4Q7DA

Wild type fc (wtfc)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
207
structure length
207
Chain Sequence
b'PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Structural characterization of anti-inflammatory immunoglobulin g fc proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4q7dA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4q7dA01
3LDBC 2NZ9D 5FO9B 1FFNB 3E8UL 4HQQH 3T4AB 5D7IB 3CFEB 2P43B 4JRXD 2LTQB 2XACC 3UDWC 5HHNA 4X99A 5CEXA 4HFUH 1WWAX 3KPNB 4Y4HC 4HT1H 4LHQB 2FBOJ 1EX0A 1UADC 1JK8B 4AIOA 4YHIA 3V7MA 4GBXA 1D5MB 3PF2A 2KQMA 2VDOL 5CJQL 5H94A 1KEGL 1BX2A 2OMBA 1HZHH 1XIWD 2CDGB 3AB0B 2J4WH 4WTZG 2R9HC 4I3RH 4YGVB 1N4XL 1T2XA 1FP5A 2CPCA 3WN5B 1UXSB 5JZ7C 1D6VL 1DBML 3HR5A 4ISVB 1JUFB 5I30H 3G5XB 1Z5LB 2R2HB 1G7HA 5KTEH 4N8CL 1U3HB 1WWWX 4JFXA 4JHBA 2BY3A 4H8WC 1OAZL 1HHHB 2X7LB 3ZDYE 2QADB 1I1AB 1A3LH 1MRFL 2BNQA 1LILA 3IU4H 5TDOB 3ALXA 2BNQE 1UZ6F 4NP4L 5GQBA 5TE7L 3U4AA 1JPFB 5D5MB 3JSSA 2F74A 5T3XE 3W0WE 1CXEA 2Z8SA 5F9AC 1EZVX 4Z7QF 3HPJA 2ZCHH 2VLKD 2J1KA 2NYYC 5MEPB 1X44A 2EYTB 5C0FB 1I8KA 4H26B 4OZFA 3MRHB 4LIQL 3MCKB 3PGDA 3SE8L 4LSQH 1IM3A 5ITFB 4QNPE 1JL8A 1XGUB 4LCCB 1NAKL 3HNTL 3P73B 5FHBL 1A4KA 3WDJA 2X10A 3MRPB 4Z7OF 1HIMH 2V5TA 3UC0H 5HVGB 1Y0LA 5DFWH 5E56A 2X4PA 2PYFA 4JDZA 1DQJA 2CXGA 4WI3A 3RVUC 1VKXB 3PNWA 3NCFB 4Y2OA 3OKMB 5L0QB 2X2YA 2ORBH 2E9JA 3RVWD 2F54A 3D85B 1BIIB 4NUJA 1G7MA 3CVIH 2LAAA 1D5XB 1EBPA 1WCQA 3RU8H 3KGRA 3AAZA 2UUDH 2HT3D 4QLRA 4TUOB 2ZCKH 4KI5E 3N1QC 5F71A 2W9EL 2Z8RA 1AKJB 1FZJB 3OJMB 5I9QB 1G9NH 4I9WD 2A83B 3NTCH 4UBDC 1T2JA 4XNXL 2W92A 4LASH 4DUVA 4LSVH 4ALAL 5MEOA 2GCYA 3N9GH 3L3DB 3S97C 2AXGB 3P2TA 1C5CL 3TYGL 4ZXBC 5I8KH 4L4VA 1EERB 5CGMA 3CC5B 2EDEA 5ITBL 3TBSA 5CZKA 2H2SD 2VR4A 4L4VE 3QCVL 4MXQC 1TMCB 4JFQA 4GOSA 1UWGL 3OJVC 3GK8H 4X6EB 4XZUB 3W82A 1OW0A 3QIWD 4JB9H 4QHLA 2E7LA 3ES6A 1L7TH 3OXRA 2Z91A 1UWEH 3CXHK 4OGAC 3CFDA 4EKXA 5GGTH 2APBA 3ZDZF 4ETYA 3FN0H 4IRJB 2CMRH 1NLDL 1F58L 3BKMH 3RWDB 3V6OA 4P9HH 3OAYH 3V6OE 1R3HB 5T1KA 1FC1A 3FT2A 3HHRB 4NKOA 3C2SA 5ESVB 1QRND 4PJAB 4F7EB 4HLZG 2O26U 2R1YB 2FIKB 3CFCH 4MA1B 1T6WA 1L4IA 3WSQL 4QRRA 1P7QA 2AABL 2ZG3A 3BUYA 2QQLH 1LO5A 2P7TB 4QRRE 3CCHB 2VSDA 2AGJH 3MRBA 4WWKA 2D7MA 3KR3L 4R4NC 4W4OA 1SM3H 1AXTH 4M6MH 4XGZA 4J3XA 5F7EL 4S1QL 4Y2DA 4OUOA 6FABH 3AY4C 4O2CA 3RGHA 1F5WA 1UA6H 4I0KA 1N6QL 4I5BA 1BQSA 4YAQB 3VFRB 4XCNB 4QRUA 1UM4L 4L5FL 4J4PA 5D7JC 3EO1B 3BEWA 3MRQB 5CJ8A 5JPMB 1PYWB 3WUWB 1ZSDA 4OFKA 4KROB 3WO4B 4BSWA 4M5ZH 4WU7B 5FYLD 5IEHB 1FNGB 3UTPE 2YSSA 3LKRB 1NEZA 1XF4B 3U7YL 5IKCA 3TBVB 1LE9B 3TIDB 3CNKA 2ICCA 5E7FA 5DT1L 1T3FB 4K23L 4H8WL 3V7AE 3VDAA 1RZGB 4ODVL 1KIRB 3G08B 1KLFA 2EDBA 5I76B 1CK0H 4ZPTB 2R4RL 1Y18A 2EE2A 4HULB 1FFQA 3WIIH 2C1PA 4XC1L 2DQDH 1X5AA 1OWRM 1RI8A 5CUSH 3K8LA 4JZNA 3O8XA 1MOEA 2Q8BL 5DD0L 3U4EA 1ORQA 3MCLH 1PQZA 5D71H 5C0IB 1S3KL 3O2DA 2OR9L 3MYJB 1VFBB 3DRTA 2W0PA 1P69B 1NMBH 1ZLVH 5I1JL 1N8ZB 3W39B 1VPOL 4NBZB 4GG8A 3O11A 1QYGH 3M1BB 3FCTA 3S35L 4EOWL 3LPGA 1YEDB 1QZ1A 3HAEG 3UAJD 3EYSH 3QUMB 3UZQA 5HDBF 3MJ9H 1T20A 4J8RA 3CH8A 1FC2D 2Z31A 4M6OH 3HFML 2LAGB 5ISZD 4Q6IC 1DQDH 3EOBA 3E3QC 5GGQH 4XH2B 4OTXH 3ULVF 4U1JB 3B5HA 4Y4FC 3QA3B 3HRZB 3I02A 4L9LB 3BH8B 4XP5L 4HFWB 4JJ5A 3KJ6L 2X4SA 4X80H 4LGRB 3CU1A 4UTAH 3LEVH 3DV4A 4HC1A 4NZTH 1FV1B 1NL0L 3KLSA 1JYVA 4Q0XH 5DD6A 1YN6A 1OGTA 4OB5L 3G5VB 7FABL 4LCUA 2NY2D 4U33A 2WP3O 4JN1L 3QEGL 4D2NA 1CF8H 4GO6B 4LOUC 5F3BB 4XC3H 4IHOA 3VMOA 4BFGA 2GEEA 4O9HH 2NY7H 3UTOA 1H3PH 4OCWL 1D7FA 5IQ9A 4KXZH 1MLCA 5FYKD 1AGBA 2D0GA 4DEPC 2IBZX 4LHUB 4FFZH 4WO4A 1AD9A 1XCQB 1IAOA 1MEXL 5D7KE 3IFLL 2AV7B 2M2DA 1NFIB 4HPOH 2Z9TA 1RMFH 1HKLH 2VZTA 3SDDB 3QDGB 5E6IC 1OP9A 5CINL 1YEIH 3QQ9D 5D7IF 3BGFC 3NH7L 2HVJB 4LDLB 2BVPB 1DDHB 1E4WH 5FF6B 3QCTL 5F7UA 3P4OB 5J13C 4HUWB 5HY9B 1CE6A 2YUXA 4OLUL 2NX5D 4WFEE 1BFOA 5DO2C 4TVPD 2AEPH 4YWGH 3MBXH 3ZTJG 3ULVD 1DUZB 3D39D 3B6SB 4AJ0A 4ZFOB 1M7XA 4OJFL 4GS7B 5DEGB 1UENA 3BH9A 4R4FH 4BFBD 3C5ZD 3IGAA 5DK2B 1F6AB 3ETBF 1T0PB 4F9PA 1Y6NR 1BJ8A 3KJ4B 5F88B 1VFUA 3AS3A 1UM6L 2CQVA 2P8MA 2BOCA 5DRZA 1X5IA 2VC2H 2D03L 5FA3B 3UPRB 3S34L 4ZO7A 3AGVA 3DX7B 2GITB 4X6BB 1YEEL 3MRRB 4F58H 5D5MF 1K4CA 3P77B 3QXAA 1AHWB 2IMNA 1DTUA 3WKML 4ZSOA 2D0FA 1CDHA 2NW2B 2ADJB 1IVLA 1MAJA 4LAJH 1CD1A 5F1KC 5H35A 3F7QA 3WFDL 1ZA6A 1F45A 2CK2A 4V1DB 1Q0YH 3N85H 2QTEA 3MZTA 4KUZH 3CPLA 3PWLA 5IFHL 4MA7H 3BXNA 1P6FA 2Q20A 1KEMH 1P5VA 3I6LD 5AUMA 3WXVL 5KSAB 3L3KA 3GMRA 1X5YA 5E4IA 4U1NB 4PRHA 2Q6WA 5BO1H 4EDWL 6CGTA 2ZJSH 4J3VA 4ZMAT 1U3ZA 1FO0A 1B0GA 3CMOH 4PRHE 4K9EH 2EE3A 3CX5K 4HW6A 5E7BA 1I1FB 4UB0H 1QPXA 5MENA 4OBSA 1E6OH 4XPFL 2D31A 5MENE 4U7SA 5BVPH 5JW4M 4NJ9L 2X05A 3E6FA 5IT2H 2Y36H 2D7OA 5IR1B 3ROOB 4MAYB 2QADD 1I1AD 1MREL 5HI5D 2J8HA 4L4TA 1QA9A 1FGNH 1KN4H 1SHMA 1A4JA 2A6IA 4WI8A 3BE1H 1CZ8H 3DVGA 4IMKC 5D93B 1ZS8B 1M7IB 3AS0A 1JBJA 1LK3L 1VADB 2OQJA 3VFSA 4JGUA 1UB6B 1NCAL 3EDFA 1TVBB 1H5BC 3JTSB 4GXVH 4PJ5B 1K8IA 4M1CD 3IDXH 5CHNB 3HN3A 3RZCD 1TJIL 1KB5L 3VD3A 5J9PA 3ARGC 