 5TFSL 3OJMB 1NGZA 4JKLA 2Q20A 1GHFH 3KVQA 4WTXA 4EN3B 3BDYL 5HHXL 4UT7L 2RQ8A 4C83A 3MRNB 3MOQA 1NANH 2BCKB 4JANB 4YHKL 1NC2D 2VXTL 5GRVK 5GS2H 2VOTA 2ZZUT 2DQJL 4O58L 3BO8B 2AJVH 1M7IA 1FRGH 4FZ8H 4ZXBA 4WU5B 4PUBH 1MHHA 5DJ2A 1OB1B 5C6PB 4Y88A 5ICYB 3RPIA 4J3VA 1FLRH 4M7LL 4NHCH 1LD9B 3H0TB 4Z18A 3QQNA 2Z8WC 2AEQH 1KTDA 4W4OC 3DYPA 3MX0A 4OKVB 2EDEA 3VWKB 2BFVH 2GSGB 5IESL 3IS0X 4PJFB 5BZWB 3MLUH 3S36X 4P4KD 1II4E 1Y0LB 4LAQL 2XN9B 1N0XH 3TGXA 2JF1A 2V7NA 3VXNB 4YHML 3SKNB 1H5BB 5I1LB 5FYLH 4OFDA 1ZT1B 2C4XA 3UZQA 3MMEB 4KQ4L 3V6BR 3KYKL 4OIIL 3OKLB 4U6HA 5I8KH 3V4UL 4WRLA 5D4QA 1VACA 4ONFH 4CMMA 2VH5L 4CN4A 4OLXL 2Q8BL 4KMQA 5C0EB 1LO4H 1MCEA 4YHLH 3WFCH 3ROLB 2Q8AH 2R69L 4RNRB 4XP6L 5T3XL 3DURA 5I1AB 5DJZB 1YEJL 5J1AA 1QBML 4ZODA 5GGQL 1QFWI 1MI5E 1U42A 4KTDH 1FFOB 4PJ9B 1T7ZA 2FH8A 4S1QL 2NW2A 5HI3D 5A2FA 4X5WA 3UDWC 2ZUSA 4RA0C 5FYKL 2Z35A 1B90A 1PY9A 3OB0K 1NMCC 4WUUB 5GRUL 4I77L 2ZPKL 3MRIB 5TQ0H 1GVIA 2BMKA 1NDGB 2XIDA 2E27L 2A9ML 5F1NB 5EN2A 3L5XH 4YNYB 1FIGH 2NX5B 4S2SA 1A2YB 3V52L 2HMID 1DQTA 3MUGB 4XCFL 1LE5A 1HCVA 3VGAB 1IBGL 3OJDB 5HI5C 3G5VB 1B0RA 4XB8A 1IAOB 4UUJA 4HXAH 4AH2B 1UXSB 3E8UL 4X98A 5J6HA 5HDLA 3LKRA 2MJWA 2X40A 5TF1H 2FJHB 3WN5A 1KSRA 3KPTA 3VG9B 1IGJB 2P47B 4XWOD 1P4LA 1OF2A 2Y9RT 2FJFA 3G5ZA 4YBLC 3VWJB 4FHBD 1JPGA 1FL3B 4AM0A 1F45A 2ZP0T 4RIRB 5CGMA 1SEQH 2HKFL 3KPQA 1DBAL 1TZHA 5JXEC 4ODHH 5F7KC 1N6QL 3WKMH 2A73B 1NCDH 1KJMA 4GXUM 5IFJB 1NCAH 1P6FA 4IHOA 3WFEL 1QEWA 2FX7L 2ERJB 4LVHC 3WXVL 3OG6B 3I9GL 1ZS8B 1EEYA 5I0ZA 3IS1X 1HK6A 4EI5A 3DJ9A 5DT1H 1X7QA 4L4TB 3ULSA 3PJSB 1BQLH 1H3VA 2E7HA 5B22A 4DOHB 3QR2A 1H0DA 3S36H 3BD5A 3NIDE 1WC7B 5T1DH 5KSAB 3T65B 4O5LL 1AGCB 4OLUH 1BVKA 1F4XH 4KI1A 3DVGB 3DTXB 2X4UA 4FQLL 4RDQF 5JOFA 4UDUB 4WENB 3WDJA 4UNVA 3V9FA 3IVKA 5AZEL 5BMFH 3S3PA 3TBWA 1G7QB 5JO5A 1C08A 1EK3A 1KF9B 1T0MA 3K3QA 1A7OL 1JWUA 1A1NB 1FBIH 5I1IH 3AY4C 4J6RH 3UTPE 3ZYZA 1VGEL 3ZDZE 2AEIT 5SWZB 5MENE 2FBJL 3OPZH 4FQHB 2XTJC 1PKOA 1Z9OA 5KN5A 3HR5A 2B1AL 4JEGB 1GPOL 1IC7L 5E6IB 3RNQA 2EDRA 4YDJA 4JO1L 2W65A 3MBED 3QZWB 2JJUA 2EZ0C 2XY2A 2VE6B 4BH8B 1TZGL 5JQ6L 2WK2A 3FT4B 3O81A 4ONGL 2F54B 2IC2A 2UZIH 4N1CA 1KCUL 25C8H 1MCNA 5AAMA 4JR9L 1Z3GL 4XBGA 1V5JA 3TNNA 3SDAA 3IGAA 4N90E 2J5LB 1J1OL 3GMMB 4TUKL 4MA8H 5DZLA 1TTGA 1F8TH 5HYQB 4DN3H 2CR3A 4L4JA 1UM4H 2OTWA 1WBZB 2HWZH 2CIIA 1IAKB 3QDGB 2QQLH 3CMGA 5B4MD 2A6IB 3Q1SL 4WI7A 5EPMB 5ENWB 1JUFA 2OCFD 5EBWA 2C26A 2F5BH 4PJDB 1W2KT 4UINH 5D1XC 3ARUA 1U41A 4ODTH 4PS4H 3SGEI 2EC9U 1K5NB 1CL7H 5DO2D 2H1PH 4TPRH 5CFHA 3EFDH 3DO7B 2JELH 3ZDZF 1XIWC 4PJCE 3WHE1 3U9PL 3P11H 4I18B 5JDSB 2RAMA 4X8JA 4G6JL 3VFVA 4X80L 4JHAL 1ND0B 1CE6B 4LLDA 4JVWA 