1IAII

Idiotype-anti-idiotype fab complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
218
structure length
218
Chain Sequence
EVKLQESGGGLVQPGGSMKLSCVASGFTFNNYWMSWVRQSPEKGLEWVAEIRLNSDNFATHYAESVKGKFIISRDDSKSRLYLQMNSLRAEDTGIYYCVLRPLFYYAVDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSTWRPSETVTCNVAHPASSTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an idiotype-anti-idiotype Fab complex.
pubmed doi rcsb
molecule tags Complex (immunoglobulin igg1/igg2a)
molecule keywords IDIOTYPIC FAB 730.1.4 (IGG1) OF VIRUS NEUTRALIZING ANTIBODY
total genus 35
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1993-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaiI02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iaiI01
1AD9A 2WUCH 4WCYH 2OTUB 3UTSA 2JK5A 2HYMA 1IAIM 2VDLL 1NBQA 1QFPA 3W9EA 2J8HA 1A8JH 3GSWA 4X5WB 1LEKA 5I1CL 4JKKA 3GZKA 3L3DB 2CR6A 4NT6B 2ZZUT 5EWIH 3VFGL 2NTFB 3GJEB 4M48H 3QHZH 1CD9B 4NUGL 1CFSB 4IRSA 4L9LC 4UTAL 3RWGB 2WBJC 2DQUL 4FQQA 5SX5H 4XI5D 3TA3D 4YO0B 3ARFC 3F5WB 1C08B 4P5KB 2YBRB 5JHDA 1KN4H 1Z5LB 1YECL 3DETC 4JHAL 4MA8L 4QT5A 4AMKH 1BM3H 4NO5A 4PREA 2A9ML 5JDSB 5FCUL 1YEJH 1FNEA 2DDQL 2HFTA 4KI5E 3RZCC 2BSSA 1UEYA 1VPOH 2DI8A 1GGUA 1J8HE 1CLOH 4ZD3H 5K9QI 4U1LB 4GXUN 3G6AB 3VXMB 1PZ5A 4UU9B 1PEWA 1MJUL 3OJVC 3NOIA 3S36X 3TBSA 3HN3A 4LLWB 2MKLC 1OGTB 3ARXA 1FIGL 1FO0A 2NZ9D 3WNKA 2QR0B 4JFEB 2V7HA 1GRWA 4Z95L 4B41A 2H2PC 1BF8A 3P77A 1RMFL 5FXCH 4X6DF 1NANH 5GGTH 4WHTB 3VFMA 2KDGA 2C4XA 4RMTA 3DX8B 1I1YB 2APXA 4G9DB 3K7UA 4EDXB 3X17A 1JPSL 2MCPH 6CGTA 5HVFB 4KZDL 3VDBA 1IM9D 1HHIB 1HILA 4JE4B 1ZGLA 4RA3A 2XOTA 3EO1B 5DMIL 4KKCD 3TH4T 1P5UA 1OAYH 3IXTA 5EFIB 4QYOB 2V2WB 5IVZB 3IXAA 1HWGB 4MJ5A 2NXYC 4GRMB 1A4KA 1KEML 3TIDA 4R2GD 5D1XB 3VFWB 4X4ME 3WHE1 1XR8B 2W60B 3CC5B 4WTZG 5E00A 3TO4B 3VA6A 4NPYA 4RMQA 5IG7A 1KCRL 3S97C 4FNLH 3CMGA 3U2SB 3V7AE 1UEMA 4FXLA 3QI9D 1ZT1A 2MSPA 5E2VH 5MP6L 5IB3A 5CZKA 4MJIE 5EZOL 1B0GA 3BPCB 1F45A 4U1GB 3BFOA 4NRZB 1D5IL 1FNHA 5CGYC 4AEIL 3N85L 3H7BA 3QUMB 4M9PA 4OQTH 4HKBA 3ULUF 5I1LA 3GIZH 2OL3B 4PRHA 4BZ2L 3IDGA 4IHOB 1BBDL 4JM2D 2R2BA 1U8QB 2A73A 1H3UA 3GMPB 4NO3A 2PETA 4RDQF 5ID1B 5I8EA 4B0MM 4WFHE 1UADC 1B0WA 2DQFB 3ARBA 3CK0L 3GI9H 2BFVL 3L5JA 4NCC2 5D8JL 1KB5A 3BPNC 3O0RL 4X7SH 2W9LA 1XCTB 3OKYA 3VRJA 5EIQA 2DBJA 1PEZA 4R7DA 1WIUA 4YR6A 5HHVH 1IL1A 1JNHB 4E5XB 3KXFB 3ARBC 5C1MB 2HJFA 4NNXB 5C3LD 4DWHA 3B2VH 2JELL 5FO7B 2AXFA 4X7TA 4RBPK 1WWWX 3CZFA 2VE6B 4F58L 3SJVA 1NFDA 2BHYA 1N4XL 2NMSA 4DKAA 4NC1C 3X3GL 3QIBD 1M71B 4KKAC 3AXLB 4QHUA 4N1HB 5EULV 4PJDA 5FYLE 2DLEA 1SY6H 2OTUA 1MAML 1ZWIA 2BC4B 3W0WA 3OB0K 3P0YH 2Q1EA 1WZLA 2AV7A 4WHYH 3RU8L 5HHMB 1R3IH 4N5EC 3D85A 3S36L 4O2CB 2VLKE 4K3DL 5DJ0B 1OAYL 3BJLA 2Z91B 4LLVA 1JNNL 1IAOA 5DMIH 1CICA 2E7HA 3MRGB 3VG9B 2EDXA 1UXSA 5TE7L 4CW1A 5I1AB 4CDGC 5DMKA 3MR9B 2ED7A 4I3RL 3LS4H 1JGDB 5KVDH 2VC2H 3SQOL 5D1QC 1B0RA 3L7FB 2X4TA 3ARFD 1XZ0B 1T4KA 2BVOA 3CNKA 1PZUB 1RIUL 4MZ3A 1BP3B 4WV1B 1LEGA 3O6KL 3W2DH 3VXRE 1NUGA 4LSSL 1G9NL 1MY7A 3TPUA 4LHUB 3CLEL 3FQUB 3OHXB 3U46A 1EHAA 2BMKB 1XGPA 5IMOA 3QPQC 3NFNB 4NHCL 1FORH 1H8NA 2E8ZA 3SE4A 2G60L 4ZTPL 5KW9L 5GS0D 3VRIB 4HS6A 1U58B 5JDSA 4HHAB 2L7UA 1J1PH 3LKNB 2QSTA 3VMPA 1JF1B 3U0TA 2SEBA 5C07B 3UTPE 7FABL 1K8DA 1U3HA 4FQ1H 5HHOD 4V1DE 1NGWA 1F6AA 1RHFA 3ARYA 3GMNB 4XBEH 1G7IA 3T77B 1QVOA 5D7LD 3K46A 5FKPA 1NCWL 5F1IB 1U8NA 4GKNA 4BA8A 1OAQL 4MWFA 4AEIH 4JRXB 4D9RE 4ZFFA 3HFMH 1TETH 1K5NB 1F4YH 2YHGA 3LDBB 5C0AD 4PD4J 4ODWB 1E27B 5CD3A 4PRDB 4QNPE 5K9JH 2QSVA 4HWUA 1CE6B 4PJIE 1TITA 3WFCL 4K7FB 2OJZL 1MRDH 2I5YL 3G6DL 1MFAH 2OI9C 4EIZC 3B5GA 1M05B 5F7YC 2X4RA 4HUVA 1MFDL 2XTJC 4POZD 2YD2A 3TN0D 5KN5B 5T5NF 2VISB 4LSQL 3ZTJH 1JMXA 5D7LB 2XFXB 3MJ7B 2AEPL 5DYOB 4HFUL 1IGIL 1LNUA 3EJYD 1DL7H 3O3BB 5JZ7C 1R3HB 1JWMB 4YHOH 2ZNXA 3L3GA 5TDOB 3Q1SL 3DUSB 4GRWE 1S9KC 1QBMH 2V9TA 3W9DB 3RVTD 2FH8A 2G60H 2V6HA 4S1DD 4KUZH 4LCWE 4UUJB 3MTRA 4JQXC 1WT5C 3QO1B 2IANE 3P9MB 4X6FB 5JIHA 1UM5L 4P5TC 1D5IH 1JHKL 3FHAA 4X6BA 3W39B 1DUZA 5DJZA 3UCRA 3S3PA 4N90E 4CVUA 4AEFA 4PRNB 1LO3H 3QULA 3CDGB 4BQ6A 2RJMA 1XGRB 2XRAH 4OLYH 1CR9L 3ZTNH 3SKOB 3VFUA 4NNYB 3Q3GA 2UZIL 4PRAA 1EA9C 3G5ZB 3L5IA 3O2WH 1MJUH 1UM4H 1IEBB 4I3RH 5DHVB 1MHPL 3MLYL 3ARZA 1GAFH 3LZFH 5EA0H 3AAZB 5EBMA 1LEIB 1RFDL 4ZDHA 3SGEI 5C3TA 1WCQA 4HJGB 2BY1A 3UPRB 1T5WB 1H3GA 3BP7B 1ZSDB 5GHWL 4P59H 2PCPB 2NR6C 5EBLA 1I7UB 3DO3A 2NW3B 5D7JB 4Q6YA 1P4LA 4YHIB 2HTLC 4M7LH 1NFIB 4XAWL 2A2QT 5LG1A 3UAJD 1UH4A 2GJ6E 5IBUG 3BE1L 2JF1A 5BMFL 1W72A 3X3GH 1RULH 1N6VA 5LQBL 2C7UA 4H0HB 1JRHI 3WN5C 3G9AB 2W0FB 1KENH 5E6IA 3WKNA 2I60L 5HDLA 1B88A 1K8IA 3CZFB 5SWSA 5I1GL 5J1AB 3PGDA 1MJ7L 5EUOB 5I6XC 1CFTB 5DC4B 3TIEA 2IALB 5D93C 5GGUA 2AJUH 5E6IC 2X05A 3C6SA 1VHPA 2VN4A 2P45B 4NQEA 2LTQB 4LCCA 2O5XH 2VDQH 4GRWF 2PYFA 2ZOKA 4MAUH 3VFRB 4KKBC 2ERJC 3AS1A 3CFKA 5GS1C 3BP6B 4Z78A 4JANA 4Z76A 3KYKH 4Z7QF 2ZUSA 5HI4C 4UOW1 2JLLA 3ARDB 3UAJC 4C56A 1U95A 3L3HA 5MEOA 4G42B 1Q0XL 1X4ZA 1T0NA 4MX7B 4YDVB 4PY8J 5IB2B 4LK4A 1RZ7H 4HS6B 3AS0A 3I6LE 4OZHA 4WUUB 3VGHA 