4BFGA

Structure of the extracellular portion of mouse cd200r
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
190
structure length
190
Chain Sequence
PLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CELL SURFACE GLYCOPROTEIN CD200 RECEPTOR 1
publication title Structures of Cd200/Cd200 Receptor Family and Implications for Topology, Regulation, and Evolution
pubmed doi rcsb
source organism Mus musculus
total genus 41
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2013-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF08205 C2-set_2 CD80-like C2-set immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bfgA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bfgA02
4H0GA 5F3BB 5TF1L 3VXSA 1Q9LB 4PRHA 4RIRA 5E00B 3VFTB 4I3GA 4H25A 4JM4H 3LOWA 3BGFB 3C2SA 1I8IB 2AJSL 4LAQH 3FO0H 5I75B 1UXSB 1GGYA 4HUUB 3VFNA 3KDMB 3HE6D 3IGAB 2YXFA 3PJSB 3C08H 4JHWL 1PW3A 4R4BB 3V6FA 1X5JA 3WO3B 2XZCL 4KUCD 4HPYH 2DJ4A 3EZJB 5JA9A 1A9BB 1PLGL 3HB3D 5D1ZD 3QWQB 3LQZA 4PJGF 3K8KA 4DN4L 5EUKA 4TSBL 3PGDB 3MXWH 3NIDE 2BVYA 2W59A 3TN0C 1XIWA 3O6LL 3FZUD 2AK4B 5DD0H 4OD2B 3KYMB 5BO1L 3ZDYF 4ZXBC 5ESVA 3PABA 4PYHA 1J1OH 4QWWC 1NFIA 3T4YA 2WBJA 3MRHB 4G9FA 3WLWD 3RVXD 4KZDL 4QT5B 3VFSA 2ZNWA 4Y16C 2E9BA 1KB9J 3QUZB 4LLMB 4WHYH 4ONHA 1ZLVK 2D7OA 3MRRA 1XF5A 3H42H 5C0CE 3QDGE 1IKNA 2CLRA 4D0CA 5I8EA 4I0PB 3UYRL 5C2BL 4QHKI 4PGEA 1YNLH 3MX0A 4NDMA 2IG2H 3PWPB 5FHAL 3UDWC 4N68A 4NM4L 3GGWA 2BNQA 4P46A 1AQKL 3V6OA 5D93C 3WO4B 1KOAA 4HV8A 1ZLSH 1NLBH 3MUJA 3B9EA 1N0LA 2H2SD 4P23D 2ZUQC 1KN2L 2AEPL 3LIZL 3TWCL 1A14L 2EKSA 3HE6C 5JQHC 4R4FL 4ONGH 2R15A 5I1DA 3AS1A 2R2HA 3MRFA 4JHBA 4LVNC 1CI5A 2A6IA 2HH0H 3CFKB 3HB3C 5D1ZC 5K93A 1LDSA 4F7TA 1GIGH 3IDYC 1TZGH 1U92A 1IE5A 4I3RL 3IJYB 4OFYA 3BEWA 1UZ6E 1N6UA 1MWAB 3QFJD 4FFWD 3VCLA 3MLSH 3WFCH 1RZKC 4ODHH 2APBA 1PKQB 1TTFA 1LMKA 4H26B 4P9HH 4X9IA 1PQZB 4X4YA 1UT9A 1EUUA 1BHGA 3UYOD 1CLCA 1INEH 1FZMB 4UMGA 3O81A 3O11A 4LCYB 4QF1B 2XZAH 3FQUB 2V7NB 2GHWB 3BOVA 4OZHF 5L8KB 1BVLB 2X05A 2MPAH 2RIKA 1JGDA 2JELL 1QHPA 2FLBT 2H41A 2IPUG 1AHWA 4YBQC 4P9ML 4QHMB 5L7XH 4RMVA 2D7MA 3WL9A 3K80A 2X4QA 4YE4H 4NCC2 5GIRA 4KRPB 1OPGH 3O2DA 5TE7H 3N1QC 1T83A 3BZ4A 1YY8B 2ERJB 4ZUUB 3HC4L 4PJDA 2Z8SA 4XXDA 2ILLA 1MNUL 3OF6D 3PNWA 5ECJE 3QB7C 5EDXA 3KNBA 1Q9WA 5J11C 2YZ8A 4P23C 4HC1H 4JG1H 5DJ0B 2DM3A 5LG1A 3FO2B 3QJHA 4HBCH 1MWAL 3I6KA 1F13A 4UINL 1BPVA 3IKCB 1VSCA 3HI6L 4C58B 4JPVL 5FYLE 3FQRA 4RGOL 1FPTL 5H2BB 2Y7QB 3PWLA 3TV3L 3GBNH 2PW2A 4X80L 2F19L 1KN4H 2R2BA 3WUZA 2HTLC 2GTWA 2YD7A 3VFMB 4Y5YC 5C0JB 3FT3A 5D71L 3G9VA 5CINH 2HJLA 5HHMB 4PJHF 4G6ML 2GYSA 3B3IB 2OSLA 1SEBB 2PXYD 3D18B 1OAXH 1P84K 4DCQB 1JNHA 5BRZE 1AQDA 5DQ9A 4CADA 7FABH 4LKXA 2XWBA 5A2FA 3QUYB 1H3GA 1K2DA 1P53A 4LCWA 4BJLA 2V6HA 4OUUB 1M7XA 2FBJH 5D2LB 3CPLB 4XMKH 2YPLE 3IJSA 5DHXB 3HZKA 1XCTA 2DMCA 3NABH 3T4AA 1TQBC 2I5YL 1OW0A 2RCSH 4ZYKB 4XPTH 2ZOKB 3L95A 1YPZA 5FM5O 4DKEH 4F80A 3SE4A 4HIXH 1MHEB 3QULA 1AJ7H 4L8BB 3BWAA 1XH3A 4XP9L 5HYEA 1T0MA 4Y0GA 2GJ6A 4EZMA 4ETQB 5D7JB 1A2YB 3C60A 4BH8B 3MV9A 4PGBB 4GAGL 3MNVA 3OAYH 4LDLB 1N7ML 2G60H 3MNWB 1N6QH 1NEZA 5F1IB 4M8QA 4ZD3H 4QHLA 4GG6E 1MCQA 1QG3A 4NP4H 4KRNA 5K9QI 3OMZA 4IRJB 2R0LH 4PLOB 4X0KB 1R3LB 3DX7B 4LSTL 1F4XH 2OP4L 4EDXA 4XAWH 3WHE1 5D7SH 4LDOB 4K9EH 3BQUD 5KJRL 2OQJA 4PJ5A 3VWKB 4PRBA 3S36L 1R5VB 3QEGL 3TF7C 4YXLH 4JKLA 3TPUB 1AGFA 3IDMA 2J88H 2EIDA 1KB9K 3VFOB 3VFGH 2IH1A 3Q3GB 6FABL 2CLVB 4UNUA 3QRFM 5DUML 4QHNB 5L9DL 1HKLH 3I2CL 4OJFH 2O5XH 4GMSH 2YPVH 3TJHC 1NMAL 4G8FA 4JAMA 2FJGB 2H6PB 1S7XB 5DJXA 5IKCB 1J12A 3QXWA 5J3HD 4JREC 4Z7WB 1IARB 4IMKC 5FUOL 3OKDB 5HHVL 3ARGD 4LHUB 3N1MC 5C8JA 5DJ8B 1JZ7A 2AQ2A 4ODTH 1RY7B 4M5ZH 1JYXA 5HYSB 2Z0BA 4GBXB 4L4TA 3MRQB 3R0MA 4MDIA 4MCYB 4OCWL 4DGYH 1PGRB 5KANI 2V2TA 4WO4C 3F6LA 3KPSE 3UJTH 1QSFA 5FYJU 1P9MC 2JB5L 3BP4B 1D5ZA 4LGSB 4PG9A 5E08L 4N0UB 3BYYA 4OGAC 1EPFA 2FECL 3X13A 4D9QE 2CDGB 3T8XA 4U6HA 1G7JA 5IHLB 1S7TB 4NUGL 5T1LA 4HH9B 4U7KA 1ZA3A 5E9DE 1JGEA 2F74B 1FL6B 5C86A 1OAUL 4KROD 1PEWA 4UB0L 4CN6A 1I7TA 1HE7A 1MAMH 4N8PA 5GS2D 3BQUC 3ULUF 3C2AL 4AZ8A 2GCYA 4PLKD 3WJLA 3MCKA 1GL4B 1N59A 1YQVH 3A6BL 4JKWA 4CN4A 3P2TA 1I1FB 4Y19B 4MJIB 1ES0A 3U7YH 1QA9A 1FNGA 1G9EA 4LPWA 2P24B 3L5XH 4WY7H 5HHNB 3TBSB 3GSVA 5F70A 3WS6C 2XACC 4NN5C 3LRSB 4L9DA 3NTCL 5D6CA 2F15A 3MFFA 1LEKB 3BKYL 4NQSA 1YECL 5ISZA 2JJUA 2UWEE 1IC7H 4TOYL 5DRNA 4PREA 1S7QA 4QRSA 2WWKO 5IBLD 2EE2A 1IQDA 1NCAL 2KL6A 4QCIA 5D2NB 1VHPA 4FZEL 3V7AE 2V2WA 5JHLL 3BIKB 1VPOH 4EXPX 2K7PA 4Z78A 5DRWB 5D5MF 4QXGL 4LCIL 4LSRL 1Z9OA 4ZMAT 1MPAH 1QSVA 2VLJA 4D0BB 2XN9B 3S88L 2C1PA 5FGBC 1F42A 1UH3A 4S1RL 4PJEB 3AXLA 1EHLH 1BD2A 5IOPB 3L3JB 2BMKB 3STBA 1ND0B 4NHUB 2ESVE 5I73C 4K8RL 3IJHB 4H8WH 3FQWA 4JQVC 4XHJD 3BPOB 4KQ4H 1RUMH 2WK2A 4XWOD 4HG4J 4X5LA 3G6AB 3LS5L 5CZVL 3O9WD 2COQA 4PJGA 4PJCE 3RWHB 4Q0XL 5D7LA 3MQIA 4X4XB 4MDJB 1KPRA 1CTOA 4FABL 3MCG1 1A6WH 4FQXC 5TE6H 5JNYB 2CD0A 4L4VA 5IK3A 4RBPH 4WUUD 3ARYA 1LDPL 4ZFGL 2RJMA 1NKOA 3UTZA 1G1YA 2WWKT 2G2RA 2HKHL 1MJ8H 1T1WA 2A1WH 4L5FL 1WK0A 