2E6JA

Solution structure of the c-terminal papd-like domain from human hydin protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
112
structure length
112
Chain Sequence
GSSGSSGPKIHFNFELLDIGKVFTGSAHCYEAILYNKGSIDALFNMTPPTSALGACFVFSPKEGIIEPSGVQAIQISFSSIILGNFEEEFLVNVNGSPEPVKLTIRGCVIGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords HYDIN protein
publication title Solution structure of the C-terminal PapD-like domain from human HYDIN protein
rcsb
source organism Homo sapiens
total genus 12
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2006-12-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e6jA00
5AZ2L 4NKMA 1GZPA 2Y25A 1QEWB 1AGCB 3WLBA 2FX9H 3JV6A 4G6JL 1NCAH 3AFLA 5INCA 1R5WA 4G80B 4E0RA 1ETZB 2WBJA 4KAQL 4F9PA 2LAGB 3NIGF 2XPGA 2DM7A 1X7QA 2X2YA 1ZEAL 2XXMB 5CEZL 4ONHA 5C09D 1SEBA 4FQ1H 4WUUD 3STZA 1DQLH 1N4XL 3O45A 4KQ3L 5E94A 1NLDL 1JJUA 5DD5L 3DXAB 5EPMB 3U36A 4P3DB 2DS4A 2X6MA 1FFRA 2EIZA 5CZXC 2OTUB 3CLEH 3K8MA 2VXUH 2PYEE 3ME0A 5ACZA 5EUKA 1JZ5A 5I8EA 1WZLA 4EBQL 2NY2B 5J1SC 3O3AA 3HI5L 1GC1L 5T1LB 5FYJE 5IB4A 5E2VH 2P49B 5TGBB 1CGSH 1XGTB 5L7XL 1JFQH 4LCUA 1EERB 4OCMC 5IB5A 4K3HA 3K8KA 3EGSB 3V4PL 1INDH 4X6EA 5T1KD 4X4XB 4OZHB 3IETA 3M1BB 2EEBA 2YN5A 3MJGX 5IG7A 4P2OD 4WDIB 3HS0B 4ZO8A 4N8VA 4NYLA 3T0EE 1CGVA 4R4BB 1M71B 4YBHA 3PWNA 1ZA6A 3MV7E 3DO3A 5MHSD 4ZO9A 4JFDE 4E9LA 4MA1B 5HVGB 4UQ2A 4OLYH 2QHLA 4HFWA 4ZD3L 4CBPA 1JL8A 2GSIA 3EYFB 4YZFF 3QUYC 1K8DB 4BFIB 1OLZA 1AKJA 1FNSH 2DWDA 1S7RA 1NDMA 2HWZH 3AREB 4G42B 3MLTB 3MLWH 3T0AA 4HGWA 3N50A 1NBVL 4WCYH 5KANI 5IB1A 2BOBB 5D9SB 4YAQB 3P73B 5E9DD 5A16B 5GRJH 5JOPE 4GG8A 4HXBH 2A2QT 3P4OB 3FL7A 4NRXA 3W0WB 3ZE2E 4Z7OE 1LDPH 3DGGB 4I0PA 3C60C 3CPLA 3C87A 4ISVA 2VISB 2IQ9H 1NANI 4JJHA 3HPLA 2ZUQB 1C5CL 3MZGB 5D2LB 1NLBL 3MV9A 2VH5L 2FJHA 3MUHL 1FZJB 5D7IF 5B3JF 1BP3B 5FGCB 1CFSB 2N7BA 1LP9B 4HD9A 3QI9C 3ES6B 3MV11 3UDWC 2H3NA 1NAMH 4G7YH 4PJIE 1QPXA 3O6KH 3BO8A 4K7PH 2BJMH 4WWKB 1C7TA 5JW4R 3WBDA 2A74B 4GG6B 2UY7A 4A6YA 5DK3A 5T3ZE 1HQRA 4U1SB 2DQTH 3MLSL 3LQMA 4M6OL 5IQ9A 4U0RB 3L3HB 2ENSA 