3PQYB

Crystal structure of 6218 tcr in complex with the h2db-pa224
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
QKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Structural basis for enabling T-cell receptor diversity within biased virus-specific CD8+ T-cell responses
pubmed doi rcsb
source organism Mus musculus
total genus 11
structure length 98
sequence length 98
chains with identical sequence G, L, Q
ec nomenclature
pdb deposition date 2010-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pqyB00
2G9HA 3U82B 5I73C 1LGVA 1EUUA 1VACB 2HH0L 5C3LD 2X7LA 2IPUK 4OGAC 1S78D 2VDML 1VEPA 2H8PB 4OZ4B 3WL9B 1JIBA 2IADA 3PGCB 3CZFA 2A6JA 5IB2B 3BZEA 4Y16A 1RURH 5C8JB 4KHXL 4R4ND 4U1HB 5D8JL 4P2QB 3T0AA 1T0NA 3BP7B 1JHKH 3CFCH 4I18A 3QRGL 5E95B 3BKYH 5IMOA 1G9NC 1TJHH 3VRJA 5FUCE 4ZFOB 1ZVSA 1I9RH 1JNHA 4H0IA 3D69B 3L6FB 1C16B 3CVHA 3KPSD 3GSWA 3LQAL 1C7TA 3SDCA 5FYJD 1S9WA 2J2ZA 1I7UB 4P4RB 1QEWA 4WI9A 5T33L 1SMAA 5J56B 3SGJC 3GMRB 3EDKA 1CZ8H 2YBRA 3UEZA 3C6LB 4WV1B 4HXBH 4X4ME 5A2LH 1A4KA 3NZHH 2FZ3B 3UJTL 3QIBD 1CFTA 3AREA 4HJ0D 3HE7B 2XWTA 1MUJB 3O6FC 2ZCHH 4PRAA 5CEXA 3I6LE 1T1WB 5FM8A 3FT2B 4RZCB 1EVUA 5D7LE 1A1MB 5A2JH 3SQOL 1W72A 5IW1A 4JANB 3SE3A 4KUCF 3GSRB 5C08D 1NBZB 3JWOC 4P2RD 2DBLL 5E56A 4Q9CA 3BZ4A 5HHOD 3BVNB 2RFXA 1WQVT 4M4RA 5KTEL 4XBEL 5HI4C 3QA3B 4RAUA 2R0ZH 4G9FB 2VZTA 3IETB 5HHMB 4G42A 3A6BH 3NIGE 5IFAH 5D5ME 1ZWIB 2EICA 3CVIL 3HG1B 2X1WL 4EI6B 4O51B 3BESR 5I75B 5GGVL 4Y4FD 5C0EB 4MD4A 1A9EA 5AYUL 1GGIH 1PSKH 3ARWA 5LQBL 2HLAA 2V7HA 4JFXB 1AHWB 3F5WA 3LHPL 4CN4A 3FTGA 1R24B 2VLMD 5E8DL 4JM2D 1YEDB 3MREB 1G7MB 1QSFE 3WN5C 3GHBL 4W6WB 1W0WA 4ZUUA 5EBGA 3MXVL 3TV3L 4DGVH 3S8WA 5SWSE 2NY6D 5KS9A 3FQXB 5DEFA 1AJ7L 2JELL 3ARGC 1FFOB 5CSBA 5D7JD 4FZ8L 3IDMA 1U8HB 2D2OA 1ZSDA 5I8CB 3IDGB 2ADGA 2VDRL 4WIQA 3FN3A 3OKMA 4K3JL 1PBYA 5F1IA 2AJ3B 5EBLB 1M1SA 1V7MH 3LKRB 4KROB 4L1DA 4MVBD 3VFPA 1KJ2B 4K3EL 4M1DH 4NHCH 4NIKB 4LCIL 3GUTA 4X4YA 2WWKO 5IIEB 1G1YA 3IAQA 4PJCE 3QXVA 3GBML 4S10A 1KT2B 3MNZA 4O4YH 4JZNB 1E0OB 4AL8H 1M71A 1S9KC 4HFWA 4ZO7A 1AI1H 5EU3A 4YQXL 1I3VA 2X4QA 3QEHB 3HAEA 3IJSB 1XF3B 2XFXA 3JV6A 1UYWL 3MV9D 3G6AA 3ZHDA 1CFVH 2Z8RA 4N90D 3DSFL 4LLYB 4JM4H 3UTSD 4ODWB 2YWYA 5IEKA 4TQEH 4PUBL 3WIIH 2FHFA 4WEUD 3KGRA 4M1GH 1OT2A 3TT1L 3GSUA 4N8VB 1F3JB 4YDLC 1CIUA 5BJTA 1X5IA 3WCYA 2AXGB 5E08L 4OTXL 1JF1B 1VEOA 4OD1L 1KBGH 2FLBT 2KBGA 4MJIA 4PJHF 2AJXH 1MVUA 4YZFE 4CRPA 5C0IA 5GRXG 3L3DA 1LO3L 5MI0C 4ENED 1DBML 2MCG1 3ETBF 2EIZA 4KK5C 2QSVA 1KCUH 5DRNB 4AY0A 4JN2A 1OGTA 4CDHA 1RVFL 3LPFA 2PR4H 1F90H 2HT2C 2VWEC 4U6YA 3VXRE 4QY8A 4XPGH 3IYLW 5AWNL 4JO2H 4YAQA 4XMKL 1D6VL 4LMQE 5CJ5A 1SBSH 1CT8B 5F7NC 4NN6C 3PABA 4NSKB 3BP5A 1IBGL 4RBPK 5L0QC 4H26A 2Y7QA 1YUHA 1XGTA 2VB5A 3HZKB 5EULV 1AXIB 3KPNA 3QB7C 3DTXB 3B9EA 4YEEA 2R2EB 1W0VA 1AIFA 1MJUH 2XTJE 4AM0B 3OXSB 1N4XH 2KDGA 3D0VB 2G60L 5CJOH 3U9PH 3KXFD 3G6DL 4NKIH 3VFUB 4MZ2A 1N5AB 1JE6A 4N0YL 4UDTB 4OCXL 2G5BB 2DM4A 3BAEL 4WFGE 2ADIA 3KPQA 3U7WL 3LKPB 3SDDC 1FGNH 3GHEH 2SEBA 4NQEB 5E8EA 1GZQB 1LDPH 4XRCB 2YD6A 5HYEA 1LE5A 1INEL 1BD2B 4XVUC 3QQ4B 3IU3B 5CBEA 1A6VL 2DQFA 3FHQA 2R29H 3QPXH 2PKDA 2GJ6B 4ZQKB 3PWPD 4W6XB 4ZUSB 1JGVL 5LXGH 5KANI 1E4XH 1L0YA 1E4WH 4GJTB 4S1QH 4X7SL 5IM7B 1TZGL 4LEXL 4MXQD 4M5ZL 3C5SA 1JPGB 4ZYKB 4UOJA 3WJJA 5A2FA 1FL6B 3BH8B 4XP1H 3O6FB 4JFZH 5A2IH 2PUQT 4G9DA 4U1NB 3B83A 2EDFA 3T2NL 5L2KE 3NCJH 3V5KA 4XNQA 1P4LA 4F9PA 4QOKD 4X8JB 2AABH 2Z93B 1EH9A 4LRNH 3N1PC 3NVQA 4XTRC 3ECBA 3KLAA 5DD5L 2EDJA 2MHAB 1AP2A 4PV8A 4YHNB 4H88H 1OT1A 4M3KB 1F4YH 5GRVL 5H2BB 3TBVB 3IGAB 3PDGA 5EU6B 5I8OH 3RVTD 5IWLA 4YXLH 3N1GC 4J23A 2R0KL 3NMEA 5D1XD 3SO3C 5IVXF 4QRPE 1X5FA 3CDCA 2I5YL 2X9YA 2P5EB 1V7NL 5F1NB 4R9HA 5DVOA 3MUZ1 4KV5F 4UV4L 4LRIC 4OCSH 4NC1C 5HHPB 3ZDZE 3DHMA 5KVEH 3TBWA 3UJJH 3OXRB 5HDLA 3ZDYE 3TWCH 3K74B 1HILA 2VXSL 1KB5H 3MOBL 2V17L 5E99H 4LU5L 4GUPB 3D6GA 3QUMH 3UX9B 4NNYA 3Q3GB 5AEAA 3TO4A 3VE0A 1H8SA 1TZHA 4OT1L 3TA3A 4Z7QE 4KDVA 5JPNA 5D2NC 3TPUA 5CMAB 1Q1JH 3O6LL 4F9LC 3QEGL 2X70B 4HBCL 3T77B 4PJHA 5D1ZC 5JQHC 3E2HB 3BD5A 4MD0B 1QFWH 3FB5A 4AMKL 4YR6B 1HHGA 3EO0A 4KKAC 1MFDL 5ANMA 1RIVL 3OKYA 5DD3L 3IVKA 4EN3D 1KLFA 2Y72A 4MS8C 1NDGB 5ABDE 5GZNC 1F3DH 5ERWB 5FUZL 4JFYB 2OP4H 4LNRB 5IP4A 3GMLB 4K8RH 4CVZA 1KF9B 4U1GB 4PTTB 4PJ8D 2FBJH 1JGLL 3G6JE 4UNVA 4NJ9H 3MV7B 5JXEC 1RUPH 1HOCA 2BVQB 3K4ZA 4QNPF 3Q1SL 4BZ1H 4NT6B 4QF1A 4Q6IA 4OZIF 3U0TA 5DHVH 4D0CB 3V0VB 3SCMC 1MCLA 4P23A 4MA7L 1MLCB 3LY6A 2BNRA 4MDIA 4XMPH 1XZ0B 4NYLA 5J8OA 3PWUA 2ADFL 4Q2ZA 2CQVA 2YPKA 2ZSVA 5JIIA 1XGYH 1XGUB 3QDMA 1RJCA 2EDKA 3O4LB 2ARJB 1H3XA 2GFBA 4JAMB 4PJXF 1LK3L 4HKJB 1N6VA 4YUEL 1NDMA 3VD5A 2J4WL 4JN1H 1UH4A 3QPQC 3VD3A 1NMCC 3JV4B 4LGPB 3OL2A 4D9RD 5IBLD 4L4VD 1ES0A 1WWWX 3SKOB 1VSCA 3VFSA 1XEDA 4YDJA 3O11B 4P5TA 4TUOA 1FZKB 3S5LG 1VPOH 4PRPB 2X09A 1FO0A 3GK8L 1GGCL 1RI8A 4FFYL 1FL5A 4NKDB 3WEXA 1MLBA 5JORB 1CBVL 1RJYB 2WBKA 3UTQA 2NX5A 3SKUD 1JRHI 1I1YA 5DQDH 5IB3A 4G5ZH 4NN6B 3PHQA 3D2UD 2FGZA 2YC1B 3TNMB 3X3GL 2DQDH 2JCCB 5DSCB 