5DJ6A 2J4WL 2KPNA 4N5EC 3O3AA 4IJ3C 3THMH 4K55A 4MA3A 1PG7L 3TT3L 3WFBH 3O6FA 3B2VL 4IRSB 3FN9A 1NEZG 2BRQA 5JW4Q 5C0BD 1KPVA 5LAXA 4LSUL 4K7PL 1UM5L 1MLCB 3QIWA 1G9MH 3ARBC 3TO2A 1ZA6A 4E9LA 3KPRA 4XMLL 3VWJD 1OGAA 2YN5A 3FB6A 4P2RD 2NY0B 2R4SL 1UA6H 3K4DA 4ZO7A 2DWEB 5A16B 2ZSVB 3KPPB 3NCMA 5SWQA 3JTSA 1MOEA 1WT5A 1LK3H 1H15B 4HK0B 4Q9RH 3OG6B 4HWBL 2B5IB 4XWOC 1J11A 2QQKH 4S1SL 4J12A 1LEGB 4XCNB 5DXWA 1CGVA 3SJVD 1AIFA 1KPUA 3DUSB 4HW6A 1C5CH 4NN7B 3TO4C 5CKAA 5I1IL 3MLZL 1DQDH 4ISVA 1UEYA 1BBJA 4IIQC 4LIQL 1NAMH 3FQXB 3VFPA 1T4KA 2YD4A 5I18L 5HHPB 1F6AB 4OZHA 3UROR 1EX0A 1VB9A 1AO7E 3U30B 4KUCF 1NMBH 4OCXH 5IFAH 4MNQD 1GC1L 4BSVA 5DMIL 3BIAX 5EOQH 1URLA 4DGIH 5KSAA 1CIUA 3RIFK 3HZVB 5I0ZA 4ZS7H 4POUB 1NUNB 2DQIL 3NFPA 4G9DB 1FRGH 4WFHD 2VXVL 3EO1A 2GJZB 5DJ2B 5EU6D 4FQ2H 1CXKA 2Z8RA 3L5JA 4PY7A 3EDKA 1AGCB 2D4FA 1GPOH 1G1CA 2VKXA 4HWZA 3PF2A 5FYKL 4IM8A 2KDGA 3ILPA 1F8TH 3L3DB 5T1DH 4K2UL 2WZPD 1MH5B 5CJ5A 5B4MD 1C08A 2XRAH 4XVJL 4LPVA 4HFWB 1MFDL 3RZWA 4D3CL 2DQCH 4P49A 4NWUL 4WEBL 2HVKA 2X9XA 1H8NA 4QRRD 4U1IB 2DIBA 2X4RA 3PL6B 1DN0B 1FBIL 3FRPA 1K5NB 4ODXA 3FN0H 1YMHA 2FB4H 4J3TA 2VR4A 3C6LB 3OG4B 3DO7B 4EOWL 3ULVH 3FT2B 2F9BT 4OCSH 1ERNA 2D31B 2VUYA 4LKCB 3IYLW 5DSCB 4KK6C 2Z31B 4KK9D 4U2ZA 5BCAA 4ZS6D 4PJHA 3GBML 1G7IB 4OI7A 2ITCA 4X6EA 2DQEL 2V5MA 1C1EH 4PB0L 2BNRE 4M6MH 4HIJA 2ARJQ 3BKML 4K3JH 1F4WH 1CICB 2CR3A 3GSRA 1L0YA 2OK0L 4H8WC 4Y1AE 1PZ5B 4JB9L 4GKSA 5FK9A 2BY2A 3RAJH 1ZGLM 4DTGL 3SKMB 4JFHE 5JW4R 4UDUA 5DD5H 3UTTE 1RUQH 2N7AA 1A4KA 2WLYA 5T5FH 5CBAA 3BKCL 4FQHB 2QR0A 1IM9B 1FVDB 3DURA 1T22B 2IAMD 4EN3C 1V5JA 3NZHL 5GS0C 3O8XB 3HHRB 1U58A 2EECA 5IW1B 3DXAE 2NY1D 3BMWA 4LLQA 3GMMA 5FKPA 1J0IA 1HQRB 4WHCA 1QLFA 3GK8L 4YR6A 3KPNA 1DLFL 1HXMB 4MLIA 1T2JA 5EU5B 5T1KB 1BF8A 3L3IB 3WFEH 5DURD 4HLJA 4JFFD 4UILL 4XPBH 4HSQA 1FO0A 4Y4HD 5CIPA 4G8GE 4OQ1A 4F2MB 4HG4K 3WIHA 3RVVD 1S9WA 1VGKB 5FOBB 1YJDL 4IMLA 1UWXH 5JLZA 4WUKL 3H9SA 3FFDA 5E99H 5MEOB 4UIMB 1EXUB 1CLYH 1G9MC 1IGIL 5JR1H 4QYOA 4FG6D 5E8OA 5MEQB 3KJ6L 3PGCB 1NLDH 4KK9C 4G6AC 4A6YA 4BZ2H 2DJUA 4L3EE 5CP7A 3MLUH 2BXZA 1OLLA 1YNTA 2FNBA 3VXME 5D1QD 5EPMA 2NY2C 3UC0H 3KXFE 3ZO0A 3JWOH 5J1AA 3SGKA 3G04A 3U7WH 4XNZB 2LVEA 1DBJL 4HS6A 1TMCB 1XCQB 4AL8L 4KHTH 4N1EA 2D0GA 5MI0C 5AYUL 5FKAB 4YHIB 5E5MB 3AY4A 4PLJC 4LSDA 3RWGB 2EO1A 5H94A 1ODAA 2HFGH 4O2EB 2VLLA 4NQCD 1A0QL 3WNLA 4XBGA 5JHDE 3MLPA 1A7RH 4NQDA 1XEDA 1KJ2A 2IAMC 4Z5RB 3ULVD 3MXVL 4CMMA 4RGMC 4IDLA 1H3VA 2XPGB 3D25B 4BYHA 4DN3L 2BSRA 5TQ2H 1QRND 4JFZL 4BZ1H 3BXNB 4O51A 4V1DB 4QEGA 4O02H 3EYUH 4MAYC 4YLQT 3INUH 1A6ZB 2Y07H 3QAZC 4K3EL 4HGWA 2WANA 4XCEA 3SGJA 3WFDH 3D69B 4J4PC 4FP8L 2JJWA 4DKFH 2JF1A 1N26A 32C2A 3EOTL 1I8KB 5C0DB 5KG9B 3IRPX 1F3JA 5MHSD 3DGGB 3PQYB 4NQXB 4FTVD 4OFPA 4DQOH 2Z35B 5EZOL 5LGKA 4XZUA 5E6YA 3LQAC 1JK8A 1U3HD 2IBBA 4MQ7A 3T0EB 3GMLA 2EH7H 3MRDA 3LPWA 2QHRL 1MRCL 4I77H 3EGSA 3ALPA 2EDHA 4LEOB 1PSKH 5L2JB 3BE1H 3BT2H 1MCIA 5D1QC 1E4KC 3CFEB 4QTIH 4QRPE 5L2KA 3T65A 1H5BB 4QOKE 4J3WA 5GZNC 2O61A 3KLHD 4NJAL 5F1KC 3EFDH 5FO9B 1RHHA 4OQTA 4GW1A 3QCUL 1K3ZA 3MV01 1UJ3C 1EFQA 3H3BC 1F4HA 4YHLH 4WDIB 3JZ7A 4EUPH 3S96A 4KJYA 1X5LA 3KYKL 5F7DB 3O4LD 1K8IA 3NAAH 4NO3A 5FYJD 2HVJA 2J6EA 1MCRA 3ULVC 3FRPG 5D9SB 5C9JB 4PRDB 2H45A 4OM0H 1FDLH 2VITB 3ES6B 2OMNA 3BO8B 2XZQL 3AS2A 3RWIB 5DD1H 1IGML 1UFUA 5D5MA 1HHIA 2PYFB 2ZNXA 4KUZH 4OD1H 4X5WB 3O45B 3VXNA 2Y6SD 3GSUB 4BFEA 4M7ZB 3RWJA 2CXGA 1FZKB 2OXGA 1U6AL 3X14A 5MEND 1B3JA 4N0FB 4Z7VB 5HGHA 3LB6C 2FH6A 3QEQB 3QO1B 3UTPD 4JFOB 1XF2B 3L3KB 5FECA 3EYOB 4PYGA 1EEQA 2EYSB 1TETH 1IGCL 2WBKA 5FIEA 5CEZE 3DV4A 3VE0A 3MRLA 3BP6A 1FNHA 4L4JA 5DJCA 3SDDD 2ZUTA 3OR7B 3R8QA 2NR6D 3P0YH 5KW9L 3BZDA 3ARXA 4IOSD 3NGBC 3O41B 4R26H 1JPGA 4N9GA 4Z0BL 3CLEL 3MV7E 4NPYA 3HMWL 3MR9A 4D8PA 4N90E 2LTQC 2NXYC 3OKNA 4OTXL 3U4AA 3ULSB 2B4CH 1MI5D 3D39D 1CK0H 2AJXL 1FNEB 1U8NB 2BERA 1Q9KA 3OZ9H 3VXUD 3H3PL 5CJXC 3FOLB 4NRZB 4NC0B 1FN4A 2DKSA 5CJ8A 3GSQB 4OLWH 4YXHH 4YHPA 2VDNH 3TNMA 1RJYA 3TIDA 1CL7H 4U6XA 1MF2H 2FX7H 1AD9B 1UC6A 4BFIA 2MSPA 2FWOB 3TN0A 1MEXL 1J18A 5A3IC 4X6DE 3U4BH 2GUOB 2ICWI 1OF2B 2CLZA 2ZCHL 4ZXBA 3JWOC 3FQTA 3I6GA 3A67H 5ACZA 4QRTB 3B5TA 3LCYA 1UGNA 4Y16A 4RMWA 2CRYA 3W11C 3HNVL 4YDIL 1HWGB 3HCVA 1FZJB 2KQNA 4LF3B 1U91B 4WW2C 5TGBB 4TYUA 4M62H 2R8SH 2UVEA 1MFCH 2PCPB 3TA3B 2YEZB 1YMME 3DOSA 4BELD 3DTXA 3SQOH 2VDKL 3SDDC 5FYLH 4MQTB 1IC4H 5GSRA 3QG7L 5E2VH 2XYCA 5IMLA 3UDWA 2WM0A 3KPOB 2BSSB 3QDGD 2YD3A 1X3DA 1SM3L 4XNYL 1A6VL 1R3KA 1T1YA 4MZ2A 3W2DH 3DYPA 1AY1H 3HE6A 5BZWA 3AGVA 4PJ7E 4PGJA 1CL7I 1T03H 3MZTA 3LKRA 3X12B 1Z5LB 2E6PA 1JZ8A 4ELMA 5C0AB 2ZSWA 4FQLH 5D1ZA 4TUJA 3J8F7 1R0AL 3WXWL 4TTGA 1OM3H 1FL3A 4UV4H 5TDNB 2DQJL 1U95A 2YUZA 1ZLUH 1AD0B 1G7MA 4L8SB 5AZ2L 1S78C 3NIFE 4X6CE 3HE7B 1NDGB 3HAEH 1WAAF 5JIPA 5CEXA 5B8CB 1DVFD 1XGQB 3GJEA 4GUPB 4KKLD 2QKIB 2VH5L 2D2OA 3K3QA 4MX7B 1EIBA 3LKOA 1CVSC 4JO2L 2BC4A 3GHBL 5BS0D 1QFWI 2PYEE 3UJJL 5EB9A 1FYTB 4J6RL 4A2MA 5C0FA 1OARL 3OGCA 1CXLA 3MLYH 1JP5A 5HI5C 4N0RA 2BHZA 4D0DB 2OJEB 2DOCA 3HPJA 4NN6B 3ZHLA 1D5XB 