4Q7DA

Wild type fc (wtfc)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
207
structure length
207
Chain Sequence
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Structural characterization of anti-inflammatory immunoglobulin g fc proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4q7dA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4q7dA01
3D69B 4ODSL 3WHXB 3QPXH 4AYFA 5GS0L 2X09A 5AG9A 5C0JA 2R4RH 4M7ZB 1DUYA 4NWUH 3VGBA 3GGWA 4LLWB 3TPUA 3PDGA 5EZLB 3DO7A 1FE8L 3GMLB 1JUFA 3B9KD 4AENB 1AXTH 3TC9A 1FORL 4PBWD 1BREA 5EUOE 5DSCB 4ISVB 5MENE 2CUIA 2G9HB 3VFMB 3LPFA 3IGAA 4NM8L 3C6SA 3HAEG 2MHAB 5F96L 3TA3B 2NZIA 3TO4D 1F90L 4IOFD 1T2QH 1ZT7A 4S1DC 1DR9A 3JBG7 2Y6SC 5GS1C 2V2XA 4RMQA 3BEWA 5EN2B 5INCA 2XACC 1VSCA 4OAWA 3I3DA 3RNKA 1P84J 2BSRA 5L0QB 3LS5H 5HVHB 4JM2C 3REVA 2I24N 3TNNB 4G80B 3ZT5A 4X6BA 3MRMA 1FFOA 5C09A 4NCC1 5TF0A 3DRTA 1HHIA 5ICZB 1KT2A 1ZMYA 4N5UA 5E2UL 1J0HA 4K94H 2EH7L 1AJ7L 3L7FB 5GS0C 3VWKB 1X5ZA 3TIEA 3D9AH 3PGDB 5IG7B 2YSSB 1N5AB 4MB5A 5AZ2H 4MCZA 4CL7A 4J4PA 5EORL 5LQBH 3BMVA 3IFLL 4EVNA 3AS1A 3CSBA 3H9YA 3QCVH 1QRKA 4PLJD 4MSWA 5I1HH 3O6ML 4RNRB 4PBVC 3ZO0A 4TNVF 5ICYB 4NQVB 2FR4A 4HZLA 3GHBH 3GO1L 5J1AB 2VJXA 3QZWB 5DWUH 4FRWA 4PJXB 4BUHA 4BELD 5LBSL 5I1DB 3OKOA 3BUYB 4KKCD 5F7LB 1O7SA 3CH1A 3P2TA 4GKSB 3IVKA 4GOSA 2NX5D 1C5CL 4HLZH 4ONHB 3RIFK 3RUGB 1R0AH 4HUVB 2XN9D 5FOJA 4KH2A 1FL6B 2ICWA 5I1AA 2GAZB 3QIUC 2FECI 5D4QA 4PB9H 4C4KO 2DLIA 2VLKA 1D6VH 2AEQL 3X11B 1HH6B 1M05B 4V2BA 3MRHA 3TVMA 1OLZA 1UM6L 3AC0A 4QTHA 1JL8A 4Y4KB 2GFBB 3MLUL 5EOCJ 1CFNB 4NNXB 5FV2A 2ESVA 3P30H 2EDOA 4KK5C 5DJ6B 1ED3A 1R5VA 4ETYA 1K8IA 4ZUTA 5JIKA 1UFUA 3DX9A 1S7QA 2VDLL 1F11A 1FG2A 1FV1A 1JP5A 5JPMA 4D0CA 3WFHB 1ZT4B 3ARVA 4OLUL 1AGDA 5DZNA 5EIQA 4JJHA 5E6IB 1T0NA 1K2DB 4FFVC 2R2BA 4HEME 4J4PC 2EE2A 1LO2H 4Z7QE 4XPHL 3JV4B 4N8PA 3BPOB 3HZMB 3BT2L 1F4HA 3RGHA 1A2YA 1OLLA 2BRRH 5GGSB 5GSRB 1BFVH 3ZMRA 4DKAA 4HWUA 4PJCF 1QSEB 4ZOAA 4JFFE 4TSCH 4ZD3L 3KPRE 4WFED 3UJIH 5JXAL 4LQ1A 4Y19A 4L3EB 3RVUD 2J2ZA 1H3TA 2AJYH 1G7LA 2Y5TB 3QULA 3QFJB 5FGCE 5I1CH 5BZWB 1I3GL 3L3GB 1EVTC 3OPZL 4JFDD 5TDPB 1KG0A 4HPOH 1NEZA 1CK0H 4O9HH 4MA3B 1CE6A 1EFQA 1N7ML 1YUHA 3TZVD 5CIPA 5HHNB 4KUCF 4UNVA 5EWIH 4HIJA 3QUMH 4HKXB 1JWUA 3H7BA 3FQUB 5GRUL 1N0XL 3NIGE 5K9JH 3TVMC 4P4KB 1YJDH 4PJFB 4ZPVB 2YD4A 4GBXA 4J6RL 4OD2B 4XPAH 1MFDH 3FAWA 1D5BB 2IH3A 3V0VA 1W72A 5T3XD 4G8GE 2A0LC 3GIZL 5H35B 1G0YR 1QSFA 3QXAB 2P8LB 3P4MB 4ONFL 3RWGB 1QLEH 5GGQH 3U9UB 2JTDA 5MHSD 4WHCA 3BZ4A 5BZDA 4G6FD 1NC2A 2EXWD 4JFZH 2CIKB 5I1GL 5GGTA 1RIUL 3KR3H 3WIHL 2YD8A 3BISA 4MJIB 4QGYA 1G7MA 3MODH 2QHRL 2XZQH 2YUWA 3T09A 3W39A 1F3DH 4O00A 3SY0A 5IMMB 4GFTB 1J8KA 4XP6H 4DGYL 1FIGH 3LKNA 3QQ9C 4RCAA 5EIIB 3WXWH 5GGTL 3QDJB 1KPVA 4PLOB 4TUJB 5AYQA 1BEYL 4P5KA 3WFEH 4R2GB 1LQSR 3QUZA 5F7NC 2CH8A 4MS8D 4HWEL 1UWXK 3P77A 3BH9A 4LHQB 4UQ3B 4XPBL 5D7IE 1IAIL 5DMYA 2DYPA 4X80H 1CICA 1IRAY 1SM3H 2XQBL 2HFFB 2JK5A 4KKLD 5DD1L 4F2MB 4Z7VA 3NABH 1MPAL 2IBGA 4GG6A 3MV9D 3GSNB 1QLRB 4X4ZA 5D5MB 5BOZG 2X4OB 2OSLB 3RZCA 4GBXC 2ERJC 2Y9RT 3UTSA 4MB3A 1X5XA 2C3HA 2IAMB 1G7QB 4QRRA 5K9KA 4O5LH 5IB1A 1TJHH 1YY9D 5HGBA 1P4BL 1LNUB 2FHFA 1H5BA 1JPFB 3WIIL 1KJ3H 3CZFB 3QEGL 2X4QB 3CFDA 3QO1B 5CZXD 1A3RH 1HWHB 4KI5C 3VGGA 4AIZA 2I07B 4PJXE 5T1DL 1JRHH 4KROB 4ZXBA 2XKSA 2NY6B 1RK0A 4LGRB 5FYJE 3ZLQC 3FQXB 1ZGLB 3RUGE 4FQQB 3RWJA 1NAMA 2BVYA 3WKML 4DZ8B 3DHJA 4OBRA 3QO0A 3MMEB 2NY4C 1PLGH 1UVQA 5C0AA 5KVGL 3MOAL 5SWQB 3SKNA 2GY5A 5SWSB 2XNAA 1RPQA 5E24E 2FX7H 3QUZC 5I1EL 1XT5A 2A6KB 5EZJA 4DVRL 3U4AA 2HTKD 1MCKA 3ARDC 1CICC 2Y06H 2IPTL 4P4RA 1FZJA 4YPJA 3V5DB 1I9IH 1MCQA 3BZFB 3IU3A 4JCLA 6FABL 3CU1A 1G6RB 1DJSA 4DAGL 5L6YH 3RZCC 1BOYA 1DANU 4RFNC 4M48H 1PG7W 3C87A 4HBCL 4J3TA 3QFDB 4QO1A 4JKKA 4OZHA 4YUEL 3VWJA 5LKNA 3RI5K 1HHHA 2CDEA 2VZVA 3O11A 3WN5C 4JG1L 1TPXC 2CDGB 2OL3B 5EUKB 3VXUB 5FCUL 3CK0L 2W0KA 1CDYA 2D3VA 2ZOKB 3WSQH 4LEOA 1T4KA 2ZWLT 3VFPA 3CVHH 3O3BA 5BVPH 1ZANL 3KGRA 3MRPB 4JRXB 2PYEB 4MNQB 1UEYA 1B2WH 2WWMD 2DQTL 4M8QA 1V3LA 4ZXBC 4MA8L 1NDGB 2QKIB 3QFJE 4CAGA 2BVPB 3MV8E 5DMKA 5ERWA 4ZO6A 2Q8BH 1FCCA 5CEZE 1BVKA 3IS1X 4OKDA 3H0TA 2VC2L 4WW1B 4OFDA 4AH2B 2BOBB 1DQLH 1EGJA 3HPLB 3LKRA 2C4XA 4W81A 3ZHDA 3R0MA 5DVLA 2JB5L 2GUOA 1A7PH 5HHOB 4M03A 3U7YL 1CT8A 1MNUH 2ICWI 1BD2A 4M6OH 4Y2DA 2Z4QB 3HMXH 1HOCA 1LWRA 1G7JB 3QJFB 4M6MH 1G7HA 2FATH 3RIAK 3BGFC 3BP4A 4GAGL 1TJGL 1AGBB 1JNJA 1JGDA 4G9DA 5GS1B 25C8H 4UDTB 3PABA 4GRWF 4X4XA 4XP1L 2EC8A 2G5BB 3EDDA 3P4LA 4GQPH 1KLFA 5CCKL 4JM2B 1EHLH 4QGTA 1F6LL 5HI3C 1NCTA 1ZE3C 4NQCE 3VWJC 4NDMA 1EEQA 1HDMA 4R7NB 3BHBA 3RVXC 2ENYA 4XCNB 2J8UF 5KBNC 1BIHA 4KRMB 4YFDB 4RAVA 3T04D 2FRGP 4M93C 4X5WA 4FQJH 5IB2B 3IAQA 2QADD 4R4FH 4HJGA 5GIRA 4H8WL 5C0FB 1CXIA 5J3HC 5I2IB 2Q3ZA 5T1KA 3REWA 1UM5H 2DQGL 3T4YA 3VXPB 4HXAH 4OUOA 5DI8B 3TH3T 4GLRH 3ARZA 4JVPA 2BVUA 3FN3A 1VACA 4QHUA 1CGYA 2EYTB 3CUPA 2DL2A 1YEEH 1OTTC 1PEZA 5C0JB 4LPTA 1F3DJ 1FC1A 4J3XA 3AUVA 4WTXA 3EFFA 5TF1H 3GGWB 1IZKA 5H94A 5DUMH 3TPUB 1FGNL 3GJEA 