4BFGA

Structure of the extracellular portion of mouse cd200r
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
190
structure length
190
Chain Sequence
PLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Cd200/Cd200 Receptor Family and Implications for Topology, Regulation, and Evolution
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords CELL SURFACE GLYCOPROTEIN CD200 RECEPTOR 1
total genus 41
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2013-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF08205 C2-set_2 CD80-like C2-set immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bfgA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bfgA02
2WBJA 5IJKC 2P5WB 2C3VA 4OD2B 4K3GA 3HZVB 3CFBA 1S7UB 4GW4A 1JF1A 1UXWB 2D7TL 4YHNA 3RU8L 3QUXB 1F2QA 3KNBB 2HYMA 2VDRH 3DURB 1CTNA 1U8JA 2H32B 1XCQB 5JOPE 1J8HE 2F19L 4PD4J 1Y0LB 4OCXL 2E7MA 5M7QA 1R24A 1Q9OB 2CRZA 1U3YA 4JDZB 5L7XL 5D7LE 4L3CB 4HJGA 4NQSB 4Z18A 4LLAA 3RTQD 4EBQH 1Q9KB 2CR6A 3P77A 3HE7D 1MCBA 3FOLB 5CINL 2HJFB 4ZS6C 3J7HA 2R0KL 4PGZA 5FGBA 1XF5B 3SE3A 3QUZC 1S7RB 1TITA 1ZOXA 2MQ0A 1SYVB 4BSJA 4WTZG 5C0BB 5D96B 4HUKB 3L3GB 4LSSH 4TUOB 3UTZB 5TE7H 4YFEA 4ERSL 4WFHE 4K7PY 2ERJC 4NM4L 5I1GH 3QWRD 1GGTA 4XP6H 2D31B 1J9CT 2VLKD 4Y19A 3WL9A 2OTUB 2CO6B 3MBXL 4AT6B 5HVFB 4QYOA 2W0PA 2X05A 5HHXH 2R2BB 5IEKA 2FGZA 4MD0B 4FQXD 3FAWA 5FUZH 2B0SH 4ZOCA 3IB4A 5IHUL 4LSRH 2VLLA 4RISL 4BQBA 1ZHLB 4KRMB 4U6VH 4XPAL 3DV6B 1OD9A 4WFGD 3S37X 4HGMA 1OGAB 5GRYA 5FDWB 1T0NA 1X4XA 2P42B 4Y4KB 4RFOL 2FL5A 2M1KA 5C0RL 4J1UA 1TNMA 2IQAB 3A67H 5HYIA 1A7QL 4DGVL 3X14B 3RZWA 4UTAH 1IZKA 5BS0E 2GCYB 4X6DA 4MJIE 4QWWD 2IMNA 5EU7C 4C58B 2HTLD 1NCDH 4UUJB 5DD5H 5CEYB 3QH3A 3OWEA 5AAMA 3VFOB 5ICZB 3LKPB 4HDIB 1I8LC 4XWGH 5DQ9B 5HYQB 1QBBA 4NT6B 4I1NB 3SGEI 2GT9A 2FHCA 4L1HA 4ONGL 4U4BA 1G7QA 4XGZB 1Y6NR 5SWSB 5DGRA 3MACH 1IEAA 1UH4A 2FX7H 1UM4H 4G7VH 3TBTB 4M5YH 1E6JH 1F4WL 3NFSL 2HKFH 1Z9OA 1KPVB 4OAWB 4YHYC 4ZFFA 1MJ8L 3WKNA 5IB1A 3C9NB 4GW5B 3ZDYE 2XY2A 1F58L 1XAUA 3UTTA 2XG4A 3MLZH 1FFOA 2J2ZA 3H7LA 4XCCH 5IEHB 4WUUB 4Y5VB 4OZHE 4QOKB 3V0AC 1I9IH 1Q0XL 3GKWH 2IGFL 3QFJA 4X98A 5GRZA 5HYEA 1LILA 5J11C 2DJSA 2IH1A 3WNLA 5CWSB 1CLCA 2LU7A 3OR6A 5SWSD 5CBAB 4QO1A 4X5WA 3REVB 4OLUL 4NNXA 1NLBL 2WWKO 3ARBC 2V2WB 4MCYB 3QJHA 1DLHA 1R5VA 1PVHA 2Z35B 1S7QA 1P4IL 3MMEB 4D0BA 4JREC 5GJTH 1TCMA 3CDFA 2ZUTA 3CMOH 2RAMA 2RBLA 2DQEH 5KVGL 4GQ9H 5EOCH 2P24B 3AS0A 3B9DA 3AS3A 1J8KA 1IKNA 1CD1B 5M94B 4JHZA 3C2AH 5A40E 3JV6B 4ZOEA 3VXUB 3BIBX 4PRNA 2BVUA 1PSKL 1BIIA 4NKMA 1ZVSB 4NZTH 4APQA 4PJ5B 4W68A 2FIRT 4BQ6A 5JW5A 1LEIB 1CXEA 1OAZL 3MRNA 5IQ7H 2GIYA 2QSQA 3RVUC 1U92A 4N8VG 1ZHKB 3UBXA 4OGAC 1FYTE 3IKCA 5DK0B 4PY8I 3EFDL 1U3HD 4YH6A 4B5EA 4DGYH 4AJ0A 1EFXA 2NXZC 3NFNA 1JN6A 1TXKA 5CP7A 3BPNC 4RAUA 2YSSA 4HW6A 1W72H 4YBQC 4CMMB 4F80A 2H2SC 3V5DB 1FFNB 3ULUD 4XVTL 1UYWL 3PGFL 2Q1EA 4NQDD 4DVRH 5H94A 4NQDE 2V2WA 4MCYA 3F7VA 1ZLSL 4ZTOH 4QHMB 2D03L 3LKQB 4ZUSA 1F11B 5C0IA 2DL2A 2D7TH 4JGJA 4NFDA 4PGBB 2XA8L 1UH3A 3QO0B 2I5YL 1FGVL 3QXVA 1D6EA 1BJ1H 1E28B 1WZ1L 3V5KB 1FSKB 5AZ2H 2YD6A 1LO2L 3GHBH 2RGSA 2PTVA 1ZLWK 3O8XA 1J8HA 2XY1A 3E2HC 4P5TA 1H9VA 2VC2H 5ESQB 3RZCA 1CR9H 3NAAL 3L7FB 4K9EL 4C56E 4M7KH 4KQ3H 3SO3C 3LEXA 3X3GL 2NTSP 2UWEF 1MH5A 4G43B 1L9NA 5HHPA 5DA0B 2EDNA 4JFFB 3MOBH 2KH2B 2AK1L 3R1GL 2E6JA 4FFYH 3K2UH 3MTRA 4QRUA 3ILQC 1EVTC 2PCPA 3FO0H 3VFVA 1OWWA 5CZXD 4JM4H 4OLXH 2L7UA 3RHWF 2IANE 4I3SL 2VISA 4JFXA 4LSQL 3SDCD 3P9MB 1YNKL 4WIQA 3GMMA 2OZ4A 3QJHB 3L7EB 1AHWA 2M26A 4TTDC 5CAYB 1URLA 3WIFA 3OJMB 4F7TA 5IIEA 4EDXA 4ISVA 1RZ8A 4JY5L 1HHJA 1C5CH 5DJ0B 3TT3L 4ODBD 2ATKA 2CIIB 3MUHL 5DI8B 2VLLB 1IC5L 4U1JA 5GHWL 1WBYB 3UJIH 1RU9H 5D96C 3PNWB 3MV7E 5EIQA 2VZOA 4X4ZA 5FFLA 2BSTA 5HYSG 4ZUUB 1YC7A 1DSFH 5FKPA 1FVEB 4WFHD 1C1EH 4KRPD 1WBXB 4M4PA 1U95B 5F9JA 4HMDA 4Y0GA 4LSPL 4NWTL 1HHHA 1BFTA 1W0VA 1P69B 5DF0A 3S36L 2DI8A 4M7LT 3UYRH 4A6YL 1FNGB 3VW3L 3P9LA 1ZGLP 5GS1A 4NP4H 1B0WA 5FM8A 1D9KA 2FATH 5INDB 3NIGF 4M43L 3SKOA 3SOBL 2BVQA 2HTLC 4PGCA 3DRTB 3MFGB 1EEYB 1BOGB 2VXUL 3K8MA 5KSAC 1H5BC 3L3GA 4TUOA 3ES6A 4EQ3A 1CN4A 2A6KA 4XNXL 1S7SB 5DFVD 4UU9A 4R8WH 2O61A 4J6RH 5E70A 3HRZB 4ZFGH 3MNZA 5D93C 3V6BR 1HYRC 5IB5A 4OTXL 1NGXB 1YEHL 3GSWA 3PABB 3SKNB 1KJ2H 2FO4B 1DEDA 1F6FB 5ETUB 1I75A 1G7MA 5E99L 4ENED 3KPLA 4LLYB 2AJYL 3PGDA 5CHNA 1UWGL 3BVNB 2VLJD 1ZEAH 2ZKHL 5FUCC 1BREA 4QTHA 1F3DH 4P5MB 5K59E 4BQCA 3PHQB 4LNRA 5C0ND 4JY4A 5IF0B 3WDHA 5FF6A 3VXRE 3BW9B 1C12A 5ESVA 5GS0H 3DURA 5EIIA 3WL9B 1NBVH 3T3MF 3UBXI 5HHMD 4UDTB 3RIFF 4FFWD 5H37H 1VFAB 1I85A 3UJTH 4JO3L 1ZS8A 4JJHA 3K8KA 1AR2A 3GSQA 4HSQA 1WAAF 4BFIB 3B83A 5HHOB 3QIUB 1K85A 4LHJB 3KYOA 1BAFH 2EDDA 3E1F1 2LE9A 5EZOL 2EDXA 4I0KA 5JR1H 3SY0B 2VO5A 3EFFB 1VFMA 1IL1A 1V5JA 1Y18A 3VFPA 3D85A 1ZVYA 4IHOA 3CFJA 3SDYH 2XZCL 3BKCL 5D2NC 3O3UN 4GRLC 3NTCH 5LAXB 4ZD3H 3ZTJH 4F9PC 2BOBB 4N1EA 4KK8D 2VDPH 4ODXB 4ORGA 3UTSA 2XIDA 4CADB 4JDZA 2VXSH 1QYGL 2R69H 1UVQB 1P7KA 2BC4A 4MJ5B 5TH2A 1KJMB 2HMID 5I66A 3MNWB 1IEHA 2XZQH 1T66D 5JXED 4XXCA 3MV7D 1M05B 