4U0RC 4MNHA 4FS0A 3TZVD 4H88H 1RIUL 4LARL 3VFVB 2P5EB 5IIEA 1DTUA 3RTQC 5C0GB 2EDLA 4P23A 1JHLL 1S7UB 1JHTA 1W0WA 4JQIH 5DA0B 3BUTA 2W60B 1JWSA 5CJQL 2R69L 4I8DA 4NHCL 2IANE 3L5WA 1U8PB 4QHUB 3MYJA 1YEFL 3VXSE 4PRHE 1RK1B 1GGIH 1ITCA 2C1OA 5HDLA 5FCUL 3EUUA 2A83B 2NLJB 3T09A 1OVZA 1EHAA 1C8PA 4Y5YA 4NQEB 4G6KH 5EA0H 1F11A 1ZVHA 3RWCB 3HRZA 4GO6B 1HWHB 4KKLC 3QQ4A 5IR1A 1REIA 5EO9A 2VZ3A 1UKQA 1ONQA 2DQGL 3HUJB 3T3PE 1EGJL 2E7HA 3F8UB 1X5YA 4CVXB 2Q87A 3S37X 3SO5A 1ED3A 5I17A 3V5DB 3IDIB 3RZCB 1LHZA 4QXUL 1BVKB 2RFXA 5DEFA 2BDNL 3GSNB 5DQDH 4K3DH 2QADD 1HNGA 2NZ9C 2VXUL 4ZG1A 4OGYH 5GPRA 4PJ9B 3VDCA 3E1F1 1D5MB 2KH2B 4L9LB 3DUUB 1KTKE 2EEAA 3VG9B 1EFXD 2V5SA 1EJ6A 2N56A 3PP4H 5H35A 3TZVC 1N5AB 2XNAB 3OF6A 4YGVA 3JWDL 3P77A 2PO6D 4OSUH 2F8OA 1OSZA 3QPXL 4RFNB 1BQLH 4JCLA 4PJAF 1Z9LA 5EBLB 3ZE1E 4XX1G 3MOAL 5LCVH 1ZT7B 3HS0A 1LP9B 1INDL 3EYFB 3QRGH 1H3TA 4UUJA 3ARDB 4GKNA 3IT8D 5C0RH 1MJJB 4KVCH 4Y8DC 2HT3D 3BDYL 2CGRH 3GKWL 1P7QD 4HF5H 3MV8B 4F7PA 5EUOB 2NNAB 3L3GB 3L1OL 4POZC 2VN7A 5DVKA 4JVWA 4LIQE 4OLYH 1G6RB 4CVWA 1W0VB 4W6YB 3M17A 3FAWA 1DLHA 1VCAA 3GSNL 2AXGA 1AGEB 3SN6N 4JM2B 1CU4H 4P5KB 1IGFH 3IDJA 3QWOA 4QRQB 5D96C 1CGSH 1I7ZA 1LO2L 1UZ8B 2HT4C 4M5YL 3O3EB 1ZVSB 4XPGH 2GIYA 5CP3H 5DK2A 5BXFA 1K85A 3S98A 3QFDA 2VXQL 2P7TB 2QADC 1T80A 2NTSP 5K9OA 5AAWA 4R4NC 1ZHNB 1EO8H 1FIEA 3NMEA 5IMOB 4W6WB 4G7YL 5E8DL 4TPRL 3EYQC 4AENB 3DROA 4R97C 5JW5A 2IF7A 2AV1A 3AC0A 1ACYH 4GKZA 4Z77B 3CSPA 3DI2B 4NFCA 4IMKA 2PO6C 1CT8A 4O00A 4BQBA 2JCCF 1X5ZA 1FAIL 4NQVA 2JKXA 1UYWL 3MRIA 4U05A 3WIIH 4OGZA 4JFED 3PG2A 2F5BL 1G6RL 4WO4A 1KBGH 4WHTA 3BZEB 4KK8D 3VJ6B 3VH8B 4KXZH 2EH8H 2GT9A 2EDTA 1P9MA 2QLVB 1P2CB 1FIGH 4HX1A 4TRPH 1I3UA 5GISL 2VLRE 3IETA 5GRWA 2CJUH 3F7VA 4MJ5B 1ZEAL 4XGZB 3BQUA 3W5NA 2H26B 3OR6B 3BH9A 3QNXB 1QSZA 4HPOL 1GYAA 3RQ3A 1CFTB 3LEXA 5JXEC 4Y8AA 5LQBH 4R0LC 1M7IA 3UMTA 4XCFH 5I6XC 3WS6A 4I5BB 1QNZH 4GG8B 4R90H 1I7RB 1CWVA 3IVKA 1QTYT 4RQQA 1IQWH 3N9GL 4GRMA 2OL3L 1G9NL 4E0RA 4ZTOH 3BGMB 2FJHA 2VERN 5D72L 1X5KA 4Q9QL 2O93L 1V3KA 3VFRB 3E6HA 2BNUA 2ZCLL 4XNXH 3ULVF 5HHOE 4D9RD 3V4VL 4Y4FD 5ID0A 1DQQA 3ARGA 2LABA 3RJQB 4D94A 4NRYB 4FQJL 1JV5B 2NYYD 3D2UD 3HI1A 4PRIA 4OUOA 2I60L 5FHBH 1NH6A 4S1QL 3O6MH 1UXWB 1EO7A 5FM4A 5I9QB 3CFJA 4LBEB 1MHHB 5DEGA 5FGBA 4WU5A 1Q38A 4NQTA 4Z7QF 3SBWC 4C56E 5CILH 1G7PA 1NGYA 1TVBA 3DPBA 2DS4A 3WN5B 1BIHA 4PJFF 5AG9A 1QSED 3AUVA 1OAKL 1B4JL 3JXAA 4JQVA 1ZKAA 1DBMH 1YPZE 5DT1L 1A47A 3H0TB 5IF0A 5HPOA 1QFOA 5KS9E 1YYML 2YXMA 3WHE0 2P8LA 3VRLE 3SPVB 4MSWB 4EQ2A 3D85D 4Q58C 3CFBA 2W9DH 5AWNL 3GB7A 3CSGA 3PGFL 1KIRB 1ZGLA 4MCZA 2GTZA 3W39B 3RL1B 1D9KB 4N0YH 1OOAA 2CXKA 3QH3B 4OCMC 5KVFL 4TSCH 5KSBB 4WHYG 3QWRA 5IB5A 3NCJH 1OHQA 3VMOA 1M6OB 5AD0B 3ZL4H 1GZQA 1UB6A 5F1NA 5FF6B 5JDSB 4X9FA 3RL2A 3MJ6A 3WKML 3QUMH 4K7PY 3CDGB 5TF1H 4O9HL 5FUZL 2R1XB 1A7QL 5SWSE 4DZ8A 1JGUL 1RJCA 4M1CC 5IBTL 3QJFA 1T7YA 3CCHA 3ET9F 2ICES 4QY8B 4K23L 4JHWH 4WW2F 2XZCH 5KVMC 1V3MA 1PLGH 4L4TE 4C55A 3O9WA 4OZ4A 1UWEL 2HWZH 1NGXA 5C0EA 5K9KB 1T21B 4AT6B 2H9GB 4NBYB 3TO4A 1WAAA 4DN4H 3KS0J 1OWWA 4TSBH 4RRPA 3WBDA 2A9ML 5FB8A 4YIQB 4YQXL 4WUUA 2R4RL 4JG0H 4M02A 5FGCB 5BO1H 4OD3L 5GRUH 3QA3A 3QHFL 5C3LD 2WINA 5GGSA 4OV5B 3DIFA 4U3XA 3G6JE 4OCNC 4JPWL 5F7LB 1U8MB 3QUXB 3I02A 3WHXB 5D1XD 1L0XA 4P2OD 1H3PL 5HVGB 3ARZA 5INDA 1PG7X 5C0BA 3MRNB 1XAUA 3UYRH 1JWUB 2GSIB 5C2BH 4K7PX 4HJJL 4XBPB 4EI5D 5FHAH 2CO7B 4NM4H 4WWKC 1I3GH 3MV11 1C5DA 5ANME 1AQKH 4J2XA 4R7NB 3U79A 1HSAA 2NY5C 3MGAA 4OIBA 3VXPB 1X4YA 2IFFL 1VACA 3H8NA 4ODVL 3JV4A 2UY6A 2IBZY 3NIDF 4M8VA 2ADGB 4P5TB 5BZDB 1KLGA 5EC1A 1DUZB 2Q6WA 1KN2H 2AEPH 1CE1L 3LIZH 3TWCH 5CGYD 3HG1D 1XF1A 4R4FH 5C08E 4YUEH 4LCCC 4DGVL 3MRPB 5CHNA 1XGUB 2E5EA 5EBWA 2P5WE 3QG6B 3LKPB 3QDMB 3QO0A 3E8UL 2X42A 4AIOA 4I3RH 4ZAKB 4Y5XC 2OXHA 4NUJB 4R2GC 2Z93B 4MJ6B 5C2UB 4JRYE 3QEHA 1HKFA 3O3DA 4HGMA 4FXKA 1F3RB 2EDYA 3UPRA 3KLAB 4JE4B 4J8RB 5K9QG 4P4KD 3QDJB 4JLRB 4UQ3B 2DN7A 1MSPA 2MOVA 3LHPH 2Z92A 3VXTB 1PG7W 3UTSB 2JELH 4OZIB 2FGZA 5IM7A 4L4VE 5F9JA 2P1YA 3MRBA 3AS3A 4Y5VC 2VSCA 3C8DA 5E94B 2A6DA 1R6VA 4P9MH 4Z7VE 1ZLWK 1OTSD 3D9AL 3V95A 4YHNB 1R3IL 2I26N 4OZGB 4R7DA 4RIRB 1HI6B 2Y4SA 4EN3A 3TYFB 3PP3H 1UM4L 4K94C 1UZ6F 3FO1A 3EYSL 1MNUH 3BPLB 4U1LA 1WWWX 3VFNB 2IBZX 1JZ2A 1X7QA 4LHJB 1AE6L 3V6FB 3DHMA 4OFIA 1MWAH 3B2UC 1WC7A 1NCBL 3WFHA 4UINH 3U9UA 4RWYH 1BQSA 3MLVH 3HI6H 4QRRA 1ZOXA 5IB1A 4JPVH 5JUEH 1BOGA 4FFYL 4RGOH 1W8OA 1FPTH 3HTLX 2EE9A 4RMRA 4PJBB 2FEEL 3TV3H 3ZKXC 4X80H 5EUKB 1YEDA 2J8UE 5C09E 4UU9A 1KXTB 4NRXA 5DZNA 5KANG 5D7IE 3VD9A 2WUBL 4G8IB 5ESVB 3PABB 4ETYA 3QCVL 1YA5A 3ZKQD 5D71H 4YDLB 3W5MA 1A21A 4G9FB 5HHQA 4G6MH 1RULL 2DLFL 4ONHB 1QO3A 4Z7UE 1GGCL 5F7NC 2WLZA 3MRRB 1XF5B 5I71B 3IDUA 2X6MA 2CLRB 1I75A 1RZ7L 4D0CB 5I8EB 1FLTX 5HYJA 3I9GL 1Q9OA 4PGEB 2AK4D 2CK0L 4NDMB 3SKUD 4F8QA 4I2XA 5SWZE 1A5FL 3GGWB 2BNQB 4P46B 1M05A 2IAMA 2APWA 1I85A 3G5VA 4YDKL 3SE3C 3Q0HA 4F8TA 2FEDC 5TPWL 1NAMA 2JCCA 5JOPD 2W38A 4KMTL 5FYKU 2YS4A 3RP1A 3RVWD 2I5YH 4RRPG 2EKSB 2C3WA 5CEZH 5F21B 5IBUG 4MAYA 3PDGA 5I1DB 