4Q7DA

Wild type fc (wtfc)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
207
structure length
207
Chain Sequence
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Structural characterization of anti-inflammatory immunoglobulin g fc proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4q7dA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4q7dA01
5L6YL 4O2FA 4JQXA 5LWYH 1YJDH 2O5ZL 2BOBA 3D2UB 3FB8B 3PIQA 4KKAD 4CVXA 4XP5L 5CKAA 2BNRB 4QRQB 3W0WD 1JE6A 1BWWA 1OT2A 1CXIA 4HW6A 5GJSH 1I7TB 4Y2DB 5HYJB 4JB9H 3RY5A 3E1F1 4TSBH 1X5LA 5FUCE 4O9HH 4C55A 3DX8A 3KR3L 5F96L 1WFNA 1RZKL 1S7UB 2BJMH 1KIQA 3QXAA 1U8QA 5EORL 1QSEA 1S7RA 3D69B 3OTTA 3MRLA 4H25B 5KVFL 1CXEA 2VXQL 2E27H 3KYMA 2NY0C 3BQUD 1BFVH 3UO1H 2FIKB 1K4CA 5F89A 1NH6A 5JNYA 5IB3A 4J2XA 4MD0B 4HJGA 1T04A 3AMKA 4R8WL 3WUWA 3PWLA 1NGXA 2J6EA 3HR6A 3IXTA 5GS1B 4K07A 5DRZB 2CDFB 4WGVB 1UGNA 1C5CL 3VWKC 2W07A 1IKNA 1L6XA 2WIIA 5L7XL 4LK4A 4MJIA 4Q6YA 1Q9WB 2QSTA 3DTXB 3QDGA 1ZLWK 2VYRE 3ZDZF 1KUMA 3BIBX 3PWPD 5H94B 1FN4A 2J8HA 2UWEB 1P1ZA 4NGHL 4ERSL 2XTJE 3MTRA 2CLZA 1KPVA 1DBKL 2YWYA 2RR3A 3TYFA 2GJ6D 4XT1C 1DBML 4JKPL 5E8DH 1EFXB 2WP3O 3G5VA 4W4NA 4UILL 4MD5B 4PRHA 5GISH 4XAWL 5BS0E 4DN3H 3EZ8A 4YFLI 3VWJA 5T1DL 3RX8A 1BM3L 1ZHNB 3S3PA 4L5FL 4YBHA 2NY7L 2E6JA 4C57C 3I50L 1B4JH 1BREA 1TFHA 1PSKH 2PO6A 3DGGA 5GSRA 1CDYA 4WO4A 1BZ9A 4CNIA 3DRQA 5GJTH 2FH6A 4LPUA 3TJEL 2R2BB 4XBPB 2ZSVB 4MZ2A 5C0RH 1E4KC 3AB0B 4HWBA 2ZUWA 4CN1A 3NFNA 5JOFB 4OAWA 4BSVB 1WZ1H 1WJ3A 1NBYA 3ZE0F 4ISVB 3MRKA 1HKFA 4LP4A 1QSED 2L4OA 1VADA 3GSVB 1JHKH 1UEMA 4NWTL 1ZVYA 5HI5C 4ZNCD 4HS3A 1OTTD 2DM7A 2F74A 2Q76A 4PY8J 2GIYA 1PEZA 1YEFH 5MP6H 4YQXL 4JANA 2BRRH 4GXVH 2G60L 5CEXB 2DIAA 3NABH 2D2OA 2DQJL 3FFCB 4JZNB 4LLYB 3LCYA 3V4PL 3P77A 1H0DB 3KPNB 3WD5H 1NEUA 43C9A 4P2RA 2CLRB 2E8ZA 4RWYL 2GY7B 1NCDL 4MJID 4U3XA 3EO0A 2Z91A 1VGEH 1CDHA 2V2XA 3QDGD 1IGIL 1QQDB 2ZUUA 4LPYA 5DRNA 3S37H 3AREA 4R90L 3VRIB 1HINH 1NLDH 2DQIH 3ILPB 3T4AA 2ADGA 4D3CH 3IGAA 1OSZB 1Z9MA 1LQSR 3KPOB 1ZA3A 1LO4L 4WHYH 5KAQF 2GFBB 1D5IH 1MCFA 3MCLL 4J4PA 4OM1H 5KOVC 4HSQA 1WBZA 2EC9T 3QEGH 4OTXH 3O8XA 1YPZB 4I48B 4PRHD 3RI5K 2J8UB 1N6QH 3I3EA 4EUPG 3IB4A 1BBDL 2PR4H 3Q3GA 5FUOL 3VWJD 3B2UD 5ACZB 4LAQL 2O93L 4KK8D 4N1EA 1R3KA 4U6HA 1G7MB 3B9EA 2PO6D 5JPMA 3PL6C 4WO4D 2X1WL 3KPSE 1KN2H 1ZTXH 3C5SB 3I02B 5DTFB 3DRTB 5KVGH 1G6RA 4RCAA 4X9IA 4HK3J 4U1HA 4PJDE 1FZJA 1KB5L 4PJXB 1KG0A 4F7CA 1ORQA 1JNLH 3BW9B 3RUGB 3QIWB 1J8HA 4F7MB 4QCIB 3BEVB 5DS8B 5EIVA 4ZOEA 5I75C 3MX0A 1FFPA 1FLRL 5FEBA 3S96A 1FVDA 2AV1B 4ONGL 1OAZL 1SY6H 4OV5B 5DEGB 3VRJA 1ZHLB 4R2GB 3IDMB 1OSPL 2WBWB 4KAQL 2Q6WB 5I0DA 1PD6A 1T7VA 3L7EB 4D0CA 2FX7H 3ARDB 1TENA 4P2RD 2FLBT 1UVQA 4GQ9H 5CMAA 5C08B 1OF2B 3KHOA 1BVKB 4BH7B 1PY4A 3MBXL 5GGTL 4OFYA 5JHDE 1FVCB 2BOCA 2JB5L 5L0QC 4MZ3A 4FZEL 3IDGA 1EIBA 5IB5B 3O6FC 3VGDA 1KCKA 4HUVB 4RMWA 4Z18A 1RUMH 3C5JB 3PJSB 5TH2A 5I17B 5FGCE 2IPTL 5ADOL 4JFQA 3MLRL 3EFDL 1CR9H 4GKNA 4J4PD 3SDYH 2BHZA 3L3JA 5EU3B 3DX9A 3O8XD 1LO3L 4RDQG 2R56L 1SJEB 3KYNB 3RVTD 4M8QB 1G0YR 1O7VA 4NUJB 3QQ4A 3BT2L 4LBEB 1JYXA 5D1XA 4P9ML 3ZHLA 2WBJC 3OAYK 2EIBA 1I3RA 3LQAH 4LQFH 2GI7A 3BDXA 4AENB 1EK3A 3EDDA 3ZO0A 1IC4H 4KGLA 5C70A 4PJ8C 5D7KD 2VLRB 1PYWA 3JV5A 4HUMB 4FQJH 2UUDH 2N1KA 1HE7A 2BNRA 3CVHL 5SWSA 3PWVB 4RGMC 5IVZA 3BSZH 2R69L 4FOMA 3EJZD 5JR1L 1J8HD 4NKIH 5DLMH 1OD9A 2ZNXA 1CG9B 1DE4A 1A9EB 2BNQE 3MA9H 2YK1H 2Q86A 3RFZC 3VFNB 3ARTA 1JBJA 1C5DB 4LNRB 1HKLH 2K3TA 2IG2H 1S7XB 4NP4H 4WUKL 5D2NB 2AEIT 1EGJL 2R15A 4DCQA 3RWFA 4XNZC 1YYMH 1CGYA 4MD0A 4AG4H 1A1OB 4OFYD 4FRWA 1FDLH 3H3BC 4F15C 5HDLA 3K8KA 4PJ7F 1CGWA 2EDDA 2HJKA 1KB5B 3NCJH 2CDFA 5DRZA 4HF5H 4G8IB 1F6AB 4M3JA 4X5XB 1CICB 1NUGA 3WNMA 1MFAH 1S7SB 1U0QA 4POZC 4Z95L 1RVFH 1IAKB 3ULUE 1FVEA 3L5XH 1ZXQA 4FG6D 2GEEA 5H94A 3MXVH 4QF1A 4X98A 5L8LB 5C0EB 1OW0A 3VXME 1N8ZB 1CIDA 3QCUL 3LEXB 2VISB 1OTUC 5D1XD 1KB9K 4PD4K 4D0DB 5IMMB 1SYVB 2BSSB 3BE1L 3AVEA 2EDJA 4FMKA 5GRJL 1OAKL 2NY4D 2FD6H 1ZHNA 3HUJE 1GH7A 1HK6A 4R9HA 4HDIA 3GI9H 2FBJH 1JHTB 2VIRB 1U41A 2ICES 3HE6B 2C3GA 5E94B 4OD1L 2BNRD 5SWSD 5KVDH 4PRIE 2JE8A 3FFDB 1QBBA 2MHAA 3VFPB 3VGFA 5C6TH 3P9LB 2DBLH 4NQDA 2RJMA 2IEPA 3BYTA 1N0XL 2P5EB 4OT1H 4JZOA 1MHCB 2F5BH 3MJ9A 5DHYB 3U4BH 3C5ZC 1DTUA 3BGMA 1LEGB 3SE8L 4ISVA 3ZMRA 2BY0A 4YDKL 3T2PA 2DIJA 2KPNA 3QEQA 5DMYA 5EOCL 4TPRL 4P2CG 4X4MA 1KJMA 4QYOB 3UYRH 5BOPA 5E6IC 4JM2B 2NNAA 5F6HJ 4IDLA 1T0PB 4TTDC 4JVPA 1X5FA 2HMID 5DJ2B 4CMHB 4M7LH 1QR4A 3FFCA 5ID1A 1FYTE 1HQRB 3KPNA 2QLVB 1J0KA 3UROR 2CLRA 4DKDC 1D7FA 1L7IL 2X5PA 4UTAH 5IT2L 3MV01 3FJTA 4X7CC 3KWWB 2C1PB 5DVMA 4DGIL 1F3JB 5T1KB 1UB5A 4LCCC 3MV9E 2NY5C 3V0WH 3CFKB 4K2UH 3VRIA 1TZGL 1UZ8B 2BSTB 4YZFE 3TIEB 5IG7B 5JXAL 2Z31B 3DBXA 4EZMA 5T3XL 1OSZA 3MLZH 1B6UA 3BN9D 5IQ7H 1WIUA 4UQ3B 3QPXL 3LH2H 2DAVA 4GAGH 4MNGE 5IESL 4YWGL 4B5EA 1NSNH 4YBQD 1YQVL 1RIHH 2VL5B 3JWDC 4QHMB 2OTPA 1WLHA 1EBAA 2WWMD 5AZEH 4X7SL 4S1QH 1V7MH 3QNZA 3MMEB 4HC1L 3SE4A 1GPOL 2C26A 3VGBA 3DRTA 3TYGL 1YC7A 4XNYH 2YKLL 1FG2B 3W5NA 1OP3H 