3DSNA 3K46A 2YA1A 5DHYA 4LK4A 3OR6B 3QCVH 1TTGA 4KV5E 1T80A 2C3XA 4P2YA 3HNTL 2DMKA 3GK8L 4QOKA 3RTQA 2I27N 3ARRA 4XNYH 3PDGA 3DX9B 2XKSA 4OCYH 3VFNB 4DOHE 5I18L 3SQBA 3C9NA 4GW5A 3DO7A 5HYSB 1IGYA 2DQFB 2GTWA 4HWBL 2BDNH 5I19L 4X4YA 5F7UA 2HT4C 3MRHA 2W0FB 2AABH 4ELMF 2BNQB 2CGRH 5T3ZD 1RHFA 4WJ5A 5AWNL 4Z0XB 3U36B 4M4RA 1I7UB 3NPSB 2Y07L 4FQPA 3R4DA 3AGVA 3IXTA 1ZVHA 2PXYA 4DTGL 3WHXA 3RZCD 2HAZA 4LSDA 4HGWA 2RCSH 2ZCLL 5DVOA 2ZCKL 4JZJA 3PGDB 1CGVA 3U9PH 3B9VA 4FTVA 2FLBT 4F33A 2VXQH 4IIQC 5HPMB 3FO1A 3HMXH 5ACLA 3EYFA 4ELKA 1AQKL 3DYMA 3DXAB 1RUKL 2FWOA 5HDLA 1KNOB 1FNSL 4K71C 1GGCH 1DEEA 3OKDA 3DGGB 4AH2A 2BP3A 4DGIL 3MX0A 2R2HA 4JRYE 5DT1L 4R90L 1B0GA 2AGJL 3KLAA 2VLMD 2QSTA 1ZS8B 3QNYA 4P2RD 3PIQA 1I1AD 3SDCA 1MNUH 4OF8A 2R1YA 4S10A 5HDOA 4WGVB 3B2UD 3SDDA 3OAUL 4J3VA 3MCLL 5EU6E 3IDGB 1XF1A 3X11A 4QRPE 4UTBL 1D9KC 4I77H 1SMAA 1TQCC 1RULL 4OLVL 3I85A 4NQXB 5B38A 2ATPA 5I71C 4O2EA 4OQTL 2WBJC 2FX8H 4P2QD 1FDLL 1IAKB 4OZ4A 1F02I 1UJ3B 1YEGL 2F8VA 4CNIB 1UVQA 5CLWA 5MENE 3VRJA 5F3BA 4NZUH 1TETL 4OCSL 4JM2C 3OKEB 3CH1B 5D2LE 2FWOB 1LK3L 5EZJA 3U7WL 3ZSTA 3LN5A 4G8GE 3CDYA 5D2NB 3QUYC 2VQTA 3P4MB 3VXME 4OLZL 3CVIL 1QEWA 3V0WH 4B0MM 4AK1A 1MJUH 3QDJD 3VA6A 4L3CA 4NQSA 1A1NA 5IFAH 2AGJH 2PETA 4BK5A 2XV6B 4R90H 5GSVB 1JTTA 3M17B 3UMTA 3L3HB 3W9DB 4Q74A 4OFPA 3SO5A 5E2TH 1S9WB 5HI3D 4Z7UA 1GGCL 1XZ0A 4AMKH 4CVUA 1RUKH 2NXYB 4NKOA 4CBPA 5E6ZA 1H15B 2YK1L 3OXRA 2AQ2A 2CDEB 2QQNL 2X10A 2XWTA 4UILH 1HHHB 2PW1B 1N8ZA 3NCMA 3SJVE 5CMAB 2DLFL 4MA7L 4PJDA 4ZPVA 4KI5F 4NDMA 5LBSL 3C5SA 4M93C 4R4FH 5ELIA 5CEZL 1YEFL 3VWKC 4D9LL 5JNYA 1X7QA 4DTGH 2J5LC 3O6ML 2YPKA 2VERN 1BD2E 4I3GA 4XHQA 2R0WH 3BEWB 1S8DB 2ZOLB 1QPPA 5EUOE 5GGVL 4YHLH 4R3SB 5H94B 1KTLA 3I02B 1JNHB 1MVUA 4OCNC 2ICES 5D1XB 2WUBL 3HMWH 1MPAL 2B1AH 1MLBB 2C7UB 1KCSL 4CMMA 4JKMA 5KVFL 5BV7C 3AU1B 4P46C 3SKOB 4FXGA 4JG0L 2EICA 3T0EC 5FUOH 4PTTA 2BNQD 4OF0A 4K71B 4QRTA 4GO6B 1TJIH 3J8F7 4FHBD 4M6OH 3O2DL 4G9FB 4MAUH 1BFVL 4FXGB 4HK3J 3WIIL 1T22A 3BKJH 3GSOA 4QTIL 4NRXB 2A6JB 3GSQB 5IT2H 4K3DH 4KMQA 4J4PC 2L0DA 3IFLL 2VLKE 3SDAB 1CE6A 5CJOL 2F54A 4Y16C 2VZ3A 3V4PH 5HHQB 3OKMB 1N2RA 2VQ1B 1RZGB 2ZSVA 4NWUL 1X4YA 5DQJA 4NC1C 4LNRB 4LPCA 5IR1A 4RX4D 3EDDA 1U8KA 2FX9H 4ESKA 3EYVA 1OT2A 1TVHA 2EDBA 4PRPA 1S7XA 3QG7H 3P0YL 1J12A 4X6EA 5JNYB 4KUZL 1F5WA 2OJZL 3WXVH 1DBAL 4MB3A 3O6FA 4GKOA 5BXFB 2VLJB 2VN7A 1RZ7H 1KSRA 3D5OF 5BRZB 1LE9B 4BZ1L 5IOPA 5IMOB 5JHLH 5C6TH 1T1WB 4LLMA 1H15A 4X7SL 3KPSD 1NDGA 2A1WL 1S9VA 1BM3L 3BESR 1CLOH 3BD4A 3TVMA 3U7YH 4J4PA 3OGCB 4J3WA 1N5AB 4OZIF 1CE1L 4MAYD 3KWWA 4G6AC 5CEYA 3OX8B 2YEZB 1U3HC 1KJ2L 1TPXC 4LCCB 5I8EA 4HLZG 3VXNB 2CXGA 4AG4H 5E24E 1GYAA 1QFUL 3S4SB 4YDIH 3VD5A 4Y1AA 3C5JA 3RWHB 2EEBA 4YHPA 1G6RA 1FVEA 1JFQL 5ISZB 4DUVA 3LKOA 1GC1C 2VXVH 1OQOA 4L8BB 2H32H 5D1QC 5KSUB 1KCUL 1BD2D 5F7KC 4P49A 4Y4KC 5EIVA 4Y5YB 4TVPH 4FABH 2FATL 3UAJD 4WEMB 1YEDA 1IBGH 1IE5A 4PBVC 2YD7A 3QDJA 4K3JL 5FHBL 4JFQB 2E6QA 5IW6B 3G6JA 3ZDXF 2IBZY 3PWPB 4NWTH 4LSPH 5T1KD 3ZKQD 3EDKA 5CMAA 1OSPL 2FJHB 4WFEE 1NL0L 1CFBA 3ULUC 2CDFA 5TE4H 4XPHH 2JIXB 5I1EL 3Q6FA 3L3OA 1K9TA 3BE1H 2H26B 1HZHH 3TLRA 3FQXB 4IJ3C 4ZO9A 1SVCP 5GHWH 3BN9D 3G08B 1AGBA 4P2QA 2OS7A 2P43B 4JFDD 3N50A 3FFDB 3CMGA 3MXWH 1S9YA 1DP0A 3ARSA 3T0VA 3EOTH 3DRQA 2MSPA 4XPFH 5BO1L 2UY6A 2DJ4A 4OFYA 3GRWH 3HPLB 1RJLA 2HWZH 4D3CH 5IB4B 1FN4B 1MY5A 4LSQH 3QQ4A 1QQDB 5FGSA 1YMMD 1M7XA 1EO8L 2KL6A 4KMTH 5LWYH 1DQJA 3I6GA 3FN0H 1JZ4A 4Z5RB 3PJSA 4JLRB 4F7MA 5D1XC 5DVMA 2NY3C 4UT6H 4HJGB 4IOSD 1R3HB 2G5RA 3FRUA 5E9DA 2J8UE 1UWXK 2VTFA 3LS5L 4ZFFB 3U1SL 5IEKB 1RY7B 5E6IC 3DYPA 2VC2L 4PJ5D 2X4NA 4C56B 4PJ5E 2NR6C 4MWFA 4C54A 1LP9A 1KCVL 3L1OL 3WFBH 5IMMA 1W8NA 4P4KB 5EZIL 3DPBA 3MRGA 4EUPA 2DQHH 3OB0K 2PNDA 3L5XL 1OOAA 4MX7A 3ARFD 5D7LA 3W9DA 1FGVH 2EDEA 2ZUYA 4K8RD 1S7VB 2I9LB 1PYWA 2AXFA 4N8VA 1LO4L 4GXUM 4IOIA 1GOFA 5CP3A 3VWKA 5ANMB 4MJIA 3QPXH 5IVXF 2ZNXA 1KJVA 4YE4H 4ZTOL 2NZIA 4TSCH 3GJEA 2F5AH 4U7MA 1SJEB 4KMTL 3U79A 5FAAA 1X5ZA 5DC9B 5JA8B 1FVCA 5TE6L 3PWJA 4GSDL 1K8DA 4FQXB 1T3FA 2YA2A 5GS2H 1W72A 4J3XA 3EFDH 2ZOKA 4YK4B 3G9VA 1T6VN 1U8IB 2HVKA 4Q58C 5LAXA 3H9HB 5EPMA 3VXTA 5E0QA 3KXFA 3T65A 4KTDH 4KROB 5SX5H 4HIEB 1FBIL 3OTTA 2BY2A 4FQXC 5L8LB 3GKZA 4WGWB 43C9B 1HYSD 1PG7W 4HJJH 2XWBB 1E4WH 4UQ2A 5IJVB 5DMJB 5MERA 2D7PA 4IMLA 4XPHL 5I1EH 4NYLB 5EO9B 2FECL 2P5WA 3ULVE 3ORJA 2LVCA 1WC7A 1NMBL 3ZTJG 1OSPH 2OR9L 5EN2A 1MCPH 1CICA 3MLVL 3MV7B 1G7PA 2VZVA 1P7QA 5D6DA 4K3JH 5FHBH 1NLBH 1WVZA 1J1OH 4DFIA 2AXGA 4G9FD 5ACMA 4M62L 2OQJA 5F6IC 4TNVF 1A5FH 5KS9E 4YHZH 5J57B 4ELMB 1DR9A 3HPJA 4OBSA 2V5RA 4M1CD 5C70A 2X9YA 1M05A 1UXSA 4MXVF 1A3RL 3GHEL 4O4YL 4OD1H 5DO2C 2DQUL 3HLAB 1F58H 3PHOA 4ZUWA 3VXSA 1Q1JH 3PP4L 4DW2L 4HAGA 5FXCH 2ZNWA 3QAZC 4ZYKA 1NBYA 1Q9OA 3NFSH 3D69A 5LXGL 5L0QC 1MIMH 4M6ML 4M5YL 1UKSA 2FHFA 1UB6A 4IHOB 2EIEA 4TUJA 4X6CF 4MS8D 2FX7L 5BV7B 1PEZA 3IFNL 3ES6B 4PRPD 2LTQB 1JGUL 5F8RC 1G9MC 4PRIB 4Y1AE 5D1ZC 4Y4FD 4EDWL 4Z76A 4XB8A 4Q6YA 4MJIB 1MOEA 3HG1B 4JPIB 4P9ML 1Z3GH 3HCVA 1F90H 4MLIA 3DV6A 3UTSD 4KJWC 