3MRFB 4JFFA 3RWEA 3QEUA 1MVFA 1OQOA 2G75B 1A1MB 4E41B 4I0PD 4OLUL 3D1MC 4LQ1A 3I3BA 3W82A 5CMAA 3RWFB 4Y4HA 3PWPD 3OX8A 3BEWB 3TBWA 4GAGH 2FBOJ 3VCLB 1T6WA 2EXWD 1N7MH 3OAUL 4X4YB 3ZE0E 4KJQC 3KJ4B 2YD5A 2OTWA 2OP4H 3MUHL 4X83A 5D1QA 1E4KA 2BCKA 2YUWA 3V8CA 5T33L 3S36H 3UCRA 5F9WB 4DJMA 3NCEB 4XAKE 4BKLA 1JGDB 4JJ5A 2P42B 1J0HA 4YXKH 1ZWIB 6FABH 3BW9A 3WL9B 1YEJL 1O5DT 2X4QB 5L9DH 2ENSA 4NQCA 5GIRB 3WJJC 3O2WL 3LRHA 4EIZC 1NCCL 1FYTE 1F02I 1T6VN 2Z8VC 3IXTA 4IRZH 4PJDB 1AXSA 4M03A 4XXDB 3PNWB 3EDJA 1KEGL 2HLFD 1HOCA 1T5WA 3KNBB 4LLUA 1Q9WB 3B9KB 1QRNA 2IPUK 4JFDA 5FUOH 4KKCD 3QJHB 3BX7C 5HHVH 3VI3E 3QNZA 1T20A 1MCJA 4M43L 3I6KB 3VW3L 4JFQA 4I0PC 3FQRB 2X4TA 1P6FA 4OCWH 4KRPD 2PW2B 3NN8A 2R2BB 1WJ3A 1CFSA 1YZZA 2GTWB 3BP7A 4PJFA 3QXVA 3PDDA 2JB5H 2EXWC 4WENB 5E08H 3I3EA 1U3HA 3W9DA 4OLVL 3P11H 3D0VB 4NUGH 4ZFOA 1WBXA 2HJLB 3VG0H 3OKEA 1BJ1J 3S4SA 1OAUH 5IB2B 4UB0H 2OSLB 2VLKE 1EHXA 3C2AH 3FB5A 4TULL 2KKQA 5CS7A 1JNHB 4X4MA 1AQDB 3O2DL 4CADB 4M3JA 5EN2B 5I1GL 5E8PA 2XWBB 4OBSA 1DUYA 3G08A 1K2DB 4LCWB 5AZEL 4UOJA 5IV2B 3NTCH 3BKYH 1YECH 1BFVL 3O4LA 5HHMD 5CJXA 3IJSB 1FQ9C 3HZKB 4TOYH 1XCTB 1YEIL 4RFEA 3L6FB 1E6OL 5JPMA 3C09B 1QYGH 3MRMB 5MERA 1IEHA 1NCAH 1X5HA 3ZE2F 3B9VA 3L95B 4FZEH 3FFCE 2CMRL 3KAAA 3QULB 4HKBA 5JHLH 3RGHA 1FNFA 4DKDC 1GGBH 3BWAB 1XH3B 4KV5E 1T0MB 4QXGH 3IU3A 1L6XA 2GJ6B 4LCIH 4LSRH 4CUCA 4JY6A 3C60B 5IB3A 3MV9B 3MNVB 4NYLA 4YHYC 2VWEE 5MENA 2ERJC 2B1AL 2OR9L 2RB8A 3IFPA 1KJVA 1LP9E 1NEZB 1U8KA 3CIQA 4M8QB 3U2SA 4WW2A 5DD3H 4RZCA 1L4IA 3QIBD 1J8HE 4MMXC 1JZ3A 3SDDA 5CZVH 4JVUA 2W65A 4PJ5B 4PRBB 4Q0XH 1BEYL 2ITDA 4XTRC 1Z9SA 5D7JD 2EDRA 4CU7A 1TZIA 3QQ3A 1YMMD 5LXGH 4HGKC 2E7LC 3EDFA 4PPTA 4XPAL 1S9XA 1LDPH 2WQ8A 4ZFGH 1XGTB 4U3HA 1UCTA 1MI5A 3D39A 3K1DA 3RPIA 4CMHC 2HKHH 4HCRH 4IRJD 3FAXA 4L5FH 3VXUA 2O26U 4NNXA 4G8FB 4JAMB 4M1DL 1S7VA 2H3NA 2VOTA 5DJXB 3VWKD 5L2KE 2Q3ZA 3MPCA 2WUCL 1ZT1A 3ZSTA 3B2VH 4LVHB 4FNLH 5IJVA 5C8JB 3MJ9A 1BFOA 3RUGB 3SOBL 4LSUH 4K7PH 4GXVL 1ZGLP 1UM5H 2O5YH 3MRJA 1I1YA 5DJAA 4J7RA 4AEFA 4X7DC 3K46A 4MDIB 2V2TB 4PRPE 4PJCF 4JDZA 5F89B 3V6ZA 4ZNCD 4AH2A 4YHML 3LD8B 2VLME 1D5ZB 4PG9B 4K3GA 4GQ9L 3X13B 1FG2B 4LGRB 3T8XB 4EUPA 4V2BA 2LE9A 2W91A 4LHUD 3QIBC 1RSFA 2ZUVA 4P3DA 3X17A 1I7TB 1V7ML 2A0LC 4GBXD 4S1SH 3WUWA 4KJPC 3KR3L 3MCKB 3T0XA 4Q97A 1PZUB 4YX2H 1N59B 2AXFB 1A02N 1UJTA 2EZ0D 3O6KH 4JZJC 4OCRL 3FOMA 3M45A 5C0CA 3QDGA 3S3JA 2CUMA 1FNGB 4DW2H 5HYQA 5I1IH 3MLZH 1NQBA 1RVFH 2UUDK 3GSVB 4Y2DC 4PJXB 1CQKA 4X6BA 1CCZA 3RTQA 4LIQH 5EOCJ 5D6CB 2APVA 3MFFB 4HJ0C 4NQSB 2GSGA 3P4MA 5I18H 4OB5L 2GAZB 5GGTH 2DB8A 2MWCA 4PREB 4GW5A 5KVGL 3U36B 4PIRF 2LFGA 4QRSB 2ICWA 1I8MA 1VEPA 4K8RD 1GC1H 5FGRA 1DE4B 2BX5A 3T2NL 4LGPB 4CW1A 2V2WB 4QGTA 3U6RA 4ZPVB 2VIRA 4B7IA 4P57B 1WWAX 4Z78B 2DQIH 3M8OL 2XT1B 1LEIA 3S4SG 5ENWB 3MODL 1AGBB 2MHAA 2VLJB 1D5IH 1MHCB 2EC8A 2QTEA 3LV3A 2NX5B 3OXSA 3VXQA 1FFOB 1AGDA 3AXLB 3MFGB 1BD2B 1V05A 3IXAA 5EG6C 4M61A 4K2UH 2P48B 3FQWB 3CX5J 4XVJH 2YKLL 3CAFA 3STZB 3NZ8A 1MFDH 3E6FA 4WEBH 3MJ8A 5DVOA 2VDOL 4PJGB 3ARVA 4KPHL 3HLAB 5D7LB 3WE6A 2DQHL 1QRKA 1FBIH 1KPRB 2C7UA 3QIUC 5C1MB 3F7RA 4CDHA 2WWMD 2XN9D 1KG0A 2EDNA 2OR7A 2PW1A 3TZVA 4EOWH 1OAZL 3ZDXE 3UTZB 2G2RB 3GBMH 2K7QA 2NY6C 3FB8B 5T3ZD 1T1WB 3MACH 2DQEH 4MD5A 1L7IL 4XPHH 5DJ6B 1S8DA 4LSSL 1NGPL 4PB0H 3O3AB 4F58L 3TH3T 3TESA 1RZIA 4U6VL 1UB5A 4JN2A 2P44B 3BKMH 1NGQL 5C71A 4XB7A 1VFOA 5EU7E 4FQ1H 4U2YA 2OK0H 4ZPTB 1FZOA 4JB9H 3TBTA 1KPVB 1MELA 1QP1A 2AJ3B 4NZTL 3IF1A 4XNQA 5FA3A 3NCBB 1MQKL 2LVCA 3VGFA 3TO2B 1P4BL 1GZPA 3KPRB 1OGAB 1QOKA 2IH3A 2VL5A 3FB6B 4MVBD 4UZGA 1S3KL 4RFOL 4LVEA 4ELME 3NZHH 2Z9TA 3KYOA 4NQUA 3ZLQC 1MRFL 1KIPA 4U1SA 4QXTA 5I74B 4HDIA 1G0DA 2FGWL 3GK8H 2AV7A 4XCYA 5IQ7L 3LVEA 1DLFH 1VENA 5F9OL 5J6HA 5K9JL 3R8BB 1UVQA 2B2XL 3F12B 3OJVC 3QXDB 5BRZA 1C16A 1QFPA 4UT6L 5TFSH 2NY0D 5EIIA 5E4EB 1EFXA 1YJDH 4WUKH 1XIWC 4ISVB 1ETZA 1IGIH 1T7XA 4GRLD 5IFJA 5C0IB 3IRZA 1IVLA 2PO6A 3VFPB 1R5IA 5ALBL 4X7CC 4OF6A 2A6JA 3MCLL 3TT1L 4OZHB 3SE9H 1CTNA 5TE4H 4G80A 3CK0L 1G84A 1DBKL 5FYKD 3PV6B 2X44D 3FHAA 4IBLT 4F9LC 1UKTA 1UQSA 5JXAL 1DBJH 1IKNC 4AL8H 5I1AB 5KSAB 1YY9C 5AYUH 4EUPG 3RJDA 3BZFA 1Z3GH 3NFPB 5T3XL 5JIKA 4ZFZA 5HJ3A 4JZNA 3WUWG 1J1XL 4PY7B 4NBXB 1NDMB 3MXVH 1VFAA 4HWZB 5IMMA 4N8VA 4L3AA 3T0AA 3EDDA 2HT2D 2VLRD 4PJ8C 1WQVT 4DN3H 1A3RL 2BK8A 4KRMB 4OZFG 2AJUL 1C08B 1XGPB 3C6SA 4R3SB 4HAFA 1MCLA 3AB0C 1U8IA 5GRXG 3QFJE 4R0LA 3T08A 2X4UA 4K3EH 2HVKB 3BAEL 5JORA 5JTWA 1AXTL 4FP8H 4GRWE 1GCFA 3GIZL 4HUVB 1SJHA 3EOTH 4ODXB 1GC1C 1NC4A 1YMHB 2W07A 5FO7B 3RI5F 3G5YA 3UAJD 2ZOLA 5EZOH 1D6VL 1EBPA 4GRLC 4PJHB 4WVRA 1QKZL 4O2CB 2HKFL 4IEFB 2VABB 2QHRH 1F4YH 1MRCH 4YK4B 2R0WL 3E2HC 3NA9H 4HIJB 1CGUA 2JJSC 2NW3A 4JY4B 2SEBA 4U33A 3BYTA 1WITA 4LRIA 4JFEA 3ZHKA 5FXCH 4GKSB 2EYRB 1AHWC 3SBWA 3SKOA 4R96A 3ZT5A 5JDJA 3QCUH 5CBAB 1CLOL 2VQTA 1WICA 2B8OT 2Z31D 3DRTA 4YNYB 5HGDB 3DURB 3KPSA 5BVPL 1OP3H 5C6TH 2IBGA 3TCLA 4HUMB 1KLUA 3QQ9D 4OAWA 5H8DA 1U58B 4LLQB 1NMCB 3GMMB 3AFLA 1JGVL 4MS8D 1QLFB 4JJHA 4YR6B 3KPNB 1CICD 4FQPA 1U8HA 