3RKPA 3DO7B 4YX2L 1QA9A 1JUFB 4XAWL 2IFGA 5J57B 2VERN 3KDMA 3NAAL 2VXQH 3MUY1 4X0KA 5AUMA 4Y2DC 5I18H 3IGAB 2X4RB 3C6SB 3TH4T 2PXYA 4J23A 4X4MA 2BFVH 1ZT7B 3F6IA 2F54A 3TWCH 1GGBL 1U36A 4JM4H 4FFWD 4W4NA 1R5WA 3BEWB 5INCB 5I71C 1MI5A 4Q58C 2QL1A 5ADOL 4OAWB 1RZ8A 1YZZA 1S3KL 3RNKB 2J12B 4Y4HD 3S34H 1WWBX 3REVB 4KVCH 4X6BB 1WICA 1U3HA 3VI4F 3MRMB 2FO1A 5C09B 3DRTB 1HHIB 1IQWH 2DIJA 1NMBH 1KLGA 4XCFL 3TN0D 5JHDD 2ZKHL 5SWZA 3TIEB 4TOYH 2BHZA 5CJBA 5ALBL 1INDL 1A6VL 4MCZB 5SWSE 1IEAB 4XNMA 4WUUE 2Q7YA 4QXUH 2O5YH 2AQ2A 4EVNB 1IKFL 3BVNA 2UWEA 5DK2A 3MLYL 4DGIL 5J06A 1EEZA 4NYLA 2PF6A 5HYEA 4MSWB 1Q0XH 5CSZA 4JO2L 1GAFL 5ELIA 4OF5A 2FR4B 4HZLB 2RAMA 4RWHA 4XX1E 1QFUL 4X5XA 3H8NA 3OKOB 3KLHD 3CH1B 4POZD 3IVKB 1NCDL 4P2QA 1RIHL 3NCCB 1ZHBA 1XF2A 2IG2L 2PXYC 4S1RH 2BDNL 3OJ2C 4KZEH 2FD6L 3U0WH 1F2XK 2EH8H 2ICWB 4NQDA 5I1AB 4ZYKB 1JHLL 1MCOL 2HAZA 2VLKB 3VXUE 1MH5B 1MELA 4PTUA 4GG8B 3WNKA 3MRHB 1QRNA 5IKCA 3V7MA 3TVMB 4QTHB 3MRNA 1BECA 3LKPB 4HHAA 4R97C 1U3HC 3UDWC 5M94B 1KCUL 5DR5H 1ED3B 4WI8A 3X13B 3GFUA 1A3QA 1K8IB 3IDMA 4KK8D 4ZUTB 4KGLA 1EXUA 3DX9B 1S7QB 1H0DA 1F11B 1FG2B 2XTJC 4HIHA 1FV1B 1CFVH 4NHCL 4D0CB 1ZLUH 1AGDB 4QCIA 2EICA 4PJEA 5DZLA 1T0NB 1UM6H 4F57L 2MMXA 2IFFL 2R2BB 1RQ5A 3O2DH 3O6KL 4AL8H 1LDSA 3KWWA 5CGTA 1A2YB 3B5GA 4YE4L 4GRWH 4NN5C 4S1SL 5GHWH 5FO8A 3KLAA 2EIZA 5CP3H 4WFFE 5TPWL 3QCUL 4ODTH 4FA8A 4HIIA 1IC5L 4OTXL 4LU5H 1DSFL 4Y19B 3O6FA 1NUFA 4XPHH 1G7LB 3H42L 4NKDA 5F8QC 3PQYA 3QULB 3GK8H 1KG0B 1NEZB 4KHTL 4G3YH 3O8XA 1F58L 1CE6B 1H9VA 4OFVA 1YUHB 2ADFL 3G6JF 1TMCB 1ROWA 2MCPL 4HIJB 2EDEA 3DUUA 3QISA 1JWUB 1YEGL 1P4LA 3RDTA 3N50A 1AXIB 1NSNL 3EDEA 1V3KA 4O58L 5ID1A 4GBXB 4P2RD 5LXGH 2ERJB 2IH3B 3UTQA 3V0VB 1W72B 3T0XA 3VGHA 4DTGL 3LQMA 1QSFB 2ZUSA 3SGDI 2Z35A 4XNYL 2OS7A 2CLVA 4X6CE 3BQUC 3Q6GH 4D2NA 2GSGA 1UZ6E 1MAML 1NGZA 4FG6D 5BZDB 1VESA 4LSRH 5B38A 1CS6A 1NC2B 5GRUH 2FDBP 1RZ7L 5ENWA 4J6RH 1WCQA 4OF6A 4BZ2L 4K94C 5KAQG 2VWEC 5C7XL 4H1LG 3L9RA 1G7MB 1D9KA 4MXVE 1T7XA 3LVEA 3W39B 3D39A 3SY0B 1HQRA 1FPTH 4LVHC 4P5TA 3UJTL 1WCBA 2C9AA 2NY4B 5D7JD 3F5WA 4UNTA 1NBVH 1KPVB 1T22A 3V0WH 4KQ3H 4P5KB 4MJ6A 4PGZA 1H3XA 3QUZB 3IFNL 4HWBH 4L4VD 3QIBA 3P77B 3BH9B 1OGAD 4WNQA 3K1KC 4WU5A 3D2UD 3O8XC 2DYPB 3ARDB 1CICB 3E0GA 4PD4J 4Z7VB 1NANH 4RRPA 4DGYH 3INUH 4FQIH 3W11D 2GEEA 3RDTC 4GG6B 3PWVA 3OSKA 4APQA 1P69B 4HS8H 5IQ9A 3RZCB 4P2CG 1I7RA 5E8EA 4PJHE 3SHSA 3BP5A 5D7LA 4RFNB 3UTSB 4R6UA 1MJ8H 4O02H 4R7DB 1KELL 3QUMA 1IAIH 1VFMA 4KDTA 3I3EA 2XQBH 3UMTA 3OKMA 5K9KB 2Z93A 3HE6D 3IDUA 5IB1B 2X7LA 4KZDL 4P57A 5HGBB 1X5GA 1EEUA 1H5BB 5EBMA 4HJ0D 3QQ4A 3CFDB 2V9RA 5I1IH 5I16A 3P9MA 4AIZB 4ELMA 1D5XA 1ZLVH 4M62H 1LP9F 4M7LL 3KYKL 4ZXBB 1RK0B 5C0ND 2EKSA 1UCBH 4UT6L 5J11C 3MUGA 1JYXA 3RWJB 2O5ZH 2VH5L 5C07D 1NAMB 3MJGX 4Y4FA 3NFSH 4P5TC 5F1KC 3QO0B 4U33A 4FZEH 1UVQB 5C0AB 1QFWL 1DBJH 4OIIH 4LNRA 2XNAB 2WW8A 4MDIA 3WFBH 3WL9A 1J87A 5ISZE 1W8NA 4Z6AT 1CBVH 3LEVH 3FZUD 2Y36L 2ESVE 1KN4L 2NY1B 1IBGH 3BGFB 1WFNA 4JLRB 2WBJA 4P4RB 1FZJB 1X4YA 1ZLSH 4YHIA 3IU3B 4GAJH 1JF6A 1NMAH 3LRSA 4H88L 4APQC 1OSPH 2E9IA 4GJTB 2DM4A 1KENH 5EBLA 3V4VH 2QQKL 2PW1A 5IMKA 4OZHB 3VWJB 4QXTA 5A2IH 1HHHB 2CDEB 2IPTH 5BCAA 1MCWW 5DC9B 3V5KA 1EO8H 3A6BH 1YJDC 2ADJA 3OF6A 4JR9L 5E8PA 3AVEA 3RTQD 1TDQA 4LEOB 1T4KB 4G9FA 3VFPB 3O3BB 5EO0A 2P8PA 2NXYD 4Y19E 4HT1H 4DZBA 5MEND 2MFNA 4M8QB 5I0DA 4NGHL 2IH1A 3D0LA 5DMKB 5ERWB 3WNPA 5DA4A 2ED7A 1BVKB 2D03L 3F7PC 2XRAH 1CLOH 2QQLH 3I84A 2R8SH 4Y4FC 3QQ3A 4HGWA 1I1AD 3TGXA 3F7YA 4KMQA 2W60A 5CJXA 2X44D 3W82A 2DQJH 3LKRB 1CXEA 5K59E 3WJJC 2E27L 2GUOB 5T3XH 4YHML 1CT8B 1PQZA 4MA8H 1BD2B 4OLVL 4Y2DB 2HH0L 1HOCB 2I27N 4ZODA 1G7HB 3BP4B 3X3FL 1M6OB 3D3VA 3JTTA 3CNKA 1JGDB 4G9DB 2Z31D 4IS6A 1JPGB 4K23H 3PABB 4X4XB 3W0WA 3VI3F 5I71B 5EZIH 5CBEA 4NBXB 1J0ZA 5FYKE 4U1GC 2XOTA 5IB5A 5H8DA 4CMHC 1GJIA 1IGTA 4NDMB 3AAZA 1HDMB 5F7MC 1K3ZA 4GAGH 5F70A 5HHXL 1GGCH 1MQKH 4RAVB 4NZRH 5AZEH 5BRZA 4PJCA 3J7HA 5GIRB 4HJGB 3MJ7A 3O45A 4FQCL 4YBQC 4EOWH 5DMJB 2EZ0C 5T1KB 3SGKA 4WTZA 5C08A 1Y18A 2V5SA 3T4YB 3MRIA 1CVSC 3WE6A 4BZYA 1VACB 4PUBL 4QHUB 3CD4A 3CUPB 1R3HA 2VR5A 4EN3A 4U6XA 3H3PH 4POUB 1MCFA 3ZKMC 1UM4L 1Z9OA 4Z7VE 5F6IC 5H94B 5DFVC 2V6HA 3GJEB 4OFYD 1BQSA 1A9EA 2C3VA 1QA9B 4YDIL 3KDMB 5HYJA 1WFUA 1K4DA 1SMAA 4X0KB 3DLQR 3KJ6H 5AUMB 4K3JH 1QTYT 4ZFOL 1K6QL 3QIWD 2PXYB 4R96A 4KPHL 4QRRE 2F54B 1X7QA 5ILTL 1R5WB 4ENEC 3HMXA 1MI5B 1T1ZA 4LSPL 3ZE1E 1RZ8B 3NAAH 3OZ9H 3ZDZF 4R97B 2XV6B 5JOEA 4GAYA 1AO7A 4NZUH 1U3HB 5B4MC 3RU8L 4MLSA 5D1ZD 4LQFL 3GI9H 4BFEA 5IJKA 3O9WD 2XTJB 3SKOA 3WKNA 1S7VA 5EBWA 4JFFD 1KLGB 1JNHA 2BC4A 3KPRD 4Y8AA 1G9EA 2ZUXA 1MLCA 4WUKL 5SWZB 4K07A 1FVCB 4XNMB 3QEUA 3SGKC 2B20A 2Q7YB 4Z8FH 4DK6A 5I1KL 4G8FA 3BVNB 3VDCA 1Z0MA 2UWEB 3ARBD 4NN5B 5DK2B 3U4BH 5HDQL 2ZUQC 4NKIL 3MC0A 3KPTA 1JZ5A 4EN3C 1MVFA 1EEZB 4Q2ZA 1AGEA 4LP4A 5CSZB 5E2TL 2ZKHH 3UPAA 1S9VA 2R0ZH 3VA6A 1INDH 2AQ3A 3PL6A 3VU2A 1A6VH 1JI1A 4G8GD 4X5XB 1LO0L 1RZIA 4TSAH 3GI8L 3OG4B 4P2QB 1BM3L 1ZHBB 1XF2B 2WUBH 4RGOL 4LPYA 4HUXA 4UNUA 