5L0QB 4WFFD 2IAMA 4QHUA 2LV4A 4KKCC 4PGCA 3MXWH 3DROB 3HI1A 1R3LA 3FFDA 3WFDH 3K46A 3T3PE 2FD6H 4LOUD 3SPVB 2V2TA 3ULUL 2HN7B 3CDYA 2AS5M 3WLBA 3IFNL 2WBJD 4ZFGL 2K1MA 4MNQE 3ARQA 1A2YB 4HIHB 3C08H 4K07A 4XZUA 3PP3H 1MHHA 3TH4T 1OLLA 4J12A 1MAJA 5FM5O 2ITCB 2IMNA 5IUSA 1BQHA 3GIZH 5ALBH 1EX0A 3KAAA 5ISZD 5DWUH 3U36B 4N9OB 2CRMA 2O26U 2DQEH 3F8UB 2DTML 5IVXA 4U33A 5MERB 4MAYB 4XCNB 2NY5C 3NCFB 3FB8A 4YO0A 2FSEB 2HAZA 1C5BL 4AH2A 4AENB 2XRAH 5IB5A 2FL5B 2NW2B 3DRQB 3ZKQD 1T21B 1IM9B 1K2DB 3V6OA 1UEYA 1RK0A 4C59B 3HC3L 3S4SA 4DEPB 4JHAL 4V1DB 4Z7VE 2Q7YA 2RB8A 1B3JA 5AZ2H 3VA2C 1SEQL 1F8TH 4U1SA 4Z95L 4JO1H 4PJ7F 1F4WL 1CLZL 1T66C 4Q9BA 4EVNB 4XPFL 2AXFB 5F3HB 2HJLB 2R4RL 4PS4L 4R0LA 3I3DA 3MGAA 3P30H 3OQ3B 2F53B 3EOTH 4ZS6C 3R06A 2CJUL 3QFJE 2XOTA 4YBHA 5C0JB 5T1MB 1MEXL 4H1LB 5HPOA 2WK2A 3PL6D 5EO9B 2AK4D 1NLBH 4M7KH 3EOBA 3C2AH 4L1HA 2O5ZL 5BRZE 1T22A 3S3PA 5IF0A 4GKNB 1A8JH 4LAQH 4E0RA 4OZIA 4GG6B 4MHHG 1LEGA 4MYWB 4G7VL 3O8XC 1YY8B 4LLMA 5DUPL 1JP5A 1BEYL 2OQJB 1QPXA 3HMXH 1KPVA 1SYVA 3C9NA 1ZLSH 4XNZB 3SHSA 1NAML 1G6RH 3DETD 3FONA 3H6JA 4XPBH 4UDUB 1EEZB 4M03A 5F7EL 4PRHA 1J5OL 3TIDB 4PJXA 5FK9B 3MRLA 3MBED 2PW1B 3D39B 5J1AA 5DRZA 1OAQL 3E8UH 5EZLB 1PZUB 1YJDL 5D1ZB 1EPFA 5C0GA 2EKJA 2G2RB 1G7JB 5JMOC 5E03A 4OFDA 4ZUWA 5EIIB 3BD4A 4LPCA 4F2MB 4GKSB 2OI9B 1MCPL 4NO0B 2ESVB 5I17B 4PP1C 4FQXB 3PWNA 3IXTA 1T89A 1DE4A 4KHTH 3SKNB 4TYUA 5JHDD 1ITBB 2XZCL 1RZGA 3INUL 4NCC2 5JLZA 1BZ9B 4PBXA 3WFEH 4O5LH 2R69H 4TRPL 3MJ8B 3HPJB 4WO4D 4P5TD 3QH3A 2ZNWA 3BYTA 3KPMA 1DZBA 1CN4A 1NCAL 2WLYA 4HUXA 1FN4A 1FVCA 1F42A 4FQQB 1F2QA 3ZKMD 3GIVB 4FQ1L 2NX5D 2QADB 4ZPVB 4DUVA 4UTAL 3HC4H 4CVUA 3MRHB 4WW1A 5KSBE 5LJYH 3IJHA 4AEHH 2VLJE 4TVPL 4Y1AB 4MXVF 4N0RA 5FHBL 2FX7H 5ID0A 4J3VA 1J18A 2CKBB 2BSED 2P45B 5E2VH 1IAIM 2JK5A 5B39B 2DMCA 3T3MF 2PYFB 3FO9A 4NZJA 1OF2B 1NMCB 3QFDA 1AD0B 5I1GH 2D03L 4UINL 3W82A 5K9OB 4P9ML 3WNPA 2PF6A 3TFKC 2Z31D 1DANT 4HGWA 1PEZA 2HKFH 4QHLA 3NA9H 2FATH 1MI5A 2YUVA 4HWBH 4MCZA 1WT5A 2NXYD 2C3WA 2EYSB 3FMGH 4U2ZA 4WFEE 1XGQA 1G6VK 3BUYB 3CDFA 2QQLL 1OTTD 4BZYA 4P99A 4PJBF 2W9DL 5C07A 3MR9A 5IJKA 1WJ3A 4UB0L 4OZGF 2P42B 1FG2A 3CXHK 5FF6A 5D9SB 3IXAA 3NFNA 4CADB 4DKEH 4Y5VC 4Y4FB 4B7LA 3HC0B 5D7SH 4PJ7A 4XHJD 2OZ4A 3FOLB 5HHXL 5EZJA 4TSAL 4DZBA 1G0YR 3CX2A 3H0TA 4EUPH 3E6HB 3GMNA 3STZA 5GS1B 1HSAA 5IOPB 2FJHA 5B4MD 3W0WD 5FDYA 5HYJE 5HY9B 1CICC 1IEAB 3DGCR 2IANE 3G08B 4FMFA 5D7JB 1EXUB 1KACB 1ZT1B 2Y6SC 4XCFH 4F8TA 3OKEB 4S2SA 5TE7H 1SY6A 5EO1A 3FO1A 5FYJE 5KSAA 1INDH 5FUCC 2D7QA 1I1AB 3BWAB 1WBZA 1GPOH 2RAMA 5DK3A 1KV3A 1RULL 3HI5H 1OTUD 4EUPG 5CUSL 4AG4H 3V2AR 2VDNL 1DUZA 2W9LA 4JRXE 4MA8L 3OKNA 1KC5L 4WTXA 3T0EE 1MWAB 3WSQH 3D3VB 5D71L 3P9LB 1ZTXL 1D5ZA 4ODVH 4ZTOH 5E9DA 4BUHA 4L8BA 4JY4A 3VH8B 1NJ9A 2D7TL 1KIPB 1NKOA 1KEML 1CE6A 4HS3B 4NZRL 3WKML 3DMMA 1J88A 1IGIL 2LAAA 2BVOA 3EYFB 2OLDA 4NKMA 3AGVA 4JPWL 5DI8B 4A6YH 2AVGA 1JHLL 3SGDI 4R4BB 2CMRH 5MHSE 3MV11 4DN4H 1A21A 4RAVA 1AFVL 1UENA 2HVJB 2BVYA 5ESAB 3UTSB 3QWRA 1FYTD 3ET9F 3LS4H 1U8IA 5FDWB 3RAJH 3DXAB 2B8OT 1KUMA 4ZFFA 3TT3H 2Q6WB 3O6KH 3VXNA 1DVFA 5IK3B 5HHOE 3TCLB 4CMMB 3FQTB 5DC0A 3D25B 4IS6B 1T1YB 1CLYH 3EBAA 4O58L 4WJ5A 4JY6B 1JWSB 3REWB 1RV6X 2YD2A 5JQ6H 1FL3A 1FZOB 1HHJA 3PDDA 5LKNA 3MFFB 2GQHA 5IT2L 4PRIB 1G9ML 1RJZB 5IJVB 1ZK9A 1NBYB 2J6EA 1JPFA 2C3VB 5FYKU 4H8WL 3QCUL 3CXHJ 5EBWB 3HI6H 3NTCL 1MELA 3MRRB 1HXYA 4HV8A 2VLME 3MGTB 5DR5H 3IAGC 1SEBA 3FFCD 1UM6L 3WDHA 2CLVB 2Y07H 4YFLF 3TO2B 2D3VA 6FABH 5T3ZE 5EOTA 5J6GA 5KZCB 4U1LA 3VFTA 4WY7H 4EXPX 4Z7WB 4Z77B 5JTWA 1D5BB 1F00I 1XIWD 1CD1B 2A1WL 2FB4L 2FJFA 4I0CC 1JYXA 5IVNA 5CKAA 2FYYB 3AY4C 5HI5C 1QR4A 4MAUH 3QDGB 4E9LA 4JFDB 1JMZA 3QIUA 1T1ZB 5GGSB 5CJ8A 3CLFH 4ETQA 1CL7L 1PX3A 3DX9A 5KJRH 3TBTA 4I5BA 3V6BR 2VZ1A 1EHAA 3OZ9L 2GY5A 4NUJA 1FNEA 1ZT7A 3VFMA 3V4PH 2NXZD 5J12C 1FC2D 3OR6B 2XY1A 4U1IA 2WWMD 3IRZA 1FPTH 4ODXA 5C0BB 2EYTA 5GJTH 3VGGA 3FRUB 3ARUA 2OTUA 2GTWB 4PJBA 1CGWA 3SY0A 4XBGB 4JKPL 4OZGA 4KZDH 3MCKB 4WU5A 4R8WH 5BS0E 5FYJL 2YPLA 4NQDD 3VJ6A 4LARH 2LABA 1B4RA 3UYPA 3BKCL 4KJPC 1ZGLA 4DK6A 1U36A 3P9WB 1UH2A 2Q8AH 4GOSA 3WS6C 1B0GB 5D2LF 2VLRA 5MEOB 5E1AB 1QBML 5D70H 1MJ7H 5E6ID 1DL7L 5L88H 4S11A 3ARBA 1HINH 5LGJB 3QNYA 3I02B 4ZUTB 1P1ZA 1R5VB 1EZVY 3MRKA 3MV8A 2WP3T 1YDPA 5IW6B 2VDKL 4M6ML 1IFHH 5D6CB 1FH5L 2WSKA 5DJ6A 3GRWL 3LMJL 4R4FH 4JZOB 3HS0A 2AAVA 4KUZL 3T1WA 3O6MH 3BMWA 1PKOA 3U4AA 1HQRA 2Q76B 1IC5H 4PJ5A 3MOQA 3W2DH 1MJJA 1KGCD 2VAAA 4G6JL 1P7KB 4WUUA 1A3LH 3LEVH 1B6UA 1QLRA 2OXGA 4XCEA 4DVRH 1IKNA 4GG8B 4EXKA 1R5WA 5F72S 1I9IH 4KMTL 4Y4HB 3QUYD 5ADOH 5IFJB 2R15A 5GGQH 3OKLB 3VA6A 5IGXL 2GJJA 1I9JL 2CO7B 1AC0A 1RZKL 4Z78B 5A3ID 3N50A 4PREB 4G80A 4L8CA 3A67H 1FGVH 2BNQD 3T65B 5CEZD 4QXUL 5DURB 1AGFA 5T3ZH 3KXFE 3LRSA 1PG7L 5BO1L 1XR8B 3MRQB 4JREB 1KN2H 1SYSA 4PLKC 4HUWB 3UBXA 1UXSA 1GGBH 2ITDB 5IMLB 4LASL 1ZKAA 1UCBH 1KPUA 4JG0H 1NMAL 1OY3B 3U1SH 1A5FL 3UDWC 1M7DB 4MNGA 1A7BA 5F9OH 1LK2A 3V6FA 3JSSA 3BEWA 4GS7C 5DVKA 3OPZL 4YE4L 4K8RC 2EDDA 2N4IA 1R3IL 1U8NB 3KS0H 5SX5K 3PGDB 