5BVJB 5E9DA 1IGMH 3Q6FA 3ROOA 4E5XA 1EAPA 1C5BL 2D0FA 3IU4L 1FO0B 5ESQA 4M7JL 1S9WB 2IMMA 5ADOL 1I4FA 1QR1A 1TDQA 1I9IH 4IMLB 1CLZL 3O8XD 5JLZB 3H9SB 3FFDB 3GFUA 5IHZB 1A6AA 3LQMA 4XP5L 5DHVH 4QYOB 4PJIE 5E8OB 5EO1B 4A6YB 4P99A 5T1KD 1S7SA 2AJYL 3KYAA 3TFKD 3D2UA 4WGWB 3CSBA 5DJZA 3GMNB 4M3KB 3C87A 4BUHA 1TENA 5CP3A 1U42A 4Z0BH 3HMWH 2FJFA 3MA9H 5H94B 4OTXH 4AQOA 3WMSA 3CMOH 4H5SB 4XXCA 2VLLB 5HHXL 5B38G 2AJXH 3DMMC 1QSEA 4J3SA 4NQDB 4ODUA 5E8NA 1KJ2B 3H3PH 1FFRA 2X4OA 1YJDC 3FJTA 4DVBA 4P3WA 1A4JB 4CMMB 4EI6A 2HTKD 3S35H 1FO0L 1WSST 2M1KA 3WIHL 4AK1A 1IKFL 4OCLC 1TTGA 4KVNL 5JOEA 4P4RB 5E6IB 43CAB 3VA6A 4HGWB 4XCEB 4M4PA 1MEXH 4PJCA 5ID1A 2ZCHH 3UYPA 1F3JB 3VRJA 4Z76B 4PD4K 3BKJL 4XZUB 3EO0A 4B53A 3ILQC 4NCDA 5I1HL 3LH2L 3HNVH 2BP3A 4MQ7B 4E41E 1A7PL 1T1ZA 5F6HI 3MBEC 1A64A 3LS4L 4HUWA 3L5IA 3GMLB 4V1DD 2UZXB 3MRDB 4FFZL 4PBVC 1PAMA 1TZHB 4JKPH 2D7NA 2VDKH 3GMPA 4ONFL 4M7LH 3QG7H 3T65B 4HKXA 3P4LA 1KLFA 2O61B 4I18A 5IEHB 1OAQL 5F8RC 3PQYD 1MJ7L 1F2XK 4GW1B 2QQLL 1SM3H 4XNYH 2DLEA 4OI9A 1A7NL 1A6VH 3FQNA 4WFFD 4PGCA 5HGAA 3T0ED 4X6DF 4KJYB 1S7RA 1BZ7A 4MXVE 2DIAA 1K8IB 3MLXH 1KEML 5IVXE 4LCCA 4NO3B 2HVJB 1NUGA 5EORL 1HHGA 1L7TL 4LQFL 3HZMA 5JMRA 1CD1A 3GRWL 4PRNB 1R0AH 2R2EA 5DWUL 3M07A 5IB4A 4G5ZL 3K1KC 3P30L 5D5MB 5AZ2H 1HHIB 3OJDA 3MOQA 5ERWA 1KIQA 4NOFA 3VXNB 4DUXA 4I4WA 3X14B 3FCTA 2V5RA 2VH5H 1AKJA 4JO2H 4J23A 4JRYD 4JRXE 2XICA 2OI9C 3GHBH 3OWEA 5FECB 1L6ZA 4XP1L 3UJJH 1V7NH 4J6RH 5KVDL 5DO2D 3DV4B 3VE0B 2WW8A 3C9NA 3BP6B 4PJ7F 4Y5VA 1HK6A 3I85A 4YAQA 1AO7A 1RIVH 3V5KA 4EI5A 1R3HA 3ARSA 1EAJA 5KSUA 1OCWL 1EEZB 4WV1C 1NEUA 1T7ZA 4QTHA 1GVIA 2P8PA 3BRGC 4N9GB 5FUCE 4NPYB 4DFIA 3MR9B 3U1SL 4D8PB 1XZ0A 2ATPA 4LARH 3OKNB 2C3GA 3NIFF 4X6CF 1R5WA 2XOTA 3QEQD 4X7SL 5I1KL 2BVQB 5IVZA 2R39A 1JHLH 4UQ2A 1Q9KB 3FL7A 3HG1A 2M2DA 2PNDA 2R69H 2VDRL 4V2CB 5E70A 2YD1A 4MA1C 1IAOA 1T2QL 5DK0A 5IMKA 1BOYA 2H2PD 2N4IA 3FRUA 4TSAL 2L7UA 1YEFH 3ARWA 1JUFA 4YHPB 2F54B 3TNMB 1RJYB 4U6XB 2VR5A 2F5AL 3LKQB 1DANT 2XFXB 4K7FA 5FCUH 2O5ZL 3DX9A 1FHGA 1PVHA 3QUMA 3TN0B 1JPSL 4ZDHB 5CD5D 5I1LB 4ZXBB 1MY5A 2N7BA 4TUKL 5J12B 4LSVL 5ACZB 3HI5L 3RGVC 1YC7A 3R06B 5I8OL 5DD6B 4HS8L 4MXQD 4Y16B 2VDLL 4MA8L 1EGJH 3V7AG 1S9KC 3HCVB 1GXEA 2ZG1A 4ZOEA 2BY1A 1FL5A 5LWYL 4QXUH 2HAZA 2BNRA 4KJWD 2BDNH 4RX4D 5A2LH 3PIQA 4URTB 3SDXE 5GSRB 5IMLB 1LNUB 4LOUD 3SQBA 2OTUA 1FVEA 2LU4A 5D93B 3FO9A 4KAQL 4POYA 5JOFB 3UTTA 3SE3A 3IFNL 4KY1L 4WFGE 4DOHE 1JN6B 1SMOA 5ABDE 3JWDH 2ZUQB 1I1AC 3HE6B 5BZWB 3QPXH 3BP5A 43C9B 5C0BE 3TA3D 4DUVA 4LVNB 2AJZA 5F7FA 5B3NA 3RBSA 4HD9A 1ADQH 1INDH 3L7FB 1MLBB 5D1ZB 4LAJH 5A2JH 4TUJB 1WCBA 3IDYB 3O6FC 4DK3A 1FL3B 3T3PF 1U95B 3GKZA 4P2RE 4UI2A 3BDYH 4OIIH 1G7MB 1ZHKB 3GKWH 3QIWC 2MMXA 1DSFL 4NT6A 2WSKA 5A43C 4G8GA 2Y5TB 5CEXB 5CD5C 2EKJA 5DK3A 4LLYB 3KDMA 3F7YA 2YK1L 3PJSA 2HRPL 1S5HA 5C0AD 1I3RA 3N06B 4DEPC 3GSNH 2R23A 5LVEA 3MLRH 1AH1A 1MCOL 2BC4B 4MXQC 4M9OA 3SJVE 1WT5C 4ORGA 4F57L 2HJFB 5M94B 4M5YH 4L3EA 3OGCB 3MMEA 3U9PL 4KJWC 5IHUL 3HE7D 1SJXA 1OWRM 2UZIL 3KXFA 3ZE1F 3X3FL 1IILE 2AK4A 3TVMD 4OD2A 1D7FA 3HPJB 3KYMA 3DYMA 1A7OL 2IJ0C 4G7YH 3MTRA 2F53B 4MNHB 4Q6IC 1WV7T 4TPRH 5E8DH 4X8JA 3B5GA 4QT5A 2QHLA 2HG5A 5J11B 4P23B 4MNQE 2AKRB 1FYTD 2A73A 3NA4A 2PR4L 1JWSB 3SGDH 1FAIH 1RZKL 3L5WB 1UYWH 4I0PA 2AABH 4ZSOE 1GJIA 4PUBL 4WFHE 1U3JA 3MRGA 2A77H 2F5BH 1G6RH 2X9WA 5EU6E 2C1OB 3OTTA 2R56L 4AIZB 3DNKA 1F45A 3Q6GL 4Y5YB 1DN2A 1S9YA 2P5ED 4K71C 5GISH 4KHXL 1IAIL 1F11B 2X5PA 3HRZB 1DDHA 3ARRA 3K81A 4QHKJ 3QQ4B 1QZ1A 3NCFB 1HYSC 2J1KA 3BH8B 3BD4A 1ZEAH 1J0KA 1ONQB 5ALCL 1A6TB 1ED3B 5I17B 1NL0L 4HPOH 1J7VR 5F7EL 1Q0XL 3BFOA 5DEFB 3H9HB 3QP3A 4ZODA 2NX5E 2N1KA 1G7QA 4HEPG 4QRPA 1WGOA 5IQ9B 5L88L 4NQED 4QOKA 3TVMC 5DA4A 3WNMA 3ALXA 5JPNB 2J8HA 1FH5L 1JPTL 3SGDI 5H35B 2AEWA 3N9GH 2OL3H 1G9NH 3WSQL 5D72H 4Q9QH 4CVZB 1TQBB 2IPTL 2V7NA 3P77B 2R0KL 4GSDL 1OSZB 1A7BA 2ZCLH 1N3NA 3RZCD 1B2WH 3V4VH 4R6UA 5DJDA 4FQJH 3WNKA 4GKNB 4EDWL 3VGAC 5SX4H 4S1QH 3RIAF 4Y4KC 1DANU 3OAZK 1KV3A 2GKIA 4NSKA 3ZKNC 1L0QA 4LVOC 1YY8A 4ZUUA 4F7PB 3H9YA 1DEDA 4MXWL 5GJSL 1F6LL 2EDQA 2JTDA 1CXIA 1AR1D 4U1HB 3FO2A 3ETBF 2AXGB 4JFFE 5DT1H 3VA2C 5I30L 3IDJB 3QWOB 3DETD 4XVUC 1I7ZB 3ARDD 3MRCA 2K3TA 4ODSL 5H2BA 1NKRA 5I1EL 3FT4A 3I50L 5DK2B 2E7MA 5AWNH 2E7LA 3QFDB 3MXWL 2VDPL 3P9MA 5I2IB 5E5UB 1UH4A 4RWHA 1J1OL 3P4OB 3ARFC 1G7HA 2YUXA 3MV7A 5KVFH 4JM2D 5JW5B 4ESKA 4J1UB 1ZLWH 4W70A 2X1WL 1BP3B 2BHUA 3HNTL 4G42A 1SEBA 4JREB 1FV1B 1JFQL 5SX4I 3D18A 4F7CA 1T1XB 1MFEH 4Z95L 3GBLA 1RU9H 4LNRA 1I8LC 4NQVB 4P3CL 4N8CL 3MRIB 5ILTL 2IWGA 3WNOA 4U7MA 1MIEH 2IGFL 1BWMA 5F97E 4OUUA 4WO4B 4WHTB 5KS9F 4O9HH 5FUZH 3L3HB 5I19L 3HZYA 3Q5YA 3VRLF 2GT9B 5T1MA 3AY4C 1JGUH 1NLBL 4X6DA 3FKUS 5IBTH 4HKZA 4HX1B 3OXRB 4FZ8L 1QRNE 2DM4A 5J89A 4FXGB 4K23H 3MBXL 3QIBA 4ONGL 3F7VB 2VWEC 2VLMD 3VDBA 1MHEA 3BQUB 2NXZC 1FGNL 3DETC 3BH9B 1UWEH 4JZJA 4F3FA 1FORL 2BVOA 2I9LB 4YO0A 1HZHH 5D7JA 3TJEL 4ETQA 5MHSE 3MA7A 4BQCA 4BH8A 1MCPL 2AJVH 4FTVE 1YMMA 5FA4B 1N6VA 4Y2DA 3SGJC 2AP2A 4ODHL 2HLAB 4U6TA 4YQXH 1T3FA 2R4RH 3T2QA 4OD3H 