4NQDB 2W59A 2Q7NA 3QSKB 4XXDA 4I3SL 1X6NA 4ZS6D 1ACZA 4EI5D 2F58H 4JKWA 1YEJL 5IKCB 1QRNB 1QFUH 3MRNB 5CUSH 1SY6L 1OVZA 4HHAB 3MYZA 4BH7B 4NQEE 3IDMB 4MA1C 5HHPA 1EXUB 3TA3D 5IJKC 1BOGA 1JHLH 4EBQH 1H0DB 1L7IH 4LBEB 1MCOH 1HEZB 3IJYA 1DEDA 3OKNA 4Z78B 5GZNC 2AAVA 3LMJL 4QCIB 2RFXA 2R56L 3BSZH 2EXYD 4LIQL 4W6WB 3VRLF 4JFYA 5TFSL 3K7UA 4JRWA 4C4KT 1IAKA 4RFOL 2DQHH 4PRNA 4LSQL 1QYGH 2R0LL 3KWWB 1KCUH 1BD2E 2W65B 3HR5A 4M43H 5FO8B 1OCWH 3KLAB 4WJ5A 3STZA 2EIZB 4DUVA 4HIIB 3VGEA 1XGYH 4PJ8A 4LVHB 5CGYD 3P3YA 2GW5A 3I75A 2F74A 1NBYA 4F57H 1X5FA 2EC9U 2IFFH 4XX1G 3PL6C 3O6KH 2VR4A 3O6FB 4PJ7F 4CJ0A 4G7YL 4NKDB 1LDPL 3PQYB 5C0CE 2P5EA 1CG9A 4UMGA 4N8CL 4YE4H 5K33A 3PHOA 1OD9A 4HXBL 3O8XB 2DQCL 5FUOH 5KN5A 4UZGA 2L7JA 1QUNA 2AABH 5I75C 3LKOA 1FYTA 3NA9H 4Q9RL 4U49A 3KPQA 4G43A 5E9DA 3CSPA 3DUUB 1G1YA 1T5WA 1NL0L 1P4LB 4L29B 3RDTB 3VXTA 4DKEL 4YZFF 2VSDA 4YXKH 3C2SA 5DMGC 1MCBA 3B2UD 4EEEA 5JR1H 5CD5D 5ID1B 1INQA 1PG7L 3ILQD 3UTQB 3V4UL 4TRPH 1OM3L 3OXRA 4Y16D 5FYJD 1D6EA 1AI1L 1DE4A 1U8MA 1F4AA 2Z35B 2AV1A 5CINL 3O2WL 1YEFL 3WFCL 2CLVB 1IFHL 2ADFH 5KSVA 2GSGB 1NGZB 4YNYA 4OCSL 5B38B 4X6DF 3AROA 4U1HA 1EMTH 5ENWB 3VRIB 4FQXC 1MF2H 2FEDD 2G60H 3G5XA 4DTGH 2ZZUT 3R4DA 3L9RB 4BZ1L 3AXLA 1FP5A 1D9KB 4JG0L 5D6DA 3BI9X 5I8KL 2DQIH 5J11B 2GT9A 1U8JA 3D39B 2H2PC 3T3ME 3Q1SL 4WI6A 1HQRB 2F53E 1FDLL 2R1WA 4X4ME 3O2DA 4PJ8C 2F54E 4P5TB 4HEPG 4QHNA 5BS0E 1CTNA 2KL6A 1CZ8L 3BN9D 1T7YA 3DGGB 1T22B 3LRGA 4BZ2H 5MERA 4MWFA 4UB0H 4MJ6B 5CP3A 3TJEL 1NGPL 2FIKA 4U3HA 5LWYH 1J05A 1HHJA 3QIBB 4WNQB 4AQOA 3LV3A 4WU5B 4KK6C 3LIZH 3UPRA 2I5YL 2J8UA 2IC2A 4LLQA 3ZTNH 1XGRA 5SWZE 5DURD 3PWVB 4APQB 2P42B 5IQ9B 3GM8A 1HIMH 2UUDK 4Y7MA 5IVZA 3BP5B 3HMWH 5D7LB 3MV8D 5CEZD 3QUMB 5IW1A 4LCWA 3B5TA 1JWMA 3OKMB 2Z93B 3B43A 3E8UL 1UB6A 2X7LB 2A9MH 2EECA 4P57B 4TVPH 1BBJB 5EBMB 3H3KA 3QQ4B 2BX5A 3PUCA 1H3GA 4DW2H 3LKSA 1D5MA 3IDIA 3P9MB 5F44A 4ELMB 2K7QA 5EU7C 1D5XB 3EJZC 4MXWL 2ZCKH 1T2XA 1KELH 5C6TH 1HCVA 2OMNA 4OZGF 3MUGB 1KPRA 3HCVA 4XTRD 3B9KA 4RGNC 5DJAA 4Y4FB 4UT7H 2Q87A 2ZUTA 4F7CA 5JZ7C 2JB6A 3F12A 4LNRB 1QRNE 2ZPKL 4MDIB 1PJ9A 4KK9C 3O0RH 4Z7OF 2X89D 4H26A 3RVVD 3WL9B 2VIRA 2I9LA 4NQCD 5E56A 2MKWA 4U6VL 3HC4H 4FQPA 5DC4B 5E1HB 4BUGA 2WBJB 3BO8A 2FJFA 4KQ4L 4ELKA 5A3IC 4YHIB 1E4JA 5TE6H 4OI7A 4PJEE 4HWBA 1TNNA 5GRZA 3VMPA 2DIAA 4RMUA 1EX0A 2PYFA 4U1GB 5EBLB 1UGNA 4G8EA 1MFNA 5MI0C 1KN4H 5IMKB 4CMHB 4QXTB 3JUYA 2PETA 2KBGA 4XVJL 4PY8J 3V5KB 2ADJB 3WJLA 3DSNA 1OOAA 4G9FB 4XRCA 4M7JL 4U2YA 1J0YA 3AS2A 3RBGA 5EO0B 2P8PB 3RGVD 1S7TA 2HLAA 4NRXA 1A02N 3NCYS 5F7KC 4DZBB 3KYNA 1DQDH 2IH1B 3D0LB 3PP3H 1DEEA 4OGYH 5T1MB 3FFDA 2OJZH 5EUOF 1A14L 1U91A 3B9KC 1TTGA 3ULVL 1I1FA 4GLRI 2NY5C 1QBLL 3QQ3B 3FRUA 3F7YB 3C09C 4LF3A 2W60B 3DYMA 4PRIE 2EYRA 2NX5A 3WIFA 2XN9A 4HFUH 2VLRB 3TO4C 1PQZB 3NPZB 1GZQA 2NY6D 4R8WL 1GHFL 4JPWL 1LK2A 4AIXA 4OM1H 4QHMA 2J4WH 1D5IL 3ZKXC 1NGWA 3C8DA 5KVFL 3D3VB 2I25N 3JTTB 3GZKA 4IS6B 3MBED 5K9QI 3W0WB 2GCYA 4E5XA 2PCPA 1CU4H 5EU3A 4AT6A 5CBEB 4WUUD 3HNTH 1P53A 2IEPA 5I9QC 1PX4A 3D0VA 4RA3A 2HH0H 2DLHA 3CVIL 2P8MA 5GPRA 5IB5B 1FVEA 1IGTB 4J8RB 3DETD 3AAZB 5FUZL 4YHPA 2A38A 2OLDA 1ITBB 3WJLC 3MXVH 4DQOL 3DVNA 4ERSH 5BRZB 4PJCB 2BERA 3MJ7B 3O45B 1ZLUK 1NFDF 5C08B 1OT1A 3LS4L 1Y18B 4PLJC 4JY4A 3MRIB 1MFCL 3WE6B 4FNLH 4WFGD 2GYSA 5BO1L 5DFWH 4JHWL 2ZUQB 5I8OH 2A2QT 1R3HB 1UXWA 3MYJA 4UV4H 4EN3B 2ZJSH 1T83A 4U6XB 3VXUD 3AS0A 4JPIA 1Q9WB 1A7NH 5ITBH 4WI3A 1QLFA 3G6JA 4PB0L 4JFDA 3AS3A 1A9EB 2C3VB 4YQXL 1DQTA 5HYJB 1NGQL 3G6AA 1K4DB 3BAEL 5D7LE 5CEYA 2VDOL 1T0MA 1RMFL 4R96B 3RA7H 1GIGH 2YPVH 5I19L 5D1XD 5HHVL 1WLHA 1X7QB 3NIFE 5DRZA 3MLRL 1T1ZB 1A6ZB 1ZA6A 3GSXA 2Q20A 3X3GL 3E6HB 4GAYB 1AO7B 5FA3B 3I85A 2BK8A 2VAAA 1K6QH 4MVBD 4XNUL 3TT1L 4KPHH 4RGMC 2WUCL 4MA1B 4WFFD 1CI5A 5F93C 4GS7C 3CLEH 5KAQF 3SKOB 3FQTA 2HFEA 1S7VB 5EBWB 3N85L 4XC3H 1JNHB 2BC4B 3P11H 1YNLH 1MLCB 4M1GH 1SJVA 1HCFX 4JN2B 2JE8A 1QSZA 2AJUL 1JNLL 3QEUB 1VEPA 4OIBA 1E6JL 1RFDH 3QG7H 1KJVA 4G8FB 4JKPL 1PKOA 4OD3H 35C8L 3RY5A 3Q5YA 3OJDA 2FSEB 5KSAD 3LHPH 4KJQD 1W2KT 4LLMA 3SKJL 1T83C 2WP3T 4Q2ZB 2E9JA 1AGEB 3RVUC 1PSKL 2EDNA 2H1PH 3RVWD 3FB8A 4X7SH 4EI6A 5L2JA 1S9VB 4OLYL 3IU4L 4GXVL 3IT8D 3PL6B 5BW7A 5DGRA 5FCSH 1OAYL 4MDJA 4OLXL 1RZIB 3TZVC 4A6YH 2XXCB 3NIGF 2FJGA 3N06B 2AJXH 4G6AD 5ADPL 4DFIA 5KOMC 4WI7A 4CDHA 3MV9A 1RV6X 4XXDB 5I75B 1OP5H 4XNXH 1A22B 1NLDH 2ICEA 1A3LH 3RQ3A 3MNZA 4KC3B 5IVOA 1U3ZA 3EYFB 1KB5H 5FUCC 3TYFB 1IAIM 3CLFL 2K1MA 2B39A 4HGMA 1LP9A 2O26U 4MZ3A 1CCZA 1J12A 2EXWC 5HHPB 1IGYA 2P4AB 1BOGB 4DFHA 1P1ZA 4NWTH 3IJYB 4XB7A 5GRYA 5IB3A 3OKNB 1PKQE 2D7TH 3RWIA 4LGPB 3BE1H 2GKIA 5INDA 5ECJE 1N8ZA 2RFXB 4EUPG 3HAEA 4JFYB 5JHLH 1I3VA 1XF5A 1NUNB 1SY6H 1IAKB 3ORJA 4PRNB 4QLRA 3S36H 3S37H 4HULB 2B2XH 4XP4H 3HR5B 4MA7L 5C1MB 1QKZL 5L8KB 1YMHA 4WJ5B 3STZB 3D3VE 1FLTX 4PJ8B 4DK3A 2P47B 3LMJH 2R56H 3I75B 4AG4L 4YXLL 1WWWX 4MS8C 2F74B 1NBYB 3W0WE 3PV7A 5DMIL 3FN0L 2J8OA 2DRUA 1A9BA 5BW7C 4LSQH 3Q5TA 4FFYL 1IARB 4KKLC 4GQ9H 1ZWIA 3MUJA 2P5EB 1AHWA 1CG9B 4BSVA 4LSVH 