3AAZA

Crystal structure of the humanized recombinant fab fragment of a murine; antibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
228
structure length
228
Chain Sequence
QVTLKESGPTLVKPTQTLTLTCTFSGFSLRTSRVGVSWIRQPPGKALEWLAHIYWDDDKRYNPSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARRGFYGRKYEVNHFDYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Humanized recombinant Fab fragment of a murine; antibody
publication title Germline humanization of a murine Abeta antibody and crystal structure of the humanized recombinant Fab fragment.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 228
sequence length 228
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3aazA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3aazA01
3O9WD 2PR4H 3J7HA 3LIZH 3DTXB 4H25B 3I9GL 5GSVA 5DJZA 1NBZA 1IM9D 2XQBL 1B0RA 1HCFX 3WFDL 1YY8B 3ZSSA 1IEAA 4X5WB 1ZSDB 4DN3H 2ZSWA 3PG2A 3WFEL 2Y9RT 5FA4B 2HN7A 4JDZA 2VDKL 1J7VR 3CXDL 3JWDL 1KIUA 1BQLL 1S7XA 5E1AA 1G84A 3FRPA 1LO3L 1S7VA 3DBXA 1F3JA 2DM4A 1TQBB 2V2TA 4DVRL 4CVUA 4Q2ZA 1N2RA 1MVUA 1KTLB 4OF0A 5DD3L 5F6IC 3VFSA 4L8BB 1AP2A 4CVWA 4U1LB 3FB6A 5KSVA 1D7FA 4MXWL 1M7IB 1T66D 3ZKND 5I2IA 1GPOH 2FR4B 3EJYD 3SE8H 4F37K 2IAMD 3DUSB 2UWEE 5B38B 2R1XB 5C6PB 5ESQB 1HEZA 4YBLB 1L7IL 1CXEA 1DQML 1TXKA 4R3SA 3ARGA 5KSAB 5C2UB 5JMOC 5LGJB 4YHYC 4OF7A 3P9LB 3O41A 5D7JB 4OLEA 5BJTB 4U1HB 4PJXE 2VL4A 3SKMB 3QZWG 3BT2L 4Y5YB 1MAKA 3M1BA 4JRXB 4NSKB 1QBBA 4K3JH 2EZ0D 2HMID 3MLXL 1MCWM 2QV2A 5ALBH 3SGEI 4FQQA 2VKWA 1BFOB 5D1ZA 3VH8B 1AE6L 5SV3A 4WWID 5D2LF 2H3NB 1PX3A 1CD1A 3LKNB 3GMRB 4JFZL 4NDMA 2ADFH 1R3JA 3IFNL 1QFUL 1CK0H 2EC8A 2AEPL 4Z7WE 3S96B 4ELMF 3ZE2E 1FZKB 5BVJB 1VFAB 1YNLL 1LO2L 1LO4H 2H32B 1OCWH 4TSAH 8FABB 1YNKH 2VUOA 1CU4L 4PRIE 1G7QA 1SEQH 3TIEB 2HJKB 4OI7A 1AFVL 4PV8A 4RMSA 4DGVH 3TCLA 4JQIL 1H0DB 1T0NB 4LSVL 4F7PA 5I1LA 2NY3C 4MLSA 3EGSB 3FOMA 1PY4A 2IC2A 3WNPA 3CPLB 3RVWC 4WFEE 2VJXA 4JVPA 2HFFA 5I73C 2MQCA 1FNFA 4JHWL 4MJIE 5E6IA 5J6HB 2GTZA 3NA9H 1CFSB 4OBRA 4L3ED 1I3RA 3BKYL 5HHMB 2ESVD 1TQCB 3RWJB 2PYEA 5HHQB 2HTLD 1NL0L 4WNQB 1WICA 3BPLC 5E2WL 3BP7A 1F4AA 5FYKE 5T3XH 1FVEA 3U9UB 3D0LA 4JO4H 2CLZB 4HUXB 4J3WA 5C2BL 3UC0L 1QRNB 4QXWA 4UAOC 5IBLD 4F37F 5IG7A 3MNWB 2J2ZA 2RAMA 2X89A 4HWNA 1IAKA 4LMQE 3QUZA 4POZC 4XNXH 2XZCH 2JCCE 4MQTB 4JFEA 1NFIA 5E2JA 1FSKC 4ODWB 4HV8B 3OAUL 3VI4E 3QH3A 1N5AA 4ZXBC 2XACC 1GC1C 5C09B 5ITFA 1LMKA 3LKPB 2ITCA 2HKHH 2N1KA 3PGFH 1QFPA 5KJRL 1GOHA 3T1WA 1QVOA 4FQCH 3X11B 2V5YA 2XXCB 5I18L 1T7YA 5ANMB 3RGHA 5I1GH 4TSCL 1MVFA 5F1NA 3LRGA 4CJ1A 4JPIA 5C08A 1Z9OA 2G60H 5E2UL 1D5BB 2YA1A 2B1HL 4XNQA 1W2KT 3MROA 2R39A 1MJJB 2AQ1A 5F93C 3PJSA 2O26U 1RVFH 4MA3B 5HI5C 3QDJE 6FABL 1I9IL 1DLFL 4JKMA 4PUBH 3I85A 3DX9B 3C6LB 4ODTH 5DVKA 4AG4L 5IV2A 5E2VL 3OX8B 3CC5B 3QIWB 2MSPA 3NPSC 2FLBT 5KVFH 3WIIH 3T2OA 1CYGA 2HFGL 3QQNA 4LSPL 5EU4A 3REWB 1CFTB 1NGXB 2E27L 1R5WA 3ESUF 3NZ8A 1KN2L 5HDOA 3EYSH 1ZK9A 3EYUH 3OR6A 1MJ8H 4HXAL 4EDWH 3G6JA 4DKAA 4XP6L 1KPVB 3HI1B 1KT2A 3LDBB 3X3GL 5TE6H 3MJ8A 5IMLA 3GSVA 4QY8B 3VXMB 5HGHB 3BI9X 5J1TC 4MMZC 3RA7H 1WK0A 1XF5A 4MNHB 3QG7H 4YHKL 1W0WB 3MRPA 1GGCL 1ZS8A 2YZ1A 2V5SA 2DLFL 4JY6B 3K3QA 3ELAT 5DD1L 5F9JB 1BWWA 1CXHA 1S9WB 3MJ9H 2VXSH 2JJVA 5H35B 5DQJA 1A7NH 1QSFD 4GKSA 2DBJA 1WF5A 1I8LC 3OTTA 1ZTXH 1RUQH 5D6DA 3P11H 3U7YH 3RPIB 3UROR 3BWUC 4EXPX 2C9AA 1FFNB 1F97A 1X7QA 5DEFA 1X5GA 2WBJC 2NY5H 3K4DA 4YX2L 1MNUH 4Y19E 1IC5H 1NC2A 1MQKH 5HVWA 3WLWC 1QTYT 1A3RL 5JW5B 1F11B 1BIIB 1S78C 1NSNL 3QNYA 4QRTB 2NLJA 3IDYC 3FTGB 3S97C 3IFLH 3HLAB 3F12B 3IRZA 5EU6D 2OR9L 1ZEAH 3KJ4B 4UDUB 4CUCA 1A3LL 1JL8A 3TN0A 4EVNB 4XVTH 1YQ2A 2P45B 4XCFH 2E6PA 3QAZB 2NY1D 1LNUB 1P4LB 1UJ3A 4U3HA 2VN7A 3WEXA 4KK8C 1QBML 4AH2A 3OKLA 1GZPA 2C1OA 1ZT7B 4KJPD 1LD9B 1MIML 4FZEH 4PG9A 1DSFL 1AKJD 1X3DA 2Y07H 3HE6D 4MA8H 1AY1L 4U4BA 3C60A 4WENB 3VFMB 3NACH 2JB6B 5C07D 3BEVA 1CD8A 3TH3T 4UT9H 5GGTA 2ADGB 2LABA 3CMGA 1MCWW 1NMCB 4NQDB 4XMLL 1EV2E 4QO1A 1G6RL 1JHKL 2KL6A 4N0FA 1T20B 4L8SA 4LCCA 1P4IH 1IGTA 4QRUA 2GT9B 1Q94A 3BHBA 3U0PB 3GUTB 3A67L 1CE6A 1RZ7L 1OAUL 4H8WH 1MCJA 4G43B 1CICB 3EFDL 1KIPA 2OI9C 1U58B 1K6QH 2DKMA 3QI9A 1TJGL 3RPKA 5I71B 3WNNA 5I6XB 1F6AA 1OAQL 1JN6A 1MAMH 3D85B 4BSVA 4X7TA 4P57A 4APQA 5JXAH 1PQZB 2HFEB 2ZCKL 3P30H 3J8F7 2G2RA 1Q9LB 1GAFH 2NY2B 1OWRM 4K9EH 1ACYL 2G9HA 2ED7A 5GISH 1DR9A 2A73A 5HYSB 4GS7C 1FH5H 1F90L 1U42A 1DE4A 4M48L 1RQ5A 1S5HA 2VITB 4U1MA 1KCVH 2AJSL 2X9WA 3LEYH 4HHAB 2EDJA 2HVJB 4D0BA 4IRSD 3IGAB 2ZCHL 3UJJL 2PW1A 5D6DC 1UZ6F 4PRPD 4EIGB 4KUCD 2BSTB 4Y2DA 4NO2B 1DUZB 1DUYA 1L4IA 4JM2A 1KFAH 1L9NA 5CIPA 3T8XB 3EO9L 1U8HB 4R7NA 1T03H 2YK1H 4QF1A 3BZFA 4JREB 1BZ9B 2VLKA 3TJEH 3P77A 4KKCD 4OGAC 3OZ9H 1U8KB 3KS0J 3TN0C 4Y4FD 5FYKL 1KV3A 1OAKH 5IMMA 4XH2A 5C92A 1UJ3C 2YC1A 5DRZA 3WUWB 3B9KC 4G3YH 4NHUB 3FCTA 3HFML 1A3QA 2JJUA 3NZHH 2WLZA 3EZJB 4RQQA 2YXFA 1ZLSL 1HNGA 3QIUA 4KVCL 1ES0B 2ZG1A 2E7HA 4U1NA 3FN3A 4X9IA 3CX2A 3PGCB 3RTQA 4G9FE 4F2MA 5C0BB 2GSIA 4KK9D 5IHUL 5SWQA 2VZTA 1IGYA 3RL2A 5C0JB 4M7JL 1MFAL 1LDSA 1WFUA 4LIQE 1FNAA 2W9EL 