3S88L 1YY9D 4NQDD 1ORSA 4O02L 4Q0XH 3ZE2F 2B2XH 1MLBB 3OKMB 2ZUVA 2LU4A 1R5VA 3VXUB 3KNBB 1IAIL 1NFDF 4GLRH 4EUPH 3U30C 1HHKB 1QLFB 4JRXB 3GO1H 1R24B 1OGAB 2P46B 3EOBB 4UNVA 4HK0A 5M7QA 1XGYL 1HEZA 3QEQD 1UXWA 3RUGA 4M8VA 4TSAH 4F7MA 2PN5A 1F8TL 2YRZA 3L3OA 1FO0H 1PZ5B 2EH8H 2AV1A 3BO8A 1IAOB 4BELD 2I25N 1ZHLA 4U1KB 2ZKHL 4H88H 4PLJC 4FTVE 3BRGC 4KPHH 1HNFA 2A77H 3C09B 4I3RH 3BP5A 2Q6WA 5DJDA 2LU3A 2NXZB 3FFCD 3D25B 2DLGA 4GSDH 1E4XH 1R6VA 4OLVL 5CSZA 3KLSA 5C8JB 3O9WC 4Y8DC 1KXTB 4XAKE 3T0DA 1G7LA 1OF2A 1BVKA 1ZGLP 4LSRH 4F9PC 1A1NA 4ZTOL 2BHYA 1EERB 4X6CE 3HC4H 2W38A 4OZIE 1DUYA 1NDMB 4DQOH 4HUVA 4M43H 5DQ9B 3C5JA 3VD7A 5KS9E 5GS3A 3SDAB 3Q6FA 1HSAA 5T3ZD 5A2FA 4PJAE 3AUVA 3DUHA 3GSQB 1I85A 5D9SB 3MOBH 1X3DA 1X5GA 5F9AC 5F7EH 5EU3A 3SDXA 4LVOC 3QG6B 5FA3B 2PXYC 4EN3A 1FFOB 3OSKA 4XP9H 4YGAB 4TUOB 5DO2D 4NT6B 3KS0J 5ENWA 4NUJA 2VZ1A 3JTSA 1OAUH 3ZYJA 1EV2E 1XGPA 3LN4B 4JFEA 3PG2A 4MJ6A 2ZOLA 5CCKH 3VDBA 4J8RB 2W9EL 2VLRA 3HAEG 1S7TB 1AC6A 5FYLD 2YEZB 3E3QE 3HI5L 4WU7B 3TBTA 1OAYL 1M05B 2ZG1A 3M8OH 2YA0A 2D0HA 4IRSC 1GGCL 3P11L 4I0PC 5GRYA 1E6OH 2QV2A 5C6PB 3W2DL 1CG9A 2H2PD 5H2BA 2EDTA 1WT5C 1QA9A 3QXDA 5CKGA 4LNRA 5EUOB 3ZDXF 1CGUA 3WO4C 4LVNC 5D2NA 1QO3A 4PTTB 2ZUQB 1YEKL 5I6XB 1YNTA 1MY7A 2AW2A 5C08D 2JCCF 3BDYH 2EO9A 1A1OA 5C0FB 3R4DA 3QQ9C 2R8SL 1G6VK 4PB9H 4G8IA 3FMGH 4XP6H 1F6AA 4KKBD 4LLMB 4OZFB 5IWLC 4KI5D 2Q7YB 1MVUB 2UUDK 4PRDB 4APQC 1S7SA 1MHHA 1IAKA 2NW2A 1HSBB 2P42B 5BV7C 1WIPA 1FORH 4RBPH 4TYUA 4ZO9A 4XI5D 1DBJH 4RMQA 4RMRA 1AGEB 2C1OB 4M62H 3WN5B 4EN3D 4LFHG 2HVJA 4G6ML 5BV7H 3MNWB 2UZIL 4ODVL 3HMWH 5E8PB 5IROC 2PTTB 2ERJB 5IMMA 5IJKA 3MUZ1 5DJCA 1G7QB 2UV3A 3L6FB 4JFED 3IDIB 2B1AL 4OJFL 2ZOKA 1JPST 5SWQA 1INEL 1OWRM 2VLRD 5JIPA 3HE6A 5DR5H 2GT9B 3BHBB 1TJIH 3FFDA 3VFPA 5EN2B 4TTGA 3GRWL 2IWGA 3P9LA 1NC2B 1MFDL 3U1SH 1IRAY 4OLZH 1WBYB 2KBGA 5FHBL 1BD2B 4G5ZH 2P5EA 1MHCA 1AD0B 2HTLD 2H1PH 1N59B 5DHYA 3OX8A 1S7WB 3CC5B 4M4RA 3OKLB 1TETL 2AJVH 4PJ9C 5HJ3A 4NYLB 2EDNA 2C4FU 5I1EL 4QYOA 4YXKL 4UBDC 2AEPH 2E7CA 2B5IB 4XVSH 1NMAH 4FFWD 5AYUL 1A0QH 1QZ1A 4Z7UF 3UJIL 3UZVB 1DJSA 4JDTH 3V8OA 1HQRA 2EZ0C 5HYSG 8FABB 1HZHH 3T1FB 1ZLVH 1HXYA 4NJAH 1MQKL 3KWWA 5JUEL 5T1KA 1L6ZA 3GMOA 4MLSA 5I1LB 4DZBA 3H7BB 3CFKA 2VLJB 4NZDA 2ADFL 4JFZL 4AIZB 2DWEB 2W0FB 4OIAA 1F6LL 4MAUL 1UZ8A 2E5EA 3IT8D 5IG7A 1INDH 3CDGB 4YE4L 1H3PL 3S36L 1F02I 2FSEB 2XT1B 1PAMA 5F7DB 1DFBH 4NQVB 3SCMA 4E41A 3B2VL 3DVNB 1FL5B 5JPNB 2MKWA 4KK9D 4FHBD 1QNZH 1LDPL 4LEXH 1YMME 1AE6L 35C8H 2H41A 4FXKB 1QKZH 3TZVB 5CBEB 3DIFB 4WEUD 2CRIA 4Z7NE 3T3MF 3P9MB 3H9SA 3QWQB 1CGSL 3NIFF 2XKNB 3SDDA 5JDSB 3OG6B 3HE6D 4NDMB 3WJJC 5KSAC 3MMEA 5L88L 3IRZA 5SX4H 2O5XL 3WE6A 1FG2A 4KRNA 4OGZA 4M1GH 3NIDE 1XGQB 3O11A 1MLBA 5HVFB 1EUUA 2QQNH 4YHPB 1KNOB 2P5ED 4GMSL 5I66A 1DVFB 1FFQA 2WMPA 5L2KB 2C3XA 4KGJA 3TVMC 3SQOH 4P4KA 4KKCD 4M7KL 4KROB 2A6KA 3D1MC 3TBYB 3IF1B 5DQDL 5JOPD 2YN3A 4PJCF 1T1ZB 4NJ9H 4ZXBB 1IAOA 4PRNA 1CT8B 4NN7C 2HFTA 1MI5B 4HHAB 5GS0C 2RB8A 3RWCB 5E9DE 3VFSB 3RA7L 5C8JA 1RV6X 3FQUB 5F6IB 5J11B 3QHFL 4C4KO 4NO3A 1J0YA 1MFCL 4GRWF 2DQHH 5EPMB 4Z76B 1W72L 4OBRA 5INCA 5T1KD 5HVWA 3RVWC 4ELMF 1I9EA 2R0LH 3IFOB 5C9KA 3HG1B 4V1DE 1OP3K 1CD1B 5FGBA 1MY5A 2GJ6E 1ZKAA 5CIPA 2ID5A 5IK3B 1BHGA 1NPUA 2QEJA 5DJXB 5JO5A 3D85B 1NBZA 1OLZA 3O0RL 3GSQA 3NIGF 1MRDH 5D9SA 3SCMD 2G9HB 4E41D 2DQTH 5IBTH 2XZZA 1BQLL 3CDCA 3CSPA 4PJEA 2VZ3A 4LGSB 2UVEA 3PQYE 4QO1A 3QG6A 3ZHKA 3WXWH 2MSPA 2DM2A 2XYCA 5EB9A 2EH7H 1FFOA 4JPKL 5KSBE 2EIZB 1G7JA 1ZE3C 3B5TA 3ESUF 4X80H 3H9SD 4IRJB 3NA9L 2G2RB 1EDQA 3O6ML 3ME0A 4M1CC 3SDDD 1AGDB 4DKFH 2PYFA 1QSFA 5TPWH 2VC2L 2NY3D 4KMQA 2R2EA 4S11A 4GW4B 4Y5VA 1JNHB 1A5FH 4LARH 4KHTH 4PP1C 3UMTA 1JNNH 2CKBL 3VGAC 2F9BT 1VFUA 1T89A 4EKXA 5MERB 1B2WL 5CEZD 4ZFZB 4P4KD 2VKXA 5C0ND 1C08B 3MRJA 4PLKD 1QTYT 4CVWA 5IMOB 4KXZI 5TDNA 3RVUD 5C9JB 3AS2A 3PF2A 3PDGA 4XPAH 3U0WL 3T8XB 3SGDH 4AMKH 3HAEH 1MCLA 4YK4C 1M7XA 5B38B 2R0ZH 5EUOA 1A02N 2NXZD 5DMGD 4PTTA 3SKMB 1AI1H 2QKIB 5D7JC 1AXSB 2NYYC 2J12B 1MAML 5C0FA 4KZEL 3MRBB 2MTPA 2DKSA 4PJHA 2MCPH 3SE9H 4OZFA 1JNJA 2Q7YA 1NGPH 3H8NA 4PRDA 1C12B 1WZMA 3TNMB 2VWEC 4OIIL 4QOKE 1QD0A 1SJHA 2VDOH 3OR7A 4KTDH 1AGEA 3OKOB 3WN5A 3K46A 2AK4A 1TDQA 3OBAA 1YZZA 3HI6H 3MRQB 3TN0B 2VZSA 3GHBL 3W11C 5L8KB 1KEML 4LSQL 5E8PA 2PTTA 4ZFFB 3GIZH 4JRYB 4G9DB 1JHLL 1F5WA 1G7QA 4M1DL 4BFIB 1IE5A 1QSFD 4NC1C 5DD6A 5J9PB 3DXAE 1QFWL 1W72B 1OB1B 1MUJB 4YXHH 4HFWB 3I75B 4GRLB 5LGJA 4W70A 4UU9A 4IJ3B 5CZXC 1MJUL 4QWWD 4YDIH 2X09A 1LHZA 4OZGB 4MXVF 3QA3B 4HPOH 4KKLD 3ZHDA 1J88A 1REIA 2NY1C 4U7MA 4RGND 2XQBH 2FDBP 1NC2A 2HJLB 4RFOL 1OOAA 3NN8A 1WBYA 1F4XH 1BD2A 1I7UA 3EYVA 3F7PC 2RCSH 4J6RH 3BIKB 1N59A 3O2WH 2FHBA 2J5LC 2AK1L 1S7WA 2XFXB 3CCHA 3QDMB 3QI9C 2B1HL 4XMPH 4YX2L 3GMLB 3OKLA 4ZAKC 5JIHA 1MJ7L 4RBPK 4FQLH 2NLJA 1N4XL 1A14L 4HG4J 2SEBB 3VFWB 5E8OA 5I1GL 3BISA 3OXSB 2XN9A 1CE1H 2CKBB 5HGHB 3G6JB 1RIUH 5DD3H 1WBXB 4OLYL 4JHAL 2IADA 3AROA 2IGFH 5D7IA 1DUZB 4C54A 3BD3A 1BFOA 4P9HC 2H26A 3LY6A 4MDIB 3VD4A 1WAAF 3PP3H 