4NNYA 4OCNC 3PHOB 1I8KA 4Q6IC 5KN5B 4L3AA 3X12A 3LKOB 1FYTB 3PV6A 1MIMH 3KPNA 3AM8A 4G43B 4WHDA 5E9DB 1U2CA 1T5WB 4PJCE 4QTIH 3VXTB 2YMXL 1NANI 2PTUA 1KULA 1INQB 2HWZH 2CK2A 1OB1A 4HIEB 5C08E 1YY9C 1JYNA 1T20B 1D6EB 2HKFL 1DE4B 1U8MB 3L3DA 2D0HA 2AV1B 4HXBH 1CN4A 1HN1A 5CZXC 5IBUB 2AKRA 4FQ2H 2F5AL 4MNGE 3F65A 4LVOC 1EBPA 5KSVB 2ZSWB 1DFBL 4YNYB 4BKLA 2VDRL 1B90A 4BM7A 4U1HB 2R0KH 4Q9QL 1ZHKA 4MJ2A 4RDQG 1GXEA 1SJHB 4YWGH 1JGUL 2H26A 5ISZD 3G5XB 3C08L 5AAMA 3U82B 2ESVD 2CJUH 1ERNA 1WAAF 5B21A 2GT9B 1U8JB 1YEFH 3O2WH 1NLBH 2YBRA 2R1WB 4M8VA 4RGNB 4TULH 5F7WC 3UYOD 4XH2A 4XGZA 1NC4D 5JW4Q 3P4NA 1X5JA 1P6FA 4QHNB 3DX8A 3MRCA 2HTKC 4GRWB 5FM5M 4XHQA 4MWFB 4MAYD 2FIKB 4PBXA 1J05B 1AHWC 1HHJB 3HFMH 3KPLA 2KKQA 4XMPH 5JQHC 3LV3B 1DBKL 1BJ8A 5IFHL 3CFEA 2FX8H 2J8UB 3AM8C 4LLQB 3RX8A 3QXWA 1HK6A 1XGRB 4Y19D 5FF6A 4PV9B 1L0XA 3TJEH 3HB3D 4L3CA 4U6YA 5IVZB 2LTQC 3TCLA 4CU6A 1S9XA 4MZ2A 5IW1B 4ZUSA 1JWMB 4CNIB 2E6QA 2I5YH 1UB6B 5FO9A 3L5HA 1OF2A 15C8L 2WWMC 1XGUA 1JPST 1UJ3A 3LKSB 1D5MB 2WSKA 3IDIB 3VXSA 1ZAGA 2C26A 3NZHL 1FZOA 2QBWA 3FMGL 3EYUH 3GKWL 4N0FB 1KPRB 3HCVB 1JNNH 1S78D 3K2UL 3B9KB 5T3ZL 3QQNA 5DJAB 4FABH 2XWJA 3L7EA 4F7CB 1MFBH 3C09B 3V2AR 2JB6B 3IETA 4OLZL 3F12B 3VFUA 4GMTL 4DN3L 5BOPA 2IQ9H 5FYKD 5AWNL 2VAJA 2YD9A 1A6UL 4H26B 4MXWH 3TO4B 2VIRB 2I9LB 4F9PA 1B9ZA 1HKFA 1I9JH 1WSST 3ZKXB 1DQMH 3BO8B 4N0UB 2FJFB 4ELKB 2R69L 4Y4HA 1CDBA 1TJIL 3QXVA 2O93L 1NPUA 3IB4A 2A6IA 2ZPKH 4L8DA 5EFIB 1ACYL 4S11A 4B41A 5I9QB 4F8TA 4PV8A 4G8EB 5HI4D 3TN0A 4IDLA 2R9HC 2QADC 5EA0H 1I8LA 2J6EH 3CSYA 5CFHA 1QHOA 4Y8DC 2VKXA 5DJ0A 4XRCB 4NJAH 3NTCH 4MQ7A 2D7MA 2NY7L 3GNMH 1S7TB 2HLAB 4NRXB 4U6HA 1CGUA 3HNVL 3KYNB 4X7CC 3EOBA 5J12C 3DV6A 2P5EE 5DVMA 1DEEB 1AE6L 4JZJA 1VKXA 3FFDB 1KXQE 3B8YA 4QRRD 1U91B 3RJDA 5HJ3A 3ES6A 1I1FB 2R23A 2D7OA 2VDML 1HKLH 3FRUB 4ODHL 3P0VH 4LF3B 5A43C 1IGFH 1A5FH 1OWWA 2EYRB 2NX5B 3C9NA 1HINL 2BHUA 3WIFB 1T66D 4OGAD 4HJJH 5CMAA 2XN9B 1KEGL 1RHHA 5J6GA 1TVHA 3FB7A 1BFOA 1GZQB 5DD0L 2ARJA 1AQKH 1LK2B 4QHMB 4FFWC 3IDGA 32C2A 1KNOA 3UZEA 1MHPH 1NGWB 3NPSC 1C7TA 2RGSA 4Y4HC 1B4JL 4Y89A 1MCNA 1RZFH 5DTFA 5IBTH 2LAAA 2I60H 3TF7C 2GCYB 2MNUA 4E5XB 2PCPB 5EU3B 4AT6B 3O81A 1G9NL 1HNFA 1YQ2A 3D0VB 1T6VN 3PWNA 2NY1D 2P8MB 3TN0C 1FVEB 4RGMB 3DX7A 4YHPB 1I8LC 4GS7B 4U1MA 2VXVL 4FTVE 3PWJA 5F7DA 5KANI 1F3JA 2EIEA 4JDTH 3T0EE 3DVNB 1X5YA 5BMFH 4G6KL 3WDJA 4M7KH 4BK4A 3OJVC 5J7CC 4AZ8A 4XCCH 4PJ7A 4JY4B 3TBYA 2EDXA 5FUZH 4JVWA 5B39G 4JZJC 1VFOA 2IPUK 1UXWB 3MYJB 1AIFA 1C5BL 3WS6A 4V2CB 5EO1A 1T5XA 3KLHC 1QLFB 3G6JB 3MREA 4JFDB 3L1OL 4XVUD 4NJ9L 4K9EL 3HI5L 1UB5A 3QDME 2APWA 3G6AB 2Y7QA 2BNUA 5CEYB 4NQED 3PXJA 2BSSA 2PR4L 4LAQL 4X99A 4LCWE 4GKNB 4WEBH 4HG4K 3MLVH 3SOBH 2QSCL 4P2RA 1O0VA 3WLBA 1KSRA 4O4YL 4PB0H 5DRZB 2QHLA 4HUWA 3U0TA 5J9PA 1ZA6B 4KK8C 3GSXB 1U8HA 4X6DA 5BQ7B 1VADA 7FABH 1CFTA 1IL1A 1BD2D 3BAEH 5DJ2B 4U3CA 1KN2L 5E5RB 4G6FB 2VAAB 2D4FA 3VXQA 3E2HC 3ILPA 4JDZA 1FLRH 3SE3A 2KDGA 3FQTB 2HFEB 5I19H 2APXA 2P1YA 4PY8I 5HHVH 4C59B 1A8JH 1VENA 4IDJL 1UWEL 1IM3A 4KJPD 4X9HA 1F02I 1HZHH 2DWEA 3CPLA 3MZGB 1KCKA 4RSVA 5I1JH 5C0CD 4FFZL 1A7BA 5HVFB 3QA3A 1TQBC 1AR1D 3OJDB 2WUCH 4NNPH 3NZ8A 1DL7L 4LLMB 3VI4E 3WS6C 2FB4H 3OKLA 3UBXG 1G6VK 5GRJH 3FB8B 4EI6B 4OZFG 5L2JB 3GSUA 2YD7A 5DYOA 3HC0A 1RIVH 4J1UA 2AJUH 3D2UA 2AS5M 4MDJB 5JDJA 4ODVH 4OQTL 2FJGB 1KCRH 4N0RA 4JRYE 4XVTL 4LCCA 3MV9B 1S7SA 2V5RA 1KCVH 3STLA 4PGDB 4NRYA 3MFGB 2ICEB 3SKMA 3MNZB 3IKKA 4HMCA 3SE4A 1RUAH 2AK1H 1I3UA 4XMLH 1T7VA 3RL2A 4PYGA 4LSUL 4OLXH 3C60A 3HE6A 5EU6D 1MSPA 5EBGA 4FG6C 4OKVB 3HC3H 4F3FA 1LP9B 3E3QE 2F53D 2A9NL 1J18A 1IGYB 3SE3C 2AGJL 4FP8H 1P1ZB 2B4CL 3GHEH 1XIWD 4LVOB 1I9EA 4OZGA 5IB3B 5BS0D 3RWIB 1LMKA 5INDB 1N8ZB 4MQTB 2NX5E 3HAEB 4K7FA 1OAUL 1XF5B 2XN9E 3GJFK 4LKXA 3H9SA 3DSFL 4Y0GA 4K8RL 1IC4L 1YMHB 2DQEH 5D7JC 5HGHA 1N6UA 2NLJA 4TSBL 1E28B 3F7VA 2CKNA 3FOMA 3QEQE 4W70A 1JTOA 1YEHL 1MHEA 2HFTA 1A9BB 1TZIA 2VUYA 3MV7A 3SDAD 1OSZA 1ZWIB 1AHWB 4BSVB 4LCCC 3W11C 4PJHF 4WY7L 1I8KB 1KGCE 1KJ2L 3WFDH 3X12B 4R0LA 4GUPA 3PV6B 3KPNB 4A6YA 1VHPA 3SE4C 2X70A 5JORA 2CLRA 3SDDC 1KXVC 5KS9E 2ADIA 1U6AH 4IMLA 1EJOH 1OB1B 3HE6C 4OCYH 2LTQB 5IP4A 3RTQA 3GMRA 3EKCA 5HHMB 3L3DB 1QPXA 1WGOA 4WFEE 4UV7H 4HJ0C 2AKRB 1KB5A 1RU9L 2JKXA 5EUOA 5F7HA 4BKLB 4ZUVA 5C0NC 1ZV5A 1NGYA 3DXAE 1QEWA 1TQCC 2H26B 4P48A 4NZTL 2XZAH 5IWLA 3DVGA 3QI9D 1S9KC 4C83B 2DQUH 5DRWA 1S7UA 1I1AA 1NCBL 3QXTA 1CVRA 1EHNA 1F4XH 2Y25A 4HF5L 3S88L 4UTAH 2XWTB 2FH8A 2YBRB 2AI0H 4XH2B 4XGZB 3P4NB 3G9VA 5T3XE 3BKML 2DI7A 3FZUC 1WZ1L 3DX8B 3ULUL 5A2LH 3MRCB 2FL5A 1S5IH 4Z7UF 4F80A 2FZ3A 4XPGH 1JGUH 3RI5F 1K3IA 4HPYH 4K2UL 2NY3C 3O6LL 2C5DC 3KPLB 3MO1A 3MNWA 3CFEB 4CADA 1JYWA 4R0LC 2VXSH 2APBA 2Q8AL 2ICES 2OR7A 3IJHA 4JQIL 1KPUB 5KSUA 3FB6A 1N4XL 4M6NL 3X17A 4LGSB 1MREH 2B8OT 4HUMB 5FF6B 2JF1A 5FB8A 3O6FD 4JFHE 2HJLA 5T5FH 3I6GB 4P23A 4L3CB 4U6YB 1DLFH 1D5ZA 3RTQC 1AGCA 1NFDA 1S9XB 1E4WL 2OR9H 3MJ9H 1DBKH 3L95A 5IFHH 4ZUSB 1NAKL 2QADB 3T0VA 3HR6A 2NXYC 2DJSA 4HCRL 5GGSY 1JMXA 1FFPB 4PRID 5TJWK 