32C2A 1RUMH 4EI6A 4KZDL 3GK8H 4FMKA 1N5YH 3RWCB 5JQ6L 4LCCC 4L8SC 2CXKA 2AXFB 2QSTA 4WFFE 2I9LB 4HC1H 1QFOA 3L3IB 4JFOA 4OZFB 1KG0A 2EDKA 3L7EB 1OTSC 4PS4L 3WIHA 1XGYL 5CZXC 3WL9A 4PGZA 2VABA 5INCB 3H9SB 1XF3B 4LLWB 3VDAA 2L4OA 3FT4B 5D70L 1T22B 5GS0C 3OR7B 1W72A 1D6EB 1JIBA 5C0RH 4UTAH 3VRIB 4ODVH 1EJ6A 2BY1A 3SDAA 2DLTA 1HHGA 5EFIB 4CN1A 4PB0H 4G5ZL 3GRWH 4BFIB 3QHFL 5DK0B 3QO1A 4OLXL 4YXKH 4K7FA 1MLBB 4F9PA 2AKRB 1RK0A 5BS0A 2XYCA 1A2YB 1V3JA 4Y2DC 4KY1L 3SKNB 2WUCH 5DD0H 3DYMA 1I3VA 1X5LA 4TUOA 5T3ZD 3SE9H 1IZKA 3HRPA 3AUVA 2E6QA 3LV3A 5L9DH 2LTQC 5AAMA 3KLHD 3MODH 1J0KA 3MMEB 2R0WL 1AHWB 3RKDC 4X6DA 1TPXB 4LKCB 5AD0A 5CS7A 4CVZB 1UWXK 1YQVH 2GSGB 1BVZA 5KSUB 1JBJA 5I1KL 3WXWH 4XAWH 3RI5K 3DO3A 4KMLB 3FQUB 3PHQB 4N0CC 4XXDA 5A3ID 3HAEH 3L5WB 4HPYL 2W07A 3G6JE 2F58L 2X44D 1CL7L 3QIUC 4HUNB 2E8YA 2BXYA 2VZ3A 3GJFK 1JGDA 1VGEL 2OL3A 1OSPH 2QQNL 5KSAD 5J6GB 5FECA 1I8KB 3E2HB 3DIFB 1Z9SA 5E4EB 5C9JB 3VGEA 1PEWA 5D7JD 4S1RH 1SVZA 4LSQH 4U1SB 3T4YA 3GM8A 2LU4A 5D1XB 4ZOBA 4JRXD 3FQXB 3VWJB 3DGGA 3MRHB 4U1JA 4KTDL 4HXBL 4RGMC 1FZOA 4XNZB 1JGEA 3WFZA 3C5JB 4NQCB 5I19L 3VA6A 5MENE 3UYRL 2E7LC 5IVOA 3BE1H 5DJ0B 4KROC 1BQHA 2ZJSL 5DJYB 1A6ZA 1AD0B 3V5DA 4HFUL 4QRSB 2AS5M 3RIFK 1LVEA 5H37H 1D5ZB 2A83A 4OKVB 3ME0A 1OGTB 2X5PA 2FEDC 5CMAB 3DV4B 4JKPH 1NCCH 3CLEL 4GRWF 3F6IA 4RMWA 3SDAC 4G6KL 2RFXB 1ERNA 4Y7MA 3WNMA 4ORGB 4BKLA 4BQBA 2ZUXA 4B50A 4I0PA 4F58L 4RFEA 2GFBA 4U7SA 4PRDB 4PJ7F 2EC9T 2VSCA 5ERWB 5MERB 1HNFA 1FL6A 3ZMRA 5LQBH 1EVUA 1JNJA 5EO1B 1AXSB 3TO4A 4EBQL 4MB3A 5LGHH 2DQHH 1G7JB 4C56A 4P48A 5I1JH 2B2XH 3P73A 3FB7A 2Q1EA 4Z7WB 3HE7B 2AI0H 4P2QB 5ACZA 5HHMD 3DETC 1IM3B 4CRPA 1NCWL 4NHCL 3O2DH 3MXVH 2QHRL 3IU4H 2Q8AH 4JZNB 1VENA 4AEEA 3RI5F 4HIXL 3O3BB 4FNLL 5D7IA 1P1ZB 4MAYB 4PD4J 4JN2A 1C8PA 1QRND 5F6HI 3IU3B 3HZVA 2UYLB 1N0LA 2BVOA 4MB5A 4LL9A 3L3HA 5D1QA 5ICYA 4MJIB 4PV9B 1YEKH 4TNWK 3QJFB 3QXAA 3MRCA 3IKKA 5E8NB 1YEJH 1KCRL 1E6JL 1GC1L 1A1MB 2HKFH 3JZ7A 4NC2B 5EOQH 1QA9A 4KPHH 43CAB 3NCJL 1ZGLM 3LKQB 1OTUD 3IETB 5LCVH 5C09D 3BW9A 3HI6H 1C08B 4LNRB 4ZUUA 1L7TL 4ONFH 3KPLB 5FGCB 1ZAGA 4R2GC 4BQ8A 3R06A 4PGCA 4LSSH 4O02L 5GSRB 2DWEA 2ZCLL 4YGVB 4HKXB 3MRGA 2JCCB 1C12B 3DX7A 3FO0L 1A6TA 3HZYB 4YFEA 5ID1A 5F89A 2HYMA 1UWEL 1LDPL 5C0AA 2AJ3A 1KYOK 4AEIH 3CCHA 3HC4L 3C6LD 2VLMD 3RIFF 2H26A 3STZA 4DGYH 3A6BH 5KG9B 4B7IA 4KGLA 4MA1C 3QIWD 1BD2B 4L3CB 4HWEL 3MYZA 2VQUA 3QBTB 4DKEL 4NJ9L 5TE4H 1WZLA 5L8KB 5DVNA 4PY8I 3K4ZA 4RAUB 4XMKL 1R5VB 1AIFB 5CD3A 1QBLH 5JR1L 1KLUA 4UQ2B 2JJTA 1CD9B 2XWBA 2BFVL 4PTUB 4I0PC 1JGUL 2P5WA 2W59A 1KXTB 2VLKE 4LIQL 1ND0A 5E99L 1HQ4A 4PJFA 3ZDYF 1NMBH 3SKOA 3NFSL 5GS3A 1DQLH 3TO4C 5HY9A 1LEGB 2Y6SC 3VXMD 4X6EA 3SGEH 2FYYA 1A1OA 4M5ZL 4P5TB 5GGQL 5DFVC 1Q9KB 1NBVH 5F9WB 1J0ZA 5E70A 2DJSA 2ZUUA 4ENED 3MUHL 2GJ6D 5IP4A 3B83A 2Q20A 3FMGL 2P7TA 1XGTA 4JZOA 2R69H 3H9ZA 4HBCH 4K71C 5D71H 2PO6A 2D03H 2UUDH 2YWZA 4ZNCD 1NANH 1U92A 4TPRH 1WGOA 5T1KA 1DN0B 3KPMB 1B4RA 3C8DA 4JO1H 3PWPE 2CIIB 1DBAL 1JFQH 4IIQA 3CDCA 3H0TB 5IVXA 4N0RA 5DR5L 4CDGC 2ATPA 2VXVL 3MREA 3T4AB 3MRMB 5T5NF 1IKFH 1KCSH 1ZLWH 3R0MA 2EIBA 3QNZA 4JFHE 4U6YA 1NDGB 3UTZB 2H2SD 5CZVL 3FO1A 4NNXA 5DJ6A 1BF8A 2HAZA 2UV3A 5ELIA 2VXUL 3QWQB 4E42B 4LVNC 4GRWB 4NZUL 4ZNEE 4HS8H 4LVHB 1GRWA 3ESVF 4XCEB 1E27B 5TF1H 5K9KA 3SCMB 1UXSB 4YHYB 3KJ6L 2E9JA 1S5IH 5FB8B 1KLGA 3OAZH 1OB1A 4PJ7B 4Y19B 4YDKH 3GDBA 1F2QA 1ZA6A 4LNVA 5FOBA 3MLTB 4U1IB 5CBEA 5I17A 5SX5K 2Z4QA 4QRPA 4V1DB 5EUOF 3P2TA 5IBUG 2NY0C 1DBJL 5IB2B 1T1XA 3TNMB 3GGWB 5JO5A 4FQHB 4LSUH 3QUMH 2FJGB 4JPVH 2O5XL 4PG2A 1FCGA 5EO0B 4NQDD 4NNYB 2Z8VC 3WFCH 4ODSH 3WN5A 3WLBB 5EDXA 2A77H 2CR3A 3VXNB 4XPGH 3RWEB 5I8EA 3NBNA 3GJFB 3PWUB 3BQUC 4NO5B 2A74A 3H9YA 1CICD 1C5BH 4PLNC 1HZHL 4X6DE 3CFBB 1EUUA 4HWBL 4XP9H 1CFNA 3CMOH 2BNRE 3D85D 3CK0L 1YNTA 3GSNA 5I73B 3NIGE 2NY2D 4PJBF 3SQOH 4HF5H 3OKMB 4GG6F 1BVLB 3VMOA 4QCIA 4ZMAT 1LK3H 4ZPVA 2PO6C 1UFUA 1SEBB 4HK3J 4Z76B 2IANA 1PKQA 3U36B 4DUVA 4CW1B 4XNUL 2EECA 3LPGA 2XI9A 4RGNC 1BMGA 1S7VB 4LKXA 3QDGB 4MQXC 2VSDA 3GMNB 5KSBA 1II4E 4Q6IB 5F88B 5IMOB 3QRFM 2C4FU 3G5VB 5DMIL 4X9BA 4EUPA 4HKJB 3ARVA 2FSEA 2DL2A 4Z5RA 3V4VL 3IAQA 1IGCL 2DQGL 4TTGA 4OSUL 1YDPB 5LJYH 5CD5C 2VN4A 2R4RH 3V7AG 4GXUN 1KJVA 4ZXBB 3L3OB 3TYGH 5FM8A 2EO9A 1J5OH 3C5SA 5IEKB 5MEPB 2HVKA 1KCLA 5T1DH 4NNPL 4XTRD 3LMJH 1A4KA 4I77L 5EZJB 4NFDA 5KVEH 2OP4H 4J3TA 4HUVB 5DWUH 4WI9A 1LO0L 1DL7H 2IPTL 3WBDA 2VWEE 2BOCA 3BO8B 4S2SA 4O58L 3D25B 2Z0BA 3QRGL 4MVBD 1KJ2B 2BSRB 4HUWB 3V8CA 1CF8H 4HZLA 4KI5C 1M7DA 5C0BD 3OAYK 2VDML 4YXHH 5IF0B 1M71B 3NPSB 5E7FA 3OF6D 4Y1AA 1MWAH 1CD1B 3EKCA 3HUJF 4KDTC 1QLFA 2F53B 5HDQL 2K3TA 3T2QA 4A6YH 3V6FA 4CMHC 4UINH 3WN5C 3BP5A 2BOBA 1D5XA 4C57C 1N6QH 1FYTB 2DLHA 5IFAH 1ETZB 3G9AB 5GJTL 2P4AB 3O81A 4HMCA 4M62H 3TA3A 5EULV 5JHLH 4NJAL 1Y0LB 3HR6A 4HAGA 3VRLF 3X14B 4YEFA 4G9FB 1QG3A 5GS0L 3NCEB 5IVZA 4XNYH 3MGTB 1J8HB 3QQ9D 3H9SD 3WO3B 1KUMA 3VWKB 4ZUVA 4E9LA 4LGSB 2MQ3A 3QQ4A 1VPOL 2GTZB 1PYWB 4D0CB 1BF2A 3GBLA 2CIKA 3NCYS 1QEWA 3EDFA 5H2BB 1S3KH 2JTDA 4D9LH 3P4NA 2OR8A 5D2NA 1NGPL 2VTFA 1GHFL 