2YD7A 4WFGD 5DYOB 4XPAL 2BNRA 5EZJB 1OGAE 4L4VB 4YDVB 4GW1A 3FTGB 1I1FB 3QEQA 1S9VB 3B6SB 1MCBA 5HHOA 2X42A 5KS9E 1AE6H 4M3JA 2X4QA 1GRWA 4UIMA 1F4AA 1R3IL 4L1DA 3OGCB 2VDPH 2VO5A 1IC1A 1Y6NR 2ARJB 2B0SH 3WD5L 3MREB 2AKRA 1FFOA 5SWSB 3MYZA 4XAWH 5KOVC 1A7OH 1W2KT 3IDXH 3LS5L 5FDYA 3RY5A 5B22A 5D1XA 3U0WL 4HUUA 4P9ML 4JO1H 2VERN 4ZOEA 5L8KB 4AT6B 5I17B 4EUPH 1FNAA 1ZVYA 1XF3B 4V1DA 3UC0L 2GIYA 3T77A 1HHJB 5DA0B 3T3MF 3MRMA 2B4CC 4KKAD 4G6AD 4ODUB 4F2MA 3RWIB 5GGQH 3L7FB 4WGWB 3TBVB 3WS3B 2IH1A 5FUZL 1DN0B 4P2CG 5GIRB 1I3GL 4F8QA 5GRXG 5CKGA 1T0MB 2I60H 2X4OA 5ESVB 4HIIB 4YIQA 3QIBA 4PRPE 3DSFL 2CK0H 4LRIA 3GJEA 1NFIA 4UV4L 4PGCB 3VXSE 4UINH 4ALAL 1Z9SA 2XN9B 5DLMH 1MI5D 4HULB 4NKDA 3IJSA 1FAIH 2DYPD 3BQUB 3LKPA 3TC9A 2GK0A 4KRNA 5EZOH 5C0GB 4MNQD 3KPMB 2NY0C 3QUML 2HT4D 3QPQC 5AD0B 2MSPA 2NY3C 4P2QD 4JPVL 2OSLB 3MLZH 3NIDF 3O0RH 3SE9L 4XX1G 2NY1B 3ZKSD 3GRWA 2DICA 2P46B 3EKCA 2PTTA 5J6HB 3RIAK 4IM8A 5A2FA 3V6OC 1K3ZA 3ULVF 5F6HI 4ZFFB 1P5VA 2QADD 2XTJC 3CFEB 4U1NB 1DQLL 4BSJA 1UB5A 3H42H 5F1NB 3GIZH 3SJVE 3BGAA 2FZ3A 4LU5L 2AEQL 4IRSC 4HWZB 1RUQH 1LO4L 5ID1A 2VXUL 2P43B 5EO0B 5I76A 1K5NA 3C5ZD 1MCPH 4JDVB 5HPMA 1E4KC 4DUXA 1IJ9A 3BZ4B 2R2HB 4QYOB 3ZKMC 3P4MB 1VSCA 3RTQC 1JFQL 4E5XA 3MJ8A 4X5WA 4IS6A 3V6FB 1XIWB 2WV3A 3OXSA 4PBWD 4QRUB 2I5YH 5DMGC 3QXWA 4Q9BA 1DJSA 3KYMA 1MCWW 3TWCH 3EYQD 2ZG2A 3TGXA 1Q72L 3UJTH 1H8NA 1WFUA 1U8MB 3D69A 4JREB 2FX8H 1GGUA 5I73B 3DETD 3T65B 3HZVB 3ZYIA 5IMKB 3OR7A 2GJZB 1PW3A 2DIBA 2X89A 3HNTH 2FD6H 2HFFA 3GJFK 4OBRA 5MEPB 2V5TA 3RIFF 2I26N 4UBDD 1H3XA 1RZ8B 4R4NC 3TN0A 4DFIA 1P7KA 1MCNA 4X7SH 1JZ8A 3NVQA 2R8SH 4GRLA 3ARBB 2VKXA 3GBMH 3N1MC 3ARQA 3I3BA 4WI4A 1UZ6E 1IARB 5HVHC 3MLWL 4K9EH 3BIAX 5E00B 5CIPH 3D0VA 1KSRA 1PYWB 4GAYA 2RHEA 5FKAA 2X4TB 5BS0B 2COQA 5GRJL 1CQKA 2AJYH 1RHHB 3SDDA 1YC8A 4HXBL 1T7YA 4QRSA 1LDPL 1I85A 3NFPA 4PGZA 3MJ9A 2IQ9L 3FFCE 4HUWA 5D96B 5GGSY 4HIHB 3EO9H 1GL4B 4HWBL 4RNRB 2W38A 4PJAA 2E7LA 3FCTB 1OAXL 3TM6A 4JVUA 4APQA 1BM3L 1FL6B 1NCWH 2QHRL 5H37H 4PGDA 4X6FA 4MHHI 2PYEA 3IFPB 1G7LB 5C8JB 2B1AH 1AC6A 1KB5A 4PRID 