4LU5L 4PGJA 3PXJA 5I1LA 4J3OC 5J1AB 3H7BA 2W0FA 4P9HH 5HDBF 4JG1H 1SBSH 1N26A 1NAKH 1RK1B 5B39B 2NTFA 3CDGA 2AK4D 4MSWA 4EDWH 3D18A 2HT4C 4G42A 5J89A 5F7DA 1MRFH 1WEJH 3REVB 1VCAA 3DVNA 5K9QI 3AS0A 1R3IH 2HFEA 3DOSA 4OCNC 5FF6B 4YGVA 3GEWB 5I1AA 4FXKA 5L2JB 4LSUL 4NM8H 3DIFA 1YNLH 1MWAH 4M7ZC 5JORA 1WZKA 4LCUA 4Z7QF 2XKNA 4RFEB 1FH5H 5JDSA 1Q38A 4NDMA 4P5TC 2E6PA 2N7BA 3DARA 3UJJH 4UQ2A 3IRPX 1NC2D 4MS8C 4NKMB 1A6VL 1Q0YH 4YHPA 1EZVX 4YHOH 1BD2D 1ZLVK 3V79C 1KNOA 4YHKL 3IS0X 1QR1A 4Y19B 1EMTH 2APFA 3DURA 4P5MB 3RWIA 5I18H 1KEGH 2ICEA 5L2KA 2EE3A 4LCYA 3AM8A 4QY8B 4XNXL 5HHVH 1KBGH 1T1XB 3TV3L 2EC8A 3IF1A 3UXFA 3VXTB 1L9MA 2APBA 2AJSH 2VH5H 4O5LL 3MOQA 2XN9D 4X6DE 1SHMA 5F1KC 3QG7H 4HKJB 3F7YB 1JK8A 4HIEA 1K9TA 5HYIA 4LQ1A 2BVPB 5EIIB 5CJXA 3TCLB 3RWCA 4R7DB 3ZLQC 2XWTB 1J18A 4L4TE 4S10A 4UI2A 5EPMA 4IMKC 4AM0B 5ESVB 3SBWC 3I9GH 4LOUD 3SE3C 2R1WA 2W60A 4NPYA 5F6HI 5FOBA 1PG7H 5IK3A 1I8LA 1KFAH 4DUVA 1GZPA 4DFIA 2G9HA 1JPGB 4L3CB 1FO0B 1IILE 1S78C 5TE4H 1LMKA 1SY6A 2BP3A 3KYKH 5F44A 4D0BA 3GBMH 4KK6C 1X5JA 4WDIB 4XNMB 1GGTA 1OAXH 2O61B 2EKJA 1OAQL 2R1XB 1V7NH 2J2ZA 2OP4L 1D6EB 4H8WL 3ARGC 5T1LA 1U3HB 4Y4HA 5EBMA 4EI5A 4XB8A 5HYJE 2BCKA 1JNHA 4TUKH 4FXLA 1QOKA 4QGYA 1S5IL 4KRMB 5MERA 1R5IB 4QLRA 1BPVA 5SX5H 4PS4L 1NUDA 4ONFH 4Z0XA 5CINH 1G9MC 2EDXA 3Q5OA 3FQWB 5FM4A 3U6RB 5L2KD 2VDNH 3ZYIA 3FRPG 1RZ7H 5E4EB 4KROD 3KYOB 1MH5B 4YXLH 1RMFL 4XBGA 5B4MD 1JZ8A 1P84K 5C9JA 3Q0HA 4Y4KB 3WIIH 1LO2H 4X6FB 3K7UA 3CFEA 3OGCB 4DGVH 2GTZB 2JK5A 1CTOA 1EH9A 4Y1AE 4BZ2H 2ZCLL 1NCWL 5B38A 2AEWA 3RPIA 4U1GB 4LHJB 4YC2B 3BI9X 2P7TB 2RGSA 3S5LA 3TT3H 1QLEL 2DQEH 3MLSH 4LPXA 3SKMA 5B3JE 4ZUVB 1AXSA 3QJHB 1AD9B 1RULL 4N9OB 3F58H 4JFOB 1EHLH 4X7DC 2UWEE 3K3QA 3TA3B 1GAFL 4Y16B 3L1OH 3ZSSA 3QISA 3GKWH 4K7PL 4TNWF 3UBXI 3CDFA 1T21A 1JGVH 5BZDB 1QFOA 4TVPL 4K9EC 3RKDD 4OLUL 3BDBA 4PGDB 5IW1A 4HWZB 1AXTL 3OKOA 2DDQL 1HHJB 5CP3H 1UZ6F 4CVUA 5GHWL 2PNDA 5CEYB 3BH8A 3JV0A 3MRQA 3TN0A 1ADQL 3STZA 3P4OB 2VDQH 4ZFFA 4LLAA 4JRYA 4HUWA 2AJYL 5AG9A 2CDGB 3GSUA 1NCCL 5T1LD 4Y4HD 1T2XA 2MOVA 5J9PA 5IM7A 4HFWA 2FEDD 1ZAGA 4OD3H 4EI5D 3I75A 1AC0A 4GRLA 2LABA 3VMPA 2FNBA 2QADC 3WSQH 1Z0MA 4GKOA 4MQ7B 5J3HC 4Z5RB 1KCUH 1W0VA 1ODAA 3B83A 1I1FB 3P0VL 5E6ZA 3TJHD 1HYSC 1LILA 2ITCA 4TQEL 1R0AL 1LK2A 1KLGA 3BIKA 4PGEB 2DMKA 3WO3B 3QDMA 5C71A 5DXWA 1MIML 3VG9B 5GSVA 3GMLA 3T0VA 1RAMA 4IBLT 3DETC 5BRZA 2WBKA 2X4TB 4GFTB 2E7MA 4CW1A 5JW4Q 3CK0H 4HCRL 3Q6GH 3BRDA 5D2LA 5HGHA 4ZO7A 3WS3A 5DC0A 3K4AA 3QUMH 5I30H 4PJGE 5CJQL 5ADPL 4U49A 5HGAA 3DI3B 3QUYC 1AGFA 2ZPKH 3V6ZB 3O4LB 3FTGA 3STLA 4R0LA 5FOJA 2D31A 4L8SB 1UADC 5A16B 5A3ID 5FYJL 3U7AA 5EWIL 5LJYH 5C2BH 4X99B 5FO7B 4M9OA 4HAFA 3TO2B 3HE7C 4CU7A 3KLHC 5HDQH 2DRUA 4NFDA 1F11B 5HHXH 5IOPA 5J1AA 1YPZE 2MKLC 2X70A 4XWOD 2FX9L 2J8UE 1IQWH 4E9LA 3JWOL 1MIEL 5JHLL 1G1YA 3QRFM 5HHPB 3TN0D 3REVA 1IAIM 4GW5A 1RUAL 1T1YA 4JRYD 2IALA 4MA1C 1SEQH 1RZIA 2AJ3B 5FF6A 3F7RA 4GAJL 4NQTA 5FUZH 1DBAL 4GRLD 4K3EH 1MCEA 4S1DD 3BMWA 3DI2B 4L8BB 3SPVA 1T1WB 4WW2B 4ODTL 2R4RL 5L9DL 3QIUB 4FQ1L 4H20L 4R4NC 1VFOA 4OM0H 3TBVB 4LKCB 4CUCA 3T0EB 4PJXE 2F8OA 4P4RB 1XGTB 4EI6B 3NGBB 1IEAB 4NSKA 2AI0L 3C2AH 3D9AH 1NJ9B 25C8L 1HWHB 4UT6L 4LCCA 3PP3K 3RGVC 3QDMD 2AJXL 2EDKA 1A22B 3FT3A 1T4KA 1P4BH 1U8MA 1N2RB 1T1XA 1UQSA 3RIAF 4BFBD 5BRZD 4YHZL 4JZJB 2XRAH 3VXTA 1VFMA 2YRPA 4XMKL 3WXVH 4RISH 3VFVA 1KC5H 5C08E 4JGUA 5D72L 4U1IB 4OKDA 1A21A 1J5OL 1WCBB 4Q7DA 4MNQB 3SDCC 1OARL 2HT3C 3DV6B 5HVHB 2NY2C 3NTCH 1YECH 5GRUL 1CGVA 5IW6B 4R7DA 4J1UA 2B7DT 3ARFB 2YPVH 5EZOH 3VI4F 5CGTA 1RURH 1QSZA 1YQ2A 4OLEA 4EUPA 1KGCE 1G7PB 4NO2B 1N5AB 4H1LB 1LO0H 4P5KB 2VXTL 2CK2A 3V4VH 3NCYP 3C60B 3CU1A 1BGXH 5JTWA 3SJVA 4L3CA 1FO0A 5EZIH 4OGXL 2HFFA 3LPGA 1PDKA 3J7HA 4RNRB 1NMCB 1U8KB 1BZQK 2A6IB 4XGZB 4BA8A 1I1AB 2B4CH 4MJ2A 4WDIA 4XNMA 2O61A 2Q3AA 5BW7C 4M03A 4PJIA 1R3JB 1PQZB 2QBWA 4K94C 3KHQA 1CFVH 1D6EA 3KJ6L 5T33L 2A74A 2YMXL 1C7TA 3CH1B 4ORZC 2ADIA 3QXUA 3S3JA 2W91A 1R5IA 2OK0H 2F54A 1GJIA 4G6AD 3U0TA 4Y19D 3FQWA 3U6RA 2LVEA 4I2XA 5DZOA 3NZHH 3KYOA 1MH5A 1S9YB 3C8KB 2V5TA 1PZUB 4KDTC 4K23H 5E5MB 3MFGB 3WHE1 3OG4B 4Y4KA 4FQXA 3OGCA 4NZTL 2GK0B 5HGDA 1LP9F 1NGQH 2GTZA 3OPZL 3H9YA 5HPOA 4GG6B 2Y06L 5C86A 1I8MA 1KPUA 3CVIH 2I9LA 1IEHA 3EZJB 2KUTA 2P7TA 4NRZB 1B9ZA 4ZUVA 2VJXA 3QJHA 5JDJA 3HLAB 3LRSA 4YIQB 5DD1H 3RP1A 4FQHB 2PYEA 5E7BA 4O58H 1IJ9A 4LLVB 1CD8A 4ZNEE 5IHBA 4HIJA 3FO2B 2AEQH 4RAHA 3ROOB 5SX5K 3LEVH 1F4AA 5BZDA 4GS7B 4P46C 4FS0A 4OCXL 1U58A 3LRHA 1WICA 4ZOAA 5MI0B 3SJVD 3V7AE 4OZHE 4QRPA 5I71C 3BZEA 2O5YH 3UTSB 1C1EL 3EOTL 4IIQA 4JY5H 4IRZH 4AH2A 4AEHL 3OKKB 2IANE 2CDEB 4HS6B 4CBPA 4JLRB 2VN7A 5CEYA 3ULVL 1JPTL 3RWGB 1F00I 3GSNL 3P4OA 4N0YL 1ERNA 4ZPTB 2CDGA 1NFIB 5TF1L 5KW9L 2P47B 4WCYH 3B3IB 2P8LB 4JKLA 3JVGC 1ZANL 2P5EE 3NZ8B 3LKOA 1GC1C 4JO3L 4XNQB 2F54D 3DSFH 3MLVL 1NCBL 4UB0L 4XWGH 4RSVA 2FATL 4JFDA 4Z5RA 1G7IB 1JZ7A 4JHBA 1PKQB 1H3XA 4XC1L 5F7KC 2CO6B 1GC1H 2CK0L 1Q0XL 4AEFA 3BP4A 4G7YH 3RNQA 3I3DA 4UDTA 4APQA 4P2OC 3MV8A 1NBQA 3KG5A 5DDHB 2OJZL 