4AM0A 2KZ1B 3QI9B 3QHFH 3IVKB 3QZWG 4OM1L 4P2QB 4X0KA 3SCMC 1DQTA 4JPWH 4E0RB 3B9DA 2OZ4L 1NFDB 2FJHB 4UTBL 1R5VA 3E6HB 2BNUB 3VGDA 4AEIL 4PJ7A 2MPAL 1H3PH 5ID0B 1DQQB 1JNJA 3OKKA 2YBRB 2C3VA 1VFBA 4PRIB 4K07A 2CLVA 3O3UN 3CFJB 1N8ZA 5DEGB 3B5HA 4WU5B 4X6CA 3VXRB 3IAQA 5FYJE 3PWVB 4U1JB 5E7BA 3QUKB 2Z4QA 1B0WA 2IFFH 4ODVH 2H6PA 4ZO8A 3SO3C 1AI1L 3RVTD 1P6AB 4QRUA 5I73B 3ECBA 1CE1H 3OKDA 5ICZA 1RUKL 4ENEC 4HBCL 2IPKA 3JV6A 5DJ8A 4DGVH 4F15C 4XNMA 2R1YA 1YYLL 3G6JF 4RMQA 2JJVA 2ORBL 2PYEA 1VKXB 3HN3A 4G6FB 3E8UH 5INCA 3QIUA 1KCSL 5C0ND 4FQXB 3CSYA 3BPNC 3CFBB 4M9PA 4S0TD 5DZLA 5CD3A 1JIBA 5MENE 3GB7B 5CLWA 4LPTA 2AI0L 3RKDC 1Y6MR 1ZGLB 2GTZB 1UENA 3UTPE 5DRZA 5EZLB 1E27B 5CINL 3BHBA 4YC2C 4IJ3B 2X1XR 5HI3C 5IB5B 1UEMA 2UZYB 3GNMH 1J8KA 1DQLL 3AAZB 3VXOA 2HA1A 1GZQB 1UB6B 3HA0A 5F7WC 5F1NB 2F58H 5BV7H 1CE6A 5I15L 2FCBA 3RL2B 3B8YA 1Y6NR 4XRCA 3T2OA 3B43A 2IANA 2R9HC 2XQBL 2D7QA 3EIFA 3TBSA 3FONA 3ARBB 4GRWH 3D9AH 1MI5E 3D39E 3W0WB 1D9KD 1R3IH 2JK5B 1Z6JT 1VADB 3VXUE 1XGYL 4DZ8B 1UM4H 4JDVA 5J13C 3EYSH 4L3CA 3CXHK 3QJFB 4DUWA 2FIKB 2Y36L 1TIUA 2EDKA 1X5IA 3CCHB 2CKBB 2NY7L 1JZ6A 4HCRA 1AE6H 5D2NA 2ZUYA 1NCBH 3EJZD 2X89D 3VD3A 4OZ4B 5DRWA 3CXDL 4PTTA 2W0LA 4FFYH 4LLWB 5C0EB 3EOAA 2HFFB 1HH9B 1A1OA 1IBGL 3TO4B 5C0NC 4D0BA 3LEYH 4KRLB 5FAAA 5JZ7D 4PJEA 2ZUUA 5FB8B 2ARJA 5IBUB 2QV2A 4IIQB 1N6QL 5H37H 1XF3B 2BMKA 1ND0A 1TFHA 3GMOB 4JDTL 4P2YA 3QA3B 4ZD3L 4Z7VF 4NP4L 3QCVH 2J12B 2WINB 3BGAA 4KFZC 4KI1A 3SDCC 1HCVA 3DIFB 3U7AA 1ZMYA 2CDEA 5DI8A 2NCMA 2Y06H 3I02B 1CFQA 4HIHB 1EEUA 3MROA 1LO3L 3RWHA 5D6DC 3SDAC 1RULH 4F9LA 2B0SL 4BSWA 2DLFH 4X4XA 5INDB 1GGCH 1CDHA 1PEZA 2FLRT 3CFCL 1RZ7H 1EHNA 1VERA 4FMFA 1HHHB 2CK0H 2CKBL 1HKLL 5EU7C 2RAMA 1C5DB 4YWGL 3WIFA 1YEKH 4PY8I 2YPVL 1HSAB 3EBAA 3V0VA 1N5YL 1P7KA 1FVCB 1VACB 4YDKH 3QUXD 2FATL 3GSWA 2J8UF 4M93B 4PJ8A 2QSQA 1OT2A 2BVPB 4KMTH 1KLGB 5D7IF 5EC1B 4OF5A 1IGTB 1NAKL 3CC5A 4OLXL 3K2MC 3VFUB 4WCYH 1AR2A 1ORSA 5GGTA 3ZYOA 5CHNB 5EIVA 1MLCA 5GXBB 1JNLL 3V4UL 4OLUH 2W9LA 2G5BB 3QO0B 2H32H 4JHZA 4EXKA 4NZRH 2X2YA 3BEVA 5AEAA 1CR9L 4Z7UF 2NY4B 5A16A 3KPPA 1XFPA 3OAUH 2MFNA 3FZUC 1BFSA 4GRLA 3QEHB 2E9IA 4OLEA 4P5TD 5BS0E 4AMKH 4IHOA 5GGRB 5L6YL 1B0GA 3S37L 3S7GA 4HK0A 3WLWC 4FXKB 3RVXC 3QDHA 2JJSA 3UPRB 4XVTL 1MAML 4EQ3A 5T33H 3QDMD 1YQVL 4NO2B 2PF6A 4Z8FL 4ZAKD 3U7YL 2VNCA 3GZKA 5IM7B 3P9LB 5F9JB 3MRBB 4ODBD 1QBLL 2A6DB 1EEYA 3PWJB 2ICEA 4PR5B 5TDOA 1UADC 3DBXA 1YEJH 1QPPA 4R7DB 4ZUVB 2HFEB 3O2WH 4EN3B 2KUTA 3B4NA 3D3VB 4UV7L 4KTDL 4MNGE 1IC7L 3P0VL 1F6AA 1MFAL 3FO1B 1HEZB 4MD0A 1FYHB 3QDJD 4PJAB 4U1LB 2VLRA 1KEGH 2H2SC 3ALWA 2WMPA 5DJYA 3ZE0F 3UTSD 4LSQL 3RFZC 2FYYB 1LO5A 1W72B 1WC7B 3HC3H 1TJGL 5F1SA 3WFHB 3U9UB 4QRRB 3VW3H 2AK1L 1BOGB 4MD4B 2YA0A 4G9DA 4WU7B 4PBXA 3NFNA 1BM3H 5BV7C 2VTFA 4FFWC 3TC9A 4UU9B 3ZHDA 4MA7L 5SV3A 1HNFA 3RX5A 1KCUL 3V9FA 3CDYA 2GFBA 4OLVH 4LPCA 2EYTA 5CZKA 1U8LB 2Y9RT 5HHQB 1IZKA 2NY2B 5J1SC 3VGEA 3CFIC 3TBVA 4TULH 5HHOA 2VISA 1Z0NA 5EC2A 3O2DH 4FHBD 1A6WL 5MI0B 5GS0L 4G43A 1IT9L 4TN9A 4YBLC 3VI3F 3FT2A 5HYJB 1Q9OB 5HD8D 2VAAA 1Y18A 4I2XB 5HVFB 4LRNL 4ORZC 3RNKA 3DMMA 4QLRA 1G7IA 2YC1A 2FR4B 2A1WL 3GUTA 1M05B 2IAMB 1BFVH 1F6FB 8FABA 5F7KC 4PV8A 4G9FD 3G5VB 4C56A 1W72L 4RGMB 5GS2H 1YEIH 3THML 2K1MA 4NKIL 4L8CA 1NAMB 2JCCB 1NGZA 4MAYB 3AU1B 1PZ5A 3GI8L 5SX5K 3QAZB 3RWEB 2CMRH 3QEUB 5KS9A 3SKMA 4FFVD 3BPCB 3MLWL 5CMAB 3OX8B 4U1NB 3RA7H 3F6IA 3IFOA 2BNQD 3OKMA 2D4DA 4P46D 1P5UA 4X98B 3KVQA 4XC3L 2GW5A 3O8XA 1L9MA 1HQRA 3MBEA 2XKNB 5T1KA 3PXJA 2C4XA 5D1QB 1R3JB 2BCKB 2V7HA 2MKLC 4OT1L 2PXYC 4E41D 2LAGB 4OFKA 4X7TA 5HDOA 4RSVA 1KELL 2DI9A 4O5LH 1LD9B 1I9EA 1BEYH 4LFHG 4F2MA 1GRWA 1FNSH 2J7LA 4JJ5B 1C5CL 3BN9D 1JPFB 4GS7C 1DQDL 1UJ3B 4NNPL 4XPAH 5JMOC 4UIMA 5HD8C 4QNPF 3B6SA 4NQCB 5MEQA 4KV5F 3PGCA 5MEPB 5JW3L 2J3SA 4G7VH 3MREB 5SWSA 3VD5A 3IXTB 1MVUA 1ZV5A 5CUSH 2UYLA 4P9HC 4NKDB 4JQXC 1HOCB 1T5WB 1FCGA 3OJMB 1O7SA 4LLUB 1NMBL 4JFEE 5IFAL 1LP9F 4JFDB 1Q94A 2FL5B 2VZSA 3QNZB 1T20B 2EC9U 2F53E 3T3ME 2CRMA 3MUGA 4GXVH 3LQAL 5FKAA 3GHEL 1RUPL 4CNIA 1SQ2N 4JFQB 3RWGA 4FFVC 3DJ9A 2X4TB 1G7LA 4P2CG 1JPST 4R8WL 2IADA 3IAGC 4P5MB 2FX8L 4YHMH 4LCUB 4PJFB 1GPOL 5ADPH 1ZHBB 3ZE2E 1QQDB 3D25A 1ULVA 3B9KD 1F3DH 1F8TL 1KENL 4M48L 3W9DB 3AM8C 4MQXD 3BXNA 4PV9A 4N9OB 4ZFOB 1WBXB 3G6JA 3S4SB 1KF9B 2OX5A 4JRXD 1QLEH 3FB5B 2XTJE 3KR3H 1PFCA 1MFBL 3JUYA 2B1HL 4WV1A 3M1BA 4OCRH 2X4PA 2Z91A 1TQCC 1T66D 3NGBB 3NACL 1TJIL 3DGGA 1V8HA 5E8PB 2E6JA 3DV6A 2LTQB 1DUYB 2ARWA 2NXYB 3G08B 4MB4A 4U6YA 4OCSL 1TVHA 4KZEL 1AP2B 3KJ4C 1BJMA 1TNMA 3C5JA 5ANMA 4D9RE 3O4LB 4JRWA 4M6ML 2XZZA 3R1GL 5KVGH 4TTDD 5DHVA 5JPMB 5J3HC 1F4WL 2X1OA 1Z2KA 5MERB 5GSVA 2GEEA 5C08A 3ARGC 1ZSDA 3T2NH 4HKBB 1K4CA 4LCWD 2P5WA 1RUQL 3DRQA 3IU3B 3M8OH 1QSEE 4JY6B 4NKMA 3MODH 2PTTA 5IB3B 5F7DA 3V52H 4NYLB 3RGVA 3X3GL 2Q7YA 1XT5A 2C4FT 3IFPB 1YNKH 4X9GA 1KJVB 1U8KB 4JRYA 15C8L 5D9SA 4WW2B 5A2KH 3ES6A 2VQ1B 4RZCB 3EHBD 3KPMB 5E1AA 3RWIA 2ADIA 2YKLH 4KROC 3SDDB 4XPBL 2W65B 2VDOH 1TVDA 4PLKC 4KPHH 3O45A 2GJ6D 2CRZA 3C60D 1TZIB 3MV9D 3QQ3B 1GH7A 1LE5B 