2VR9A 2I9TB 4DCQB 5F3HB 4ZUWA 1NAML 1MFAH 2CDGA 4WNQA 4G7YL 2DWEA 5FGBA 5FXCH 3O6KL 4K7PL 4MQTB 3V6ZB 1J0IA 3GKWH 3BKCH 2DQTL 4JQXA 5EZLB 3FAWA 4RQQB 1SMOA 3JWNC 5D6CB 5CHNA 2HMIC 3UP1A 3QWQB 4K94C 2X40A 5F88B 1R3KB 3QA3A 3WIHH 2VLRD 4K8RH 4L8DA 5D6DA 5DQDL 3T0EA 4NO2A 1F97A 4U49A 3ZHDA 3CVIH 5ID0B 4PRBB 3V5HB 4N0FB 4OIIL 4NUJA 1QPPA 2VDPL 4JFDA 1ND0A 1ES0A 4Y0GA 2B0SL 4JRYB 2DQUH 1QNZL 3G5YB 3I3EA 1A6ZB 3IDXL 2XRAH 4PGBB 2IAMC 3CVHB 4RMWA 2DBLH 3TT1L 1B0RB 4OJFL 4P4KA 1HYSC 2HG5B 1X5IA 3A67L 4TUJB 5EA0H 3MNWA 1DQTA 1S8DA 4WGVB 4NQDE 5CINH 2XA8L 3JV4A 2WQRA 3QCVH 2F8VA 1AFVL 5IT2H 4LAJH 3HB3D 4FQLH 1F4YH 2LQRA 3PABA 5T5NG 4B7IA 4QHNA 3MPCA 5EU6D 4D9RD 2MQ3A 4NHUB 1YYML 2I60L 3HAEG 4K71C 3IAPA 2VLJD 3C09C 2CK0L 1LO5A 3L3JB 3O3EA 1MCFA 3RP1A 4UINL 2H1PH 4XP9H 4GAGL 5DLML 5EO1B 4ERSH 1OTUD 2RB8A 3GK8H 4HS3A 3BRGC 1CK0L 2VLKE 4KK9D 5DJ0B 4M48H 3X11B 2NZ9D 4JFFB 4PJIA 4X6CB 5JMOC 1JGVH 3OR6A 4Z7UE 4WUKH 2BSSB 3ILPA 3O0RL 3HE6B 3H7BB 2UYLB 4C56B 3D39E 5E08H 2OP4H 1A4JA 2Q6WA 5DJ2A 5AWNH 4IDJH 1PY4A 3E8UH 1OGAA 1I3VA 1ITCA 5I1HH 5KS9A 4QXTB 5L2JA 3DURB 3GSRA 4L9LB 4PJCF 5DR5H 3V0AC 1CL7H 2P7TA 3R1GH 4X6DB 3VFMB 4JN1H 4AMKH 1IAII 12E8H 5IM7B 5GISH 3OKLA 1TVDA 1N2RB 1ERNA 5I1AB 1PZ5B 3LN9A 3BXNB 1I8KA 3OKNA 1ONQA 3DROA 3GJFB 1BD2B 3D3VE 1UJ3B 4JVWA 4NHCH 3SDCC 5ITBH 4BSWB 2I5YL 3QEHB 5ICYA 4MA7H 4Y2DA 4YE4L 2V9QA 3TWCL 3IDMB 3Q6GH 3C6SB 4NQXB 3BKMH 1DBAL 1T89A 3KPSB 4QGTA 2J3SA 3UJTL 4HLZH 3LPWA 3N06B 4L8SB 2FX8L 1Z2KA 1CD8A 4LSDA 3QDGE 4D9QE 3TO4B 4PRPA 5EO9B 3HNTL 4EI5B 4Z0XB 5GS1A 2Z93A 3VXSA 1CQYA 4Y5VA 5E5MA 5IVXB 1L0YA 4JY5H 1ZS8A 2JLLA 5D1ZC 1VB9A 2SEBA 4M93B 1H5BB 4Q6YA 2JK5A 3KLHC 1KBGH 4Z78A 3V4UH 4X7SL 2R8SL 4UILL 2O5YL 2GY5A 3O3DB 3P4NA 1D5ZA 2WWKO 4K9EL 2AK4D 1NCCH 3UJJH 2UZYB 4MD5A 3K74B 3QFDA 3I6KB 1A6VH 4LVEA 4N9GA 3IB4A 2E7HA 3VFRB 4WTZG 3QAZB 2ZCHH 2AJYL 4KROB 3X12B 3I50L 4ZO7A 1S5HB 1DFBL 4CNIA 3VXPA 1E27A 5DMIL 3ULSA 2BRRH 1ULVA 4MNGB 1QA9B 2O26U 1DEEB 2JELH 4ORZC 5EBMA 3SJVA 5DMKB 4Y88A 4OQTL 3VXNA 4AZ8A 4KMQA 1CDCA 4UDUB 2KQMA 2OMBA 4QTHB 4KZEH 4MAYD 1SVCP 