2W9DH 4PGEA 1KELH 4FQXD 4Y4KD 4L4JA 5I9QC 1JPFA 2EXYC 5KTEL 2P24A 3D39A 1YJDL 3B5GA 4TRPH 4D9RE 1N6VA 1A9BB 5LGKA 3LZFL 2G5RA 2DQDH 1Q9LB 1GGYA 4GH7B 4PJBB 2DL9A 2A6JA 4FP8L 2CGRH 5DFVD 1U92A 1A64A 5ANMA 3G04B 3KXFA 1IKFH 5GJSL 1FPTL 1Z9LA 5E2JA 4KK5D 4N0FB 3VXSA 1RK0B 2PYED 3V6ZA 2GUOB 3LKQB 3WFDH 4L8SA 4PRBB 5A16A 2VZVA 5DMIH 2XPGB 1KJVA 5FO7A 4N90E 2AV7B 2OQJB 5J6GB 1CU4L 3V6OA 1RUKL 1J9CT 5AAWA 4S1SL 3QUXB 4WI8A 4QRPD 1D9KC 5IHZB 1BFVL 3MO1A 3MQIA 4P23B 2PCPB 1EEYB 2WUBL 3OAUL 1I7RB 3MBEB 5C7XL 5AYQA 5HDOA 3OZ9L 4PUBH 2Z93B 3P0YH 2EYTB 3C08L 2FB4H 3D0VB 4JHWH 3B9AA 4ODHL 2K7QA 4XCNB 5FHAL 1A6WH 3I6GA 1QRNB 3LQMA 4LLUA 3PGDA 2OX5A 5A2LH 3VXUE 4L8BA 1HYRC 4KJQD 4WW2A 4BK5A 4M48L 3ZKSD 4ELME 4JRXE 1NANH 1P69B 5TF0A 1OGAE 3FO1B 3TBVA 4JFDD 4LKCA 3DX7B 4MAYB 5I15L 1XGTA 1QRKA 1UCBH 3BKJL 2P8MA 3R1GL 4APQD 1C5BH 3UPRB 3MV8D 1NJ9A 2DM4A 12E8H 1KIPA 1OY3B 3GSNB 4K8RC 3D39D 1IC7H 5EBWA 1UKTA 3SQBA 1FQ9C 2W1NA 4ZO8A 4KI5F 2F5AH 3WFHB 3D0LA 3EYOB 5FO9A 4BJLA 1TZHB 1UWGH 4P49A 1FGVL 3MXWH 5EUKB 5J8OA 3KVQA 3LN5A 2RBLA 4ETYA 3VXPB 3KXFD 5C0RL 2R0WL 4MB5A 1EUTA 3SDXF 1OL0A 4CN4A 4F80A 4NUGH 3NCFB 3VXSD 2CLVA 5D4QA 1CFTB 1T03H 3INUH 2J4WH 1WVZA 5BS0B 3LV3B 4XMLL 4DW2L 4LHQB 4NCC2 1JJUA 2HJFB 4NC0B 1JHKL 4CKVX 1KJ3H 1G7PA 5FKPA 1KXQE 4ZS7H 2YA2A 4HKBB 5ICZA 1KJ2L 1MNUH 4KZDH 4JDZB 3TCXA 3NA4A 3NABL 5JQHC 1G9NH 3FONA 4HUKB 5ESAB 1UENA 1IVLA 3PP4H 1Q1JL 4U1SA 4U1NB 1TITA 1U8KA 1KLFA 5T5FL 3S36X 2BY3A 5CJ5A 1QYGL 3PV6A 4OF8A 4P57B 4UBDD 1RUQL 1XIWA 1ZGLB 1PQZA 3RAJL 4WWKC 1S7VB 5T3XE 3OWEA 1CLZL 5CHNB 1MHPL 3SKOB 4UV7L 1NLDL 3OR6B 4OF7A 3E6HB 3L3IB 4KKAC 1YY8A 1N7MH 1QBMH 2EZ0D 3CH1A 5ALBL 1LD9A 3T04D 4LSTL 1LDSA 1OPGL 2BVTA 1MCDA 4XP1H 3X13A 2NY0B 4YUEL 3TGXA 1RIVL 4U0RC 5DC4B 4OGYH 4ZTPH 5B8CC 2X05A 5J6HB 3IKKA 1S9YA 2FO1A 4DEPC 1N5YH 5IV2A 1J86A 4KU1A 5BMFH 1JYWA 2LAGB 3LMJH 2AJUH 1MCWM 1QFUL 3RZCC 4WFHD 2AQ2A 3CLEL 5K9KB 3BQUC 3JZ7A 4GG6A 3CLFH 4U1LB 5E24E 1XR9B 5J4MA 1CLYL 4PJFA 3IFNL 1T66D 3GSXB 5E99H 3VFGL 2YHGA 5DD5H 4Z78B 5DRWB 1MJJB 3HLAA 1BF8A 4YIQA 4GG8B 5IVXB 2VDLH 3BXNB 3QJFB 2R4SL 1QFWM 3TWCH 5I74C 4LLVA 4XXDB 3O3AB 3UTQA 3ARBB 4X7FC 3KPSB 3N1GC 1AO7B 4G6FD 4X9GA 5I2IB 2I07B 1VESA 3QO0B 1T5XA 1W0WB 2OS7A 5D6DC 3RPKA 4G6JL 1A4JB 3U7WL 3UTSA 5TQ0H 4ODXB 3BKYH 3HAEA 5TDOB 3T09A 2CDEA 1DQDL 4HS6A 1AHWB 1XIWD 4JLRA 4PJDB 5C0CA 3RWGA 2A0LC 3X3FL 3OKNA 1BIIB 5CSGA 4ACPA 3LDBB 4G8FB 1U8NB 3U0PA 4JQXC 4MXQD 2Y25A 4A6YB 1CE6B 3PWUB 3ALPA 2P8LA 5CILH 2H6PA 5LVEA 3IJSB 3MOAL 4HK3N 3UTPD 2HVKA 1EJ6A 1EHAA 4LPWA 1KJ2B 3RDTB 5SWZE 1CR9L 4Q9RL 3SDYL 1F3DJ 1VEPA 1O0VA 1RQ5A 5E8EB 3RVXD 1OCWH 3Q1SL 3R06B 2Z9TA 3KPPB 3EUUA 1FE8H 3BH9A 4XTRD 4OCWH 2E7HA 2L7UA 1BIHA 4ZDHB 4BUGA 3MZGB 1WFOA 2XA8H 3PHQB 4FXGA 4M7JH 1IC4L 5GRVL 3WNOA 3ZTNL 3ARZA 1K6QH 4L4VB 3DO7B 2HLAA 1OTTC 4FQ2L 4JAMB 1A9BA 4XCYB 5K9OA 3RI5F 3ZL4H 1J1PH 1Q9LA 3QXWA 5HGBB 2OL3H 4JPIB 5HPMB 3AY4A 3TNNB 4MA8H 3J8F7 2V2WA 2W0LA 3VXOB 4XVTH 4TULH 1ROWA 1K4DA 2Q8BL 2VLJE 5TGBB 4N0FA 4BSWA 4LPVA 1TVHB 1IKNC 1FLTX 1QFPA 4UTBL 4YHNA 3OKYA 4KJWD 4I3GA 3CAFA 1NGYB 5CJOL 4JFFB 2XPGA 3MLTB 3ET9F 2R29L 1JZ3A 3CFBB 3W82A 3ILQD 3C9NB 2GTWB 1HKLL 3I6KA 5AUMA 2WQRA 3UTSD 2E9BA 5IHZA 1A6TB 2PCPA 2YD9A 1I7RA 3MBEA 4G43A 5FGSA 4HXAH 5C0CD 3P73B 3B5HA 1I4FA 3ZKND 1P5UA 2YD8A 3D0VA 4JN1H 3VWJC 3B2UC 1ED3A 3QUMB 3A0OA 5M95B 3I2CH 2JJSA 3LKNA 2EE9A 3GJEA 4KK8C 1H8NA 3TBWA 3X14A 2X9YA 2I27N 2PO6C 2ZSWA 4E5XA 4R97C 3HZMA 3QXTA 4WO4C 5ACMA 2XA3A 4F33B 3V0VB 1A6UL 1J0IA 5MHSD 3S34L 5JA9A 3QPQD 1VB9A 3MUGB 1A47A 1A7BA 4YBLC 3GNML 4MAYA 4PG9A 5HGGS 2YBRB 4YDLC 1WC7B 5E95B 3L5JA 2ARWA 1HH9B 4DOHE 1IGFH 1MI5E 5D1QB 1HNGA 5HYSA 4LRNH 5EOTB 4Y5YC 4ZYKA 4XCFH 3WFHA 3EYOA 4NRXA 1TZHA 3RBGA 3O2VL 5L0QB 1MWAA 4KWUA 4WW1B 5IF0A 3G9VA 4JPVL 3F7VA 4PJEF 3VXMB 3VXPA 2D9QB 3ZSTA 1UM4H 3HFMH 3HG1E 3L95B 4LFHD 3K2MC 3WIHH 2R1YB 1ACYL 1T22B 1H5BB 5BS0A 4P5TA 5D8JH 3CXDH 1JUFB 3OV6A 3HUJB 4LHUG 4U6VL 2HWZL 4PB0H 3HNTH 3QNXB 1LK3L 5E8NB 3SKJH 1A7OL 3VI3F 1OTSD 4HKBA 1CS6A 3QYCA 5DJZA 1C8PA 2EYRB 1ZWIB 4PJ8B 1KB9J 4PD4J 3MBED 5ESAA 3MRRA 3RVTC 5JW4R 5C0AB 1XF5A 4M93B 2DICA 4Z7WB 4XZUB 3MYJA 2YUVA 2VITB 3QWOB 4P57A 5D96C 2V5SA 1K5NB 1S7QB 1Z3GH 2CJUH 1S7VA 5GZOD 3EO1B 1PW3A 5CHNA 1URLA 3KAAA 3SKOA 2RFXB 4L8DA 3E6HA 3L3IA 5EUOF 5K33A 5AG8A 5BCAA 2XZQH 2FO4B 2PW1B 2NY5L 4MAYD 3GB7A 4W6YB 4WFEE 4F2MA 5IQ7L 1KN4L 2AP2A 1XCQA 1T2QH 4IMKA 3U79A 1F4WH 1GRWA 3MODL 4LSSL 1I9RL 5C07B 2FIRT 1ZVSB 4XNZB 4PJ5B 5J6HA 2Y6SD 4Z7VF 5KVEL 4PJHF 4U05A 1FJ1A 2FWOA 2HT4D 1DQTA 3MV9B 3UBXG 1MJ8H 5I19H 4ORGA 4C83B 5KN5A 1R5WA 4R3SB 1X5AA 3O6LL 5DJYB 3JWDL 3CSYB 1K3IA 2XTJD 5I1CL 2A9ML 1DQLH 4OCSH 2HG5B 3QDJB 4HBCL 3KPLB 3ARXA 3SKNA 2GSIB 4DVRH 1J05A 1UYWH 3G5YB 4IOIB 5BS0D 2VUOA 4P5TD 4Z78A 2VRAA 1QHPA 4LLQB 4JKKA 1UCTA 2OZ4L 4YHYB 3T77A 3QJFA 1CXFA 1T7YA 4NWUL 4EXKA 2GHWB 1XFPA 4XHJC 4XXDA 3BJLA 1ZEAL 3BVNA 3ARBA 4KV5F 3KPSA 2JKXA 1MLCA 4FQIH 1CLOH 1FZKA 1A7QH 4FG6C 2XY2A 3ZYOA 3DSNA 2A77L 3GSOB 4R4FH 3M1BA 1JL8A 1FG9C 1ONQA 5C0BB 5BVPL 