4KHXH 5DFTA 4F80A 4PJEA 4WEUD 5BZWA 5KVGL 3TM6A 2W1NA 3PGDA 4RMUA 4HJJL 3IXAA 4JQXA 1MEXH 3WIFB 1ORSB 3RDTA 4HLZG 1CGSH 5H94A 1G7HA 5EUOB 2JB5L 3E8UH 1IAKB 1QFWM 3S4SG 2ED8A 3BN9D 4KVNH 5DJXA 1TITA 4NKDB 4ZQKA 5KS9F 4WW2A 4LCIL 4OF6A 2WBJB 2CUMA 3TPKA 5JPMB 3LQAC 3K2MC 1OARH 5C0AE 4F9LA 5HVHC 2F5BH 1GXEA 3B2VL 2Q3ZA 3MA9H 4ZO6A 3I6KA 4XGZA 2DWDA 1T5WB 1H3XA 2VAJA 5IB4A 1T6WA 3ET9F 4L9LA 4LSRL 4G42A 2J6EA 4JPKL 5AWNL 3PP4H 3MRQA 1U8LA 1E4XL 3JBG7 1YECL 3VFRA 1BZ7A 1RFDL 4S11A 1GOGA 2QQLH 1OPGL 3EW3B 5CP3A 1F5WA 1VESA 1A21A 3PJSB 2NX5B 3BWAA 4LCYA 5EZOH 4ZUTB 1IGJA 2Q76A 1XGRB 4Y4KA 2VDPL 4HUUA 5I8KH 2PW2A 3CZJA 2Z92B 4HMEA 4K8RL 1OQOA 4JHBA 2P5WE 3SGDI 4PJBB 4PJFE 3SKUD 4PJ5A 5JXED 3S36X 4RGOH 1K5NA 2ICWB 1G0YR 1I7ZB 2VOTA 5KOVC 4I18A 2DIBA 1K9TA 3S9DB 2HLAA 3IDNA 2FH8A 5D1XD 5L0QC 1FVDB 1WAAF 1SJHB 1RU9H 3BEWB 3QFJA 3I2CL 1FO0B 4HJGA 2BSSB 1I7UA 3VWJD 1CL7I 5HVFB 5F72S 2H2PD 3TA3C 3QCUL 3WIHL 2OBGA 2XV6B 1GJIA 3BYTA 1A8JH 5JDSA 5BVPH 5IJKA 4NQCD 3K8LA 3GMLB 1AR2A 1KT2B 4KKBC 1S7SB 1U91A 4RX4A 3BKCH 3IFPB 2GKIA 3GSVB 1KN4L 1DBML 3QG6A 4RGNE 1G9MC 5IB5A 3GI9H 3PWLB 2J5LC 3FZUC 4JFXB 1A6VL 4LLDA 3U1SH 3QPQD 1U9KA 4N9GA 5HGDB 2VIRA 4RBPK 3VGBA 2PCPB 5D2NC 1TZGL 2JELH 5MENB 2OTUA 4U7MA 2F15A 3H42H 1LO5A 5FFLA 5CBAB 2CDGA 4JQXC 1NAMB 2W0FA 1IGML 5DUBA 4UILH 1QZ1A 4KQ3H 3HE7D 4MSWB 3MGOA 2JJSA 1X7QB 4P2QD 2DJUA 2XZAL 3R4DA 4KMTL 5DYOB 4M6OL 4MXVE 3T1FA 1DQDH 4F9LC 3MBEC 2CRIA 1YC7A 3U4EB 3BXNA 1LWRA 3JXAA 4QRPE 4Z7QF 3BYYA 5BV7C 2I5YL 1S9YB 4MAYD 5C0GA 4HKBA 4L9LC 1F4YH 1NFDF 2DBLH 3W9EA 3LEXA 3G04A 4KI5E 1HINH 5MHSE 1RK1B 1FAKT 4MJID 1RPQA 3JWOC 2A9MH 5FOJA 1EMTL 4L8DA 1AGFB 4M1CD 2V2XB 5FIEA 5B3JF 4KJYB 4OFYA 3AY4A 5ACMA 5K9QG 3B9KB 4RNRA 2OL3L 4Y4KC 5FYKD 4AL8H 1MHPH 2Y5TA 4U6XB 5BOPA 1NGZB 3WS3B 3RWFA 1N4XL 4PG9B 2YUZA 3OB0H 4U6HA 4YJZL 4UT6L 3F58L 5JLZB 4I18C 1IAIH 3AU1A 5DRNB 3SO3C 4TULH 3IJHA 1ZT4B 2MTPA 4IMLB 1V8HA 4AENB 5AYUL 4HCRA 3KNBA 2OJZL 1E4WL 4PY7A 5IGXL 3HPJB 1X5KA 3RP1A 1LGVA 1MF2H 4PBWD 1ZOXA 4ONHA 3I9GH 3GSOA 1GZQA 3W39A 2XQBH 3S35X 3WFDH 1BD2D 2CKBB 1M6OB 4NP4L 1C5CL 2IANE 5GGRB 1PKQE 1H3TA 5KS9B 3QNXB 3WFEH 4J23A 3BPOC 3MV7B 5C3TA 1QR1B 2BHYA 2VDKH 3CXDH 5KSBE 3JWDH 1DLHA 1BQLH 1A0QH 3PWJA 3WSQL 1LO3H 1HIMH 5JHDA 1NLDL 4Z8FH 4XCYA 3Q5TA 5F7DA 5D7LA 4MQ7A 3KR3H 5DD3H 3CFEA 4KMQA 1SMOA 3HR5B 1B3JA 3LZFL 1EPFA 3RUGF 4W70A 5I16A 1TZHA 4MXWH 4XZUA 1XR9A 4Y16C 2BNUA 5F8QC 3DX6A 4NO0B 2AK4A 3C9NB 3BZEB 4UB0L 4MHHI 5HVGB 1X4YA 1L7IH 1DQMH 4P5TD 2X6MA 4WV1A 1U6AL 5B4MC 1HILA 3DGCR 1HE7A 3SHSA 1WBXA 5F7NC 3QUKA 1FIGL 3TEUA 5EZLB 1U8JB 3BT2H 3OXSB 3WDHA 5BXFA 4LHUG 3ARXA 1T0MB 3OKNA 3O6FC 3UBXG 3KPNA 4P3DA 1JUFA 1QSVA 3EO0A 1HHKB 1AE6H 5C0DB 1UH3A 2B4CH 2R1WB 4OCMC 2BVQA 4XH2B 5GRJL 5ADPL 4NPYB 1J0HA 2VDLL 4JFZH 3IFNH 1QFUH 4WHDA 3S5LB 2EDLA 4YAQB 1IM9A 4EDXA 1YNLH 2XKNB 1UM5L 5GZOC 4H1LB 5D6CA 4X8XA 2EIZA 3LS5L 4U1NB 3UTQB 4OF5A 5J9PA 2NTFA 1CU4H 3V6ZB 1AFVH 2B8OT 2DQTL 3PWPB 5SWQB 4JQIH 1IGYB 3SCMD 3MLUH 2ZSVA 4LSVH 4F15C 3RZCB 1I1AB 4QOKE 2P8MA 4HPOL 4Y19D 3ULVC 3V5HA 2XRAL 5B8CB 1IQWL 4JHWH 1CCZA 1NCTA 4V1DD 2B39A 3DYOA 1NBYA 3G5XA 2AV1B 4PGEB 3BKYH 4RGMB 2XN9B 5D2NE 5E2WH 1OAXH 2IAMA 3BUTA 1VKXB 4I5BB 1N26A 5FUOL 1EHXA 2FBJL 3R0NA 4KROB 4NN6C 4Z7UA 5C2BH 4P49A 3UC0H 1GGYA 3MUGA 4Q9RL 3PABB 2YA2A 2CGRL 5FM5O 1ZHLB 3IF1B 2EDXA 3HNVH 4C4KT 3KGRA 1EEUA 4Y89A 2HRPL 2VISB 4QT5A 1HHGB 3VGDA 3OAUH 4PP1D 4OM0H 4FN0A 3FQWA 5DJ2A 4Z7NF 2IQAA 1FL3A 1JGVL 3H3BC 4N8PA 5DUPL 2DKUA 5CUSL 5HI3C 1NCBL 5KJRH 1P7HL 3RVWD 4FTVB 4WV1C 5EBMB 3MRKB 4Z6AT 5I18H 1UM4L 4MMXC 3DURA 1CXIA 3F7PC 4Z0XA 2RR3A 2QJDA 2ADJA 1VEPA 3HNTH 4TUOB 2B1HH 1D5MB 1PW3A 3QULA 5F44A 1TMCB 1EGJA 5JUEL 6FABH 1DLFH 3RWGA 5JW4M 4QRQB 2GTWA 3SQBA 4C59B 4AG4H 2GJZA 2GW5A 3QDGD 1FFRA 4PJ5E 1VA9A 2C1PA 2BNRB 3CLFL 3MRNA 3VE0B 4WEBH 2V7HB 2Y06L 4M6NH 2EDOA 1JYXA 1BAFL 4UI2A 3H3PH 2HFGH 4OLWL 4LSPH 2HJFB 2E27H 1U8QB 3BIAX 3CVHB 3NAAL 1KN2H 4ZXBD 1S9XB 4GQ9L 4L3EA 2CO6B 1FFOA 2VLJA 2ESVA 4HXAH 3PE9A 4NQTA 4XP6H 1JGDB 3KPSA 5FDYA 2OL3B 2R15A 4QHKI 1CFQA 1PVHA 4M6ML 5LBSL 4R4BB 4R2GB 1I7RB 1MFEL 2BY0A 3VD4A 3U46B 3GO1L 3FOLA 2FB4L 3VFOA 5C0FA 3BH9A 1MPAH 1KEGL 5KANI 1H15A 1U93A 1FZMA 4BK5A 1EBPA 5HI5D 1P7KB 3DGGB 4PLJC 4YHKH 4LCUA 4WJ5A 1I85C 3PL6A 3LKSA 2R4SL 3EYOB 2B5IC 4FQLL 4K2UL 1GGCH 1BBDL 2DLFH 4MA1B 5EZIL 5DD1H 4N8CL 4PFEA 4KXZI 3V5DB 2F53D 1CXFA 3TNNA 2FH6A 3HMWL 5C1MB 1YUHA 1NDMA 3DPBA 1INEL 1FYTD 4N0UB 4OM1L 1Q0YL 4GKNA 4RAVB 4PJCA 1MJUH 3T0DA 4YX2H 5I9QC 2D3VA 2FJHB 1OAYL 4G9FD 2EZ0C 3KYNB 3QWRD 2HMIC 2ZP0T 1H8OA 3BZDA 1U36A 5JA9A 1UKQA 15C8L 1A3RH 1LP9F 1I1RA 1J8HD 4LLVA 3ALWA 3LHPL 4N1HB 1RJLA 4NYLA 3UDWA 3VWKD 5FK9A 1CDIA 2EE9A 2G5BA 3TLRA 4L5FL 4ZFZB 3CFJB 4LAJH 4Z9KB 2NW2A 3HPLA 2OR9H 1B9ZA 5IESH 4UQ3A 4UIKL 2BNQE 5ACZB 2OK0L 1JV5B 2AABL 2K1MA 1Q9OA 4JB9L 2AXHA 4CAGA 4PBXA 1OP3K 3N1MC 3RFZC 3EYFB 2V9RA 1H3WM 4AEFA 3M07A 1QBMH 4UV7L 4K71B 4XPBL 5JW3L 3HZMB 1MLCB 4YNYA 2P8PA 1GGBL 1AY1H 1ZANL 5GJSL 1H5BB 2SEBA 3LQAL 2OLDA 3HG1A 3UTSB 4LSTL 1UVQA 2X2YA 2WBJD 2EXYD 3HC3L 3BOVA 3ULVE 