4S2SB 1RZKH 4HJGB 1TQCC 4HKJB 3SPVA 3MFGB 2IPKA 3CUPB 1E4XH 1CFTB 1ZGLB 3LD8B 4O58L 5DK3A 2UVFA 1D5IH 3I3DA 2XN9B 2PO6C 4XAKD 4J12A 4KVNL 4PGDB 3V6ZA 3NACL 1IMHC 5CLTA 4R0LC 4MXVF 3RWGB 5HI4C 5A2IH 4APQD 3PE9A 2GAZA 2XQYK 4GXUN 4JDVB 4OLWL 5CP3H 3RL1A 4H1LA 4U1IB 5DMIL 5IB1A 5CGYC 3TJEL 4PJAF 2QR0B 2JTDA 4OLVH 3ET9F 1T89A 2NY6D 2VXQH 1B4JL 4M93B 3D85D 3MV9D 4NSKB 3DX6A 4RX4A 2GTWB 4MAUL 5EZOL 3OV6A 1AKJD 1KNOB 2AK1H 5C0DA 3FQUA 4PTUB 3B9VA 3ZKNC 3F58H 4JFFA 3OZ9L 5HHNB 2JJUA 4EQ3A 4JFFE 5CEXB 5CILL 1J1OL 1FVDA 3OKOA 3EDEA 4RFOH 1QBAA 5F3HB 1P7KA 3R4DA 5JQ6H 5I71C 5HHME 4M1GL 5KOVC 3TH4T 2IEPA 2XZAL 4FFWD 3O6KL 4GBXB 5FV1L 4J2XA 3T2NH 4AG4L 3K8MA 5H94B 3MLZL 1ZLSL 3A0OA 4KK8D 2V2TA 1T1YA 4M1DH 4NNPH 2NY4C 3K3QA 3TPUA 2DLFH 4IDJL 4WW2A 4YQXL 5FO8A 5DD5H 1R24A 3MUY1 1I8LC 3RAJH 2BERA 3G6AA 1LE5A 2HKFH 2W91A 2YA2A 12E8L 3ARBC 4I77H 3CDYA 5FM8A 3RL2A 3T0WA 1P5UA 5TPWL 4KRLB 4HV8A 2DIJA 2FB4H 4NWUH 5C9JA 5JXED 5GS0C 5GRZA 3MODL 1IGIH 2BNQB 4PP1C 1I7UA 4ETQA 4UI2A 3ARUA 2XRAL 3W0WB 2J5LB 4LKXA 1RUMH 2PETA 4WCYH 3RVTD 5C0NC 5SWQB 2F74B 4WUKH 3NCYP 3L1OH 1T22B 4L4JA 5ENWA 4JQIL 1CGVA 2G5RA 1MLBA 3HPJB 2FNBA 4G6FD 3EYVA 5B3JF 2HJFA 4Z95H 3EO9H 5JR1L 2A73A 1I8KB 2IGFL 1WCBA 4TSAH 4OZFB 1H3VA 3PGDB 4JVUA 4JLRA 1IM3B 2QKIA 1JFQL 2DJ4A 3TT3H 3TCLA 4Q2ZB 4PRPA 5SX5H 1A4KB 2KKQA 4QRPD 1FE8L 1QBLH 3JWDC 4BH8A 1FHGA 2X4PB 2C5DC 3BT2L 4JDZB 4LARH 2A9NL 2MCPH 1NBVL 5GS1A 1A7RH 3BZ4A 4XVUD 4OQTH 2F54B 1YNKH 1UVQA 1RZ8B 4NUJB 1G7MB 3U1SH 4O5LL 2P44B 2A6DA 3RJDA 5BW7C 4JO4H 4LEOB 4XNUH 3VXNA 3AAZB 4DW2L 5DK0A 4H0IA 5I1LA 4FNLL 5EWIH 2Y07H 2ZPKH 5J57B 8FABA 3C8KA 2OL3H 1AO7E 4NRYA 4Y4HA 3ZL4H 1OAXH 4KPHL 4FQJH 4WUUA 5CAYB 1ZEAL 5MEOB 4WUUE 2GCYB 2OS7A 3EZJB 5TE4L 1CICC 4L4VB 4N0FB 4MNQA 2P48B 5GJSH 3TBSB 5TDPA 3NIFE 4OCNC 4KQ3L 4MNQE 1FIGH 4JFQB 3CSGA 5H37G 4QHLB 1U95A 4WFGD 3OXRB 5CEZH 5ALCH 4H20L 1UCBH 2J88H 2LVCA 4NQTA 3CFKA 3CFDB 1BOYA 3KPMA 3RUGF 1BBDH 4Y16C 4ONFH 4LNVA 3NIDE 5BS0D 4DTGL 4NN6B 3QDJD 2ZKHL 2QHRH 5MEQB 1BFVH 3D9AH 3R8QA 2AQ3A 2R56H 1AXSA 1G0YR 3I84A 2EXWD 3VGBA 1QPPA 3LQAL 3FT2B 3MFFA 1L9MA 1MAKA 4JFPA 1CFVH 4XVTH 3OPZL 5KZCB 3QUMH 1IBGH 4LSDA 1QFWM 4QRRB 5D1XC 1P7QB 1INDH 3NA9H 4K7PH 4P4RB 3BUYB 1LO5B 4LVNB 1E6JL 4XPTL 5J12B 5FV2A 5CP7B 4AEEA 3QI9C 3MRBB 4WWKB 4JCMA 4MD4A 1UKSA 4UNUA 4RDQG 1H0DB 4B41A 2AJXL 4JPKH 3B2UC 4XGZB 5I8EA 1ZV5A 1H3WM 4OCRH 1CU4H 4Y2DB 5E2UL 3WKNA 1OARH 1XF2A 3VXMD 4O2CB 3A6BL 5ACLA 5J4MA 1KXTB 4PLOB 4I5BB 1EEYA 4X7DC 1K85A 4YHYB 2XIDA 4QRUB 1HYRC 1TITA 4NGHH 4LHUD 3P40A 3X17A 4OM0H 4M7ZB 3I6KA 3ECBB 3BEWB 4KKBD 4FMKA 4BSWB 3JZ7A 1FCCA 3QDGD 5CJXC 4ELKA 2YSSB 1NEZB 3J7HA 2IH3A 1KTKE 2H6PA 5IKCB 2R0ZH 2C3VA 5DZNA 2C4XA 3CMGA 3WNOA 1U8NA 5FOJA 4MCYA 5SV3A 4ZXBA 3F7RA 3T8XB 4EVNA 1GXEA 1WFOA 5FKPB 1GSMA 5GS0L 1DZBA 5T3ZE 1Y18B 5C0AD 2XPGA 2AJVH 2B2XL 1H8OA 2VAJA 2C1PB 1WBZA 2HFGL 3FHAA 1VFOA 3ZE2F 3RKPA 3H42H 1E4KA 2FGZA 2WWKO 1MNUH 4JZNB 3O8XB 4KJYA 1EHLH 1ORQB 3TO4D 1PQZB 4L3EA 4I18B 4B5EA 5A2FA 3DRTB 4MQTB 5I1EH 1PY4A 2X4UA 4PTTA 2Y4SA 1U6AH 4GG8B 1KCSH 3O11B 1JGUL 3FCTB 2W0KA 5FGRA 3E2HC 4XT1C 1UQSA 5EU4A 1T20B 4J8RB 1YEGL 4G6AD 2Z31B 3RWJA 3GMQA 1A6WL 4NZRH 3VG9C 1PD6A 1TQBB 2H32H 3V9FA 4XBPA 2ENYA 4AM0B 4AYFA 2MWCA 2VZVA 2ZUQC 1U8JA 2X1PA 1CQYA 3JWOH 3P11H 3FFCA 1J8HA 4XP6H 5T1MA 3UTTA 1IEHA 1J8HE 1U0QA 4WFHD 2XOTA 4JJ5B 3UTTE 5DUMH 4HUUA 2X4SB 4XMKH 2V17H 4HJJH 1YDPB 4JQVC 3DV4B 4GSDL 1FORH 5DGRA 1KN2L 5AYUH 4Y19A 5DD6B 1YN6B 2D7TH 2J8UA 4V1DD 4Y19E 2IQ9L 3ZYIA 2J8UE 1A7QH 3AY4A 1QP1A 1VDGA 5JIKA 4LCUB 4FQXD 1X6NA 1EHAA 3CZJA 4ZUSA 1B0WA 4YXLL 3UTSA 1OOAA 4O51A 3UTSE 1JV5A 4DJMA 1JPGB 5KSAD 2VH5L 5KAQG 1P4IH 5C86A 3EO0B 4MB5A 5IQ9B 1MLCB 1AGBB 3BDYH 1FNLA 1WTGT 4XRCA 4WO4B 1R3LA 1AD9B 3P0GB 4FZEH 1IAOB 2F9BT 4R90H 4I0PC 5T5FH 2YWZA 5C0BA 3ESVF 4HJ0D 4YDKL 3Q3GA 3QIBC 5C0BE 3H9ZA 4OCYL 2HWZL 3MBEC 4CKVX 1SY6L 5LBSH 3LRSA 3L3GA 3GSXB 2F58H 2HT2C 4MAYD 4X6DE 4KRPB 1S78D 4YXHL 1CE6B 3HC4H 2VMFA 1F90L 4C56A 1GGCL 4WY7L 1BFOB 4C56E 2NR6D 2FX9L 4PJ5D 1KC5L 4LF3A 3SGDI 1P4BH 3EW3B 1J5OH 1PDKA 3BH9B 4RRPA 4G7YL 3WLWC 2FBJH 3IGAB 1ACYL 2BHZA 1A6UH 1VGEL 2XWBA 1JGDA 1MFBH 2VDPH 3ARFC 4JRYA 2CLVA 1K3ZA 1IC1A 4FFVD 4JRYE 5DUPL 2CRYA 4MXWL 4MJIA 4FXLA 2P8MB 4UV4H 2BOCB 4OGXL 5KVEL 43C9A 3L3JB 1YMMD 4MJIE 3WV0A 3MJGX 4K2UL 3MNVA 4Q6IA 4W4NA 3JUZA 1NCCH 4RFNB 2KQNA 3BAEL 4UILH 3UMTA 3VWJA 4PJHA 5C2BH 3P9WB 2W07A 1K4CB 5GGVY 2BRRL 1RUQH 2EH8L 3O45B 1J1XH 4NM8H 4NO5A 5HI3D 1J1PH 3S9DB 1INQA 4M48L 1ZLVK 5DD3L 1DN0A 4KMLB 2OXGA 1CD1B 1ZA3A 4KRNA 3T0VA 1G6RA 5IUSA 1S7XA 5JHDA 2YA0A 4N90D 2FWOA 4L3CA 1U41A 4M5YL 1ONQA 3PWLB 1XIWC 5JMOC 2VDQL 2AJSL 3RKDC 3BXNB 4LNRA 2ADFH 1B4RA 5F9OL 4QHMB 2I07A 3TBTA 3DI2B 5AUMB 5I19L 2Z92A 1CL7L 3L3KB 2YZ1A 3GMRB 3MNZB 3TYFA 4GBXD 4PRHB 2Q6WB 4HUMB 3QG7H 4UIKH 1FO0B 4G3YH 2NTSP 1DEDA 2FX7L 1MFAL 4DKFH 4U05A 5E1AA 1IAII 4NM4L 2IFFL 1U91A 4YZFE 5E6IA 5MENB 4KI5F 1QKZH 5IHUH 1WZLA 4YBLC 4GMTL 1CR9L 3RQ3A 4LLUA 3G6DH 3VE0A 2IPTL 3E6FB 3T65A 5FYKU 2CDFA 4UINL 4XB7A 5D6DC 5E5UB 