3RNKB 1V3JA 5J06A 1IM3A 1SM3L 1RZ8B 3TT1H 1TZIB 5AWNH 1YEGH 4OCYL 2H2SD 3ISWA 4OZGE 1S3KL 2A73A 4PJDA 1Q94A 1JI1A 3VCLB 1OGTB 1UXSA 2NY4C 4G7VH 4P48A 3BJ91 3V52L 4A6YA 1E6JL 3LHPH 3EFFA 2R2HB 3OJMB 3FB5A 2NXYD 5J13C 3HMXL 4FTVB 3UYPA 5EFIB 5GGSB 3QIBA 1KENL 3RRQA 3H0TB 4EDXA 1GGBH 3QDME 4MJ5B 4N8VB 3JV6B 3R06A 4HQQH 4RQQB 3LEYH 1J0HA 3KPPA 3BAEL 3WLBA 5D7IF 1HILA 2CR6A 4X6CB 5JHDA 3LRGA 5CP3A 3G6JE 4OZIB 2COQA 4PYHA 4UINH 3RWEB 3PHQA 5I0ZA 5CCKL 5ETUA 1AY1L 4Y5XB 4OFIA 5IFHH 3O41B 3RL1A 3DO7A 1FGNH 3T08A 4HIIB 5C09B 1EPFA 2QQLL 5BXFB 1IC5L 1DSFL 4JPIA 4XPHH 3X3GL 5HPMA 4MXWL 2HMIC 1UM6L 5I76B 3KYAA 3QAZC 4ZPVB 4FQCL 5GS1C 1TVHA 3NMEA 1E6OL 2DQUH 1UM5L 5CWSA 3ARBD 3FRUB 3MLTA 3KPSD 1A7NH 3V7AG 2YWZA 5I8KL 3VH8B 3IXAB 5I1KH 4QRTA 4X8JB 3C9NA 1B0RB 5TJWK 1EJOH 4K7PX 3CFJA 1FYHB 3QP3A 1BZ7A 3BN9C 1D5ZB 1A6TA 2WWKT 3FQNA 1S8DA 3BDYL 2IBZY 4O2EB 2CR3A 5F3BA 3AC0A 4Z0BH 2VXVL 5F1IB 3O2DL 1II4E 3IU3B 4YBQC 3QUMA 2YD7A 3V4UH 1E27A 2WWMC 5DJAB 3RY6A 3BUYB 5K9JH 1KLUA 2P8PB 1F3RB 2ENSA 2X4UB 1CBVL 1EEQA 3LKPA 3QIBD 4Y19E 4JHZA 1U8JB 1YY9C 2HLFD 3QUYA 4M62L 1YN7A 1INQA 4M5YL 4BQ6A 5BV7L 1IFHH 2YPKA 5C6WH 4K3JH 3VJ6A 5IB2A 3L3HA 3HRPA 1EBPA 4IDJH 3QQ3A 5JHDD 4OKVA 3HZVB 2FGWL 2EDQA 2PUQT 5F1NA 3GMRB 2BVQA 2VR9A 2DQCL 2NPLX 2P48B 5D1QA 3RVVD 2KZWA 5EOTA 3PABA 5E2UH 3U7YH 1AGCA 4TOYH 1FZOB 4WW1A 5L6YH 1IGYA 3DV4B 3VXMA 2O5ZH 3UTZA 1P4LA 4N5UA 4YO0B 4XP5H 1CDGA 4LSDA 5E2VL 2VN4A 5JW5B 4G5ZL 4YLQT 4HT1L 2QADD 2R1YA 2OR9L 4OFVA 4AEIL 1RZKC 1PX3A 1H5BA 1T22A 4LVOB 3GIVB 2DYPA 3IFLL 1JWMB 3L3GB 1PBYA 4X6EA 3B9KB 3HUJA 4C56E 5IVNA 3KR3H 5KSUB 5F96H 1RZKH 5E8NA 5KANI 1M1SA 1AQDA 5EORH 1EO5A 3IDYC 2F8XC 4PRIA 1ZWIA 1LP9E 2VXQH 4H26B 2ARJB 2VLKB 2Y36H 3FB6B 5DO2C 3QFJB 5ERWB 2DI7A 4XZUA 5DWUL 2OXGA 3QWOA 4H0IA 1BX2A 3IDNB 3PWJB 4R8WH 3SE4C 3T0XA 1F2QA 4GUPB 5EU7E 2VDML 1C5CH 3EO1A 3SDCA 2FL5B 3QUYD 2RFXA 4PGBB 5L7XH 1UB6A 2Z35A 3ECBA 4KJYA 2AKRA 2FO4A 4JFPB 2PW1A 5IBUB 2CRZA 2LTQB 4MCYB 4NGHH 4ERSH 2OMBA 1FYTA 3GMPA 4F7EB 2VERN 1DBKH 1QKZL 2YXFA 1DBMH 4JKPH 3WFZA 4ZSOE 3N1PC 4U1JA 3U9PL 1ZVSA 5D1QD 4ALAL 1ZHBA 1GCFA 2ENYA 4KUCD 4UILH 4ETQB 3MV9A 2UY7A 4XAWH 3ULUD 4LIQL 1UH2A 2H2PC 1HN1A 2AVGA 5ID0B 4R3SA 4DZ8B 3RIFK 5T1DH 4BQBA 1BM3H 3CFDB 3SGEI 4L5FH 3VXMD 2NY7H 4HKZB 3I50H 2NZ9D 4QTHA 2H32B 4LEOB 2ED9A 2EEAA 4P3CL 2QQNL 1MREL 1BBJB 4IOIA 2RQ8A 4MNGA 1BFSA 2XACC 3JTTB 2DYPD 1HHGB 2CH8A 4AL8L 5ACLA 3SOBL 3X12A 3ALXA 4BQ9A 1X5ZA 1XF3B 3GK8L 3VMNA 2AJZB 2FLRT 3KPQB 3CX5J 5INDB 3OKDB 2EYSB 2BNUB 3BIAX 5FB8B 1I85C 1LEIB 4PRID 3MLYL 4XI5C 4JJ5B 4NWTH 3V6FA 3GSOA 2X44D 4DUWA 2V17L 3RJDA 4WFFE 3VD5A 4EN3C 1I8KB 3RNKA 3OXRA 3A6OA 2G60H 2LV4A 4Q9CA 1RZ8A 3CFCL 1TZIA 5KZCB 1VACB 5E03A 2AS5M 2DQJH 5GS0L 3S4SB 3V4PH 1UJTA 3VCLA 2ESVB 4RWYH 3C6LA 1OGTA 5D5MB 1V8HA 5EC2B 5M94B 1MHEB 3SDCD 3BFOA 1NCDH 2E9JA 3QULB 2NY2D 1IGIH 1M7DB 1U3JA 1R3LA 5D2LF 4FTVA 1R3HA 1YEIL 3DYPA 5GGSA 5TDPA 4UOW1 1W8OA 4R90H 3H0TA 3KS0H 5CGMA 2WLZA 1U8HB 1FYTD 2V6HA 2YPLE 4ELKB 4BQCA 4N8VA 2IJ0C 5J0BA 3IU4L 2BMKB 5J57B 4RQQA 2FHFA 3UC0L 4NQXA 2ZCHL 2HTLC 3MCLH 2FR4B 1ZGLM 1KV3A 2NZIA 4XCCL 2CRMA 2X4SB 1DBBL 3MV7E 4X6CA 3MJ7B 3MV9D 2F53B 4OZIA 4ZFOA 5FUOH 3R0NA 1JN6B 5DHVB 4LAQH 4Y5XA 5KS9A 2V7NB 4WTWA 1A5FL 5D2NC 4Q2ZB 4PJAA 5IB1B 4OZFG 3O4LE 5BXFA 4JO1L 3QHTC 5HVGB 1ZLSH 4L29A 2W0KA 1UH3A 5I76A 4L1HA 1U95B 5CUSL 5KSBB 4WV1A 1LWRA 3DYOA 2XTLA 4NZJA 4EIZC 5IHUL 3BZFB 4I8DA 1TIUA 4WI4A 1KYOJ 5EZLA 2IH3B 2N7AA 2HN7A 1U8PA 5DT1L 1KB5H 3BYYA 1IZJA 5BO1H 4AMKL 2X4OB 1P6AB 4DK6A 3ZE1E 4GAFB 1GZQA 1TCMA 3RWHA 4NZUL 1OP5H 1FLRH 1OAZH 1YNKH 5GGUB 1ZA6A 1KIUA 2C9AA 5KSAB 1D5ZA 4P2OA 4M02A 1C7SA 1OSPH 2A9NH 4IHOB 4KAQH 3RU8L 3V5KB 4IMLA 5IJKC 5HY9A 5DF0A 4O2EA 3VGHA 3HZKA 3C6LD 4TVPE 3VA6A 4FFVD 3T0EE 3LSOA 2J8OA 5DJAA 4TSCL 1LE9B 3MBXH 3U46B 5GGTH 3G6AA 3BUYA 1NGPL 1TLKA 3HE6C 2UZXB 4QHKJ 3TVMB 1BVLB 5FK9B 2X4UA 2JB5H 4FTVD 3RTQB 3FOMB 4FZEH 4JO4L 2VSCA 4EVNB 3MC0A 4MJ4A 3TPKA 4A2MA 2D4FA 1A7RL 3HR5B 2D7MA 2IPTH 5ADOH 3MLRH 3EFDH 4XAKD 4F57L 4ZUWB 3HPLB 4G8GB 1LO3H 3GIZL 2R56H 4KKCC 3HZVA 1AR1C 3BT2H 4MNQE 2GCYB 4P9MH 1OP9A 3PGCB 3X11B 4HKXA 3A6CL 3BPCB 4NNYB 2XZCL 1JIBA 4EJ1C 1MCQA 4QOKB 1FZOA 4LPCA 5F21B 1X44A 4ONHB 4CMHC 2QL1A 2XQBL 3GJFH 3AAZA 4PGZA 5E5RB 1ZS8B 1S9WB 1LE5A 2IFFL 4ZQKB 2I60L 3CVHH 4S1RL 5JW5A 5EC1B 2VR5A 2HT2D 4PJIF 3DUSA 2R69H 2NX5B 1FV1B 2HH0L 3NCMA 4JPWL 5JR1H 4U0QB 3L3GA 4FQLL 5CJBA 3FQRB 3UPCA 2FJFB 1L7TL 3T0AA 1TXKA 5KSUA 1FRGL 1YUHB 2UYLA 1EHXA 1VKXB 2P44B 3PUCA 3FOLA 3BX7C 3SCMC 1X5KA 3LS5L 1HHIB 4P2OD 1RZJC 3DJ9A 5MEOB 5FYJE 1U9KA 4NQCB 5C0DB 1RJZA 3P0GB 3QSKB 1F13A 6FABL 1X4YA 4LGPB 2EXYD 4WUKH 4YDJA 2F19L 4HZAA 5EO1B 2EDBA 4M3KB 2MJWA 4PV9B 1PG7X 5JZ7D 5KSVA 3H42L 1JGEB 4M6ML 2FJGA 3SDDC 5IMLA 4HMEA 1MFBL 4YJZL 2FEEL 2FYYB 3BP6B 1SMOA 2NY3C 1T83C 4U6XA 5L8JB 1SVCP 2C5DC 3U9UA 4RMSA 4TUJA 1NAKL 4JFPA 1D5XB 3WEXB 4Z95H 5IKCB 4IEFB 4JREB 3OB8A 1EHNA 5EU5A 2R9HD 4OUOA 4XC3L 4X4XA 5LGHH 3CZFB 2Y1VA 4F7EA 3LPWA 4RDQF 2N4IA 3GZKA 3QCUH 5D7JB 4Z77B 2FJHB 