1EO5A 1Q0XH 1QUNA 2A6KA 2K1MA 4XMKL 1T1XA 1TETL 2J8UE 4HKJB 4PG2A 2DMBA 2ADGB 3GMPB 1T20A 1UWXK 2YC1B 4K71C 5FM4A 2UWEB 4MNHA 3MCLH 5JIIA 1A9BA 2MHAB 3QBTB 5DRXA 3MXWH 4MWFB 1MELA 5E8OB 4KAQH 1SVZA 3P9WB 4PJ7A 4LHJB 2AK4E 4HT1H 4LNRB 3M8OL 2OMBA 4FQQA 4HJJL 5HI4C 5F6HI 1L0YA 4U05A 2EDFA 3SGKC 4LKCA 3L3GB 1HEZA 2H8PB 4AIOA 1KXVC 4XP5H 4ZUWA 4XZUA 3OXSA 4JPKL 4N0UA 2BHYA 4JY5H 3CSBA 4RX4A 1NLDL 1J8HE 1HHIA 2VYRE 4Y4HD 4YWGL 3SE4A 1NQBA 4XPHH 3QIUC 3ZE2E 4KC3B 1IQDB 2EE9A 1DFBL 4PJCF 5CHNA 4KVNH 1WFNA 1K4CA 2HA1A 4R97C 3TIEB 5HYSA 4G8GD 4FFYL 5EA0L 5HHME 5C0BD 5IKCA 2AS5M 3AREA 1DN0A 2B1HL 3K8KA 4M1CC 3MV7B 1PG7L 3KPNB 4MLSA 1WQVT 1NBQA 4LNVA 5EZOL 1T2QL 2DJ4A 1QO3A 2XWJB 1MHEB 4LRNL 2R8SL 1D5XB 4GRWH 4DGYH 4MAYA 3VXRA 3G6JA 5CP3H 2VABA 1UWEH 4P3CL 2CXKA 4AY0A 4PJ8D 1IC4L 3GSVA 4NKIH 4C56E 4XP4L 4P46B 5DHYA 3QWRD 1GJIA 4LCWB 3TVMD 3FO9B 5BQ7B 3OMZA 2VIRA 2VXQL 4EXKA 1FNAA 3HC4L 5D1ZA 1YZZA 2H32H 1AHWB 3GSXA 3MJ9H 5IROA 5F7NC 3RGVC 3P4NB 4YDVA 4FQPA 4PRPE 3RY4A 4GG6A 3U9UB 3D39D 4RBPH 3QIWD 4LPUA 5F70A 2NYYD 2A0LC 4JB9H 5FGCB 3MNWA 2IQ9H 4HUXA 1J87A 4WO4C 4XWGL 3TBTB 3JZ7A 4EVNB 4U1JB 4E5XA 5FKPA 3RWFB 5IV2A 1WEJH 4KK5D 3CZJA 1JYXA 1FDLL 1CQYA 2YOCA 3F7QA 1H8OA 4P59L 2ICEA 2R56H 1RZFH 4JZJB 5DI8B 1H3XA 1DQLL 2YN3A 3MV8E 4N5EC 4NDMA 1MAMH 4RISH 4KXZH 4PV9A 4NQDD 3HZKA 1XGYL 1KELL 4RMWA 5DRWA 1I1RA 5E00B 5IW3A 3GUTA 1XF2A 2ZNXA 5KTEL 1P4IH 4YHIA 5GRJH 5A2KH 2AJUH 4MDIB 5IVOA 4NO2B 3CCHB 3MCKB 2FB4L 4TULH 3T0EC 1AR2A 2EDYA 3BSZL 3PDGA 1ES0B 5DMKA 3V5DB 1CVSC 5BVPL 4G80A 1CFTB 2ZKHH 1F4WL 5D96C 1HDMA 3CZFB 3BD3A 1Y18A 1RJYA 3EO9L 4LGPB 4P5MA 1JRHH 1MWAL 4AT6A 3R8QA 5LGKA 4JRYA 3O4LA 4YHOL 3P0YL 1E4KC 3QUZD 5KVFL 3W0WE 4CDGC 4OJFH 1DBBL 3O2DH 3AM8C 4MHHI 1DQML 1WWWX 2EC8A 2V5YA 3VXQA 1I3GH 3T1FB 3BP7B 4PRIA 1C1EL 5LQBL 5IR1B 2NZ9D 4ZSOE 4XNXH 1UB6A 4QRPE 1QNZH 1ZT4A 2X4TA 4RMUA 1G1CA 3B8YA 4DAGH 1VESA 1RULL 1CTOA 2NY6D 3EHBD 3WJJC 5DLMH 5L0QC 3GIVB 2DTMH 2DAVA 3B2UC 3V0VB 3PL6C 2VSDA 2WWKT 2VLME 4QTHA 3L7FA 3DX6A 3GJFH 3MV9B 3WNNA 3F5WB 3BN9C 4DKEH 3UTSE 4JFDA 2OJEA 2P8MA 3FB5B 1YEGL 3QFJD 1JNJA 2OR7A 2Q3AA 4X4XA 4NQSA 1H15A 1ADQA 4GS7B 5T1KA 5C3LD 4U6HB 2GJ6E 3P9LA 2X4RB 2BXZA 2FJGA 5I6XC 3U4BH 1RMFH 4KQ3L 1UCTA 4QRRD 4NQCE 2VERN 2X1PA 3NAAL 4IRSA 4FP8H 4F9PA 3QPXL 1D7FA 2NY1B 1AQKL 4XMPL 1QFWM 3W39A 2X4OA 1OP3H 1G7JB 2HG5A 4K3DL 1UJTA 3D3VD 4M6NH 1SY6L 4LASH 4JDVA 3SO5A 3LEVH 1FCCA 3RWDB 4M5ZL 3JBG7 1I8LC 4XCYA 4OGAC 2QSCH 1IAIL 3WLBA 5J1AB 3O6FA 1YEKH 2AGJL 5LWYL 2W60A 4Q0XL 1YY8B 5IT2H 1KG0B 4A6YH 1O0VA 5E0QA 5EBLA 3VRLE 3O9WC 2EXWC 3MRFB 1FVEB 3UC0L 2IH1A 3KJ4C 5EN2B 3O2WH 2V9RA 2ICWB 4RZCB 3BZ4A 4WW1A 3KYNB 1JV5A 3QO0A 1ZA6A 