2P47B 5EH1A 3LKOA 3VG9C 3ZKXC 4HGKC 1G6RH 2F5AL 1JHKH 3HCVB 2HTLC 3WLWD 1T1WA 1FNSL 1XF4B 3QZWB 3SGJA 4XB8A 4OQTA 4NQSB 3CH1B 1S78D 4R0LC 1Q8MA 1YJDC 3A67H 2O61B 1QHPA 1RZ7H 2RJMA 1QSFA 1OAUH 1HDMA 3VJ6B 1BGXH 1TJGH 5IK3A 3AREA 1KEMH 1YYML 5JHDE 1TCMA 3MRGB 2NX5D 1OAQH 3ORJA 4DN4L 1S7WA 5TH2A 1SY6L 2AJ3B 3PL6C 5D7LE 4KK8D 2OTWB 2ZCKH 4M5YL 3Q6FB 5I30L 1ACYH 4HIEA 2DTML 2E9IA 4B5EA 1G1YA 1UC6A 2NY0B 3MLZL 1ZWIB 2LVCA 2IQ9L 1F90H 2X4SA 4M48H 1I4FB 1H3VA 3MACL 5EU7E 2AJSH 1E4XI 2P46B 2DMCA 1OP5H 3BRGC 5EU6A 4PBVC 1TJHL 2DM7A 3UJJH 5CSBA 3ZKQD 1EXUB 3V4UL 5A2IH 4JFPA 3B6SA 1HHJB 3AGVA 3LSOB 3LN9A 1N6QL 3VFNA 1DEEA 2XWBB 3EO9H 4Y4HC 2FCBA 3TBVA 3FO2A 3BQUB 5FO8B 1G9ML 3DJ9A 3UO1L 4D0DA 1KYOJ 1XF2A 5DZNA 5CEZE 2X4NA 3VD3A 4RFNC 3MFFB 1AKJA 1I8IB 4URTB 2EEDA 5IFJA 5CAYB 1WBZA 1CLOL 5C07A 3WUWG 1B2WL 3LY6A 2J7LA 4OCXL 4U49A 3QR2A 4FQJL 1A9EB 2AVGA 1G7MB 4YK4C 1TVHA 1A6PA 1CVSC 3T0AA 4A2LA 5MEND 3HFMH 3TPUA 4JGMA 4WUKH 4NUJA 3PWVB 3Q1SL 4Z0BL 3VXPB 4RWYL 1U92B 4KVCH 1MFDL 3PIQB 5CJOL 2VLLB 2Z93B 1S7UA 5CWSA 4I2XA 4NQUA 3O8XB 1INDH 5IHUH 1VGKB 5M7QA 5JA8B 2YEZB 1IT9L 1DDHA 1HKLL 1U8OB 4XNMB 2EDNA 2A6KB 2W9EH 5GGRY 5FAAA 1I8MA 5HTSA 1BM3H 4ETYA 4KZDH 4OZ4B 4BSWA 2J6EL 4OAWA 4P2OC 5JQ6H 4D3CH 1TIUA 3DMMC 3JWOL 4OGAD 4YR6A 2F8XC 2YUVA 4PJGF 1B0GA 2ITDA 3MUJA 3WFBL 5E5RB 4DK3A 2I9TA 4PS4H 4JGJA 1XGYH 3TN0D 4IRSA 4Z7UE 5C9KA 3B9DA 3QPXL 3AREC 2XTJC 2VAAA 3E6FA 4PRPA 3B43A 4MNQE 1IAMA 1ZA3B 2XY1A 5I8OL 4PRAB 1QPPA 2ICWJ 3B9KD 2UVFA 1JF1A 3I75A 4M00A 3T09A 5FOBB 5CBEB 5J1AB 3PXHA 3MCKA 4ZD3H 4NFCA 5FYKU 1TTUA 4M7LL 1NJ9A 5A16A 3DRTA 5D8JH 2VR5A 4O4YL 4G5ZH 1MI5E 1JHLL 3BIBX 2CXGA 1HSBA 3QHFH 2WINA 4OLXH 5EPMA 2IFFL 1N0XL 1ODAA 5D4QA 5FKPB 4JJ5B 4CMHB 3OJDB 3CUPA 1FAIL 4Y4FA 3U7WL 1WWAX 4KY1H 3KYOA 3RNKA 4AZ8A 3NFNA 3RWHA 1BZQK 3OWEA 1F2XK 4Q9CA 2G5RA 4IJ3C 3OPZH 4YHZL 3RWDA 3NIDF 2A74B 1OTSD 4KZEL 4Z77A 4KJPC 3VXUE 2F19L 3LN4B 1Z0NA 3GMOA 4OCYL 5TGBB 3MV7D 1KPUA 2R0WH 3MLWL 5CZXD 1EK3A 2XNAA 1WFTA 1YEGH 1RIUL 5E5MB 5FA3A 5GS0D 3UJTL 3SGDH 3TVMA 1S9VA 1PZUB 3WXVL 1MUJA 4AJ0A 1DJSA 4WI5A 2ILLA 5I1KH 3OMZA 1K2DB 2VDNL 3UJIL 4YFDB 1CIUA 3STLB 4CVXB 1HYSC 5LAXA 3QEUA 4OI9A 1PAMA 3BDXA 3BAEL 2VLJE 3BGAA 4GAYB 1F3RB 2IANB 4NO0D 3N85H 4Y0GA 3TBWB 1CL7H 5HYIA 1VFOA 2ICEA 4X9FA 3KPSE 4FXLA 1H3UA 4GW1A 4OV5A 1VGEH 3EOBA 1DCLA 2FIKB 2O5ZL 1MJ7L 3VW3H 2FLRT 1IGIL 2QQNH 4KRLB 1M05B 3QO0B 4G8IB 1BVKB 2ARJA 1GGIL 4XVSL 4OUUB 3CZFA 2DQFB 4HWZA 3KHOA 3WHXA 2IJ0C 2DD8L 5C0NC 4ORZC 1HSAA 3FQTA 4LQFL 4GLRI 5HVHB 1U3ZA 4KTDH 3MYJB 4HXBH 4U6TA 2KPNA 4D9QD 1BHGA 5I19H 4MDJA 4U6VH 1XAUA 1L0XA 1UQSA 4MXQC 1CLZL 5TFSL 5A2JH 2Y4SA 5CGTA 4QXTA 3KWWB 4GUPB 4X8JB 3DTXA 3T65B 4N0CD 5GZNC 1MRFL 4JO2L 4H25A 5TDNB 3F7YB 3L3JB 4PJCE 3B5HA 5IQ9B 3LS4L 1YY8A 3EO1B 4YHLL 3CLEH 4Y5XA 1OF2B 4G6KH 3DARA 2VRAA 3MOBL 4KKCC 4HCRL 3PWPD 4F58H 3ULVL 5A2LH 5E4IA 3MRDB 4I3RL 4PJIF 3RZCD 1QLFB 1I1AD 5DA0B 2QEJA 4Y4FC 2BOBB 5L0QB 1KTLA 5CLTA 2NY7L 3BH8B 1Y6NR 4DQOH 4JVUA 4U1LA 3LEVL 3OHXA 3MRBB 1M7IA 3GIZL 3IT8D 1M7XA 5K59F 1NCWH 4NHCH 2XN9D 2FR4A 4RIRB 1T7XA 3NGBC 3DUSA 5B38A 2R1XA 5DD5L 3S37X 5ESQA 4HIXH 4FNLH 3V7AE 1WISA 4KROD 5ABDE 4OCRL 2XTLA 3KPOB 4KK9C 5KSAA 1QLRB 3WUZA 3PV7A 3TO2B 3ZE1F 4QOKB 2QQQA 3TVMC 5LGJA 4PJAF 3P9LA 2J5LB 5BW7A 5D7JA 3O45B 4OGYL 4N0YL 3HG1E 5BJTA 4U1HA 3SKMA 2DOCA 1KCRH 1E6JH 1U3HC 4OCWH 3G5ZB 4GAFB 4S1SL 5EBGA 4JRXA 2AW2A 4NSKA 1G7PB 4WFGD 3NCJH 4YDLC 4PRNB 1AI1L 2L7UA 1L7TH 5FHBH 3VH8A 4FTVD 3ABZA 5HHXL 2H3NA 2YOCA 1QSFE 3ALXA 1CQKA 4K23L 3LKNA 1F3DJ 3GMRA 4MS8C 5F9DC 5H37G 1JF5A 4ZQKB 2XTJE 1MRCL 1YPZA 4NRYB 1WCBB 1ZHKB 3DETD 3S96A 5CEZL 1FZKA 5EIIB 5BVJA 1VFAA 2ZCLH 3SBWC 4B0MM 4GXUM 1FGNL 3MBEB 3L3DB 1UWEH 4PJ9B 2H32A 2OXGA 1I9RH 8FABA 5BV7B 3MNVB 1WIOA 3V4PL 2FWOB 4MB4A 2HJKA 3TIEA 3FFDA 4KKAC 2OZ4A 1H0DA 4HIHB 1T0NA 2BNRD 2H9GB 5EU5B 4HWEH 2H6PB 5IW1B 3EGSA 4FQXC 3CPLA 5EU6E 2ZUQB 3L9RB 5EIVA 5E24E 4NN5C 3S88L 1EO5A 2WWKT 2WP3O 4DKEH 5J6HA 3BWAB 1CFSA 2EDTA 25C8L 2Q76B 4XMKH 3PDOB 3MR9B 5ESAB 3RWJA 5HHQA 5LWYL 4GMSL 4WNQA 2X9YA 4D9RE 4Y5XC 4ZOAA 2VUYA 5JR1H 1P9MA 2HG5B 5F70A 4WUUE 3KLHC 1EEZA 5HHPB 4CBPA 3U9UA 2WUBL 3D3VB 2CLZA 4R2GD 2DQUL 4R26L 4HUXA 5E99H 1QRNA 3G6JF 2HLAB 5DT1L 3SO3B 5F7WC 2QL1A 3O6KL 5C07E 4C55A 4A2MA 4M5ZH 5GGQH 2APFA 1T3FB 5FCSH 4MA7L 5A3IC 2AK1L 1NGQL 4ODWA 4HV8A 1BOGB 4MJ6B 1TNMA 3AAZB 5C09A 3FMGH 5DMJB 4LRIC 3LKPA 4OT1L 3B5GA 3T2NL 2IMNA 3QQ3B 5I66B 5ANMA 2PKDA 5IB5B 5IIEB 4I2XE 4J3UA 3OKEB 4NCC1 3V2AR 1D5BA 1DBAH 3G6AB 1NC4A 5IVNA 4N5UA 1MJJA 1WBYA 4HDIB 1QD0A 3UBXI 2EO1A 2YD9A 5DR5H 2AEWA 1L6ZA 4MA3A 2N7AA 2MQ0A 2VXVH 2C3GA 3DX9A 4MJ4A 3C6LA 2FBOJ 1ZT1B 5DO2D 2ZG3A 1MCIA 5FUZL 1KC5H 2VLRE 3PNWB 4Y16B 5ISZB 3OX8A 3P4OB 3WO4C 1J1OH 5DZLA 4GSDH 5CZVH 3FONB 3INUL 5E8PB 1WC7B 4GH7B 5DSCB 4JDTL 4FP8H 4NZUH 5DFVD 1EGJL 3REWA 1CFTA 1NGXA 4PRPE 3VDBA 5MEOB 4PJHF 4PLKC 3BSZL 4YDIH 4OIIL 1ULVA 4PJIB 1TTFA 2IBZX 5EBLB 2KZWA 2XZQL 5DJCB 1KPVA 4M8VA 3VXSE 4JHAL 3HI1A 3O6FB 1DBJH 3QHZH 1U8IB 2EE3A 4QY8A 4G6JL 4I4WB 3UTSD 3HZKB 2O5XH 1FG2B 5HGHA 3VXMA 4NO3B 2BNQB 4MNHA 