4N0FA 3V4PL 4Z7VA 1S9XB 1OAZH 5DVLA 5E99L 4JO4L 4UT7L 2X1QA 2A38A 4M1GL 2DMBA 3QO1A 1XF2A 1I1AA 5GS1C 3UP1A 1NLDL 4BZ2L 3EJYD 1ROWA 1L7IH 2VXTL 5FUCC 2V17L 4LSSH 1NGPH 1C12B 1QD0A 4WFGD 4U6VH 1S7VB 4OKVA 2H3NB 5CAYB 5HPMA 3B83A 1WZLA 1NGQH 1IC5L 4I0KA 1Y0LA 5IBLC 3OKOA 1ZT1B 1RUAL 1QVOB 3NIGE 5IJVB 1BFOB 3O41A 1RZJL 3IDGA 4K9EC 3MRJB 5DJAB 3ULSA 3SDYH 4JGMA 2HFGL 4LSPH 1P4BH 5T3ZL 1FNEA 1MRDL 4JDZB 3A6CH 4RFOH 4MAUL 3V6ZB 2J8UA 5C09A 4AH2B 1J1PL 3FOLA 3LKSA 5D7IA 3DARA 1MRFH 1RK0B 2FGWH 3ZDXF 5IQ7H 2A6KA 4EUPB 4NC1E 4XHJC 5F9OH 2QQQA 2Y07L 4RX4A 5K9JH 1V3JA 3WFDL 3WD5L 3O9WC 3WUWB 5CZXD 2B2XH 4MHHG 3REWA 4DKFL 4Z7UA 3FOMB 1RFDL 2YHGA 4U0RB 5C0CB 4UT6H 4Q6IA 3BDBA 5HYQB 3H3KA 3DX8A 2X4SA 4OZFB 4QRTA 1CD8A 4YBHA 4BK5A 4X6BB 5E8EA 3RTQB 2BJML 5SWZA 5DC9B 4UDTA 4L29A 1FZJA 2ZG3A 2GSGB 1N2RA 1U91A 2XG5A 3P4MB 2VDML 5ALBH 2VXSL 2R2CA 2ICWJ 5FV2A 3MJ9L 3ARPA 3MCLH 3TT1H 2EIZA 4ELMF 4JPKL 2ICWB 3CK0H 1I8MB 1IL1B 1HQ4A 4YGAB 3EFDL 4CW1B 3PWUB 5CJOL 3AS0A 3U6RB 2R0ZL 2VIRB 2Y1VA 5HDQL 1NFDE 1CDJA 4YHLL 1LEIB 2WP3O 4OFVA 1S7WB 3VWJC 3MGOB 2DTML 2E27L 3ARUA 6CGTA 4OBRA 3HG1E 3LV3B 4X99A 3RDTD 1J1XH 1KTLA 1Z5LA 3OXSB 5DFVD 3VXQB 5C0AA 5BOPA 1AGDB 2Q8BL 3ABZA 1SVCP 2W9EL 2DBLL 1CFNB 3OJ2C 3NCYS 1A3QA 3RWDB 3H7BB 2DQFB 1HDMA 3IXAB 2P45B 4M61B 1PYWB 3HE7A 3MJ8B 4AJ0A 2DAVA 3BAEH 2W0KA 2X09A 5CFHA 1AXTH 3KLDA 3WE6B 4HXBL 1T0NA 5CZXC 4U1KA 3KPTA 5B8CA 3TVMA 1I7UA 1XGQA 4JFYA 4GUPA 2C7UB 12E8H 5DHYA 5IVOA 2QKIA 2NX5D 2PW1B 4LLVA 3TZVB 3GI9L 1BD2D 2RBLA 4GMTL 4X7EC 4M00A 5DTFB 1Q8MA 1VEOA 1QKZH 2XA8L 2HKFH 1FYTA 4MD5B 2R1WB 2YRLA 2L4OA 4RA0C 2R0WH 4TVPL 2JE8A 1RZIB 1UB5B 2JIXA 4JN2B 1EGJA 4M7KL 5D7LD 3P0YL 5F96H 2WP3T 4Y4KA 1Y6KR 2CDFA 1MIML 1FZOB 3TBTB 1JYWA 1S5IL 3IF1B 5I8KL 1WZ1L 5DGRA 4HKJA 1DBAH 5EU4A 1CLOH 2P5EA 1GZPB 1F5WA 2DKUA 2IH3B 4Q2ZB 5BVPH 2C4FU 4GRWF 5HVHC 2Y72A 1B6UA 2W60A 3RDTC 3KYOB 1NBQA 1NCDL 1EDQA 1KIPB 4QHUA 4U1SB 4W81A 5D96B 4B7LA 1BIIB 4HDIB 5GJTL 4OLWL 5ITFA 2AV7B 4XCYB 5D4QA 4F7MA 3GMQB 1RK1A 5B4MC 5FGSA 2YD9A 1UH2A 2DBJA 4UBDD 5B38B 1JZ4A 2QADB 2VLKA 1ADQA 5LGJA 1C5BH 1UVQB 3IU4H 4M7JH 1X5AA 1BLNA 5BRZB 3ARFA 1C16B 3A67L 4UTAH 5EIIB 1JF6A 5FYJH 3NBNA 4R97B 3LDBC 1SYSA 3JTTB 4YPGA 4E42A 5IFJB 2MQ3A 4ZS6C 2PO6B 5T3XD 3L9RA 3V5DA 1R5IB 3IDIA 2YPLB 5IESL 2X7LB 2R8SL 1I8LA 1CVRA 3GSNA 2AJYH 1WBZA 3SQOL 3QXUA 3T0WA 4G80B 2V9TA 4KK5D 3LEVL 2Q7NA 2AK4E 5KTEL 4HT1L 3OHXB 1HH6A 1D5MA 2FHBA 5CKGA 1QFWL 1XR9A 1SJEB 2VO5A 3FFCA 2VAJA 1KSRA 1MREL 4HZAA 5CSGA 3BZFB 1CGTA 1N5AA 2YA1A 2XNAA 4MJ2A 5JOPE 1YDPB 5HHXH 2X41A 1I85C 1XR8A 4N0CD 1VFAB 2FHFA 2NY1C 1LP9A 1WISA 2VYRE 1VGEL 1QR4A 1OT1A 4GG6B 3PWPE 4UOW0 1OM3L 3O4OC 1T04B 1MJJA 1IKFH 1J8HA 2HP4A 3C6SB 1LK2A 4PJIF 4KVNH 1U8IB 2CIKA 1WBYA 4R0LB 5KSAD 2X4UB 3CZFA 1X6LA 5I6XB 5JORB 4PJBF 5J6GA 1CF8H 2VDQL 5EUOA 4XPFL 3L3GA 4Y4HC 5IHBA 3T1FA 4XBEL 3RVVC 1SJHB 1G6RA 1KB5B 1O7VA 4HWUA 1NC4B 1W0VA 1RZGA 1KUMA 4UAOC 3TBYB 4TNVK 4TQEL 2DYPA 3G5YB 5KBNC 1CXHA 1XF4A 2ZOLB 5CSZA 3SCMA 1AGEA 1D5BA 2NY3B 5L0QC 2HMID 1I1CA 3LH2H 2LU7A 5I76A 4QRQA 4FG6C 3F58H 1A7PH 4LMQE 2DIJA 3LS4H 4FFZH 3OKLA 1K6QH 1SY6H 3F65A 4X7FC 4MQSB 1VESA 1PKQE 1UG9A 4ONFH 2P8MA 1J86A 1IEAB 1OAQH 3V6BR 4GXUM 3SKOB 2QQLH 3MO1A 1A7NH 4ZUTA 3DRTB 1YEEL 4PRPA 5HDBE 3KPSB 4LPXA 4JZOA 4IOFD 3TCLB 3WLBA 1KEMH 3C5ZD 4OAWB 5TH2A 4ZTPL 5EORH 2OL3A 4LQFH 4PTUA 3C5SB 5L8LB 4Y7MA 3GRWH 1W2KT 1KB5L 5DWUH 1BECA 2I07A 5E9DB 3Q6FB 1GOGA 4JFXB 4O2FA 5DDHA 2ADJB 3ROOB 4G5ZH 3LMJL 1EAPB 5CBEA 4JANB 2V2XB 5ESQB 4AG4L 2OYPA 3UZQA 4KKAD 3UO1L 1I4FB 3N0PB 3BESR 1YN6A 3NVQA 1U3ZA 4GXUN 1TITA 3Q1SL 1U36A 1T2XA 1A6AB 3AMLA 3ORJA 2XQYG 4XGZA 1U3HC 2GK0B 1DEEB 4X6FB 4XP1H 1S7SB 2UWEB 5KVDH 1LE9B 4KKNA 1FFPA 5DQDL 5D8JL 4MXVF 5IVXF 4WI4A 2GITA 1BZ9A 4TUOA 5DJZB 5DC0A 3MJGX 2H1PL 3KLHC 4GG8A 4HUXB 1E6JH 5HHME 1FFNB 1HSBB 3K7UA 2QSCL 3U1SH 1NUFA 3EFFA 3BGMA 5I1KH 1WIOA 2V5YA 3QHTC 3F5WA 1HXYB 2D7PA 1RJZA 4ODUB 4RISL 3D0LA 3WEXB 4IOFC 2YPKA 2X4OB 2GJJA 3C5ZC 2UY7A 5LCVL 2VDRH 4HIEA 3MGTB 4DVBB 3PUCA 1T2QH 2ESVB 3EOYG 5GGQL 5D2LE 4RMUA 3FB7A 1MHHA 1WFNA 2CGRL 2F5AH 3LN4B 2O5ZH 4HF5L 1IGYB 4HHAA 5DRXB 1YEGL 3MC0A 4PJCB 5ID1B 4HH8A 1JPSH 4GAJL 2Y6SC 4HFUL 3WN5A 4TUKH 3VRJB 1ZLUK 4NQDD 4YHKL 3SDCA 4LSVH 1OP5K 5KOMC 3HI5H 2YRZA 1MJUH 5I8OH 3H0TA 3UTOA 1IZJA 2YD6A 3IDNA 4MA8H 1OQXA 3QXTA 5D6DA 3SDAA 1T1ZB 1JRHH 5FDWA 3CFDA 4HUWB 4M4RA 5LWYH 3SPVA 5E6ID 3N85L 1I1RA 3V5HB 3GMPB 2NR6C 1KIRA 5IFHL 2C3XA 4HKXB 1EO8L 2J5LB 5E95B 2P47B 2Q86A 4WWKB 4CJ1A 3QT2A 3W39A 1BX2A 1PX3A 3VRIA 1EO5A 2BOCB 4KAQH 1A9EB 1E28A 1FLRL 3IFNH 5ACMA 3FQNB 3QHZH 4PGCB 5HGAB 4H1LA 5DS8A 3OAZH 1S7RB 1UCBL 3F62A 1BZ7B 2GQHA 2FIRT 4CU8A 4LCCB 4ZO9A 4ERSL 3WCYA 2BXYA 1ACZA 3EOBA 4HLZG 2X89A 3WIIL 5E2WL 3RRQA 2VN4A 3IS0X 3CDGA 3KPLA 4PP1D 4Y5XB 1BGXL 2IQAB 5IB4B 4R2GB 3OJDB 4WFED 5ERWB 4TVSa 4BQ9A 2OCFD 1DSFH 5F7HA 3OQ3B 4PS4H 1FIGL 4RA3A 1JRHI 3CX2A 3SDXF 1IAKA 4Z7WE 4I4WB 1T7VA 1KYOJ 4QY8A 2YK1H 1QHOA 3LZFL 2KBGA 3FCTB 4UIKL 3UJIL 5FV1L 5F1OB 4NKOA 1AKJB 1U8OB 4JN1L 1FCCA 1MCOH 4F9PC 4IDJL 3UTQA 4AT6A 3C9NB 