1CFTB 2DL2A 5C07E 4Y5YC 2YD3A 1SJVA 2VQTA 1IGCH 4JKLA 3PNWB 1MFAL 4PJBF 2P5EB 1DQMH 5F7MC 3P9WB 4R97B 2WM0A 4UZGA 4LKXB 1IC7H 1JTTA 4HHAA 4U6VL 5C2BH 3HFMH 3GKWL 3IF1A 4PP2B 4OZIB 3FFDA 1NGXA 2A9ML 4NRYA 5F9WB 3B3IB 2D7PA 4LCWD 5DTFB 1F58H 3WIHL 4Y4HC 5A43C 1KYOJ 5DJ8B 2R0WH 4KRMB 2BHYA 4KJYB 1D5XA 3CVIL 3OKKA 2PYFA 5T3XE 5DRZB 5F7FA 3W9EB 3W5MA 3DUSB 2DQUL 2I07B 2YA1A 1V7NL 3HI1B 3O2DL 1ORQA 4RWHA 4H0GA 5J9PB 1TPXB 5D7SH 2D0GA 4G6KL 3EOYG 2AQ3A 3OV6A 3QQ3B 1R3JB 3X3GH 4XMLH 3BD3A 4JZNB 3OKEB 4MJ5B 1BIIB 5EA0L 1XR8A 2GJ6E 1T1YA 2DLFL 2VZ1A 1FL3B 5CINL 3SGJA 4Q9QL 3QCVL 1VACB 3UBXI 5GGRY 5IT2L 4XPFH 3QQNA 5BRZB 1F4YL 4N0UB 3MRLB 1TCMA 3T2OA 1MF2H 3NCYS 4R8WL 1PGRB 4HF5H 4LLYB 3FFCA 3VFUA 4MMXC 2OXHA 5TE4H 1KENH 3OAYH 4AQ1B 5DRNB 3ZDZF 3JWDH 1F4WH 1IGFH 1DEDA 3WFEH 3D6GA 3U2SA 2VZ3A 1AH1A 3CSYB 3N1FC 1EUTA 3C6LC 1CLOH 3NOIA 4WO4B 3IFNH 3GMRA 2A77H 1EAPA 1P84J 5DWUH 3CX2A 4K55A 2WUCL 1QFUH 3QCUH 5DURD 2BXZA 3HR6A 5CWSB 3OB0H 2ZUVA 5C09E 4WUUE 1TQBB 2VDQH 4HKBA 3EYUH 1AGBA 1AXSA 3BEWB 1S9XA 1T20B 2OP4L 1Q9WB 3FHAA 1NC2B 2R9HD 4ELKB 4HH8A 4J8RB 5JHDB 1J1PH 3O9WA 5AWNL 5CBAA 1F11A 1P4IH 2GEEA 5C9JA 4MX7B 2CH8A 1RUML 43C9A 4Q6IC 4LLMA 4LLWA 4HPOH 2IMMA 3MGAA 2R4SH 1RSFA 3WN5C 7CGTA 5DR5L 1CICB 1T1WA 1CL7L 3R1GL 3MBEB 4JFXB 3VDBA 4JN1L 3SY0A 4AMKL 3F8UB 4M4RA 5GISL 3UTZA 1WBYB 5IR1B 1KJ2H 1NGZA 3UYRL 1Z9MA 3WUWA 3HZYB 1MNUH 5E8DH 4KUCF 5HGHB 1U8KA 3LN5B 1NMBH 1RIVH 4JG1H 1S7QB 5JIIA 4NQDA 2VITA 4NKMB 5DGQA 1CDGA 4MA7L 2FHCA 4KKAC 4G6AC 1GAFH 4F15C 2CUMA 1M7XA 5C0CD 3Q6GL 3WLBB 3BKML 4FA8A 4BUHA 5MHSE 2IALB 4XI5C 1RJLB 1YDPA 5IFAH 1A1NB 3QQ9C 1WT5C 4NN6C 1VGKA 5INCB 1NUDA 3BZFA 5HGBB 3VJ6A 3BP4A 4O9HL 3SE8H 4LCIL 1XT5A 1E6JH 1HHKA 3NZ8A 1WF5A 4DK6A 3BUTA 1EEUA 2CPCA 1T22B 3STZB 1FSKC 3DVGB 1GH7A 2OTPA 4JY5L 2QQNH 4ODXA 1KBGL 1EHNA 4LSRL 4EIZC 2VLKA 4F7CB 1CFNA 1EO7A 3QIWD 1HDMB 4JFOA 2W0LA 1NC4A 2YD5A 1RIHL 3C8KA 4PR5B 1AO7D 3NCBB 4Z7UA 3UJJL 3MUGA 4J3VA 2CMRH 3D39A 1T7WA 5SWQA 4D0CA 4Y4KB 1ZGLA 2ZCHL 4U1KA 1NL0H 4LCCC 3IKKA 4XNMA 3EYVA 1CD1B 5BZDA 2PXYD 4X6EB 2WW8A 2D0FA 2BRRL 