2KZ1B 3SDCB 1W0WA 1YEDB 3LB6C 4IDLA 5DS8B 1YJDL 5F7FA 5D5ME 4PP2B 4X6FA 4JY6A 3RX7A 2FATL 5F9JA 4JDVB 1S9WA 1YA5A 1IEHA 3V6OA 2J3SA 5H35A 2DAVA 4MX7A 3TBSB 4OKDA 1CBVH 3BVNB 1HZHH 2IGFL 4F15B 2BVUA 4NC0B 3RPIA 1FFNA 4X6BA 4ZS6D 3CK0H 4RRPA 5C6TL 3ZKMC 1NPUA 4OZGF 3FT3B 1U95B 3C2AL 4U1GC 1V7MH 1OTUC 2NY0D 4UUJB 5JW5A 4HEME 3C8HA 1F11A 1BIIA 1AC0A 3ECBB 4QRTA 4ELMA 1Q38A 4XMPL 1AGCB 4H26B 3FTGA 2XFXA 3HLAA 3F12A 4XNUH 4YZFE 4F57L 4NN6B 4UDUA 4LEXL 1NLBL 3BP6B 5GGSB 2W9LA 1XIWB 4IOIB 4EVNA 4OD2B 5DMIH 5F7DB 4PREB 5DHVB 1LNUA 1P4LA 3D69B 5EU3B 3ES6B 1IGCH 2DQGH 2NW3B 3HI5L 4ZS7H 4OSUH 4NBXB 4ZTPL 5DMKB 3C6LC 3BQUD 5I16B 4U2YA 2P5WD 3ZT5A 1ZT7A 2MKLC 1LD9A 4BUHA 1EHNA 3O6LL 5M95B 2XWJB 6CGTA 4JM2F 4F8TA 3VFMA 1MFCH 1ONQB 3LH2L 1F58L 4GAGL 5FYLH 2JB6A 1FDLL 5E6ZA 8CGTA 1T04B 4I77H 1LO0H 2IPTH 4BQCA 1T20A 2WQ8A 5HYQB 4O58H 3M45A 2GT9A 2MKWA 3TV3L 4PGJA 3U0PA 3MUZ1 1T7WA 3GUTA 5HHVL 1F42A 3WJJC 2R2BB 3CIQA 4PTTB 1NKRA 1JUFB 5GGTH 3EOAB 4G43A 1CICA 3G9VA 4X4ME 4ERSL 1U58A 3O8XD 3UTOA 2VDMH 5CJQL 1MHHB 2EYTB 4K3HA 4POYA 2YUXA 1EJOH 4YUEL 1S7TB 4OQTL 5AG8A 3D85A 3JV6B 3QDHA 5F8RC 4OF3A 1RY7B 2HFEA 5CD5D 5DTFA 1Q9LA 4I0CC 4B53A 3LOWA 5EOCJ 5HYSA 5H8DA 5GJTH 4DAGL 3REVB 1KOAA 1XZ0B 3V6OC 1T2JA 2VITA 3DOSA 4WCYL 4C54A 5T5NG 4HHAA 2E6JA 2HVJA 5I1DB 3IGAA 2ZSVB 1RURH 5IJVB 2QSCL 1PD6A 4L4JA 3ULSB 2VXQH 2PTVA 2BSTA 2GAZB 1DUZA 1VPOH 4YDJB 3G08B 4JM4L 1OP9A 3THML 4QRPD 4DUXA 3T8XA 4J3SA 1U8HA 4G8EB 1JMXA 3G5XB 1FLRL 2B5IB 3L6FB 1BZ9A 5HGAB 4F7MB 2H2SC 4PJHB 3MBXH 1P84K 5DVLA 5MHSD 1NGPH 4G7VL 1GHFH 3QA3B 4MCZB 5KVGH 1U8KA 2CRZA 3HKFA 4HJJH 3OL2A 4MNQB 5CIPH 4Z95L 1WTLA 5FV1L 4JO3L 2OYPA 3U30C 1YPZE 2JB5H 43C9B 2EE6A 3WUWA 4ACPA 4NHUA 4NUGL 4LCIH 4GT7A 3QXTA 3MPCA 5I9QB 1ITBB 4IRJB 1FQ9C 3VDCA 3B2VH 1ES0A 5DJ2B 1EDQA 2J8UF 4NQEB 3PGCA 1MI5B 4JFDB 3PP3K 5HGBB 4Q0XL 5C0BA 2M2DA 2V5RA 4LSRH 5I0DA 1FNEB 4MD5B 5ENWB 5C0JA 3OF6A 4JPKH 5AWNH 3FN0L 2DI8A 2BDNL 1E4XH 1MHCB 1YECH 5IW3A 1RFDH 5C3LD 5IFHL 2E9BA 4KJWC 1OPGH 3RWCA 4G9DB 3ZL4L 3QHTC 3WE6B 3QULB 4I9WE 1X6LA 3BPNB 2I9LA 2IAND 4KAQH 5AAWA 1ZGLB 4IBLT 3L3IA 3QCTL 3VXUB 4OZFA 4F3FB 1LE9B 1FFPB 2VDPH 3L7EA 4LP5A 1CICC 4CN6A 4K8RH 4OZGB 2C1PB 4QHLB 4OGXL 5J7CC 5INCA 3UTTB 5IBTL 3H9SA 4WU7B 1XF3A 4LLWA 2M8XA 3FT4A 1RIHL 3NCFB 3OR7A 5I1AA 1D6EA 3EIFA 4LARL 1U0QA 3VRIA 2NY2C 4RAHA 5JTWA 4O5LL 3A6CH 3UEZA 1EBAA 3I2CH 3IXTB 3VG9B 3ZKXB 2NY5C 3ZE0E 2EDEA 2D7MA 3QCUH 3WIHH 3SE3C 5IQ7L 3CSGA 4JG0L 5C09E 5EFIA 3KPSB 4R0LB 3RY6A 5FCUH 3NMEA 3VI3F 4G6FB 5IBUB 1KCKA 4BFIA 2R29L 5DK0A 1WFNA 4XP1L 5ANME 1JGLL 1MLBA 3PF2A 2AKRA 5C0FB 1OOAA 4P5KB 1A2YA 4WHYH 5K93A 1KN4H 3L7FB 5CKGA 5A2KH 4LF3B 4KQ4L 1C7TA 1FRGL 3X17A 5DQDL 2NXZC 3PL6B 3BESR 1F4WL 3NIFF 3RGVC 4JREC 4G6ML 2NQCA 4UV4L 3MMEA 2MHAB 4HIJB 1UZ8B 1AHWA 1TZGH 4LCWE 4CVZA 4E5XB 4B41A 3IDUA 2GSGA 4IMKA 3CU7A 4QTHB 1RUKL 2WWMD 3AXLB 1IGMH 5E95B 1CLCA 5DF0A 1Z9LA 4PJCB 3FQUA 3PHQA 1IFHL 2XZAH 2M26A 4KMTH 4M6OH 3IAGC 3L5WA 1JNHA 2AQ2A 2H1PL 4Y4HB 2EH8L 2R2HB 2I5YH 1I7TB 3T0EC 4RFNB 5J6GA 1QFWL 3KYAA 5JXEA 2YRLA 4QOKD 2H41A 5C9JA 5I1IH 4L4TB 3FZUD 1AH1A 3HPLB 1KB5L 5D7IF 2XA3A 1A6UL 1EMTH 4AT6B 2DF3A 2DI9A 5KTEL 2Z31B 3IYLW 4BFEA 1LK2B 3FQXA 3VWJA 1UWGL 3MRHA 5AZ2L 1EX0A 4JCMA 2OL3H 4HQQL 4W4OA 1ZVHA 4NQCA 1A14L 3LN5B 4GMTL 3V6OE 4FQ1L 1UACL 3ZDXF 2APXA 2NY6B 3MV9E 3NCYP 4HX1B 1N4XH 2VH5L 2ENYA 1DBKL 5DJYA 4UT6H 5SWSB 3F58H 1AD0A 3EFFB 4H5SB 5A1AA 4QRSA 2UZIL 1N64L 1JWSB 2J88L 1J18A 1D5ZA 4OKVA 4MQSB 3TJHC 2IF7A 1OGTA 2NYYC 3MBED 5CMAA 5AYUH 3DV4A 4PJ9D 1A1NB 4NT6B 5BO1L 2OJZH 5D2LE 1E4WH 4BUGA 5IGXH 2IPUK 4P2OB 2RFXA 2KDGA 2YKLL 3PXJA 1I1CA 3DMMB 1NCDL 3I6LE 4PRDA 4NP4H 4ELME 5ERWA 5J06A 5MERA 2AEIT 3PQYB 5EO1A 1AXSA 1K8DB 5DD6B 1IAOB 1PZ5B 2CH8A 4FZ8L 3BZ4B 1G7JA 4D8PB 2QSVA 4KV5F 2YD6A 4Z7WA 3HE7A 2Q8BL 3NN8B 4YFLI 3WSQH 1V3KA 2FX7L 1NLDH 4P2QA 4Y4KD 5GQBA 1IM3A 1J05B 3TP4A 2W38A 2VZSA 5JORB 2OJEB 3K7UA 4JZNA 1S7RB 5L6YL 1OGAE 5AUMB 3O3BA 4X4ZA 5FKAB 3T04D 3QXDB 3LZFH 1AHWC 1P1ZA 4MAYA 3D3VD 2ERJB 3L5HA 4GLRH 4LGPB 3O4OB 1OW0A 1L0QA 3IU3A 2UYLA 3MRFB 3F62A 4YBQC 1MHEB 1G9NH 4WI4A 2YD5A 4MJIA 4PV9A 5SV4A 3QJFA 5E8NA 1A1MA 2ATKB 1U6AH 2VZ1A 43CAA 2EH7L 1DEEB 3LKQA 3IETA 2AJUL 3TFKC 4WUUB 4IJ3B 4AM0B 1T1ZB 1FIGH 1C08A 3VFTA 5GRUL 3MXWL 3KPLA 1OY3B 1TZIB 2X10A 4WHTB 4O2CA 3S35L 1ZVSB 1HH9B 3FHAA 3AM8A 3ZT7A 4HH9B 2IALB 2R2EB 4YDVB 4CDHA 1IILE 4YHML 3IKCB 2OXHA 2XZZA 2EICA 2QADC 3WHE0 4MCYB 5GSRA 4YGVA 4HKXA 2JCCA 1C12A 3HZYA 5GRJH 3WJLC 5ADPH 3VWJC 4TOYL 3S4SB 5J89A 3NA4A 4NGHH 1F4XL 4M1DL 4R90L 4W4OC 5DC0A 3BD3A 3DVNB 3HS0B 3TPUB 5KG9A 4Y16D 5ISZD 4LHJB 5IVXF 3T0WA 3TBYB 2FX8L 1UM5H 1BD2A 4L3CA 3LS5H 3V52L 3VFUA 1T83C 2PR4L 5DMYA 4ZOCA 4P0DA 5B4MD 3HMXA 2FL5B 4RAUA 4N9OB 1R5VA 5TQ2L 1AIFA 4HGWB 5SWZB 4HPOH 2I25N 1PKOA 4YHPB 4NM4L 3ULUF 1IQWH 1ACZA 3O4LE 4UQ2A 2PUQT 3CU1A 2VLRB 4PTUA 4YR6B 2VDRL 2FZ3B 5GGSY 3O6FD 3QWOB 2ITDB 2CLRB 4FXGA 5KN5B 1JVKA 3MRIB 2X70A 4FXKB 2FBJH 1LEGA 4M6AA 2BNQD 3MRLA 4P5TA 3HE7C 3TT3L 5ETUB 3B9VA 1DQTA 1Q9KA 5E8OB 3SDCD 3BP4B 2MPAH 5CHNB 2YD8A 4Q9RH 4DVBB 