3GJFA 1ACYL 5B38A 1MWAL 3PWPE 3KPOB 3HNVH 3PJSB 5IVZB 4EN3B 4WDIB 3RGVB 2ATKA 2VZUA 4ZXBD 2IQAB 4IDJH 4U7SA 5TJWK 3I6GB 3RWIB 2KUTA 3C6SB 4Q9QH 5I2IA 4JKLA 1VDGA 2H2PD 1JYNA 3LKQA 3WS3B 2ENYA 1OP9A 3LEXB 2L4OA 2I9LB 1AGDB 4HG4K 2J88H 3HNTL 3WYRA 1N7MH 2HJKB 3MYJA 3ZKXC 1K4CB 4OZHF 5H94A 2CRYA 2IC2A 5DJ2A 5E8OB 4I0KA 5KS9E 3KJ4C 3DVGA 1PDKA 3PWVB 2X89D 1ADQA 5D7LB 4MB5A 3AMKA 4UI2A 3OB8A 1VKXA 2N7AA 4Y8DC 4KKLD 1BJMA 5GRJH 1HSBA 4OKDA 3FQWA 2BERA 1J1OL 3ARFD 1J0JA 3C5ZA 3QAZC 3O4OB 4I48B 2AJYH 3P4MB 1QYGH 5ESVB 1DQLH 3T0WA 4OLWL 3KHOA 4MNHB 5LBSH 5D5MB 2NY7H 1JGUH 4L4VB 5EO0B 5JDSA 4XVSL 4DVBB 5HXMA 5E6ZA 5EBMA 1E4KC 4MDJB 4YXHH 1TCRB 3DRTB 3S35X 3CVHH 4IOIA 1URLA 1AXSA 3M17A 4WU7A 5KN5A 5T5NF 4FQJH 5D2LA 1J8HD 1UB6A 1JNNH 1DBAL 2D9QB 3MTRA 2YUZA 3GEWB 4PD4J 4L29A 5J13B 4RGND 3VI4F 2YZ1A 3LKSB 3DBXA 3C60D 1KG0B 1RZ7H 5J57B 3KWWB 5CZVL 1OW0C 5B21A 1JWUB 4YNYA 3TVMC 4CN1A 1TJHL 4LHUD 4PLNC 4LCWA 5DYOA 3RZWA 3RWFB 1I9RL 4IRJC 4F37F 4WWKC 1PY9A 3L1OL 1KTDB 2FX9L 2PTVA 1JHTB 4GQ9H 1S8DB 4JG1H 5KOMC 3KDMB 4E5XA 4PR5B 1U8PB 4GRLC 1W72H 4O2FA 5F6IB 1RZJL 3VXSA 1Z5LA 5ISZB 3MLWL 4S1SL 1CE1L 4ZODA 4DW2L 4JRYA 5ELIA 3NZHL 1RUKL 4FQIL 4FQHA 3EAKA 5JOFA 2Y5TA 5J9PB 4OF6A 1NCCH 3GMMB 2XACC 3RZCC 3SOBL 4BK4A 1NBVH 4NZUH 2CDEA 2PYED 3T0VA 4W6YB 2AKRB 3B2VL 1WTLA 3KNBB 4ODTH 1B2WH 1BFTA 4APQC 1VGKA 4KY1H 5BQ7B 5D7IF 1CDIA 3RWGA 5DFWH 4UT6L 1JNLL 4OLVH 5DJYB 4D9RE 2NY1C 1IAIL 4JB9L 4GRMA 3MRIB 1T20B 3ARDD 1WSST 4HJJH 4P5MA 4RMUA 1WWCA 2R0ZL 4HUKB 3A6BL 2GSGB 4Y2DD 3PGFH 2AI0L 3H3KA 3B8YA 3TPKA 5IFAL 4LSPH 4DKFL 4Y4KB 1WITA 15C8L 4GAYA 1A6UL 1KIQA 1HH9A 1UZ6F 4JFEA 4NM4H 5EC1A 3RNKA 2FCBA 4HX1B 1H15B 4IRZL 1TITA 1ZHLA 4KI5D 3WN5A 5BZWB 1U42A 4K3DH 4N0FA 4PJ9B 4X98B 1U8OA 4NHUA 4FFVC 1NGZA 1PY4A 4HAFA 2VZ3A 5C0AA 2AK4B 4I0PB 3ARGA 4RCAA 5TQ2H 1QSEA 1KB5B 5BVPL 3OAZK 3V6ZA 3SGKA 3QG7H 3QUMB 5BVJB 4L8SB 4OZHA 4X7FC 3VXQA 4MA3A 1OGAA 4NO3B 3HAEH 4FN0A 4JHBA 3BDBA 2EEDA 3DYMA 4EI5A 4QKXB 3LSOB 2EDWA 2XTJB 3OJDB 1MPAL 3IFLL 4CW1A 4NHCL 4KJWC 5DK2B 1QKZL 2P8LB 1Y6KR 4BZ2L 1NGWB 3FRPG 3MO1B 1ZEAH 3UROR 1S5HB 3HAEG 4HH9B 1FZMB 3GSQA 1MRCH 4ONFH 1U8JA 4Z0XA 4S0TD 3QNZB 2WWKT 4NKOA 3RWHA 4LF3B 2AJVH 2D31B 2EIEA 4OIIL 3AXLA 1U93A 2HKHH 2PO6A 5DZLA 3BI9X 1JGEA 1U8QB 1CFQB 4QYOA 3O3EB 4BQBA 3ARTA 3GFUA 2ZOLA 4RMTA 4YPJA 5E70A 4M1GL 5IB4B 1GAFL 3CK0H 3I9GL 5I6XC 4GLRI 3D85D 5BV7L 2VDOH 3MROB 3BPOB 2YRLA 4WO4B 4KFZC 1OSPH 1T4KB 3ZKXB 4C55A 4QRUB 3QI9A 4NWUH 3S5LB 3UYRL 2P24A 4NPYB 3F7QA 2GTZA 4PB9H 2DQIH 4J3UA 2P5WB 4PBWD 4X6BB 4G3YH 3HLAB 1HDMA 2EDEA 4X6CB 2AJXL 3CFEA 2F8OA 2R1WA 4PLOB 1A6PA 3PHOA 3QQ3B 1EAPB 4PJHE 2NMSA 4XVTH 4OLUH 5SWQB 2EH8H 5ETUA 2XNAB 5ANME 1QZ1A 3O9WA 3PXJA 3OTTA 4XPGL 4PRBB 4LLQB 4JO2L 4NBZB 5E00A 3QIWD 1WZ1L 2XZQL 3HCVA 3QHZL 2EXWC 4ISVA 4YHPA 4AIZA 3RVXC 4U1JA 4QRPB 4N0UA 2OSLA 3GMPA 1U8KB 1WAAE 3DURA 4K7PY 4JPKH 3H3PH 4YC2B 2NXYB 4NNPH 5DJDB 4KI1A 2R1YB 4XB7A 2ZJSH 4HC1L 1TQBB 2HG5B 1MJUL 5DGQA 1N4XL 1YNLH 3U9PL 4NKIL 3SE4A 3DVFA 2BNRE 1PX4A 4HFUL 5D7IA 2YMXL 5CS7A 1UVQA 4OQ1A 3RTQC 3SDDA 3OAYH 1SJHB 3IFPA 4FG6D 3QDME 5I8EA 4F57H 3JWDH 5L6YL 1BWMA 5CJQL 1WF5A 3D5OF 4Z9KB 1OM3H 4P2OD 1UJTA 4YXKH 5CGTA 4WWKB 2PW2A 1MFAL 2BSSB 4LSDA 2YD7A 5FHAH 2OJZH 4PRNA 4FQCL 4X80H 2R1XB 4X6DE 3M8OH 12E8L 4LPTA 3VWJC 1BFVH 4GRLB 4F58L 1YEKH 1P2CB 2F5AL 1WLHA 5MENA 3F7PC 1HIMH 4IIQC 4RISH 4YFLI 3UC0L 3VRIA 3RY4A 3WE6A 1NGXA 4LCCC 2DM3A 3G6JB 3MA7A 3B9KB 4ONHB 2YOCA 1QFUH 3DO7A 2NX5E 1D5IH 3VRLF 5L7XH 4ODSH 1OB1A 5IVOA 1BLNA 2BRQA 4JFZL 1UZ8A 5DRWB 1YMHA 1JPTH 4R7NA 3OGOE 3NCJL 3T2PA 2HWZH 5E2WL 1A4JA 2LU4A 1KCVH 5F97E 2H6PA 1LEKA 1TTGA 2VL5B 3DUUA 4OFPA 1CWVA 5GGRY 1INQA 1MH5A 5D6DC 3MRDB 1OAXH 4OSUH 3RWEA 1FC1A 1OOAA 1OGAD 4PJDF 1F4YL 2VXTH 3L3IB 3BW9A 4HW6A 3EZJB 5TPWH 5I8OL 3S88L 3L5XH 4S0SD 4P4KC 5D1QC 5DZNA 4YHYC 5CLWA 4M4PA 1RHHB 2ERJC 1A47A 4MQ7B 2UVEA 3ALXA 1RUMH 1S9YA 5EWIH 1EFXB 4MZ3A 3CNKA 5IVXE 3QCTH 3UZVB 3LV3A 2JB6B 4OCSL 3ROLB 1QRNA 4GBXC 4LPWA 3HMWH 3V0WH 1AR1C 1YA5A 4KRPD 4KV5E 1ONQA 1NC4A 1JFQH 1NGQL 4ZOEA 3TJHD 2HT3C 1G6RB 1XCTB 5D2NA 1GOFA 3QUML 3CFBA 2XG5A 3HZMB 3V6OE 4PJIF 4F9LA 3BE1H 2VLLA 1QO3B 3RX7A 1MQKL 3RWCA 3L3OA 1Q1JL 1CK0L 4U7MA 1YY9D 4LVHB 4LSRH 5GRVK 2QV2A 4ZAKD 5J06A 2KPNA 1GYAA 1RY7B 2KKQA 1NCNA 1KELH 4GRWF 4B0MM 1TENA 4MNQB 1A9BA 2M1KA 5LWYH 3WNNA 3MUJA 1CXIA 4M8QB 3QBTB 1AXTL 1NMBL 2GJZA 2OYPA 4D8PA 1H3UA 3B2UD 5JXEA 5HGBA 3ILPA 4HMDA 4L4TD 3PIQB 4R3SA 3MNWA 2FBJL 1JK8A 2VKXA 1V3JA 2PTUA 4TNWK 3C8DA 3RDTA 2NCMA 1UCTA 3SCMA 5BZDB 3QQ9D 4GW5B 1HHKA 4PY7B 5DA4A 5F96H 4QNPE 2P43B 1J0YA 1HWGB 3C8KA 4HS6A 2XWBA 2YZ8A 4OZIE 5CP7B 4R7DB 4U1KA 3QIBC 1KJMA 1G7QA 1MCSA 1KPRB 4HJ0C 5KG9A 1XGYL 5A40E 2XICA 3S97C 4LLWA 4RX4A 2MTPA 2EKSA 4RFEA 1H0DA 3CLEH 2VABA 1DUYA 1FAIL 3K2UL 1C5DA 3DNKA 1TTUA 2CLZB 4PRHE 2EE9A 3TZVD 3ROOA 1S7RB 4PJXE 4J3XA 43C9A 3HZVA 5F7UA 4ZPTB 2AJUH 1E27A 1I8LA 4TSCH 5EFIA 3V7MA 2J12B 5DMYA 1VA9A 2NY2B 3QDHA 4NQCA 3STLB 3KPRA 3QFJB 1VPOL 5C0DB 1CR9L 1MCNA 3I84A 4JQXA 2DL9A 1A6AA 3CXDL 4HUUA 3G5VA 1BPVA 