1D9KB 2AABH 2ZNWA 4DKFL 2HT2D 5TQ0L 2PW2B 3K1DA 35C8H 2WMPA 2R0LL 2AJXH 4J3XA 3HRPA 1M7DA 1JWUA 4FP8H 4NYLB 1DBKH 2FYYA 3UROR 5FM8A 3B9KA 2YPKA 3FB5A 4XBPB 3NN8A 5D5MA 1YEIH 5LBSH 2P8PB 3C5ZC 2AJUL 3G6JB 1FYTD 2GSIB 2EYSB 3O8XA 1NAKH 3D3VA 4QRRE 3RHWK 1G6RA 5C2BL 1S7RB 2CKNA 2XQBH 4OZGF 3NCYP 2Z92A 4HGWB 4P2RD 5I8CB 2B1HH 3EYQC 5IMMA 4OF5A 5H37G 5IB1B 3VGFA 1F58L 1II4E 3PL6B 1I7TA 4PJ9D 4I77H 1R5VA 4XPHH 2R0WL 1U93A 4YHPA 1MRCH 2R0KL 3QDGA 4GG8B 5GHWH 4ZNCD 4NRXB 5E1AA 4JDTH 4I0PB 1H0DA 3QNYA 3CPLB 4XGZB 5E8EB 1UKTA 4EIGB 4Y16A 3HPLB 1KCKA 4M6MH 4F9LC 3MR9A 2FJHB 3RGVC 4MSWA 4DKAA 4WW2F 5D7SL 3IGAB 1QUNA 1DP0A 5HYSB 3LSOA 5CFHA 3MV8B 5DHYB 3TA3D 4ZS6D 4HPYH 5IMOA 4XMLL 2C7UA 2XTLA 4NNYB 2YD9A 3TH2T 4K9EC 3EYSH 4XPFL 3SO3B 1MQKH 3K7UA 4FQXC 3BGMB 4MVBC 1HQRB 1MI5E 1EGJA 3QEGH 5JPMB 5LGHH 2DLTA 2NXZB 3FRPA 1KENL 1AI1H 1DQDH 4KC3B 4FQIL 2BNRB 3Q6FA 1T0NA 7FABH 1IGFL 3WFEL 4P2QE 1T83A 2FJGA 4HKZA 2HTKC 2AI0H 5C07A 1UADC 2OQJB 1CLOL 1JNLH 4KY1L 2CO6B 3PHQB 3OPZL 2MQCA 4LHUD 5IBTH 3SGDH 4ZTOH 4M00A 2HJKA 4WW1B 5HDBF 1FFOB 4BK4A 1QFUL 1XZ0A 1AGEA 5ISZD 5D1XB 4HUUB 5IF0A 5L0QC 3EYUL 1J18A 5GJSH 5AEAA 3KPRD 1P4IL 3T77B 4LVHB 3BIKA 3NIGE 5IFHH 4F2MB 1IGYA 1JE6A 1OAZH 3GSUA 1F3DH 1X9QA 1KV3A 1T2QH 1X6NA 4BA8A 5F6IC 4JFZH 1DVFC 4YHOL 2EICA 1QLFA 3QIBB 4AEFA 1N5YL 1S9YA 3MA9H 4JQIH 3GJEB 1NFIB 3GSNL 4GKOA 5FECA 1KJ2L 3ULUF 4N90E 1MNUL 1E6OL 1RMFH 4NKDB 5E8DL 5E6ZA 3X13A 1M05A 1UVQA 3L3GA 4XMKH 1NMBL 1RIVL 2XICA 2GJ6A 1S7XA 4B0MM 3BKYH 4OSUH 1ZGLP 4N8CL 4F7PA 5IBLD 1FNGA 4OBSA 5L6YL 2GAZB 2NTSP 2BNUB 4G6MH 5J13B 3HG1E 3I9GH 4KUCD 5IFAL 2YPVH 2HFGH 4J4PD 2H32B 1OAUH 3L9RA 4NQVB 3PXHA 1UCTA 4RDQG 3SE8L 2ADIA 1E6JL 3MA7A 4BQBA 1IEHA 5AAMA 2KBGA 1KIQB 2DAVA 2BVOB 1UB5B 4XMPL 5DEFA 2QQNL 3DV6B 4XNXH 4LBEA 3L95A 3B2VH 3QR2A 3WO4C 4ETYA 4YZFE 4KK9C 2EZ0C 4XH2B 4HLZG 2QQKL 5C09A 4WUUA 4FHBD 2CMRL 5EB9A 5A2IH 1ZV5A 4FQJH 2Z31C 1A6UH 4GUPA 4JO4H 4OB5L 5DSCB 5GZND 4N5UA 1TETH 4WFFE 5IBUG 3MRFB 4TSAL 1KXVC 3ARGA 4JEGB 3TZVD 3IXTB 3UBXA 2D3VA 1AIFB 2B20A 3PHOB 2AABL 3RKPA 4ZAKC 4PRIE 3QH3A 4JE4B 4F80A 