5CJ5A 1P7HL 1T20B 1KIQA 15C8H 2H2PC 2OXGA 3V7AE 1RZ7L 4M1CC 1OCWL 2E7CA 1VPOH 1CBVL 2ZUQC 1X5JA 2R0LL 1JHTA 1AP2A 4J7RA 5C08B 3MFFA 2VLRA 5BMFL 4NGHH 3CXDL 4HFUL 3PL6B 5SWQB 4UDUA 1OGTB 5EZLB 4G8IA 3T2OA 3DXAD 1J18A 1XGYH 1CGWA 2BC4B 5DUBB 5F44A 3C60A 1MJJA 3DGGA 4CN1A 1YUHB 2APVA 4NSKA 4P2QE 1A1OA 1G7JB 3HAEH 1NCCL 1HNFA 4GOSA 1JP5A 5HHNA 2VDLH 2YRZA 3LQAL 3LPWA 3QISA 3WIIH 1IL1B 4G6ML 2EYRA 3GMPA 5J12C 1DL7L 3Q48A 1EEYA 3BPOC 4ERSH 1CU4L 2NY1D 4EI5A 2HJKB 4TTGA 4N8VB 1KIRB 3MRIA 2BNUA 3LPFA 1IAIM 3RNKB 2CKBB 4JFFA 1CG9A 4ODVL 4LBEB 1DQDL 4JG0H 2DM2A 4HK0B 2PTTA 4I13B 2OYPA 4P4KA 1UACL 3SGDH 1AI1H 5I1LB 3ARZA 4GKZB 1ZKAA 2R0KH 5IJKA 3L3JA 4EI5D 1WEJH 2GTZB 3T3ME 1OAXH 1MQ8A 4PJCE 2E9JA 3QWQB 3PWPA 1TDQA 4JN2A 1JWMA 2OL3B 1IILE 4EQ2A 4PJ7F 3I3DA 3GSNH 5CP3H 4NYLA 5EO9A 3IDXH 1ZHNA 2ATKB 3QDME 3RUGF 2XQBL 2LVEA 1OLLA 3B8YA 1QR1A 3QIUC 1KIUA 1L7IH 43C9A 3IDMA 4N0FA 4Z78B 2HJLA 1C8PA 5DMGD 1P84J 3DXAA 4WY7L 1RZIB 1YEFH 2APFA 4WU7B 2MCG1 5DJAA 5EC1B 3BD3A 1N6QH 4GQPH 2JK5B 2B4CC 4NQEB 5F1KC 1GOHA 3LKRA 4JO2H 3S4SG 1FCCA 4X7TA 5DD1L 4PJAF 1RFDH 4LLVB 2BNRB 1AD9B 2GEEA 2BNQE 2LTQC 3N1MC 4MA8L 4P2OD 5D72H 1FIGL 3EFFA 2FGWH 1NDGB 2F53A 3JV6A 4I9WE 3ULVL 3STLB 4JKLA 4JFYA 5J11B 3TA3B 2Y5TA 2LQRA 3R06B 3V0WL 4S1RL 4JRYB 1FH5L 2EIBA 3DECA 1EERB 3D48R 4KJYB 1U3HA 1U8OA 4ZUUA 1XR9A 5D7LB 3IFPB 3G5XB 2A38A 3NZ8B 4HX1B 1DN2A 1U2HA 3E6FB 3D39D 4DKEL 4OCSH 1RQ5A 1NC4A 1YMHA 2P5WE 2B5IC 4TULL 5E7BA 3FQRA 5ESVB 4LDEB 4P23D 4U1LA 1RIVH 3SKJL 4HUWA 4G8GB 3BZDA 4ZXBC 1RULH 5KSBE 3EYUL 5HGDA 4WTWA 3IDYB 3MRFB 5CZVL 1EDQA 1EPFA 2EYTA 4XP9L 4HWEH 3O2VH 3TEUA 2WIMA 4PIRF 5IGXL 1MI5E 4XRCB 3L6FA 1UH2A 5CJBA 4GXVL 3I75A 3MV11 3TPUB 4PJ9A 3MJ9A 2VLME 3O3AA 2P7TB 4YXKH 2AXJA 1CICD 5IB3B 2JB5L 1A6WH 3RAJH 3FZUC 4UV7L 3W2DH 2D3VA 2OTWB 3M1BA 4I2XA 3IFOB 1F4YL 1N64L 3B2VH 1HQ4A 2BHYA 3TBSB 4J2XA 4Q6IB 4QHKJ 1AXIB 5GS3A 1MQKH 3SDDD 5HHVL 4KAQH 2R2EB 1DVFA 2GCYA 3SBWC 1ULVA 4WO4B 3W0WE 4O51B 3PL6C 1MHEB 2HVJA 2CDFB 5F1SA 5I1IH 8FABB 1GGUA 1SHMA 1DQLH 5EOQH 5JHDB 1FFPA 3WYRA 1T21B 5D9SB 5DEZA 4GG6A 3O4OB 5AYUH 2QQQA 4YLQT 2Y07H 1U58B 4HUXB 1FFNA 1KIPA 5I17A 1BVKA 1WTGT 5IMLA 1VGKB 3EHBD 4KI5D 4RIRB 4M8VA 4R26H 4OM1L 1JF6A 3BKMH 5L2KB 4YNYA 4JJ5A 1H0DA 1A7OH 2DQDH 2N7AA 3L5WB 4L8BA 2BDNL 2LFGA 4MLSA 5HGBA 3S35H 3U82B 4GRWF 1FNLA 1JNNH 2FNBA 2FBJH 2HT2D 3QJFA 3KHOA 4PJAE 1A64A 5JORB 4P2RE 5HGHA 1QO3B 4XNYL 35C8H 3QP3A 4OZFB 3S88H 3GK8H 1HIMH 2EDLA 4P57A 3IU3A 3PF2A 5IG7B 4LKXB 1OM3L 4Y4HA 5SX5K 2FZ3B 4HIIA 1VKXB 2DLEA 4RGMB 4E41B 2X4SA 4OLYH 5ENWB 5JMOC 2GSGB 4PR5B 3AU1A 3ZE0E 1ZSDA 2Y25A 4LIQH 4G43A 2AS5M 3SCMD 3UO1L 5C0JB 1UCBH 1YDPB 1RVFL 1EZVX 5I16A 3HAEB 1BGXH 2DLTA 2C1OB 5D2NA 4W81A 2Z8SA 5EWIH 4Y2OA 4L8CB 3HZKA 4Q2ZA 4ZD3L 3ROLA 1ROWA 2XTLA 3C2SA 1JHKL 4KHXH 4JFQA 2GAZA 3JBG7 3LKSB 2MHAA 4PJGE 5ID0A 2NX5E 1I3VA 1CDGA 4R7DB 4I18A 3BO8A 3T4AA 1CLYL 2IC2A 5CKGA 1CDUA 5SX4H 3ARBD 3BQUC 4LNVA 4HX1A 4XP4H 2B20A 1MFCH 1WSST 1F45A 4HHAB 2AI0L 3RDTC 1JF1B 1A02N 1DUYB 2V7HA 1N0XL 3P11H 2X4RB 5ITFB 1ORSA 3MBEA 4NO2B 3IXAB 3E8UH 3T0BA 2NNAA 3AB0C 4D0CB 3BPLB 3V5HA 1QFWL 4OCWH 4NQVA 1PLGL 1UM5L 4MNQE 2MTPA 3H9SE 3O3EB 4AEHH 5A2KH 1BQUA 4P46D 1EBPA 3MYJA 3T0DA 3CDGA 1T89A 3IGAB 6FABL 1AGEB 4Q9CA 1CXKA 1RUQL 1CFVL 5GGSA 1KPRB 3N1FC 4N8CH 3R06A 1MCRA 1WICA 5TFSH 3DX8B 3MZGB 4PJEB 4QXUH 2CLRA 3U4BL 3K0WA 5JW3L 1GZQB 3LIZH 4ACPA 1ZANH 3L5IA 2R0ZL 5F6HJ 1XR8B 2Y7QB 1YEHH 5GRJL 4YHYB 3CU1A 4PYGA 3ZDYF 4OCRL 3I84A 3O9WB 3BQUD 4L4VE 3U48A 3D3VE 1ADQH 3FN3A 4X6FB 1CDBA 2AEPL 4EVNA 4F2MB 2WNGA 1S78C 1MAKA 2XN9A 4P99A 1GGBH 4EN3B 3S96B 1HOCB 5HGDB 3NCJL 3KNBA 2OK0H 1UWEH 4UAOC 2IH3B 2HP4A 3MRQA 1B6UA 4YFDB 4G80A 1CFQB 3VWJC 4NP4L 4Y19E 5J06A 4RDQF 1S7UA 4QXTB 1MY7A 4WHTA 3H8NA 5T3XH 2O5YH 3O81A 5HGAB 1EEQA 3QUKB 3D25A 4DKFH 5KN5B 2EDTA 3SDAA 1AD0B 3ULUL 3O3BB 1YJDL 1D5ZA 2YXMA 3QEUA 4ZFZA 1JZ7A 4ALAL 4M3JA 1P4LA 3TA3D 4QXTA 1RU9L 3DVIA 2I9TA 3GEWB 1NEUA 1TCRA 3QA3B 4OZFG 1MRFH 2V7NB 3WCYA 4LRIA 4KVCH 5KOVC 2ICWB 1CGUA 1NGWA 4LHUD 4LVHC 5J56B 5FA4B 1JGEA 5KZCB 3B8SA 4OKDA 3RY6C 1QFOA 3MUGB 1PKQE 5FDYA 4GUPA 5HBBA 1KELH 2VDOH 1GHFL 4GRMA 4N9GA 4ZNEE 4Z7UE 3EZ8A 3MV8E 3F7QA 4I3SH 2XI9A 2ARJB 2ICWA 3WFDH 1FVCB 4XNUH 4P3CL 4G6KL 5F7MC 3VFGL 4XAWL 4POZD 3NCFB 2E3VA 1U9KA 4KRNA 2J88L 3QUYD 3R1GH 1R5IB 1TJGH 2AK1H 3BEVA 4D9QD 1AXTL 5TPWL 2H8PA 1GGIL 1EHLL 2FSEB 3BAEL 3MFFB 4KQ3L 4LEXH 2HFEA 3L3IB 1D5ZB 4LMQE 4MB5A 1T2XA 3O3EA 3O41A 4Q6IC 2Z31A 1NFDF 4KU1A 4KRLB 1VERA 1HILA 5DTFA 2D7MA 2GJJA 5ANME 3V6OA 2Y36H 2EDOA 3RWJA 3O8XC 1YMMB 2FJGB 5EIIB 3T8XB 3ZHLA 4NQUA 4XC3H 3ARWA 4Y4HC 3WFZA 3QUZD 1NGQH 4I3RL 5D7LD 2UZIH 3LQZB 4LBEA 5C09A 4I18B 1UYWH 3PGFH 1F97A 3RWGA 2HVKB 1A2YA 2X5PA 4JVWA 1I1AB 2ITCA 3B3IB 5CS7A 1AKJD 3IDYC 3PDDA 4LSVH 3ZYOA 2H6PA 5E5MB 1IGCH 1W72B 4NC0B 1DBBH 3UTPE 3KPRA 5I1HL 1JNLL 4CU6A 1B4RA 4XXCC 4WU7A 3RX8A 1OAZH 3HE6D 4AIZB 3FQNA 5FYKH 2ZG3A 1YNLH 1KCKA 4NZTL 1C08A 1TZIB 3OV6A 4FQ2L 2PXYB 1FYTA 2XACC 1CDJA 5EOCL 4LSTL 1AQDB 5KVGH 5HY9A 3CMOL 5CCKH 5EBLB 4LRNH 2WUCH 1KC5L 1YEEL 2HFFA 