4OI8A 5B39G 1ZHNA 1WJ3A 4L4TB 1QA9B 1WTLA 2A6IB 1A4JB 2WBJA 3RVXC 2BNQD 1KJ2L 2Y06L 3I50H 1TIUA 1AY1H 3DVGB 4QHKI 3BPOB 5E2VH 1NKRA 3O3BA 5T3XD 3VFSB 4K71C 2XY1A 3UJIL 1JNJA 1K8IB 5E1HB 3VFUB 2NY5L 3E6HA 4G8GA 2XZCL 2GQHA 4G8GE 4FFYH 4PLKC 4OT1L 5J9PB 5EORH 1I9EA 1XCTB 2VLJA 2X1WL 1EBAA 1SVZA 3SPVB 3C60C 2N7BA 2IAMC 1B2WH 4F7PA 2Q1EA 1B9ZA 2JB5H 3V6ZB 4NHUA 3A67H 2JK5A 1G9NC 3HC3L 1UWXK 3AXLA 3EYOA 5I8OL 1KPRA 1EJ6A 4R9HA 3WFEH 5JW3H 4YHMH 3FFDA 3RVWC 3VGAB 3U0WL 1MJ7H 1ZANH 3MOBL 2GAZB 1C16A 1HWGB 2R2BB 4NWTH 3RL1B 4H1LB 3VG0H 4OZFH 5CKGA 3WL9A 1WZMA 5IB1B 2CJUH 3LVEA 4DGYH 3BQUC 3HKFA 4K3JL 4XXCC 4GUPA 2WBWB 2YPLE 2F54D 3S5LG 3U4BL 4QO1A 3EOAA 2RR3A 3DX6B 4KI5D 4KJQC 3C09C 1F97A 2IG2L 3IYLW 3MA7A 3D48R 5IESH 3ZKXB 5C0DB 3FQUB 1HQ4B 4OCSL 5FGSA 5FUOH 4JFFB 1TTGA 1NSNL 4ODHH 1FVDB 3OKOB 1C7TA 2HLFD 4P9HC 3UYRL 5HHMB 1P7KB 4L4VD 5IGXH 2YPVH 4V2BA 1B0RB 3RA7L 4BJLA 5BQ7B 2X09A 4CNIA 3K81A 5ABDE 2DQUH 4CN1A 1E0OB 2V2TB 1T1YB 4XNZC 5HD8D 3TPUB 4Y4KD 3S96A 4WW2B 5FO8B 1R24B 3QNYA 3G6AB 1VGKA 1ADQA 4YDJA 4DN4H 3KLDA 2BSRA 4GLRH 4G6ML 1M71A 5F1OB 3RL2B 5IHZA 4JANA 4G6KH 4TTDD 3F5WA 5E2WL 3PP3H 4WHTA 1MPAL 4HV8B 3RTQB 3LKSA 4HAGA 4MDIA 5CMAA 5CFHA 2VZUA 5DJ8A 4ZFGL 1PG7H 1AE6L 3Q5OA 5EU3A 5C9JB 2DM3A 1PJ9A 1I7UB 4ETQB 4LP5A 4GMSH 4BZ2H 5T1KD 4LKXB 3BPNC 3OAUL 4HG4K 2YBRA 2UZYB 4WEMB 4BSVA 5DA4A 1JGLH 4ZNEE 1WUNT 4MD5B 1MWAB 5KZCD 4U6VH 3EYVB 4QRRD 1P7QD 2HJFB 3LMJL 3GSRA 4HKBA 1YPZA 2X9YA 1SBSL 2PO6A 3L5XH 1WCBB 5DRXA 2VN7A 4R0LA 4JLRB 2QKIB 2VZ1A 1MHPH 3DJ9A 4B53A 4FQLH 3TCLB 5FA4A 4Y2DD 4PRPB 3VD5A 4OFVA 4EUPH 3LQMA 4PJXA 3TN0C 4BH8B 4PJXE 5K9KA 2ZCLL 3IU4L 3DSNA 4MA8H 4U3HA 3CDGA 3MRNA 3SDXE 3OB8A 1TETL 5GS1B 4FRWA 1I8MA 1WWCA 3BZ4B 2VSCA 4J4PD 3QHTC 4LSRH 3SDYH 2DQFA 2H1PL 1A14L 1UVQB 2J8OA 2A6DB 4NCC2 1IARB 3BO8A 5I1HH 3QXUA 4NN7C 5DK0B 1GJIA 5C3LD 1V3LA 4ZUUA 5I17B 3EYUH 5I1LB 4L8SB 1AO7B 3MLWL 8FABB 3C8KB 4NRYB 4Y4HB 4UT7L 3T0BA 4WUUB 2OR7A 1RFDH 4HUKB 5LXGL 4LL9A 1EAPA 4L8CB 3LS5L 3NVQA 1HH9A 3Q6FA 1FNSH 2EIBA 3B4NA 4MNHA 3HI5H 4MNQB 4ZS7H 4NO2A 5EA0L 5D1QA 1Q1JL 2GKIA 5D6CA 3LS4H 2GK0A 3GIZH 1Z9LA 4R6UA 5I1DA 4NN5B 4XVJH 4LSTH 4KI1A 2ID5A 4JAMA 1U95B 2ICWJ 1BEYL 4UIMA 4U1HA 3CVIL 1YNTB 1RZIA 1NDMA 3RU8L 4Q9RH 3CFKB 15C8L 2WWMD 3F7VB 3KPMB 5IJKC 3OWEA 3SKOA 5FDYA 4JG0H 3QDMA 3FQTA 3KYOB 5GGRY 4PREA 3QDME 1KJ3L 1CTOA 3E1F1 4DKEL 4NJAH 1AXSB 3NFNA 1GL4B 3NGBC 1NBYA 1E27A 3VW3H 4D9QE 3HPLA 3MFFB 1P9MA 5F1NA 1GIGH 3VD9A 2F53A 5FEBA 4D0DA 2B1HH 4JFPB 5DJAA 2F53E 2DIBA 2R0LH 3REWB 4F8TA 3GRWA 3HNSH 3KYNA 5EIQA 4XP1L 3S4SA 4N1EA 3D2UA 1U2HA 3UJJH 5DI8A 3CX5J 5I8EB 5IW1A 1S7RA 2PCPA 4RBPK 3CXDL 3FZUC 1QSVA 1YN7A 1XF2B 3SQOH 5EO9A 5IBTL 4JFOA 1TJHL 1FLRH 1LO4H 2JELL 1Q72L 2BFVL 3P0YH 1AP2B 4POYA 3R1GH 3FMGL 5KVFL 1EEYB 4HIXH 5M94B 3PWUA 2DQCL 4WO4D 4S1DD 5BW7A 3I6KB 4HH9A 2YEZA 4GW5A 1FJ1A 5H8DA 3HCVA 2OJZH 3MXWH 1IQDA 4JZJA 2DJUA 5HYSA 1TPXB 4HCRA 3MPCA 4ELKB 3OR6A 2IH3B 2H6PB 4TRPH 2C3VB 4P9MH 3GSVA 1OTSC 3EDKA 5EG6C 1GRWA 4PD4K 4OF3A 1U8NB 3MRDA 4KRPD 4MCYB 1IFHH 1CICA 3LHPL 4ZXBB 1CXHA 4DOHE 1K9TA 4WFED 3BD5A 4EVNB 5GISH 4M7LH 5AZ2H 4CADA 4MSWA 3SKMA 1WBZB 5DS8A 2P4AB 2MOVA 3QYCA 3IDJB 5L9DL 4KJYB 2HAZA 3ZKMC 5H2BA 2X42A 4L3EB 2EKSA 4M43H 5E24E 2PTVA 3O6FC 3MC0A 5JXAH 1OTTC 2ZUXA 2X4UB 4BZ1L 4PTTB 1IT9H 1L0XA 2A2QT 5I1AA 5DSCA 5C07A 1P1ZA 3VXUA 2F5AH 1UQSB 5CD5D 2BRQA 4PIRF 5C07E 4MQXD 4WV1C 3RI5F 3VFGH 2AAVA 3RWJB 3GMQB 1MCPL 4TULH 4NQDE 4Z9KB 4XAWL 5AD0A 5DJYA 4QWWC 1U8JB 4K9EC 5FYLL 4GRWB 3WIIL 2LTQC 3O9WA 4F7MB 3H3BC 4ZYKA 2DQDL 3FFCB 5DRNA 1J8HB 4KKNA 5T1MB 3UTTB 5HHXL 4JO3L 4YNYA 4HUUB 3RZWA 5GGRA 2CKBB 3QI9A 4OKVA 3P0VH 1NMBL 3NCJH 4Z7NE 4Y19B 3GO1H 2J8UB 2YD1A 5IP4A 2DRUA 4YXKL 3LZFL 3IVKA 2FIRT 4LPTA 1QTYT 3UTSB 3V5KA 1UACH 3QQ4A 4O51B 1IILE 3WN5C 2ATKA 1JV5B 1FZKA 4M6OL 1R5WA 1R5IB 3BRDA 4PRHD 4DAGH 5FUCC 4AEIH 3VXQA 1U3HC 4XRCB 1R3LB 1NGXA 1BOGA 1RZKC 1I1AC 1QNZH 3DSFH 5A43C 5CJXA 2DQTH 5MEND 5C0BB 3GBNH 1R3KA 3Q3GB 4X80L 5LQBH 4MMXC 5TF0A 1BFSA 1F00I 1MF2H 2VN4A 5SWSE 3UZVB 3PWVA 3SDCA 1MCCA 1KFAH 4M1CC 1FO0H 3LRSB 3L3GB 4X6DB 2X5PA 5FOBA 1NGQL 4L4TD 3TV3L 2OTWA 4P2QA 2YMXL 3GBMH 1JNNH 4P2QE 4C56B 4N8VA 2VQ1B 1GGUA 3BRFA 3NMEA 4PBWD 1IGFH 5CCKL 1C8PA 4LF3B 1NAML 2NY7L 3PG2A 4PV9A 2OZ4L 1YECH 4LCCC 1EUTA 3TNNA 5E5MA 4KJPC 4UUJA 2PUQT 3O2WL 1HXMA 3QDHA 4WW2F 1ZT4A 1FBIL 3ZHDA 1NMCC 4OV6F 1QACA 5I1CH 5L6YH 35C8H 4X7SL 4JRYB 2CLVB 3U0TA 4BM7A 3LKOA 2EC8A 4MJIB 4U6YB 2JJWA 3SJVA 3N1PC 4NZUH 2CGRL 1CYGA 3SJVE 5FYKL 4BQ8A 3MNVB 3KS0H 1A7PL 2VXSL 4KHXL 5E2JA 2D0HA 4JN2A 2Q8AL 1Z3GL 2NMSA 4PYGA 3X3FL 3VWJB 4PJHB 3OR7A 2HVKA 5DJ6B 2ITDA 1U8IA 5DTFA 3V79C 5IVZA 4ELME 2FATL 4NO5B 5T33L 4Z0BL 3HMXL 5F6HI 3C2AH 3EHBD 4LEXL 1OAKH 4RX4D 1T03H 1ZA3B 4XMLH 1IC4H 1MCKA 3BDXA 3ZSSA 1G6RB 1S7XB 4S1RL 5JHDB 2V9TA 4LSPL 2HFFA 1BVKA 4FFWC 4TVPL 1MCWM 1UH2A 4JFFD 4MS8C 2VAAA 1EPFA 3ULVL 4KK8C 2VLRA 4L3CB 4OUUA 1ONQB 4GAYA 1C1EH 5BRZD 2AKRA 4LNRB 1JGVL 3QHFL 4XCFH 4DFHA 5HHMD 2Z92B 5K9JH 3TYFB 2OTPA 3RFZC 3NOIA 3CK0H 1QG3A 5ILTH 