1QG3A 2R2EA 2GY5A 5K93A 4Z0BL 3ARDC 1GC1C 4UUJB 4M93C 5DJCA 3ZDXE 2KKQA 4MXQC 1R0AL 5IWLA 5IOPB 5DD5H 3EZ8A 4LCCB 2NTSP 3O3DA 5D7JB 4I5BA 1P4LB 5M7QA 4EN3C 4GO6B 4ZUTA 1OQXA 1KCVL 1QHOA 3FJTA 1E4XL 1GOGA 4AM0B 2DQTH 3MTRA 4PY7A 2PCPB 4MXWL 2R29H 4WFGE 3SO3B 3VH8G 7FABL 4OFIA 1ZTXH 1CDIA 4EKXA 3GMRA 4AENB 1QRNB 1XGPA 5C2BH 5F7DA 1VENA 3H3PH 3NIFE 4AEHL 2AERT 1BFOA 1SBSL 3HMXH 4XVJH 1ZLVK 5GGSA 1NCCL 5ILTH 1GCFA 1AY1H 3GRWH 1MCQA 5D8JL 4OZHA 3HNSH 4GKNA 1QSZA 3VWKC 4BZ2L 4ZOBA 4P2QA 1NAKL 1EEYB 4HLZH 1H3PH 4MQSB 1PX4A 4X8XA 2PW1A 2C3VA 3ULSB 2EE3A 3VE0A 1QA9B 3O0RL 1OARL 4GG8A 4YHPA 1P7QA 3ZDXF 1UXWA 1H5BC 1H0DB 1TIUA 3WKNA 1AR1D 2X09A 3QPQD 3L3KA 2EEAA 5C1MB 2MQCA 1MIMH 5BV7B 1DL7H 4OZGE 5JOFB 5C3TA 4Q9QL 4ODUA 3IVKB 3PNWB 5I75B 1UH3A 4NJAH 3W9EB 1HQ4B 3QJFB 1J1PH 3TO4B 3KG5A 3R0NA 1ZLUK 3QXDA 5BS0E 4N0RA 5FOJA 3T4YA 4YDIL 4M4PA 4P2OA 4OCYH 4ZO8A 5DDHB 5I74B 4FABL 3NIFF 4TYUA 3HR5B 4U6TA 2PNDA 2CDEB 3D87B 1YC7A 2W65B 1HHJB 3EYQC 3BPNB 1HH9A 1MFCH 1RD6A 1INQB 3QUYB 1FCGA 3VW3L 4L8SA 3GBNH 4OD3H 5T3XE 1JGLH 4M62H 4V1DB 1JNNH 1KIPA 5ISZE 4N8VG 5F3BA 1HIMH 2WSKA 3TNNB 1YMMA 1UQSB 5FKAA 2HTLC 2F53E 2J88L 1X5ZA 5I16A 5HD8C 1IGYA 1NMBH 4NHUB 5GRXG 4HKXA 3VGAC 4XMLL 1PJ9A 4LIQL 4RDQG 2C3GA 3DARA 1E28A 1P5UA 5IHBA 3QSKB 5FHBL 3B5GA 4GXVL 2IPUG 1JTOA 2PYEE 3VG9C 3IDJA 4OZGF 3TH2T 1MI5D 1OAQL 3VMNA 2CLZA 4KRPB 5MEQA 5ELIA 1LP9E 1WISA 3HE6D 3B6SA 1K8DA 3VWJC 3LRHA 3KS0J 4JM2A 1A64A 2E9WA 2I5YL 2IPTL 4OLWH 1JPTL 2AJSL 4F7EA 5C6TL 4LF3A 1G9MC 1IAII 1Q9WA 5DGQA 3ZT5A 4AL8L 3FT2A 3VFVB 1E6OH 4KU1A 4R4BA 1NL0H 3VFSA 4OF5A 2XZAH 1XCTA 2OS7A 3L3DA 3BH9B 3EBAA 1INEH 4G8IA 3WL9B 4OCSH 1ZA3A 3U4EB 1T20B 3A6BL 1FC2D 1F42A 4MNHB 2ERJC 1A9BB 3X12A 5DRXB 5TE7H 5GRWA 1BVLB 3I2CL 1U8HA 4QXTA 1MCKA 1U0QA 4JFOA 2DWEB 1AXTL 4MX7A 4KZDL 2XXCB 3A6CL 3D85A 4LLYB 4UT6L 4XC1H 1EV2E 4OAWB 5DUMH 5I1GL 5I66A 1MREL 5DEZA 1DEEB 5KSAC 3FB6A 1FZMA 4N0UB 3PG2A 5FUCC 2VQ1B 1LP9F 5A3ID 4HHAA 3QRGL 3ZL4L 1GGCH 5FOBA 1CD0A 1U3HA 1A47A 5I8EB 3NFNB 4GH7B 1UVQA 1RURH 2W9EH 2GT9A 1GGUA 1K4CB 3E6HA 3FQWA 4LPWA 1UCBH 3BGMA 4HC1A 1PKQE 5E6IC 1IILE 4XCEB 1DLFH 3MRBA 5T33L 3FB7A 1BQSA 4DFIA 4DZ8A 3CX5K 5B39B 3REWA 5K9OA 1G84A 1YEHH 1FGVL 3NZ8B 4R90H 1QO3B 4YX2H 3LH2H 4OM1H 3X11A 1T1YB 5KSBB 1AGEA 2J5LC 2VC2H 5LJYH 1FJ1A 3UJJH 1VEMA 2AKRB 5J4MA 3VXRB 4NP4H 3O3EB 2VABB 1LDPL 2W38A 1L7IH 4QNPE 1NLBH 3GSVB 5DHYB 2EYTB 2P5EA 4IMKA 3RVWD 3UTPD 5GGRA 3D0LA 2MPAH 1CICB 1GAFH 4LARL 4OUUB 5MEND 5TE4H 5AEAA 5GRYA 2E9JA 2YN5A 3KPSB 4JM4H 1YQVL 5HGHA 1X4XA 4GQ9H 4KRNA 4X7TA 3KLHC 4G6ML 1FVDB 2W0PA 2X1XR 4CADA 3GSXB 4JDZB 3BHBA 1AC0A 2OZ4L 2ZUYA 2B0SL 4M6OL 4GG6B 4PJ5A 5ANMA 4WFFE 4N90D 3FT3A 2ZOLA 