2X4TA 4HKXB 2X4RA 2AKRB 4Y1AD 1D5IH 3AB0B 1T2QH 1TMCB 3OKKA 3OR7B 4NPYA 1I1RA 2J8UA 3PV6B 4FQHB 1ZA6A 3ARFC 3SPVA 4K94H 4F7MB 2A6IB 2IGFH 1I9IL 5KSAA 4PJXF 4U3HA 2ZUXA 1MFBH 2VZUA 2NY6B 5IMKB 1KACB 4ZSOB 3RX7A 3OKDB 3RVWC 1LP9E 3X17A 4F7TB 3FQNB 1IT9L 4XHJD 3DI2B 3HZKB 4M7LL 2B1HL 4WENB 4R7NA 4NM8H 5C0GA 4WVRA 2XQYK 5DK2B 1EUUA 1LWRA 1SEQH 1RSFA 4PRIE 1PY4A 4N90D 4Y1AB 1VENA 3LEYH 4OT1L 3V0VB 1S7TA 3PWLA 1XIWD 1ED3A 1EBAA 3QFJD 4UT9H 4G3YL 3VXSB 4HIXH 2OI9C 4HWUA 2JJSA 4PJHF 2YC1B 1NGWB 2WINA 2BRQA 5HHPB 1ZA3A 3RWCB 4MNHB 5K9KA 1CGTA 2VITB 1K5NA 5E2VH 3OKYA 2GY7B 4PRAB 1MCFA 1P53A 1G7IB 2OQJB 4IMKA 4F58H 1SJHB 5I1KL 1Q8MA 4DGVH 4BUHA 3LCYA 1EEUA 1RD6A 4FP8L 3G6JB 5BXFA 5C0RH 5F1IA 5CGTA 2BJMH 3S5LA 1JTPA 5E9DB 4F15C 1HNGA 4JFFD 3QO0A 3KPSE 2HFEB 1SM3L 1BVKB 5L8JB 1F13A 2E5EA 1CVSC 3S98A 3VD7A 1VEOA 1J1PH 1A4JA 3LS4H 4NRZA 1PFCA 4GKNB 1XF2A 5GSRA 3X13A 2AK4E 3KVQA 1X5FA 1EGJA 2X44D 3RWHA 5SWZA 5HHXL 4X7EC 1HSBB 1L0XA 1JYVA 1XGPB 3IKCB 2Y5EA 3G5ZA 1X5XA 3B5GA 1QOKA 4C55A 3SKMB 4WCYH 5F7DA 4JFPA 5I74B 4R97C 4NM4H 3GBNH 3BUTA 4UOW0 4Q7DA 4ZAKD 3IETB 2AXHA 1JGVH 3IDIB 32C2B 2O93L 3U4AA 4YDVA 5C0AA 5TGBB 1DTUA 2EYSA 5I76B 4U3XA 5HGHB 3VGDA 4KJPD 5F9OL 2VDNH 4XZUB 1CLZL 5K9JL 4HFWA 4XVJH 4Y19D 3FFDA 1NCBH 2OSLA 3GMNA 4LP4A 3STZB 1OTTC 3GBLA 3FONB 2P8LB 4HT1H 2JKXA 4HUUB 1HXMB 1IGMH 3C5ZD 4PJGF 5IK3A 5DDHB 1CGSH 1RJZA 4D9RE 2J1KA 1ORSB 3W11D 4QRPB 5ESAA 5DJDA 3BW9A 5KZCD 1PJ9A 2F19H 4JKWA 2CIKB 4U1HA 5JA9A 3CVHH 2VDRL 4YBQD 3IKKA 3WEXA 4Y5VA 2CLZB 1A6TA 3QCUH 5AG8A 3O3DB 4M48H 1RMFL 1QBAA 3HE6B 2VR4A 2GFBA 1INQA 2NZ9C 3ILQD 5FGBC 5KANI 4E5XB 1DQQA 2VLRE 4WDIB 5ACZB 4KUCF 1U92B 4YWGL 3DWTA 1T3FB 4LDOB 1JYXA 3TBTA 2G2RB 1A6VH 4JFYB 3IDJB 1G7QB 4OJFH 3LD8B 1QHOA 4PP1C 3V52H 3ROOB 5I1CL 5FM5O 3L5HA 4PLNC 3H42H 5D7KD 1ITCA 1NSNH 1NCTA 3SE4C 1JCKA 1R0AL 4Z9KB 1PDKA 3SKMA 2K9UA 3H9ZA 4LOUC 3IU3B 2VLJA 3PWLB 1FNGA 3KPPA 5I1JL 1LMKA 3QIBA 4LSUL 3FQWB 2I25N 5EO1A 5EUOF 1TVHB 3WNNA 3PXHA 3WJJA 5F9JB 5D1ZB 4NQCE 2FL5B 3LEVH 5ICXA 1T4KA 2V7HB 3ZHDA 2YPVL 3KPNB 1EJOH 5KSVA 1U8NA 1INQB 4X99B 3THML 5E94B 5CEZD 5DRWB 1OAYL 4IEFB 4XWOC 5KJRL 1MCLA 1OVZA 4R0LB 5DJYA 1XGQB 4QT5A 1P6AB 1FFOB 1X7QB 4K8RH 3LKQA 3CLEL 4LEOB 2G60L 1JWMB 2OL3A 4KDVA 2EE9A 2VN4A 2BVPB 3NZHH 4XMPH 5KS9A 5DEFB 3LRGA 1ONQB 4YPGA 1OPGL 3PWNB 4ONFH 5GGRY 4G9FA 4U1GC 1HXMA 1MHHB 4YBHA 2DM4A 4MDIB 1JWUA 1OB1A 3BGAA 5CILL 3NA9L 2A6JA 4NKDB 1AY1H 4EN3C 5K9OB 1YEJH 3VFVB 1B2WH 1KXQE 3ABZA 3QUMA 5H2BA 2DKUA 2W38A 5E8DH 4X6DE 3FQXA 1BX2A 5C07D 3VXUA 2C26A 5FYKD 3IDJA 5DUML 5IW1A 1RIUH 3L9RA 2B4CH 5DMGC 3ZT6A 1IGIL 2IG2H 4FTVB 5IBTH 3LV3A 5FO9A 1KTLB 5E5MA 4ZYKB 2QQLL 3MGAA 3G5ZB 4XMKH 3BP6B 1I4FB 3GSNB 4JJ5B 3BPCB 4GLRI 3TWCL 5KANG 1WGOA 2A6DB 1VACB 3N85H 5EULV 1JPSH 3JTTA 1MREL 1DANT 3NACL 3B4NA 3BSZH 4N1HB 3BZFB 1FL5A 1CZ8H 3V79C 1X5HA 1T21A 3E2HB 5T5FL 3IJSA 4PJFF 1RZJH 4I18C 1BFOB 2Z93B 2PXYD 3KYMB 2DQFA 3HB3C 4Y2DC 3U0TB 4HULB 4HKJA 4NJ9L 4AENB 3BKYH 1NBZA 1CXHA 4BQ8A 4XNQB 2Z92B 1MRDL 4RFNC 3EZJB 1UGNA 5F96H 3WKMH 3EGSB 4HFWB 4PJBF 1JWSA 4IDJL 5E8DL 5I2IB 5CJQH 3C6LB 5J13B 3EO0A 3BXNB 1ND0A 5L88H 4S1SL 3FCTB 4YDVB 3JWOL 2O5XL 5E9DD 2VITA 4XB7A 3I2CL 3MXVL 1Z0MA 3MLXL 1DBJH 3BH9A 1I3RB 3S9DB 4KZDL 1BECA 2DMCA 4LGSB 3RX5A 3GBML 3RBSA 2I26N 4PJHE 5GZND 4PUBL 1N4XL 3R8QA 4PJGB 3ME0A 3S7GA 1Z9LA 2ITCB 2Q3ZA 4ORGB 5IQ9B 5L2KE 4QHLB 4MB4A 3O2WH 1RURL 2Y06L 1MI5D 5DK2A 3NZHL 5HHNB 1Q9WB 5D1XA 3HC0B 1RUML 3CLEH 1ZHBA 4K8RL 5ISZE 3QUXC 1N0LA 2R23A 4J8RB 1I8IA 2NY6D 4IIQA 3QUMH 1DDHB 4JE4B 1HINL 1G9NC 4OZHF 1X5IA 2NY2C 4M93B 2F53D 2A6IA 4UIKH 3VFMA 3CCHA 4K55A 4MDJB 4E41E 5KAQG 5LGKA 1PBYA 3E3QC 5IWLC 4O02L 5KSBA 1S3KL 4M5ZH 3IFPA 5DLMH 2X4PA 4JZNA 1G0XA 1NGPL 1I7TA 1T03L 5I30L 3STLA 3EUUA 5B21A 4PFEA 2YD5A 1IC7H 4PLJD 1ZWIB 1AO7B 5D71L 5D6CA 3T65B 1HCFX 4OF6A 1BOYA 4DN3H 3KR3H 3WIHH 4C57C 5IFHH 3DVFA 3VG9B 3HG1A 2HN7A 3X12B 1P2CA 1A6VL 1QSZA 4Y5YC 3GMPB 4OFDA 4F3FB 5ICYB 1TQBB 3OF6A 2F53E 1S7RA 5AUMA 5ADOL 4K23H 3WS3B 3N9GL 4HZLB 1PEWA 1YN7A 4JM2A 4Y4KA 5I9QC 4XBEL 2YBRA 2DD8L 3M8OL 1P2CB 4OZIE 1GXEA 3TO4B 4KZEH 3RGVD 3KYOB 3HS0A 1IAKA 1D9KB 3MA7A 4XPTL 3JZ7A 5FGRA 1G9NH 5HYJB 3TZVC 1YY9D 1K8IA 5DK3A 1V7NH 2NY2D 1Z2KA 2ZPKL 3MRJB 3TBWB 3WO4B 5J9PB 4OUUB 1EO5A 5DEFA 4OD2A 4JHAH 3L3JB 2Y6SC 5I0ZA 5FKPB 1YJDC 3NH7H 4XCFH 1YECL 1UZ6E 1T0MA 1MCHA 3BZFA 2V9TA 3ULSA 2KZWA 3LH2L 3OJDA 4TYUA 4NOFA 1XZ0B 2Z31B 4WTZA 1H5BB 3RGHA 4JFZH 5CJ8A 4YDLC 4HJ0C 4HXBL 2JELH 1DBKL 3BN3B 1VACA 4WO4D 4R7DA 2XT1B 3M17A 3H9HA 4PJBE 3OZ9L 5GZOD 4FFWC 3MR9A 1YY8B 4KKAC 1NFKA 1JGVL 3QDGE 1HEZB 4LL9A 2YBRB 1JPTL 3LY6A 4ODSH 4X9IA 4WCYL 4TUKH 3FT2B 3LN5B 4MJ2A 1NAML 4GBXA 4PB0H 3S37H 1FC1A 4P59H 4X80H 3TCLB 4CKVX 2YEZA 3F58H 5FHAH 3IT8D 1KB9J 3BP4A 4JRXE 5JIKA 1R5WA 2LU3A 2GSIA 3EOAB 2OJEB 3ALXA 3D85B 1OY3B 1U8JB 1WFNA 3QSKB 4JPVH 4NNPL 4K3HA 1F6LL 3MYZA 2IFGA 4YHKH 5E8PA 2O5ZL 3LPGA 3SQOL 4LKCA 5GJSH 3QIWC 4PD4K 2XN9E 2MWCA 3GRWA 2BJML 2W65A 3IU4H 3BP7A 5EO0B 5D7IE 4OIAA 5KW9L 4KJQC 1A14L 5I1DB 2LU4A 5T33L 1T1YA 3UEZA 2XTJD 1XGQA 