4I3SL 2VWEC 4M5YL 5C09A 3T08A 2QLVB 3L5HA 1AKJA 4FTVD 5AD0B 4F7PA 3FFDB 2G5BA 4PP2B 3C60C 5HHPA 3RHWF 4NPYB 1AE6L 4L4VE 4XCFL 2WINA 2A0LC 3MX0A 2A83A 4RFEA 5EU7C 1D9KB 5FHAL 4PRPA 1KULA 2Z35B 4UUJA 4CMHC 3GB7B 5GRUH 4LLUB 2Z8RA 3EYUH 4WFED 5T3XD 3ZT6A 4LQ1A 5DJAA 4F9LC 3RGHA 1A3QA 5CGMA 3O6LH 1LD9B 3SGDH 1FYTA 5AYQA 3T3ME 1NSNH 1CIDA 3FZUD 3UYOD 4OZ4B 5DYOA 1MI5E 4JPKL 4QXTB 1DBKH 1NC4B 3TV3L 4DCQA 3BP7A 1AI1H 3PNWB 4N0RA 4G8EB 1DQQB 4JO4H 4NZRH 3KLAB 1LDPL 4HUVB 4JPWL 4PRBA 4QHNA 5F3BA 3WFCH 3ZT5A 4XNYH 4FXKB 3H9SE 2XA8H 3FJTA 3MXVL 4LCIL 3TBTB 4HUKB 5HGDA 1G0DA 5GGRA 4XPGH 5JZ7D 1MCFA 1AO7A 1WQVT 5CIPB 3QQ4A 5I19L 1M7DB 4LRIC 1EZVX 1A7QH 1Q0YH 3UYRL 3F7VB 4LIQL 4PB0L 3D0LA 3DRQB 2GCYB 1CXIA 5C0GA 5DLML 3HB3D 4XPFL 4CGTA 3ARSA 2VYRE 3RP1A 3SJVD 2DQDH 1U8OA 4N8VG 4O58L 4ZS7H 1I3RA 3P4NB 1A47A 3P3YA 1QNZH 5I8CB 3N1MC 4BSWA 2MCG1 1JN6A 4LCYA 4N1CA 4D0BB 1G7HB 1F2QA 4LSRH 5L88H 1BECA 4YZFF 3HZVB 3IFNH 3K4ZA 4RCAA 2FZ3B 1FN4B 3JUZA 3FRUA 4PRPD 3S3JA 3EGSA 4PJEE 1AD9B 1SVZA 4JDVA 1GHFL 1U93B 3EYQD 1SHMA 5E8PB 1FPTH 4G43A 1A6AB 1EZVY 4XNUL 5EG6C 4ALAL 3ZE1F 5GS0C 2R15A 1BZ9B 4WDIA 1RQ5A 3BH9B 4P59L 1D9KC 3S37H 2AK4E 1J0JA 1ODAA 5ALCH 1JHLL 5DGQA 3FO0H 3QCTH 3OF6D 5KN5A 4R3SB 3S5LB 3L6FB 1MRFH 2XG4A 4JY5H 3BP5B 1D9KA 4HQQH 5J3HC 5CSGA 5DJCB 1T03H 4A2LA 1KT2A 1GGIH 5T5FL 2ED9A 4B7IA 4L1DA 4XCEA 1HZHH 3FQWB 5IOPB 3FO2A 3WXVL 2R1XB 3BAEL 4ETQB 4XMPL 4QHUB 1KPUB 1H3VA 5IIEB 4TULH 3SE8H 3BUYA 5GS1B 3P2TA 4NO0A 3DX9A 5DQDH 5L2KE 3S96A 2GUOB 3TO2A 3BE1H 5BMFH 1K5NA 5CD5D 2C3WA 2VLKA 1UKTA 5F9JB 4RBPH 1IGCH 3WE6A 1HE7A 3P9LB 4JZOB 4S1SH 4HGMA 3U0WL 1YYML 3CFKB 4UZGA 3SEPA 4JFEA 4HDIA 4LQFL 4M00A 4CAGA 3LN4B 5E56A 1URLA 2BXZA 4XRCA 5T5NG 3ULVC 2D7QA 4S1RL 1JGDA 4FQCL 1FLTX 5GRVK 1C12A 4ZYKB 2AXJA 1BGXL 3IDIB 1P4BL 3L9RB 3MACH 3NFNA 4FQ2H 4LVNB 2V2XB 5F7EL 5GS3A 4DN3H 1YA5A 4G8IB 1T2QL 3WIHA 2YKLL 2ZSVB 5EORH 1MFCH 2A73B 5F7LB 3BZEA 1A6VH 1FO0H 2HVJB 1BD2E 5DD5L 1IGFH 1LILA 3X14A 3OR7B 1RI8A 4BSVA 3ILPB 3QUYB 4HK0A 5J56B 4N9OB 4ZFGL 2Q3ZA 4GKOA 2W91A 4J3WA 3ARTA 1AGEA 2DQDL 4O58H 4UIKH 3OKNA 3STLB 5IVOA 3L7FA 3HE6A 2QL1A 1ZXQA 1MCSA 2ZJSH 2DM2A 4JQIL 4ZFFB 2HT3C 5A2KH 1IQWL 3V5KA 4S2SA 1IKNA 4P9HL 3KYAA 5FO7A 4GG8A 3O4OB 2Q8BL 1JGUL 4HIEB 2VQ1A 3QUXB 3VU2A 5ENWA 1B6DA 4JM2A 1FNAA 4OLEA 1QA9B 4PS4L 3H6JA 3NVQA 1H3TA 3QIBB 5D70L 4IRJA 3W11D 3VXNB 3PP4L 3C8DA 3HMWL 2ZUTA 3T0AA 1RZJH 4ONGL 5GRJL 3GDBA 5BS0A 2C3GA 2R4RL 3KPPB 4NKDB 1AXSA 1WK0A 2H32A 4YE4L 3CXDL 4F7CB 3TZVB 3VGAB 2EIBA 2DWEB 2X1WL 4PJCE 5DS8A 4GLRI 1F3JA 4F80A 4NFBA 3QSKB 4UBDC 4EBQL 5E9DA 4CN4A 4Y7MA 1S7UB 4UT7L 3TN0C 2QJDA 3GSVA 1CE1L 1NGPH 1T21A 1BWWA 4ZS6D 5IG7B 1F4AA 3HMXL 3WHXA 4PLKC 2EIDA 2YSSB 5CEZE 2Y36H 4U6YB 2NY4C 4RGMB 5INCA 1NGXA 4X99A 3UC0L 1DEEA 3LKQA 2GUOA 2WWKO 5D9SB 3TO2B 2NXZB 4DKEH 5IEHA 4PRAB 1ND0B 3QFJB 4R4FH 1X6LA 4OLUH 1XH3B 1QYGL 3G6JF 3SO3C 3QG7L 4I0PD 1YEGL 3IB4A 2EC9U 4Y5YA 1QFWL 2ZSWB 4TVPH 5BS0D 5C07D 5D7IB 4DGYH 4S0SD 3ARRA 1KEGL 2E6QA 2E27L 5ELIA 5GS2H 2EDLA 4R3SA 1WTGT 3S5LA 2A6IA 3TBTA 2AQ1A 5ANME 3KPMB 5F72S 3BGFB 3CX2A 1BZ7A 1YPZF 3V6ZB 3GJFB 1RIVH 2HJFB 3ESVF 3DGGA 4BJLA 1BFOB 1I1FB 3MCLH 5CP7B 3ALXA 5HVHB 4ETYA 3PJSA 1T1YB 2Z8SA 4LRNH 5CJQH 3NTCH 3OPZL 1GPOL 1MCKA 4BFIA 4DFHA 4R26L 1U9KA 1NC2A 4MVBD 4I4WB 3BGAA 3L1OL 1A9BA 1VB9A 3PDGA 1NUNB 3C8HA 3VXOA 5IGXH 1ED3A 3RY6A 1EJOL 4FQLH 3TCXA 4PYGA 5C0DB 2DJ4A 3OGCA 4XX1E 3GMRA 4NC2B 1TIUA 3CFEB 1G6RH 4HJ0C 5DDHA 2ZSVA 3NCYP 2H26B 1DBAL 5JOEA 1I7UA 4XTRD 3VFPB 1J8KA 1RFDH 1NEZB 3BP4A 3QCUH 4U6TA 5T3ZD 4XRCB 5FO9A 4KGLA 1I1RA 1UVQB 3WJJA 4Y4KB 5FM5M 4BH7B 4U1LA 3B9KC 4C55A 4JLRA 5IP4A 1M7IA 4S1RH 3TBSB 1YDPB 1CWVA 2YMXL 3E2HC 4I0PC 4M02A 2HWZH 1GOGA 2J5LB 4Z7VE 1EX0A 3SDAD 4IDJL 1U8IA 4X6EB 3SKMB 3T65A 1R3LA 1FNFA 2GCYA 1MCCA 1KGCE 3HAEG 2IALA 4GG6F 4NQDD 1V7NH 3FOMA 3QG7H 4KKNA 4WFFD 1RUMH 3VD3A 4BQ8A 1QHOA 1RZJL 1E4WH 2CJUH 1QBML 3OV6A 4UDTA 3DSNA 4G9DA 4XMPH 2AERT 1J5OL 4F57L 3GFUA 1NC4A 1T89C 5EO0B 3CFDA 3SE3C 5HY9B 32C2B 4JRXE 4UB0H 1DQQA 2WIIA 2Q8BH 3TPKA 1S5HA 5IV2B 5BJTA 3CH1A 3GGWB 3GSXB 1LO0H 2RFXB 3GUTA 3W9EB 3U36B 2YPLB 2V5SA 2GTWB 3FONB 3ARWA 2HN7B 4JFDE 1FGNL 1T04B 4PGBB 1CFQB 4RWYL 5ITFB 4GKZA 1DLFL 2VDNH 1WIOA 4UIMB 2EO1A 1HSBA 4X6CA 2I24N 4FQHB 3QDHA 2UWEE 3FB6A 1B0GB 3BPCA 3V4VH 2YKLH 1FRGL 2YUVA 2RCSH 1H8OA 2DQEH 4LKCA 3WNMA 4PS4H 4WRLA 3SDDA 4PJAA 4XC1H 1QUNA 1CXEA 3S7GA 3T09A 3LV3B 3M1BB 1FVCA 2OR8A 3DSFL 4DGYL 3G04A 2YSSA 43CAA 5C0FB 4LSUH 1PLGH 4GRLD 2CK2A 1FAIL 3JTSB 1KB5B 5D2NA 3N06B 1S7UA 1CXHA 3VXUD 1T0MA 3KR3L 2H32H 5KVGH 4UV4L 3QIWB 2YZ8A 2ZPKH 1MWAH 4F3FB 4OLVL 4KK8D 5M95B 4TUOB 3T0EA 3L5XL 4LEXL 3SQBA 1HN1A 2HKHH 3IDMB 3VH8A 3UYRH 3IF1B 2IANB 2Y07H 4HX1A 3HMXH 1A9BB 1W8NA 3MLYH 1T4KB 4J3SA 3UYPA 1CK0L 2HVKB 1GSMA 1I7RA 2C3XA 4FZEL 1ETZB 2XA8L 5CINH 5KTEH 1BREA 2AEWA 1AGDB 1IGYB 2YD3A 5GSVA 5JDJA 3QDJA 4XNZB 1YNTB 1JPFB 1BD2A 1RUQL 3HCVB 4PJGB 1JZ4A 1IAOB 5DMJB 1JZ6A 4XNMA 1L9MA 1NJ9A 1ACZA 4LCWD 4PJ7F 15C8H 4QYOA 2BNQA 4HBCH 1KPUA 4KUZL 1JF1A 5E2UL 5TH2A 2BRRH 3UTZA 3B43A 4QRRB 4ACPA 2AS5M 3OB8A 