4HK0A 3MXVL 4FZ8L 4I0PA 4IRJC 3LPFA 4IRZH 5E1AB 5I1KH 1EA9C 1U91B 3ZDXE 3CVHA 3QHZH 4WIQA 5JIIA 1XGPA 3MBEA 1YEFH 4G7VH 1DQML 2ARWA 4ZFZB 3EYFA 2GFBA 4G8EA 1EZVY 1RZFH 2R69H 4LLUB 4XPBL 3VXTA 3VE0B 2FH8A 5MP6H 3WXWL 3T65B 3CIQA 1OM3L 2DTML 3TWCL 2CDFB 1DBBH 3T0EC 4MA1C 2O5YH 1LEKA 4RGMB 2WBJB 1SMOA 2A1WL 4HMEA 3HAEH 4CJ0A 1CGWA 1RHFA 3FAXA 1X4ZA 3NIFF 1PLGL 2EE6A 5HYFA 3RIAF 2ADGA 3PWNA 1F2QA 3E6HB 4G8GB 2IMMA 5LGHH 25C8H 3W9EA 4QXGH 1L6ZA 1EK3A 2XA3A 2L0DA 4KHTH 2XKNB 3FO0H 3L3OA 4QY8A 3L3HA 4PJEE 4I8DA 4F7PB 4NHUB 2JK5B 2FD6H 1DQQA 1F42A 3DUHA 1XGYH 3AXLB 3EYOB 1KJVA 1T2QH 1MFDH 5AG9A 4XVUC 1MWAH 3FFDB 4PRPD 4HZLA 1MRDL 5DFVD 4G43A 1NANI 1CFQA 1C16B 1NCBH 1PBYA 1RJCA 3VGEA 2NNAB 5IROC 4KROC 5CSZA 3WO4C 3QP3A 4KZDL 5E95B 1QEWA 3VJ6A 4HZAA 1U9KA 1QSZA 1QSFA 4LSSL 3GI9H 2YPLB 4NQSA 3MGOB 4DZBA 1A7OH 3GHEL 1QSFE 3VFVA 1OPGH 2AI0L 1I3GL 5T1DH 3P30H 3RVVC 4HLJA 4Z7WE 3L95A 2AXHA 2BVOA 3MA7B 4XHQA 5TGBB 4QF1A 2QJDA 1UJTA 4O02H 3D0LA 5D4QA 5HDOA 5JOPE 4MMZC 2CKNA 2W9DL 4Y4HD 1KCUH 4WUUD 1BD2D 2BY0A 2R1XA 3PDGA 4UT6H 4UT9L 1DBAL 3TT1H 4K8RH 1WF5A 4NFBA 2GHWB 2A38A 3U83A 5F9WC 5JO5A 1OP5K 1WBXB 3OGCA 4CNIB 3KYKL 1MIML 4XNQA 1RIHH 2R9HD 5DYOA 2E27L 5JZ7D 3S96B 3ZTJH 3OB0H 3IXAA 3GUTA 2K7QA 3QNYB 4Q74A 5L8KB 1VGKB 1F4XL 4S11A 2BC4A 4YDJB 2BSRB 1KG0B 1J18A 4K07A 1M71B 5IHZB 4JANB 4WHTB 1IC7L 3LKSB 5GS3A 3ZKSD 5DJ8B 3MV7E 5EU3B 4OLYL 1BMGA 4JQXC 1RPQA 4WHYH 2YBRB 4BSVB 3RGVC 2AXFB 2F5BH 2FGWL 1NC2B 2NYYD 2BNRA 3P4NB 1J8KA 2J6EL 2BNRE 5M95B 4UOW0 2AJUH 3GMOB 3GSRB 2AEIT 2IAMA 4MZ3A 2PO6B 3MUGA 3BRGC 3QCUH 1JPTL 5DRXB 2XV6B 5EFIA 1FH5H 2P8LA 3OGOE 3QZWA 1GGIH 3VMNA 5EOQL 3GKWH 2VLLA 5MERA 2AQ2A 3U30C 5FA4B 3L9RA 1N7ML 1BIHA 2FB4L 4PJXB 2GY5A 2MKWA 2G60L 3SDXB 3RWCB 4I1NB 4KKBC 5K9KB 3QUZC 1CG9A 3CDGB 3BQUA 3MRNB 5GHWH 3RVUD 5D9SB 3OKYA 5EBLA 3SDDC 5KVDH 4RMTA 2M8XA 5DQJA 1I8MB 2VDKL 4GRWF 1ZHKA 1A5FL 1CDIA 2DQFB 1GPOL 5JUEL 4TUKL 3BO8B 2AJZA 5SWZA 1IEAA 3T77A 5GGTA 3MJ7A 5SWZE 1MRCH 1KIQA 4ZUUB 2I24N 4X5WA 4P3CH 1S5IL 3SKJL 3BSZL 3JV0A 2DQEL 3VRLF 2J8UF 4BK5A 1EAPB 4FQ1H 4ZXBD 1HH9B 4OLZH 3Q6FB 5I71B 1Q94A 1S7SA 4S0TD 4MNHB 2OLDA 4PRDB 4E41A 4HXAH 3MUHL 2ZSWA 4NO2B 4E41E 2MQ0A 5D1QB 5D6CB 2NY4B 3JWOC 3KJ4C 2GK0B 5E0QA 5BXFA 1W0WA 5I1DB 4EI5C 2IPUG 4JAMB 4L3ED 4PG2C 3NFPA 4OGAD 2Y7QA 4U1HB 4G6AC 2CLRA 1NDMB 5T3ZH 1S7VA 5KSUA 5GJTH 1JWMB 3DROA 4OGYL 5BV7L 2HJLA 3SKOB 3HI6L 1A9EA 3QDMB 4UZGA 4PREB 5DVLA 2Z8WC 2FCBA 5DMKA 3ARWA 4D0CB 4C55A 1FYHB 4PJ7A 4M7KH 3NFNB 1RZJL 2ZUWA 4PJ7E 1TLKA 1NBYB 1E27B 1S7QA 4YPGA 4FQHA 4KC3B 1V7NH 4CMMA 3HPLB 1MQKH 3BIKA 4RCAA 5F1NB 2F53B 4LAQL 3JV4A 4PJFA 2CIKA 3FFCD 3K1DA 1J8HD 5DJAB 2YRPA 5JHLL 4LGSB 4OKDA 2DLHA 3UTTD 4PJFE 1BQHA 2P8PA 5ALBH 3O3EA 2QSCL 5J6GA 5FUZH 4WI6A 3QRGH 2NCMA 3IS0X 4X4XA 3S4SB 2IBZY 1AFVH 3MLVL 5KSAC 4R4ND 3U6RA 2GY7B 4Y19D 3PP3K 3GJFK 5FYJD 1SQ2N 5CZVH 4ODSH 3VRJA 1DFBH 3DXAA 2YKLL 3F8UB 4H0HB 3DXAE 3TN0A 3PQYA 1CLOL 1S7RB 4YR6A 1RIVH 1Q9LA 3UTSD 1DANU 3PQYE 1YN7B 3D9AL 3HE7C 4RAVB 1KCRH 5EO9B 4JFOB 3S98A 2CKBH 4R7DA 1OAUL 4PJHF 3T2QA 1T7ZA 3PWUB 4P2RA 4UOW1 5F89A 1LO2H 3PUCA 4P2RE 1IZKA 4HH9B 5FCUH 2YEZB 5E99L 1CFVL 1S78C 1IBGL 3HCVB 1DVFA 1IQDB 3CZFA 4JZJB 3SE3A 5D93C 5C0BD 5HYSB 4XXDA 2DF3A 2GJ6A 3IAPA 1FCGA 4NOBA 2GJ6E 2EDHA 3DI3B 2NW3A 2R8SL 3GSVB 1Z0NA 1CN4A 4FHBD 4ZOBA 4DOHB 3MRDB 4OZHA 3IFNL 4JPWH 4DGIH 5L2JA 1CICB 4OZHE 5JW4N 2XA8L 5ACMA 1KV3A 3HLAA 4C56D 4Q9CA 2C9AA 5I15H 2OI9B 1QFWI 1HHIA 2EDQA 4JFHE 3PXJA 4NKIH 4CADB 4MSWB 3SKMB 3K46A 4BFIA 5DS8B 3AROA 2FZ3A 4QTIL 4ZTPL 3HMWL 3DUSA 3VFPA 5E6YA 1HH6A 4KKCC 1FFOA 4K94L 2AS5M 1XR9B 5H2BB 4CMHB 3U79A 4HX1A 1AI1L 3DURA 3T0AA 1NC4A 1UFUA 4JRYD 4NQEA 4TSBL 2YXFA 2OJEA 4MJID 5I1AB 4NQEE 5C07B 5DSCB 5JPNA 1P1ZB 3VXUB 3UO1H 5HI3C 1I75A 2HTLC 2X1QA 2DWEA 3FQRA 4CW1A 5J8OA 2VQTA 2APWA 4NQCA 5DJYB 5TDNA 4F15B 1A3QA 4NQCE 1H3UA 3WO3B 4NC2B 1J0ZA 4WW1A 5IQ7H 4L8BA 3O9WB 3MO1A 3JXAA 4ZYKB 2R4SH 3AMLA 5DRNB 4ONGH 2DM2A 3FOLB 2HJKB 4HKZA 4YNYB 1NMAL 1WICA 5GGRB 3QI9B 2G9HA 1YY9C 4BUHA 4OKVB 5JHDD 2YRZA 3ILQC 3C5SB 3FTGB 3WIHH 1NEUA 1KCSL 5LG1A 1VSCA 4ZFOL 3IVKB 5AZEL 3QQ4B 2ATKB 1YC7A 1FZKB 4JDTH 1R5WB 1U8LA 1Z6JT 4XWGL 3LEYH 4FTVE 1V7MH 4WTXA 3VXQB 5DLML 4OV5A 1NGXB 1BOGB 4EIZC 3DRQB 3DWTA 3NCMA 1GC1H 1O7VA 5JA9A 5E6ID 1AQDA 1EXUA 5LAXA 4Z76A 1W0YT 1R3KB 3QUXA 5C0GA 5SWSB 4D94A 1FORL 4RFEA 4EBQH 3SDCB 1JYXA 4DN3H 4GG6A 4HF5H 5FOBB 4L3AA 1B6DA 1CGSH 2OTWB 1Q9OA 4P2QB 2WBJD 5DO2D 1I3VA 1R3IH 3U9PL 3KLHC 1G9ML 4N8VB 4PJGA 2W59A 5GRVK 2V5YA 2UY7A 1BM3L 4FABH 4PV9B 5DGQA 4R4BB 4NBXB 3S8WA 4K3DL 3TNNB 3O6FA 2DM4A 4QRTA 5E5MB 2O93L 4UUJB 1HXMB 3FO9A 1ZT4B 2P45B 2VLJD 4LCWA 4JCLA 5I1IH 5EZLA 5T5FL 4LCWE 5I18H 2DQIL 2P5EE 4HIEB 4PRAA 3E2HB 5ADPH 4HWBH 2IH1A 3LKOB 5CBEB 4TNWK 4PBXA 2B8OT 3PGFH 4WV1A 3BPLB 5T5NG 3O0RH 3SJVB 1CE1H 2JKXA 2VDRH 3VG9B 4H88L 4OM1H 3B83A 4KGJA 2QQKL 3NCBB 1FFNA 4JN2B 4KI5C 5K59F 2ZUQB 1NBZA 4JM2B 2HVKB 2UZIH 3OTTA 3FONA 4BQ6A 2ITDB 5CD3A 5CJOH 1U8IB 1IGCH 5DTFB 4ELMB 5F9JA 4CL7A 3BOVA 1QD0A 5IVZB 4A6YL 