35C8L 1QFWI 1QSFE 3ZL4H 3NFSH 4FP8L 1DBKL 4UU9A 5B3JE 1W8OA 5C0EB 1YEIL 5LBSL 3ARWA 1JWSA 3AY4A 1HZHL 3BFOA 5T1KA 1HXMB 3LHPL 4OM1H 5GGRA 4PYGA 3UPRA 1SVZA 2RFXB 2Z8VC 4P5TD 1E4XI 4P2OA 1N64H 3T0WA 4GRLB 2VLRE 4I3SH 3MODL 2XQBL 4MDIB 2V7HB 4XXDA 3QIUC 3MRQA 2FR4B 4U33A 1MFCH 3NH7H 4YNYA 3MNVB 3RIFK 1GGCL 4JN2B 5F70A 4RGNC 3GMPA 5IW1B 1BVKA 1ZA3B 5CLTA 2WLZA 4XPHL 1Z5LB 1UXWB 2NY4C 1XF4A 5GHWL 2P42B 5FYKD 4QRSB 3CDCA 1NKRA 2NY6D 4M6ML 1YMMD 3GGWA 4PJAB 3GMOA 1CXFA 1BZ9A 1KPRA 5F8RC 3VGEA 1WTLA 4X6FB 2PYEB 5GZOD 5C0ND 5EU6E 4D9RE 2JIXA 4ZUWB 4WNQB 3T4YB 3T3ME 1Y6KR 3UYOD 3EYSL 2X9WA 3EUUA 1HHGB 3MRRA 1MQKL 1PX4A 1XGRA 5HHVH 4JKKA 2HFTA 4RFNC 5GS0H 3WKMH 4M6AA 3UZQA 3ARXA 2CKBA 5LGHL 4M8QB 5SWZB 1EV2E 3KPQA 3VXUB 3W11D 5L2KD 1Q9LA 3BH9A 4NNXB 3QA3B 4L8DB 2FSEB 5J6GB 3SBWA 3S36X 4NC1C 1N5AA 3QXUA 5DUBB 2AI0L 4Z18A 5K9JL 3SCMD 3MBXH 1UGNA 4I3RL 1JNLL 1MWAA 3HMXH 5IBTL 4GRMA 5EUOE 3KJ4B 4HQQL 1ND0B 5BQ7A 1FNHA 3RZCD 3NIFE 3LDBB 1JNHB 4DEPB 5MEOB 2EC9U 3REVB 4XNUH 1ZVSB 3NIDE 4ZTPL 3S5LG 5J3HD 4WHCA 2AEPH 5DFWH 2OJZH 1IL1A 2BNQE 5GJSL 5I1LA 4OGYL 5KJRH 4XCNA 2VDOH 3OJMB 4NKOA 1BWWA 5CGYD 1Y18A 5F89A 4B5EA 3IU3B 2OL3B 4GKSA 4PTUA 5HHPA 4CVZA 3ULVE 3E3QE 1OAZL 1WEJH 1JMZA 2FIKA 3MUY1 5CMAA 1KCRH 4EDWH 5C0AB 2EDXA 1T2QL 4ZSOE 4JFZL 3TVMB 1QBMH 4KK5D 2GI7A 4LQFL 5HXMA 1IAKB 3FQRA 3MA9L 1LO5B 5EIIA 4WJ5A 2XT1B 4JM2D 4TNVF 1I1AA 3S36L 1WZMA 3PGDB 4OCXH 4RZCA 1RMFL 1N26A 4R0LC 3RX8A 3OG6B 2A6DA 3DOSA 2OCFD 4EN3C 4HS3B 3TYGH 2UZXB 4XCEB 3BIBX 3QHTC 1NBYB 3BKYL 2FB4H 4OSUL 4HSQA 2XI9A 1IQDA 2UZIH 3SKNA 4XVTH 3OR6B 2CLRA 2D9CA 4NZRH 3ILPB 3ULUD 3H9HA 3AUVA 4R7NA 3WNOA 4G6ML 5FKPB 2OS7A 5DGRA 2YPVL 1ZHKB 1MI5A 4JRXD 1I7ZB 4LGPB 4OFYD 2DYPA 2Q6WB 3H9ZA 5LWYH 1NCBL 2XIDA 3RI5K 1BBJA 1OP3K 3WFCH 4JZJA 1OGAB 4JY6B 2EXWD 1URLA 1ROWA 4P2QA 3PGCA 5HPOA 3U48A 2AK4E 1TCRA 5KS9B 1D3CA 5L2JB 5IIEB 2P7TB 3LRSB 3QWOA 4DGVL 5I18H 3BGFB 3RVVC 3T4AA 5LAXB 1A6UL 1JF1B 4JO4L 3G04B 2VXTL 1DE4A 2ZSVB 4YHZH 2R9HC 4TYUA 4CVWA 4Y4FA 1MPAL 4ZNEE 3INUL 2YS4A 3TBTA 2IANB 2EKJA 4U6YA 3U9UB 1MAMH 4X4ZA 1W0YT 5CKAA 