1CT8B 2CGRH 5DDHB 1QNZL 2UY7A 1NQBA 5GZOD 3VXSB 1CG9B 1R3KB 4MAYC 2HRPH 2X09A 5B21A 2Q3AA 1OW0C 3QUXA 4ZOEA 1DN0A 3KPMA 3T0EE 4L1HA 1JGVH 5DUPH 3K81A 5C0BE 2WINB 5CUSH 1NCBH 4YO0B 2A38A 2CIIA 3ZKSD 3ULVD 1UM4H 2DQCH 3H0TA 3CSBA 1IBGL 2PTUA 3RNKB 2AJXL 5EORL 5D5MB 2LV4A 3RVUC 3T4AA 3MRMA 3GHEL 1MCBA 3UTZA 1NDGA 5JUEH 3AM8C 1UB5B 3SDDA 1K4CA 4E42A 4HK0B 1XIWD 1E27A 4K94C 3H9SE 3SCMA 1UXSA 3CLFH 3BKMH 1MUJB 1MAJA 4R9HA 2Y06H 1LO4L 2Q87A 2F8VA 5FB8A 1G7LB 4CMMA 4PJ7A 4OLWH 1SHMA 1U3HB 3MLTA 3NH7L 2RQ8A 4NN7C 4U1IA 4Y8DC 2CPCA 4M7ZB 4XP4H 1KB5B 2FD6L 4V1DA 4YDLB 3NAAH 5DRWB 2A9NL 4GQ9H 5IB2A 2I60L 2XXMB 1YYLL 1FP5A 4XX1G 2ZOLB 3TNMA 5HI3D 3GGWA 4FQHA 2GCYB 4ETQB 2IG2L 3D9AL 5DFWH 4M6MH 1MFEH 4HS3A 1A4JB 5EO0A 3CZFB 3GO1H 3DO7A 4NNYA 4LPTA 1PX4A 2FB4H 4OTXL 4LGRB 3WLBA 4MZ3A 1KEGH 1I1FB 3RWEA 7FABH 3GJFA 3PWUA 4NO5A 2R4SH 3RKPA 4JO4L 2NXYC 4K2UH 2AJZB 3DLQR 2A6IB 3BD5A 3MLYH 3C5ZB 5EZIH 2LFGA 3CFBA 1R3LB 4N8CH 4GFTB 1GGUA 5DK2B 4FQXB 4P5TC 3BIKB 1DQQB 2KQNA 5F9WC 4NN5B 3D2UB 3HMWH 2ED9A 1FCCA 2MMXA 1INEH 2P8LB 3EDJA 3OKMA 1Q0YH 5HGGS 1RV6X 1BVLA 2N56A 4WHCA 4Y5XB 1I9EA 2HKHL 4XPAL 3D1MC 2CD0A 4Z76A 1SEBA 3ZYZA 3EOYG 5IMKB 1TENA 5C8JA 1OAYH 3U36A 3QUXC 2R1YB 4CW1A 3TCXA 1JZ3A 3T3PF 1F8TH 15C8H 3GSNH 3QDGA 4MD0B 1JPTH 3GMNA 5CCKL 1F4HA 4Q6IA 5F88A 3LHPH 2LAAA 3FAWA 4HS6B 5CSZB 5IMOA 3G5VA 2V7NB 2DTSA 2DIJA 4L5FH 5IOPB 1LEKB 4HKJA 4KUZL 4OZHF 4PLJD 2FEEI 1YDPA 2VDQL 2PTTB 4UIKH 3OHXB 2OK0H 1MY7A 3NABL 2AABH 2D4DA 4OCLC 4ZXBA 1UZ6E 4ZAKA 5FYJD 3L3OA 5T33H 4NQCE 2X4UB 5IEKA 5MEPA 3SJVB 3SDDC 3WIIL 3L3KB 3O2WL 5HHNB 4UV7H 4XPBH 5JW3H 4EUPH 3T0BA 4LVHC 2MCPL 4YPGB 4MNQD 3SCMC 1GGBH 2X4OB 5EZJA 5IHZB 1CWVA 3SE4A 1ZANH 5GJSH 4HUVA 3EYSL 3LQAH 1MJ8L 3E3QC 4PJEF 2DM2A 4YQXH 3BO8A 4LSTH 3D25A 3V8OA 2WMPA 3HC3H 1QSEB 2X1WL 4IRJD 2DLGA 3U0WL 1KJ2A 3DI3B 2BSRA 2F5AH 5CEXB 1FNSH 4NQED 4HUWA 1FGVL 1MI5D 4JFDD 3WO4B 3L3GB 4WW2F 5GIRB 5TE6L 4LHUB 4CU8A 5IF0A 1M71A 5I75C 1F45A 3UBXB 4FS0A 3V79C 1FG9C 2F53A 1YPZB 2AV7B 1RZFL 3M17B 3CFKB 1FYTA 1YYMH 1ETZA 3MLPA 4P2QE 1NANI 3VFGL 2D7PA 3VXUD 1Y0LA 4ZDHA 4M5YH 5E9DB 4PP1C 5AEAA 3FFDB 3X14A 5I30H 4Q58C 4G9FA 2DTMH 1DVFC 3QWRA 1RZGA 3P0GB 1DP0A 3MLZH 3MGTA 5DMGC 2IQ9H 2NTSP 1ZTXL 3UTTD 1J8HA 1Z5LB 4J4PC 3P11L 2YPVL 5DGQA 3MACH 3OKKA 4EI5C 3VWKA 4XBEL 1BEYL 3FO9B 1YEEH 4G8FB 5ILTL 1KTDB 1Y6MR 3LPWA 4JKLA 2NY5L 1PYWA 1MNUL 1TJHH 4D0CA 1IC5L 4DZBB 1NEUA 1T89C 5E00B 3P40A 3V4UH 2Y72A 3GBNL 2VLJD 3U0TB 5H2BA 2CMRL 2Y36L 1QO3B 3P0VL 3KPSD 4LPYA 1EEZB 1V05A 1UM6L 2N4IA 4G6FD 5FGCE 1G9MH 2J12B 3SGKA 1ZEAL 1KTRL 4Q6IC 3WIFA 1ORSA 3V7MA 1I8LA 5CP7B 1XCTB 5EUOA 3KG5A 1OT2A 5EN2B 2I27N 4AQOA 1CLOH 5HDBF 3GKZA 4NKDA 1B2WH 3PL6D 2Y7QB 3RU8L 2WBJA 4OCXH 5JPMA 4LK4A 2V17L 4FQJH 5EC2B 4U1GB 3U79A 2OSLA 2EKSB 4IS6B 4ZAKC 2DQIH 4FFWD 2Y07L 1T5WA 2LVEA 4L4VB 1J8KA 3Q0HA 4WI8A 1BD2E 3NACL 3Q1SH 4RWYH 4Z0BH 1V3MA 5L2KB 1MFDH 3GM0A 3SE4C 2PXYC 1NC4B 2ZKHL 1WBYB 2NX5A 4V2CB 1IT9H 1HKLH 4ZUTA 1O7VA 1XGRA 3KYMB 4Y4HD 4KJQC 2J6EH 1T2QL 3QISA 2ENSA 2Z92A 4D94A 4LCWB 4PJBA 2ICWA 5CP3H 1I7ZA 2A6JB 4L4TD 1EUTA 1MAML 4WGVB 1F6LL 4O2FB 3QPXH 1FVDA 4U31A 3MLRL 2Z31D 1SJHA 3BEWA 4JHZA 1FO0A 5I8OH 2BSSA 4NKQB 2VB5A 4YLQT 3VFVB 5DJ8B 2APTA 3GMLA 3MRRA 5HDLA 1GOFA 2NY6D 1G1CA 1NCAH 1S7SA 4X5XB 3TGXA 3EYQD 4MNGA 4OZHB 3IFPA 4P23A 1JZ2A 3PV6B 3VWKC 3OGCA 5BZDB 4K3DL 4O4YH 2YUWA 1BJMA 3HG1D 4V2BA 5K33A 3RVVC 3C09B 4S1DC 1JHLH 1FV1B 4X7DC 3PWLA 4JFXA 1P53A 2IFFH 1N0XH 1XEDA 4OD3L 4OLVL 4HWBA 1FAIH 2GK2A 5C7XL 4BFGA 4P2OD 5HGDA 4LBEB 3I02B 3U7WH 4JCLA 4X6FB 3RX5A 4RZCB 2PCPA 3X3FH 3DMMD 5D93C 4AIZA 5MENA 1FYHB 3VGHA 4IM8A 4YHZH 5B39G 3MV9B 1Q1JL 3SGKC 4KZEH 1A5FL 4MX7B 2F19H 3PQYD 2H8PB 5CBAA 4OCYH 1MCRA 2WBWB 1NAMA 4GRWE 4M3KB 3ARED 1OAKL 2XTJD 3DVFA 4MSWA 4X6BB 3HNSL 4N8VB 3UJTH 4UT7H 5DYOA 2EXYC 3NZHL 4PJ7E 5D2LB 5KAQG 5A43C 1N6VA 5GHWL 3U2SB 3G5YB 3EDKA 3F65A 1PEZA 2VDNH 3K1DA 3U4EA 2AGJL 3UJIH 4V1DE 1E4JA 1S9YA 4U3CA 5C0CE 4ZSOE 4JPWL 4P46B 5EA0H 4ELMB 1UCTA 2D0HA 4YHIA 2XFXB 2Z9TA 12E8L 1A7OL 2LQRA 1RK1A 3I3DA 3ARDC 1MJ7H 3L95B 1KBGL 4DK6A 4EQ2A 2W0LA 3GK8L 1IGIH 1AGFA 3DROB 1H3PL 3D0VB 2V2XA 1GGIH 3U30B 4XVSH 4HJ0D 4KJYA 3BUYB 4D9RD 3B9KA 1QLEL 2F9BT 2DD8H 4WUUD 1NKOA 1OGAB 4JZJC 4LQFH 1FZJB 1QHOA 4U6XA 5HPMB 1NGZA 3WS3A 2X4TB 1JPGB 4YBHA 3ZYIA 2W0PA 5JLZA 3UZQA 1BJ1J 1J0YA 5DRNA 5ID0A 1CLZH 4KHTL 5TFSH 1ZT4A 1T4KA 2DMBA 3MV01 4IMLA 4AENA 2EE2A 1CR9H 4YFLF 4OCSL 1HYSD 2A2QT 3HPJA 4JFFE 4K3EL 1MRFH 4JO2H 2KBGA 4P5MB 4LLYB 4PB0L 1E0OB 3LS4H 2CKBA 1M6OA 4YHLH 1NGYB 5GGRA 1HQRB 1CN4A 4YXKL 5KS9A 3QNXA 4P23C 4BZ2L 4BYHA 5KBNC 3MV7A 2NY4C 1ZLUH 1QR1A 2V5TA 4LPVA 4HCRH 3QDGE 4W6XB 2WUCL 3A0OA 1J1PL 1CFVL 4I3RH 3ARFC 4RA0C 5SWZD 5C0ND 5DTFB 5HYFA 2NY7H 2F8OA 4JQVC 3HR5A 2VLRD 5HI4C 3LEVH 2C4FT 3T2PA 3GIZH 5INDB 1OLZA 4NO0A 5CZKA 1FVCB 1HXMB 3C9NA 3BZEA 4MXQD 5KVMC 5DD5H 4X7CC 1BREA 2X9XA 4IOSD 4HIIB 2XT1B 1ZXQA 4KC3B 1HOCB 1I3GL 5GZND 1JF6A 4DCQB 4U1KB 3ZDYE 1AD9B 4OGYH 4N0YH 4RISH 1SJXA 4IDJH 2NXZB 3O4LB 4DUWA 1I9JL 5EZLA 3VXSD 1U8JA 3RGVB 3OXSA 4S1SH 1OTTC 4X4XB 2IH1B 2Q86B 