1EO8L 3K2UL 3KPNA 4Q9QH 4PV8A 1ES0A 5C3TA 1X4YA 3L3IA 4URTB 4JG1L 1J5OL 1KUMA 4V2CB 1NUGA 4JPVH 1BLNA 4YUEL 4RGNE 1YPZF 2HN7A 3TBWA 1G7LA 2DWDB 3GSNL 4OF5A 3W11C 1TZGH 3MLYH 4M6NL 4R26H 2DI9A 2HFFB 2XWJA 1A3RL 1BVKB 1EGJL 1RJYA 2X6MA 1PW3A 3KPRE 2CDGA 2ICES 2VAAB 3RJQB 1OW0C 5BCAA 5HD8C 4GAYB 4TSCH 2DQJH 3O2VH 4Y5XA 5L7XH 2AKRB 5DZOA 5A2KH 2V9QA 1A8JH 4DK6A 3G5XA 3I85A 2R2HA 5I1GL 4UILL 2EO1A 1MIEH 1U3HA 1JI2A 3VU2A 2X7LA 1BAFH 3TC9A 1J1XL 4TTDC 4I0PB 4NN6C 1GCFA 5HGGS 4GFTB 4RWYH 4HEPG 4P23A 3VA2C 5TDOA 3CVHB 5LJYH 1XGPB 5F96H 3EYFB 2GFBB 4G8EB 2A6JA 4HWNA 4NDMA 4ONHB 3VXTB 4J3TA 3NZHL 1WBYA 1LEKB 3EFFA 4LLMA 5CP3A 5C0FA 5JIPA 1HCVA 1BF2A 4DVRL 1BJ1H 1I3RA 4LVNC 4XCCH 3F62A 5TH2B 4DVBA 3DUUB 4U3CA 2BHYA 3V4VH 4WWKC 2ADGB 3PWNB 4XCEA 4W4OC 1W72H 3MV11 3SE9H 1I4FA 3HE6C 3W9EB 1FLTX 2DDQH 4YX2H 4KY1H 2W9LA 4Y2DC 3QIUC 3L3OB 4QY8B 3L3HB 2PO6D 2ATPA 4Q9BA 3WD5L 2CUMA 5C71A 4LLWA 3H3PL 2RQ8A 2A9MH 4X9BA 1Z9OA 2OP4H 4OCXL 1HHKA 3DARA 5HI4D 1DQQB 3S36X 4UU9A 1D3CA 1KJVB 1MFCL 2OBGA 2N7AA 5D7SL 4M7ZC 4HZLB 3QT2A 3ARDA 3SOBH 4G43B 4JY6A 1CFQB 4A2LA 5CGYD 5CSZB 1KTLA 4BELD 2B4CH 4TQEH 2WNGA 2R1WA 3VJ6B 1QSFB 4NQSB 2BVQA 1MAMH 4DZBB 1MCSA 3EDJA 4JY5L 3VFVB 2CDEA 2VR5A 4ZOCA 2AXGA 5KANI 5EOCH 5IF0A 1JZ5A 5CKAA 5D7LE 3BUTA 4HPYH 1C08B 3ZKND 3ZTNL 4UV7H 2BVOB 4K7PY 2KUTA 1MFEH 4QF1B 2PW1A 1LDPL 5T3XL 3D0LB 5GRUH 3S36H 5EU6D 4WTWA 4AEHH 2R1XB 3O8XC 3O6LL 4NQVA 4I18C 4NZJA 1MJ7L 4O4YL 2LE9A 1MJUH 2A77L 4YHLL 2Y5EA 2EXYC 5D1QD 3OGCB 2WWMC 2NY4D 3MLUH 2WIIA 4IRJA 3OKEA 2QLVB 4GW1A 2CJUL 4XNQB 2FHFA 2P47B 2VYRE 3D1MC 4DGYL 3RWDA 4EEEA 4F57H 5T5NF 5DYOB 4X7TA 1OAQH 2YD3A 2YN5A 3GUTB 5TFSH 4YBLB 1ND0A 2F19L 2Z31C 4HWZA 1RURH 3ARBD 3LCYA 1TQBC 2BC4B 2BDNH 4LLVA 4LQFH 3SGJA 4YPJA 4GQ9L 3V95A 3T0EA 3BKYH 3QDMD 3T0EE 3PV6A 5D8JH 2PR4L 2VISA 4LRNL 5F21B 2MSPA 5IGXL 2DQHH 2OTUA 4PJIE 3TP4A 3HZMB 2F53D 1HXYA 2ADIA 2BNRB 2ZOKA 3ZT6A 4G9FA 2OX5A 1QBMH 4POZC 2RIKA 4X8JA 4G9FE 1GGTA 1FZOA 2IAMB 5C92A 2E9IA 2MQCA 3U7WH 3H9YA 5HHVL 3MUGB 3D2UD 1CGXA 2FRGP 3NCYS 3VFRA 4OSUH 2P8LB 2OL3A 3QZWB 3W2DH 4OIIL 3MRMA 4FQCL 2VLLB 1A1MA 3MRQA 5JPMA 1PYWA 3L9RB 3U0PA 5IROA 3RX8A 1T66C 1TJGH 1WFNA 1EEUA 3GRWH 1CG9B 1QLEH 2ZNXA 3BQUB 4HBQA 3KPTA 4KMTH 5EBLB 4PB0H 2OK0H 4X8XA 1PY9A 5DQJB 3IETA 2VDLL 1JTPA 4PFEA 1A6VH 4M62H 4ZPTA 2AJZB 5DHVH 5SWZB 3T77B 2VDMH 4X0KB 2JJVA 4X5WB 2X1XR 1RVFH 4L8DB 3OJ2C 1JRHH 4MHHG 1YEJH 3SDAB 1UYWL 1CICD 1VFBA 4X9HA 4D9LL 3STLA 1CTNA 1Q94B 1S7SB 2O5ZL 3SKUD 1INEH 1T4KA 4YBHA 2PYEA 4E41B 4KKAC 5I0ZA 2ZSWB 4X7EC 3M1BA 2PYEE 1YEDA 4MA8L 4MJ6A 4XNZB 4MX7A 4XWOC 5BXFB 1W0WB 4PS4H 3ME0A 1VA9A 5C09A 3NFPB 2Y7QB 4RGOL 1YQVH 5C09E 3V5HA 4XNMA 4XH2A 3V4PL 5E4EB 2CLRB 4RFNC 2F8OA 4ERSL 1A6ZA 5KSUB 1CLYH 3S88H 4U1JA 1IC5H 3DROB 2J12B 3LH2H 1DCLA 3MQIA 1QSED 3FB5A 5C07D 2B0SH 3VXUD 5MHSE 4FQIH 1AXIB 4JHAL 1A7BA 1A9EB 3WFCH 3GHBH 5IBLD 4HBCH 1DJSA 4Z7UF 1KELH 5DMKB 5DR5H 1CVSC 4JQXA 4PJ7B 3DECA 3NFSH 3JWNC 5E9DA 2C3GA 2CO7B 3RGVA 1S7QB 4YPGB 4FQHB 5CZXC 5E9DE 4CMMB 1WT5C 3IDNB 5B38A 3BIKB 5IW6A 2VTFA 3O9WD 1PZ5B 4PJFB 3JV4B 5AG8A 2CIKB 1EJOL 3SGKC 5IBUG 3BKCL 2P8PB 3O3EB 2CK0L 3GI8L 1WQVT 1FVCB 3PIQA 1CGUA 3QI9D 3S6CA 5J6GB 1MCEA 4UDUA 4X4XB 2WLYA 1R6VA 3FRPA 2BX5A 4X4ZA 1SY6A 3DX8A 4JGMA 4KUCF 3U6RB 5E8PA 4Q9RL 1HKFA 3VRJB 3DXAB 4KAQH 2Q7YA 3PQYB 4PUBL 4YR6B 1Q9LB 3B43A 2VR9A 1CT8A 3QUZA 1CLZH 3J8F7 4M7LT 3RWEA 3SDDA 4N5EC 4BQ9A 1PZUB 2X41A 3O2DL 1KTRL 1YNLL 1MHEA 4P2CG 3KPOA 5JDJA 4AIZB 1FG9C 4P2RB 2E6JA 5F89B 4D0BA 3PP4L 4YE4L 4S1SH 4HUWA 5J3HC 4C58B 3TA3A 4NN7B 1DVFB 1HINL 1NBQA 3CZFB 1ZXQA 3BPOC 4G5ZH 4XXDB 3QNZA 4CVZA 1DUZA 4OD1H 3WHXA 4OD3L 2GJ6B 2RCSH 2VXVH 3SDCD 5MI0C 2NW3B 3BGMA 1RUKH 3BKJL 2H32A 2XFXA 4OZHB 3T3PF 4KQ4L 3OKDA 5L2JB 3F7YA 2PN5A 2DQGH 3DHMA 3HLAB 4FOMA 1XGQA 2EDNA 4XMPL 1T7YA 1HHIB 1WLHA 2R0KL 3P0YL 1BQLL 4BFIB 1MJ8L 4EI5A 4XP9H 4HC1L 2FZ3B 1IKNC 3DUSB 4D3CH 1HH6B 5LGKA 1FFOB 3UPRA 5F93C 4XHJC 5GRYA 3ZDXF 3QPXH 4WRLA 3HUJA 1A0QL 3HUJE 4KUCD 3DURB 5D70L 4KTEH 1NC4B 1SJHA 4NQEB 4HWEL 4FA8A 2OJEB 5JPNB 3SJVD 4MB4A 3EFDH 1KLUA 3NIGE 4LU5H 3MR9A 4JZOA 2SEBA 3EHBC 3FQRB 4U1MB 1QFWH 4CW1B 3TVMA 4HHAB 5TDNB 1F4WL 1T5WB 4NQCB 3E8UH 1EHXA 5KJRL 3ZKXC 4KTYA 1U92B 5J7CC 3GEWB 4L8BB 3V8CA 1KIUA 1MHHA 3GMNA 3MO1B 4KZEL 1CXKA 3MX0A 4HKZB 4PBVC 2G9HB 3WNLA 1LP9A 3UXFA 3MGTA 5E8EA 1KJMB 1RJLA 2UYLA 4OF7A 2H3NA 2IWGA 2VDOH 5CJQH 1KEGH 3S37X 2Q3ZA 2QQNL 1G7PA 2VLRD 5C6TL 3HE7A 4YGAB 2F5AL 4RISH 3CDCA 4WW2C 4HKXA 5DZLA 4FQ2L 2J3SA 1D6VH 1DBMH 1E4XI 1ZMYA 3WFHA 4JO2H 1U8LB 2JJSC 5JA8B 3BD4A 4N8CH 5IR1A 2I25N 1J0HA 1KB5B 5FYJU 4Y8AA 1OAZH 4I0PD 4OV5B 2LVEA 3RTQC 1A7NL 5F7LB 1P6AB 4EXKA 3DO3A 1HSBA 1MCOL 1MRFH 1AQDB 1EXUB 3MBED 2VL5B 3JTSA 4NP4H 3QUXB 5C0GB 3JV6A 3RNKA 2PW2A 3LKQA 3UTZB 1V3MA 2HT2D 3P0VL 4RFEB 4ODWA 2Q76A 4Z0XA 5HGAA 2VO5A 1NCDL 1KF9B 1BQHG 4JY4B 4R8WL 1NGZA 1FNFA 1Q9OB 2LFGA 1CFTA 1S9XA 3EAKA 4U6XA 2PXYB 1P2CB 2YUWA 5EDXA 1LGVA 2Y72A 4PGDA 5EZIL 4LIQH 3BN3B 4P57A 1EIBA 2MQ3A 2ZG2A 3G5ZA 1NAKH 1YEHL 3HNTH 3OF6A 3WLWD 1F8TL 