5DO2D 5I76B 1JV5A 5DQDL 2JIXA 3VFWA 1U3HD 3L3JB 2DQDL 2OTPA 2E27H 3CH1B 4X5XA 1EAJA 4Y5XA 1N5YH 1PD6A 3MXWL 2QSTA 4KQ3H 3WFDL 4PJGE 3EDJA 1C7SA 3EW3B 3ZTNH 1MFBH 1S7TA 5TDPB 4CJ0A 2NY6C 4G6FB 1MCDA 2M8XA 3U30C 4OV5B 4AEIH 5I66B 4TNVF 3GM8A 4RIRB 1BQHG 4EUPB 4GMTH 4DGIH 2IBZY 3WLWD 3ARYA 5TQ0L 5K9KA 4G8EB 4U3XA 3BIBX 3C08L 4PJDA 2WLZA 5CKGA 1LEIA 4J2XA 1TQCB 5T1DL 2V9TA 1MCOH 1CFSA 2J8UF 1LO0L 1RU9H 2DAVA 4MVBC 4ZOBA 3DV6B 5INCB 2X4SB 4ALAL 1KCRH 2DQEL 5DJ0A 4NQSB 4P9HH 2K7PA 3IFOB 1N8ZA 3G04B 4I9WE 4R2GC 2AEWA 1YN7B 4MJ6A 3VFNA 2DLFL 1M05A 4YHZL 2IPUG 5IHLB 5E7FA 2VRAA 1RJLB 3S4SG 3VMPA 2V9RA 2HFTA 3BKML 3GB7A 3P4NA 1JPSL 1MI5E 4XNXH 5L2JA 1ETZB 2EDRA 1YQVL 3IU4H 5FKPA 1AGCB 3ZDXE 4KMQA 2ATPA 1YMMA 1VHPA 4NZDA 4JLRA 4PJIA 4LIQL 2ID5A 2AEIT 3P73A 5C07E 4Z7OF 3GBNH 1NFIA 5AZ2L 3UPRB 2VDLL 2B0SH 1U8LA 4A6YB 5DMKB 3VFRA 1NEZA 2M26A 3DUSA 3RA7H 4Q9RH 1YEJL 5E5MA 4WI7A 5A2KH 4PJ7E 1KJVA 2IG2L 1IGCH 2VLJB 2A0LD 1A7PH 2J1KA 3OGCA 3QEUA 3SKJL 2DF3A 3MOAL 5J0BA 4ZUVB 2ARWA 3WD5H 3D9AH 1OAYH 2E9BA 2ARJQ 4RFOH 5LGHH 2WINA 3OSKA 3GSNL 4EJ1C 3LIZL 2EXYD 3V5HB 3QP3A 3C2AL 4E42A 1I1RA 4I18C 1Q8MA 4JFHE 3O8XA 5FYKH 5JXAH 1HQ4A 2F9BT 4DQOH 3QG6B 2R0WH 5DD0H 4QCIA 1DBJL 3BIKB 1ZT4A 1U3ZA 3CSPA 2UWEF 3BX7C 1FFRA 1LDSA 2NPLX 4YK4B 3U4BL 4Z76B 1ZLSL 1TLKA 3IDJA 2BRRH 4G6AD 3SKMB 5TE4H 2Y06H 3AU1B 3CJJA 4HQQH 2W0KA 1EO8L 2NZIA 4P46B 2UVFA 3MLPA 2DWDB 2BNQE 3F7VA 2HFGL 3FAXA 1IC1A 2WQ8A 2A9MH 5E9DE 3VXTA 1OSZA 1NANI 4DCQB 3U46A 3QUZB 4LCYB 2APBA 1JUFB 2XPGB 3WIFA 5H35A 5F7MC 4LBEB 5KVDH 1K5NA 3AREC 4K71C 1YECH 4WW2F 1CDJA 4CL7A 4RNRA 3QDJB 2DQJH 3HRZA 1BVKB 4F3FB 3DGGA 1RZJC 1AKJA 5HYJB 3C60B 2IANB 1NGPL 3QCVH 2X4RB 5C0FA 5ICZA 1R3KB 2DDQL 3FT4A 2YD5A 1N0LA 1RZIB 3SE3C 4ODHL 4LP5A 5IB1A 2LU7A 3NIGF 4KK6D 4XAKD 3VW3L 1N6QH 3VMNA 2A83A 5CD3A 2FO4B 5DXWA 3WFEL 1AGEB 2AJZB 2YA0A 1AO7A 4Z6AT 3KPRD 4JRXB 1F58L 3EDDA 5E24E 3T0EB 4NRYA 1BVLB 4XP9H 1KXTB 1P4IH 1SBBA 1YN6B 4HWEL 2NNAB 5IW3A 4MXQC 2CPCA 1JGDB 1T2QL 1WFUA 5EC2B 3FCTA 3DI3B 1I3RA 4PIRF 3LPGA 2FX7L 2HYMA 1CGYA 2Z9TA 5DS8A 1U91A 4MXVE 4YJZL 4HIEA 2VUOA 3W5NA 4PJEE 5I71C 1OTSD 1JZ4A 3VXUA 1BBJB 1BQUA 2OJEA 2VISB 1MCKA 1ZV5A 2OZ4H 5I1GL 2ZUXA 1JN6A 3IF1B 3T3ME 2PYEB 2Q86B 1Q72L 3RX5A 4Q0XH 4HJGA 2Q7NA 3NA9L 1D9KA 3QJFB 1QFOA 4BKLA 4PJCF 4J7RA 1A7OL 3CZJA 5I1LB 1CGSH 1CF8H 3SO5A 3CGTA 1T3FA 3ARDB 4JR9L 4XP4H 1I7TB 4TOYL 1RPQA 3BRDA 1FNSH 4YBLC 5CILL 2JJSA 3CCHA 4Y2DB 1SY6H 5HJ3B 3W5MA 1FNAA 1ZAGA 3DWTA 3FQUA 3LZFH 4HWZB 4PJBE 2HMID 1Z9SA 3MLXL 3MYZA 5JIKA 1L7TL 1KN4L 2F19L 2XQYG 4G8IB 1OPGL 2Z92B 5BOPA 4PGBB 2YPLE 4RGNE 1EEQA 4RBPH 4OQTH 4QHNA 5GZOD 5KW9L 1BWWA 2WMPA 5EU5A 2VLRE 4U6XB 3T1FA 2LVCA 4RGMB 4QRRD 1D5XB 1UWEH 3NOIA 2R0LH 1MCFA 3P77B 2MWCA 5CEZL 1NCBL 5MEPB 5LGKA 4ZS7L 5ENWA 2XZAH 5TE7L 1I1CA 4FQ2H 3MV8E 2BSTB 5T1LA 4C56D 3BEVA 3CDGB 4M93C 5ITBH 1LE9A 5EOCJ 1F4AA 4MSWA 4R2GB 1LNUB 4AG4L 2ZCKH 4H5SA 4TNWF 2MQCA 5JW4N 1FSKC 2O5XH 4PJ8C 5HHQB 2UWEA 4PJ5E 3HZYB 1FCCA 4RDQF 5C7XH 5T1KB 1DFBH 4WUUE 3ZLQC 5BV7C 2UY6A 2ZSWB 4I3GA 4K7PL 4OCWH 1YEHH 3MNVA 4U0RB 3R8QA 5CIPA 5TGBA 3L3GA 2J6EH 2EYRA 3L5JA 2X4OA 1GIGH 2CMRL 4DN4L 1PLGL 5M94B 4HXAH 4WW2A 2C1PB 3LS4L 5FUOL 4XHQA 3RAJL 5FV1L 3QXDB 1I7ZA 3RY6A 3U2SB 3BXNA 1I8IB 2DLIA 4QRQB 3NIFF 2G9HB 3RFZC 4M43L 5AD0B 1UXWA 5FYKD 2X7LB 4KTEH 2R2HA 3JTTA 2PETA 2IADB 3S37X 2IEPA 4IHOA 2A6JB 5IBLC 3BZEB 3H7BA 4Y16B 4MNGE 1T0NB 1R3JA 1PFCA 2H8PA 5EPMA 3P9MA 5IMOB 2YD3A 3VRJB 3HI6L 1FIEA 4UBDD 4D9LH 1ZVSB 2HTLD 1OLZA 3K4DA 1JNHB 4TTDC 3CVHB 3GSWB 3SDCB 3K1KC 1BGXH 6FABL 3BP7A 1S9WB 5GSVB 4E41D 5SWSA 3AY4A 4TUKL 3RJDA 2APVA 3QIWB 1UJ3A 1G7HB 4KH2A 4WTWA 1QEWB 2XN9A 3RVWD 1U2CA 4L3ED 2D7NA 3CPLB 4LOUC 2YBRB 4BFEA 4K7FA 2V5SA 4TTGA 3ZHKA 3PNWA 4BM7A 1A4KB 2WBJC 2VLKD 4ZMAT 3Q48A 2KZ1B 1I7UA 4P4RA 1CFTB 1C5CL 5KJRL 5GISH 3WJJC 5ICYA 3GMOA 3JWDC 5C6TH 4B53A 2XWTB 3K2MC 4UIMA 4WNQB 5CEXB 4H25B 3V79C 3T2QA 5IKCA 1KLGA 4MWFA 4UILL 5J89A 3VI3F 2IFFH 2GK0A 1W72B 5I1JL 3HE7A 5IW1B 3GSOB 5I15L 4IRSD 2F54D 3BZ4B 2X10A 2E7CA 4FABL 2RFXB 4FFWC 3BGMA 4KTDL 3S96A 3ULUF 4RAUB 3WS6A 4G42B 4LARL 5GRUH 2Y36H 4KJQD 2C5DC 3ULSA 2OTWA 1KENH 2Q8AL 3CSBA 4G6MH 1ERNA 1U6AL 1Q0YH 1GGUA 2E7BA 1P9MC 3UJIL 4MD4B 3NGBC 2HLAB 2V7HB 2X41A 3BD3A 5D2LE 1WUNT 3F5WB 3L9RB 1P6AB 1Z9LA 1JNJA 1MQ8A 1YPZF 3L3HA 3MC0A 3VWKA 4X9IA 2W38A 4POZD 3X11B 4EI6A 3FQNA 4ZUUB 2Z35A 2GIYA 1IFHL 1REIA 5DC9B 3MRPA 5DEFB 3TA3C 5D72H 4R4FL 2E9IA 4OCLC 3O6ML 2ADGB 5EOQH 1EIBA 1IC5L 1RFDH 4HLJA 5ACZA 3VGAC 4BFIA 5I9QB 5F1IB 4LCWE 3FQXA 1FFOA 3RP1A 1LWRA 1WICA 1GVIA 3A6OA 1FDLL 3EYQD 5F44A 4GAJH 1MFNA 4M5YL 5GGUB 4X4YB 3VXSE 3QUXD 5EBLA 2NLJA 2OL3H 3UBXG 1BECA 4HK3J 4FP8H 4HFWB 5EU3B 1FORL 1T5WB 3DETC 4JRYE 2X4QB 4WUKH 3HAEB 2XFXB 1Q9WA 5ICXA 3G6AB 1EEUA 2XA3A 1X7QA 3MBEC 3UDWA 4JZNA 2P7TA 5AAMA 3L5HA 4D9QE 5IEKB 1UCBL 2W92A 1QBLH 2R9HD 3U1SL 5BW7A 4JHZA 3VG9C 1GOHA 4JVWA 3GSUB 3I2CH 5F9OL 2ZUWA 4XNMB 1XF3A 4Z0BH 2EO9A 5BJTB 3MMEB 5B38G 3RL2B 3WNKA 4OCYL 4ZAKB 1DLFH 4DAGH 3X13A 5I1EL 2YKLL 4EOWL 5JPMA 5GRYA 4MJIB 