1R3KA 1XGUB 4XMKL 2WQRA 1UJ3B 2XXMB 3I2CL 1D7FA 3RWDB 5IWLC 4Y5XC 2OXGA 3WLWD 1FZOB 1F6AB 1I1AC 4KMTH 4N1HB 2RCSL 2R2CA 5F89A 1MHCA 3MLXL 1V7MH 4WU7A 2QR0A 4P0DA 1BFTA 3BKCL 1F4YH 1MRFL 2XWJB 3L7EB 4PGBA 4KKAD 3IETB 3VFUB 3FT4A 1ZVSA 3ZT6A 1MUJA 3ARUA 3QIWA 4I2XA 5DQ9B 3GSRA 1D9KD 3V8CA 2Z31C 3FMGH 4UT9H 1RUPL 1X6LA 1HWGB 3NFNA 1UWXH 2IALB 4Y4HB 5F9JA 1FH5H 4H1LA 4GMTH 5TH2A 5L7XH 2A6IB 3JSSA 1BP3B 3RWHA 4L8DB 1RI8A 5E00A 5D1ZA 1A6UH 5D6CA 3NCJH 3O9WA 1AD0A 3HNSH 2OZ4H 4JFFA 4PV8B 3U6RA 3KPRA 3QIBD 1WC7A 3TN0B 5JHDB 3EDKA 1YEKH 3RRQA 2LFGA 4R4BA 4AMKL 2YR3A 2X41A 4OSUL 2R69H 1OAQH 3CSYB 2XICA 4S1QL 1LE5A 3MLSH 4ZUWA 2CMRL 5DJ0B 5C3TA 4UINL 4OV5A 3IF1A 3ARBA 4MQ7B 2DBJA 4M61A 1GOFA 4U6HB 3EOBB 4U1JA 4YK4C 3DV6B 4JZJB 1DBBL 3HUJF 1VKXB 3UC0H 3MRGA 4QWWD 5HJ3B 2DDQH 5TDOA 3ES6B 5LGHH 1RJYA 2XZZA 2R23B 1BMGA 1MY5A 3C9NB 4C55A 1FBIL 3EYOA 1NCCH 3QIWC 5CMAB 1F3RB 2Z91A 3S5LB 5DD6A 5M95B 1RHHB 5J6GB 2UVFA 1OTSD 1TVHB 3FB7B 1BFOB 3LQZA 2ARJB 4X6FA 3ZE1F 1ULVA 4JO3L 5GS3A 2CKBL 1SYVA 2IANE 4EI5A 4CKVX 2YXMA 5HHME 3IDGB 32C2B 5K9OA 2XY2A 1KNOB 4F7MA 5HDOA 1K9TA 2EEDA 3V4PH 3TBTA 5DTFB 1KCSH 1PDKA 2VZSA 1BFSA 4NQXA 1OP5K 5D1ZC 3O9WC 5DD0H 5IW6B 1Y6NR 3D25A 2YA2A 4NZJA 2VZTA 1GC1L 5IEKB 5HYSG 5JXEA 3MRKA 3DX7B 1A21A 1IKNC 1IQDA 2WBJD 1MJUH 3KG5A 1CLYL 1YDPA 3IXTA 2GY7B 3GDBA 5F7DB 3L6FA 1F3JB 3BD4A 4HQQH 3BIBX 4PS4L 1V7NH 5D7IA 5D2NE 4RQQA 3ARBC 1ADQL 3CMOL 4Q6YA 4LDLB 1G9NH 4YDVA 2ZG2A 4YHKL 1J7VR 1I9RH 1ZTXL 4OCWL 2VLJD 3VI3E 1I4FA 4PJ7B 3TBYB 1TQBB 1Y0LA 2JCCE 4L9LA 1G9ML 1A7OH 3MACH 5AG8A 1AIFB 3R8BB 3C6LD 1RUML 3Q2CA 1WK0A 3MLZH 1T5XB 4OCXH 5AEAA 4G6KH 5LVEA 3JV0A 1RUQH 4OB5L 1UB5B 3CU7A 4IBLT 4I18A 2Y7QB 4ZS6C 2BNUB 1HILB 4M7ZC 1GC1C 4QXGL 4EI5C 4FQ1H 3VFGL 2BSSB 2HJFA 4X99B 1E27A 3RVTD 2HMID 1YQVH 2Y23A 1NH6A 5C0RL 4ZOCA 1IAMA 2XZCL 3GMNA 4P2RB 4L5FL 5C0EA 4Y16A 5F21B 1GPOL 4WVRA 1N6QH 2RIKA 1DDHA 3U0TB 1TNMA 3VW3H 5J9PB 4KHXL 4MD4A 1U8HB 4X6DB 1VADB 2FJHA 2KH2B 4ZTPH 3TA3C 3VXSE 4XB8A 5DQDH 2M26A 3UO1H 1CFTB 1IL1B 3UPCA 1A7RL 4NUGL 3L5XL 1DBAH 4LHUG 2PR4H 4LAQH 4RDQF 1RK1A 3VXQB 2EXYC 4J2XA 3ILPB 1AD9A 1G9MC 2VOTA 3R0NA 2QSCH 1WAAA 4JDZB 3D3VD 3WDHA 2HJKA 3QHZL 4F7EA 2P24A 4O4YH 1IM3B 1Q1JH 3W0WD 2DWEB 3CPLB 2DD8H 2AEPL 3AB0C 3JWDC 3V6FA 5IFJA 3ZL4L 1FAKT 1EUTA 3ULUF 3QA3B 1F8TL 5CGYC 2F5BL 2ZNXA 4L9LC 2J88L 3KYOB 3ZDYF 5D7JB 1YECH 3NZ8B 8CGTA 3OKLB 3P73A 1Q0YL 4IDJH 2FWOA 1UWGH 3GSUB 4DVBA 1TENA 1YY8A 3VXMA 5DYOB 1DVFA 1ZEAL 4L4VB 3HC0B 4J1UB 1E6OL 1OGAB 1CDHA 2APFA 5FYJU 3KXFE 2R39A 3D2UB 2ZCLL 5C08D 4R90L 5EDXA 2YA0A 3GSOA 1OGTA 4YHLL 1L4IA 1NMCC 2YRPA 4QY8B 3MXWL 3CDCA 4JKLA 2FO4A 5F9OH 1R3IL 4LCCB 5DEGA 1TXKA 4D0DB 1VEOA 1DL7H 3VFSA 5D1QA 1F5WA 3B2UC 1FO0H 3STLB 5CD5C 4NRYB 2VABA 3ILQC 4LRNL 1PZUB 2CUHA 2ED8A 4Y16C 3VXRE 3SKMB 5L2KE 2PO6A 2YD6A 3W9EA 3QYCA 3BRFA 5FM4A 4JPVH 3ZSTA 3RL2B 3QUXD 1RZKH 4UU9A 1IGJA 3HE6B 5SX5K 4OQTH 2MSPA 1FRGL 4F3FB 4TVPE 4FZ8L 5FDYA 1RD6A 2A73B 3I9GH 4LPUA 4YGAB 4Y4KC 3B6SA 4PGEA 2EDQA 1G7PB 2FEDC 4OZGB 5A16A 3T3MF 1PBYA 1U8IA 5HDBE 3QNZA 3M8OL 1WBXA 1JFQL 3SKUD 3BX7C 4K7FB 1TQCB 2UZYB 2AERT 3V6OE 4LKXB 5E5MA 2VITA 5C07B 3TBWA 2IPKA 1JPSH 2WNGA 1HSAA 2EDRA 4JB9H 4RMVA 5C71A 5FK9A 4JO4H 1YPZF 2A9NH 3BN9C 1QFPA 3KPPA 4MAUH 2B4CH 4HMEA 5HGHB 1AR2A 5EH1A 2X89A 5D2LE 1QO3A 3F7VB 4PP1D 3BJLA 3FOMB 4PJDE 4HC1L 5ALCL 4QKXB 3VXNA 3DURA 4NQCA 1CQYA 1PX3A 4EUPH 3IFOA 2YS4A 4R26L 3TM6A 1MHEB 1U95A 2NZ9D 1SBSL 3DSFH 3VRLE 1OSZB 4FN0A 1Q94A 1J1XL 3K4AA 3Q0HA 1TIUA 3RPKA 5AYUL 3UAJD 2Z0BA 4IRZH 4R0LB 4I0KA 5D72H 4P9MH 4GUPB 3CJJA 5FHBH 4A6YB 4LLAA 4PRDA 1RJLA 2X70B 5JORB 2CLRB 3RBSA 2ADIB 4IMLB 1EZVX 4JE4B 5IF0A 2FHCA 4KXZH 1G0XA 3FRPG 4Q0XL 1CR9L 4QRTA 3RTQB 3GMRB 2VDQH 5IESL 3RAJL 1TZGL 3QDHA 3UJJH 4GT7A 4RIRA 3RGVA 5DK3A 1KB5B 2NXYB 2W1NA 3D6GA 4KTDL 2IGFL 5EUOB 4JFXA 3R1GL 1JF1A 5MENB 4G5ZH 3THMH 1XGPB 4ZUVB 5HSFA 5DLMH 2M8XA 5F8RC 1NGYB 1T3FA 3OX8A 1QEWB 1BJMA 4YZFE 3DVGB 4DEPC 2FH6A 5DRWB 1I1AB 2W07A 5JMRA 4UI2A 2AJVL 1RJCA 2FECL 4Y5YA 5IJVA 5C86A 3NCFB 3RVVC 3D5OF 1RZJL 4I77L 2OTUA 3U7WL 2FL5B 1A1OA 2FZ3B 2Q3AA 4QHKI 1FAIH 2M2DA 7CGTA 5F88A 2DLEA 1WIPA 5E2VL 4EJ1C 4HUUA 1RURL 3MFFA 4ZNEE 3FT3A 2Z31B 2EEBA 3MBEA 4XP5L 2V5MA 4KWUA 3MO1B 3MNWB 3WUWG 4CADB 3BEVB 5T33L 4IRJD 1H3PL 1NUGA 3IJHB 1K8DA 3ULUH 5KSUB 3FB6B 1BBDH 3BZDA 4GW1A 1QR4A 5FB8B 2HJLB 4IMKA 1MIEH 1CL7H 4P23B 1UH2A 1LVEA 4Z95L 1D5ZB 1AGCB 3TNMB 2VXUH 5FECA 1J1OH 1Z9MA 3L95B 5FXCH 3NN8A 1ETZA 3ROOA 3RGVC 2YWYA 4KRPD 5GRXG 1AC0A 1RZJC 1UA6H 5DHYA 2DKMA 4UILH 1R3KB 1JN6A 3V9FA 4AY0A 3IKCA 3P9WB 4MXQD 3OGCA 1IE5A 5GQBA 2QQNH 4YK4B 1E4WH 3BYTA 3C5SB 3HZVA 5C70A 1G6RL 1MHCB 4IIQA 4KVNL 1LO4H 4XPFH 4Y5YC 1KFAL 1KF9B 4DUWA 3T2NH 1T80A 4WCYL 2QR0B 4WU7B 1I85C 3TV3L 3QDGA 4PGBB 1IAOA 4HK0A 4G6JL 1BWWA 2NY6C 2YXFA 1HQ4A 1FNSL 4XMKH 4Y1AE 3T1FB 5L8JB 3FT4B 1EDQA 1ZVSB 1MUJB 1OAKL 3QIWB 4I2XB 3FJTA 3FKUS 1NCWH 3C2AH 2OL3L 1TCMA 3GSRB 2ZP0T 2RCSH 3WV0A 4LHUD 3MBEC 3MGAA 2MOVA 3MCLL 4ONGL 4FTVD 3NFNB 12E8L 4W6YB 3MRBA 3T0ED 2FEEL 3BKJH 