5FHBH 1TZIA 4QRTB 3O81A 4TUJA 4CN4A 3JTTA 2YN3A 3G04A 3FO9B 3SBWC 4LCWB 3ARFD 5EZLB 1S5HA 1KOAA 1QVOA 3O3AA 4OFIA 1W0VB 5FKAB 4PRAB 4JM4L 4ZTOL 2IH1B 1BGXL 3I75A 1X5LA 4PGEA 2VRAA 4DUWA 4NSKA 5KW9L 1D6EA 3AMKA 1FO0L 4KJWC 1QHPA 2EDXA 1GOFA 4K8RC 3QWQB 1NLBL 2BHUA 1AGCA 1G7IB 4LDEB 1NBZB 1KNOA 5EBGA 4PTUA 2W9EH 3FONB 5CD3B 2VWEE 3Q0HA 3UYPA 5F9JB 4TPRL 1QSFD 2P24A 4L8SC 5DEZA 5TJWK 1B3JA 4XNXH 4N1HB 4PV8B 1ES0B 1YZZA 5F3HA 3L3IB 4ALAH 1K6QL 1VB9A 4RGNB 1AGFA 4WEBL 2DL9A 1BLNB 1C5CH 5HYJA 4HSQA 4QHUA 3ARYA 2HFTA 2HN7B 4JR9L 3TBWB 1G7LB 5HYJE 5ITBH 1OL0A 4HS6A 1HN1A 1XMWA 2XWJB 5IMOB 1RJYB 1UWGH 1MCHA 2V5SA 5C0JA 1OGAA 4H0GA 4JHWL 3RKDD 4NN5C 1OGAE 5C6WH 1OAYL 4Y5XB 1TDQA 4HUVB 2UWEA 1J0KA 5ESAB 3AS1A 2UWEE 3B9AA 2GSIA 2WWKT 3RHWK 4BSJA 4PPTA 3OL2A 2OSLA 3L5WB 1F58H 4JRXE 2CO6B 4ZD3L 4P23B 3LN4A 2JIXD 3W0WA 3MRGA 5SWQA 1DSFL 1YQ2A 5FCSH 1T22A 2A6JB 4GAFB 4LSUL 4NDMB 2XZQH 3FB6A 1OQOA 1N64L 1S7TB 4U7MA 3S37L 2A74A 3RVXD 3UBXA 3WSQH 1WBYB 3EFFB 4XVSL 3ZE1F 4LLMB 2AABH 3DMMC 3UEZA 1I3RB 5BZDA 1UC6A 3O6ML 4DVBB 1SEQL 1XH3A 4UAOC 1W2KT 3KR3H 4PLKD 4XCEB 2BNRD 4Q2ZA 4QHNB 2EC9U 1FGVL 1I4FB 2VJXA 5F7EH 1FG2B 4S1QH 3C60D 3AS2A 1D5BB 1NMCB 2XXCB 2IAMD 1HCFX 1JMZA 4PJCA 2ATPB 4LLWB 4PJCE 1N6QH 1HHKB 4Z6AT 1UM4H 3VFOA 2HH0L 4L5FH 4UU9B 5TQ2L 3C6SA 4U6HA 4QXTA 1RZ8A 2AJYL 1JTTA 5E2TL 1R3JA 4KMQA 3WE6A 2VZOA 4LEOA 3ARDB 1TVDA 2WK2A 4JY6B 4PJ7F 5HHOA 3I9GL 3QO1A 3DO7A 1KTLB 3BQUD 5HHOE 1TPXC 3S35X 3WIFA 5LCVL 3MV8D 2R1WB 1WSST 2LQRA 3ZE0E 4LQ1A 4LLYA 1P53A 2BVQB 1I1CA 4LLAA 3VH8A 4OI9A 4XPAL 5BMFL 1T7VA 5DT1H 2CLZA 4PJFF 2CDEB 3I2CL 1IAIL 4KJQD 4K23H 4H8WH 3GIVA 2D9CA 1NGPL 4UMGA 2FH6A 5IF0B 5D7LB 2X4TA 4ODVH 1EEZA 1JZ6A 1GGBL 3OBAA 4N0FA 5K9OA 5SWZD 4GRLC 1ITBB 2R4RH 2DD8L 3FB7A 3MRFB 4XC1H 1Q0XL 1YYLL 2PW1B 5IK3A 4U1SA 3SGEH 3NA4A 1E4KC 5DD0H 2Q8BH 5DMYA 2X89A 1O7SA 5KVGL 1S3KH 2OR9H 4NQVB 1FL6A 2I26N 2B1AL 3QUYA 5I1JH 3PHSA 4E41D 2X4NB 1VPOH 3KHOA 4PRBA 1N0XL 2CIIA 4IS6B 3H6JA 5I2IA 3S35H 2WIIB 4EOWH 1SJEA 3OKEB 4GW1B 4CU7A 5MEQA 2M1KA 3MLSL 1F6LL 1MCRA 4P0DA 2HA1A 3QEQA 4X7TB 4I9WE 1OPGL 3U2SB 1ND0B 3QEQE 4HWZB 2I9TA 1K5NA 3BVNB 4LLVB 2O5XL 2Y6SC 1FYTA 1UZ6E 1FYTE 3T0EB 4QEGA 4EUPA 3PDOA 2IBGA 4P4RA 3PV6B 3QXTA 4XP5H 4OZHF 3ULUE 4Z7QE 2VISB 4Y88A 3KJ6H 2CRMA 1JTOA 3KNBB 3PJSA 5CP7A 1AR2A 3DIFA 1NL0H 1YJDH 4PJIB 4NKQB 1H0DA 2OTUB 3DYMA 3HE6A 4XX1E 4OB5H 1JWUA 1HXYB 1B88A 2ADIB 3QIUA 2ZOKB 3V6FA 4G9FB 4JN1H 3QEGH 4X8JB 1FZOB 1LEIB 4Z7OE 1E28A 2OL3B 2Y23A 4OCWH 1KBGL 1LVEA 3DXAD 3MRMB 4P2YA 3ECBA 3INUL 1A1MB 3TN0D 1QRNE 1RIUL 1CBVL 3PQYD 1MEXH 3U0PB 3IFLH 1IGML 1D5ZB 5KS9A 2JCCA 5FAAA 5DRWA 5KS9E 5CINH 2JCCE 4P2RD 3NH7H 4ZS6C 4KVCL 3BDBA 1UH3A 2RBLA 3IETB 3QCTH 3QNXA 3FQXA 3T8XA 4G6JL 5FKPA 1PEZA 4HK3J 4TOYL 4XI5C 4OLUH 4PJ8A 1YYML 5AWNL 1JHKL 2CR3A 3R8BB 2GJ6D 1FRGL 3K4AA 2APFA 2ESVA 1ZK9A 4M61B 4OJFH 2ESVE 3WDHA 2E5EA 4MGXA 1DL7L 4I18A 4IOFC 5EBMA 1T21A 2D4FA 5FDWA 1O5DT 4XBGA 3STLB 5F9WB 5BOPA 1JF1A 4JFHD 1T4KB 5IG7A 2PYEB 5C0RL 5ERWA 4YO0A 3P4MA 2AERT 2JE8A 4MJ6B 1UM6H 5KVDL 4MX7B 4CAGA 3BJLA 4NKMA 1DEEA 2D03H 1G84A 4KK6D 3GMLA 5C09B 4OFPA 3S34H 3V5HB 4XNMB 4AM0A 4YHOL 4H25A 1NC4D 1A6ZB 5JW4Q 3VWJC 5A2JH 5EULV 1S9YA 4AMKL 2D7QA 5B4MD 3FB5B 1DQTA 1MQ8A 2I9LA 2NQCA 4GG6F 5TE6L 3WKMH 3M8OL 1K8DA 7CGTA 1I7TA 1YDPA 2K1MA 3VFTA 5E9DB 1QQDA 4NQCD 3RGVB 2BVYA 4PJGF 3TO2A 3WFDH 3WNMA 5C70A 5B38B 3UP1A 5IW6B 1BREA 5E03A 2ARJA 3FQWA 4WI2A 1H9VA 5IFHH 1DBKL 3THML 1JPGA 1H15A 3PIQB 5F8QC 3F6IA 4WTZA 4UDUB 3WXVH 1T1WA 4P46A 2BJML 3EO0A 1A6TA 2ZUUA 3DX8B 1VFMA 3H9SA 5E8PB 4EDWH 4Q97A 4DWHA 2UVEA 3H9SE 3U30B 4GAGL 4NNXB 5E8DH 3B9KC 4BK4A 3GMPA 3FZUD 2Q7YB 1AQKL 4TNVK 5B8CC 4CUCA 2KZWA 1CT8B 3QUZB 4GH7B 3RWEB 4F37K 4XPFH 3CX2A 4K3EH 4J23A 4JEGB 1NQBA 4NJ9H 3KXFA 1MHEB 3KPOB 3KXFE 3GSXA 3AU1A 1LO3L 4D0BB 2DM7A 2WUCL 3VDBA 1UWXH 1MREH 2L7UA 2EZ0D 1VHPA 4J7RA 3TA3B 4NZDA 4RGMC 2XTJC 2WBJC 3IFOA 1LK3H 3QUXD 1G7JA 3P9MA 3QNZB 1NCAH 4Y89A 4CVZB 1OTSD 3WHXB 4XTRD 2VL4A 1TJIH 1KB5H 2R29L 3JV5A 3BGMB 4MQ7A 2H32B 2XFXB 5FYKE 3OKDB 2AEQL 3F7YB 1L9NA 5E08L 4UTBL 4JRWA 4O58H 1XGQB 2KDGA 4YDLC 4KVNH 4MJ4A 5CWSB 1ZVYA 3NACH 2H26B 5CIPH 4EI5B 3L3JA 2FECL 3F6LA 3P3YA 3ZKMD 2WSKA 2OCFD 1OD7A 3WUWG 4G9DA 3O6FD 5FYJL 5I66A 2L7JA 4J1UA 1OTTD 1IGJA 4KV5F 4LCWD 4I48B 3HUJB 4MA3A 4OLWH 4KU1A 1EAJA 3A6CL 1RZ7L 1SJHB 3O45A 5DMIH 3UPCA 1J87A 1M6OB 4YC2B 3TJEH 5EBWA 3TPKA 4LKCA 4WNQB 1DR9A 3ULVE 1KLUB 3IB4A 5FB8A 1B4JH 1LQSR 2HLAB 1EO5A 3MR9B 4U2ZA 3UTQA 4JZOB 5DJXB 4PJ9B 4QWWD 2SEBB 2FO1A 4DGIL 2WV3A 3SCMC 4AL8L 2FX8H 3TVMB 4Z8FL 2DIAA 1WT5A 5EZOH 1JF5A 1MCWW 3W9DA 5C7XL 2YD2A 3SGKA 1BWMA 4XBEL 1MHHB 3GMNB 3KS0J 3OZ9H 1N2RA 3DVNA 5CILH 1J1OH 4RGND 4QHMA 2ZZUT 1WISA 3VWKC 4WFFD 3MNZA 1LP9B 2BVEA 3KHQA 3MGTB 4M1GH 5ECJE 5E8EB 3O6KH 1RJLB 2JB6A 2UYLB 4UQ2A 2H3NB 4AG4H 4D9RD 3IXTA 3MLZH 1ZLSH 1G7PB 1X5KA 2V7NA 4HS8L 4IDJH 3HE7B 3WFBL 3BEVA 4YQXH 3U48A 4PP2A 4HKXB 4LCIL 3PV7A 1XGRA 4I3SH 2ICEA 2VB5A 5HTSA 3WFHB 3UCRA 3TJHD 3QBTB 1U3HD 12E8H 1T1XA 4DFIA 4Z77A 5TPWH 2NY0B 