1N0XL 2DYPA 1G6VK 1UCTA 1TVHB 4TSCH 1WBYA 5TE4H 5I2IA 4C56D 3KPOB 2VZUA 1BVLB 2BY2A 5CKGA 1II4E 3SKMA 3T65B 1XF4B 1RZFH 2DS4A 4I2XB 5FGBC 3RX8A 5TF1L 2AEPH 3DUUB 3C8KB 2F8OA 2BMKA 1FRGH 1VGKA 1M7IB 2DQJH 4OSUL 2KL6A 4JHBA 3ULUD 4ZOBA 2GQHA 1T04A 4X7DC 2QKIB 3TYGL 3L9RA 5KS9F 1SYSB 4I1NB 3QUZA 4F9PC 3G6DH 1YJDC 2FL5A 3QDAA 2C1PB 1VA9A 2GI7A 3I6GB 1TZGH 3MV7B 3MNWA 4XZUB 3VFPA 4KKLC 3BW9B 3DUSA 4G6FB 4TNVK 1R3JB 3F7RA 4OD2B 4PTUA 5AUMA 3X14B 5DTFB 3W11C 2I9TB 3FRUB 1RUPL 1QP1A 1A64A 1JGVL 2CKBA 2OQJA 5T1MA 1BLNA 1G7PB 3ZDZE 1CGTA 43C9A 1FCGA 3AREA 5GRWA 3IETA 4QRSB 3F7VA 1YEKL 4IMKA 2DQUH 1DBBL 1JYWA 4FXGA 4KDTA 4WVRA 1J5OH 1NFDB 3HI1B 4MA1C 5EN2B 4EVNA 3RL2B 5EIIA 4HKZB 3MJ8B 1T1XB 1K3IA 1JZ5A 2XXCB 3L3IA 4PJEA 5JQ6H 2R56H 3V0AC 5T33H 1B2WL 1EHXA 4KDTC 1BJ1H 2NX5B 4MXWH 3HR6A 3RBGA 3O9WD 4OFYD 1KNOA 1U3HB 4O5LH 3L95A 1B6UA 1XR9B 4NWTH 4ODVH 3QXUA 5DK0B 3FQWA 5IOPA 2JB5H 4YHKH 2MNUA 2FHFA 3D3VD 4TUJB 1UQSA 1CK0H 3LKOB 4P2QB 4L1HA 3MOQA 3O11B 1DLHA 4GJTB 4NJAL 4UQ2B 5ETUB 5DQJA 3TA3A 5TE7H 4DZBB 4HKXB 4JFXA 3WUWA 3IDYB 1BQHA 5FB8B 1QRNE 3RWHA 2X4NB 3BIKB 3U7AA 1T22B 4NRXA 5EU5A 4JQIH 1IKNC 3JTSA 3BRFA 4KROB 1FYTD 1FZMB 2D3VA 2JCCB 4PJGF 2G9HA 2X4SA 4LDEB 4GG6A 5IGXL 4HG4J 5I1JL 3O6LL 4XAKE 1FAIH 3B9KB 4FFWC 2Y07L 3H9SA 3QO0A 5SWZB 4GBXA 5BRZB 2YOCA 1MCOL 5DURD 3BKJL 1J1XH 4NJ9H 4J3UA 5C0RL 4NDMB 3E8UH 9CGTA 3NTCL 1TJHH 2MJWA 3QWQB 1TDQA 4P46A 3HC0A 4TSBH 3EOAA 3VG0L 1OCWH 4HCRA 4JO2L 4I8DA 4GW1A 4JFED 4KJQC 5B8CA 4LSQH 5I8OH 1N59B 1P7KB 4X9HA 3D3VA 4Y2DA 4DGVL 3O4LE 2EXYD 1HCVA 3EUUA 3OAUL 4OFVA 3SCMD 4P46C 4KRPC 1ZA6B 3DJ9A 3JZ7A 3C5JB 5CEXB 5H94B 5DRZB 4JG0L 1Q0XH 4DQOH 3FQRA 2VITA 5FF6B 3QUXA 3MREB 4U7MA 2VQ1B 1LP9B 3QDJB 3RRQA 3E3QE 1JPFA 1ZLWH 4JFFA 3GM8A 3VRJB 1U2CA 3FN0L 3OKLB 3L3OB 1LO0L 5C09E 5D7JA 1T1XA 2ZCKH 3RIFK 1FO0B 5CJXA 1IL1B 1K4CA 4OTXL 3IT8D 5F88A 5FO8B 5IHUL 2X4PA 1RZJC 4MYWB 4YXHL 3VDCA 2ZSWA 1SYSA 1S7WA 5JPMA 1HHIA 1HILB 4KY1H 4PLOB 1ZGLB 2DWDA 4RWYH 4LLUA 5F1OB 4FZ8H 1T03L 2VLJA 3K2MC 1R24A 2VR5A 3IJHB 3C8KA 5KANI 3DX8A 5GJTL 3OG6B 2DWEA 3CPLA 1XF4A 1N64H 5DTFA 2WZPD 2PO6D 1QO3A 2C4FT 4JPKH 1RUML 3LKOA 4P2QA 4UV4H 4XP6H 2CKBH 2XZCH 4PREB 5CUSL 4M93C 4K7PY 3WN5B 4APQA 3V6OC 5FCSH 2ARWA 3SKJL 3NPZB 4K7PH 1KLUA 4Y2DD 3VMNA 1JV5B 4NN5C 4NQED 4TQEL 3G6JA 4X8XA 2VDPL 1NCNA 1KCLA 2XPGA 3H0TA 4NQVA 1U92B 3TBVA 1QSFD 4Z76B 2A83B 1WGOA 1UVQA 3G6AA 1WITA 4JM2B 2XZAL 3LPWA 1NAML 4DZBA 3VFWA 1JZ2A 5HSFA 1F90L 4JFDA 4DEPC 4H8WL 1QRND 5AD0A 5I1HH 1MCJA 5C0AE 4P2RD 1IKFH 3KPLA 2OL3A 3X11A 2HFFA 4M8QB 3LEVH 2HFGL 3QHFH 4H5SA 1HINH 3PWNA 1S8DA 2PW2B 4OM1H 2YD5A 1YJDH 4M1DL 3FRPA 4RMUA 1BOYA 1W0VA 4P5TA 2PXYC 5FECB 1FIGH 1OTTD 5AYUL 2FX7H 1QNZL 2DOCA 5I74B 4Z7WB 3S37X 4L8DB 3WD5H 3KDMA 4HLZG 4LBEB 4LSTH 2AKRB 2EDNA 1PJ9A 5IVXB 1E6JL 3MROB 2D4DA 2J12B 3JV4A 3PJSB 5T3XH 3WJJC 3WXWH 4OZ4A 4L8BA 4LLQA 3V4PL 4RSVA 3DVGA 1V3LA 1WBXB 2JELH 3EYSH 3VCLA 5EOCH 2OSLA 2F8VA 2DIBA 3GSNB 5DJAB 4G9FD 4MWFB 3S34L 2IANA 3QEQB 4F7EA 5DRNA 4L4JA 4Y5XA 1J1PL 5F6IC 1J9CT 4OGXL 1N0XH 1ADQH 1BQHB 5FB8A 3LY6A 5DUPH 1JK8A 2BVPB 2E27H 4KPHH 5GSRB 1ORSB 4U3XA 5MHSE 3IDGB 2FB4H 1KIPB 4LCUA 4NQXB 4BM7A 1EVTC 4K9EH 1MOEA 2EC9T 1R3KB 4R8WL 1I8LC 4GAFB 4PGCB 4GRWB 3T8XB 3F6LA 3NCMA 1UH2A 4IDJH 1NGYB 3DMMA 4MX7A 1QQDB 4YDVA 3WV0A 3MOBL 4J6RL 4ZO9A 4P2OD 5I8CA 3RVXD 5E6ID 1HIML 2ARJQ 2EDHA 3TNMA 5B39A 1U8OB 3OG4B 1XR8A 1ITCA 3AM8C 5KSBF 1AP2A 1HSAA 5D6CB 2WK2A 5JR1L 3T2NH 3HRZA 5C0GB 4E41E 1LK2B 3U4AA 2Q87A 1MH5B 5GS1A 2X9YA 1IT9H 1MCPL 3P40A 4NKQB 5DK2A 4H25B 5EU4B 3MRFB 3IAQA 2NY7H 4D2NA 2VUYA 4YDJA 12E8L 1YNLL 4NC0B 1CDUA 1TQBC 2W9DL 3AB0B 4YLQT 2NR6D 3RVXC 3K0WA 4LHUA 2B0SL 3P4MB 3PG2A 3BP5A 5ANMA 2O26U 2P5WA 2L0DA 3TT3L 4JRXD 2P8PB 3KLAA 4X0KB 1YNTA 2EYSB 1S5HB 4RISL 2H41A 5BCAA 5JOFB 4CW1B 1BFOA 3RHWK 1GZPA 5D7IE 1MVUA 4LVEA 4BFBD 2R69L 4NOFA 4MXQD 5EZLA 3ZE1E 4CVZB 5KSVA 4S2SB 5FM5O 2R2HB 2APBA 4N0FB 2IJ0C 2HJLB 2IPKA 4JG0H 2I5YH 4KTEH 4FFZH 3QIUB 4P4RA 3HPJA 3REWB 4JJ5B 4L5FL 1JPST 1KJ2L 4X8JB 4N90D 4ODWA 1F4XL 4KTDL 5GJTH 3RPIB 1Q9KA 5KS9B 1YEIH 1QO3B 5K59E 3ARFA 2NTSP 2X5PA 4ZSOA 3WDJA 2IBZY 3WKMH 5FGRA 4DVBA 5E9DE 2DL9A 3ZDXF 1N4XH 1QSEB 4NP4L 1XEDA 3EJYC 4KAQL 4UI2A 1I85A 4NQVB 3FQXA 4M1DH 4PFEA 3M1BA 1IT9L 1MCPH 1JPGA 3V6BR 5T1KB 1K4DA 3LPFA 1ZLVH 4EEEA 3W0WE 1U42A 2XPGB 2H9GB 5I1JH 3BIAX 3RNKB 4PV8A 5IJKC 1B0RB 3VXUB 4HUXB 4MCYB 2XZAH 2H6PA 5JO5B 3MLTA 1ZVSA 3LHPL 4BFGA 3P9LA 3PXJA 1NFDE 4Q2ZA 2VH5L 3RIAF 5HDBE 3IVKB 4LVHC 4XGZA 3KWWA 1EO8H 1V7NL 2I9LB 4S1SL 1CFQA 4R8WH 3LN5B 4ODTH 3M8OH 3ZKMD 5BVJA 1W2KT 3IF1A 3C5SB 3CJJA 2CIKA 5TE6L 5MERB 3GHEH 5GRJH 3FMGL 4M7KH 3D0VB 1X5ZA 1ADQL 5GJSL 4CU7A 2GSIA 5IW6A 4LLDA 2J8UF 4Z7NE 4K55A 4GMSH 3DVGB 5IB5A 3MRBA 4JRYB 2GJ6B 5ENWB 3EW3B 2Q6WA 3L95B 4OLZL 4AG4H 3VXSA 3CVHA 3GIVB 3QAZC 4L4VB 2Q76B 3UBXG 1QPPA 5F93C 3V4PH 1XT5A 1VACB 4TTDC 4XH2B 5F89B 4E42B 2CKBL 4AT6B 1HIMH 1S7TB 3P0YL 3DXAB 4YK4C 3SOBL 4JO1H 5ALCL 1OLZA 5FYKU 3DMMD 2J3SA 4QHKI 4TRPH 5HI4D 5HYEA 2DM3A 5IVNA 3BHBB 1X5KA 1N7ML 3SKUD 3RWHB 4EI5C 4KKBD 3QEQD 3QULB 3QDMB 4FTVE 