1F3JA 5C09D 1ADQH 3C09B 4M62L 3HNVL 3VXMA 3L3DB 4JDVB 2LE9A 3OAUL 1HI6A 1MAMH 2AXGA 3WDJA 2EIZB 2VDQH 4NP4H 1QSZA 1CD0A 4JN2B 1OGTB 1YEFH 4U49A 2J5LC 4P5TC 4Q9QL 3O2VH 2AK1H 3L3KA 4X4XA 4Y8AA 4U6YB 2DLTA 4QY8B 2IPKB 3BQUA 1TJIH 3RIAK 2J88L 1MFEL 1N7ML 3QXWA 4Q6YA 4P57A 5F9WC 5C0AE 5L2KA 1F6FB 1QSEE 4P2QD 3PABB 1QLEL 1Q38A 4O2CB 3B9VA 4JDTL 3BT2H 5L8LB 3IDYB 5IESH 1A1NA 2BVPA 2VNCA 4FZEH 2IAMC 4H26B 4ETYA 4OZHE 1YUHB 1XGTB 1H5BC 2YD4A 1OGAE 4IOFD 1WFNA 1Y18B 1CT8A 3ELAT 4X0KA 3V8OA 4M7LL 3D48R 2Z31C 2YPVH 4XXDA 1DQLL 3DTXA 1O7VA 2V2XA 4XNYL 2PXYA 2R2EA 4NO2A 5LBSL 4WHDA 1JGUL 3C6LD 9CGTA 2ADIB 3KPQB 5DRXB 1S5IL 3VFUA 1OTTC 2SEBB 4M48L 5E8EB 3HE6A 4OF8A 1Y0LA 2NY3C 4Y19A 4LQFL 4I8DA 4YDKL 4MD5B 1BZ7B 2XQBL 2C4FU 2QHRH 4JY5L 5EU4B 5CBEB 1V3MA 4XVJH 3BJ91 5TE6H 3CFDA 4FXGB 1KCSL 1YPZA 1F13A 1ZVYA 4JZJC 3HA0A 3V6OC 1QACA 4ONGL 3TVMA 3VI4E 3WFZA 4GXVH 2W59A 3IU3A 1RZFL 2CSPA 5JHLH 4IRJA 3C5SB 4XP6H 4EQ2A 2GJ6A 4G9FD 2Y1VA 1BIHA 4ZUSA 2FEDD 2B5IC 4OLYH 5IM7A 3HG1D 4XNQB 1P4LB 5AG9A 5FFLA 3JWOH 1JPGA 3BH8A 4R0LC 5CP3A 1OTUC 2D7PA 1JTTA 2VO5A 3KLAB 5CWSA 4U1NA 1EMTL 1N2RA 4NGHH 4MQSB 4PV8B 3HN3A 5FOBA 4GW1A 5SWZA 2Z93A 3H8NA 3WXWL 1I7RA 3VGDA 3QXTA 4WCYH 3RZCA 3CU1A 1A3RH 3MPCA 1NCCL 4N0UE 5EZOL 4YHNA 5H2BA 3TBVA 4ZSOA 4U1MA 1HHIB 1NBVL 4APQA 4NZUL 5T3XE 1JRHL 4PGZA 4KROD 1ZANH 3TBWB 4PJAF 4ZDHB 4NJAH 1MSPA 2FIRT 4HCRL 5D7KD 3HTLX 3UO1L 1HILB 4X6EA 4HWUA 4OLVL 5F1NA 1A14H 2H9GA 4NNYB 3TO4B 5DJAA 3VE0B 3ILQD 5CAYB 5D7IE 3TA3B 4J1UB 4NQVB 4HJJL 5JPNB 5H8DA 1KCLA 3OB0K 3TPUB 1RMFL 3JWNC 1XGRA 4XP5H 4HEPG 4U2YA 3MACH 1YEGL 4OLXH 1CGXA 1NAMA 3H9SA 3FB5B 1XF4B 3MLZH 4XBPA 3EO0B 4GFTB 1TMCB 1J7VR 1NC2A 4WGWB 1UZ6E 4X8XA 4RFNB 2ZP0T 4XI5D 4PYGA 1JZ6A 1FFQA 4KZEH 3F7RA 5EA0L 5MENE 4OF7A 1IT9H 3CX5K 2E9WA 4YR6A 2C7UB 3BKJL 3EJYD 2EEBA 2GITA 2HT4D 5AAWA 2FEEI 3VXPA 4HIXH 3VG0L 1H3WM 4LVOC 1HOCB 1NDGA 2V7NB 5TF0A 4CNIA 2HRPL 4EBQH 1XIWC 4LDEB 3BPLB 3SJVD 3GO1H 3HPLA 4QF1B 5KVFL 5KSBF 4Q6IB 3GMLA 3U0TB 3BZFB 2ILLA 3SDXE 4YWGH 3K0WA 2PNDA 1UKQA 4P23B 4MDIB 4IEFB 2BNRB 3HNSL 5ILTH 1CDUA 5E4EC 3WFCL 4Q2ZB 4PGEB 4O9HH 4UTBH 2YPKB 2ZSVB 2BP3A 3P3YA 3QDMB 3WFBH 4LDLB 4D0CA 1BOGA 2GFBB 1MRCL 2NXZC 5I1HH 2VITA 5EB9A 5T5NG 1E4XI 2WWMC 4UT7L 1NDMB 1S7QA 2IH1B 3V52L 4UV7H 2HKHL 1IC7L 2CH8A 4LP4A 3ULVD 2RGSA 1IKFH 3KYNA 3O4LA 1YC7A 4XH2A 4JFFA 1SJEA 3VFSB 4YDJB 1QR1A 1CI5A 1MY5A 1Z6JT 1ZHKA 1A7NH 1NSNH 3LDBC 4TUOB 5MEQA 1MCQA 1X5ZA 4HH8A 3W9DA 5F1KC 1FL5B 2CXKA 3CK0L 3JV4A 3T8XB 3WEXB 1QRNE 1MLBB 4M61A 1V05A 4FNLL 4KTYA 4XC3L 5K59F 2EE3A 1OSPL 5IB3B 3DX6A 3C5JA 1G7IB 3PHQB 4NWUL 1X44A 4QHKJ 2DQHL 2J8OA 5IBTH 1FZKA 4J6RH 4PRPA 2IAMB 4QHUB 4NKDA 4PGCB 5T3XH 3HI1B 5JORA 1R3LB 1RJYA 2W1NA 3FFDB 4W4OC 4CMHC 1WIUA 4NQED 3V4VH 4RWYH 1S7SA 3BH9A 5DJZA 2BJML 2V2TB 4FFZL 3WLBB 1RIHH 1NANH 4EIZC 1ZE3C 3ESUF 1BD2D 3FO2A 4X99B 7FABH 2APTA 2EH8L 1N3NA 3O0RL 2ORBH 3EIFA 4W4NA 1FVDA 3DROA 4K2UH 3R8BB 2YUXA 3Q6GH 1DLHB 4XZUB 4OFKA 3TH3T 1MHHB 1FFPA 3QEQA 2FECI 3LD8C 1BQHB 2WUBH 5GRZA 1X5JA 2VTFA 4L9LC 2DQUH 5C0RL 3QUYC 3X3FL 5IVXB 5HGGS 2NY3B 3QJHA 3H3PL 3O6FD 1BP3B 3V0AC 3QISA 3FB8B 1SVZA 4YO0B 2ITCA 5C2BL 1QFWI 4AH2B 5A3IC 1IGTB 2B2XH 5IB5B 4PJAA 2IPTH 3MJ7A 4MAYA 1AY1H 1KJ3L 1VFUA 1BBDL 3S4SB 3U4EB 3MRCA 4NWTH 3DMMC 5DD6A 2Q7YB 4MMZC 5DVMA 2D0FA 4AENA 2FL5A 4F7PA 5CSGA 5EU6D 3ARSA 3KLDA 5I1KH 2RCSL 3TESA 4U6VH 1OM3L 2ZCLL 3GKWH 1BMGA 2GAZA 4U1SB 1K2DA 3VWJA 3ZL4L 5GS0H 5FHAL 2OJZL 3O45B 1JTOA 2XTLA 1EEYB 4M6OH 5CHNA 2GCYA 2P5ED 3F62A 4ZTPH 1DVFC 4XAKE 4QRRB 4NC0B 2FHBA 2NY0B 4LCCA 3C2SA 3FKUS 3VFGH 3N9GH 4BQ9A 1FIGL 4NQCE 3R06B 3KPRE 4G8GA 3G9VA 5LCVL 4JO3H 2B1AH 4HT1H 2AXFA 3SDAA 1U2HA 4JM2F 5GSRA 4JO4H 3IJYB 4KPHH 3BN3B 3EOBB 5L7XL 1CQYA 4ODSL 1T22B 5FYLD 1MHEA 2VC2L 2F53A 4N1EA 5JW4Q 1UC6A 3JTSA 2BC4A 5FKAA 4BFBD 5JZ7C 2YN3A 3MRGA 3PWLA 1JPTL 3VRLE 3R0NA 4E0RB 1IAKA 4LLMB 1KCVL 1IEHA 3GGWA 3LVEA 2FX8H 5EO9A 3R0MA 5GGTH 1KCKA 1KPVB 1SYVB 1S7VA 2E8ZA 4GAGH 2MFNA 1RIUH 1OAXL 1CDCA 1IM3B 2R2BB 2Q8BL 3FB7A 3B43A 4PRHB 5D1QA 4KKLC 4PJXB 3MRLB 1H3PH 4PJDE 5TPWL 3HB3C 5J1AB 3L7FA 2OQJA 1P6FA 5DRZB 3NAAH 3QIUC 3MV7D 3NH7H 5C0GB 4OJFL 4UDUA 1FBIL 4ZUWB 1WEJH 5FOJA 1X5HA 5E2TL 4R6UA 1T03H 3D39A 2QEJA 5I8KH 5I18H 4K23H 4YHKH 3V0WL 3RPKA 1JFQL 3PWNB 2G2RA 3IXTB 4O02L 1DE4B 2WV3A 1A64A 1VGEH 1A6WH 3GDBA 3ALPA 2NTFA 1RZGB 3Q6FA 1GC1H 3BE1L 2H26B 4F2MA 3ES6A 2D7MA 2R4SL 1A0QH 4G6KL 4GKSA 1HNGA 1YMME 5JLZB 4IMKC 4I4WA 4RGNC 5L8JB 1MREH 2GUOA 1P5VA 4HUXB 1FN4B 3RY5A 1KELL 3IDXH 2ZUUA 1NL0H 3MLVH 3BIAX 4K94C 4NFBA 4Y5YC 4KK5D 4WW1B 4KJYA 4GRWE 2NY4C 3KPSA 4I3RH 2W07A 3IJHB 3ARBC 4PRPD 2ZUTA 4C56E 2UZXB 1X9QA 4UIKH 4YIQB 5E6YA 1FJ1B 3GIVA 4WI5A 2R39A 3AB0B 4ZPVA 2K7QA 2DD8L 5DJCA 4DN3H 2H32A 3MRMA 2JK5B 3B9DA 3LH2L 3OKOA 4M7ZC 1GL4B 5CINL 3FO9B 4Z7WF 5F7HA 4I2XE 3QFDB 4YDIH 4LVNB 4N5UA 1ZLVH 5SX5H 3QIBA 3KPLB 2QTEA 3BP4B 4HGWB 1MI5B 3AMLA 2OX5A 4WTZA 4MCZB 4L5FH 4NCDA 4JQIH 3GRWA 4IRSB 5F7FA 5HHNB 1G0XA 1OF2A 1AD0A 1D3CA 4MJ5A 5F8RC 4G8FA 4UQ2A 4XCCL 4MHHI 4KK8C 2GYSA 4WVRA 2E7LC 2YD8A 