1T0MA 1WAAA 3V0VB 1AI1H 5MP6L 4NKOA 1HHKA 2P24B 4LSQL 1UH2A 2D0GA 5C0DA 4ZFFB 5HHXH 2F53E 2R1WA 4FFVC 4NPYA 3CSYB 4K23H 2PETA 1FYTE 1MRCH 1NEZB 3S5LA 1AO7A 4YAQA 1URLA 5DI8B 5CEZH 3D87B 1CGXA 5GGVY 2EDWA 2XKNA 1FGNH 4JAMB 4H1LA 1KNOB 3F7RA 4KRNA 4EJ1C 4K94L 3UTQA 3JVGA 3BE1L 3V4PH 2M1KA 4NBZB 3T0EB 4P4RB 3V6ZA 1MCOL 1NMAL 1UCBH 3S37L 3PWPA 1J8HE 1VFBB 3TVMD 1IRAY 3RZCA 1I1AA 1M1SA 3FB8B 2WQRA 3SDXF 5B8CA 1U3HD 3S88H 2C3VB 1T7VA 3SY0B 5I15L 25C8H 4PGEA 2AV1A 1F02I 4GMSH 4M9OA 2XN9A 3FRPG 3HMXL 1TVBB 4IRZL 4UMGA 5LQBL 4NQXB 4GW5B 2E7LA 4I5BA 1VKXA 5F3HB 4ZNEA 4POUB 2DQHL 2B2XL 2DQUH 4R26H 4MS8D 5IUSA 5GXBB 5EUOE 5FO7B 4QGTA 5E5UB 5I1AB 5DT1H 4AY0A 3PABA 2X40A 3L5IA 3O6KH 3ISWA 3IJSB 1ZHLA 3IF1A 4HMDA 5I1HH 1JYNA 3GSRB 5CINL 4J12A 4MA7H 1IZJA 2VISA 1MH5B 3RAJH 5L8JB 4K7PY 4KKAD 2W60B 1A9BB 4KU1A 4OT1H 4HFWB 4FQXD 4FTVA 5EBMA 3MRKA 3AS1A 3BRDA 3GKWL 4ONGL 3D2UD 4GW4B 4KPHL 3ARQA 5LCVL 1RZ8B 2NX5E 3F7QA 1HCVA 1RUAH 3QEHB 1D5MA 1MCDA 2P43B 2GY7B 4LVEA 4GG8A 3R8BB 1IAII 1X4ZA 4LEOB 4QRQA 4M7KL 4PJBE 4GG6E 2BNRA 3INUH 3VE0A 1MCLA 4CNIB 2V7HA 3B9EA 5BRZB 3O9WB 4MHHG 1CE1L 1EGJH 1JRHL 4PRHE 4AEIL 3VRJB 4DTGL 2HJFA 3R1GL 4QWWC 1WT5C 1U8QA 3KPTA 4Y2OA 1TFHA 3CVHA 5TJWK 1JNHB 3BSZH 3LAFA 1S9XA 4OIIH 2AEQL 3RL1B 4WO4B 3TYFB 5J3HC 3JVGC 3SJVD 4NKIL 3P3YA 1JNLL 1T21B 5FYJU 2XZQH 5B22A 4MNGE 3CDGB 4JHAH 1RUPH 4R4BA 4PPTA 1I7RA 3U46A 4QHUB 3RZCC 4JR9H 2UUDK 5IEHB 1I1AC 4L9DA 1JP5A 4NM8L 2QADB 4G6JH 5B8CC 3VMPA 3MGAA 4RSVA 2NCMA 1P7KA 1QSED 5DZOA 3EYOA 3SDYH 1YJDH 1N7ML 3GMQA 4ZFGL 4R96B 1HXYB 4LHUD 2FATH 4M43L 4MD4B 1ZLWK 5DLMH 1KCUL 1C16B 4X7SL 3FQRB 5TPWL 2DMKA 2RCSH 2BERA 2IGFH 4PLKD 4N0UA 1EAPB 4RAVA 1BBJB 1V7NL 3ZDZF 4HBCL 3C2AH 5E9DD 5HPOA 2FJHA 3OAZK 3HUJE 4X83A 3OG4B 3KYNA 4TPRL 3QUYC 3MZGB 4AQ1B 4H0IA 4X6CF 3BKJL 5DHXB 4I48B 5CJBA 1T0PB 4XMPH 3RQ3A 4ZFZA 3CFJA 4F57H 3C08L 5BQ7B 4LEXH 1NLBH 2WIMA 5FGBA 3VRLE 3VXQB 3LB6D 4I9WD 4BQ6A 1A7PL 1J9CT 1JV5A 2B4CC 4HLJA 4HWUA 1NUGA 4NCC2 1FPTL 3EYFA 5JOFB 3MNZB 2COQA 4ZTPH 3M8OL 3HAEB 3SDXB 1CGVA 3U48A 3HZMA 1MLCA 2V6HA 2Z8SA 3O6LH 1LEIA 1TVDA 1H5BA 3LH2H 3WD5L 1F58H 4GAGH 1FDLH 4XPHL 3UTSA 2RBLA 3ZKMD 4KH2A 3EZ8A 2X4QB 1DFBH 1MREL 3HCVA 2BVYA 1XF4A 3QZWA 4M8QA 3VFTB 2QR0B 4NQSA 1XH3B 3CH1A 3SKJL 3WDIA 3B3IB 1VACB 4O2CB 3TV3H 5EOTB 5KS9E 3ETBF 5HHVH 5L2KD 2O61A 3MV7E 2RHEA 4ERSH 3VJ6A 1FHGA 4R4NC 1NC4D 1B6DA 4QTIL 1PSKL 4NIKB 1KJ2L 3RBGA 4W68A 3GI8L 4JN1L 4YUEH 4OQTH 3T0VA 3GB7B 2ZNXA 1RJYA 5EBWB 4L8CB 1KTKE 3K74B 5KW9L 2OTWA 4NN7B 3Q6FA 3FAXA 1U2HA 2D9QB 1C5BL 4NZRL 4MAUL 4P2RB 4LCWD 1SVCP 1ZWIA 1I4FA 2D4FA 2Y1VA 3VFUB 5HHOE 3BRFA 2CK0L 4WCYH 4F7CB 4F33B 4X0KB 4M61B 4XBGB 5E7BA 1B90A 1EXUA 2QSCH 2BVPB 1HHJA 4U0QB 3LSOA 3OJVC 4XWGL 4U7KA 1A6WL 4ZPTB 1X6NA 4JM4H 4DFIA 1MCPL 2WM0A 3MV11 3THMH 1X44A 3FQNB 2LAGB 2YPLE 3BQUA 1FLRH 5FO8A 5DO2C 5KANG 1U3JA 2NXYB 4ODUB 4KUCF 3HA0A 3KDMB 4FXGB 1WAAE 5T3XD 2X70B 5IKCB 3MFFA 4D9QE 1I8IA 1ZHBB 3N0PB 1SJEB 1MCSA 4G7VH 4AEHL 1A6AB 3MRLB 5FGBC 3PUCA 1X5ZA 1A9EA 5CJXC 1G7MA 4Z95H 4FABH 3SPVA 1YC8A 5EG6C 3KS0H 1YMHB 1AO7E 2DJ4A 4NRZB 4NUGH 5GRVK 3MV9D 3V0AC 5J56B 3PWVA 2BP3A 2WLYA 3VXPA 3VCLB 3B9AA 3QUXB 3PIQA 4OLUL 2VLLA 2Z93A 1H5BC 1R3IL 4YHOL 5KVEL 4UOW1 3RHWK 3O8XA 4Q0XH 1VGKA 2YEZA 4EQ3A 1EEYB 1U8OA 3MA7B 4XNMA 5D7SL 3RY4A 3FN0H 2A6KA 2BDNH 4DW2H 2P44B 4ZUWB 4P9HH 1QRKA 4OZ4A 5IFHH 3ZL4H 4Q6YA 3I6LD 3WS6C 4P46D 2XN9E 1KENL 3QCTH 4N68A 3SDDB 1K4CB 3S7GA 1AGEA 4EKXA 5D96B 4A6YL 5C70A 3GMPB 4OGXH 4JGUA 2CSPA 4Z7QE 1KB9J 5IBTH 2X05A 1ZA3A 3AFLA 2GK0B 1RIHH 4MDIB 4PRAA 4CMMB 2YD1A 4ZS6C 3X12B 4X6CB 1LP9A 1NFDE 4O2EB 3BN3B 3DVGB 3IDJB 5J1AA 4LARH 1OGAD 2YMXL 5C0CB 4ZSOB 3DNKA 3O6MH 1FBIL 4WFGE 2DICA 3GNML 5DXWA 5IQ7H 5A2FA 1TCRB 5B3JE 2FX9L 3D39B 1FO0L 4JG1H 5I75B 2R29H 3O3DB 4FTVE 4HS3B 4KDTA 1JGLH 3KPRA 3DO7B 5MI0C 1HHIA 1CTNA 5FKPA 4JJ5A 3OJDA 4KJWD 1WEJL 1J86A 3K8MA 2YPKB 4OZIF 2AJVL 1FRGH 3BJ91 5DQDH 3MJ7A 3VGGA 1F4WH 4JLRB 1RZJH 1ROWA 3LN4A 4G6MH 5TGBA 1DVFB 3ILQC 1A7BA 4UV4H 1FNLA 5F7EL 1P4BH 5TE7H 3L1OL 1NFKA 5E5MA 4EI5B 4QXGH 3EJZD 3S36H 2YR3A 3GIVB 2RB8A 4JFFB 1K2DA 1CGWA 3RHWF 3STLA 4CVXA 1NAML 3I84A 1IFHH 3HHRB 1QFHA 5LXGL 4IOFD 4GAYA 1UA6L 1I1YB 4TVPE 4X99A 1S7QB 2H1PH 5C8JB 2QBWA 3TBWA 2EH8H 2FHBA 5E6YA 2CDFB 2NPLX 1RAMA 2FIKA 4RMVA 3O8XC 5SX4H 4G7YH 1M05A 1QFWH 2HT4C 3QO0A 4G8IA 4XX1E 1BVKA 3TZVC 1CDCA 3RUGE 4OUUA 2DQFA 2R0KH 1KB5H 2NXZD 2QKIB 3O4LD 1LHZA 5E8DL 5FHAL 5T1MB 4ALAL 3MOAL 1A6UH 2BJML 3ROLB 2B0SL 3GJEB 3RGVD 5KTEH 2CUIA 4ZAKB 1UWGH 4N90D 3MYJA 4HQQH 4RGOL 3GSUB 1IC7L 4ZYKB 4BQ9A 4WTWA 3TF7C 1WQVT 1A14H 4GMTH 1CD0A 3K8KA 1JTTA 4FQ1H 1UACH 3RWIB 1PLGL 2VH5H 4LASL 5IROC 3KWWA 3QUMB 4GUPA 2PXYB 4WHYG 4J8RB 4X8JA 3O11B 2VE6B 3T65A 5E8EB 4N0UE 3UYOD 2HFTA 5J0BA 4OIBA 5TDNA 1RZIB 3F7YA 3L3JA 4RMTA 5C0EB 4N5EC 4E0RB 1C7SA 5IQ9A 1JJUA 3EO1A 1Q9WB 2YXMA 2LE9A 4FFZL 1I75A 1OF2A 1SY6A 2X1XR 2YKLH 3T0ED 1J11A 1P5UA 1NCDH 2W91A 4NQVB 2OR7A 3GI9L 2D7QA 2F54E 3MRDA 3O0RL 3HB3C 2ZNWA 2QHLA 3DHMA 5F1SA 3U1SL 4FZ8H 3CFCH 4XBPB 5T3ZH 3QEQB 2CKBL 3BH8A 1ED3A 2EIDA 2Q8BH 4G80B 