1FQ9C 2QV2A 3ULSA 2FB4L 4OIIH 3C60B 4AIOA 3QCVL 1NBYB 2VLJD 4LPTA 1DVFB 1TETL 1CZ8L 3SDCC 1NBVH 2AW2A 4PY7B 5KVFH 3A67L 3QO1A 1TJIL 4JFDB 1ED3B 1XGUA 2KKQA 4ELME 2QQQA 2ITDB 4AENA 3W0WD 3CX5J 3H7BB 3QUMA 5FDYA 4EKXA 4KHTH 3TH3T 3O2DA 5EOCJ 4YJZL 4ZUVB 3TM6A 3QDGA 3ZSSA 1F02I 2VN7A 3MODH 1JGUH 5D1ZB 2W9EL 5AEAA 5T33L 1ES0A 4FABL 3NZ8A 3QQ3A 4KJQD 5KW9H 1FDLH 3T4AA 4UT6H 5ITBH 1KTDB 5DJ0A 2Z91A 1U0QA 1YY8B 3HZMA 4U1JA 2UZYB 4OQTL 3I3DA 1FP5A 5HI5C 4NT6A 5GIRB 4NM8L 3MLVH 3P30L 2CGRL 3IDJA 3KPNB 3MRIB 5I2IB 5DD5H 2AJYL 3MZGB 5I66B 1PKQE 2R4SH 3V7MA 4FRWA 4PJFB 5D1ZD 2VKWA 2BJML 4TVPD 4IRJB 1YEEH 2XWJA 4PJ9B 5I1HL 3HG1D 1L9NA 1YQVH 1F4WH 3F58L 1OY3B 4HJGA 2OXHA 5D4QA 4Z8FL 2PYEE 4OLYL 1S9WB 4ZXBC 1DBAH 2E8YA 4PD4K 4PJGA 3JSSA 1OP5H 3S37L 1I8KA 1WEJL 2B20A 2YRZA 1F6AB 4MNQE 1JYVA 5D2LB 2IADB 3PDOB 3O8XD 4ALAH 3HE6D 4XPGL 3LKNA 4XNUH 2GITB 4MD4A 2F53E 2Z93B 2R4SL 4HS3B 2EECA 2EICA 1MFEL 4HGKC 3KPRB 1AE6H 1RK0B 1HXMA 1LDSA 4QHLB 4OZIA 1T5XB 4NQCA 1HCFX 4P9ML 1KCSH 3TPUB 3ULSB 4CN1A 5J12C 3UBXB 3OKDB 2L7JA 3E8UL 4ZQKB 5IB3B 1FYHB 1U3ZA 1F42A 3D48R 3VXUA 3FB8A 1KJMA 4HWZB 3QUXC 5BZWB 3SDCD 3UTSE 3DO7A 1G6RB 5J8OA 2C9AA 5I0ZA 1AO7E 1TJGL 3O8XB 5CFHA 1CGSH 3MODL 3N9GL 3BISA 4HDIB 3QFDB 4FG6C 3MRGA 1LQSR 4HZAA 2BNRE 3DVFA 1WFNA 2RCSL 2FJGB 5K9KB 3H8NA 3AC0A 4XP5L 4J12A 2UVEA 4EOWH 1B4JH 3PHQB 5GGRB 3U0TB 3WFBH 4U0RB 3MPCA 1WAAA 4J3VA 1PG7H 1S9VA 3QXDB 3ILQD 3BOVA 4YQXH 2VRAA 2I9LA 4PRBB 3NACH 3SJVB 3RA7H 3V6OA 3C5SA 4OZFA 4PRPE 3JVGC 5IMOB 2BNQD 2LV4A 1OTUD 3RBSA 4LLAA 5C0IA 3CVHB 4L4VA 2FEDD 4WO4A 1JZ7A 3GSXA 2K1MA 1FFOB 2OP4L 4M3KB 4FQJL 2DI7A 2HVKA 2X9WA 5IV2A 2Q8AL 5DO2C 3NMEA 1ZHBB 5JPNB 5I18H 1RK1B 3HRPA 4BFEA 4V1DD 2MHAB 3VH8B 4MJ6A 4ZUVA 4OCMC 3QDGB 3EDEA 3UZQA 3FQXB 4F57H 5L2KB 1D5MA 4KJWC 2ZG2A 5DHVA 1K4DB 5CSZA 4IIQA 4ONGH 2F9BT 1YEEL 3C2AH 2W38A 3IFPA 4K94C 4DGIH 1G7HA 3B83A 4LAQH 3MV8E 3TVMC 4XHJC 1L0XA 4FQIL 5EH1A 3L3KB 3MRDA 2CGRH 2HJLA 2IPKB 4JR9H 3GEWB 2BHZA 1JHKH 1VADB 3QXAA 3BDBA 4Q9RH 4ZNEA 4H0IA 2UZXB 4Y4HD 4OCYH 3N0PB 3P11L 4FTVA 4AL8L 4Y1AE 2R56L 5D1QB 3KLHC 4QLRA 5IFJB 1BFSA 1BX2B 3ISWA 2VDQL 3RWIB 4HUNB 4ORZC 1LO2H 2ARJA 3O3BA 5EU7E 3MRPA 2AV7B 5E99H 2NCMA 3TIEB 5IB5B 2OCFD 4MNHA 2J7LA 4L9LB 4CUCA 3OKKA 2P5WB 4L29A 4QKXB 2PO6A 5ACLA 4A6YH 1QKZL 4X0KA 3U30B 1NQBA 2HKFL 2FBJL 2PW1B 4LBEA 3WEXB 1U93A 1X5FA 4WIQA 3CH1B 3GGWA 2FYYA 1NMAH 1MJJB 4JPVH 3MLWL 4YAQB 2V2TA 1CS6A 3ECBA 1E27A 4PLNC 4TPRH 4L8BB 1LK2A 5EBLB 5E6ZA 3B9DA 4N8CH 1N3NB 1IC4L 3LN9A 3MOAH 2YPKA 1QBLL 2NPLX 4JVWA 4G8GA 1WFUA 1RIVL 4HK3J 2VKXA 3MV9A 1QSFE 2NY6B 2BOCB 4JFZL 4UMGA 3Q0HA 4FQXA 4P4KC 1PSKH 3V0WH 5H37H 1A7QL 1VGKB 1J8HB 1A2YB 1O7SA 2CLZA 5EZOH 3FB7A 3F7YA 5EZIH 3MRQA 3U0PA 5F70A 4PRPB 5DJXA 5I1KL 4WW2C 1BVLA 3KJ4C 4KV5E 5F6IB 2NQCA 5J89A 1E6JH 4ZQKA 2VSDA 1CG9B 2W65A 3A6BH 5IW1A 3TT1H 3RWDA 5GGTA 5MENE 4YUEH 4P2OC 2O5YL 2VIRB 2OR9H 2LVEA 4OZHB 1DANT 3HC4H 1MRCL 4PGZA 2QADB 4AIZB 1OCWL 4JO2H 3OPZH 2W92A 4U1GC 3RUGB 2E9BA 4Y0GA 1OAUL 4OLXH 1D5BB 3ES6A 4XWGL 3H9SD 5JA9A 1CFSA 3Q5TA 3FTGB 3V6FB 4IRSB 2APTA 1RU9H 3O6KH 3WO3B 4CADB 5MEQB 4ODUB 1DEDA 4P5MA 5C0RH 2XTJB 3VFSA 5F9AC 4OCSH 4MZ2A 1HNFA 4LOUD 3UJTL 1DQJA 4AY0A 4UNTA 4PLKD 4L3CB 4NHCH 5JHDD 5LGKA 3PWJA 2NYYD 5FM8A 1FJ1A 2VQTA 4ZDHB 5I73C 2ERJB 4GRWH 3MUZ1 1I7ZB 1ZE3C 4N0UB 1W0VB 2XN9D 5ANMB 3LEYL 3R06A 1AXSB 4RMRA 3WUZA 1MRCH 2VLRE 2CQVA 4PG2C 3DARA 4OLVH 4ZUSB 5I8KL 5ECJE 5A3IC 4ZUWB 5CS7A 5F7KC 1RVFH 1XIWC 2DQHH 1J10A 3MLUL 3OJ2C 5B8CB 1W72B 1NC2D 1M7XA 1CDJA 3GJFA 3MLTB 1W0YT 1A1NA 4GRLA 3CFCH 1YY8A 5ACZA 1QLRA 5CP7A 2P5WE 3SCMB 1T7VA 3CXHK 1OL0A 2W0LA 3AB0C 3MGAA 2PUQT 5T3ZE 1EEZA 1AHWC 5FF6A 4K8RL 3GBML 1SYVB 5T3XE 3TVMB 1R3IL 4JFZH 3WIFB 3CSYB 2R1YA 3JV6A 4FFYH 5DGRA 4PJ8D 3VXRA 1EJOH 5BZWA 3RFZC 4OD1H 2EIZA 5D7IF 1ONQA 5EU3B 5JXAL 1JTOA 3O4LB 1MCBA 3C08H 4Y16D 1FORL 1XH3A 5GGRY 4RX4A 2H26A 2F5BL 4G3YL 5ITFA 3ARDA 5DEFB 4YC2B 3ZMRA 4JB9H 3HMWH 4S0TD 1KFAH 4PLJD 4P2CG 4M1CC 2HFEA 1DJSA 1BBJB 1B4JL 1X5YA 4Y4KA 5JPMB 2G9HB 2P1YA 1JGLH 1GAFL 3LZFL 3G5XA 5EA0L 1NDGB 4W4OA 4PJ8B 4MNHB 3NN8A 3CC5A 3QA3B 1I1FA 3WXWL 1Q9WA 5F6HJ 1LO2L 3ECBB 1FFRA 1T1YA 1UZ6F 1G7MB 2AK1L 4XVUD 4ODUA 3VRLE 3P9WB 4F37K 3GK8L 2OK0L 4UIKL 4OLUL 2VXSL 4ZS6C 3O6FA 4UT7H 1DTUA 3UPCA 3RUGE 4GQ9L 1E4WL 1FBIL 2DMKA 4S11A 1C1EL 3UTTA 2FJHB 4CDHA 5I71B 1WICA 1C5BH 4YBLB 2M1KA 1FC2D 3IDJB 3KPNA 3MRIA 4ERSH 3KYOB 1P9MC 3KYNB 1ZHKB 4YE4H 1EFXA 4HH9A 1NKRA 5E1AA 3HC0B 1FC1A 2F53B 2OI9B 1R0AH 3G08A 5CJQL 1U8NB 5BRZE 1T0NB 2Y1VA 1J0ZA 4UBDD 2X10A 4OGYL 5IFHL 2GK0B 4JZJC 2VC2L 5GGTL 1UKSA 1K8DB 3C5ZB 3TNNB 2GSGB 5IEKA 4TQEH 3KS0J 5K9OA 2D9QB 2QBWA 3BEVB 5ICXA 3D39E 3LQAC 3N1PC 1UGNA 2AXGB 3AFLA 4MJIA 2X4NA 3BIKA 4XCYA 1NCBH 4ONOA 2HT2D 3EKCA 4IOFD 2AABH 3VXMA 5DJDB 4DKFH 1M6OB 3GMMA 4NQCB 5C0CA 1CFNA 2EDOA 5E9DD 3BD4A 4PY7A 3ALWA 3CPLB 2HJKA 4AJ0A 2BVYA 3VH8G 4HPOL 3KPSD 3LIZH 2WUBH 3HKFA 2X2YA 4HS3A 4DVBB 2IGFL 3LH2H 1TENA 2YWYA 2R0ZL 2RIKA 5EOCL 4XNXL 5E5UB 3TO4D 3GBMH 3UC0H 5TDOA 4A2MA 3M17A 4WEUD 5ESQA 3BKJH 1MHEA 1MFCL 4XBEL 4LGSB 3PL6C 2GYSA 4HIIB 