1FG2B 2CK0H 5EZIL 2GT9A 5FF6B 5C08A 5AUMA 4P2RA 3IXAB 3NFNB 5HHOA 3MRBA 4QTIL 1L0QA 2G75A 4PJ7B 1UM4H 5GS3A 1TFHA 1TVBB 1GGTA 4S1RL 1Z9OA 4DZBB 5F71A 3H0TB 2R56H 3M1BA 2JJTA 5FM4A 4PRDB 4LKXB 5D9SA 4CADA 1E6JL 1HSAB 3EYSH 2FJHB 4Y4FA 5FO7A 4XCYB 2XXMB 2VH5L 5DD1H 4PV9A 1TPXB 3K81A 1IM9D 4WEBH 3UTTB 1KEGH 5FGCB 4JM2A 1NFDF 5TH2A 4S2SB 4V1DD 3E6HA 3FO1B 1BQLH 5KSAB 1L0XA 3MODL 1WBZB 5IQ7L 2ZUQC 2BCKA 3P2TA 4KQ3L 1GHFH 5IV2A 3RNQB 1DUZB 1BAFL 1Y6NR 5D7JA 1AO7E 1ROWA 3J7HA 4YFDB 2DQTH 1ZT1A 4RA0C 5DEGA 1K8DB 2DLHA 2QQNH 3OKEA 4AEIL 4XPTH 3P0VH 5HVFB 2Y4SA 1UKTA 5E9DB 4C4KO 4L8BB 4JY4B 4HPYH 1NJ9B 3QUXB 1P7QD 4XTRD 1ULVA 2F53D 5ITFB 2ZUSA 1CE6B 3TNNA 2EDLA 2X4TA 5GHWH 1MWAA 3WNMA 3P9LA 4QWWC 2W60A 5FO8A 5IHUH 3L7EA 4DJMA 3VH8A 1S3KH 4RAVB 1F5WA 1T6WA 4WENB 1U8IB 4U4BA 3VXUE 3O3UN 3EDFA 4ZO9A 1T7YA 4ZFFB 3VXNB 3U0WH 3JBG7 1Q94B 2ICEA 3MV9A 4R4BA 1MRFH 3BPCA 5CZKA 4N0CD 1DJSA 3UTSA 1I1FB 1HHJB 1NEZG 5JO5B 5F9AC 4DTGH 2QSCH 3EFFA 4OKVA 3WO4C 2FNBA 2HH0H 3MLUL 1CG9A 2YSSA 3GBNL 1JPFB 3D39D 1J8KA 2B0SL 2VDMH 5I1IL 3REWA 1JWSA 4Z7OE 4NFDA 5D1ZD 1HXYB 4HV8B 1AQKL 1SEBB 5M95B 2XWJA 4KHXH 2A77L 5SV3A 2BMKA 4NQXB 1IGCL 5D8JH 5EOTB 4KRLB 5DQJA 5J3HD 2MCPL 4U1LB 3VFTB 3CIQA 4MS8D 4ZO8A 5GZND 2LTQC 4NO0D 2ESVD 2FJFB 4FQXD 5E2JA 3MGTA 3I50H 3D9AL 1UACH 3ARVA 4CU7A 5AZEL 4F7TB 2LFGA 1C08A 4K9EC 3QIUB 1WWAX 4ETQB 4XXCA 3LS5L 3FN0L 4Z7WA 5FYKL 2UV3A 5JXAL 4KC3B 2X4UA 3TBTB 4I5BB 1AD9B 4DQOL 3CD4A 5DD0L 4Z7UE 1ZT7B 5I19L 2ZG1A 1HZHH 5C92A 2QADD 1T1ZA 4U1IB 2AV7B 4FQPA 3UJTH 2BRRL 1XH3A 2UWEE 4ODXB 2EYTB 3ZO0A 4TSBL 2OR9L 1UM5H 2OTUB 4PJBB 3SY0B 4P3WA 4Y1AD 3KXFA 4OZGB 1FG9C 2EDNA 3OAZH 2YPLB 4L3CA 3SQOH 3VJ6B 1YYLL 3FRUA 1EHLL 2GTWA 2JTDA 3G5ZB 3UTZA 3MCKA 1X3DA 4FG6C 5KTEH 4D2NA 4XBEH 2NY4B 4PY8J 2F8VA 1CCZA 4P2OC 3MLYL 4RRPA 4N5ED 3RWDA 1P1ZB 3CVIH 3MRKB 1ACZA 3MV8B 5C09E 1R0AH 3VDCA 1B0GA 1FAKT 5GGVH 3PWPA 1NFDA 3TN0B 3UTPE 5DJ6B 5AYUH 1XFPA 4P3CL 1BQSA 3HS0B 2MPAH 3LHPH 3BGFC 1WTGT 5E8DH 3EHBC 5D93B 4KKCD 3GI8L 5JR1L 4PJ5B 1MJJB 1HH6A 1M7IA 2VAAB 5IW6A 2E7HA 3MXVH 5KVMC 4WUUB 3WMSA 4HDIB 1JZ3A 1DQJB 1QLRB 4XCEB 4FZ8H 1R5WB 1XF5B 2PN5A 3F12A 4QOKA 2Q76A 2VDRH 1CVRA 1OAUL 1U0QA 2YA2A 3AVEA 4HHAA 1MJ8L 2XN9E 4OI9A 1UT9A 5F6HI 3NN8A 3SGKC 3ISWA 5I30L 4G80B 4X83A 4B41A 4L8CB 5IQ9B 3O3AA 1I1AD 1N59A 3REVA 3LRSB 4EI5C 5FB8A 3D87B 5D1XA 3UBXB 1UXSB 1R5IB 1F11A 5C0CD 1MHPL 3D3VD 1CGSL 4DK3A 1MOEA 4YQXH 3F6IA 1I85C 4MNGB 2VIRA 4XP4L 1PW3A 4LHQB 1LK2B 1FHGA 3V6FB 1UYWH 3BEWB 3CC5A 35C8L 4HUVA 3QXAA 4PUBH 1MAKA 2OL3B 3AS3A 1M7DA 3ZE0F 4KAQL 3F65A 1NLDL 2IBGA 5B38B 2YUWA 2PO6C 2XI9A 1T66D 2UZYB 1SHMA 2CIKB 4OFYD 4OQTL 3DXAD 2BOBA 1FLRL 5E08H 4OTXH 4OD1H 1RZ8A 1YNTB 5I2IB 1YY9C 2F5BL 1WZLA 3O2DL 2PCPB 3LKQB 5CIPH 5HHME 5IVZA 4EN3A 3NPZB 4WDIA 4HKZA 1LO3H 1DBMH 4PRID 3SJVB 3MYJB 4OBRA 1N0XH 4FQ2L 3QI9C 2F74A 5H94B 3RWIA 1RVFH 5GRWA 2EDYA 3DVGB 4PJ8A 2C4XA 2XQYK 4HSQA 5HDQL 1BOYA 1F45A 3B2UC 5AWNH 3LEXA 4XMKH 3EO1A 1D6VH 2HJKA 3FQWB 4NN7B 4NBYB 4LFHG 1J10A 1HCFX 1I3UA 3C5ZB 1IBGH 1WISA 3QQ9C 5KZCD 4YDVA 4KVNH 4LSUL 4OCWL 3UPCA 4HKXA 3O9WC 1YEHL 1MCRA 1WAAF 1MIEH 1FFNA 3C87A 3HR5A 3DARA 3QDGD 2Q3AA 4EDWL 4Q58C 4JFDD 3S37H 3E0GA 1CD8A 2B20A 3G6DH 5E5RB 5EBMB 5I73B 4EQ3A 3LEYL 5DDHA 4PBVC 3M17B 5L9DL 5KN5B 1QG3A 4OCXH 3BAEH 3AAZA 4L4VA 4KTEL 4NUGH 5EO0A 3T09A 3U7WH 2FH6A 3NIFE 4L29B 1DQDH 3SE4C 2X05A 4S1DC 1TCRA 5C0BD 3B5TA 3J8F7 2VZVA 1WC7A 5FA3A 4BSVA 4QHMA 3VD7A 4ZFOL 4HC1A 4X6DF 2HA1A 5IROC 4FRWA 1Z0MA 1BJ1H 4LCWB 5DYOB 3D2UA 2KL6A 3SQBA 3QXUA 2YR3A 4IJ3C 4PTUA 1LILA 3KWWA 1JGVH 4X7SH 2AXJA 5I1AA 1BGXL 4QT5A 4XPHH 4R26L 4YHML 1U3HC 4JVUA 1KTLA 4M5ZH 3VXME 1A6ZA 5GS2H 4O2FB 8CGTA 2HFFA 1Z3GL 3T4YA 1XGPA 4X6CF 2BNUB 3VXSB 1T80A 1TVHA 5B8CA 4XNUL 1Z5LB 3LQMA 2WBJA 3RX8A 3T2NH 1YEEL 1U58A 1JPST 4M3JA 3S7GA 4JRYB 4LKCA 1U8PA 4FQHB 5KSUB 5JOFB 1AQDA 2AW2A 2Y5TB 5DD5H 2JLLA 5ISZA 2IFGA 2AEQL 3RPIB 3I75A 5GS0C 1FRGL 3X12B 1CFNB 1OWRM 1EHXA 4AIXA 1KFAH 1QQDA 1C1EH 5JUEL 2CDEB 3DVNB 4YGVA 2R0KH 1VGKB 3VI3E 3GMMA 4Y4HD 3RWGB 4JPIA 3FQRA 5E94B 2I5YH 1ZHNA 5DQ9B 1V7NH 4GRMB 4UV4H 2AXHA 4P5MB 2AKRA 1PYWA 3RL1B 2VQTA 5BQ7A 1P9MA 2NTSP 4BA8A 4GAYB 3ULUE 2VXSH 3MOBH 1WGOA 5DURD 1FYHB 2BVTA 1KIQB 1HH9B 4JFEB 4CVWA 4Y19E 2GK2A 4ORZC 1ZHLB 2UZIH 3WN5B 3RKDD 3O6LH 2IQ9H 4N0FB 1U8OB 3UTOA 1HWHB 4Z7NF 1NGZB 1CICD 2EH7L 4BH8A 5C0AB 3ARGB 4OI8A 4AMKH 1YPZE 2Y6SD 4UAOC 5INDA 4HX1A 5HI3D 1H15A 4JJ5B 1RIVH 5DD3H 3SEPA 5BZWA 3VXQB 1UWGH 1WFOA 3IKKA 4MA3B 3PL6A 5EOQL 1RFDL 5FUZH 4EI5B 2AK4A 1DTUA 1CLOL 3V7AE 1KJ2L 2GJ6E 2HVKA 3RU8L 2EXYC 3QUMA 3RGVD 1JGLH 1BZQK 2B1HL 2RHEA 2VR5A 3GSVA 1B9ZA 5J11C 2HLFC 4NO3A 2ICWJ 3H9HB 2MMXA 1T0MA 1WAAA 2BOCA 5HPMB 4XGZB 5DUML 4N9GA 4WHTB 2BHYA 3F58H 3GSQB 3P40A 1U8JB 1WCQA 2JB5H 2OL3L 2O5YL 3PF2A 1QHPA 1GC1C 1G7PA 4OCRH 5ADPL 5SWZE 1L7IL 3MBEA 3RDTC 3I6LD 1JYWA 2P8LA 2PO6B 1NGWA 2QL1A 3MO1A 5DUBA 3U0PA 2AJSL 2B39A 4N1HB 4QYOB 5D7LD 2FWOA 2MNUA 3QNZA 4YDLB 4LF3A 2NQCA 4I13B 2J4WH 4ZSOE 1NCWL 2EDQA 4G43B 1CGUA 3EYUL 1U8QA 3NPSC 5IG7A 1CFQA 2X9WA 1DSFH 