4YDIL 4YHKL 1KIPA 4BQBA 4QOKA 1OD9A 2R4SL 3WLBA 4GAJL 4P23D 4QOKE 5HDQL 1HSBB 3MODH 3UBXI 1CQKA 3QXWA 2I5YL 2XRAH 4PB9H 3N50A 4P59L 3JV6B 3RNKB 3VFUA 2PW2B 3ARPA 3LKQB 4ODWB 2Q76B 1Q8MA 4Z0XB 5HGAB 3WJLC 5GRJL 5FK9A 4BFEA 4CVUA 4PR5A 3PHQB 4JQIH 5D2LA 1IAMA 1NGZB 1XCTA 5D2LE 5E8NA 3IDYB 1K3IA 1S9XB 5JR1H 4U6XB 1QFUH 2IGFH 4ACPA 3AM8C 2MPAL 3T04D 3VGDA 1J88A 4LHUG 1IKNA 1OB1A 1FL5A 4P57B 1KLGA 3MRIA 1JZ3A 1JFQH 1B90A 1G6RL 4KJPD 3G5ZB 1QOKA 3UROR 1TZIB 4HIHB 4TUJB 2R2BA 3JTTB 1FE8H 3G04B 2DL2A 1S5HB 5EUOA 3O3AB 1QVOB 3BT2H 5EUOE 2A9NH 4QGYA 5F9DC 1NBVH 3I75B 4PGEB 3ULSA 1I9RL 1D6EB 2EIDA 4XB8A 3ARDD 4O5LH 1GAFL 3MLRL 1AGCB 2R2EA 1IAKA 4DW2H 2DLIA 5IFAL 4GLRI 1NPUA 1HQ4A 3K4ZA 4FNLH 2NTFB 4U1KA 2P24B 4QHKJ 4XAKE 4KPHH 2EH7L 2R0WL 1G6VK 1Z9MA 3QSKB 1SEBA 1ZEAH 3DGGB 1AGFB 2V5MA 5FFLA 1YY8A 3QXVA 1AIFA 5GPRA 1B0RA 3GFUA 5TE4H 5HYJB 3K80A 4QHUB 4ZO6A 5BQ7A 2Y9RT 4HS6B 1LO0L 1FDLL 4MS8D 4KQ3H 4BH7A 5D1QC 3ZHKA 3IAQA 1GZQA 5HGHA 5C0JB 3WFZA 2FO4A 1OGAB 4C57C 3HAEA 1MCLA 2HRPL 4QTHA 1LMKA 4MJ5B 2JJSA 2UWEB 1S7WA 4H20H 3MV9E 4ZDHA 1TCRA 4AZ8A 2GSIB 1Z0MA 3H7LA 3G9AB 5F1IA 3BP4A 4IRJD 3RTQA 2VXTL 4DTGH 3Q2CA 2EECA 2ZKHH 1MUJA 2OSLB 4ZFFA 2Z4QA 2I60L 3LN4B 2K3TA 4RBPH 4P2OC 1GHFL 2AXJA 3GSWB 3MRGB 5IMKA 3LQAH 1UM5L 2WM0A 3OSKA 5B22A 3T0DA 2XQBL 3FB6B 4MD5A 1MWAA 3T0ED 1P9MC 3VD4A 2E7MA 4XP4L 2N56A 3MLXL 2A74B 3OPZH 3UBXB 3H9HA 1KCVL 1FAIL 5BZDB 1E6JH 3P9LA 4XPTH 4X7CC 3WMSA 1XH3B 5J11B 2EDLA 2AJXH 1A22B 3GDBA 2C3HA 1R0AL 3SBWA 4G9FD 3T08A 3STZA 5E2UH 4F80A 2H41A 3HZKA 1WVZA 4OLXL 1QO3A 4PJCB 5GGVL 5JXEA 3A6BH 1DE4A 3S3SA 1JI1A 5F96L 3FO1A 5D1ZA 4DGVL 3VFOB 2EO9A 1NUDA 3B9EA 3C6SB 3KYAA 4U6HB 2HKHL 4QXTB 2KBGA 1R3JB 2KZ1B 3MUZ1 3WE6B 1QLFA 4KROD 3C08L 3VGFA 4U1LA 1DANT 3CLFH 5HHOB 3AREC 4MWFB 4JZJC 3QO1B 5I17A 3DO7B 3WIFB 4L8SA 1AO7A 4NQXA 4LLQA 1ADQL 1KENL 1KB9K 1I9JL 4LLYB 3V8OA 1DQLL 3QJFA 3VH8B 5HVWA 2L4OA 2VQUA 4L8CA 3RVVD 5CEZD 2CLZB 2VITA 1HEZA 1KYOK 3GIVB 2LU7A 5IVOA 2X4TB 4YX2L 1EEZB 3EBAA 4KY1L 1ZLWH 5K9OB 4QRPA 5GS0H 5IFJA 4QRPE 2OI9C 3FB7B 1S9VB 2A9ML 2B2XH 4FXGA 3GJFB 2HFGH 5F72S 5EO1A 5IK3B 4U1SB 4ESKA 4XPGL 1YNTA 4CMHC 5FECA 4FQQA 1FL6B 3QUYB 3N0PB 3F7VA 1ORSA 4PRBB 2CIIB 5DA0B 3VXRA 5I2IB 1JGUH 1KCKA 1SJEB 3KYOA 3VXRE 3CFJA 1KULA 2VUYA 5IBLC 1G9EA 1YEGH 3QEQB 5C0CA 5C09D 2GJZB 1A6WH 5C0CE 2I9TB 5DJ2A 1K5NB 2WINA 4NPYA 3ROLB 4JFDA 1FYTB 2QQQA 1CD0A 4F15C 3MMEA 5MHSD 1MJJB 4JFDE 4FN0A 1P84J 4Y5YC 1JYNA 2RB8A 4NFCA 3DMMA 4EUPB 3O9WC 3PDOB 3REWA 4JE4B 5IB5A 3QULA 1GOHA 1PAMA 3L5JA 4GW4A 3VFWA 1WEJL 5ID0A 4K7FA 3PJSB 4CU8A 4WGVB 2DJSA 5DQDL 1H3XA 5SV4A 1CCZA 4LPUA 3RGVD 4GSDH 3DIFB 1IGYA 1L7IL 1KN2H 1WWBX 1J12A 3HE6B 1RSFA 2IQ9H 5FHAL 4AH2A 1JWUB 1JN6A 1WC7A 3QIUB 3V6FB 3K74B 3QDJA 1WZ1H 4P5TC 4RMWA 5DEFA 4YXLH 5BS0E 2QSQA 3QDJE 1AP2A 3HUJF 1X5GA 5F7HA 2VH5H 1F02I 1E28B 4LFHD 1MH5B 4JFZL 1SYVA 4JKMA 2VNCA 1XF5A 3Q1SH 3NIGF 3VFMA 2DKMA 3R06A 5F7MC 2R2CA 4ODXA 3QUZD 4WHDA 5D8JL 4DKDC 3SDDD 4YDKH 4HAFA 5KS9B 2JCCB 1OY3B 4OCYH 1FL3A 2HWZH 4XNYL 5DRWB 1SY6H 2D4DA 1BWWA 4XPHL 4LCYA 3SDCC 1P4LB 3QNXB 4JO1L 2B7DT 3FQXB 3MRLA 4GRLA 3TA3D 4YXHH 4OZFG 3MA9L 1UEYA 3TF7C 1EHNA 1G0DA 3FQNA 1GGCH 3NCEB 4FP8L 4WY7H 4G8IA 4PJ8B 1LP9F 2FX9H 4WU5A 5I75B 5D72L 3VXME 2QHLA 1KC5H 4AEFA 1RU9L 3IDJA 2ESVB 1EMTL 5IEKA 1CLCA 3MCG1 2GK2A 3IJYB 1UG9A 4NKDA 4G7YH 5EBMB 1T21B 5FDWB 4OFDA 4TVSa 4XBGB 1ACYH 3SHSA 1JF1B 1VGEH 5IG7B 4DKAA 4R2GB 5ERWB 4YO0B 3P4MB 3GRWL 1QLEL 5DUPH 4EI5D 4MXWH 1YEKL 1DLFL 3BWAA 5TQ0L 4PB0L 4OGXH 5KVEH 4NKMB 2WUBL 3BPLC 3RUGE 1DEEB 2HRLA 1CDGA 1PFCA 4K2UH 4NCC1 3GMLB 1FSKB 1FNAA 3RY4A 4KDWA 3JWDL 5AAMA 3BAEH 1NCWL 4H25B 1N5YL 4JM2C 3IDMB 1MY7A 1S9YB 3ARTA 2BRRH 5C0AA 4F7MA 2EH8H 1CDBA 4JPIA 5C0AE 2I9LB 4KK5C 1NJ9A 5B21A 4M48H 5DD3H 2CKBA 1K8DB 1I7TB 5TF1H 3VFTB 2VIRA 3L6FA 4WDIB 1QQDB 4KTDL 3BP5B 3TO2B 1X5JA 3T09A 4DQOL 4NRXA 4HCRL 1FNEA 4I3GA 2ARJB 1Q9KA 3FQWB 4LPYA 1M7DA 5KSBA 4M5YH 1C5DA 2VDQH 2IQAA 4QXUL 5KSBE 2AJSH 1H15B 1R5IA 5F9OH 5I19H 1T1WB 4P46B 1A6TB 1C5BL 1ERNA 3H9SB 5J0BA 1MCBA 2FSEA 1IC5L 1RJZA 3V5DA 2ZNWA 5DJZA 3HA0A 2FX7H 3GMPB 1MFAH 3B2VH 4OF0A 4LHJB 3S3JA 3HE7D 4NM4H 4HXBL 3GHBL 2OXHA 3PGCB 2IFFH 5FM4A 2YHGA 1PG7W 4GMTH 1CR9H 4WFHE 4GJTB 3KXFB 1NAMB 2IPTH 4YHPA 4X6DA 3WCYA 3AU1B 4DCQB 5ETUB 3EJYC 4UINH 2PTTA 2VZSA 2YD9A 1KJ2H 2NY2B 2X9WA 2Y06H 1EFXA 3IFOB 2VQ1A 1OCWL 2GW5A 1A02N 1K4DA 1G7JB 3CSPA 3P9MB 4QRQA 4BYHA 4M7JL 3UJIH 2BOBA 3DX9A 2GT9A 2NY5H 4NC1E 1NCTA 2X4QA 2XZCH 4B50A 4EN3C 4X4ME 1WAAA 1JF6A 4MQ7B 1ZGLP 4OT1H 1WAAE 2VXUL 2P42B 2FL5B 3HS0B 1F4HA 2XN9D 2UWEF 2EDRA 2BNUB 3RY5A 3QH3A 1Q9WA 1ROWA 4U6YA 4B7LA 4KKCD 3ZDYF 1NH6A 3HC3H 3B5GA 5I8OH 4OCLC 3OF6D 5F7DA 5JOFA 5C9KA 2APTA 4G9DB 2IF7A 3O3DA 5I66B 3U0WH 4J1UB 2VUOA 1IGJB 1FNHA 2NZIA 3MOBH 4MA3B 1CIUA 2P46B 1NEZG 3LKNA 3V0WL 5DJ6A 4R96A 1Q38A 1I7ZA 3LQZA 3WIHA 5IMMB 2W0FA 5EBWB 3V7AG 1OP5H 4H5SB 4LKCB 4ODTL 2DS4A 4K3JH 2HTLD 5FB8B 4M6AA 3UTQB 3U4BH 1HNGA 3MOAL 2AJ3A 3QXDA 4P5KA 2XICA 3C5ZB 2IG2H 2VDNL 3L7EB 2C1OA 3OKLA 4QNPF 2XG4A 