4UMGA 3RVUC 2CXGA 3SGJA 2LQRA 3HNVL 4ETQA 4LL9A 1T7XA 1CFQB 3BE1H 5GRJH 1OAKH 4DZ8A 3C09C 2YUWA 3ZDYE 4NKOB 2NXZC 5DMGC 3SEPA 4F8QA 3EBAA 2R23B 4E0RB 5H35A 4OD1H 4PP2B 4V2CB 3IDJB 4WWKA 4X0KA 5E00B 1YN6B 1B0GB 1YMMA 3JTTA 1HHGA 3JWNC 1N0XH 5FGBC 3UTSE 5AZ2L 1BLNA 3EIFA 2VAJA 3SDAC 2AJZA 3KPQA 5F7WC 1M7IA 1HI6B 5INDA 2EYSA 1LO5B 1XH3A 5FB8A 4YDKH 4KQ4H 2CMRL 4W4OA 5EOCH 4W68A 1P7QA 1XMWA 4JJ5A 1F4YL 4WEBL 2YD5A 3T0BA 3MNVB 1I8KA 4JDVB 5IB4B 2FZ3A 1Z5LA 3QH3B 1EAJA 5EDXA 4WHTA 3MRNB 1ZSDB 3T2NL 3RZCA 1WWWX 5DSCB 2OJEA 1P7HL 5EC2A 3IKCB 5KBNC 3UJTL 4Y5VC 1L7IH 1XF4B 4M61A 5IT2H 1PKQE 1MRCL 4X6DB 4PG2A 3RHWK 3QI9B 1T89C 4DGIH 3EJYD 4ZAKB 1M7DA 3NPSB 4BH8B 1XGRB 4KKLC 5TE6L 1QBAA 4RGNC 2D3VA 5JXAH 5E9DA 4ZUSA 5T3XH 4QXGL 3K8MA 4DK3A 1HDMB 3H9HB 4L4TB 2FR4A 3FB7B 1CZ8L 1ZLUH 3QPXH 3QEHB 4PJBE 3MJ7A 3N0PB 4X7TB 5IESH 4YWGH 4V1DA 1PJ9A 3WJLA 1YQVH 2BVOA 3DMMB 4Y2OA 1JN6A 1XZ0A 2WZPD 1MCKA 3MFFA 2Y07L 4OQTL 2YRLA 4X7SH 2ZUQC 5IB1A 2D0GA 1A8JH 1CFNA 3PHSA 2QHRL 4HC1H 4HZLB 5I6XC 1GPOH 2BY1A 5TQ2L 1C16B 3TYGH 4ONFL 4WWKD 2YKLH 2APVA 3PQYA 3EDKA 4ODSL 3S88H 1YMMD 3GSWB 4H5SB 2VDNL 4DKEL 2OTUB 4O02H 1EO7A 2DI8A 1S9VA 4OSUL 5KSBA 3HI1A 3U4EB 1TCRA 1G9ML 1IAIH 4NN5B 2IH3A 2BK8A 4P2QB 3PGFL 3RX5A 4PJ7B 1XGYH 4WW2F 5EOQL 4DGVL 3HPJB 1P7QD 3HC0B 4OZFH 4M7ZB 5KG9B 1I9JL 2X6MA 3WN5C 1RPQA 1QRNE 3QFDB 2ZKHH 4JG0L 1QEWB 2ERJC 2X2YA 4IHOA 5I1DB 1I7ZB 4WU5B 4JE4B 5CLWA 2OL3A 3RZCD 1CDCA 4OLVH 1GOHA 1QBLH 4CVZA 1E28A 3UP1A 4WNQA 5HTSA 2BX5A 3KLAA 1LE9A 4ZTOH 1JGVL 3NFPB 1FNSL 1JV5B 2X7LA 1U8IB 4Y1AB 4PLOB 4RAVA 4EVNA 1K8DB 2RHEA 3ULVE 2DKMA 3P9WB 1G7HB 5E9DD 4K9EL 3WBDA 1B88A 4QKXB 2V9TA 4ZUWA 4NQEB 1U8LB 1X5YA 2C7UA 1NDGA 1TVDA 4V1DD 1UWXK 1OP5K 4U7KA 2GCYA 4HAGA 4U2ZA 3IFPB 3PGCA 3X11A 1DQML 4NNYA 2B5IC 5I73B 4NNXB 2A0LD 2EICA 4QOKA 3PQYD 2W9EH 5LKNA 3L7FB 5GGVY 4HXBL 1ZS8A 5B39G 3BN3B 4JN2B 4XPGL 1ZMYA 5CLTA 4ZQKA 1OAYH 5CBAA 5FKAB 1HOCA 5DUMH 1FBIL 5EC1A 3T2OA 1IGMH 5E2WL 1GGCH 3DXAA 4LOUC 2HFGL 3P11H 3IAPA 3FQRA 2FJFA 1D6VL 2Y72A 3F5WB 3VRLE 1JMXA 5DFWH 3W2DH 1VKXA 4R96B 4HX1B 3ARGB 5I30L 4Q9QL 5MEOA 3DROB 3CMOL 2P43B 5C0DA 2B39A 3BESR 1ES0B 3FO9B 4UV4L 3OMZA 4KI1A 3MJ8B 4Y5YA 1AXIB 2NTSP 5C2BL 2IQAB 1A3LL 3HCVA 1IT9L 2A1WL 3IJYB 2R8SH 2ZCKL 1M71B 1NAML 4JFYB 4WWID 3WIHA 1UJ3B 3O4OB 3RWDB 4L3EE 2ATPB 1LNUB 3GJFK 2WLYA 4Z6AT 5EULV 4GG6F 2VABB 1TVBB 5AD0B 4PJFF 1KXVC 4KV5E 3QUKB 1V3KA 3BZDA 4PJGB 3DYMA 4GBXB 3IDXL 4NKQB 2VDKL 1U8OB 3QO1B 4Q97A 2JB6A 5KJRL 2B8OT 2OSLB 3AM8C 1BOGB 3MGTB 1U3YA 4KROC 1FNFA 1QACA 4G6MH 2UZIH 1NFDB 4ODVH 4YHIB 1A6AB 5B4MC 2XQYG 1VEOA 5CD3B 5CSBA 4WY7L 4F3FA 5MENE 1CFQA 5GGRB 5HSFA 2F8VA 2R0KL 1X7QA 1OQXA 2B1AH 4OJFH 4QOKD 4LHUB 2Z92B 3L3KB 1INEH 1OD7A 4KRPB 1KTLB 5IVXE 1EEZB 4UUJB 4XCEA 5CJXC 1JGUL 4Y4FB 3LKRB 3VE0B 5F6IC 5J11C 2A6DB 1JWUB 5EU6B 3V5DA 1AO7E 3GRWH 1YN6A 3K4ZA 1B0GA 1MFDH 3M17B 2YS4A 3DXAD 1UG9A 1KTDA 5E08L 3L3DB 3JV4A 4HH9B 4LNVA 5FHBH 3NFSL 1EO8H 1I8LC 2AABL 1N3NA 3D3VB 4K3GA 3MLUL 5F7FA 1TETH 1CIUA 1LO5A 4ODUA 1RSFA 3JBG7 4O4YL 3RKDC 5I1EH 5HHMB 4N5EC 3CPLB 4YXKH 3W9EB 2H3NA 3E2HB 3MNVA 1LEKB 4NO0A 4XH2B 3QH3A 3RL2A 3MCKB 3WIFA 5AYUH 1P7KA 3MRNA 4WUUE 3UTOA 5TE7L 1RURL 4Y4HC 4UDUA 1FL3A 3HRZA 2FEDC 4EI5C 1XF4A 3WL9B 5FYJU 1LO0L 4FQQA 4X6DA 1MQKH 2CIIB 5JUEH 1I9IL 3UBXB 5DYOB 3EYQD 4BH8A 1XGRA 1BGXL 2ADFH 4JFZH 4JGJA 3AXLB 1UFUA 5EZIL 4U6YB 4MAUH 5BQ7A 1KIRB 1H3PH 4X83A 3S36H 4L4VE 3TJHC 2MQCA 2XNAA 1MCRA 5F9OL 3B2VH 1HDMA 4L4TA 1A1MB 5I8CB 2LE9A 1DL7L 4MYWB 1YEJL 3VFUB 1AE6H 4FABL 2DJSA 3LQAC 1MF2L 1NAMB 3DMMA 4AIOA 4TNVK 4QEGA 4Q58C 1CGSH 4K94L 7CGTA 4BYHA 3O3DB 5L88H 1JWSB 2OK0L 2XWJA 3O6KL 4MB3A 1OHQA 2OR7A 4JFFE 2O5XH 5DK0B 4H5SA 4XVJL 3BD4A 1VHPA 4LLDB 1EXUB 4IS6B 3D2UA 5A3IC 3FB8A 2JCCB 3U4EA 3AGVA 4GMSH 3DLQR 1OLLA 3GBNL 4QRQA 3EYFB 4N0CD 4Q9BA 2X4QB 3HNSL 5FECB 2F58H 4XWOC 3HPJA 1I7TA 3HC0A 4Y2DA 5HYJA 5DQDH 3WNLA 1VSCA 4ZUUB 4JEGB 4NO0D 1S7UA 2KQMA 3TN0C 1ZLUK 1WZLA 3RX7A 3D69A 1QEWA 3AU1B 4H25A 1U36A 1MCOL 1I7ZA 4WU5A 3GBLA 1P2CB 3UDWA 1BOYA 3H3PL 3RA7H 3EGSB 4GRLC 2FIKA 3QHFH 4IJ3C 1P6FA 4S1DC 3L9RB 1MFCH 43CAB 2AEQL 3SO3B 1W72H 1JV5A 4LF3B 2D9CA 2Z4QB 4CMMB 3DX6B 4RWHA 4Y1AA 4RRPG 5MEQB 3CSBA 3PHOB 5GS1A 4OB5L 5IFJB 4MWFB 4QNPE 1L0XA 3VXRB 3O0RH 5ISZB 1Q9WA 4XHJD 3DTXA 4H0GA 1BQLH 2YC1B 4L4TD 3BP7B 1U8LA 2UWEA 1JTTA 4BKLB 4JPKH 5IP4A 3DMMD 3NA9H 5KANG 3O6MH 3IFPA 1WSST 1EFXA 4XPTL 1GIGL 4OZHB 2VC2H 4MD5A 4XWGL 4FZ8H 2VLME 1U6AL 3O3UN 2J3SA 2CKBH 1GC1L 3IJHB 2IANB 2PTUA 2G75B 4R0LC 1RJYB 1B2WH 3D2UD 4MA3B 4JGMA 3WDHA 5FKAA 1P4IH 4Z7UB 3NAAL 3FO0L 2R2BA 4GMTL 4XBPA 2ZSVA 3O3EB 4Y2DD 5HYJD 3O45B 1E4WH 5C0AE 5JOFA 4BSVA 4QHNB 5HHQB 4Z7WE 1LGVA 3U0WH 4O2CB 1K8IB 1DN0B 2DQFB 3DROA 1NGZB 5FYKL 1Q9KB 3LOWA 3GSVA 2ITDB 1T80A 1HXMB 5J12B 3GJFB 4YFDB 1N64L 5CEXA 1MAMH 1EFQA 3IJYA 2A2QT 3CVHB 1M71A 4LLYA 4JZNA 4Y1AD 4JCLA 5FDWB 1JTPA 1H0DA 1LNUA 2OMNA 5IGXL 2VAAB 3T3PE 5GS2H 4Y0GA 5EBGA 5J1SC 2VABA 3PWNB 2NR6D 5C07E 4PJ5E 3QUKA 4PJGA 1QHOA 5FO8B 4G6AC 1QQDA 3QO1A 4OIIH 1WITA 5E4IA 5SV3A 