3ZL4L 2AJSL 2AAVA 2EO9A 3NFSL 4LRNH 3QUYB 1FBIL 4PJEF 4GW5A 5FOBA 3CVHH 5DD3L 5GS1B 2Z93B 4PJFF 4TVPE 4Y5VB 1TTUA 4OM1L 4LCWE 3AS1A 5IB3A 3MRNA 1F13A 3C5JA 1N64L 3QUZA 1CBVL 3BKJH 4PG9B 5TDPB 4I3SL 2H2SD 4RDQF 5DJZA 1D5ZB 3F7VA 4U7SA 4EXKA 1F5WA 4BKLB 1MFCL 3C8HA 1A6WH 2EE6A 5DDHB 2VXQL 3D18A 1NUGA 1NEZA 3C60B 1T03H 1E4WH 1JWMB 3HG1A 5HI5C 3C08H 1FH5L 4G9FD 4ZQKA 1U58A 1GXEA 5TQ2H 5ESQA 1J86A 1YY9D 3VA2C 3GMNA 3ARDD 4NO0A 3C5SA 3S88L 3B8SA 4JR9H 3IDNA 3ZHLA 3FOLA 3ULSB 1LO0H 1AJ7H 1FLTX 2Y5EA 4FFWD 5EBMB 1YPZF 1BBDH 1SJXA 2JKXA 3RY6A 1KPUA 2F54B 5HHNB 3OSKA 5DQ9A 4XZUA 1PAMA 1KCVH 3GSOA 4HGKC 4YK4C 2YRZA 2GTWB 2WP3T 1P9MA 3QXDA 4NQSA 3TV3H 4JRWA 2BHUA 2L7UA 1D5BA 2A6IA 5HYJB 3BD5A 1M6OA 4LSQH 4NN5C 4JDZB 4M7LH 4PV9A 4HK3N 4P23A 2PW1A 2XWBA 3AAZA 4LARH 5CEYA 1X5AA 5HHVL 1XCQB 1P69B 2APWA 4R2GB 3WKML 1U3HA 3UTTB 4FN0A 4NRYB 1DLHB 4L8BA 1HILA 2X4RA 2HT2C 1DN2A 4PRIA 1G7IA 5E5UB 3F58H 1QSFA 2VDKH 1D7FA 3SN6N 3RWFA 2CK2A 1W72A 3NPZB 2PYFB 3MBXL 4RGOL 5DVMA 2FBOJ 1A9EB 1QO3A 3GJFH 4Y8DC 3CUPB 4LQ1A 2AQ1A 1W0WA 3GO1H 2MFNA 1LO2H 1J0KA 3X17A 4LLUA 1ORQB 1P7QB 5MP6H 4A2LA 2VLRA 4O58H 1HOCA 5E2TH 2HYMA 1CLYH 3K80A 2VRAA 5F7HA 1ZGLM 2ARWA 2OJZL 5KJRL 3X14A 2VDOL 1QYGH 1XR8B 3I02A 3VG9C 2ORBL 2ITCA 5B38A 3QUXD 3TCLA 2XTJE 4NPYB 3ZMRA 1MCEA 2AERT 1OARH 2I9LA 1XH3A 3FJTA 1KCRL 2IQAB 4EDWL 4PJCE 3VFUB 2JB6B 4RIRA 4KRPC 3RA7H 1I7RA 1HE7A 1QBML 4NQCE 2NY0B 1WISA 2NY3B 4HBCH 2J4WL 2EDDA 4IRJC 4OCXL 1JGLL 5C0CE 1PFCA 4HIJA 3TA3C 5J1AB 5JQ6H 3TYGL 3WMSA 4K8RD 5EU6A 4S1QH 3SGKC 2FB4L 4I5BA 3GSWB 2UZIL 5HSFA 4XVTL 1X5LA 2VLJA 1ZLVK 3QP3A 3LKNB 1KPVB 4NZRL 4PJGB 5F7DB 5B39A 4FXKA 4OAWA 2FWOA 1F8TH 4HC1A 4LCYA 4KTDL 5E24E 1P2CB 1JHTA 3B9DA 1BX2A 3PQYD 4OUOA 3GDBA 4L29A 5LWYL 5CBAB 1F11B 5D71L 6FABL 3WFCL 43C9B 4IRSB 4GMSH 1OSZB 3LZFL 4PGJA 1AO7E 2HJFA 5BXFB 1MH5B 3OKMA 4L3ED 4XX1E 4HIEA 5T1MA 1IAIM 3U82B 5EUOA 5EG6C 5JXED 3EYOA 2GTZA 3S96A 5C08D 5FOJA 5C0IA 1RVFH 1FZMB 2DQCH 2NY2C 1OP5K 4CRPA 1JYXA 3G6AB 1MCWM 4HG4J 2X41A 4L4TD 4P48A 1NGYA 4G8GB 5I18L 1OCWH 2BNQA 3ZT5A 4P5MA 3QJFA 3CMOH 3HNVH 