2FX7H 4ZDHB 3MRBA 3MLVL 4LMQI 2C3HA 2C4XA 1UXWB 1MFBL 3GSXB 4RIRA 2AXGB 3IS0X 4WI2A 1RSFA 5GRZA 1RZGB 2E9WA 1ORQB 1FC1A 4LRNL 3RVXC 1DTUA 2Y23A 2B1AH 1ZKAA 3KPOA 3OKKB 2VQ1B 1QLRA 3OB0K 3TO2A 1DZBA 4QOKA 3TJHD 4TRPL 1AXIB 3O45A 3UTSE 3D18A 2NYYD 5EUKB 3ZHDA 1RULL 2OMNA 4OD1L 1SQ2N 3MZTA 3K4AA 5EO9B 4IEFB 2AJYL 3G5ZA 1G7PA 1ZLVH 1E4KC 3O3EB 4PRNA 1E6OL 2DBLL 2AJUH 1WV7T 4P99A 3QFDB 5D93B 2XG4A 4LQ1A 5GRUH 3IDXH 3MXWH 1XCQB 5F7UA 1F00I 1F6FB 2J8OA 3H7BB 3VG0L 3TT1H 1X5HA 1AGBB 3W82A 5FF6B 4Z78B 1S8DB 3TWCL 5F1IB 1K8IB 4YHMH 1RJZB 4NRYA 1WCBA 2I07B 1ZHKA 4Z7NE 2IADA 1IEBB 5EIIA 2OX5A 4ONOA 3JTTB 2OSLB 3MBEA 3L3DA 4TOYH 4PJ9A 1L0YA 3LRHA 4OJFL 3MNVA 1QUNA 2A0LD 4M1DH 3ZLQC 4R90H 5GGUB 3MRJB 2FWOA 1LE5B 1BQHG 3T3MF 4TSBH 4HIHA 2FX8H 2C7UA 4TULL 1RJCA 4OZIB 4YBQD 2H9GA 5EU5A 1HHHB 2H6PA 5IW1A 5BOZG 3RJQB 5BRZD 3ARDB 3QJHA 1KIRB 3L9RA 5FO9B 2VR4A 3BJLA 4XPFL 1MF2L 2H32H 1MWAB 4NKMB 1J10A 4DWHA 2DL9A 3BGMB 4JRYE 4A6YB 1JZ5A 4IHOB 3PDOA 5TQ2H 4WO4D 3L5XL 4WW1B 3TFKD 3MR9A 5ESAA 2OZ4H 3KXFE 4NM4H 4JZJB 3F7VB 4YC2C 2HG5A 4RWHA 3ZTNL 5EB9A 4GJTB 1WITA 1YN6B 4LLUB 5HHPA 4MWFB 2VDRH 3D3VA 3V5KB 4DKFL 4GG6B 1CVRA 1A0QL 2EDRA 1HIML 4XP5L 4ELKA 4Z8FL 1JRHI 1MCHA 2QADD 4AYFA 2WWMC 4BH7A 4PRHB 3KR3L 1UG9A 5IWLA 2PYFB 5JZ7C 3TT3H 4J3XA 3HRZB 1T3FA 4P4KC 2XA8L 2EYSB 1NCNA 1HH6B 2ZOKB 1BOGA 4MJ6A 3DX8B 3AAZA 3MRRB 1QNZH 3OXRB 4MNGB 3U6RB 3P0YL 5T5FL 4P23B 3QQ3A 4ODBD 2NY4B 3OGCB 5I66A 3I3BA 5IIEA 3OKEA 3JV5A 1VFMA 3B8SA 2CQVA 3G6AA 1MRDH 4YIQB 1OD9A 4G8GB 3ARFB 4K55A 1BECA 1IBGH 4HDIA 1PY9A 4QHMB 1EVTC 2AJXH 5EORH 4Y5VC 4X98B 1MOEA 3HTLX 4AIZB 1ZT1A 2X4PA 4PJ8C 4Y16A 3GHEH 3N1GC 3PNWA 5ISZA 3P4OA 4FA8A 3E6HB 4J7RA 3FONA 4LAQL 2OCFD 2YRPA 5E8PA 1WC7A 4RMRA 3LRSB 2B4CL 5GS1C 2Z91B 4ISVB 1QYGL 5DSCA 2GITB 2WZPD 2OQJB 5MEOA 4Q9QL 1LP9E 2C3XA 1JMZA 4PJ9C 2VKXA 1X9QA 3HUJB 1YMMB 4PJIA 4X9HA 4CU7A 3NH7H 4WRLA 5EBLA 2FD6H 5DJCA 4QNPF 4GAJH 5IT2L 2A9NH 2ADIA 4YHIB 5F7YC 3O6FA 5L7XL 2I60H 3MLUL 1YYLH 2Q7YB 4LPWA 5C71A 1B4JL 1T5XB 1U8IA 3CVHL 1G0XA 2LU7A 2ZUQC 4I4WA 2IG2H 3D9AH 3HZKA 2FJFB 3KPRE 1FG2A 4TVPL 4NO3A 2BNQA 1GH7A 5IB1B 4J3VA 3Q2CA 4P3CH 4OTXH 1YEDA 3SDCA 5DS8A 4PJDF 4MLIA 3RVUD 4PP2A 2X7LB 2CKNA 1OAXL 3CXHK 4PJAA 1JZ4A 4JDVA 4XHJC 5KVDL 2D31B 4ZUSB 3TBSA 4HBQA 4M93C 3BVNA 5IB3B 4WI3A 1TETL 3U83A 3WKNA 5ID0B 5E2TL 2YWYA 1T4KB 5IM7B 3QEGL 5IWLC 1J1XL 3HNVL 5DQ9B 4RA3A 2GEEA 1BFVL 3IJYB 4PGDB 1AQKL 3FT3A 1U95A 2BRQA 2V2WB 4X4YA 1PG7X 1KIQB 3GBML 1QBAA 4K7PX 1KJMB 4OM0L 4P2RD 4UUJA 1EHLL 4JE4B 3ECBA 4XPAH 3ARGC 1AGCA 4H26A 4QLRA 4UIMB 3P9MB 3BP6A 3HNTL 5DVMA 5GGSA 5CCKH 3B8YA 1XIWA 5IW6B 2C3WA 4IOIA 2IPUG 1ADQA 4OD2A 4PREA 4DVRH 5DHVA 5IR1B 1Z0MA 3D69A 2OMBA 5EU3A 1IL1B 3ES6A 4KUZH 2CRMA 2NW3A 5DMKA 2VDQH 4W81A 3NABH 2NXYD 3RNQB 4UU9B 4OB5L 3V6BR 3MOQA 3ARBB 2IH3B 3QXWA 5D1ZC 5HHOB 1PDKA 3OKOB 1FIEA 2XWJA 3GMMB 4LLMB 4WEBL 4M6NL 1ONQA 3O2WH 1X5JA 4Z7OE 3H3PL 2MCPH 2YBRB 3CNKA 1HYRC 2Q6WB 1Z6JT 1T04A 1JWUB 4NZJA 1XF1A 1JZ8A 4UTBL 5HYQA 2YD4A 3EDDA 2YPLB 2DKSA 2HT2C 1XR8B 2WIIB 3U0WH 3QUXD 4R7DB 2MOVA 2R2BA 3MLXH 4XCNA 4PTTA 3EOAA 4NKOB 1FGVH 3P9WB 4Q97A 3X13B 4EEEA 1KXVC 3W11C 1MHHA 2EYTA 5ADOL 1MPAL 1HWHB 3MTRA 5E6IC 3UYPA 1S7TA 3S6CA 3K0WA 4K3GA 3JV6A 2I26N 3SDCC 1OVZA 3V9FA 4CN4A 4DKDC 3CGTA 1AO7B 2AEPH 1RZFH 2BCKB 2GJ6B 1LO2H 1WTGT 3VFGH 3U4BL 5ICXA 3REVA 1XZ0A 2IBZY 4WWKB 3ZYJA 5EOCL 3SDDD 3JWNC 3DHJA 4EOWL 5I1DA 4AIXA 4CL7A 5IJVA 3DXAE 2BC4B 2YPVH 3ULSA 5F7HA 2UY6A 1ZVYA 3QUZC 4XBEH 4BZ1L 1BEYH 5JQHC 2BXZA 2GAZA 4X7EC 1MJUL 1JYVA 5ILTH 4YDJA 3G08A 3HC0B 4PJGE 4RFOL 4J6RL 9CGTA 4G8EA 4NRXB 1I85A 5CSGA 1D3CA 5GRYA 4U05A 3GBNH 5C0CD 1NL0H 3L6FA 35C8L 2CMRH 2Y36H 5HGAA 4F7MA 1QQDB 3P0VH 4PJHA 4Z7VF 3P4MB 3D39D 1UM6H 1J88A 3QA3A 4LFHG 4EUPG 4MCZA 1U8PB 2HRLA 1AR1C 1WSST 1XIWC 5IESL 1DANU 4MNQA 1WWWX 1CFBA 3WFHA 3LKRB 2JK5B 4LPCA 1NFDB 1WVZA 2ICWI 3N1QC 43C9A 1N3NB 1SBSL 2XQYG 3RU8H 2V17H 4E41B 4IRJA 1YEHL 3KYKL 2P5EA 1JNNL 1DVFD 3QUYB 4XCCL 4NQEA 3H9HB 5DMGD 1O5DT 1MI5A 4JFDA 3EYVB 4OGZA 5HGBA 4J4PD 4PJDB 4EI5D 1H8NA 1FNEA 1T2XA 5HSFA 4MD5A 4TSCH 5ENWA 4TVSa 1KLFA 3NIDE 3ROOB 3RVTC 3LQZB 3VFPB 1H8SA 4JFFD 1MHCA 3D48R 5E2UH 1OP5K 1PG7W 4G9DA 5DHYB 2BMKB 2ZKHH 3WE6A 4GG8B 4QGYA 1ZGLA 3K2UL 1I9IH 1P5VA 3VXUA 4F3FA 1LE9A 1X5AA 1FFPA 4QRRB 4YEEA 1T2QH 5E2VH 5FDWB 4OZGA 3D3VE 2DQEL 4QHLA 3UP1A 3C6SB 1BGXL 1W8NA 3UTTA 1KEML 4WU7A 5D72L 2EXWC 1IQDB 5CFHA 4HK3N 3IB4A 5JIHA 3OV6A 4OZFH 3PDGA 4MJ5B 3MLRH 4JFYB 3JV0A 2J4WL 4ZAKD 3IXTA 2BY3A 5FV2A 4O00A 1EZVY 4R0LA 1R5IB 5MEQB 1KGCE 3VGAB 4EN3B 2OM5A 5J8OA 4NC1C 3W9DB 2PXYD 3K1KC 3RUGB 3X3GH 2UWEF 1YEFL 4P5KA 1CDBA 3L7FA 4K3DH 1JHTB 4XAKE 4LF3A 3QDMA 2EEAA 5DEGB 4QYOB 3FFCA 4OD3H 2EDQA 1V3LA 4OLVH 2HTKD 4KJQD 3T08A 3GMQB 4BH8B 5C7XH 1UT9A 1HK6A 2CLVB 3JTSA 3ZTJH 2BVTA 4PJXF 4PR5A 2R8SL 5K9OB 2MHAA 5ISZE 4HIJA 1UZ8A 5JW4N 5HYJB 1Q1JH 1A5FH 4CKVX 1NBQA 1SM3L 4E5XA 4N8VG 4NOFA 3V95A 1KF9B 3BISA 2ZUWA 4XI5D 4DGIL 4QTHA 4F7EB 3AXLA 3EHBC 4QXUL 3QEQD 3QCVL 3HNSH 4GRLA 1FORL 3ZHLA 4LP4A 4WUKL 4IRJC 2K9UA 2MFNA 4PJIE 4Y4HA 5GHWH 4UDTB 2R2HA 3FKUS