4QT5B 1NDMB 3MV8B 1BJ8A 5KVMC 4JFOA 4WWKB 1NUDA 1R3JA 3VXSD 2FO4A 1D5XB 3T0EE 3GIZL 5DD6A 1FPTH 4YK4C 1TVBB 3ZE1E 1JGLL 4ZO7A 4JM2B 3SCMB 2VOTA 3R0MA 3FO1B 4G8FA 3F7RA 3PJSB 1FAIL 1A7RH 4DZBA 1NPUA 4JB9L 4HXAL 3LEYL 4OT1H 3BPCA 4PG9A 1DVFB 2HTKC 2YWYA 2DDQL 4RMSA 1E27A 1KB9K 3KG5A 4H0GA 1FO0H 4H0HB 3LV3B 2BOBA 2WBJD 3C8DA 1NANH 1IT9H 2NR6D 3ARVA 1HQ4B 4P23A 3G08A 1BZ9A 4GAYA 4WI5A 1XR8A 2Y7QA 1ZTXL 3AXLA 4YUEL 4QY8A 2DQJL 3QI9D 1JV5B 4JR9L 3VWJA 4M6NH 3B2UC 3VJ6B 5D1XD 4RA0C 4QHKI 4RWYL 3FT4B 4BZYA 5C3LD 2APWA 4CVZA 1D5IL 1MFEH 3HE6A 4B41A 1SBSH 1G0YR 4PV8B 1JVKA 2A0LC 1SYSA 2UYLB 4YPGB 1JBJA 5KAQF 4KPHH 3SHSA 5IW6A 4NZRL 1AC6A 5A2LH 4LEOA 4X7CC 3BH8A 4D9QE 1JUFB 3G9AB 4R0LA 4LLYA 5DJYB 4NO3B 3VXTB 4CU8A 5FYKL 1TJHL 3NABH 3WXWL 5ISZD 3ARDD 5EC2A 4NUJA 1DBMH 1NGXA 3GM8A 3QEGL 3JV0A 2DYPD 2Q20A 1DBBL 2K1MA 5E2JA 4YHPB 3PE9A 4FXKA 3FQWA 1S7SA 3HRPA 1INEH 5FKAA 5BS0B 5JO5A 4LGPB 3MRMA 3VGFA 4OGXH 5C07E 3ZDZF 1MFAL 5GGSB 4R4ND 5DYOA 3ZMRA 1E4JA 3TCXA 4Z8FH 4JRXA 5E8EB 3EIFA 3IYLW 3TYFA 2CMRL 4L9LB 1A14H 3QG6A 1QEWB 2Z31C 4G8EA 2EXYD 4PJEE 1AO7D 3TO2A 1LP9B 1L0QA 2YD1A 1NUNB 4L4TA 4LCYA 4EOWL 1LP9F 2DIAA 3V6OC 3O0RH 1J0KA 4L8DB 5FF6B 5TDNA 2QHRH 1D5MB 5LQBH 4ZODA 5D7JD 2FO1A 5HI4D 5D2LA 4HZAA 1O0VA 4WUUA 2NY4C 3QXUA 4U1JB 3IAPA 4IOFD 4EXPX 4UOW1 3BAEH 5E4EB 1AXTH 4NQXA 3QDMB 4HK3N 5FHAL 2E9BA 5EA0H 1S9KC 1WISA 2CIKA 1U8HA 3ZL4H 2ZUUA 3NPSC 5E8NA 1BZQK 5A16B 2X4TB 3D3VD 1JE6A 1JRHH 3D87B 4TUKL 3TA3A 3D85D 2D31A 2BVTA 3OG6B 5I1AA 3MUZ1 5AG9A 4I48A 4QRTB 3JWDC 1ERNA 4LU5L 4MNGE 3RPKA 3VD4A 3F12B 5I73B 4OIIH 4RQQB 4XP5L 5GGRA 1HXYB 3JSSA 4KJQD 2YRPA 3I6LE 2PO6D 3P4NB 1HQRA 3HZMA 2A9NL 2EIZB 4HXBH 1U91B 4R2GD 1DEEB 3U30C 3VFWA 4PB9H 1S7TB 2FDBP 2APTA 4NKQB 5D70L 1KJ3H 1NKRA 2OZ4L 1LVEA 5FA3B 2QSVA 4NNXB 3WS3A 2P5EA 4X5WB 3REVA 3LN4B 1U95A 1KCRL 4UBDD 1IRAY 2NW3A 1U93A 4PTUB 2HJLB 2ZPKH 4KKCC 5T3XL 1VFOA 3RA7H 3VD9A 2GFBB 4WHCA 1GC1L 1AKJB 2PYFA 3RWGB 1ADQA 1G9NL 3T0XA 4TVSa 1NMAL 3B5TA 1REIA 5FYJL 3H3PH 3O4LD 4Z77A 5D93B 1VSCA 3WNMA 5FIEA 4O2FA 5KSUA 1RK0A 3NCJH 3M8OH 4GG6B 5B38G 4U1LB 3BEWA 1V3KA 5DJDB 5JIPA 1P4BL 1RZKC 2ZUWA 3G5YA 3HFMH 5DC4B 2AEPH 2HRLA 1QVOA 1AHWB 3Q6GL 3KPSA 3H0TB 3TJEL 4KROD 4M03A 3FT3A 4X5XB 3PIQB 2R2EA 4ODHH 3MLPA 4FFZL 5GRJH 5F21B 4DAGH 1FYTB 3ESUF 3QNZB 2UY7A 1OAQL 1VGEH 4U0RB 4CVXA 1D9KD 4GLRH 3KPRE 3I3BA 1YYLH 4JHWH 3UC0L 4W4OA 4YHOH 1BJ1J 4HF5L 4QY8B 4YDJA 4PJDE 4KHTL 1OAKL 4PP2A 1ZLVK 5F9AC 1OP3K 4KKLC 5DVLA 1PLGH 5C0EA 1ORQA 3R0NA 4IS6A 3EW3B 3GZKA 3FQTA 5DJZB 1E6OL 2YOCA 3E8UL 3BZEB 2VABB 3GSVB 3QEHA 2QSCL 1KPUA 3DX7A 4ETYA 4QXGL 2J12B 1IEBA 5KVDL 2QTEA 2H32A 2DQGL 4HC1L 4I5BA 1AO7A 4KI5E 5DMIH 3QUML 3RHWK 1GGYA 3LRHA 2IPTL 1SJVA 5C2UB 3BWAA 5C0CB 4JFOB 1RZGA 2ZSVB 4WWKA 4B7LA 3RFZC 4UT7H 3C09B 3MPCA 4OKVA 2GI7A 1RURH 3P4OA 5DD3L 4KHXL 1NCWL 5HYSA 1FZKB 4OF3A 3BIKA 2YS4A 4PUBH 1ZHKA 3GBMH 3UBXB 4Y4FB 3KLAB 1ACYL 1BGXL 2R29L 3MRPA 1T22B 2AKRA 4M02A 4PJ9C 1QA9A 3MLXH 3T1WA 2D0GA 1A6AB 1CFNA 1UCBL 2HT2C 5TQ0H 1F6AA 3KGRA 4LIQL 2O5XH 4Y2DA 2DTML 4G80B 1LO0L 4QRRD 1AQDA 1PG7X 1QG3A 5EH1A 5DVKA 3HNVH 3EYSH 1QRNB 2YKLH 4MD4A 5E2UH 3WNPA 5HYJA 1FIEA 1DVFC 2GY5A 1HIML 2UVFA 1J8HD 4HPOH 5IHZB 3MJ7B 3VH8B 1N7MH 4H20H 5EBMA 2FH8A 2H1PL 3RZCC 3V9FA 4RAVA 5EORH 4ZSOE 3TV3H 2FBJL 5JQHC 1TLKA 1WZLA 3WNKA 4Y4FC 3BYTA 2CRMA 5MI0C 3KPRB 2DLIA 4YDJB 5IBUB 3X13B 1BLNB 1XGTA 2V7NA 4XBGB 1KFAL 4PJEA 3DX6A 4UNUA 4LAQL 4L3EE 3O6LH 1FC2D 2AXFB 5INDA 3MLWL 5F7EL 3ULUF 3MYJB 1NUFA 1A3LH 2PO6B 3DYOA 2J6EH 3FMGH 1OB1B 2AJUH 3QUXA 5E7FA 3KYMA 3U0TA 3VI3E 3BDBA 4DCQB 3C5SB 5E8PB 3GJFH 4BUGA 1YPZB 3BQUB 4HMEA 4JPKH 3EOYG 1ZT7A 2EE6A 2OX5A 3QRGH 1RIUL 5I15H 3JXAA 1QKZH 2H3NA 3G6JE 3MRQB 3ZKSD 3CU7A 2I07B 2W9EH 1JJUA 1LD9B 4TRPH 4E9LA 3TFKD 1OF2B 3L3IA 2BNUB 1IAIL 3BP4B 1AY1L 1C08B 5GGUB 3NA9H 2JB5H 4PLJC 1A1NB 2YUWA 2KBGA 3ETBF 5IB5B 2XNAB 4YDKL 5T1MB 3CGTA 3MRLA 1MCOL 3P4MA 5JDJA 4RZCB 4QRQB 2MPAL 3P30H 4JANA 3MR9B 4POZC 5ILTH 4JPWH 2APXA 5B3JF 4JCLA 3QFJE 3FL7A 3QHTC 4F7PB 1R6VA 2DWEB 1QBMH 3FFCA 3DUSB 4PJHB 4JQIH 3BPNB 1S9YB 3KYAA 4Y5XC 2PTUA 3DVNB 4BZ2H 3HTLX 4F7CB 5DJ6B 3H9YA 4ZXBA 3LEXB 1ZT7B 5LGHL 4HG4J 3NCYS 4IRJD 1QO3A 2K7QA 3RWIA 2VDQL 4RMQA 3IXAA 5D8JL 3V8CA 1ZGLB 3LEVL 1C7TA 4MS8C 4PJFE 3TZVB 3GI9H 4KK6C 1DE4A 1DLFH 4HS3A 1MI5B 4K7FA 4NZJA 1TZHB 3BYYA 1R3HA 4GBXD 3ZYJA 5IESH 4MXWL 4JKPH 4LQFH 4V1DA 3HI5H 3Q1SL 2P46B 5DRWA 4EUPH 1KIPB 2FGWL 2R2HB 1U8MA 2VZTA 3A6CH 1YZZA 4DK3A 1KN2H 5DRNB 1FL5B 4KDWA 3HZYA 4OJFL 5CBEB 3QULA 2VKWA 4N9OB 1RJZB 4HV8A 1PAMA 4O58H 1RUAL 2ADFL 3QIBB 1AH1A 3BPLC 4NJAH 3MCG1 2AK4D 1FE8H 1ZSDB 2VLJE 4XP1H 5C8JB 3HRZA 5JTWA 4G8GD 4H0IA 3CDCA 2X40A 4JFED 3UJJL 1FNHA 4LKXA 5IBUG 2F9BT 3IFOA 4WWKD 2QV2A 1PG7H 5BVJB 5D5ME 5FKAB 3Q6FB 2WP3T 3IDXL 3LRSB 2DM7A 4JKPL 1T1WA 4LLMB 4LQFL 4CU7A 3QUYA 1M7IA 4TQEH 2G2RA 2P7TA 1DQTA 1MELA 4D2NA 5H35A 1AO7E 5T3ZE 3SGKA 3WJLC 2R9HC 3QFDB 1FNFA 2NY5C 5KVEL 3SGJA 3O4LA 3DO7B 1FZKA 2R4SL 5F7WC 2NY4D 5LCVL 3QHFL 5D8JH 2AV7B 5DI8A 5EBWA 2VDQH 1CF8H 4CJ0A 1HHGA 4P5TC 2IH1B 2VSCA 4X6DF 4U7KA 