3DHMA 2WWMD 3MV8A 3UJIL 4AM0B 1YECH 5E2JA 4PJAF 4AL8H 2PKDA 5K9KA 1BFTA 3MBEC 3TBYB 1V5JA 4PJAB 1MUJB 4J1UB 4XXDB 4EBQH 4GT7A 4F7CA 1BPVA 4YHYC 3QEHA 3KG5A 2BSTB 2AXHA 2R39A 3FQRB 5DMYA 5BVPH 1A6VL 4XC1L 4N0YL 4MDJA 5D2LF 3PF2A 5I66A 3Q3GB 1BAFL 5J9PB 2YD9A 2DQTL 2VZTA 3ZKQD 3QDMD 3OKNB 1QFUH 2E5EA 3EO9L 1KBGH 5GGSY 4HAFA 4YBLC 1KCUL 2EZ0C 4NRYA 4WW2F 4ODXB 2VXVH 4L8SC 4X98B 5DWUH 2AV1B 4DOHE 2D7TL 4Q6IB 4LCWB 4YHLH 4JO4L 4HIEA 1H5BB 1IILE 4YHOL 4I18C 1DBKL 1IGML 5FDWB 4KK5D 2LAGB 5F7UA 3J7HA 3KJ6H 5IMKA 3F12B 3P4OA 3GM0A 4XVTL 3HC4L 3CFIC 2VZOA 1OWWA 1DUYA 1FBIH 1XF2A 4OFPA 1AY1H 5GGQH 4JFHD 1AGFA 1AXTL 3WCYA 1FCCA 1GJIA 1DBBH 2BNRA 1HZHL 3TJEH 5KTEL 3KPOA 4O2EA 2IAMC 4ISVA 4NIKB 4LAQL 3I2CL 3MV11 5GZOD 5C86A 4DK3A 4EQ2A 3MJ9H 2X4RB 3WFBL 5KSUB 1X5AA 4M8VA 2PR4L 4EUPA 3B2VL 2XTJE 3V0WL 3LQZA 5EU3A 2YBRA 2EYRB 1RZGA 3EYQC 4XXCC 3FB7B 4NM8H 5GZND 3OSKA 2YA1A 1RSFA 4QRQB 4WENB 1I7ZA 3BVNA 4NQCE 5E70A 4NHUB 5FA3A 1NSNL 5HYJA 5D1XD 3MUHL 4LHUD 2OR7A 2MQCA 2Q8AH 3H3KA 3GSNH 5EZJB 3QHZL 5IBLC 4Z7OF 1IARB 4UILL 1S9YA 1FDLL 4QRRD 4MAUL 4H26A 3P4LA 4NFCA 1NGZA 1IZKA 1SMAA 2FR4B 2B8OT 1I7RB 1YMHB 3OF6A 4FABH 3STLA 1BBDH 4QGYA 3PUCA 5GSVB 2DQIH 4QRTA 3PHQA 3MRKB 4ZFOL 3I6KB 4Q9QL 4JFQA 2YD7A 1YEKH 2G2RB 1Z0MA 4E9LA 4MNQA 4WI7A 2WINB 3T0ED 2VL4A 3WXVH 4LP5A 4D9LL 1UJ3A 4HIXL 4QHLA 1T66D 2P5EE 4TSAL 1MCOH 1Q0YL 2BNUB 2PYEB 4Z7VB 1KB9J 5FAAA 1MRFL 1LD9A 4HPOH 1RUKL 3MACL 3RDTC 4DN3L 3WD5L 3RZWA 2V5YA 2EYTB 2ADFH 3WFDH 1WT5A 1FGNH 2VUOA 5T1LA 4C4KT 1E0OB 2PCPA 1YC7A 5IEKB 3PWVA 4JHWH 4LRNL 4Y4FA 1E4XI 1OSZB 4LGPB 4HG4K 5I1CH 3CZJA 4MNGB 3HNSL 1A4JA 2VABB 3TGXA 2EC8A 3MV8D 2OX5A 5DQ9B 4JM4L 2OLDA 1P6AB 2AJXL 1DN0B 1U95B 3L3HB 5MEOB 4EQ3A 3REWA 3QDGE 2ESVE 1CTOA 5D9SA 2X89D 2ICWI 3DXAA 1BEYL 5HHXL 4PJHF 3GRWA 4HSQA 5HYJD 3O6FB 4LSVL 5D1XA 4XAWH 4P3CL 3IS0X 5GRVL 1NAKL 4MLSA 3VFMB 2VL5B 3QWRA 1N26A 1TPXC 3GJFK 3B3IB 3TLRA 2H1PH 3IGAB 2WQRA 1J05B 1HKFA 4H1LH 1CT8A 4WW2A 4PV8B 2XFXA 2HFEB 4PJBB 3WEXA 4OTXH 5CEZD 2UZIH 4NRYB 2A9MH 4JDVB 5HGDB 4XPBL 4POYA 4AIZA 3C2SA 4XVJH 5EU6A 5DUML 1AKJD 1MIMH 4M6NH 3QDJE 2OJZH 4JQVC 3VFOA 3FKUS 2JKXA 2J4WL 4HLJA 2YPLA 3U9PL 2G2RA 5F44A 5DJ6B 4XPAL 4F3FA 4J3OC 5EBGA 2LFGA 4P5MB 5JQHC 1EAJA 1MCNA 4J7RA 4JKMA 4KVCL 4TNWK 5E2WL 4GMTH 2DQJL 2EXWC 3FT3A 1NEUA 1A2YA 3T0EE 1QSVA 3MRJB 5EU6E 4OUOA 1U8KB 2EEBA 4A6YL 2Z8VC 4MJ6B 2XN9B 3CU1A 4WU5A 3SKOA 3BPOB 1QSEA 5IHZB 1MIEH 2FX8L 3CSGA 5B3JF 4YWGL 5L9DL 1TPXB 3C60A 1FH5L 1Z0NA 1XF5A 4XPHH 3OAZK 5D2NE 3JTTA 2XI9A 5HGHA 2X4QA 2EYTA 2IQAB 5E8OA 3T4YA 3N1FC 3ARGA 4HAGA 15C8L 2CR3A 4KJPC 5GGSB 5D2NC 1YDPA 3HAEH 1RVFL 3NGBC 1GVIA 3IDNA 4U1KA 3GSUA 3ZYIA 5A1AA 1G7LA 1SBSH 4JN2A 4M4PA 1OD9A 4JREC 4TRPL 4HMCA 4NZRL 1AXTH 3W9DA 4UTBL 1DQTA 1N3NA 2VERN 1BOGA 2UWEA 4AK1A 4MDIA 2C7UB 4NSKA 3ZKMC 4P5TD 4X6CE 2XWTB 3HR5A 4QRTB 4WFFE 4EXKA 1BIHA 2VAAA 4KJPD 1EHLL 4I77L 1S7XA 2X1OA 2GSIB 3L7EB 5IW6B 2XWBA 2AEIT 3RI5K 1QZ1A 1FSKC 4U1MB 4Q6IA 3MREA 4MCZA 5CJOL 5E5RB 2CH8A 4MQXD 4U33A 2ZUQC 2WIMA 2PO6B 1MWAL 3KYNA 2BDNL 5I1IL 4TUKL 2H45A 2P48B 3FO2B 4M62L 4LSVH 5DRXB 2AEQH 4OF6A 4JREB 2BK8A 1YPZB 5DJ2A 1FNEB 3BQUC 4OFYA 4XPTL 1N64L 1GOHA 4P9HC 3RVUC 2OTWA 1TQCC 5FK9B 5HPMB 2WBKA 5ADOL 3QQ9D 5GGVY 5F9DC 1AQKH 5JXAH 2I9TA 4W4OC 3QIBC 1AGCA 5DD6A 4D9RD 3PP4H 4KY1L 4YXKL 1A6ZA 3H0TB 4M93B 3B6SB 4XVSL 3VFNB 4RWHA 5DRNB 4Y1AD 4KZEH 4HXBH 5C6TL 1GGYA 4LPVA 35C8H 2WUCL 2CO7B 3BPOC 2JIXA 5I1DB 1KCKA 3UX9B 4PJFF 1IBGH 1DLFH 3OR6A 2HMID 5C0IB 4E41A 1CD0A 2HVJA 5DEFA 3BJ91 4MB5A 4I2XA 5L2KD 5HD8C 1OAZH 2HP4A 4IJ3B 2VLKD 1QYGH 2YA0A 2CDEA 3MRHA 4JY6A 5CMAB 3DX9B 3U79A 4HUWB 1KENL 3VXSD 3MUJA 4HKJB 4WW1A 5I8OL 4IMLA 4HIXH 4R26H 3KPQA 2RFXA 5DFVD 4YGAB 2IBGA 3BEVA 5DK0A 5BQ7A 2DKMA 3NIDF 5ACMA 1JFQH 2A38A 2YK1L 1F13A 5IROA 8CGTA 2B1AH 4ZUTA 4UDUA 4FQPA 1MH5A 5C6WH 4GMSL 3O3AB 2IH1B 4Z0XB 1F8TH 2BNUA 3FQTB 1HI6A 4LU5H 3ARDD 1RJYA 2IAMD 3QPQD 4GOSA 4I77H 5HGBA 3D2UD 4U6VL 4C59B 2XIDA 1R0AL 1JYXA 1T1ZA 1V7MH 1WZ1L 4LPWA 3UZVB 2NXYD 4K7FA 4X4ZA 3ULVH 1NCDL 4KRLB 2EE9A 5H2BB 2HT3D 4JM2F 5C8JA 3NIGE 4Y19A 2Y06L 4X80H 1ZLUK 2BOBB 3LAFA 5CBAA 1RJLB 4FZEH 1UZ8B 3MRRB 2ZCHL 4ENED 5CZVL 3BPLC 3EDKA 2BSRB 2NY0C 3QWOA 3OBAA 4LHQB 2ZUXA 3V5KB 1Q94B 3TNMB 4OF7A 5B39B 4K71C 4PG9A 4PJXB 1T7XA 2GT9A 3DWTA 3NN8B 1XF5B 1P4IH 2R23A 1OTSD 1KEMH 3D1MC 4NKIL 1D5XA 1Y0LB 2A74B 1PSKL 4BELD 5EDXA 1C5DB 3OKLA 5KSUA 5FGSA 2J8UE 2DJUA 1PX3A 4HKXA 3X13B 1IC4H 1JGEA 5IM7A 3RVWC 1UG9A 2R0LH 4RGOL 4PRHB 3HMXA 1MRDL 5B4MD 4NYLB 2ZUQB 1FPTL 3G6JE 4WWKA 2XY1A 4RGND 5T1LD 5ID0B 1GHFH 4QXUL 3VGAC 3TZVC 5EPMB 1PVHA 1M4KA 5GS0H 3L6FA 4JM2C 4DJMA 1UKQA 3WLWD 4HT1H 2CLVA 5E4EC 4KC3B 3RNQB 3PV6B 1MUJA 4HV8A 5JW5A 4CL7A 4XMLL 1IGTA 2HLAB 5IQ7L 5TGBB 4NUGH 5TF0A 4E5XA 3C5ZD 2LE9A 3VFGH 4OZFG 3VGGA 5DEGB 4HMDA 2NTFA 3SE9L 2FEEI 5IIEA 2VXTL 4QOKD 3IJSA 4FXGB 1U3JA 2B5IC 4YDKH 2EDTA 3DIFB 2X4SB 5IB4A 1OLLA 1G1CA 4O9HL 5D6DC 4OJFL 1VCAA 1TNMA 4U1JB 3VWJD 1JVKA 2R2BB 3FL7A 5GIRA 5T1KD 2WP3O 4Z0BH 2EE3A 4PB0H 4YHNA 4CMMA 5ID1A 3Q6GL 5DI8B 4OLZH 3PNWA 4D0DB 3C5ZC 3QRFM 4HCRH 5I19H 