1ZHKA 3EO0B 4MJIB 4HUXB 4WHYH 3CH1A 1YNLH 1Q9LA 4F57H 4ZDHB 1XGRA 4E5XB 1BJ8A 4WY7L 5IV2B 5BW7A 2Q86A 3LKPA 1TQCB 3KJ6H 4LSQH 5EU6B 3LD8B 2G2RA 4BKLA 5EU7C 1CLYH 4O02L 3FOLA 2ICEB 3CJJA 3CFEA 4G9FA 2APTA 3WFHA 3VXSB 2CUMA 5DRWB 5HGDB 1CR9L 1NGXA 3GUTB 5C0AA 5C71A 2VDPL 3DXAB 5CCKL 3ET9F 4K3GA 1N2RA 5C7XH 4QNPF 3ECBB 4KJPD 4YHIB 5B38A 3RJQB 2ENSA 1TTUA 4PRHA 1S7TB 1WK0A 3DMMA 2ADFH 3KR3H 1BEYH 1B4JL 2E7LA 4H0GA 2MWCA 4ZTOL 2GYSA 4LDOB 2VNCA 3MRPB 3ZHLA 2J6EL 1Y18B 3QEQE 1AI1H 1G7MA 4P5MB 4JPWH 3VCLA 3GI8H 1YN6A 3HB3C 4NKOA 7CGTA 4U1HB 5DQJB 3VFWA 2LE9A 2YKLH 4H8WH 4BFIA 1ITCA 1MLCA 4Q6IA 3GM0A 2AK4D 3UYPA 3VFPA 4PRIB 2HKHH 4WEUD 1UB6B 1UEMA 4U33A 3RUGE 1ZT4B 5GGTL 5JW4N 1ZSDB 1K8IA 1KTLA 2J6EA 2MNUA 2Y07L 4GRLA 4WCYL 4JG0H 4YR6A 4HXBH 3CDGA 3L7FB 5EUOE 1J9CT 1J8HD 1WZLA 3TJEH 2HFTA 2P8MB 1UKQA 5CGTA 5GZOD 5FUZL 4TTDD 1IRAY 3VMOA 4P46C 3BZFB 3RIFK 4X4XB 4NQSB 3SGJA 1H15B 5IJVA 2AK1L 4ZG1A 3W81A 1I85A 4DQOH 3FN3A 4M1DH 5HHMD 3P9LB 3B9KA 2FJGB 2FIRT 4BZYA 4LSSL 4GFTB 1AHWC 5E94B 3P4LA 4X7SL 5E5MA 3W11D 3QEGL 2DLFH 3W39B 1JPSH 4TNWF 2X4OB 1H8SA 1G6RH 3P77A 2E7BA 1XF4B 4AIZB 2BVTA 4JDVB 3QULB 4XCYB 4X6DA 3NFPA 3WLBB 1DBJL 4Z5RB 5L2KA 3O6FB 3HKFA 2PW2A 4EUPH 1RU9L 1CVRA 4C56D 2O5YH 3RUGF 2VLKA 3EYVB 1ZLWH 1HILB 4U2YA 4JZJC 4JN2B 2DBJA 3LQMA 2BHZA 1T3FA 3F7YA 5EUOF 3DYOA 5KJRH 3BZ4B 4WW1B 3SN6N 3QFDA 3QO0B 1ZA6B 2WMPA 1CFQA 4RFEA 4LVNB 3CXDH 1EAPB 2X4NB 4PRPD 5B8CA 2UYLB 3BN3B 1RZJH 1HQRA 3MLWH 2V7HA 4KKLD 4PJHB 1HN1A 2AXHA 2ATKB 4JFYB 3RRQA 3KPRE 1T0PB 3DV6B 1EEZB 3KAAA 4WVRA 2VZSA 4U1IB 2R9HC 4I5BB 2MCPL 1IC1A 5DJXA 2DLIA 3QXVA 4K07A 4LRIC 4NC0B 1MJ8L 1I8MA 4PY7B 1EFXB 4MGXA 1YNKH 3MV8D 1SM3L 3VJ6B 1KEML 3AUVA 4Y0GA 4WI3A 2DD8H 1FN4A 1TJGH 3GMRB 3DGCR 1JNHA 5DC9B 4RGNB 5GGSB 2VR9A 4HK3N 3FN9A 1OWWA 3LQZA 5L9DH 4U6XB 2V17L 1BJMA 2Z31D 3WS6A 4JQXA 4LSVH 4OZHB 1WUNT 4G5ZH 1SJXA 5B21A 3HG1E 2I60H 4QRUA 2AXFB 5I71B 1LO0L 1IEBB 2C3VB 4PRBA 5DJ8B 3C6SB 1D5MA 2I27N 3VE0B 3C6LD 5I76A 5C0CA 4GMTH 4OTXL 1DR9A 4EDXA 3WNKA 1QSEA 5C9JB 5F9AC 4JRWA 3W0WD 2BVPA 4W6XB 4ENEC 3QNZA 5F96H 2WIIA 3UPCA 3SDXA 2VXSH 3L3KB 5E7BA 4GS7C 4F37K 4NRYA 1LEIB 1SYVB 3CK0L 2A6JA 1P1ZA 4OCXH 2FEDD 4ODUB 1TDQA 2P49B 3HPLA 5ALCH 2Z91A 1ONQA 4QRPD 5EUKB 3WBDA 4U6YA 2NY1C 3QXDB 1I4FA 4L4VB 1LO5A 3T4YB 3QP3A 1KGCE 2KL6A 4YC2B 1QQDB 4WFEE 1OP5K 2CR6A 4JZNB 5E9DA 3N85L 2VLMD 3HZMA 4WWID 3UTSD 5E2UH 2P24A 1YEFL 5HDBE 2AV7A 32C2B 3L3HA 1KIRA 3PQYB 2RR3A 2ZG2A 1I9EA 3LAFA 4NZDA 5DD1H 1KIPB 4ZFGL 3JTTA 1MCWW 3L7EA 5F3BB 1YMMB 2BNRE 3FTGB 2GJ6D 4GW1A 4KMLB 3BKYH 1AKJD 1FFPB 5HDQH 3TC9A 5ID0A 3RI5F 1N59A 1UM6L 3CC5B 1ZHBA 4NQCD 4YXLH 3UO1H 1BIIA 5CEYA 3FRPG 5INDB 4PJAB 1R3KB 