2BSTB 4J8RA 4GMSH 4RGMC 4LRIC 1YC8A 2NTFB 3V5DA 3VMOA 2Q8BL 1KTKE 4MXVE 4HUVA 2YD9A 1A6ZB 4Z7WF 5I66B 1DL7H 3L95A 3GSVA 3VG0H 4LCWA 3JWDL 2D7OA 1IGJA 1KUMA 3QQ4B 3D0LB 1P6FA 5ILTL 5HYJE 5HI4C 1EGJH 5JPMB 1XEDA 1GL4B 1NCCH 5BV7L 1ORQB 4TSAL 1MCOH 2YMXL 3BXNA 1AFVH 4Q2ZB 3VJ6A 5D1ZA 3MJ8B 2XYCA 4BM7A 2XFXB 4O2CB 3C5ZB 5J6GA 2CD0A 1PD6A 1KN4H 3TA3C 2UV3A 1KB5B 3QDHA 4TRPL 4CVXB 4Q9RL 1QSEE 5F1NA 1SM3H 1U8QB 4HUNB 4P9HL 2I9LA 2FYYB 3MNVA 3DMMB 2NCMA 4F37F 4Y4KD 4N5UA 3D2UD 2H9GA 2A74A 1I3GL 5E6IA 1UM6H 5FO7B 4CMHB 4OZFA 1UA6L 3EYQC 3TN0D 5I0DA 5MHSE 4WTXA 1EEZB 4AQOA 4I9WD 4I48B 4FP8H 1CBVH 5L8KB 2DBLH 2AJZA 3EJYD 3VXRA 3OPZH 2RR3A 4PJXE 1I8KB 5MEND 5CBEA 1N3NA 3O11A 4HHAA 5FYLH 1A3LL 3B9KC 4BKLA 2ADGA 4HWNA 3SDXF 4LAQH 4J3TA 4Z7NF 1TFHA 3WE6A 3KPLB 2WQRA 2DS4A 1KXTB 2VLRD 4HD9A 4HIXL 2DLGA 4RFEA 4G3YH 1CL7H 4K7FB 5SWSE 1I9JL 1OP3H 3U7AA 1T1ZA 1JF5A 1Q9LA 4IRJB 4TSBH 1HHKB 3GI8H 5B8CA 1OTUD 5JW5B 5J8OA 2E7LC 4P23C 4FQQA 1N6VA 5HY9B 1GZQA 3FONA 1P7QD 1UZ6F 4O4YH 4OD1L 3GMLB 3K74B 4A2MA 4R4NC 1JWUB 2J7LA 5D7IB 4KK9D 2X42A 3MROB 5GSVA 2XTJE 2FZ3A 4HIIB 1VKXA 2DTMH 3H7BB 2VH5L 4BYHA 1PGRB 5C0AB 2XPGB 5D5MA 2PUQT 2NLJA 2BMKB 4NBZB 2C3HA 2NW2B 1HKLL 1MCWW 3QDMA 5JW4Q 4UQ3B 2WANA 1LE9A 3WLWD 2OR9H 5ITBL 3NIDE 5DD3H 1DQQB 2FEEL 3B3IA 2PR4L 4JO1L 5HHOE 3VGAB 4HS8H 1NJ9B 3Q5OA 4PJCA 4QHUB 3BH8B 3OKNA 3BX7C 4LHUG 5DMIL 4HUXA 1KG0A 1FBIH 5B8CC 4Y8AA 4HUWB 2W60B 4CW1B 1VDGA 3MLSL 5KVDH 4QXGH 3V4VL 3KPOA 2F5BH 4PY7A 3CK0L 2J4WH 3QXAB 2WV3A 1QPXA 2X4UB 1N8ZB 5DTFB 2BCKA 1KEGH 4HUMB 3MO1B 1GIGL 5DYOB 4P4RA 3MZTA 3O4LB 4XH2B 4HMCA 4Z7UB 1IAMA 3TYFB 4XCNA 1X3DA 3MA7B 1SVZA 5JO5B 5CEXA 1KENL 2GSGA 3MNVB 4KTEL 3TF7C 5J6HB 4CJ1A 4UB0H 4QWWC 2Q86A 4HF5H 4ZUTA 2YN3A 4YHOL 3UC0H 3TPKA 1MRCH 1XGTB 4XBGA 1EHNA 1VGEL 4I2XB 5HHOD 1NAMB 5DHVB 5ACZA 2NPLX 3KYKL 1WTLA 3DUHA 3MJ8A 4R2GC 2YC1A 3L5XH 2QR0A 3CH1A 3HKFA 4HLJA 1MJJB 2D0HA 2KQMA 4HGWB 4L29A 3G6JF 3X14A 2X4QB 4WEBH 3WLWC 1A4KB 4XNZC 5E5UB 4POUB 2P48B 3MOAH 1NBQA 3FFCD 5GSRB 3U83A 1NKOA 4XMLL 1S9XA 4UT6L 3H3PL 5C08A 3H3BC 1XF4B 3X11B 5FYLD 5JW4M 5IVZB 2Y23A 8FABA 2W92A 4FZEL 2UUDH 3V6FB 4YJZL 4NHUA 4D3CL 2AJVL 1A9BA 3SDXB 4PP1D 3GRWL 5JPNB 1RAMA 4DN4H 4AT6A 4RGOH 4OIBA 1YQVH 2Z8RA 1T7ZA 5D7JB 5GS2D 3JV4B 3MLRH 3BPOB 1H3GA 3RKDD 4LCIL 1CVRA 3BEVB 5F7NC 1V7ML 1OSZA 4N0YH 1G1YA 1NMCB 2HH0H 4IRJC 1GCFA 3HC0A 3HUJB 1JMZA 2UZYB 4TPRH 2YD8A 4PTTB 2X2YA 4IRZH 4NQDA 2BZDA 4XP5H 3BE1L 4BK4A 2QLVB 1T7YA 2CUIA 4RGOL 3FQUB 4WO4C 3UPCA 2YPLE 2J8OA 1XH3A 1NBYB 1NCUA 3QZWG 5D7SL 1CGYA 3KPQA 4GUPB 1GPOL 4DKFL 4GKNA 1I3RA 3QB7C 5DJ8B 3GIVB 3ZL4L 5DD0H 1R3IH 2GJ6D 2P45B 1HE7A 3C8KA 5HVHB 1NAMA 5DHVA 4QHNB 1ND0B 5F9DC 4APQD 2GYSA 2IFFH 1UC6A 1I1AC 2X1QA 1JPST 2XTJC 1KEML 2IANB 4MAYA 3EGSA 5F1IB 1AGEA 4HS6A 4X6CB 4TNWK 1B6DA 2R1XB 3FB7A 2WBJB 4LHUB 3MGOB 1A6UL 1C16B 1D5BA 1QFWI 2VMFA 1JFQH 4NKIL 3VXOA 2HG5A 3PUCA 5IVOA 2B39A 1ZGLA 3RJDA 4EUPG 2XWBA 3FTGB 2GW5A 3SDDB 4YFLF 2R0ZH 5SWSA 5DJCA 2OP4H 3HHRB 3VXOB 4HIEA 1MRCL 4LARH 1U8PB 4ZNCD 1IM9D 1BVZA 4RNRB 1UKTA 2JB6A 5TH2B 1BM3H 3MV9E 3C6LC 4K07A 1INEL 3Q3GA 2X89D 4F2MA 2CK0L 4C83A 1FN4A 1F8TH 4JDVA 3NCCB 4QRSA 1QFWH 5IB2A 4O5LH 2P4AB 4FQJL 4NRYA 5C0FB 2V5TA 3VXPB 2FEDD 3IRPX 1MJ7H 3T0AA 1X5YA 1HI6B 1N0XH 3P11L 2F5BL 4NO5B 5EZJB 3P77B 4D8PB 1BOGA 4OI7A 3QG7L 1MFCL 1N26A 1NAKH 4C83B 1FG2A 1ZA6B 3CFKB 2EDKA 2HT4D 4ZUWB 4XPGL 3VWKB 1CLYH 3TVMD 1PYWB 5E08L 3MRKA 5C09B 1CI5A 4GRWE 1MCEA 1QR4A 4JN1L 3MJ9L 4N68A 3PWVB 1K8IB 5C0DB 1WBXA 5FYKE 3ARQA 5EOTA 5FOBA 1UCTA 4NHCH 1T1ZB 4AZ8A 3MRJA 1QSED 2NY3D 2IANA 4MAYB 1AD0A 3RIFK 1H3XA 2Q7YB 1L4IA 3TO4A 2VH5H 2HMIC 4M6NL 1RUPL 5IVXB 1C16A 4M6OL 5JIHA 4C4KT 4GMTL 3ARGD 4QNPE 4HCRL 4JPIA 1OM3H 4YUEH 4BKLB 3MOQA 1CIDA 3QIWD 4NBYB 2V17H 2XWJB 5IB4A 1KNOA 1ZE3C 1ZHBB 2BVYA 3OAZK 1C5DA 2V2XA 3IS1X 5KSAD 5AYQA 3UX9B 2DQCL 2ZSWA 1KCSH 4G8EB 1P7KB 2QQKH 3LQAC 3QZWB 1I9JH 4JB9H 1A7RL 2A74B 4GRMB 4N90E 1A7OL 2DQDL 5EBMB 1CT8B 4YHMH 3D18B 3F5WA 3QHZL 2J8UF 4HWZA 5DJCB 1FORH 4CL7A 3GGWB 2FECI 2PW2B 3MRCB 1ES0B 2H26A 4EIGB 2D9QB 4O2CA 5FYLL 2W9DH 1UXWA 4Z7OE 3W39A 1A9BB 1KPRA 2QQKL 1QLEL 1W0WA 1J0JA 4ENEC 3IU4L 4X4YB 4XCNB 3ZYZA 5LBSH 2Z92A 2GTWB 4UI2A 3T4YB 3QBTB 1UM6L 4R97B 3ARYA 4JFDB 3B6SA 4MSWB 2V17L 3MO1A 5GJSL 1T0PB 2R4RH 2VWEC 4RDQG 3VFNA 4WFGE 2YK1H 4HCRH 4Q9RH 4NNPH 3B2VL 1MAMH 1RZ8B 1SQ2N 5E2TL 2HT3D 3WFCH 1CK0L 1KCLA 2Q7NA 2AEQH 2ZJSH 3RDTD 1YPZF 1RK0B 5LG1A 1MWAB 4U1SA 3QEQE 4QHUA 5DDHA 5ADPH 3RL2B 4W6WB 1MJUL 5T3ZH 4L3EB 4FFVD 4NN7B 5HYJD 1P1ZB 2P44B 1BVLB 5IQ9A 3S37L 1ZLUK 4GXVH 2VISB 4JFXB 1J11A 2ICWJ 4HLZH 4HKBA 4PREA 3FHQA 2GAZB 5EUKB 4S0SD 3B9KD 4OFIA 3U0PA 3ZE0F 1U93B 1QZ1A 4HPYL 5H35B 3SEPA 4HWEL 3KJ4C 4XP9H 1FP5A 2GQHA 5CZVH 2AERT 3DV4B 3K3QA 4NFBA 5IW1B 4OSUL 1MCWM 3JTSB 3V8OA 2XZAL 3OB8A 4XPGH 1BBDL 1WV7T 3AY4C 1BX2B 1FDLH 1FZMA 4XNQA 1BZ9B 4GAYB 1RIVL 5ANMA 4OCLC 3V6OE 2I9TB 1JYNA 3BRGC 2VR5A 3ARDC 1JNJA 3CDGB 1HSAB 3LH2H 1A0QL 3LKRB 2PO6C 4NBXB 1JI1A 1WIOA 2R4SH 3HI6H 4O5LL 2CKBL 4PLKD 2AV1A 4B7IA 1CTOA 2F8XC 3CFCH 4LFHD 3D0VA 1QVOB 