1BOGA 3MGTA 1HQ4B 3ILPA 2ZJSL 3WFBL 2OCFD 3GHBH 3QDJE 1KEMH 1A6AA 3KPOA 4LSQH 4QHKI 2VQ1B 1M6OB 1B4RA 2D7PA 4OFPA 2GFBA 1EFXD 1JHLH 4M1DH 5IFAH 1YPZA 1QFWH 4I48A 1JVKA 2J8UA 3I6LE 4LHUA 4PJCB 1MJUH 1KTLA 5ACZA 5F72S 4NNPL 3V0AC 1QFHA 1EEZA 4H1LG 5D70L 5E70A 3L5WB 3S35L 4NO5B 1MPAL 2GSGB 4R7NB 4P46B 1G7MA 2V5MA 3VE0A 4HGWB 5HYQB 5I71B 1C5BL 1JWUA 2Q8AH 2DMCA 2YD4A 1RZFH 4PJDF 3I02A 3C5SA 5DTFA 4P3DB 3TH4T 4RFOH 1CVRA 4GJTB 5A2JH 1CWVA 1IC7L 3L3DA 5C0BE 3EO9L 2B1HH 4XX1E 4YX2H 4K8RL 2ATKB 4ELMB 1MJ7H 1VA9A 3WHXB 3B6SB 15C8L 4PJXA 1A14H 5JIKA 2J88L 1FC2D 3BW9A 3QIWA 5I1GH 2YUZA 5C0IB 4QCIA 1P5VA 3BEVA 5DS8A 3W9EA 1MCPL 3P3YA 1T6VN 4YNYB 3HHRB 3INUL 3HZYB 4JHAH 4OV5A 5DEGA 3W5MA 3I84A 3MCKA 3IDMA 3OJDB 1U3HC 2QHLA 2IMNA 3L7EA 3ARDA 4K7FB 3TM6A 5C08A 2CIIA 4HD9A 4BH7A 4LU5H 3UBXA 1YMHB 1QLRB 3LIZL 5I9QB 5DYOA 2VOTA 5DMKB 4HUUB 4JO2L 1TQBB 1FVCA 4ODWB 4AZ8A 3AXLA 5C0GB 1S9KC 5IB5A 1ULVA 2R2CA 4HMCA 3WV0A 2X1PA 5E4EC 1BEYL 5LAXB 3PJSA 4N0UB 3G9AB 4PY7B 5I17A 1WISA 5C09E 5DUPL 2AQ1A 5GGQH 2QSCL 1YEHL 1YDPB 1A1MA 4Y4KC 4FQXC 1FFNB 1RU9L 3QXVA 1AGBB 1YEEL 5D1ZB 3U48A 3VFUA 3UAJD 4LSUH 3HB3D 3VFTB 4MVBD 4LSPL 2CUMA 1SJEA 3KYNA 4LHUD 1NMBH 4M8QA 1CFSB 4KRPD 1OM3L 4JQIH 1WGOA 4K55A 4YC2C 1ZT1B 4LBEA 4WI3A 4QHUB 5DFVC 1JWSA 3K80A 4AENA 2CKNA 4XP1L 1D9KB 3GFUA 3DECA 5DK0A 2JELL 1CL7H 4KK5C 3AFLA 5GGVL 2GITB 4KQ3L 4LLDA 4PRAB 4CJ0A 2DKUA 1A6VH 1HWGB 2X1XR 1PVHA 4CL7A 3QUZB 4MMZC 4YHKH 5LCVL 1NL0L 2ED7A 4KTEL 4CJ1A 3PWVA 3D3VD 5FECA 4XNXH 4WHCA 1U91B 2DIBA 5F7HA 3MLWL 4JKMA 1OVZA 3QIWD 2GAZB 4IIQC 4O5LH 2DS4A 2VMFA 4PREB 1KOAA 5E99L 4HUXB 3LKSB 1A9EA 4R2GD 3VFNA 4YHLL 5E1AB 2DLFL 1C5DA 1GOGA 1S7XA 1NCAH 3EGSA 3ARDD 4LVHB 4KUCF 4KJQC 2UVFA 4HWEL 2AXGB 3SHSA 2Z4QA 4HIHB 4MHHG 4CMMA 2IH1B 4G6KH 4N9GB 1KB5A 3ULSB 3L5HA 5IFJA 4X5XA 4MWFA 3MGAA 5F9DC 1CICA 4JFHE 4KKNA 4HUNB 3IAGC 1KT2B 2GYSA 5EO9B 1CQYA 3T4YB 1AP2B 2HKHL 3U82B 4HULB 1T2JA 5D93C 1KGCD 5C0EA 1VFAB 3HUJF 4Z8FH 1H3TA 4H8WC 3PDOB 1GVIA 3VXQB 4ZNEA 4ENED 3EYSH 5CILL 1N8ZA 3KPMB 5F7UA 1OAQH 3LEXA 3THML 2OP4H 2QQKL 2VISA 4D0DA 3BKML 4H8WH 3BEWB 1SYVA 4UZGA 4OZHA 4FFZL 2BSSA 4I5BB 1BP3B 5DVKA 5GGTA 4OLXL 5A43C 2D0FA 5FDYA 1MCCA 4RX4A 5T5NG 1S5IH 2IANA 4L8SC 5ILTL 4HPYL 1JHTA 2VIRA 1FE8L 4PS4H 5D7SL 5HHNB 1IL1B 5E94A 3V6OC 3IDUA 2WINB 4J12A 3O3EA 1H8SA 2VLKE 4LLWB 5ALCL 1JF6A 2WUCL 1X4XA 3O45A 2KDGA 3QFJE 1DDHB 4QHNA 4M9PA 5SWZB 1EZVY 1IGTB 4P0DA 1I8IB 3W39B 1LEGA 1NEZB 2ZCLH 4PRPE 3UTTE 1NCWH 5SX4I 1AJ7L 4W6XB 2Y9RT 4PTUB 4KHXL 1QLEH 5HD8D 1L9NA 4PYGA 3OJ2C 2J6EL 1HXMA 4JM2A 3GJFA 4Q6IB 4OCRL 1RULH 4WW2C 1Y18B 3WKNA 4QRUB 3CVHA 5DJ2A 4NM4L 3QIUC 3WYRA 3DVGB 5FDWA 4YZFF 2XXMB 4K7PH 4DEPB 4CAGA 2VAAA 1MFNA 4F7TB 4JM4L 1S9XB 4TVPH 3NGBC 1CICD 2X4NB 1VPOL 1KCSL 2C1PA 1F3JA 5FO8A 4OLUH 4J3UA 2MMXA 1L4IA 2DDQH 2I26N 3P4NB 3MUY1 3TIEA 2BSTA 5GHWH 1JFQL 4NZRL 2Z31A 1ADQH 5EZJB 2ZG3A 1H3VA 4G9FB 1EGJA 5T1MB 4UQ3A 1NCCH 3SGEH 5DUBB 5I74B 1CXHA 2MFNA 4M00A 4RX4D 2VL5A 2IAND 3PWPB 1DANU 3CXHJ 1T66C 4QHMA 5HVHC 2GY5A 4R7NA 4HGWA 4HWBL 3U36B 3ARFC 4MCZB 5C0JB 3KLDA 4P3DA 1T83A 5DHXB 2VDRL 3P0VH 5I1IL 4KMTL 2Q3ZA 1J1OL 4ODBD 4TQEH 1R0AH 3OKMA 3QRGL 1TTGA 4J3WA 3VXUA 1DEEB 4NCC1 1MEXH 3K2UL 1MIMH 3KNBA 4ELMA 1HHKA 1QLFA 4JRXA 4FN0A 1R24A 1OGAA 3WFCL 5DEFB 5K59E 3EOBA 3A6BL 2BOBB 4H1LH 5DC9B 4I3SH 4CVXB 4HCRH 2ESVE 1AR1D 5D5ME 3HFML 5C0IA 1L0YA 1DZBA 5ELIA 1PZ5A 1XIWC 3CX2A 1JF1B 4JM2D 4NBYB 5CJQH 3RY4A 4X6CF 5FCUL 5ADPH 4U1KA 4DOHB 2Y7QB 4KVNL 4OZIF 4MXQC 2E6QA 3BKCL 3OJDA 3DX8B 3LN9A 3D25A 1TNMA 4UIMB 4D9RD 5FYJH 5KS9F 1UKSA 4R26L 3QXAB 4PJAF 3VFRB 2GJZB 1QSEB 1S7RB 5CP7B 3TBSB 3MLXH 3VDCA 5KOMC 3TFKD 1YMHA 2E7LA 1MSPA 4HS8L 3SGDI 4FNLL 4HUUA 2FX9H 2F53E 3RVXC 4ODWA 2H9GB 1K4CB 1NDMA 5F89B 1PFCA 2XQYK 1QUNA 3TH2T 7FABL 1MIEH 1XAUA 5JNYB 5DQ9A 5IB3B 3FZUC 5JHLH 2EXWD 4MDJB 3GHEL 3SDAA 4HJGB 2Z31D 4XTRC 3WUWB 1TNNA 3PWLB 1RUAH 4N90D 1NGXB 4LCWE 1YDPA 4X5LA 3IXTB 1TMCB 1FFNA 4FA8A 4GAJH 1F6FB 3QQNA 5FA3A 4EOWL 1CXLA 1DBAH 4OLWL 4NHCL 4TUOA 3QDGB 4NT6A 4UOJA 5DD0H 4UAOC 1G6RL 4BZ1L 1JZ4A 1FAIL 2R4RH 5JA8B 5L9DH 4FQ1H 1FN4B 4H20H 2YN5A 4ZD3L 2DQGL 3P30L 5HI4D 3BGFB 2CLZB 3LN4A 3CMGA 4Y7MA 4LIQE 1F4WL 4KJWC 3TC9A 1JRHL 4J8RA 1S7TA 2XKUA 2W59A 3G5VB 3QUZA 2YEZA 2AI0H 4WU7A 3QCVL 25C8H 4UT6H 4PRHB 3VXUD 3ZDZE 2AJXH 1M05A 3ARQA 4GS7C 4JRXD 3RWJB 3ILQC 1OGAD 2FHCA 1U91A 1DQLL 4YHZH 2PO6B 4R97B 4XMKH 4CNIB 5D72H 1J5OH 1J87A 4HUXA 4UIKL 3NBNA 2JJTA 3NH7L 3ZKNC 5LXGL 1OARH 4HC1A 5E1AA 4YBLB 1F4HA 4K3DH 5GRUH 1NBYB 2QJDA 1BJ1H 4YDLB 3ZZ1A 3MRKB 3EOYG 4DGYL 1VADB 4K71C 2AXGA 4HIHA 4G8GE 3MRMB 3QPQC 5LG1A 4N9GA 4YHML 2F74B 4XPBL 2ICWJ 4FFYL 2V5RA 3WFEH 4LLMA 4B7LA 3ZE0E 4OQ1A 3SDAD 1KCRL 1MVUA 1VFBB 1RZGB 2W9LA 4OGXH 3P77B 4LMQI 1JPSL 5EO9A 1HSBA 43C9B 2DD8L 1AP2A 4P2RB 1CDJA 4UT9L 5D1ZD 3VW3L 4JCMA 2C1OA 3FN9A 3PDOA 1UACL 4OCMC 5F71A 1F90L 3EO0B 3VG0H 2HTKD 2V2XB 3KPMA 5SV4A 3MNWA 2BC4B 3R8BB 1F3DH 3AY4C 3MROB 2UY6A 2BHUA 3AREB 3KJ6H 2FEEI 1F42A 5T33H 4JY6B 4I5BA 2NX5E 2ADGB 3QDAA 2YMXH 2DTML 3IGAB 