5ECJE 5IGXH 2IF7A 2Y06L 4Y4FA 3PV6A 4D0BA 2CLRB 2H45A 5L2JB 5F7UA 1I9JH 1HHKB 2Z8RA 3BKML 5HHOA 4LCCC 5DHVB 1G9NH 1XGQB 3NCJL 5ADPH 5D7JC 2Y5TA 3QUMH 4NKMA 1CG9B 4HIXH 3GK8H 1A6TA 4BFGA 2DQUL 3B6SB 2P48B 2P5WB 3LKNA 1IAIM 4Z7VF 4Y4KA 5JXAL 2DTSA 2ATPA 1LNUB 2XI9A 3KPOA 2CKBA 4YFDB 1JYVA 3SO3C 1HWHB 43CAB 1FNSL 1BVZA 4F7EB 2QQNH 3CVHA 1MRDL 4L8BA 4LF3B 5AAWA 1X5AA 4HWZA 4V2BA 1Q9WB 1GZPA 4ZS7L 2VDMH 1N5AB 3H7BA 3NCBB 4HIHA 3V0WH 3RTQB 3EYFA 1H9VA 5HDBF 1K4DB 3NA9H 2Q3ZA 4HD9A 4X6BB 1CF8H 4K23H 2ORBH 1ZA3B 3QO1B 3C60D 2GSIA 2VJXA 4QHNA 4NM4L 3X12B 1LK2B 4MJ6B 3KXFA 2FIKA 1QR4A 1U8HB 3L1OH 1BFVL 3KPPA 1B2WL 4KUCF 3WXWL 4E42B 3PP4L 5F6IB 4MX7B 3ARGA 2XG5A 1YY9D 1U8KB 3UTQB 4WFGD 2EKSA 5IB3A 4JCLA 3NACH 1CFVL 1N0LA 1AO7B 1FZMB 1RK0A 3WIHL 5BV7L 3V6ZB 1EMTL 3LEYH 1ZE3C 5BV7C 3GJFB 1EGJL 2HLAB 3MV11 3BPLB 1HSBB 4HHAB 4JFQA 2HP4A 1E27B 5I1CH 5I75C 2YUWA 1FNFA 3MA7A 4JFPB 4M61A 4OQTH 3TO4C 1CDBA 5EOTA 5IFHL 3OKNA 4QXWA 5FV2A 1M6OA 1F97A 1KLFA 3P0GB 1UVQB 1A22B 4MA7H 5D7IB 5IQ7H 5EO9A 1QPPA 4M9PA 5I74C 4YUEL 1IC5L 5FO9B 4I0KA 1DQJA 4U6VH 2LAGB 5D7LA 4J3OC 2V2TA 3WE6A 5J9PA 2CRMA 3BPNC 4Y1AB 3THML 4EI6B 4X6CA 3QUYC 4MNQB 1YN7A 4JJ5B 3REWB 1OGAA 3SDDD 3WIHA 4WWKA 5B3JE 1J7VR 5CMAA 4H88L 3WO3B 4K3JH 1C5CH 2DDQL 4I0PA 3I84A 3WUWG 4PJFF 2MFNA 4J4PA 5HSFA 2VISA 4U1NA 2OLDA 5INCA 1WBYA 5AYUL 2E3VA 5BS0D 2AABL 3DUUA 6FABH 3D0LB 4U49A 3GKWH 4HIEA 3TJHC 1TLKA 4YAQB 4NBZB 3UPRA 4LIQE 1QBBA 3HAEH 3WDHA 4X7TB 4H1LG 5GJSH 4KRPC 4P5TA 4E41A 1T83C 3UPAA 3ILPB 1IGML 1VA9A 5T3XD 1QFWH 1VFAA 3LIZL 1IL1A 3VGDA 1FE8L 4JY6A 3ARBD 5SWSE 3TZVA 1IEAA 5ISZD 2JIXB 4PJ5B 5ANMB 4LMQI 3MLRH 3O11B 3F62A 2IH3B 3FT3B 5EG6C 1LK3H 2F53D 5TE6H 1GHFL 3RDTA 2VXUL 4WTZA 1JF1A 3DUSA 5E2JA 5E8EA 2VDRH 1JGDA 1Q9LB 1XGRB 5DWUH 2O93L 4OGZA 2C7UB 3QDME 1VGKA 4TNVK 5CJ5A 4BKLB 3NCCB 4PG2C 2D9CA 4LLUA 3T2PA 3MOBH 1A1OA 2AJVL 3FOLB 4FFWC 3CFEB 1FRGL 4FZ8L 4I4WA 2ICWI 3HZVB 4PUBL 4AJ0A 5C09B 4RAUA 3WFHB 2PYED 2HT2C 2BOCA 1FLRL 1HHHA 1QP1A 4NHCL 4ZFOB 1NGXB 5C0AB 2AEQL 2G60L 4N0FB 4LLVA 4QY8A 5B38B 5IEKB 1Z6JT 3SCMB 2BFVL 1S7WA 1R3JA 3MLUL 3DMMB 4GW5A 1FL6B 1N0XL 3QXWA 1LVEA 5FEBA 5KSUA 4HJGA 3SGDI 3BQUA 3VCLB 4MD0A 4HG4J 1U8OA 4OZIA 5C0IB 3RVXC 5JXED 3O2VL 5FUCE 2R2BA 5FYLL 3QH3A 4JHWH 1QKZL 3ZYOA 4BFIB 5JLZB 3ARSA 5GZND 4Q6IB 4V2CB 4HKBB 4OGYL 3QG6B 5DJ6A 5I8KL 2UZXB 1XGUA 2VZOA 3FQTA 4MA3A 1JF6A 4MNGA 4ONFL 3O8XA 3SDCD 2Q6WA 5SWZE 4HPYH 3FOMA 1JI2A 5H37H 4YHLL 2WLZA 5MEOA 5DVMA 1DUZB 3WFCL 4BFEA 2Q8AL 5E2TL 3PDOB 4Q9BA 3QDJB 4CL7A 4YEEA 1FFNA 5LCVH 3PGCB 2LU4A 5TFSH 1ZANL 4EQ2A 1CGVA 1Q0YL 5DA0B 3PF2A 1T4KA 4UT7H 1RJLB 5TQ0L 5C0GA 5JPNA 2GQHA 3G5YA 3QWOA 1BQHG 1U8NB 1CICC 2X9YA 