2NY5L 2Q76A 3G6DL 3P73A 3U9PH 5LQBL 4Y5VB 5IHUH 4RAVA 4YAQB 1AO7B 5E0QA 5E2UL 3IFLH 4N0UE 3V5KB 1R3HB 4D2NA 1A7OH 1X9QA 4QTHB 1QNZL 2AGJL 2P8PB 1GAFL 1FAKT 1XZ0B 1RJLA 4ZTOL 3QUXA 4NJ9L 3DVGB 5IVZB 4HS3B 4UQ2B 1FC1A 2CUHA 4MJIE 4Y19E 2E9WA 2PR4H 1G0YR 3T77A 2XWTA 4B41A 1RZKH 2YSSA 1IAOB 3DX6A 5DK0B 5IMKB 1EK3A 1JWUA 2GSIA 3FRUB 3UXFA 4XBPA 2QBWA 4PUBH 4DAGL 2EDXA 4H0HB 3ZKXB 4AQ1B 5FFLA 3HMXL 4PP1C 2R56H 1BBDL 2EO9A 1GOHA 3QFJA 4K7FB 5GGRY 1KTDA 3QUMB 3U0TA 4QO1A 1DVFC 4NO0D 4P5TA 4KHXH 5DF0A 5HGBB 1IAIH 1DUZA 3OGOE 5AG8A 4QGYA 5D2NE 1LO0L 3MOBL 2DQDL 5C7XL 3MRPA 2B4CC 1XGUA 5ALCH 3RKPA 3WV0A 1CDGA 2WQRA 3K2UL 5I8CA 1NL0H 2MJWA 2F54D 4HJGB 5F7EH 5F88A 1Q0XH 3KPQA 4ZAKA 2BNRB 2XN9E 2QJDA 1IEBA 4K94L 5DQJB 1DFBL 5DLML 4PJEE 3PIQB 4S2SA 3TN0D 1CG9B 4AEHL 5L88H 4MJ6A 1DP0A 4ZXBD 3ELAT 4QWWD 1WWBX 2OTUB 3HFML 4PJXF 4Y1AB 3U46B 1FVEB 5T3ZE 1JYVA 1FH5H 1P84J 2V5TA 3I6LE 1EBAA 1JPTH 3OB0H 3FO9B 4GT7A 3UTTB 1SHMA 3CDFA 4Y16D 3KLAA 5M7QA 3EAKA 3QDJA 3RU8L 2IPTH 3ZL4L 1MCCA 2R0KH 4GSDH 1Q1JH 3G5XB 1IAMA 3BP5B 4JKMA 4WI3A 2EDDA 4UT9H 2AEQL 2AJZB 3DXAB 1CDCA 2APFA 2XKSA 1ZS8B 1CGXA 1WCBB 2EEBA 4EDWH 1BMGA 1IAII 4YHNA 4OZGA 3KHOA 1HI6A 4D9LH 4NZJA 2YRPA 3LSOA 4YDJA 3TYFA 3QISA 4NT6B 3ESUF 1F4AA 5GRZA 2J2ZA 4MXWH 5GJSH 2ATKA 4G8GB 1U8JA 1JWMA 3F7YB 3QNYB 3P0GB 4PP2B 1S5HB 3OV6A 1I3RB 5JIIA 2R23B 2PXYA 5I30H 4NFDA 1ZT4B 4PJIA 2FZ3B 2HWZL 4ORGB 2X4NB 3WNNA 4L3EB 4ODSH 3RNQA 2X70A 1NBYB 4NO5A 5I1EH 4PJBA 3MMEB 3I50H 2LQRA 3PHQA 3VXMB 5E4IA 2VDPH 4H1LG 5C9KA 4JHAL 3KXFB 4WTZA 4IOIA 4JG0L 3PDOA 1PY9A 4G8IA 1NC2B 5GRUL 2BVUA 2H32A 2QQNL 2DQUL 5J12C 4PFEA 2CIIB 4X8JB 2Q8AH 1KXQE 4FQCL 4L8DA 1KACB 3FHQA 2OS7A 4JQXA 3HNTH 3G5ZB 1JFQH 2HG5B 5FYKE 4O58H 5JHDB 4EEEA 2A73B 4Z95H 3BMVA 1K3IA 4YBQD 4P3CH 4J3UA 4N8CH 5ILTH 3B8SA 2HN7A 3QZWB 1XMWA 3DO3A 2IGFH 5IT2L 3CDCA 3KWWB 3MRGB 2J8OA 5HGGS 4IS6A 1I3GL 2HT3C 5GHWH 5I19H 3ARED 2F53D 2AVGA 4CDGC 4HUKB 5E5RB 5AAMA 4JPIB 1B0RA 1F58L 1S9YB 2BOBA 5D70L 1U2HA 4FZ8H 3AM8A 1VEMA 1OD9A 1DDHB 2E6QA 2FSEA 3MBXH 3MRKA 4AY0A 4YUEL 4TVPE 4WJ5B 2G75A 1A1MA 4E41A 1FGNH 2ICCA 1KYOK 3HRPA 3RWFA 4HC1A 1FORH 1OY3B 3TJEH 2AXHA 4ZUWA 1MCPH 3O3BA 2E8YA 2HTLD 3STLA 1E4XL 1G7QB 3VGHA 2XTJD 5M95B 4QRPB 2P43B 4QOKB 1ZLVH 3ISWA 1DQJB 3RHWF 3S3SA 4OM1H 4LU5H 2WV3A 4XP6L 1M7DA 1KGCD 2OZ4H 1I9JL 5FM5M 3UBXI 3P4NB 4UTBH 2A74A 3CMGA 4AEIH 1N3NB 4APQD 3LHPL 4KXZI 5IVXA 5DJDB 2FX9L 5JO5A 4OF7A 1A8JH 1ZWIA 4LRIC 3HKFA 2ZKHL 4WNQA 3UPAA 4KK8C 3NFSL 3GIVB 1MUJA 4NSKB 3AREC 2MQCA 1H8OA 4M6NL 4KWUA 4YHYB 2WNGA 1J0YA 1RZ8B 1AI1H 4O4YL 3B9KA 4RCAA 4G8EB 4ZFFA 5IGXH 4GW4A 1RUKH 1FSKC 4JRXA 1YYLH 3KHQA 4RWYL 3MLVL 5JUEL 1CFVH 3MRCB 1NUDA 2ORBH 3I84A 4GH7B 5J0BA 3BVNA 1BAFL 3CGTA 3FT4B 1KCSH 5H37G 4U7SA 1WZMA 3P9MB 3DHJA 2AI0H 1HIML 2XTJC 4CMHB 5GS1A 2JLLA 1NJ9A 3D0VA 1G7HB 1KT2A 3MV7B 3CVHH 5IB2A 3SHSA 1J10A 4G42B 3HPLB 1DQLH 4F7CB 4ZOCA 3LPGA 4Y4FC 4APQC 5I15H 3LN5A 4LNRB 3UPCA 5EN2A 2IALA 2XQBH 2NYYC 5IV2A 4YFDB 3HZYB 1SVZA 2AJSH 3TJHD 5T1MB 1XGYH 4EKXA 5I16A 4PGDB 4X6DB 3NPSC 4HKZB 4N1HB 4Z7NE 3L6FA 4XXCC 2Y36H 4DFHA 4EVNA 2NY7H 3C8KA 3MRMA 2FO4A 4WTZG 5CSBA 3QIBB 3TYGL 5CEZL 4HMCA 2AEIT 3CXDH 4JZJB 1U8QB 4F3FB 4WO4D 2BVOB 4YO0B 3MA7B 1TPXC 1IBGH 1YMMB 3EYVB 4C83A 4Y2DB 2FHCA 4HUNB 5J7CC 3SDXA 3O6LH 5C07B 1T3FB 4OGAD 2VKWA 3RI5K 1WF5A 4JDTH 4AM0B 3MUY1 5J9PB 1UACL 5ETUA 1F00I 4V1DE 2IC2A 4BH7B 4KZDH 4JO3L 4XB8A 1QFUL 4DZBA 4KMLB 4YJZL 1LO3H 1OB1A 2B0SH 1CS6A 4PJ7B 3R4DA 3PQYE 1JCKA 3CFCH 4NCC1 1F90L 3HNSL 4GAFB 1ORQB 3OKKB 2C26A 4YXKL 5F93C 2C3VB 1VFBB 2DWDA 4XP4L 1XGTA 4WFFE 2CKNA 3VWJA 2CKBH 4I18C 3T0EE 1RMFL 1N8ZB 4P2RA 1IGJA 3QI9D 4YWGH 4NWTL 5SX5H 4X6CB 4P2QD 3L7EA 1N5YH 4IRZL 4WW1A 2Z4QB 4KDTC 2FATH 1IAIM 4QRUB 4MMZC 3REVB 3WXVL 4NNYA 1A14H 2DQTL 3ECBB 1CGWA 1NAKH 5F9DC 4OLXH 3SKJL 5ICZB 3KYNB 1XGRB 5GGUB 3LPFA 3ARTA 3RUGA 2IPKB 3JV6B 3PP3K 3GJFB 5F6IC 4XNMB 2R1YB 1JNLH 3V4UH 4PRID 3SJVA 2PYEB 1GHFL 1ZXQA 2JB6A 1NBZB 1ZANL 5INCB 3QIUB 3GM8A 4NC1C 1R24B 3CSYB 3RX7A 5CD3B 5F89A 1JF1A 1CR9H 3VXRD 1QEWA 1YUHB 1IFHL 1FG2A 5EWIL 2NY6B 5DRZB 3P11L 5L6YH 3BHBB 3S37H 3VG0L 2JJTC 1DL7L 4XVTH 3ZSSA 4JO1L 3VXOB 5D1XC 4MNQA 4P2OC 1UWGL 2AXFA 4G6FD 2DICA 1CE6B 4Z8FH 4FQXD 1BFTA 1S9VA 4XRCB 4Y89A 2DM7A 5DYOB 1LO4L 1JNNL 2IANB 1OD7A 2AQ3A 4LASL 1QBLH 3FONB 4PJXA 4ZSOA 3MZGB 1KJMA 3VXSB 4EI5C 4PRHB 3QEQE 4EJ1C 4A2LA 4KKBD 3V79C 5EU6A 4H25B 1HHKA 3IB4A 2YMXL 3QI9C 4OF3A 3HC4H 3RDTA 4N5ED 2GAZA 4KTDH 4UV7H 3QWRD 1CBVL 3P0VH 4JDVB 1MFAH 1KFAL 2BSED 4L3CB 3U36A 1K8DA 1P1ZA 1PJ9A 1QYGL 3U0WL 5IG7A 1YEHL 1BF2A 5CGYC 3LKNA 1DE4A 1OL0A 4LSQH 2BY3A 1TJGH 1GGBL 4ZPVA 3ARBD 2VSDA 4P57A 3VMNA 5LBSL 4PTTB 2AK1H 2ED9A 2B20A 3LQZB 1FJ1A 4U1GC 3EOAB 3W0WD 5ENWA 1TTUA 1KCKA 1AGBA 2F19H 1A1OB 1MHCA 1U93A 4KU1A 2NX5A 5F3HA 1FFOA 1XIWB 2ARJB 4MA7H 5FO8A 2YWZA 2I25N 4XMPL 4WHDA 1KCUH 3VGBA 1AC6A 3DI3B 1EUTA 4Q9CA 5DD3L 1NFIB 3T4YB 2WBJB 1NPUA 5LGHL 1A3LL 2CDEB 5DI8B 3VFSB 3STZA 5CWSA 1CFBA 4G3YL 2DMKA 1CFQB 4P4KC 4YDVA 3MROB 3MLTA 1RIHL 4TNWF 3HLAA 3VI4E 4BSWB 5IW6A 1M71A 3TO4D 5LXGL 5GS0H