5F9JB 4ONOA 3DV4A 1U8OA 1UZ8B 4H1LB 2CGRL 5TH2B 1XCQA 4LAJH 3RWHB 3DETC 4WGVB 4IMKC 5D1ZB 5IT2L 5D6CB 3O9WB 1AD0B 3H9SE 4JFFB 4LPWA 3U6RB 3KPRB 3TT3H 4Z7OE 1RUPH 1UH3A 3FO0L 4LP5A 4KTEH 4R4BB 1Z5LA 3KVQA 1A6WL 3K8MA 1CGXA 3ZSSA 4X8JA 3MA9L 1LE5B 3HI6L 4ZUWB 4OV5B 3IF1B 3ARBB 5KSAA 3MJ9A 4M61B 4PJ9D 3QDMD 4JZOA 2IQAA 3L3IA 2ADGA 1QBMH 3MV7E 4U1JB 2XWBA 4LCWD 2CIIA 4IIQC 1FNGA 3MRGB 3JXAA 1RJYB 1J88A 1RHFA 2HRPL 3JTSA 4G8GB 3MOBH 5EULV 1JHTA 4LCIL 3BWAA 4UINH 5GJTH 4OF3A 3EYOB 3VFWA 2Z91B 5DD6B 1P4IH 1B0WA 4X6FB 5D1XC 1A4JB 5KSBE 5I74C 4EI5B 1SYVB 5IM7A 1KEML 4F7MB 2W0FA 3B2VH 5HY9A 2LAGB 5JOPE 4GMSL 1FGVL 2DMCA 4MVBC 1I7TB 2J3SA 4YDKL 3MRRA 4JGMA 3BESR 5D71L 1DANT 3D25B 3S37X 4WIQA 2CKBH 4H20L 4IRSD 3L3OA 1LO3H 1IQDB 4XVSL 1YDPB 3IXTB 3L6FB 2B0SL 1F2QA 1GGIL 3H9HA 2OZ4A 5D7IB 1UKTA 4PJFF 3SDYL 3AB0B 1E4XI 5KSAC 4KJQC 4EDWH 1TFHA 2AEWA 1CF8L 4YDVB 1WIUA 4JRYD 1MAKA 1I4FB 1OPGH 3RVWC 1DZBA 1Y0LB 3QHTC 4L9LB 1N59B 2AXJA 3BGMA 4LIQE 5F7EH 4PJHA 1N5YL 4D9LH 3EHBD 3UYRH 1ADQH 4G6AC 1GZPA 4M1CD 4I18B 2XA8H 4K7PX 3LKQA 3ZHKA 4TPRH 1NMCB 4H0HB 1SYSA 4D3CL 4LASL 3LEYL 1NFDE 2HJFB 2ZCHL 1E27B 5FO7A 1SVZA 3CH8A 4U7MA 3NCBB 4WW2F 1JK8A 1OTUD 5C0EB 4CVWA 3G6DH 4G6MH 4Y16B 4Z77A 4RZCA 3QXUA 1RVFH 2CPCA 1DDHB 3PGFL 5E8DL 4DGVL 3LH2L 3MLWH 4MD4B 4OF7A 2FJHB 5FYLH 4QXGH 4LKCA 3VFGH 1CGSH 3EO9L 4JFEA 1AD9B 2BHYA 4M4PA 2XZCH 4N0CD 2O5XH 5DZOA 1OAXH 4L5FH 1FNHA 2IPUG 5ISZA 2HJKB 3QEQD 4F7EB 2P24B 1A6TA 4MHHI 5JW3H 3T2PA 4YHOH 4MX7A 5MP6H 1MFAL 3V6FB 5IFJB 1FNEA 4F8QA 4I2XE 2OI9C 1MCWM 1HNGA 3FHAA 4P59H 5GISL 1A7RH 3WO4C 3L5XH 1MOEA 5DD3H 1NC4A 2AQ1A 1KGCD 4U1SA 4B50A 5IFAL 3CDFA 1ZVYA 2B1HL 3P73B 3WXVL 2FWOB 4DVBB 4MAYA 5AD0A 1YY8B 3VXMB 3JWNC 1MEXH 4U1NA 4KUZL 1KACB 4PR5A 1T1YA 1W0WA 2EDYA 4JN1H 3GSOB 1OGTB 1F8TH 2F5BH 2J88H 3GBMH 2FO4B 1WZMA 5DEGB 5DURB 3VFSB 1JGEA 5D1QB 3A6CL 4ZMAT 2V17H 3S35H 1OARL 3U83A 2VABB 4OZFH 5DUBB 1KIPA 4MMXC 3MV01 3MV8B 2PO6B 3P4OA 4K3EL 4MQXD 3FTGA 3DXAD 1E6OH 4UBDD 3W9EB 2Z92A 1H15A 3ZZ1A 5TE4H 2VO5A 1OT2A 3N0PB 4QRUA 4UU9B 5D7SL 1IGJB 4YHLH 5IQ7H 3SBWA 4CMMA 1R3IH 3P0YL 1JPTH 3PGCA 3B6SB 4ODXA 4PGEB 3U30B 4G7VH 4M02A 3IDYC 4TYUA 5FM5O 4WO4D 3TEUA 5A16B 1MCEA 2BY3A 1U8IB 3QNZB 1ODAA 3QUKB 5JW5A 3HG1D 1XEDA 2Z8WC 4NP4L 5E5MB 5SX4I 2VITB 4OM0L 4DWHA 3I50L 3TBWB 2IPKB 4DEPB 1U2HA 1YYMH 3CIQA 1HSAB 4NUJA 5FK9B 4UIMB 2FEEI 4L8CA 3JWOL 3OB0H 5IGXH 3KPPB 3OAZH 3MOQA 1Q9OA 1W72L 2DBLH 3KPOA 1QO3B 3H7LA 4DN4H 3MSPA 3A67L 1JF5A 3DURB 4NQCB 1JFQH 5IHLB 4JFHD 3IFOB 2A77L 4QRPE 3VD4A 1U95B 2RR3A 3K8KA 1JIBA 4EIZC 4OUUA 5CSGA 2GJ6E 4X6EA 2BNRE 2MQ0A 4PGJA 4RWYL 4YC2C 1INEL 2AK4A 1Q94B 1LEGA 4U1KB 2X4SA 1GOGA 5FYKL 4XBPA 3JV6A 2BSED 4W68A 1F4WL 2KQMA 3P0GB 1X5HA 3HB3C 4JPKL 3D1MC 4PRDB 1MWAA 1RJLB 5JNYA 3K4ZA 4R26H 4TNWK 3S7GA 1Z3GH 4FQLL 2VQ1B 5IF0B 4ALAL 4K3DL 4ZTOH 1FO0A 1MRCL 3SBWC 4QRTB 4JY5L 1VCAA 5AYUH 4KAQL 3JWOC 4RIRB 4NFDA 1G7IB 1MFEL 2VXTL 1YEIL 3RGVB 1N2RA 3HUJA 3GBLA 1DBMH 4JFXB 3QNYB 1JF1B 3K80A 5FYKU 1XGQA 3ESUF 4XP9L 1RUKL 1T3FB 2R0WL 3OX8B 5I17A 5DEZA 1S78C 2EIBA 2E9BA 4XNZC 5BXFA 2SEBA 4WGWB 4QRQA 1TZGH 1LK3L 3V52L 2ID5A 5KJRH 4Y5YB 1OAZL 1NFIA 4M5YL 4V1DE 5EZOL 2OXHA 4ZDHA 1BQLL 4JHBA 4OD1L 2OTUB 1T21A 2HA1A 1YYLL 1A1OB 3DHMA 4NC0B 2IMNA 1UACH 5F88B 1BGXH 3FO9A 3BDXA 4HUUB 4NN6C 3MFFB 3ULVE 3FT3B 4AEHL 2VISA 3EOTL 3MBEB 3GSNH 5DUPH 1PGRB 3NH7L 3U1SH 3SQOL 4EUPA 3SDXE 1WVZA 3MLTA 1WAAE 4WUUB 4Q74A 4OJFL 1J10A 1BF2A 1HH9A 1WWAX 2I26N 2WAHA 5JIHA 4X83A 1K8DB 4PG2A 3U7WH 3DIFB 3KLDA 5HI4C 4GW1B 4KKBD 4TQEH 1T1WA 3O3EA 4CVXA 1NAML 1RURH 2CK0H 3EYVA 1BZQK 2VN4A 1PZ5A 5FECB 3NN8B 1MRDH 4N1EA 1ETZB 3GRWH 3ROOB 5D70L 4UTBH 2WINA 4QT5A 2C3WA 1RZKC 1PY4A 3T08A 5DHYB 3WYRA 4ZSOA 1JN6B 3LQAH 3VXME 4Z7WE 3IKCB 1UYWH 1EAJA 3OGCB 3TIDA 1CE1L 2EE3A 3B9EA 1ONQA 3B4NA 5L9DL 2IAND 1JVKA 4P9HH 5IVXE 1WEJH 5HHMD 4XXCA 3HZVB 1KC5L 4RA0C 1H5BC 3T3PF 5I15L 4IIQB 1T66C 3VJ6A 2K9UA 3DYOA 4OGAC 1FIEA 4BSWA 5JMOC 4OLWL 1M7IA 5CILL 5ACLA 2FGWL 4HK0B 2VTFA 5JQ6H 4P3CH 1HQ4B 3D85D 4NQEA 4DKFH 4HH9A 2AJSH 4KGJA 4B7IA 3TESA 5CZVH 5KVDL 4BSJA 3VGAC 3FCTA 5D1XB 1BJ1H 5I74B 1G6RH 2DMKA 4I3RL 1NFKA 3OXSA 4L1DA 3MRDA 5D8JL 3OR6A 3SGEI 2GTWA 3OKKA 3BDYL 1QVOA 4CVZA 3UYPA 2F8VA 3MRBB 2OP4L 4L8BA 2YK1L 5GGRA 3DV4B 3IXAA 1U8OB 2BNQE 4PG2C 3DBXA 4HX1A 2NY1C 1XCQB 2R1XA 2VNCA 2L7UA 2X4NA 1TETL 2I9TA 1KIUA 3MQIA 4WHTA 4WI9A 2LABA 5DRXA 1W0VA 2JELH 2UUDH 1U41A 4XWOD 1EGJL 4ONGH 3OB8A 4YH6A 3K0WA 1MCPH 1Z5LB 5E08L 4NHUA 1HXYA 5KW9L 4X8JB 4R9HA 5C0CA 2WV3A 1MJ7H 2UZIL 2B1AL 2FYYA 2WLZA 4RX4D 1VGEH 5J8OA 5KSAB 5HI5D 2H6PA 4JZOB 2IQAB 5T1LD 2DTML 1ZKAA 3L3IB 2ADGB 4YPGA 1ZS8A 2XWBB 4XXCC 3PXHA 3IS0X 5JUEL 5A2JH 2CIIB 2BZDA 2BP3A 4CW1A 3DYPA 1FNGB 1IC7L 3DUSA 3PIQA 1J5OH 1Q72L 3JTSB 5KTEH 1JHTB 5EO9A 3BWAB 1SEQH 5BV7H 1GGTA 1QNZL 3SGJA 1IT9L 1YN7A 4QOKA 3VFWB 3VXSD 5EOCL 4X6CB 1CFQA 3BW9A 1L7TL 1EFXD 4KV5F 4CJ1A 3WNNA 4RISL 3MBXH 1DUYB 3S8WA 4PY7A 1GCFA 1PAMA 4M7LT 1OD7A 2MPAH 3O3UN 4PP2A 2UV3A 5IM7B 2WWKT 1GGYA 2W0FB 2HRPH 3DNKA 2P5WE 4LCIH 5HY9B 