3L5XL 1FIGL 2E7CA 5GGUA 4UMGA 3D2UD 2O5ZH 1BJ1J 1DDHA 1H3WM 3K0WA 4HUUA 3FMGH 5HHQA 1MNUH 4PR5A 2AI0L 4XCCH 4DVRH 3VFTA 2JJSC 1OSPH 4HXAL 4N8PA 5E5MB 3K2MC 5GGSY 2EZ0D 4FQCH 4PJDE 4MHHG 5TF1L 4L29A 1A02N 3SEPA 3P77B 4DGIH 5D1QA 2RFXA 3I6GA 3WJLC 4X6DB 2X42A 1HYRC 4EBQH 3PGDB 3P9MA 2EDLA 1S7SA 4NYLA 1ZLSH 1TQCC 1N3NB 3QNXA 3LD8C 3V4PH 5CZVH 3MSPA 5FCSH 3BIAX 1KJVA 1NUDA 1DVFD 1G0XA 4ODHL 1MCLA 5E4EB 5C9KA 4OIIH 3WKML 2MQ3A 3LB6D 1NBYA 2DS4A 2UWEE 3QXTA 2Q87A 1SJEA 5DTFB 3GHBH 2H41A 1NCAL 2X44D 2Q8BH 4Y19A 4UAOB 1F90H 2CUHA 4UIMB 4QRQA 2X70A 3WEXB 4WFFD 2QJDA 2NLJA 2VRAA 1YYLH 2PXYB 3BPCA 1CGUA 2GAZB 4U1SB 1D9KA 5DT1L 1I9RH 1XIWD 2F9BT 1BQLL 1YEJH 5GGQH 5DHXB 5F7EH 4S1QH 3I02B 3MJGX 2X4SB 3O6KL 3BH8B 2GUOB 3QNYB 4PJDF 3S36L 5ACZB 1JTTA 4I77H 2ZPKH 4LHUG 5T1DL 4BSVA 5KOMC 4OLUL 4P5KB 1F4XL 4PGZA 2E27H 5A16B 1EERB 1NANI 4M8QA 2J4WH 1G7LA 4N9GA 5BMFL 5DEGA 4D9QE 4ERSH 2AW2A 1FBIL 2OM5A 5IMKA 5I1IL 5HI4D 4J6RL 2MQ0A 4Y2DA 4YPJA 2FWOB 3OPZL 3L95B 3IJYB 4OI8A 1UFUA 3MV7E 4QRUB 1X5XA 3H42H 3BISA 3QEQD 5KVGL 2UWEF 2DQIH 3OAZK 4J3SA 4MCYB 3VD9A 2DM4A 4FQXA 4B7IA 1UC6A 1RIHH 1M7DA 1D5MB 5I76B 4JCMA 2UZIL 1B0GA 4UTBH 3O3AB 4EDXB 25C8L 3HR6A 2BX5A 4H1LH 3RU8H 1NC2A 1GL4B 3SDXB 1KLUB 1A5FH 3QIUD 1SYSA 4EOWH 1JZ7A 2OR8A 3MRRB 4RWYH 4MA8L 3QEHA 4NRYB 3DVIA 3S96A 1F8TL 3Q5OA 3WLWC 4LCWE 3ZO0A 1UM4L 2Z91B 2HWZL 2QR0A 1ONQB 2QQLL 3FFDB 1J18A 4LHUD 5HVFB 5FIEA 4K9EC 3V6FB 1LO5B 3HI1A 4M1CD 2FX7H 1UH2A 4FTVB 3T8XA 4G43A 1GZQA 2F5BL 5TPWH 2R23B 3HZMB 4UINL 1M71A 1NPUA 4P4KA 4HUWB 1OTTC 3O6FC 2P24B 4ODTL 4X7DC 3GMOB 2IFFH 3LSOA 1CL7L 1E4WH 8FABA 2H1PL 4TPRL 4KROB 3L3HB 4QF1B 1KIRB 5FGCE 3EFDL 4PJIB 1ORQA 2VL5A 3P11L 4NC1E 5CJXA 4LLMA 2EO9A 3JTTB 5SV3A 1WWBX 3L7EB 1FO0A 4WI5A 1AIFA 3MRMA 2ZCLL 1Q0XL 5IMOB 2IANE 1JN6A 3MGTA 4FQLH 3O6MH 1NBZA 4RGMB 5CEYB 4WW2A 5HXMA 4LVNC 4Y4FB 4TVPL 5JHLH 5F97E 1CYGA 3MCLL 4QWWD 1LO3H 3PUCA 4UOW1 4GKOA 5GSRA 5KG9A 2VZTA 5IWLC 3MXWL 4LLAA 3RGVD 2YRZA 3T3ME 1I1FA 4KAQL 2XKNA 2UVEA 4HT1L 2FZ3B 2Y5TB 4Z7OE 2CDFA 2VKXA 4JHZA 3VRIB 3Q6GH 5JNYA 5DJYB 5TDNB 2MOVA 2E7MA 15C8H 5I15H 5IW6A 4FFZH 3D9AH 2P45B 3KPOB 2VTFA 4XP5L 4J12A 4JY5L 4WEBH 1EAJA 4RGNC 2R4RH 4HWEH 1A4JB 4N5ED 1NAMB 2EDJA 1ZHNB 3D5OF 3TBYA 4XPHL 4OSUL 3SJVE 1AGFA 4K2UH 4KVNL 3R4DA 2GSIB 4B41A 1KN2H 1CS6A 1NFDE 4FFVD 3ROOB 2NY7H 3V95A 3KPRD 4RAHA 3HE7D 3Q1SH 5KVEH 4XH2A 4O00A 5I71C 1W8OA 5F7YC 4OD2A 4X4MA 1UJ3B 2H6PA 1F02I 3MRDB 3ARGB 1TVDA 4WU7B 1C5DA 3C9NA 5CLTA 2WM0A 3CXHK 3LV3A 3MV9E 2EKSB 4OD1L 5IB3B 3T3MF 2G9HA 2VUOA 2I24N 4GW4A 5C08B 4DGYL 3CIQA 3U9PH 1PEWA 1RK0B 3L3IB 4JFXB 1A7NH 1UWEL 1H3GA 2ZSVB 1F4HA 5DRNA 2X9WA 3PHQA 4NKIL 2HFEA 2EIEA 4GAJH 4M7ZB 