4BELD 3O3EA 4GT7A 3GKZA 1DLFL 4X6DA 1E6OL 2GTZB 4IBLT 5JHDA 4YEFA 5MI0B 1GGCH 1HDMB 4UMGA 2DQCH 5CBAB 1LO4L 5KBNC 3CFEB 3RVVD 4JFQA 3AFLA 1Z2KA 2KH2B 3PHOB 4KK6C 1I8LC 4WO4A 3KG5A 1MAML 2VDQL 4NP4L 3H9SE 4NPYA 2XT1B 4OLZH 5HSFA 2R23A 2P5WA 2XY2A 1QSFD 4UQ3A 4X6CA 5F7DB 4JQXC 3O9WB 4FTVB 2I27N 3X14B 3GJFK 3LAFA 3QQ3A 5F88A 3ULVL 4PJGF 4ISVB 3TGXA 4AIZB 2ED9A 2WW8A 2R8SL 1JWMA 3IFNH 3QO0B 4N0UB 4ZFGH 1WCBA 2OSLB 1H5BA 3GMPB 2XNAA 3CFJA 5IESL 4FZEL 1HK6A 4Y5XC 6CGTA 4GSDL 4XC1L 5IMMA 1Q9OA 3BDYL 1WIPA 1GGYA 3G5YB 5JDJA 1WBXA 1OTSC 1EHNA 2Z31A 3S36X 3S35L 5C6WH 8FABB 1I3GL 2EDOA 5D7IB 2YPVL 4I3SL 2A74A 1G9NL 1NH6A 5I0ZA 5LVEA 3SDDB 4D0BA 3OF6D 3MJ9L 3PV7A 1C5BH 1T83C 2HG5A 3T0BA 5F9JA 1G0DA 4FQLL 2VXVL 3MQIA 3FHAA 2PW2B 4KJPD 4J3TA 1MY7A 2ED7A 4PRNB 2YEZA 1ZA3B 3HC3H 1W0YT 4JHAH 3ZDXF 2QHRL 4MB4A 1A1OA 3T08A 2HMIC 3O4LE 5E8NA 4JFFE 2BFVL 4TVPE 4JZJA 4Z8FL 1LO2L 4XVJL 1SVCP 3MUGA 2KZWA 3QSKB 3MLRH 1SEQH 3WUWG 3DIFB 1O5DT 4Z95H 3VRIB 3V7AG 4J3OC 3WE6B 1NGXB 1CLZH 3CMOH 3G5XA 3MA7B 1KIRB 5IR1B 1WZKA 4XPFH 1GRWA 3OG4B 3W0WA 4OF0A 2R4RH 4HIIA 4J8RA 4PS4H 1P2CA 1OB1B 1B4JL 2NW3A 2HTKC 1KOAA 4OGZA 2AERT 1HKLL 2CJUH 2Z91A 1KB9J 1YMHB 4PRPE 5GGSY 4QXTA 4Y4KD 1DN2A 1MEXH 4R7NB 3V5DB 4MLSA 1QSVA 5CCKH 1A4JB 4ONHA 1P7QB 5JOPE 2H6PB 1LEKB 3JWOL 5FA4A 3O3BB 3DUUB 1W2KT 1INQB 1I8MA 4OUOA 2O5ZH 3VXRD 1MH5B 1VFBA 4GW4A 1OWWA 3K8KA 4KGLA 3RWEB 4PJ9D 4NGHL 4G7VH 3VGBA 4I0PD 3BW9B 3SO3B 1BEYH 2HFEA 5KOVC 2OR8A 1IMHC 1ZHBA 3QEQE 4RMSA 1HE7A 4GKZB 4PFEA 5MP6L 1A3RL 1NAMH 5C9JA 3MUHL 1KTRL 2J8HA 1L6XA 5F7EH 1S9YB 2B4CL 1J5OH 1JI2A 3S9DB 2XTJD 2YK1L 1JMXA 5EOCL 1FYTA 2E6PA 3GSNA 4D94A 1QRNB 3NACL 2D0GA 1ONQB 1NC4B 1YJDH 2BSRB 3KS0J 3KYKH 3VGHA 5FYLL 4PJAE 5FGRA 3TCXA 1DQML 5D2NB 1A14L 4X9GA 3CFBB 4X6FB 4WFGD 2QR0A 3TYGL 3N85H 3QR2A 5DTFA 4K8RD 4LLUA 2FJGA 3LQAC 3BDXA 4I77L 3RWCB 1MCPH 1TZIB 3L3OB 5HYFA 2W9EL 1FNFA 4MQTB 1U92A 1V3KA 4IMLB 5KVGL 2XZCH 3HZMA 1CVSC 3EO9L 3U48A 3INUH 2DI8A 3TYFB 1KNOA 3NA4A 3FFCA 4V1DE 3O2WL 4TRPH 2F58L 5I0DA 3B6SA 5F8QC 1FP5A 2P46B 4UBDC 4WFHE 2HTLC 4KZEL 1EGJL 1NCAH 2GJZB 1VB9A 4D8PB 3PQYB 4CU8A 3ILPB 5HYQA 3NFPA 4FQ1H 3MNWB 4G8GE 4R3SB 5HGAA 5JW3L 4LPVA 1XIWA 4PJGA 4UTAH 1JK8B 4YBQC 5SX4H 1Z0NA 2P5WD 3RHWF 3RVWC 3SCMB 3GO1L 3O81A 1HHKB 4TVPH 1NGYA 3GMQB 1Q9KA 5FHBH 2F53E 3C8KB 3PIQA 3AROA 4HS6B 4U1KB 3TIEA 1KJMB 2BY2A 4UT9L 1G7QB 2VN4A 4X5WA 4O9HL 5BZDA 4ODBD 5JMRA 5KG9B 4PJEF 4UINH 2IH3A 4P9MH 4PY7A 4LLAA 1EBAA 3WFBL 3PE9A 4OAWA 2EKSB 1H0DB 1DUYB 1C5DB 2DYPD 1OCWL 4Z5RA 3ROOB 4QRPD 3A6CL 3KPPA 2QQLH 1MNUL 5HD8D 3E6FB 1E27B 3VDAA 2N56A 4UB0H 5EFIB 4NQDA 3PWJA 3DLQR 1D9KC 2H2SC 4NQCB 4FS0A 2CXGA 1T1XA 1QNZH 2APWA 1BX2A 2FDBP 3D39E 1A6AB 4ZPTA 3GJEA 4TVSa 3S6CA 4HUUB 4OZFA 2XA8L 3S34H 5E6IA 1JV5B 5HHXH 1OAKL 3HUJF 3O41A 2JIXB 2JJSC 3CFKA 4G7YL 5K59E 5LAXA 3IKCB 4HZAA 4W4OA 2IF7A 2OXHA 3HKFA 4POZC 4F15C 4KDWA 4WWKD 4R97C 1S7TB 1LP9F 4K3GA 5IHZB 4W68A 3SE9L 4GRLD 4C83A 1RULH 4PB0L 5K9KB 5CUSH 3UXFA 4PJDB 3Q6GL 1LO5B 1LEIB 3KPSE 4MA8H 4F37K 4L9LA 4OV5A 3MA9H 1T7XA 3QUYA 5D71H 4QTHA 3B9KD 4RIRA 3DSNA 25C8H 1IL1A 2UY7A 1L9NA 4F7EA 2D7TH 5DJ0B 1ZVHA 4ZFZA 5C0CB 1KEMH 1A22B 1JZ2A 3WKMH 4MJ6B 3VFNB 1M05B 5F7YC 1IARB 2BNQA 5ESQA 2AQ3A 2CGRL 3P4NB 2ADJA 2IPTL 4P59L 5L2JB 1OAZL 3IFOA 5FKPB 2CIIB 1J1PH 2ATPB 3PG2A 4P48A 4NDMA 2VDPH 5IBUG 4NWTL 4JLRB 1RJLA 4B50A 4PJIB 3P73B 2R9HC 1NFIB 1U3YA 1DBKL 1U8LB 2HJFA 1NEZB 4OCNC 5HBBA 4HS8H 5C08E 4ELKA 1T7ZA 4WWID 1CIDA 3DUSB 4WW2C 4P2RE 2H3NA 2OMBA 1I8KA 5IT2H 3P4OA 3RY6C 5E5MB 5I74C 3I6KA 1J0IA 1KJVB 1EFXD 4TPRL 3BHBA 3OGCB 4TUJA 4MX7B 3VFGL 2JJWA 4ZXBA 2ICWA 3EFDL 3NTCH 3OKDA 2YRZA 4KI5F 1MHCA 3PP4L 1UM6H 2WINB 4F7MB 3GBLA 4M7LT 3EOAA 3JUZA 3GNML 3FOMA 4E42B 1MFCL 5HTSA 3O8XB 4UUJA 2DJ4A 4LPUA 1HQ4B 1OD9A 2A1WH 1PQZB 3FO0H 1GZPA 4NQTA 4QCIB 5JIHA 4L8DA 1NAKL 2FGWL 5HGHB 3Q2CA 4MNQD 5GGTL 2X89A 3IDJB 4WRLA 4GAGL 1ZS8B 1UJ3C 4CDGC 2C3XA 4PJEA 3OZ9H 3QG6A 2Y23A 3RWJA 3F7VB 4KMLB 3NZ8B 3VXTB 3ARFA 3BMVA 2BY0A 3DX8B 4M7JH 3U46B 4N1CA 1H3PL 4NRZA 3WIFB 3QZWG 1VFAA 3NAAL 1YEIH 3VD9A 1VEMA 1K5NB 3D1MC 2IALB 5JNYA 1K9TA 4RNRB 3BWUC 1WEJL 3A0OA 4DCQA 3THML 1M6OA 1T6VN 1L6ZA 3DGGB 3KR3L 1DCLA 1AKJB 4WV1C 4K23L 1ZA6A 4YHKL 4JFPA 5FYJH 2O61B 3UZEA 4LDOB 5C0FB 1J8HA 5GGRA 5ICZB 2P4AB 1X5GA 2WUCH 3BKCH 3HE7C 3MV9E 3OR7A 1PKQA 1VGEL 4N90E 5IB1B 3HUJA 4IMKA 3UTSE 2H32H 1J0ZA 4LLDA 3C60A 2WP3O 4NFCA 1DL7H 1AO7B 2JJUA 2X4RA 1MREL 3AS1A 4NRYB 3T4AA 4Y5YA 4JJHA 3IDXL 2ZKHL 4M6MH 5BXFA 1P84J 4LHUA 3MRNA 1LP9A 1FH5H 5SV4A 1FQ9C 3GRWH 3LMJH 3BSZL 2NY2D 4I3RL 3QFJD 4KUZH 2CKBL 4ELMB 3TEUA 1BVLA 1I3RB 3KLHD 5CLTA 4W81A 3VWKC 2NNAA 1CXEA 2J8UB 2AV1A 1U91B 2LU3A 4HIEB 4WTZG 2EIBA 1AHWC 3VXUB 2OJEB 4KMTH 1JN6B 2QJDA 5ALCH 1S7WA 1TETL 2XKNA 4Z7WE 5IGXH 1H8OA 2PTTA 2V5TA 3BO8A 4HJGB 1I9JH 5ID1B 4G6FD 1RZKH 5J4MA 4QGYA 4JQIL 2WQRA 2VISA 4MJ2A 2E7LA 5EORL 1NFKA 3IF1A 4QXUH 1R3HA 1RUAL 3LB6D 4WI8A 1PG7H 5BO1H 2PYEA 4UU9A 4M1CC 2MQ3A 4YX2H 1E4JA 3CCHB 1NCDL 5EG6C 3ZKND 2CK0L 4Y5VB 3FQUB 2CDGA 4KROC 1BHGA 1NMAH 4F33B 