1JZ4A 4XAKE 5C2BL 3BOVA 2OJEA 5EU6A 4LNVA 1QPPA 4HW6A 1BAFL 3WD5L 5IR1A 3JV5A 3SJVA 3MRRB 4ODSH 2F53A 4G8IA 5GS0H 1I75A 4ORZC 1CXLA 1XIWA 1G1CA 5BS0A 2WZPD 3VDAA 2V2XB 5IVNA 3L3OB 4KJPC 5FEBA 3FQWA 1FJ1A 1FE8H 3QAZC 1JGVL 2VDNL 1FORH 1YPZA 2BSRB 4D94A 5DK0A 4M3JA 4GMSH 3FQNA 5IIEA 3H9HB 4GW4A 4NM8H 1FFOB 1AR1C 3ZE2F 3KXFD 1KT2B 5F96H 4AEIL 4XCEA 1HI6A 2OI9B 1F90H 4XWGL 1H3UA 3MRFA 4BQCA 3WO4B 1JTTA 2VDKL 4RMWA 4JAMA 3BGMB 3HZKA 2J5LC 2B0SH 4PJHB 2J1KA 3VXRD 5L2KD 3SDAA 2PTTA 3S3JA 5D93B 3I3BA 5E2UH 1CF8H 3NFPA 1G84A 2EH7H 1AJ7H 1GZPB 4ZG1A 4YDLC 2Y07L 3LKQB 4TVPD 1SYSB 4NBZB 3L5WA 5FO7B 1N26A 1VPOL 5C0DA 1N5YH 5EORH 1JK8B 1A7QL 3IFLH 4LARL 4CBPA 4Z77B 4RZCB 2BXZA 3TBSA 3EJJX 4WFGE 3PE9A 3W81A 3O6MH 5C0BA 3KHOA 3QCTL 1XIWC 3EFDL 5M7QA 5IHZA 4LKCB 5L88L 1N64L 4YHZL 3GO1H 4LSSL 1NQBA 3W5MA 4PJBE 4JFEB 4O2CA 4UOW1 1XZ0A 1C08A 5LBSH 3TFKD 3IDYB 5ISZB 3QPXL 1WIOA 3QI9A 1KB9J 2ESVB 1A6TB 2R4RL 3QDGE 1C5CH 3K4DA 2EDFA 4F9LA 1R5VB 4NWUL 5C6PB 4MX7B 1XR9A 2AXGA 1IM9D 2EDDA 4I13B 1FNEB 2VL4A 4BQ9A 5CD3A 2GJJA 1AXTL 5JPMB 1JMZA 2AEQH 1NC4B 1URLA 4U1SB 3MLUH 4F58L 5IHUL 5CZKA 5J89A 3SDAC 4MAYB 5AD0B 3RY4A 1T2QL 1MFAH 1RJZA 2E6JA 2VDLH 4PR5B 4Y5VA 4FXKA 1YEDA 3TLRA 2CXKA 1T1YB 2D4DA 1W0WB 4OLUH 5JW4N 3SN6N 5KS9F 4YC2B 3HI1A 1LO5A 1JGEB 3T2QA 1BJ1J 1ES0A 5CJ8A 1TLKA 4D9QE 4K94L 2NW2A 3BT2H 1U8KA 1KIPB 4YBHA 2OCFD 1EJ6A 3P4OB 3FTGB 5B39A 3L3JA 2Z92B 1H15B 4IOSD 3D9AL 4QRUB 5AZ2L 4MQSB 5CIPB 4CMMB 4ZD3H 5LQBL 5LCVL 5MEPA 4PRIA 3H7BB 5JXAH 3WMSA 2GJZA 1OARH 3QCVL 1RY7B 3PGCB 4KXZI 4ODXB 5EG6C 2HT4D 3AMLA 3QI9C 1I3GH 3OPZH 5I1HL 3O4LA 2N7BA 4F9LC 4UQ2A 5JW5B 3VFOA 3V5HA 2PTVA 3GHBL 1N7MH 4TVSa 1TTUA 5D7SH 1E0OB 4XNZB 3BZ4B 3P0YH 4NUJB 4QNPF 1N0XH 3BWUC 1ND0A 2AEIT 1H8SA 2V7NA 3FO1A 4H0GA 43CAA 1R0AL 4YBQD 2NY0B 3MLPA 4LEXL 1Q9OB 1EV2E 3GIZH 3KPOB 4PB9L 1EO7A 5ICYA 1D6VL 2YD5A 4ONFH 4Y5VC 4OM0H 5DDHA 4LRIA 4X6EB 2DICA 4NN6B 5FKPA 2MWCA 3LKNB 1KBGL 3ZT7A 5EU4A 4DJMA 4JFPA 5I1GH 2X4SB 4GRLD 5F7UA 2NR6D 4XBPB 1RIUH 3JV6B 5DJ8A 3O6FC 1RAMA 3WIHH 4P2OD 3UTTA 2QHRH 1MWAB 5JNYB 2A77H 2VR9A 2NXZD 2JK5B 5AAWA 1FO0B 3UBXA 4NNXA 4OZFA 1ZVHA 2A83A 4XHJD 5L8LB 3FO2A 5GGTH 1EHXA 2BRRL 2D9CA 1BEYH 2X1OA 3HUJB 3OQ3B 2X4UA 4W4OA 1BFVL 4HDIA 4Y1AD 4HWEH 1XGQB 4WRLA 3WLWC 4XPBH 5ETUA 4TSCL 1T89A 3G5ZA 3UJIL 5E6IA 4L4TE 1XGTA 1K2DA 4KMLB 4QRRB 4S0SD 3BDBA 5I17B 1C1EL 3C60D 5DD1H 1MRCH 1NDMA 1MPAH 4K71B 5BXFB 2AJYL 4JY5H 2SEBB 4QRQB 2E5EA 1O7VA 5I1CL 4KKAC 3JUZA 3PJSA 4HPOL 1NFIB 4I5BA 1CK0L 4O9HL 4ZDHB 1FG9C 1D9KC 2EC9T 2QJDA 5EWIL 3QUML 1T21B 4XP9H 4ZAKD 4JQXA 3R06A 5K9JL 1J1PL 3H9SD 5JIPA 3FO9B 1YJDL 2XG4A 4LRIC 1OY3B 1P4BH 4ZO9A 3VGAB 2GTZA 1MFDL 2K7PA 4X9IA 4U7SA 2VISB 1LK3H 3WIIH 5T5NG 1MCIA 3OKDA 3QEGH 4MGXA 3BRGC 1H8OA 4M5YH 4JFEE 5FAAA 3SKNB 4EUPB 3PDDA 3MLTB 5T1DH 1QLEL 1HH9B 1E4KA 4PJGE 5GGQL 3QIBC 4X7DC 5EZJB 4U1LA 4JFZL 1T1WB 3MV7D 3O3EB 3VG0L 4CVXB 3WKMH 3EYVB 4Z7UE 4AEHH 3KR3L 2DWDA 2AJZA 1PZ5B 1NGXA 5KVGH 3MOAH 3MODL 3RWGA 2G2RA 2WINB 4OZIF 4QT5B 3VG9C 1BVZA 4W4OC 2VLJA 1SMOA 5I1EH 4WWID 4ZSOB 4XP6L 4DVRH 4HS6A 1L6ZA 2FHBA 1FIGL 4KDTC 1DQQA 3O11B 4QWWC 3TIDB 3WXWL 1ONQB 8FABA 6FABH 3WFEL 1MAJA 2YOCA 3C6LA 5DFTA 1I3RA 1V8HA 3CX5K 4DAGH 2BVOA 1OWRM 5D70H 3VJ6B 4BSWB 1CLCA 4X80L 5JOPD 1SM3L 1M7IB 3H2WA 1OTSC 4NM4L 4HBCH 4WW2A 3NABL 4YUEH 5DGQA 4NQEB 1J9CT 5DHVH 1MHHA 2BVQA 4HH9B 4PJAE 4JG1H 3H0TB 5I8CA 4F33A 3EYQD 4LMQE 1FN4A 4UOW0 5FCUH 3CK0H 1PKQA 4JY6A 2F8XC 3U4EA 5I15H 2BJML 2E8ZA 3X14A 5CWSA 3OXSB 1ZANH 1YMME 3KNBA 5LAXA 3MRDB 3OR6B 4WI5A 2GTWB 3OKKB 3SE8L 1QVOB 4CVZB 2QSTA 5CILH 2HFFA 2DQTH 4O5LL 5DXWA 4L8BB 5GGRB 1TJHL 3IXAB 3DBXB 4H5SA 4HX1B 4F37K 2R1XB 1ZLWH 2X4NB 4OBSA 1KJ3L 3GSNA 1GOHA 1A3RL 2VC2H 2WBJC 3BPCA 2I9TB 2OSLA 5KVDH 4WHTB 5EOTA 2R29L 4KDVA 1JRHL 1W0VB 4I3RH 4IM8A 3TPKA 3QAZB 5DMGD 4NHUB 2JB5H 4NPYA 2JCCF 1HXYB 3U7YH 2OP4H 5C6WH 1F13A 2YK1H 5C0CB 3VD3A 4OT1L 2FYYB 3FHQA 5F1IA 1PLGL 2L4OA 2ZG1A 3BHBB 4LPCA 1TJGH 2H6PB 4P23D 3GRWA 4X5WB 4YPGB 3C6LC 1HE7A 2FX7L 5D9SA 2X40A 1EGJH 4XP1H 4DUXA 2AK4E 2VQUA 3QWOA 4CW1B 4S2SA 3DUSB 3PIQB 4FQXD 4AEEA 5CCKH 3HLAA 2C4FU 1A1MA 4HS3A 2J5LB 5F9WC 4O51A 2BOCA 1MCLA 4WEUD 3TO2A 2Y06L 3REWB 5EO9B 5J13C 4WW2C 1I9IL 4BJLA 1YN7B 4QOKB 3RVTC 3CVHA 4MNGA 5L6YL 2HMIC 1CFQB 3BW9B 2DTMH 4YDLB 3EFFB 4PY7B 2A6DA 5CJXC 4H8WH 2YRLA 1O5DT 4PP2B 1Q72H 3EAKA 2PUQT 2RJMA 2IADA 3BPLC 3KYMA 3QUXA 3HUJE 2DQGH 1VGKA 4NKMA 3F7RA 3SPVA 2OJEB 5EU6B 3BZFA 5F1SA 4Z76A 1A1NA 5IR1B 3WSQL 1YN6A 3N9GL 4CU8A 5BVPL 2F53B 4G8IB 2IBZY 1MCSA 1QOKA 1XIWB 1B2WL 4RFEA 5BS0B 1EIBA 1FGNH 5B22A 3WDIA 4YX2H 3FQWB 1FJ1B 3LDBC 3W2DL 4UUJA 4XAWH 3S9DB 1Y6MR 2Q8BL 1YPZB 4NQUA 1CTOA 2D2OA 2GSIA 3BPNC 1WTLA 1I7ZA 3FQNB 5SV4A 5IIEB 3KPSE 1B6DA 3K2MC 4GW4B 1DQLL 1HYRC 4XCEB 1HI6B 3MRPA 2IJ0C 1B0GA 3ABZA 3MRFB 5E2JA 1GGBH 3PG2A 1A4KA 4M6OL 2HTLD 1QD0A 3HMXL 5ADOH 3RX5A 1S3KH 3HZKB 2FATL 3MJ6A 2CXGA 3HE7D 1H8NA 2PTTB 3EOYG 3SDAB 3OB0K 3K8LA 3P9LA 1MJJA 2XKUA 4IHOA 3OAZK 3S4SG 4LL9A 2DS4A 3NFPB 3SCMD 4YEEA 3UCRA 4NYLB 4XCFH 2E7HA 