2DOCA 3KDMA 4M61B 4PB0H 1M6OB 3ORJA 5T1LB 1MCDA 3HG1D 5ESAA 4YC2C 5EO9B 4J8RB 1I1YA 1XF3A 3RA7H 4GMSH 5F88A 1U95B 1RZKH 2NMSA 1NCBH 43C9A 3MJ9L 4Z7NE 3ALWA 4WGWB 2Z4QA 5J9PB 1VEPA 4X6CB 4YBQD 3BN9D 3FFCA 2VZ3A 4IRJB 2O26U 4LMQE 1PYWA 1OGAB 1NFDF 3G9AB 1G6RB 4JB9L 4CDHA 4P99A 4OZFB 2IQ9L 1A3QA 3GSWA 4U0QB 3EO1B 3T2OA 4JPKH 5FHAH 4D8PB 4Q97A 1WEJL 4PJGB 2VISB 4U1NB 3R0MA 4WEMB 4OUOA 2DIAA 2W0FA 4ESKA 4M1GH 2R56L 1RZFL 1KGCD 3DUUB 4F7CA 4D9LH 2VLLA 4WFED 4HIEB 3VFNA 1W0YT 1MAML 4RISL 3X3GL 6CGTA 1IM9B 2H32A 3RZCB 3UPRB 1JPST 2QLVB 3E3QE 1P4IL 2XT1B 5GRJL 4E41B 4QHKI 2AJUL 2DJSA 4X0KA 4TULL 3MBEA 4OGAD 4XVSH 1M05A 1IL1B 2P8PA 1QHPA 4JY6B 3DGGA 1MFEH 3TZVB 1KT2A 2JKXA 5I0DA 2BNRD 2CIKA 2ZKHL 3FO2A 3AS1A 1T22A 3O9WD 4X6EB 2EXWD 2YMXH 4Z7NF 5F9JB 1CL7I 5E8EB 5J6GB 5JZ7D 1GGBH 1CGTA 3RTQC 4KK6D 1RUPL 3BJ91 1QRNE 1KLGA 4Q9RL 4OJFL 2APFA 3O2DL 5JW5A 3NCFB 2B20A 4I4WB 2R0WH 3ARDD 3V7AE 2NW3B 5A2IH 1I3GL 2BOCB 4MXQD 4ONHB 3U46B 3OL2A 2APBA 3MUZ1 1HHHB 4NZTH 2LABA 1DUYA 1T5XA 4KTYA 4XNXL 3HUJB 5CD5C 1QNZL 4F3FA 1YUHA 4QY8B 4DAGL 2KZWA 4KKBC 2VDKH 4PGDA 3EDDA 2NPLX 1TVBA 3KYMA 5DLML 3T77B 1S7WB 1R3JB 2DTML 5LAXA 4PTUA 4ETQB 5D7KE 2P42B 4DKEL 4HJGB 2ID5A 1CZ8H 3BQUB 4PLKC 4MD0B 4U1GB 4BQ6A 1U8OB 3BPLC 1TJHH 2BSRA 4YLQT 3LKOB 1R6VA 3CH8A 3ZTNH 3QH3B 4Y5YA 4ZUSA 3TP4A 4HPOH 1KFAH 3OF6D 2EDOA 4KDTC 3TH3T 3U4BL 1MLBA 1RMFL 4MNGB 3VWKD 4A2LA 3O8XB 1TZIA 3O4OB 4FP8L 3UTZB 5F3HA 5KTEH 3TPUA 2OSLA 1NC4D 4OLEA 5KOVC 5C0DB 5GQBA 3KHOA 4M6NL 4N8CH 4LASL 2GK0A 2FH6A 4PJEA 5L88H 3LEVL 5CZXC 1YPZE 2XWTA 3BP6A 1KB5B 4V1DE 4CJ0A 4YGVA 3D0VB 3TPKA 3EO9H 1JHTA 5IT2L 1T4KB 4A6YL 1TNMA 3ZE0E 4Y4HA 5C0GB 5JPNB 3G5YB 3P0YH 4RMSA 4IMKC 1JZ5A 5IBTH 3OV6A 3GIZH 2Z0BA 2A1WL 3O2WL 3MXVL 1DBBH 1U3ZA 4YDKH 1F11B 4GLRI 2H2SC 4HUUB 1KEGH 4B53A 4G8GA 2PTUA 2AAVA 4XC3H 1AD0B 1PZUB 1W72B 2P44B 5C0BA 4ZD3H 3E0GA 3X17A 3EYQD 5DD5L 1AXSA 1J0HA 1ZVSB 2HLFD 2EDHA 3FQUB 2Z92A 2D4DA 1F6AB 4A6YA 4JGJA 1TITA 2JB5H 1S7SB 2DQTL 5HD8D 1T1ZA 2R29L 4PJ8A 4HFUH 1Q8MA 1ZTXL 3T0VA 1YPZF 3QWRA 5C2BL 2QHRH 3D69B 3H3PL 1EHNA 3TVMA 4ZFOL 3HMXL 4XVJL 4ZAKD 4NUGH 4W6YB 5ILTL 1NBYB 5LVEA 1P84K 1AY1L 3GRWL 4NQEB 2L7JA 5CSBA 1HOCB 1T7VA 3L3JA 4QO1A 4KKNA 1CIUA 3ZE0F 3JWOH 2PYFB 3NAAH 4Y19B 5SWSD 3SCMC 4G6AC 3QA3A 5IQ9A 4KXZI 4XTRC 3MLYH 4QRQB 4XMPH 3VWJD 3DMMC 3QUKA 1RAMA 5M94B 3D39A 2XRAH 1H3PL 1MOEA 4K3DH 1J0ZA 3FRUB 1OW0A 3BPCB 1U36A 3DHMA 1FYTB 4KKCC 3QJHB 2YD5A 4HKZA 3QDMD 5IVXA 4DCQB 4MJ4A 2K3TA 3CX5J 3F58H 2RGSA 2ZOKA 4Z8FH 2DYPB 1EUTA 1YYMH 4QHMB 3QZWG 4LEOA 4Q6IC 3L5IA 3IKCA 1MIML 5ALBH 1KC5H 1XF1A 4D94A 1DL7L 3RNKB 2K9UA 3PXJA 4NQDA 4NJAL 4WHDA 1J1PL 1VFUA 3GEWB 4MZ2A 3H9ZA 1G7HA 1GC1H 4P2RE 