2DLHA 3W5NA 4Z7OF 3WV0A 4TQEL 1MNUL 3JV5A 5EDXA 1G6VK 2A6DA 1FO0A 3ZSSA 4XPTH 3ULVH 3SDCC 2PYFB 3O9WD 1FFQA 4OFYD 5DT1H 4EZMA 1ZHNB 5BOZG 3CFEB 2OL3L 1NEZG 2OR7A 2RJMA 1D6VH 4PJBB 4D94A 1FNSH 1Q0YL 4Q9QH 2ADGB 3D2UB 5EO0A 1U3HB 1U8OB 3PDOB 1PQZB 1N6UA 2O61B 4O58L 2ZCKH 5CGYD 3RVTD 5D5MB 3RDTA 2Q86B 3P4NA 3A0OA 1PZUB 2X09A 2LABA 3DETC 4XVSL 3S4SA 5IFHL 1FZJB 2PTTB 3UPRB 1L7IL 2IFFL 3EDFA 4DKAA 3QEQB 2XQBH 1KIRA 4PJIF 3EYOB 1EXUA 3TBSA 1S7VA 2V5YA 2DQIH 3ZKXC 1R3IL 4LLQA 2BVEA 3DLQR 1MH5B 4JAMA 3GMLA 4OBRA 1D3CA 2CGRL 1WBZB 1FZJA 4MZ2A 4LPVA 1T89C 2X1XR 3MRGB 5I30H 1GPOH 2AABL 4MNQD 3P9WB 5INCA 3E0GA 3RZCB 4QRQA 5DLML 4W6YB 1P84K 5ALBL 4DK6A 3STBA 1XCTA 2PYED 3QIWB 1HEZA 2NXZD 3DMMC 1UACH 1OGAE 5EB9A 3D3VB 2XKNA 2VAAA 3ZKMC 1UJTA 4OCYL 4X98B 5DUBA 4DQOL 3BP5A 5T5NG 4NQEE 2VKXA 4LP5A 1D5MA 1L7TH 5BZDA 3K4ZA 1BQLH 1UZ8B 2P5ED 3EYVB 4G6FB 2JCCB 4X4ME 5TDPB 1MFDL 4MVBD 1FYHB 4JKKA 5H37G 4JQIL 3F7VB 1HHIB 3HAEA 4WWKC 2RQ8A 5I8CA 1T1XA 1EMTH 4Y19B 4LCYB 3K1DA 3P30L 1QYGH 2WBKA 1N4XH 5C71A 2NYYC 4V1DE 3K8LA 4U0RC 5JXAL 5F1NB 5CD5C 5ALCL 4XCYA 5L0QB 2YZ8A 1NC2B 1CFSA 5J1TC 2ICEA 2HTKD 5GRUH 2VWEE 5DJ2B 1IARB 5HYQA 1OSZB 3GMNB 4HIHA 3MOAL 5DQDH 4N1CA 1LNUA 1LK2B 4F8TA 3N1PC 1WWWX 3A6OA 5CJQL 4H26B 5J1SC 5EZOH 3GJFA 3FZUD 4WEBL 4U1IB 2IEPA 2EYSB 1BWWA 1JPFB 3BZ4A 4I4WB 3P0VH 4A2LA 5F9WB 1K6QL 5I15L 1UB6B 3B43A 1MRDH 4YEEA 5ESQA 3U9UB 2UWEA 2HJFA 3QXTA 3NMEA 4L3EA 3ARGB 2PYEE 3CJJA 3TJHD 1OCWH 1JUFA 2CQVA 3BD5A 4OQ1A 4FFVC 1RIHL 4C59B 1WZMA 4RGNE 5T5FH 2J6EL 1A6ZA 4S1DC 3CD4A 2D2OA 3MREB 4XC1H 5ESAB 3HA0A 4LDLB 4UB0L 5HI5D 1U58A 1DCLA 1MREH 1QFWM 2ADJA 1KFAH 2EDYA 3AC0A 5E99H 5CLTA 5K93A 2MOVA 3RI5K 1WFUA 1JZ6A 1MIML 4UIMB 4ZFOA 1PKOA 4OZGB 1GVIA 4O51A 1CE6B 5IB1B 2R9HD 4XNMA 1MCNA 3V4VH 3VWJB 2AK4A 2IG2L 1TNNA 2B4CL 4Y88A 4H20L 3ZO0A 2DQUH 1XGUA 3LQMA 1I1FB 3GHEH 3SJVA 4K7PH 1G7HA 2VXUH 2YD2A 3G6AB 4WW2F 1CFTB 4PRBA 2ED9A 2XRAL 4G7YH 5E2UL 3TVMB 4HS8L 4YHZL 5A2JH 3QPQD 2FB4H 5JPMA 4ZS6D 4UINH 2HLFC 4LLVA 4WUKL 5HVGB 3KXFB 5GZOC 1DUZA 4MJ5A 3HR5A 1OHQA 3UTTE 3DUUB 3C8HA 4HIJA 3ZHKA 1LEKA 3MLVH 2DL9A 4NN6B 3HLAA 1NMBH 2F15A 4L8SA 5DVNA 5T3XD 5I75C 1WT5A 3GMOA 3DBXA 1CDHA 2FB4L 2E7HA 4PYHA 1CIUA 1J86A 2XRAH 1IC1A 4GRLB 3VXQB 4JM2D 2WSKA 3V6ZA 1OGAA 1G9MH 1IFHH 1C5CL 3TT3H 1XGRA 3I3EA 5F71A 4JY5H 4NC2B 5CFHA 4G8IB 1IQDB 4ODUA 5KN5A 1TTFA 1E6OH 5C7XL 5INCB 1CL7L 4GAFB 4GSDH 5C0AE 3TZVA 4HQQH 5I1JH 2P49B 3IDGA 5GGVY 1SJHA 1J0HA 1WWAX 2DKMA 3O8XD 4B53A 4HGKC 1OAKH 5EBLA 1EXUB 2CDEA 4P5MA 3T3PE 1R5WB 4U31A 3TNMB 1XF3A 4ZAKC 1BIHA 3MLTB 4XC1L 3KPRD 4K9EC 3MOBL 3A6BH 3TNNB 3SGDI 1H3PL 1QSFD 4OZHA 5FO8B 1MCSA 2FCBA 3MUJA 1AKJA 2HJKA 3PWPE 5HJ3A 4FQQB 1VADA 2GHWB 3VCLB 5C0GB 4JO4L 2DBLL 1MCDA 4E42A 2ZOKB 4YIQB 4IRJA 1UA6H 2DI7A 4BSVB 2XNAA 1KCVH 3CPLB 3WFBL 1K6QH 3FT2A 4XHJC 3K7UA 4YWGH 3VGAC 4FZ8H 1FL6B 3ARDB 3DI3B 5C08D 2DM3A 3B5HA 4NSKB 3C5ZC 1WZ1H 3DRQB 5TDOB 3U1SH 1RMFH 3LS5H 5DZLA 2MKWA 3NN8B 4K8RC 3QCUL 4PGCB 3FKUS 3IGAA 1NMAH 3RUGE 5ALCH 5GS1B 3V4UH 2J8UB 5BV7H 5L6YL 3F6IA 1NQBA 3IRZA 3RWIB 2HWZL 2IPUG 4C56A 2IAMD 3VG0L 1EH9A 4I0PA 5DJXB 3G6DH 5HI3C 5BO1H 4DVBA 1BQLL 2A83A 4GG8A 4PG2C 4XVJL 4NO0B 2MKLC 2DWEA 3FFCB 4U6YB 1PSKH 1CDIA 4WFFD 4UQ2B 3AREB 5IJVA 5IV2B 1HH9B 3WUWA 1NFDB 4L8SB 4ONHB 1A1OB 4LU5H 1TQBC 2VIRB 5GRVK 5HDBF 1BEYH 5TE4L 4GQ9L 2DQEL 3WBDA 3D39A 2P8MB 4LVNB 4L4JA 4BSWA 3GIVA 1I8MA 5HPOA 1QSEA 5JW4N 4F3FA 3QDJE 2WP3O 4RAVB 1JIBA 1I1AA 4IS6B 4U2YA 3FQUA 5J1AA 1OW0A 1PG7L 2UWEE 3PWJB 1SY6A 2YHGA 3SDXE 5I6XC 4BA8A 1TTUA 2Q76A 1CFTA 4PRBB 3UJJH 3VMNA 4XVSH 4P57B 4PJXA 5E03A 3IF1B 5DR5L 1RV6X 2VXVL 3VFRA 4OZFH 5I2IA 3V2AR 2QHRL 3H3KA 1YQ2A 4MA3A 5AD0B 4QXWA 3LSOA 3MRHB 4FA8A 1LEGB 3MBEC 3HUJF 2HKFL 4HS6B 1Q0YH 1C5BH 5DRXB 3I9GL 2E6PA 2IPKB 4MQ7A 3OXSB 4XVUC 5B4MD 3P4OB 1ZGLM 2P8PB 4UBDC 3G5YB 4CVWA 2BSRA 4P2OB 1Q9WA 4IRSB 4PJ8C 4PJAA 1M71B 5IESL 3PHQA 1CLOL 1S9XB 2H8PB 1CT8A 2A1WH 2IH3A 1LEKB 4I5BB 3MC0A 3CFCL 1J87A 4F33B 5IKCA 3GMMB 2HLFD 3QEGH 1A0QH 1VESA 4U0QB 2ZWLT 3C09C 3WXVL 3SN6N 5D1QD 2EE2A 2B1HH 2C5DC 2V5MA 4L4VD 1VFBA 4P4KD 5LGHH 3OB0H 2XZAH 4DUXA 4KI1A 2FX9L 2EKSA 4LFHG 2VNCA 5DZNA 4QOKD 4OSUH 4ELMA 1B90A 4LLWB 5BRZD 3SE8L 2OM5A 3IJYA 3CNKA 3M45A 3QA3A 1KJVB 4XPAH 3TBYB 3VI3F 4NWUH 4HPYH 4LSRL 1LNUB 2VZ1A 2ITDB 2NX5A 2ESVE 4OFVA 3TN0A 2MPAH 3T2PA 2OCFD 2G75B 5T3ZL 3WFEL 1CICB 1G7PB 3IFLH 2FRGP 1DLHB 4EI6A 1YEEH 2VL5A 1MF2H 2EO9A 1EX0A 4PJIB 3MBEB 4DEPB 1QLFA 1BFVH 3Q5TA 4U1NB 4ZAKB 3ULVF 4NQCB 5I1GL 4O00A 1CK0H 4F7CA 1TVBA 4PRHE 1TJIL 1PZ5B 2G5BB 3CIQA 3RBGA 4ZDHA 2A0LD 4LSSL 1YN6A 4Y7MA 3P2TA 3BP6A 3F62A 3UTSE 5FUOL 2MQ3A 4PJHA 3QO1A 4Y5YA 4D8PA 2ZCHL 2BY1A 1Q72L 4H25A 3BISA 5E94A 2EH7H 1K2DB 1FL6A 1FO0L 2CPCA 2NQCA 4NC1E 4JPKL 5KVFH 4S0TD 2DDQH 1EIBA 5DO2D 5FYJU 2WLYA 1QLEH 1HKFA 4HXAH 2EC9T 2KZ1B 2J8HA 2C1PB 2EXYC 1JK8A 2W9DL 3LOWA 4LVNC 7FABH 4LSVL 5ABDE 4MMXC 4LCUB 1TZGL 5F7EH 4Z7QE 3MLWH 4FG6C 3O6LL 1K3ZA 3KPPB 4NN5C 4OCXH 4WWID 4JQVC 5E4EC 1AD9A 4J23A 3S3PA 2HA1A 1U8PA 5GGVH 4YHML 5TJWK 2BVQB 2H41A 1WWBX 5ICZA 3MROA 4WHYG 