3N1FC 4M4RA 1EHLL 3L5WB 5ALBH 5C0DB 2DTSA 3QUXC 3OTTA 1IKFH 4FQJL 4KTYA 4ZSOE 3UBXI 1QFHA 3TBSB 2G5BA 4R4FL 3MLYH 4DGIH 2XY1A 2EDKA 4N68A 5E8OA 5HDBF 5IOPA 2HP4A 4JO2H 1GAFH 4M00A 1C16A 5IHZB 1UM5L 1S7XA 3LZFL 4HXAL 3FB5A 2YD3A 4PTUB 3V6ZA 3ZTJH 4O2CB 1XZ0B 1C08B 4YHNA 3QI9B 3ZKQD 1NCDH 1RIHH 1VB9A 2IG2H 4QRPD 5TF1L 2BDNH 1XR9B 2AXGB 5IROA 5D2LF 5DUML 2FD6H 3UZQA 2GJ6D 4PJDF 2BNRD 4HIHB 5CD3B 3SEPA 2P43B 2VXQL 4YHZH 3HS0A 5HGDA 5JXED 4PP1C 3H9ZA 3VXPA 4PJEB 5I18L 3SO5A 1XMWA 2NZ9C 1FYHB 3CGTA 2BFVL 4NOFA 3AY4A 5HYSA 3TWCL 1JYVA 4JM4L 1RJZB 4ELMF 4PREA 5ANME 3UAJC 4Y5VB 4FXKB 1YEDB 2YHGA 4NHCH 2LU4A 4IRJA 4DCQA 3S34L 3U36A 1RSFA 3HI1B 4KVCL 5BV7C 3GBNL 1LO5B 5KANG 3ULUE 2X4RA 4QEGA 1IQWL 1ES0B 3M17A 5IHUH 3MGOA 4F58H 5CLTA 3QIUA 2NW2B 3ZDYE 1NMBL 1U8KB 3VMOA 4S1SH 5B39B 1U8QA 3L3JB 3ZYZA 4TOYL 5TPWH 3QCUH 1IC5H 4OTXH 2IF7A 4QXUL 5MEPB 2O5YL 4PRIB 1ZA3A 1DSFH 2GJZB 4V1DD 3H42H 4ZFZA 5C9KA 1ZGLM 1SVCP 3ARFD 4ETQA 1H3VA 3BXNA 1Q0XL 2DJUA 1KB9K 3O4LB 1X5IA 4UQ2B 1VFUA 4HKZA 2GK0A 4KHTH 2ATPA 1AGFA 2V7HA 1UKSA 5IROC 3V5HB 3VFOB 3GSQA 1F58H 4QOKE 5JLZA 3ULVD 2E3VA 1IEAA 5LCVH 2MCPH 5E95B 3U9PL 2NQCA 4PLKD 1UG9A 1YEGH 1NSNH 1ND0B 5GS2H 2V7NB 3FO1B 4O58H 43CAB 3MRJA 4S1RL 4KZEL 3H3BC 3U0WL 2EH8L 4OCMC 4XBEL 3AY4C 5TQ2L 5EU6E 4LHUA 4XNYH 1JRHI 1BQHG 3SJVE 3N1MC 4FTVA 4DKDC 3O3AA 2C7UA 1PY9A 5DDHB 5JW4M 1MAMH 4IRJC 5FKPB 3T0EA 1NBZA 1WCBB 1FL3A 4BFIA 5EU4B 1RZ7H 4JFPB 3WCYA 1VERA 3F5WB 2DJ4A 5DR5L 3VH8G 4KI1A 4LEXH 5DJ8B 1L9MA 5EPMA 1YPZE 1R24A 4ZYKA 4NQSA 5LG1A 3N1PC 5C7XH 1CFVL 1ZHLA 3VXMD 3UTTB 1DVFD 1MH5A 3QR2A 4H0IA 3OBAA 2Q6WA 4GG8A 2YPLE 4YIQA 1Z9SA 2C3XA 3DROA 3C8KA 3LKPA 3O2DL 3UBXB 2CD0A 4KRPC 3UJTH 2X05A 2ZUYA 4AL8L 1KBGH 4OZFB 2A83B 1U9KA 5D1QD 3FO2B 3J8F7 3X13A 3LPWA 5GHWL 4PJ9A 4GXUN 3QDMA 1I7RB 4MXQC 2X9WA 5E8EB 2X4UB 3VG9B 4ODTL 4HDIB 3IFNH 2PO6D 5ETUB 4MYWB 5MEQA 2RBLA 3G5ZB 1XGTB 1BHGA 5C0GA 4LU5L 4DOHE 3BH8A 1NDMB 3GJFH 1FC2D 1GGUA 5E94A 2VN7A 3MGTA 3GK8L 3PJSB 5I16B 3FONA 5HYQA 2N4IA 4I5BB 3GUTA 4G3YL 2BNQD 4PRBA 5D6DC 4XBGA 2EKSB 3R06B 1C1EH 3EGSA 4KZDH 5HPOA 1B0RA 4HFWA 5C0BE 2GTZB 5LXGL 3T0EC 1S9YA 3I02A 4IOIA 2WQ8A 3OKDB 4OCLC 5F6HJ 1II4E 4I1NB 2VZOA 4M7LH 3KYKH 3KLSA 3Q6GL 1Z6JT 1XF3A 4UT6H 4IRSA 4LSRL 4ZPTA 4U1LB 4OLEA 1J1PH 4ESKA 2VH5H 2NY5L 3WIHA 3EJYD 2DWDB 2NMSA 2AJZB 1NGXB 2ZNWA 1QFWH 3LRSB 1EBAA 2YWZA 2OTPA 4I8DA 4ACPA 3MCG1 4PJ9C 2G2RB 4N8VG 2YEZA 1KCLA 2VLJB 1KUMA 2Y36H 4JRYA 2DKUA 2VUOA 2PW1B 2W9DL 1FPTL 4HS6B 3IJSA 5ITFA 3IDNA 1CD8A 1DQQB 4LLYA 1KTDA 3VG0H 1NBVL 3V0WL 4KQ3L 8FABB 5E8PB 2VKWA 3C6LB 1I3RB 5CJQL 4W6XB 4H88H 2BVOB 4HWBL 2P5WD 5KSBF 5F9WB 4XAKD 1S8DA 3EYSL 1OHQA 2QQKH 5J13B 3FRPA 4WW2B 1JWSA 3INUL 4FQIL 1MHHB 2BVQB 3UTZA 5I8CB 4HS8L 4WHYG 4F33B 2D7PA 4JR9H 4J12A 1FN4B 2EYSA 1XCTA 1PKQB 3O41A 4JY6B 4HGWB 3U4EB 3X14B 5CWSB 1MJ8L 3F62A 3KNBB 4O02L 5LAXB 3PHQA 5FGSA 43C9A 3ARDA 2UVEA 3BPLB 4NM4H 4ZO7A 1EH9A 4JO1L 4IOFC 4NGHH 3DI2B 2VSCA 5FYLE 4H5SB 3O4LE 4IRSC 1DN0A 2D03H 4HG4J 1LE9A 3BPCB 1SHMA 5I1IL 1A6PA 4ZUUA 5K93A 2WIIA 5EOTB 2LU3A 2BJMH 3QEQA 4M62L 4EZMA 4Y88A 1WWCA 4R7DA 3WFZA 3LDBB 3PNWA 1UCBL 2E27H 5LGKA 4NPYB 2X10A 3SE8H 2YA1A 3OJMB 3S5LG 4YHMH 3WN5A 3BPNB 5I0ZA 2O5ZL 2FCBA 3MROA 4OLVH 4CN1A 4P46D 5ESVA 3NFSL 3LB6D 5F1IB 4FZEL 3X3FH 3WUWA 1DBJL 4OIIL 5GRWA 5DF0A 2R29H 1MY7A 1UQSA 4X9BA 5D9SB 3WFBL 3EHBC 4NO0D 1CBVL 3LEVL 1OP9A 3QWOB 4S2SB 3V7AG 5KS9A 3HLAB 4HS3B 1A1MB 4O51B 3S35X 1IBGL 2BOCB 1F6FB 3TO2B 4M1CC 2E7LA 1EK3A 4OT1H 4ODUA 3ECBA 1ZLSL 3UTTE 4GAJL 3E3QC 4I9WE 1NMAL 5HHXH 3CVHB 4MNGB 1OSPL 3ET9F 2CO6B 1OTUC 3O2VL 4KKCC 2A6DB 1KENL 3V4VL 5IK3A 3CFCL 1FZMA 4FQCH 4PG9A 3DXAA 4LCYA 2CRMA 3E6FA 2IADB 5DHVA 4JLRA 5DHXB 3KYMB 3QUXB 5GRVL 3QDGD 1VGKB 1B6UA 4NKMB 3SPVB 1EO8L 3A6BL 4Z0BL 4Z76B 4GRMA 1A1NB 4PUBH 2JJUA 3LD8C 1YN6B 3T77A 4N0CC 3K3QA 1UM4H 4RFEB 2BRQA 4HT1L 4WO4A 4UUJB 4ZQKA 4YDIH 1J8HA 1EEYA 3HG1A 5DS8A 2GSIB 2EO1A 1CLOL 2QQLL 2XRAL 5ID0A 2R8SL 1I7ZB 1QSEE 1NCUA 3LSOA 3N9GH 4JQVA 2DQJL 5GGVY 3PHSA 5DO2D 2WIMA 1B0GB 4L3EE 5ILTH 5T3XL 1U93A 4OQ1A 2AV7A 3OGOE 4J3OC 4LVNC 1A4KB 3RJQB 1KJMA 1UXSA 3W2DH 4LSPH 2ARWA 3OWEA 1LEIA 4D9QD 4CRPA 2E7LC 5J6HA 5C0IA 2X4TA 5DJCA 4OFKA 5KZCD 3P9LB 2V2TA 1MJJB 3RU8H 3FFCA 4IHOB 1HSBA 2VLLA 3QH3A 4K23L 4AJ0A 4LQFH 1UH4A 4MJ4A 5EZIL 2JJSA 4PJFE 4WUKH 2RHEA 5BV7B 5IBLD 4MQXC 2XQYG 4UBDC 4UDUA 4WWKD 5I1KH 1GGCL 1M6OA 1MQKL 5E2WL 2VLJE 1JPGA 4NZRL 1XF1A 5AZEL 5HDQH 2YUZA 4NKIH 4HUXB 3DVIA 1VDGA 5E8OB 5IOPB 4Y2OA 2HYMA 5E2TH 5H37G 3VRJA 2C3GA 4EOWL 2H3NA 1C16B 4MJIE 4WO4C 5GXBB 1S7XB 3FB5B 3V6ZB 2DF3A 1LO0H 4YHNB 3NBNA 3H3PL 3GI8H 1BM3H 4RGOH 1NBQA 1MCCA 2R9HD 1EVUA 3GSVA 1HHKA 2ZOLA 4JQVC 2VRAA 1SBBA 3FQRA 3QDJE 4I3SH 5T3ZD 1MQ8A 3F7QA 2D9QB 3LZFH 3HS0B 5HGDB 3KJ6L 1YEJH 4K3JL 1BPVA 5IW3A 4UOJA 2HT3D 4LVEA 4X5LA 5FDWA 5T5NF 4X7TA 2PN5A 5HYSB 4PREB 4EKXA 3S3SA 2JJSC 2E7MA 5D5ME 4IRJB 3OZ9L 4DCQB 3U36B 2A6JA 3E1F1 4LIQH 4NZUL 3GMPA 5TFSH 3M17B 4RFOH 3MGOB 1JGLL 3GI9L 4E41A 3G5YA 3QIUB 2R0LH 3NIDE 3PWPD 4OZIA 4L4TD 3QUYD 1U8QB 4J3SA