3ZKND 3K8LA 3T0DA 5L8JB 4E41B 5D2LE 4MJ2A 3U4BH 1X5JA 2F54B 2GIYA 4DK6A 2V2XA 5HGHB 3IS1X 2GFBA 3D3VE 2R1WA 3TBWA 4BKLA 1L4IA 3SBWC 5SX5K 3JWOC 3C5ZA 1EO5A 4UTAH 1XF1A 1PZ5B 2AEQL 4UU9A 3F6IA 1KELL 1TCRB 3EO0B 3MRLB 5CEZL 4NWTL 4OCXH 3UP1A 3UTTE 3WMSA 1CDGA 2D0HA 3FRPG 4RGNC 3DYMA 2F15A 2JE8A 1CICB 4ZO8A 1NH6A 2P24A 1KIQB 2BSRA 3QDMA 4Y1AB 2IAND 4X7FC 3BKCL 4JO3L 2ZKHL 3SGEH 4PP1D 1QLRB 4F15C 2DLTA 1EHLH 1ONQB 2ADJB 1H5BC 4LLMB 4IIQC 4K3HA 3IFNL 1A1OB 3HPLA 2X42A 5DJ8B 2YN5A 3NIFF 3C09B 4Y4HB 4XPAH 1DCLA 3QH3B 1GGBH 1VFAB 4DW2H 3CFBB 1KNOB 4JZNA 4LASH 5E94A 1NEZA 3RQ3A 1QEWA 1HI6B 4FFVC 2ZPKL 1TCMA 4K3JL 5KG9A 1INEL 1CICD 1RZ7L 5IKCA 4O9HH 4IEFB 2EDYA 1HXYA 3EDFA 5SV3A 2AJVL 2HT4D 1KOAA 5JO5A 4OCYL 3W81A 3WFEL 1T7WA 4Y2DB 3QBTB 1CLOL 5ILTL 1J05A 5FFLA 3RZCD 3D39D 1M7DA 3EIFA 3D69A 5EO0A 2R0KH 3VFOB 3VD9A 3SDAA 1UC6A 3SGKA 5I16A 4CADA 2QQNH 4Q9CA 1QSFB 2IPUK 3UZEA 1UJ3B 4BSVB 2BERA 4WGVB 3QIWC 2FD6H 3AROA 2OMNA 5JW4M 2XA3A 1Z9OA 4HXBL 3D9AH 5C6TH 3P0VL 4XX1G 2OJEA 1T2QH 5IUSA 2F19L 5B38G 4XBGB 3CUPB 1U3YA 1X4YA 2FEDC 1UZ8A 3MRRA 4X7CC 3HE7C 4BZ1H 4H5SB 3RDTD 1U41A 1LE5B 3OKOA 1MELA 3B9KA 2A0LD 3NIGF 4JDTH 3AY4C 1AGBB 2AK4D 1EUTA 2X7LB 3U0WH 4YFDB 5E7FA 4O5LL 5T5FH 2DICA 5FA3B 3BDYH 4RIRB 5EO1A 2LU4A 4K7PL 5D93B 3P4NA 1I8LA 1XIWB 4QCIB 5LWYL 3FT3B 1BQSA 5KJRH 1LWRA 3WBDA 4Q9RL 1GZPB 3WN5A 4APQB 4ZUUA 1BMGA 1WC7A 4PGCA 3BO8A 3BESR 1T5XA 1GGIL 4JAMA 1H15B 4CVXA 4JPIB 1N0LA 5D5MF 3VFTA 1JPSH 2MCPL 4YXHH 4PGJA 4M6ML 5GJSH 4HW6A 3HZMB 5A40E 1XGQA 2JB5L 1IFHL 4I9WD 2G75B 1QFUL 3KJ4B 1IGJB 4BFIB 5I71C 1ERNA 5T1LB 1S8DB 4OZFH 5D7JD 1UM5H 3IJSB 1ZVYA 1ES0B 4WI2A 2VXUH 3T0WA 3SHSA 4APQD 3DRTB 1R5WA 5IKCB 2H9GA 5DVKA 5KOVC 5IMLB 3LRGA 2Y6SD 2WMPA 3RNQA 4FQXD 1I9IL 1X7QB 5KVDL 1JI1A 4LPUA 1CL7H 3CFBA 2VDLH 1U2HA 1HOCA 5I15L 4U1KB 1T6WA 5E08H 1JFQL 1U6AL 8FABB 1N5AB 3BGMB 1UZ6E 1VEMA 3QJFB 1WWBX 3CDGA 2J5LC 3RWJA 4DAGH 3MGTA 2AVGA 3VFUB 2VAJA 3IU4L 1PW3A 3DGCR 3MRFA 2P42B 3DOSA 5DD3H 4D9QE 2Y23A 5C9JB 2YXMA 4MHHI 3KXFE 3C6LD 3MJ9L 1V3KA 2J8UB 5E7BA 3MLUH 4P0DA 5HYSB 3DURB 2E7BA 3VXTB 1B90A 3ARVA 4PR5B 1U8KA 5K9JL 4H20H 3I75A 5SWQB 3EO0A 4JN1L 3N9GH 1FNGA 3CAFA 4D9LH 1QFWI 3VXSB 1I85C 1JF6A 3EOYG 1F4WL 4LCCB 1NGYA 2OM5A 5JPNA 1F3JB 4LSPH 4LPYA 1LK3L 4Z7WF 2MOVA 4C56E 1AHWB 3PWLA 5IVXA 4Y2OA 1DQLH 2CXGA 3K1KC 4M1GL 2LTQC 3ZKXB 3H9ZA 2ICWJ 4JN2B 1BFVL 3THMH 3O9WC 3RZCA 3QI9B 1DUYB 3KWWB 1JPTL 2VDMH 1QFWH 1EIBA 4P3CH 1KBGL 1P7QA 1EAPA 5ITBL 4ODSH 4PGEB 2Z31A 3QIBA 1YYLH 4K7PX 4Q0XL 1H0DB 2DLFL 4TUKH 5HGBB 3QEHB 3RVVC 5CJ8A 3FO9A 5C70A 1U8IB 1J12A 2H3NB 4U1NA 5HI3C 4OZFB 2QQKL 3GB7A 4XBPB 5KG9B 2O5ZH 3FT2A 3PHOB 3OB0H 5C08E 3REVA 4OGAC 4G7VL 2YXFA 3TCLB 5J3HD 3DMMB 4LDOB 4OM0H 3TBWB 4BKLB 4LLDB 4L4TA 1HK6A 3D3VB 4OKVB 1G7PA 1MFAL 1U8LA 1LO4L 4IOSD 1UWXH 4FFVD 4R0LB 3AU1B 4JCLA 3SY0A 6FABH 2AI0H 3KHOA 3OKMB 1G6RL 4FQIH 2FJFA 3E6HB 3QJFA 3WO4C 5B21A 3KR3H 3GSQA 4JDTL 1UACH 4MB3A 5INCB 4U1IB 5C0CB 4YR6B 2VZ3A 4RIRA 5EIVA 3H42H 3T1WA 3D2UB 3ZYZA 5GZOC 1ZHLB 4RAUA 3IU3A 4IS6A 1JUFB 2X4PB 3VFRA 2DIJA 3MV01 3V5HA 5C6PB 2I26N 2YS4A 4GAJL 1T2XA 3P0VH 4UB0L 2FX8H 3CIQA 2YPKB 4RDQG 3EFDH 1MJ7H 3CDFA 3G9VA 5T1KA 5J13C 2P8PA 4ODBD 2XWJB 1RJLA 1A7NH 4OGAD 4U1SA 3HNVL 4RISH 5I1LB 1J1OH 4PJ5E 1JHTB 3CVHL 5ICYB 2E7LA 1UENA 2NY3C 3T04D 1S9XA 4RFOL 4LARH 3I6KA 2IWGA 3BN3B 2HTKD 4AIXA 1SMOA 1IFHH 4LVOC 4GFTB 2FECL 1A7PL 5IF0B 2FR4A 4R4FL 1EDQA 5FCUH 5CINL 3T4AB 5HGAB 3LPGA 2HRPL 3LEVL 3ZDZF 5D7LE 4YBHA 2ZP0T 4R7DB 4Y16C 2P43B 4WHDA 1U91A 1PQZA 2X9XA 3LDBC 1JNLH 4P57B 4PJIA 1BZ9A 4WDIB 3FCTA 4K3DH 5DF0A 1NBZB 3EYOB 2FH6A 3FB5B 5DT1H 4ZXBA 2DMBA 1YPZE 3C87A 5CWSA 2XKNB 5FYKE 3NABL 5KSAA 4ONFL 1F4XH 3HZKB 4KTDH 3O6MH 4ODSL 2EKSB 2J2ZA 3BZDA 4XTRC 2PYEA 3S9DB 3OZ9H 3NPSC 3U83A 5I17B 1I1AB 2IPTL 4V1DA 3GRWL 3BW9A 1D6VH 2F5BH 4HIJB 2NX5D 3VRLF 1MCWM 4RFNB 5KANG 5B4MC 3MLZH 3DX7B 5C09D 4L8SA 5KZCD 1DQLL 1OOAA 1S7SA 5F7FA 4TYUA 2R1YB 3JV6B 4QNPF 2EDEA 4YXLH 4GAGH 1E4KC 3UBXA 1ZHLA 4RAUB 4X7SL 3NCCB 4XP4L 3E6HA 4AENB 5GRYA 5LBSL 1QRNB 5ESVA 4WI6A 2OBGA 4R97C 4N1EA 4G6KH 2YPVH 3D18B 4NKDA 1CLYH 4H20L 5HGGS 1ZEAH 3WS3B 5B22A 5GISL 1MQKH 4ETQA 5FV2A 4WUUD 1MAKA 3CU7A 1DSFH 4LIQE 3MMEA 4ZUWA 2IAMA 3TYGH 2YUWA 3R1GH 4GXVL 3QQNA 1P6FA 1OP5K 1KJ2H 1OGAD 2HLFD 3EYVA 3ZDYE 1TVBA 3EOBB 1H3XA 5D7JC 4UINL 4FFZL 2Y7QB 2D0GA 3EOTL 2D03L 5BRZD 4AQ1B 4ELMA 4OZGE 4UDUB 4U1SB 4AMKL 1G7MA 5L88L 1AC0A 4U1NB 3MA7B 3TBVB 1CTNA 2IH1A 5A2FA 4LLQB 2EZ0D 4HZLA 4PJHE 5C7XL 4KQ4H 4NSKB 4PJFA 2QHRL 4PBVC 1NDGA 1FZOA 3O4LD 3IRPX 4WWKD 2VL5A 3MROA 3LS4L 4HIHB 4ZS7L 3VWJC 4WO4C 1OGTA 3P11H 5HHQB 1IVLA 1JUFA 1I7TB 2ATKA 2PYED 5L8KB 1RZIB 5IR1A 3WNPA 4P3DA 4HUMB 2AJ3A 4NKIH 4Z18A 1HHHB 1G9NH 3G5ZA 5CEZH 5E8NA 1A7BA 2BOBA 1P84J 2XKNA 2NW3A 5IFHH 4N68A 5HYQA 4HEME 3F58H 3CFCL 3NZ8B 4Q7DA 4OIBA 5DA0B 4MD4B 4ORGB 4I5BA 2GITA 1T5WA 4KRMB 5F7WC 4MSWA 3ROOA 5CZVH 3LB6C 4AEHH 1UM6L 4PG9B 3GHBH 4U7KA 3MXVH 4LCIH 3DVNA 2R2HA 5I8KH 3GSRA 3TVMA 3G04B 5CKAA 3P30H 5T3XL 3VI4E 1INDL 3RWGA 3RU8H 1NDMB 1AY1L 5GGQL 3DUUA 2VXSH 4X5WA 4HLZH 5DR5L 1ZA6A 