3IAPA 3KYOA 2EO1A 3ARDA 1QFWM 2BY3A 4PD4K 5C0ND 2MSPA 5C0BE 4Y2DA 3DO3A 3ILQC 4QHNB 1XMWA 3OPZH 4YE4H 1A6TA 3NABL 5J7CC 1CICB 4N8CH 5EU5B 1R3IH 4DUXA 4KK9D 5BW7C 3T1FB 5GIRA 5TDNA 4G8IA 4Q97A 5DD1L 1NBQA 1ACYH 3RUGF 4X7CC 1KEGL 1S7XA 2BDNL 3EDEA 3RBGA 5ENWB 1ZLVK 2ED8A 2NY5L 5JW4M 5E2UL 5T1LB 4M02A 5C86A 4XI5C 3BEVB 1AE6L 1LE9B 1NFDE 4ZD3L 4H20L 4MSWB 1D5XA 4H5SB 4YPGA 3CU7A 3HNTH 2QQNL 2UWEB 4XPTL 1VCAA 3P0VL 3UPAA 1A7QL 2BSTA 4WEMB 3VFVA 3CSYA 2WBWB 3CDGA 2VLJD 4HPYL 4JDZA 1DQQA 4RGOH 4Y2OA 2A9NL 1LNUA 2A6IB 3VH8G 5IFHL 1BM3H 3BQUC 3ORJA 4C4KT 4QOKE 5CIPB 3L3GB 2AQ1A 1Q0XL 3WIHL 2X4OB 3HZYA 1Q9LA 1J1OH 4Y7MA 2ZSWA 3ZYOA 4KVCH 3QULB 1DBBH 1I7ZB 5T5FH 3V4UL 1U3JA 3BXNB 5EN2B 2DBJA 3MZGB 4AEEA 4WFED 2EDTA 4PPTA 2X6MA 4YH6A 4XVSH 4LSSL 2R2HB 4GBXD 2L0DA 3JTTB 4JFOA 3SE8H 4IHOB 3R1GL 4O2EB 3QNXB 4ZOAA 3ULVC 4YHOL 3H7BB 4P46D 5H37H 3LN5A 4DTGL 2QSCL 2AEPL 2D4FA 2MJWA 1QLFA 4LEOB 3QUZD 1DBAH 5AD0A 1SJXA 2PXYC 1IQWL 1EDQA 3D85A 1R3JB 2MOVA 3EYVA 4QLRA 1MCIA 4LSQL 3U7YL 3ULUC 5EPMB 3P9MB 3W9EB 2CLRA 2W0FB 4FMKA 3PHSA 3HE6C 5C71A 1TVDA 3OBAA 3QDJD 5CZVH 2X4PA 1AR2A 1QSFB 3FB6A 4ORGA 1ND0A 2Z4QA 1F4XH 1DDHA 4Z18A 5H37G 5SWSB 5HYJD 4J3WA 1UJ3B 2IAND 1RURL 3VCLA 4K55A 2XN9B 1W8NA 3L95B 3I50L 2BK8A 1QA9A 1UACL 3L1OH 4OGXH 1JHKL 2FX9H 3CFCL 4H0HB 1IEBA 4K7FB 3BKYL 4XWOD 3IB4A 5EU7C 3PNWB 5F3BB 3IRPX 1IRAY 2VOTA 5GSVA 4OFVA 3KYMB 4KRMB 3QIWA 4DKAA 1G7HA 1RZJH 5ICYB 3GMOB 4JRXD 3OB0H 4UIMB 5J12B 3T0ED 1F6AA 3PV6A 3CPLA 3MLWH 3JVGC 1IJ9A 1HZHL 4S1SH 1CE1H 4DW2H 5IKCB 1KLGB 4MWFB 4PJCB 1RUKH 2RQ8A 4FQIH 2GK0B 1CZ8L 4M8VA 3SBWC 1UM5L 1M4KA 3DYPA 4WNQA 4H25A 4HXBL 4DZ8B 4O00A 4R96B 4KGJA 1T04A 3SOBH 5MHSD 3BGMB 4U6TA 3S96B 2ZCHL 3B2VH 2P44B 1CDGA 3GSOA 4RRPG 1ORSA 3ULSB 2OTWB 4UT6H 1DANU 3ZT6A 1JNLH 2JKXA 1IAIH 4JB9H 4P2OA 4RMVA 4TULH 3LRGA 1J1XH 4HULB 1AGBA 2AI0H 3P11H 4DKFH 4L4VE 3L3HB 3VWKB 15C8H 3RUGA 3JV5A 1A6UH 3D18B 3FN9A 1R0AL 3FQNB 4M9PA 2Z35B 1K3IA 2ICWI 3MRPB 4BSWA 1ZLWK 4IRZH 1YYMH 1TJGH 2MPAL 3L9RA 2B4CC 2B7DT 4HCRA 5ACZB 3X11A 4BFIB 5BMFH 1GGIL 1PSKL 3LKOA 4PGDA 5DHXB 1I9EA 3VXRB 5BVPH 5T3ZD 1QUNA 4YHIA 2DWEB 1ZLUH 2NR6C 4WFFE 3KJ6H 4DWHA 3RGHA 4ZNCD 3BJLA 2EC8A 4DGVL 3ZE1F 5GJSH 3E2HC 1YJDC 5EIQA 4OM1H 3BP6A 4QXGH 2NLJB 3SDXF 1MPAH 1C12A 2QKIA 3IFLH 4TNVK 2GKIA 4CUCA 2X4NA 1B6DA 1KYOK 1QKZH 1RAMA 4BZ2H 5GGUA 1V7ML 1Q9WB 4R2GD 5ICXB 1X7QB 2P7TB 4U1GC 1I85A 4M1DL 1K8IA 4PYHA 5ISZE 4GS7B 1T5WA 4JKMA 4OIIH 5T1KD 3FRPA 4O4YL 1IC4H 5CD5D 2DLGA 1AH1A 1IE5A 4AL8L 1B88A 5DJXB 4UOW1 5DK0A 5BS0D 3PDOB 1AI1L 1PEWA 4FXLA 3BN9D 3X13B 1P5UA 1IAOB 1CFVL 4J4PD 3PXHA 5JPMB 1GAFH 3I9GH 4XNMA 2CUHA 4P3DA 5DHVB 4JM4L 3ZYZA 4TQEL 1N64H 3VXMB 3MMEA 5BV7H 2DOCA 3RL2A 3WIIL 3ZE0E 1HI6B 3LN4A 4ZAKA 1HHHA 3UYRH 2CO6B 1UG9A 5DFVD 2F15A 1EJ6A 3B5GA 3L3KB 4X4XB 3QUKA 3BQUB 3RIFK 2BX5A 4JDVA 4QRTA 4Y16D 1KBGL 4NO5B 3KJ4B 3AS2A 4P57B 5L2KB 1N0XL 4NM8H 4D0DB 2CRZA 2YS4A 4L4TA 4BFGA 1A1NB 2BVPB 2QQKH 2NZ9D 2IPKA 4OD3H 4PJFF 4NBXB 1KCUL 3WO3B 3QHFH 1WZ1H 2XZQH 2PR4L 2VERN 3QAZB 3QHZH 3SDCD 1E28A 2AK4E 1F90L 4X0KB 1TDQA 1J11A 2GSIA 4O2CA 3EGSB 3T0XA 3CUPB 5B22A 3MCLH 4KVNL 1A3QA 2DYPB 1HN1A 2XKSA 2JJVA 4KRNA 1I4FA 2APXA 1SBSL 4XXDB 1MIEL 4RQQA 4MMXC 3BOVA 4HC1H 1Y18A 2V2XB 2APFA 2PXYB 4NO2B 4LCUB 4NNXA 5HDBF 3S37L 1VERA 3ARED 4BUGA 3OX8B 3HE6B 4HFUH 1H3GA 1Y0LB 2YMXH 4HBQA 4Y19B 3TZVA 3KHQA 3TLRA 1KYOJ 1HNFA 5CJOL 3UBXI 1UQSB 2XYCA 4NUGL 5L6YH 1XCQA 5DZOA 3ZT5A 4HKBB 5CJQH 3NIDF 3TBSA 5DRXA 1DQDL 1DEDA 2FEEL 2EDHA 3CFDB 3CSGA 4QXWA 1YPZB 4ZNEA 1X5KA 1P69B 1MFAH 3U6RB 4MD5A 1BZ7A 4FQCH 4HZLB 2V2WA 4MAYC 5IROA 3TVMB 3W39B 12E8H 4LK4A 1FGNL 3W81A 3GHEL 2A6KA 5EU4A 1X4XA 4F58H 4IRJB 2UYLB 3WUWB 4OM0H 3NFSH 2F5AH 4MLIA 5E8PA 4FXGA 3UC0H 1LDPL 5DT1H 2I9TA 1U3HA 2CR6A 5JHDE 4OUUB 4XPHL 5C6PB 2X5PA 4DEPC 2R29L 3QPXL 3LOWA 3C8HA 5DJ8A 1CGVA 5DLMH 3VMOA 3DX7A 5LXGL 1E4XL 1FZJA 1E4WL 2VMFA 4S1QL 5CWSB 1N2RB 2P5WE 5I16A 5TDOA 2ENSA 4X6CE 5E2WH 5FOBB 3F7YA 4GW1B 3SDAC 2XKUA 5SWZB 3JZ7A 3SDXA 4XP1L 5TF1H 4OF5A 1I7RB 1T7WA 3RZCB 1J12A 1QOKA 3GSXA 1LQSR 3SGEI 2AABL 5EUOF 2DLEA 1OARH 4LRNL 4ZSOB 1D5MA 4U1MB 1KFAL 1G9MC 4APQB 1C1EL 3S88H 4LL9A 1TTFA 1XR9A 3DI2B 3GM0A 3LQZA 4PP2B 4OFIA 4H88L 2NY1B 1NCUA 4LNVA 4U3CA 1EBPA 4H8WC 1UB5A 1V5JA 4X6EB 3WNOA 1PGRB 2H9GB 5ACMA 5JA8B 5DJAB 5J1TC 4YXLL 1HHIA 2WIIA 4BH7A 1P7HL 1VADB 4NOBA 1JL8A 4N0CC 4OD2A 4ZDHA 1OP3K 1XGRB 4F7CB 2DMBA 4XNZC 1NGQH 5HGDA 1S9XA 4FXKA 1QBAA 1ED3B 1NAMB 3H9SB 3TBYA 3EJZC 5KVEL 2A6DA 2MKWA 4XBPB 3UJJL 4DGYH 4J1UA 4NQVA 3U9UA 1NC2B 2ZZUT 3TWCL 2UZIL 4CGTA 1MQKH 3DECA 3WFHB 1KB5L 1CK0H 2FECL 3MLTA 5E99L 2IQ9L 4GQPH 3QYCA 1J05A 1XF4A 1S78C 4Z7NE 3TP4A 2GITB 3LKNA 2CKNA 5J3HC 2WANA 3VXPB 4YHLH 1GH7A 1EJOH 2OI9C 1UWGL 3W0WE 3QWOA 2L7UA 4CNIB 1QFWL 1XT5A 4KKBD 4FQXC 2DN7A 1AXTH 4R4NC 4OI7A 4MCYA 3HPLB 4PJFA 4MJID 1NMBH 3MGOA 2C7UA 5BCAA 1V3LA 2E3VA 2OP4L 1XF2A 2V7NA 4K8RL 3U79A 43CAA 4LIQE 2I07A 3BZFA 4NJ9L 1BOGB 1OHQA 1RUPL 1F02I 3F58L 2VITB 3VFOB 2JB5L 2QADC 4BZ1L 4OLEA 1BFOA 1S7QB 5HYSA 4OCRL 3RKPA 4PGEA 3RJQB 2DIJA <