4Y2DB 2EXYC 1PZ5A 5H94A 4OCYL 3W5NA 1R0AH 3Q5YA 1R3LA 1Q72L 5IMLB 5AUMA 2BK8A 8CGTA 4L9DA 1T21B 1RUKH 3NMEA 5KSAD 1MFCL 5DFTA 1M7DB 1WJ3A 4KUZH 5KSBE 4WJ5B 3GBNL 4OD3L 1JGLL 4NWUH 4M62L 5DURB 3CDYA 2A6DB 3EJJX 4IRZH 4P23B 4NNYB 5F89A 2Q76A 3DUHA 3SGJC 1JMXA 3VFGH 1HIML 1NC2B 1IVLA 3QUZA 1JK8A 3EYOB 3K1DA 3S7GA 2FYYA 2LTQB 2A2QT 1I85C 3QEHB 1NMBL 2XYCA 2J2ZA 5ESVB 5SWZD 5GS1A 1SBSH 4ELMA 3KPSE 2HN7B 1CGXA 2OJZH 4KHXH 1N7MH 1B9ZA 1S9XA 4CNIA 2HT4C 2GJZB 3EOBA 5D8JH 1QBLH 4Q74A 3RKDD 3T8XB 2X9XA 5DFVD 1GZQB 3C5SB 4XP1H 1M71B 3RWGA 3VD3A 3V5KA 2OQJB 1PDKA 5TGBB 5EWIH 4MJIE 3OQ3B 3OR6A 4OLWL 3PWJA 3QFJA 1ORQB 3RJDA 4GAYB 3REVA 4PG9B 4X9IA 3RWEB 1AFVH 4LLMB 4Z7UA 3OKKA 5KZCB 1FO0B 3ARQA 5EU6E 3WDIA 1AIFB 1E6OL 1P5VA 5E4EC 2C1OA 1NL0L 1ZAGA 1JN6B 4LSUL 2XZAL 5KSBF 1FSKB 1INEL 3VXSE 4IOFD 4OCSL 5L8LB 3C8KA 3IJSB 4QRRA 3KLHD 1CXFA 5I17A 4UAOC 2HRPH 5KG9B 5GSRB 5TE7L 2QSTA 4FXGA 1HE7A 4YDIH 2V9QA 3L9RB 4GAGH 4PRDB 4PTTA 2D7MA 2YHGA 2XKNB 2PXYC 3D3VA 2NY2D 1AGDA 1EHAA 5HPMA 2RIKA 2NY0D 4YHZL 5EO0A 4XC1L 4I0CC 4L3AA 5DUML 3VW3H 1RUMH 3IB4A 5C07B 3LPGA 4E0RA 2BOBA 1N64H 4OCLC 3OJ2C 4NRZB 4GG6F 4BM7A 2WUCH 4ZNEE 4M4RA 2YUVA 3AMLA 1GGCL 3HTLX 3MBXH 1D6EA 1Z0MA 5JOEA 2PKDA 4XMLH 4HDIB 1AGFB 1RURL 3GSNA 3WS6C 4JQXC 3VU2A 3ZKXB 2KH2B 2DL2A 3QUXC 5SWQA 5DRZB 2DLHA 1H3UA 1UCBL 3MRJB 3ES6B 2XWBA 3FONA 4I48B 4D3CH 2ARJB 1DLFL 4XH2B 5F71A 4OD2B 3HNVH 2H6PB 2DLEA 3PWUB 4A2MA 4JREB 5HGBB 1YEHL 4NFBA 5F44A 4R90L 3HB3D 4LVOB 3LH2L 4YX2L 3TYFA 2W9LA 4OM1L 4R9HA 2BNQB 2I5YH 1G9MH 2VC2L 3UJJL 2B8OT 3TM6A 5C6TH 4FRWA 4NP4L 1BJ1H 5C6WH 4AL8H 5IEHB 1L7IL 4D9QD 1NLBL 3PHQB 1EHXA 1ZK9A 3ME0A 4GKSB 2HFEB 4JRXB 4NO5B 2MPAL 1GAFL 1ZWIB 5TE4L 1UWXH 5E56A 5ESAB 3MV7D 3PWPE 4JM4L 3B9KD 2ITCA 4GQ9L 3CAFA 5KS9E 2CMRH 1T89C 4U1LA 4APQB 1KCRH 3L5WA 4DZBB 3MNVA 4KROC 4KZDH 3ILQC 4KK8D 4X7FC 1PYWB 1R5VB 3MNZA 5IG7B 1MREH 1S3KH 5D2NB 2ARJQ 4P46D 3GSWB 4ELKA 2R0ZH 1EBAA 4LCWD 5K33A 4X83A 3IXAB 4LPTA 4LSQL 3ARVA 4RGMC 3ZL4H 1CLYL 4U1KB 2W0FB 4PRAB 4Y4FC 1BBJB 3GGWA 3LMJH 1WWCA 3BEWA 1BP3B 2VLLB 4G3YL 3VH8A 3EJZC 5KAQF 4JLRA 4QYOA 2XG4A 4TVPE 5C7XL 1OAXH 3I75B 4LVEA 4PJHE 3B5HA 3RY6A 3TBSB 1YQ2A 1NGWB 3MBEB 4ZYKA 1KPUB 4NN6B 2DM2A 3QQ4A 2ADFL 1I7RA 2P8PB 2YPVL 2X41A 3DGGB 3KR3L 1NBVH 1KT2B 1BEYL 1FGVH 5CEXB 5BZDA 1AI1L 3IFOB 2IBGA 4JPWL 1S7RA 2IAND 3GI8L 4KY1L 2DI8A 3G6AA 4JQVA 3DV4A 1LEGA 4AEFA 2YKLL 4H8WL 4HUVB 4HZAA 5CJQH 1U8QA 4MQ7B 2QADD 4LCYA 2R1YA 2JJTA 3K8MA 2GCYB 1BOGB 1Q1JH 1RJCA 2HKHL 3HLAA 5E8NB 4O4YH 2C3XA 4O51B 5IB4B 1WVZA 2IAMD 1MI5A 3TLRA 5TQ2L 5JPMA 2X5PA 1UJ3C 4I2XB 4F3FB 1YUHB 5FDWB 4LSRH 4PGDB 3BW9A 1RK1A 3TYGH 3KYOB 2B0SH 2VLJB 4DVBA 2N4IA 1BLNA 4JG0L