3MFGB 1DZBA 2EDJA 2IFFL 3UJTH 5F9WB 5BS0B 2P7TB 5KVEH 1DQDL 3LEXA 2FJHA 1GGCL 3QEGL 3VJ6A 2B4CH 4JJ5A 3LB6D 3WDHA 5DJCA 4Z77B 4PJ9C 1D5MB 3OAUH 2NZIA 3GSUB 3EFDL 1BVZA 2CIIB 3OR7A 1IZJA 3VFTB 4BQBA 2DD8H 4FQXB 4KTYA 3FT2B 1K3ZA 4YQXL 4V2CB 3S4SB 5IESH 4U2ZA 3H3BC 3ZKSD 3BMWA 2R0WH 4ZNCD 4AZ8A 3O2DH 2PO6C 1NFIA 4WUKL 4TNVF 4P23B 4Z7QE 4GBXB 3OR6B 1NBVL 4MCYA 1TZIB 4XP9L 3VE0A 5ISZD 3QA3A 4OLWL 5BQ7B 1FL3B 3DGGB 4OIIL 4I0PA 1MHEB 1OB1A 5FYLD 3UTSD 3FTGA 3V6FA 5ICXB 4JFHE 2OL3L 5FYKD 3MNVA 5A2LH 4CBPA 1E4XL 4ZG1A 1FE8H 1J11A 4FFYL 4JFDD 2VLLB 3DMMC 3SE8L 1PYWA 4NO0D 3TJHD 3GBLA 2AJZA 3VXMD 5JXEC 1NCWH 2VB5A 4LDLB 4XB8A 3TC9A 1KB5L 3OKOB 4YXLL 1U8JA 5C0EB 5DHVH 5I1DA 5D5MA 1BQLH 4J4PD 2IMMA 4XNXH 1IGMH 4P9MH 3ZKXC 3D87B 3D25B 3HPJB 2YZ1A 5DC0A 1VSCA 3K81A 2YPLD 4C56B 1DVFC 4IIQB 1C08A 5J0BA 1J8HA 3F62A 1IC7H 4F15B 1U8PA 4Q0XH 4Y19E 3TEUA 4H1LG 2JJTA 1HOCB 3PQYB 1JZ3A 1A4KB 4BH7A 3GSVB 1NCDH 3W5NA 1J87A 3BD3A 2Q76A 2D7PA 2FWOA 4YK4B 5E03A 4NRXB 1ZLWK 4FQJH 1EO7A 4LU5L 2HMIC 1QLEL 4Z8FH 2IEPA 4JFXB 4JGUA 2V9RA 3PWPE 5CMAA 5D1QD 5A43C 1SQ2N 4LHJB 1XGQB 4YPJA 5D96B 1I1YA 2CDGB 3EYVB 4U1MA 1HH6B 2V5TA 3EOTH 1A7PH 4KHXL 4NZDA 3OKKB 4L9LA 5JOPD 1LMKA 2AJSH 4KJYB 3B2UD 1R5WB 5HY9A 1OP3H 1LO5B 1RUPH 4GQ9H 1OGAB 4Y4KD 3LH2L 4YDLC 3KLSA 1JN6B 3X11B 4J1UA 2D7MA 4LSDA 4PJ5A 5GISH 4UAOB 5DD3L 4ZFGH 3LV3A 2CIIA 3QPXH 5H94A 4HUUB 1XFPA 5TQ0H 2Y72A 1NCBL 5FECA 4JDZA 1X5LA 4CN6A 4WHYG 3L3KA 2C26A 1YEFL 3MJGX 3VWKA 4ORGA 3KYMA 4ZFOA 4MA7H 5JUEL 4LOUC 3UJJH 3O3UN 5E0QA 4P3WA 4X6BB 3OXSB 1I7TA 3UDWC 1JGEB 5IM7B 3GI9L 1NCTA 4XHJD 3U0PB 4P3DB 4K23L 3CDCA 3NCJL 3O3EB 4KK6D 3R06B 2N4IA 3GKWL 5DSCA 1OP9A 2OS7A 3MJ9A 3P4OB 4WUUE 3I02B 2DQFA 4QF1A 4X9GA 4IS6B 4ONFH 4U05A 1IEAB 4X7EC 2XV6B 1IGYA 4CU8A 4HJJH 4PPTA 5EB9A 5DI8A 5C2BH 4OZHE 1OAQH 2VLKB 2FHCA 4WI9A 4M43H 1UXWA 5C0AA 4TVPE 2V2TB 3TH2T 5C08A 5HYJB 1YEHL 1NLBH 3C5JA 5SWZD 5CEXA 2YC1A 5HVGB 3ZE0F 3MSPA 1OAKL 3BWUC 4WNQA 2I07A 3P73B 1CGSL 1IM9B 1UM4L 3R4DA 2OTPA 1JWSA 4KK9C 1R5VA 4R97B 2XZQH 5D72L 4M7ZB 4JFQB 4NQEE 4NN6C 2HFFB 4JEGB 1MCDA 1EEYB 2AJSL 1WTLA 3PWNB 1KCVH 1UCBH 5DEGA 5JW5B 3BZEB 4P2QE 2I25N 2O61B 3D18A 3QDGD 3A6CH 3HI6H 3C2AL 3VFVB 1QEWB 3S35X 1RHHA 5J11B 2FECI 3QR2A 4HIIA 4OD3H 3OWEA 3V9FA 1LP9F 2QTEA 4AQOA 3O4OC 3BP4B 5CLWA 1ETZA 3QYCA 2GFBB 1S7VA 3HE6B 3ROOB 3FT4A 1KC5L 3E3QC 4MS8D 4EN3C 2VR4A 1EEQA 3KNBB 4LF3B 4WI8A 4FS0A 1A6PA 2FD6L 4CU6A 4A6YA 1GC1H 5BW7C 3PHSA 5BZDA 2EEAA 4YHNB 4GKZB 3KPRA 4U6XB 5CLTA 3MRMA 1UWGH 3JV5A 5E2WH 2ZG1A 2A77L 1ZVSB 2Z93A 2VQUA 1HHKB 2A9NL 2EIZB 4N0CD 1CU4H 2W0FA 5BW7A 4KMLB 2ORBH 1XZ0A 1HKLH 2BVOB 2NY5H 2ITCB 2X89A 3DXAD 3AVEA 4LLYA 4BQCA 3S6CA 4FZ8L 3X12B 4PUBH 2FX7L 4G6FD 4Y16B 3VI3E 3QAZB 3GSOA 2HTKC 5CP3A 3LEYH 1HH9A 5GGUB 4X6DE 2VZVA 1F4HA 3L3IB 4PJEB 35C8L 5DS8B 3MZTA 3NZHL 5TF1H 4LCWA 4P2YA 1I9IH 1PKOA 3AUVA 2DTMH 1DLHB 4UQ2A 4Y4HA 2OL3H 4JRYA 4QRPD 3MBEA 2P46B 1S9XB 4OKVA 3BD5A 1C5CH 1L7TL 1A7OH 4LLMA 5JTWA 3PDDA 1EBPA 4P5TB 3BSZH 4EJ1C 4PB9L 1CICC 1CFVH 4PRDA 2IG2H 4PJIF 2I60H 3JUYA 1NMAL 4JPVL 4WNQB 1XGRA 4OLXL 1TQCB 1Q9OB 4WEBL 1FIEA 4M7ZC 5CILL 4R7NA 4RZCB 3O2DL 4WUKH 3HS0A 4X4YB 1D6EA 5KAQG 3OKEA 1OW0C 1RJZA 5L7XH 3WSQL 3O3DA 1WISA 4U6YA 5BO1L 1DE4B 3V5HB 3QCVH 2V7HB 3Q1SH 5C71A 5DXWA 2B4CL 1QR1B 3BH8A 4BH8A 3M17B 3TFKC 1J1XL 4NJ9L 5LGHL 4JVPA 4HQQL 4HFUH 3PL6B 1KJ3L 3EOAB 1RURL 3EZ8A 4R4NC 3MBED 5EC1A 2GK0A 2CKBB 4I3SH 4EN3D 5ADPH 1I1AA 1WLHA 3UO1H 1XGYL 5GGSA 5IR1B 2H32B 4M61B 3C6LA 3S36H 5IT2L 3ZO0A 1YY9D 3QIUC 4JGMA 5F96H 3CXDH 4X9IA 4H0GA 2YN3A 1C7SA 4U0QB 5J9PA 1CU4L 1S7VB 3NCJH 4KXZH 3L5WA 5TDPA 1ZT1B 4X8JA 2ICEB 3F5WA 2EH7L 1O0VA 1OF2B 4L5FH 2EO9A 1AFVL 5F3HB 3RTQC 5KVMC 3UJJL 2VE6A 2FIKB 5D7SH 2VDOL 4O2CA 4PJXE 3BVNB 3QISA 2UY6A 3H9HA 3QI9C 2WV3A 1BJ8A 4M5ZH 1DQDH 2J6EL 2DB8A 2CJUL 4OZHF 5B39G 1ZV5A 3L3JB 3X12A 3GMRB 5L2JB 2AP2A 1OGAE 1IM9A 3TWCH 3GSNL 2OZ4L 1KACB 1TQBB 1CVSC 4FFWD 1LHZA 1GZQA 1GOFA 2OQJB 1P7QD 1T83A 4MQTB 2OYPA 5KOMC 4TVPL 2FLBT 2G5BB 1G9ML 2AAVA 1UCBL 3SDAB 4FP8H 2Z0BA 2NX5E 1RIUH 2WQ8A 2XXMB 4K71B 4KAQH 1ZLUH 5C09B 5JOFA 3V79C 2NY7L 4JFOB 2CRYA 2XNAB 1CZ8H 3X3FH 1Y6MR 3TJHC 1TVDA 1BZQK 4NBYB 3A0OA 1D5BA 3RVWD 1IGJA 3HUJF 2JTDA 5E8EB 5AG8A 4BSJA 5EBWB 2QQKH 5HYSA 1I4FB 3CCHB 5EOQL 3SJVE 2BNQE 3I75B 2ICWB 4EI6B 1KLGB 1ORQA 3EHBC 5EUOF 3D25A 5BZDB 2BSSB 3PQYE 2DLFH 3SGKC 2WAHA 3VGBA 1HQRA 3I3BA 1P1ZB 1OM3L 2KQMA 4PJ9A 3SDXE 3ARFB 4L3EA 1CBVH 1T0PB 1U8LB 1QD0A 5DJXB 2JB6B 3VXPB 2VABA 2DN7A 3FO1A 3GKWH 4HUUA 5FHAH 3TO4A 1E28B 3GSRB 2WWMC 5D2LA 3RWEA 1KF9B 5SWZE 3TCLA 4G42A 2B1AL 4XWGH 1A6ZB 4M7KL 1T20A 3QFJE 4PP1C 1PDKA 1KCVL 5IHLB 4Z0BL 1A1NB 3ARGD 4PRHE 1MY5A 2GTWA 3FONA 4R7NB 4RZCA 3WS6A 2VZ1A 4U6HA 2XTJD 1N6UA 4POZC 1ZA3B 3MJ8A 4QRPE 1EO8L 2E7MA 4LL9A 3FO0L 3QCTL 1VFBB 3LRSB 3CK0H 1JNNH 1E4XH 3GK8H 2OK0H 3OMZA 5CEYB 2ATPA 2VXTH 4D94A 1JP5A 2DL2A 3IJHA 5TDNA 4LVHB 4N0UA 1H8SA 5C2UB 4NN6B 1IC5H 2CIKB 1FFPB 5F7DA 3WNNA 1T3FA 1UB5A 3CFJB 1GIGH 4YEFA 1P7KA 1CFBA 4HF5L 1JNHA 3MOBH 4J6RH 4DZ8A 3QB7C 2K3TA 1FO0L 2CSPA 2EKJA 3W39A 2DYPD 4C54A 5C0FA 