5ICXA 2IADA 3W9DB 3M17A 4HK3N 1N2RB 5JDSA 3DVNB 1NSNH 1YMMA 3DHJA 5LWYL 2MNUA 1YY9D 3CXHJ 1JNLL 1YMME 3UYRH 5KSVA 2HG5A 5HYJD 4PJCF 3ILQD 1IKFL 5FIEA 3RA7H 5GIRA 2BVTA 3B9KA 2JB6B 4UQ2B 1NGYA 1FVEA 3IXTB 2EDTA 1OGAD 5B8CA 1UJ3C 2X70A 3RWIA 3CLEL 2V7NB 3BEVB 3ZT7A 4PP2B 4ZFZA 2FEDC 1XGRB 2ICEB 1HQRA 3MACL 1QFWL 1XGTA 4ZAKC 3Q6GL 1T1XB 3ZE0F 4G6MH 4R7NA 5HVHC 3HRPA 4Z77B 5E2WH 2V6HA 4I2XA 1MPAH 1IQWL 1KIPB 3D25A 4QOKB 4ZFGH 4I2XE 4PGBA 3WLBB 1AE6H 2XKSA 4N90E 2XTJE 1FPTL 4Q7DA 3W0WD 1J05A 4HWBA 3OAUH 5C0EA 3EYQC 5ANMA 1OP3H 5F6HJ 5MI0B 4GQPH 5ANME 4U6TA 5FK9B 3MRJB 4PR5B 5D2LB 1T7XA 3QWRA 5GSRA 3KLHD 2XKNA 3LMJH 1UKTA 5E8NB 1JWSA 4KRMB 2BVUA 3X12A 2AP2A 2EDDA 1SBSH 3FO2A 4RISL 2NXYB 3L5IA 3AFLA 1OB1B 1FL5B 1A47A 4JO2L 1KLGB 3BISA 3MRIB 4JKPL 4NUGL 3EOTL 2GTZB 1BJ1J 1LD9A 2WIMA 3TNMA 2NNAA 5EB9A 1BZ9B 3NABL 5EUOB 5LVEA 2ZCLH 1U93A 5L88L 1X6LA 2XG5A 1EEQA 5CLWA 3KPPA 2YPLA 3MGOA 5JORA 1TETH 4PGZA 3GSQA 3ULSB 1X5XA 2H1PH 2OYPA 3RZCB 1A14H 1CDYA 3SCMA 3ULUF 2D3VA 4NHCL 4L29A 2R2EB 5C1MB 1IAKB 4P3WA 5E8OA 5HHOD 5TGBA 3OKNA 2K7PA 2IJ0C 3CVHL 3LN5A 2Y25A 1I9IL 1TZHA 4JHZA 4N68A 4U1KB 3MLWH 4TYUA 4UT7H 2VE6A 5LXGH 1KPVA 1SEBB 3LS5H 4N0YL 3SDAC 3VWKA 5ADOH 3W11D 3VD7A 3F7PC 1F4YL 1YY8B 1AIFB 1AJ7L 2X44D 4APQB 2ITCA 1EV2E 5IOPA 1JHLL 1WBXA 4IRSC 5EA0H 1Q1JH 4BH7B 1K2DA 1BVZA 1XF3A 4KKLD 3D87B 4L1HA 1GZQB 4YK4C 5HGHB 5EOCJ 2FO4B 3MJ8A 1JPSL 5FM5O 1L6XA 2X89D 3HAEB 1BEYH 2NY6B 4QTHB 1DBJL 4J3UA 3MV9B 2F54E 3QUYD 4U0RB 5L8LB 1KG0A 1S7WB 2DMBA 2C26A 5E4EC 5F7KC 4ZDHB 1YJDC 15C8H 1TCRB 4KK9C 4HQQL 5GRXG 4MD0A 5KS9F 1W72A 3NBNA 2JCCF 2XTLA 5F1IB 5INCB 3BP4B 3GJFH 1SYSA 1MUJB 3QAZC 4ZFFB 4ODBD 1KJ3H 3QEQD 4HFUL 2Z4QB 4HT1L 1QUNA 4DKEH 5IMKB 2W60B 4ZNEA 1KTDA 5JNYA 1FQ9C 3WJLA 1FYTD 2AXFA 3PWJA 1NC2A 5DWUH 4Q6YA 3P4NA 4YHNA 3T0XA 2FLRT 1HYSC 3GMOA 1HZHL 3ULUD 3H9HB 2J4WL 4Y4KA 4I3RL 3AM8A 3BPCA 3P9LB 4MDJA 4WWKD 4XP1H 3VA6A 4JFEA 5I30L 1MHCA 2P49B 3KVQA 4JFEE 5KTEL 3HE6D 4OGZA 4WI4A 5E00B 2I27N 3QIUD 2EEDA 3STZB 3CXDH 3ULUH 1A3LL 1UT9A 3SDXA 3HZKB 3RWCA 2IPUK 1QO3B 5IBTH 1T0MB 1TJHH 1DE4B 2JELH 5D9SA 1Q72H 2BFVH 1VESA 4U1GB 4NO0A 3FMGH 5HYIA 3QFDA 4ZG1A 3FO1B 5KVFH 1S7UA 4RIRA 2UY6A 4U0QB 5D1ZB 2WBKA 2DQCH 2XZQL 2EYSA 1V8HA 2ZCHL 4CRPA 1S9WA 4G6FB 1QLFB 3UTPD 2R15A 4S10A 1GZPA 4U1LB 1DVFC 1PKOA 5D2NC 3SE3C 4ZO9A 2C7UB 5EOTA 4P3DA 4MB3A 4LSQL 2W65A 4LLQB 4NQXB 4Y0GA 3QJFB 4HH8A 3FN9A 2MKLC 2VITB 1HEZB 2IBBA 1B6UA 3LHPH 3ZYOA 1HIML 4PRDA 1PX3A 3UC0L 5DURB 3K0WA 4QRPB 3T4YA 3VI3E 4LP4A 4PJ8D 5IFJB 3H7BB 1U8OB 5BV7B 5CJ5A 4FXGB 3RDTC 2ESVD 5EO1B 4TNWF 3O8XD 1DLHA 5L9DH 2ORBL 4C59B 3H0TB 2EIZA 1I85A 4KK6C 5JIHA 4H1LG 5FECB 4FQQB 2EXYD 5F7YC 4A2MA 2ZCKL 1JWMA 4BZ1H 1ORSB 1ZWIA 4R2GD 4M9OA 9CGTA 3VXRB 1J86A 3O41A 1MVFA 4KDVA 1G9NL 3CFJB 5B4MC 3NTCL 4D0CA 2Z31D 4P2OA 4LASL 4LSVL 5C0CB 3REVA 2E9BA 3DYOA 3K8KA 4TTGA 1MCPH 3N9GL 1IL1A 4XAWH 5DJ2B 1AR1D 2WINB 1TXKA 5I8KL 4GKNA 4NPYB 4JFDB 5I6XB 4NFDA 3CFBA 3MMEB 5FYLH 3GK8L 3DMMB 4KH2A 4JB9L 3QULB 5IB5B 2E6QA 4P5MB 4LGPB 5HHXH 4GW4B 4JO3H 5DJ0A 3VFWB 1L7TL 3JBG7 5ID0B 1QR1A 4K7FB 1UWEL 2D2OA 1LNUA 4UAOB 3LPWA 4E5XA 1IGYB 3LB6C 1O0VA 3OKKA 1FFPA 5GGTL 4AH2B 2YRLA 1JN6B 3FN0L 4POZD 3LZFH 4YXKH 1WC7B 2VERN 2CMRL 5DHVA 3ALPA 5BS0B 3BKML 4MNGA 3QDJB 4RAVA 5I16A 4Y8DC 5DEFB 4MNGE 4P9HL 3T1FA 3MUJA 2UV3A 4P46D 2QSTA 1BP3B 3H9SD 4R3SA 5LKNA 4P99A 1SYVB 3CFCL 5D7KD 1XF5B 3VFMB 3IJSA 1T66D 3O4OB 3R06B 2EZ0C 1OHQA 3AREA 4ODXB 2QQLL 2JJTC 5B39A 1A2YA 2AGJL 3KXFD 1ZOXA 3QUXC 1FL3B 1VFAB 1YJDL 4XTRC 4LCYB 1UB5A 1SM3L 1AXTL 5T1LA 3TESA 4M6ML 1NGQH 3TGXA 3WNPA 3KG5A 3TV3H 4N5UA 3MRLB 2YMXH 4GRLB 6FABL 4HS3B 2FJFA 2FJHB 2PXYC 3FQNB 1UA6L 4G8IB 1C7SA 2DBLH 5FO7A 3VXMB 5IB2B 4WU5B 5CCKH 4AENA 1NAMH 4MVBC 5J89A 5IEKB 1RUAH 2OZ4H 3KWWA 1XR9A 1MVUB 4JVWA 3D18A 4PG9A 4NKDB 3O2WH 1A1NA 3VMPA 2YD8A 4KKAD 4F3FA 2DKUA 1JYWA 1NFKA 1FBIH 3GJEA 4C4KO 4M5ZL 1U8HA 4X7SH 1S8DA 4XWOD 4F33A 1V3JA 3V4UH 2EE9A 3BWAB 1HOCB 3RUGB 5I74C 3FHQA 2CGRH 1CXIA 1ZLWK 4NQDA 1KXVC 5FYKH 3PXHA 5HVFB 2BSED 4PGJA 1A7PH 1XAUA 2VXSH 4KHXH 3S5LA 2Q8AH 1Z3GH 3X3FH 2XWTA 1CK0L 4IIQB 4LPCA 2FLBT 4Y5YA 5C0AB 5BZWA 4JPIB 2EDYA 2FATH 1LEGB 5T33H 5ESQA 3FOLA 1NJ9B 2HJKA 3M07A 4FXKB 5CUSL 4Z0BH 5D2LF 3HMXH 3MCLL 5D71L 3G9VA 4LEXH 4RGNC 5CZXD 3TO4B 1MCFA 2V2WA 2VIRB 3L6FB 4NOFA 5LGJA 4PY8I 4S1RH 3C5SA 3FTGA 4LSPH 2V5RA 1QYGL 1MY5A 2MFNA 4NRXB 3RPIA 4TVPH 1PKQA 4P5TA 3EYSL 1FNEB 3ULVH 1JZ4A 3MJ9L 1Q9KB 1PKQE 4NYLA 4WHYG 1M7DB 5KSBB 3MTRA 4X4YA 1C5DB 2IQAB 2EEBA 1JGVH 3QHFH 4Y5XC 3LSOA 3WJJA 1DQDL 5EUOF 5GGQL 1VACA 3TJHC 1JZ8A 2FSEB 4OTXL 1RJZB 3V5DB 5DJZB 3MXVH 4FZ8H 2EEAA 4BKLB 3DRQA 4N5ED 5DHXB 4P23C 1IJ9A 5B3NA 3QPQC 2HTKC 5SWSA 4ZSOE 1HSAA 3P4LA 4N9OB 1DQMH 4UTAL 3LEVL 4NZTL 4N1CA 3PL6A 5J1TC 4XPBH 2D7NA 2NXZC 4Q0XL 3WXWH 4YHPB 43CAA 1KPUA 1OM3H 3H2WA 2DTMH 5J3HD 3TWCH 3ELAT 3TZVA 3MROA 3TM6A 4QOKD 4AQOA 2PTTB 4N8PA 4ZUVA 1JJUA 4FQXB 1CF8L 2A1WH 3L5HA 2FR4A 1EFXB 4XC3L 1T0NA 1K4DB 1ZAGA 4QRQB 1PLGH 4O9HL 4HWUA 2BOBB 1H3PL 4M4PA 3DX9B 4R4BA 2GT9B 2O61A