4NO2A 5JOFA 4X6DB 4MNQA 4PLOB 4G42B 5T1LA 3TIDA 3VG9C 3OQ3B 2H1PH 5F8QC 2X4NB 5IROC 1QSFB 4PG2A 2PO6A 4PJCB 4Y16D 2QQNH 4WU5A 1H3WM 2OLDA 3V5KA 4K3EL 3I6KB 5EG6C 2D4DA 1LO0H 1T5XB 3O11B 1RUPH 4FQIL 4JRXD 4OZGF 1QFHA 5D7JC 4F57L 4H5SA 5IFAL 1LDSA 4H1LA 4MJ6B 1BQSA 3AVEA 1ACYH 3GSXB 1EEZA 2R2BA 5FA3A 4X80L 4PJDB 3BRFA 2EE3A 3CVIH 4GS7C 4OLZH 4LLUB 1JGDA 3MV9A 5SWZD 4JQVA 3T3PF 3VXRB 3OAYK 3RL1B 5DS8A 5B39A 1FZOB 43CAB 3TO2B 5JLZA 3OXRB 3RKPA 2XICA 2R15A 5I16B 3MRRA 4NZUL 5CIPH 5IG7A 4MQXC 4L5FH 5DEGB 3F12A 5E8EA 3S8WA 3OZ9H 5ENWA 2JIXA 2BRRL 3QH3B 3BIAX 4TN9A 1ZV5A 1A7BA 1G7HB 3G6AA 4U1MB 1S9VB 5BW7C 4MCZA 1YECH 1MJ7L 1AE6L 4AEIL 2J6EA 3VE0A 4C56D 1F8TL 2KUTA 5T3XE 4FQLL 4L9LC 2CK0H 1X9QA 3CFEA 2ESVA 4GXUN 4NUJB 1ZAGA 3L5WA 2GUOB 2ORBL 3MODH 2QKIA 5D6DC 3VDCA 4MA1B 1DN0B 5J89A 4LARL 5DMYA 3BDYH 3NFPB 4Z7WE 2OP4L 1JNHA 5DFVC 3HC4L 2AV7A 4ZQKA 5BS0D 3INUH 1A4JB 1UADC 2A73A 4EI6B 4ODHL 1ZMYA 2W1NA 2GUOA 2X7LB 1JTOA 4DKDC 3RWJB 3T8XA 2FHBA 3N9GH 4WI9A 3WIHA 5K9QI 3Q6GH 1KB5L 1YY9C 5J13C 1NGYB 2E7BA 1KB5H 5C0EB 1PKQB 5HHQA 5I8OH 4NKIH 4X9FA 1T7WA 2L4OA 1P4BH 3T4YA 3P73B 2ZCLH 4CVZB 4WRLA 4NRXA 3FB6B 3HC4H 3QI9C 2OTWA 3M1BB 4PJXB 2Y6SD 3LIZL 5GRXG 5FOJA 2IBZX 5JW3H 1G7IA 3BDYL 4AH2B 1EV2E 5L2JA 1FFRA 3OKOB 1SEBB 5AWNH 1CFVH 3RA7L 2F54E 2KQNA 2VLKB 3TN0C 1JYWA 5DJ2A 3SE9L 5JHDD 5EC2B 3O6FB 4YBLC 2OJEA 5ERWB 3WHE0 4FQLH 1QSEB 2IBBA 4K7PX 1UG9A 5D7SH 5MENA 1MCJA 4M00A 1S3KH 4WNQB 2NTFA 3LDBB 3OMZA 3KPOB 4FXLA 1KJ3L 3EO1B 1JGEB 2F74A 3EO9H 2C4XA 2A73B 4UIKL 4GW1B 1QRKA 1ZK9A 2JE8A 4PJAB 2HH0L 4H1LB 4N0YL 1T5WB 4PGDA 4LQ1A 1UZ8A 4PV8A 4DZ8A 5MEPA 4OIIL 3TFKC 2H2PD 5BRZE 3KPMB 3OKLB 5BCAA 4X9GA 3EJJX 2AJVH 2AQ3A 4JRYA 4KDTA 2R69L 5EFIB 3TBVB 2VXSL 4HKJB 4AENA 4TVPD 5D1ZD 3ALPA 3PWVA 1Z9SA 3TIDB 4O9HH 3LRSA 3PP3H 3NTCL 3RGVB 1FLTX 4JAMB 3I2CH 1U91A 5EU5B 1I9EA 1UFUA 3SE3C 4APQB 5I1LA 5EU6A 3F5WB 4P2RB 1H8SA 1ZLUH 1QUNA 4KK5C 1QD0A 3G5VB 3CFKA 2GJ6B 4RQQA 1U3JA 5GGRB 5DJ6A 1BD2A 3PGCA 3MCKA 2PYEB 1YEKL 2WINB 3MRKB 4Z7VB 3W9EA 4URTB 1OTSD 2EH8H 3S88L 5JLZB 2P8MA 2EDFA 4HV8B 5DA4A 3KJ4B 3TC9A 4D0BB 4D9RD 1OQXA 1I1CA 3NPZB 4NJ9H 4JFEE 1YN7B 3PWPD 1P9MC 3KYKH 4UU9B 1VADB 4TOYL 4R7NB 1NBVL 3C6SA 3GSUB 5GS0L 3RPIA 2BVOA 4Z8FL 3BKML 2Z8VC 4M1DL 4AYFA 2I07A 2VYRE 2LAGB 7CGTA 1S8DA 4GBXC 4KTEH 2GK2A 1UWGH 4F9PA 1JPSL 5AYUL 1NC2D 7FABL 5E5RB 3LSOB 3RGVA 4L4TB 1DQLL 3ARPA 2E7LA 1KPVA 4MXQD 3VFRB 4NNYB 4QRRA 3ARTA 4Z6AT 4J6RL 5FCSH 1S9WA 3MLSH 1I7TB 1Q72H 1OARH 3T08A 2ZCHH 5I73C 1BP3B 1NCNA 5DUMH 3V95A 2FYYA 3FB8B 3U6RB 5HHVH 4KWUA 2EDHA 4QTHB 1KLUB 3BJLA 3GUTA 5C6PB 1WBYA 3QXDB 5F3HA 4MDJA 4NT6A 4CAGA 4JO1H 2PKDA 4RX4A 4X6CA 3UTZA 3JTSA 4M43H 4M1GL 3GB7A 5ITBH 1AR1C 2Z91B 1AGCB 3VFTB 1SBSL 1MF2L 2DICA 4A6YH 4V1DD 3OG4B 1A7NH 1PY9A 3RVWD 1S5HB 1RJLB 4MQTB 3CFIC 2CJUL 2IQAA 5MI0B 3EAKA 2N7BA 1FRGH 1QACA 2C1OA 5HTSA 3IAGC 2D0FA 1P5VA 5FO8A 1C1EL 5IGXH 3ZKND 4XMPL 4PS4L 3TJHC 1PX4A 3O2VL 5F3BB 3S3JA 3DRTA 1H5BA 2FIKB 4MZ3A 4HEME 1F3RB 5SV4A 3QT2A 4CDHA 5D6CB 1OAYH 2D4FA 5F70A 4WI2A 3THMH 3E3QE 3SKJH 2FEDC 1G6RH 4HKZA 5HD8C 3OGOE 1YPZA 2VRAA 3BQUA 1FG9C 4Y4FA 1KF9B 2CO7B 1WK0A 3KDMB 3QRFM 3DTXB 2YPVH 1V8HA 1M4KA 4KKAD 3BI9X 1XIWA 4QF1B 1DFBL 4Z7WA 3KLHD 2AXGB 4BFIA 2R1XA 3F65A 1HN1A 3O3BA 3H6JA 5EU6D 1NBZB 1JGLH 3E6HA 4S1RH 1FPTL 3GIZH 3BWUC 4LLWA 4J12A 2D9CA 1F11A 1OTUC 5C0IB 1C12B 5E4IA 3H9SD 4I0PC 4ETQB 4IIQB 1RFDL 2R23B 2X4QA 1WFTA 5T33H 5DD1H 1Y6KR 5KW9H 2R1WB 2X1OA 3I9GH 4WNQA 3BVNA 5IK3B 2JJTA 3WHXB 1I3GH 3FOLA 2WBWB 5FYJE 2CLVB 3HNSL 1C5DB 3MV8D 4PRPE 4WW1B 4P9HH 2GJ6A 4ODXA 5DR5H 4WY7H 4RCAA 2XA8H 2AAVA 3ARBB 1TCRB 1J7VR 3UXFA 3VFPB 4Y5XB 1QA9B 2Q6WB 3CVHL 3IJHB 5A1AA 1K4CB 5EU4A 2YR3A 4DVRL 1VCAA 2YMXH 1CL7I 1OW0C 1T04A 5FYLE 1N59A 2WMPA 1CGSL 1WITA 3GDBA 3DX9A 1S7QB 3MMEA 1T1XB 1HCVA 3K81A 4EUPB 1OAXL 4X0KA 1D6EB 1WEJL 2VXTH 4D0CA 2NY6C 4HKZB 2EC8A 2N4IA 3RWFB 3QNXA 2MFNA 1U36A 1CLZH 5K9JH 2VDNL 3W11C 4UOJA 2GSIB 2BVPA 1AJ7H 5B3NA 3PNWA 3RTQC 3LN9A 4L29B 4NN6C 5C0BD 5DHYB 5LCVH 2VXTL 3T77A 4GRWB 5E6YA 2X70A 1BWMA 5DK0A 4GG6F 1WIUA 2VDLL 1P5UA 2ED7A 3FO2B 4KKLD 3O9WA 3VDBA 3VFWB 1NFDA 4OLUH 3NIFF 3F6LA 2Z31D 2FJFB 5HJ3B 3L7EA 2IF7A 2CKNA 4RMVA 3D6GA 1YDPA 1T6WA 3LS4L 4PRAA 1XGYL 3MRRB 4MDIA 3FJTA 4X7TB 4OZGA 5T1KB 4XCCL 2P24A 1RJCA 3LDBC 1KV3A 4HFUH 5M95B 2OXHA 4NJAL 3I6LD 1F42A 1MHPL 5IUSA 1RUAH 2ADFH 3GMRB 1MJ8H 2AJ3A 2YN5A 4QCIA 3RWEB 5IMMB 1W0VB 1VPOL 1AIFB 5EFIA 3TBVA 1E6JL 15C8L 5E1HB 1W0YT 1F3JB 1H3PH 3MGOA 1PQZA 3A6CL 3A6BL 3JUYA 4PJ8A 5J3HC 4E5XA 3N1GC 5D71H 3KHQA 3Q1SH 1IC7L 2O26U 3LKSA 2VAAB 5E2VL 5IVXE 4GKSB 1FL3A 5HDBE 3RIAF 2PN5A 3RRQA 3PG2A 4HZLA 4IBLT 4NPYB 4PV9B 1NCDL 3T0EB 1KLGB 5GGSY 1BBJB 3UP1A 1EO7A 3GI9L 5C7XH 4M5ZL 4UTAL 2G9HB 3MNZB 1FFPB 5IHBA 5IM7A 2V5SA 3D1MC 1AC0A 4NM8L 5FB8B 3C5JB 4DW2H 1G6RL 5T1KA 4XGZA 1G9ML 1IFHL 1HINH 1HXYA 5F1OB 1A3RH 1BZ7A 1QFPA 4BZ2L 2YD3A 4XNZB 1CFSB 4MA1C 4R0LC 1XF3B 1G7LA 2L7JA 5JORA 1RUMH 1EHAA 5DFWH 4UNVA 1FGNL 3D39E 3DV4A 3CZJA 1QBML 5GQBA 1A6AA 1CFNB 2BX5A 4N0UE 1EZVY 1I3UA 5JXEA 4M62H 1A7PL 4NCDA 1U3ZA