3L6FA 3IDIA 1ZA3B 4HQQL 3H9ZA 1Z6JT 2E3VA 4J23A 1GOFA 3QUZD 1WBZB 1JGLL 3O8XB 3CH8A 3GM8A 4N8CL 5CS7A 4LCIH 5T3XD 2GT9A 3HC3L 3BHBA 3Q3GB 1J1XL 2WINA 5EN2A 4NQCE 2ZUTA 2DJ4A 5IFHL 1OTSC 4LLWA 4D9QE 5D96B 4LSVL 4OV6F 3P40A 3MA7B 1P9MA 3EDJA 5SWZA 1AD0A 1G6RB 5EBLB 4NZTH 1I8IA 3CC5A 3MBEC 3W39A 3EHBD 3OPZH 2Y06H 2DWDB 4NYLA 4M6NL 5FUCC 3BPLC 3ZKXB 1CTNA 3MRHB 2JJSC 3QCTH 1XF2B 4DTGL 4M6OL 5GZND 1IZKA 1FZJB 4Q6IA 5GZOC 1BVZA 4F7CB 1ORQB 4B50A 1Y18A 3KJ4C 4QRUA 4GRMB 4TN9A 4J3XA 2OI9B 1ZV5A 4NHUB 3S96B 1FVDB 3B9VA 1A6PA 8FABA 4MAYC 1T20B 4F7TA 4U6TA 3JUZA 3T1FA 1TJGL 1CF8L 4OCXH 2X4NA 1I1CA 1BAFL 2VLJA 1C1EH 3EOTH 4AIZA 1QP1A 2DWEA 4Z7NF 1JCKA 4AEHH 3ESVF 5CMAB 2Y6SC 2B0SL 2FECL 3F12B 4KMLB 3ULVH 1BQUA 1JPTH 4J3TA 2FSEA 4X5WB 4NQVA 3GSNH 2BOCB 4N0YH 1FL5A 3IDGB 2VWEE 5JPNA 4HJJL 4PV8B 4XP4L 5TF1H 4QT5B 2XTJC 5KW9H 5TH2B 3U4AA 3E8UH 4Z7OF 5CBEA 3TZVA 3NIDF 1ZT7B 3PV7A 5C3TA 1JZ6A 3P9MA 4JFQB 1ZANH 5B22A 4HIXL 4XNUH 1IGCL 4JO3H 4DN4L 3MLVH 1NCBH 4UB0H 2FATH 1I3GL 3OB0H 4NC1E 4XC1H 5C0JA 3MJ9L 2CK0H 3CUPB 1Q0XH 5D1XB 3A67L 1XGQA 1I3RB 2IC2A 1S5HB 1DEEA 2ZP0T 1FSKC 1X9QA 5SWZD 1DVFA 5KTEH 5DEFA 2IQ9L 1PYWB 3LZFH 3TBYA 5J13B 4XBEL 5SWSB 5HHOE 5IBLD 4FP8H 2H2SC 4OFDA 2BXYA 1T1ZA 1JF1A 5IVZB 1UWEL 4ZXBA 4WI7A 4RZCB 1CT8A 1FPTH 2Y7QA 1MI5A 3EYUL 4HHAA 4LMQE 2BVYA 3GRWA 4UIMA 3B43A 1JI2A 2NXYC 3VFSA 3VFRA 3FQUA 1DE4B 2GJZA 5CP7A 1KTKE 2MNUA 3TBSA 3G6DL 1CU4H 2Q86B 1Y0LB 1RUKH 4S1SH 5T3ZL 4Z76A 4QHLB 4WGWB 2Y36L 2VLJD 2H9GA 3IFOA 4ZFGL 3HG1A 5KSBF 5C92A 1CD1A 1MAJA 2RIKA 4DCQB 3RWFB 2WUBH 3OAUH 4MDJA 4CRPA 3KPRE 4QXUL 5DJXA 5C7XH 3OZ9H 3D85A 2MCG1 4HFUL 3C08H 3QAZB 4ODHH 4G9FD 4C56B 5FHAH 2HJKB 1JZ5A 1HHHB 1XEDA 5EA0L 3TZVD 5J7CC 4FMFA 2EIZA 2BXZA 4IRJA 5DJ0B 2XZAL 1FVEB 2G2RA 4M48H 1LP9B 3W81A 4QF1B 4X98B 3CGTA 2FGZA 2V7HB 1AGDA 5FYLL 4P2QE 3FCTB 3FN0L 2AGJH 2WIMA 4PJ7E 3BPOB 5I15H 4WVRA 4GW4A 3BKJH 3TIDB 4XX1G 3R1GH 4XHQA 3ARBC 3ORJA 5ECJE 1DVFD 3RWJA 4U1MB 1WFTA 4ZFZA 1F45A 4AJ0A 5LBSH 3B4NA 3GI8L 4HDIB 4P59L 1A3QA 1C08A 1T5WB 5CFHA 1FGVH 5IMOA 3K81A 4K3HA 1UT9A 2GQHA 2MHAB 1AHWC 1GHFH 3WNPA 3T8XA 2R0WH 4ZXBD 4NQDB 3S7GA 3LDBC 1NUFA 4N8VG 4ZSOB 1MI5D 4QTIL 3TH3T 4JZOB 3BGMB 1IBGH 4XMLH 2QKIA 2CPCA 4DW2H 2CO7B 1A3RL 4CGTA 3QEQB 3QIBC 3RDTC 4A6YH 4NQEE 3SN6N 1ZVHA 3MRMA 2D7OA 2HLFC 1KJMB 4I77H 3MRBA 3HG1D 2NNAB 1KJ2H 4KY1L 1FIGL 1KULA 2VXSL 5JXEA 1VGKB 1VFBA 3FQTB 3D85D 2EEDA 1RZGA 1C12A 3UYOD 4PR5B 5ID1B 4G3YL 3TNMA 2CD0A 1Q1JH 4XVUD 4LAJH 5T5FH 1DCLA 4WJ5B 4N5ED 5CD5D 3RVVC 1QYGH 4RGOL 5JW3L 1RUQH 1FNGB 3RAJH 1UB5B 2BC4A 3MRIB 4IRJD 4X9BA 1F97A 5DVNA 3MROA 1CLZH 5C2UB 1MHPH 4UV7H 4G9DA 3VH8G 4NCDA 4JY6A 4BFIA 4LDOB 1W72A 1OB1A 1MUJA 3DBXB 2MQ0A 1F58L 5I8OL 5ALBH 3ROLB 3IDYB 4XPFL 4LSTH 4OZGA 1OPGH 1H3WM 2G5BB 1Q72L 3QA3A 4YUEH 1RIVH 2X9WA 5DGRA 3AMLA 5F1SA 1CK0L 1RJLB 3MACH 3P2TA 2HJLA 4LASL 4KRLB 3QNZB 4WFED 3MA7A 1GGIL 3CZJA 1ZLSL 1CN4A 5EBLA 1QFUH 2XFXA 4WEMB 3CLEH 2YPLB 1ORSB 5ITBL 2DWDA 1CLYH 1R5VB 3MRHA 2X89A 2EIDA 1YYLL 2SEBA 3IFNH 3VFWA 5JW4N 1XF2A 3RIFF 3MV7B 3OXSA 3RY6C 3VFGH 2CKBA 3G6JA 4PPTA 2DI9A 4HK0B 1DLHB 1WBXA 5BO1L 1HEZB 1UXWB 1HIMH 4W6WB 1GXEA 4GRMA 2R4SH 3BZ4B 4CU8A 2XKSA 1BJMA 3ZE2E 3L3OB 4KDVA 4NHUA 3BO8B 1T20A 1YNKL 1NFDE 1DUZA 5HYEA 5JXED 1WV7T 2A9NL 4MDIA 1CVSC 3BP5B 5DJDB 4KJPD 2NW3B 4G6JH 3U7WH 5CSZB 5D1QC 1G7LB 1RK1A 5JQ6L 5B39A 1DQDH 2E8YA 2ORBL 3F12A 2VXUL 5IUSA 1A1NB 5JIIA 3X3FH 5CZVL 4X5WA 3T2QA 3ULUC 3LVEA 1DUYB 5EU6E 3ARED 4PV8A 1SJXA 4QT5A 1NLBL 2OYPA 5FV2A 2Q7NA 2NZ9C 3Q6FB 1HSAB 3ULUH 5L2JA 3MOAH 1ZT7A 3M45A 4Q9RH 4RFEA 1PLGL 1X6NA 1H5BC 3D3VE 3SDXB 4EN3B 3Q1SH 5ENWB 3CUPA 5HHME 2IFGA 4NKMA 5AEAA 3JTSB 2XI9A 2NY6B 1AR2A 4X6DF 1S5HA 1XGPB 2HKFL 4JFEB 4MJ6B 4Y19A 3S6CA 2RAMA 2ZOLB 4P5MA 3ZTNH 2EIEA 5I8EB 4QY8A 4FQ2H 1UA6H 4GOSA 1V3MA 4F37K 4M93C 1MQ8A 2X89D 5D7LE 3TBTB 1G0DA 1I75A 5IBUG 1SMAA 4LP5A 1FC1A 4RZCA 4HKJA 3F7YA 2Q8BH 5F88B 1ITBB 4HGKC 4UTBH 4F58H 2BVPA 4D94A 5EIIA 2I5YL 4EBQL 3EW3B 2IPKB 3TCLA 5I1HL 2D03L 5CJOH 1B3JA 1UKQA 2R29H 4I9WE 2XWTA 5H2BB 1Y0LA 1FP5A 3B8SA 3QXDB 1QA9B 3GUTB 3OKEB 4AM0A 3OB0K 5ESVA 4QHLA 1WK0A 2ICCA 1QO3B 4KTYA 1RZJL 1YNTB 4MQXD 5GPRA 2B4CC 1JPGA 2HRLA 4C56A 4NIKB 4O00A 3ZDXE 1HHHA 1WWBX 1MAKA 2EE2A 1GL4B 1MHHB 4P99A 2JCCE 1SBBA 2NW2B 5DJ0A 1A6UH 1LP9A 2R1XA 3C2SA 3FAWA 5GS2D 3S34H 2V7HA 5LGHL 3FCTA 1U3HA 2QSQA 2VUYA 2HVJB 1BWMA 3GNMH 5CEZL 4YHYC 4HJ0D 3S35X 4UNUA 3TPUB 2QQQA 4H0HB 3TIDA 3ZT6A 4GXUM 5HBBA 5DJCB 2MPAL 5F7NC 3S4SG 3QHZL 3QZWB 4L9LB 1J12A 2BFVL 2ZOKB 4U1MA 5SWQB 1J0JA 3MJGX 4U2YA 1T5WA 5B3JF 4D9LL 2WP3T 3O2VH 4JPVH 4QXWA 4X6FA 4WTZG 1RFDL 3C6LC 3AS1A 2UWEF 2BRQA 4FFVC 4ZSOA 3OX8B 1ACYH 3MV11 3QR2A 3VXRE 4KUZL 5HJ3B 5ISZE 2Q1EA 3VFOB 4KQ4L 5E0QA 1AD9A 4U6VH 2VQTA 2HWZH 4I18B 1LK3H 4JFOA 1A7OH 3IAQA 1KCVH 3MLPA 1ZK9A 3TA3A 4Y16A 1VGKA 3FQTA 4BUHA 2C3WA 3LD8B 4PR5A 1WWCA 4C56D 1EEUA 4PGDA 4WJ5A 4Y5XC 4HWZA 1J8KA 1HXYB 1HHJA 1FNGA 2CXKA 4S0SD 3GMOB 3MRIA 3VD3A 4DZBB 1NC4B 1D5BB 4M5ZL 4Z7UE 3GDBA 1G84A 5DA0B 2VZOA 2D7TL 3MYZA 1NBVL 1U3HD 4WV1C