1HINL 4MD5B 4U3CA 2WIIB 4V2BA 2F74B 5C0BB 2NY5L 2WBWB 2WUBL 3U2SA 1MEXL 2MPAH 1Q72L 2FLRT 1A6UH 1S7TA 4FQCH 1A3RH 5C0CE 1RULL 2ICEA 1RZKC 1EGJA 4OCWL 4GG6B 2J8UA 4TUOA 4OF5A 5AAWA 5JUEH 1MCWW 1HDMA 1ZS8B 3V5DA 3EDDA 4LKCB 3CLEH 5D5MB 3LSOA 3C6LB 4JY4A 3H2WA 5CJOH 3WLBB 1ND0A 3QFJA 3UTTB 4O4YH 43CAB 5TH2B 2NXZD 3O2WL 4OAWA 3BQUD 5LAXA 3FOLB 3WFHB 2X4TB 1NAMB 2X1QA 4GBXD 2Q7NA 3RX7A 4G9FA 1WIPA 2FGZA 2R23B 4PLJC 4KMTL 4ZFZB 4YHIA 3VCLB 3SDXA 4FP8L 1Q9WB 4XCNA 3UO1L 2NY6C 4ELMF 1V3JA 5KJRL 5I17A 2YRLA 3FHQA 4MXWL 5HHME 4YDLB 1F00I 5F9JA 1CIUA 4YHMH 2HLAA 4MB4A 4U6VH 4NZUL 4CVWA 4W81A 1OARL 1ZWIB 2BC4A 1UB6B 3ZL4L 4GRLC 5CEYA 5TFSH 4BYHA 2BP3A 3MBXL 5TDNB 4D3CH 4XMLH 3ZE2F 4JPIA 5DWUL 4Q6IC 5EPMA 2FO4A 4LNRB 1DDHA 3Q5OA 3D39B 5KSBE 4J2XA 3B2UC 2RR3A 2BCKB 4M9OA 1KFAL 4PJBE 5FUZL 3WL9B 2OP4H 4MNGA 2W59A 4W6YB 5INDB 2WNGA 1TCRA 3MRLA 3ZKNC 1GGCH 5EC2A 1QFOA 5I75C 4JKLA 4X4XA 1P84K 1NCCH 3G6JB 2DJSA 4L8SB 5L6YL 1S7RB 3DBXA 4NCDA 5M94B 3GIZL 3D2UA 1BLNB 2P5WD 2GY5A 4GW4A 4QXGH 3O3DB 5JORA 5J4MA 3MJ7A 3QJHB 2UYLA 3QEQE 2F5AH 5GSRA 1IGFL 1N5AA 3BGMA 4U2YA 1RZIA 1QBLH 4WFEE 4LPCA 1FGVL 2NNAA 5SX4H 3GHBL 4DUVA 4Y19D 4G80A 3MUY1 4HIHA 4DN4H 1AH1A 3PWJB 1ZHBA 2NXZC 5DHYB 5IFAL 1A3RL 2J88H 2VR9A 2CLRB 2WANA 3O6FC 3RTQB 3TNNA 5E8DL 4U6HB 1Q94A 3UTQB 4AYFA 3I84A 2IBBA 5J1SC 3JV4B 3EJZC 3HRZB 5EFIA 5IVXF 1P9MA 2AJXH 5IF0A 1UQSB 2VMFA 4R90L 2ENSA 3QXTA 2MQ0A 4ZUTB 4P23C 3VA2C 4MDJB 4EVNB 4PJHB 4OGYH 3MMEB 1MHHB 3SDCA 5F7MC 2ITCA 4MAYC 1DR9A 1YN6B 1S9VB 1X9QA 1RZ8B 2DIAA 5EUKA 3ULUC 1T1ZB 1H9VA 3RVUD 1HDMB 2NLJA 4UTBH 1DBJH 2E7LC 3LN5A 4LCUB 4NQXA 4YX2L 4Z0XA 2XZCL 3O2VL 4PJCA 5CUSH 4G8EA 4EUPG 4AM0A 2OR9L 3UMTA 1NFDF 3JV0A 4GKSA 3WKML 1WFTA 3NA9L 2A6IB 1N2RB 4G8FB 5BXFB 3H9SB 3QO0B 3T0XA 3TT1L 4I9WE 4MQXC 2VDKL 5BS0E 4O2FB 4LEOA 3ZHDA 4HC1A 2PXYD 5ID0A 3V0VB 3PIQA 4JRYE 4FMFA 3E2HB 4I0PB 3KLDA 3UBXI 4ODVL 2Z4QB 5CBAB 3RX5A 1QSEE 1AGCB 1MCQA 4PJ8C 4WI4A 5DD6B 1HHHA 3SGDI 4ZAKB 1D6EB 3CUPA 2GJJA 4X6DA 3V8CA 3MV9E 3PABB 3RIFF 1NPUA 4UT6L 3H9YA 5HHQA 4JB9L 4GMTL 4P48A 3QUMH 2JIXB 1AQKL 1MFDH 5I1GH 1NC2B 4G6AD 1D6VL 3DIFA 2E6JA 2VSCA 5IJVA 3L3OA 5D71L 2IADA 3ET9F 1YQ2A 2CMRH 4XH2A 3WFZA 4GSDH 1YEGH 5FHBL 2AI0L 5I1AA 4TSBL 3QWOB 5D1QA 3GKZA 3Q6FA 1NDMA 1Z9MA 2V7NA 4KU1A 3HE6C 2W9DH 4C4KO 2P5ED 4RNRA 2NY3D 3S96B 5DLMH 5FYJH 2CLVB 4KUCD 4QWWD 1UH3A 4WTXA 5HD8D 2IQ9H 3VI3F 5GRXG 5J11C 1QACA 4YPGA 5TQ0L 4XCFH 2PN5A 5E4IA 2X4OA 1XGTB 2COQA 2O5ZL 3GMQA 1MJ8H 4CKVX 5E6YA 1CLYL 1MPAH 2UWEF 2D31A 4LVNC 2FEEL 1OAXH 1P7HL 2AK4B 2MQ3A 5I30L 2DMCA 1RJYB 4BQ9A 1KTDA 1RJCA 4OCRL 5B8CC 2YEZA 2F8XC 4RQQB 3TN0A 3S35H 5I6XB 1BQUA 3UXFA 1MLCA 4GW4B 4P2RB 1KJ3H 4JPWH 4Z7UB 1JMZA 4MMXC 1WCBA 2ATKB 1U92A 1YJDL 3DXAE 5EBWA 4OCNC 5DJYB 3BH9A 5TPWH 1QPXA 3DX6A 2DWDB 1ZMYA 2NW2B 4HWZA 3DBXB 5DVNA 3SCMC 1I9RH 5IK3A 1TFHA 1UA6L 1YEDA 1WF5A 4KPHL 4TOYL 3ILQC 2CK0L 1K4CB 1X44A 4LSUL 5HYQB 3FMGH 5FYLH 2BRRL 4MD0A 1JTTA 1LK3H 4Z7WE 2AJUL 1G9EA 4Y5YC 1NCAH 1RMFH 3BXNA 3SCMA 1A22B 3JBG7 3OKMA 4ODTL 2JB6A 3VXPA 2E7CA 4BK5A 1R24B 2ADIA 2RBLA 5AZEL 3JWDH 2R1XA 4OCXL 1DN2A 3NBNA 2FATH 2CXKA 2CRZA 3UTSB 2OXGA 1JNLL 2DTML 2LAAA 1FLRH 1B9ZA 2VDNL 1V05A 4JZOA 1YMME 3SDDB 2P5EA 4QRUB 2H3NA 6FABL 3RGVB 3V2AR 1IBGL 3QDJD 4QEGA 3VFSB 2F58H 1NGWB 2Z31B 2IGFH 3DO7B 2N7BA 1N6QL 1LNUB 3FN0H 4K3EL 5AZ2H 3CVHH 1IC5L 3B3IA 4I48B 1AGEB 5E8PA 4NQCD 3QWRD 3FFCD 2FGWL 1QHPA 1VENA 1NMBH 3IFLL 2BVQB 1LO3L 1RK0A 25C8H 5EWIL 2PXYA 1F6FB 1G84A 1KTLB 1EPFA 3HB3C 2KZ1B 2ZG3A 5DQJB 5HDQL 1PD6A 3QIWA 3S98A 5KS9E 4ZO7A 1BEYH 1CGXA 5I75B 2PTVA 1AR2A 5T3ZH 3PE9A 4DKEL 3H42L 3QXVA 2NY2C 1I9RL 4UT9H 4TSCL 3VXRD 1I8KB 2XN9A 1N7MH 2XTLA 1KCRH 1U91B 3SQOH 1BQLL 1F11A 1XF3B 3B4NA 1MHPH 1ZT7A 3FQNB 5JMOC 4YBQD 5D96C 2HT4C 3FFCA 3MLSH 3CH8A 1YNKH 4DZ8B 3PGFH 4NBXB 1RIHL 2LQRA 2MMXA 4YNYB 3K1DA 3EYOA 1KIPA 1MJJA 1FYTE 3TP4A 2DYPB 4K2UL 3LOWA 2XACC 3QNYB 3ZYOA 1IQDA 8FABA 4KXZI 1G0YR 2AGJL 5JR1H 3T2PA 5LGHH 2BNQB 4P4RB 5F7NC 1X7QA 3MYJA 3PWUA 1BQHG 1FG2B 3U48A 3SDXF 4J8RA 4Y5VA 3STZA 4HJJL 1G7JA 2Z9TA 3AGVA 5L7XL 1YYLL 3BGFC 4OB5H 5ESAA 2VAAB 1ADQA 4ZFZA 3MCKB 4DFIA 4D8PB 3KAAA 3AM8A 3DNKA 4WV1C 4Y5VC 1TJHL 1IE5A 4CMMB 2NY4D 3HC3L 2ILLA 3NAAL 3VXOB 4F8QA 4JFYB 1HEZB 1I1AD 2QKIA 1N5YL 3LS5L 4JY6B 3SO3B 4PR5A 5D8JH 1GZQB 2VIRA 4P2OA 5DK3A 1OAXL 1F2XK 3U7WH 3WS3A 3T3PE 4ZD3L 5GGVL 3FFDA 1CG9A 2W65B 4OD2A 1INDH 4X5LA 2BSTA 4TTDD 3GI8H 4OT1L 4Z7UF 5IW1B 2D03H 4BZ2H 4LFHG 4NKOB 4K8RH 3STBA 1R3LB 3M45A 1OSPH 2AQ2A 5DUBA 4ELKA 2P24B 1Y6KR 5HYSG 1KIQA 3QZWG 3KPMA 4M5YH 5H37G 1T2JA 1RHHB 3VFNA 5MP6H 1WFOA 5J1TC 4PBXA 4GRMA 4Z9KB 5EZLB 1MF2H 4CVZA 5KSVB 3NPSB 1I4FA 1BGXH 2ZOKB 5IHBA 1KYOJ 1RK1A 2O61A 3DX7A 1I9JH 1RUAL 3IYLW 4IRSC 1AGBA 4NQDE 4Y8DC 1FZKB 2GJ6A 4RGNB 2E9WA 3KGRA 1BJ1J 2K9UA 3EO1A 1EMTH 3D39A 3O8XC 3C6SB 1P1ZA 4N9GB 3ZSTA 4ZTPH 2J6EA 5IWLA 3EYFB 3BPNB 4GAYA 2VWEE 1Z3GL 2BXYA 2HG5B 2X40A 5JNYB 3GBNL 3CFJA 3MRQB 5HVWA 4EXPX 1S7WB 3LQAL 5LVEA 3PIQB 2XT1B 5IQ9B 4HWBL 4QHNB 5F3BB 4LSSH 5IWLC 4ZAKC 2VDPH 3D69B 4XHQA 2R4RH 4WW2B 3GMQB 4K8RC 4YDIH 1PKQB 4PV9B