1N6VA 4NQDB 1LVEA 2BCKB 2VITB 1T1ZA 3CK0L 3NCEB 5AG8A 1SY6A 4LPVA 1A4KA 4OD1H 1MCIA 1YDPB 1MAML 2FH6A 4LVNC 3KYOA 4LRNL 4ZSOA 3BZFB 4XCYB 4D0BA 4XVSH 3BHBA 4K3GA 1BAFH 4L9DA 2BSTA 3L3OA 2QR0A 5HVHB 5HDQH 2NX5B 1IT9H 4PG2C 1CT8A 3RPKA 1SYVB 1IAOB 3AREC 2OR9H 3LCYA 3MZTA 5BVPL 1MJUH 1MCJA 4PJBE 1YEDA 3BKJL 1UWEL 1CFNB 4AG4H 1CYGA 4KFZC 5IBLC 1NC4B 3SDAA 2PO6A 1JUFA 1DDHB 4Z95H 2Y07H 1T03L 1E4WL 3DTXA 3R4DA 5EU7C 3X3FL 1ZWIA 4J4PC 4E41E 2YK1H 1I3RA 5TQ2L 1ZGLB 4QRPB 5IB2B 4LGSB 4U1KB 1WCBB 1JP5A 3ZDXF 3I6GA 2ZUQC 4JR9L 2V2XA 1AJ7L 2YEZA 1VENA 5IROA 5A2JH 2YR3A 1PBYA 1S7UA 2AK4A 1BBDL 3D85B 1UA6H 1D5IH 4U3HA 3O6FD 4JHBA 3TV3L 3B9KB 5F21B 5D5MB 3S37X 1OL0A 5HHMD 2IFFH 1IGTA 2DM4A 4OF0A 3ZE1F 3CDGB 4AYFA 4WWKC 3W5NA 2VN7A 1VEOA 4Z7VE 3O8XB 4IEFB 5DQJA 4ODWA 1X3DA 4LARL 4U6TA 4D0DB 5D70H 1VDGA 3DBXA 2Z92B 4NZDA 4MAYA 2Q8AL 3KR3H 4ZXBD 4NN7B 3EBAA 5DUPH 1R3HB 1CDHA 3F58L 4NT6A 1R5VB 5CP7A 4I0CC 1U93B 5E6ID 3ZDZE 3QDGB 3CFBB 1SJEA 1D6VH 3HPJA 3LH2H 4M7ZB 4X7TB 2FGWL 1H0DB 5H8DA 4ZYKA 1AQKL 3T8XA 2ID5A 4H20H 4Y16B 3VD9A 3T2PA 4M9OA 1HH9B 2F58L 4HWNA 1LO2L 3KPRE 4HK3J 4LCWA 1NUNB 4P5TC 4U1GB 3Q1SH 3GB7A 4HT1H 5MP6L 2IH3A 5C3TA 4Z7WF 4J2XA 2MQ0A 4O58L 4JAMA 2J8HA 2YWZA 1UYWL 5EU5B 3S37L 4LIQH 5IMOB 3CZFA 1QYGL 1A7RH 3HI6H 2J2ZA 1BWMA 2MCPL 5HGDB 4K71B 1BQSA 4QXWA 4WEBH 4WU5B 4XCCL 3C09B 5DVLA 3BZEA 4ONGL 2X1OA 2NR6D 3QEUB 5KVDH 3SEPA 5BW7C 1OARL 2WBJD 2P1YA 3E6FB 1WIPA 1WBZB 2PTUA 3EO1A 2GFBA 4Y1AB 3TT3H 3RA7L 3U30C 1CD0A 3THMH 1QFOA 2DM3A 3LIZH 2A0LC 4DAGH 1Q9KA 3U7WH 5KSAD 1K9TA 4U6XA 5DVKA 3ZTNH 3VW3L 1PKQB 2V7NB 2LU3A 5JQ6L 2AW2A 5EDXA 5C0NC 3D25A 3SKJL 4CW1A 1CTOA 32C2A 5I1EH 5AG9A 2C3VB 4G8FB 3T0VA 4BFGA 4FFYH 3VFWA 5J12B 3U79A 1F8TL 4QXUH 5F93C 2YC1B 1FO0L 4H0HB 3TBWA 1FFPA 5F9AC 1BF2A 3D1MC 1ZT1A 1GGYA 2F15A 3W11C 4C54A 1IGMH 3EOAA 1HCVA 5DFVD 1FGVH 3S3SA 2CDEA 4RFEA 4NO5A 1IGYB 2NW2B 3MRHA 4GQ9H 3O2WH 4OF3A 1CG9A 5TPWH 3SCMC 5FUCC 2FJFA 2V5YA 2A9NH 3V7AG 1KF9B 3MOQA 3MYJB 2DQCL 4C58B 3VXRB 1S9YB 2YD1A 3SDCB 2GUOA 2VB5A 3SKOB 5FECB 4MWFB 3BI9X 1IM3B 4W6YB 3RNKA 2IPKB 3PDOB 1TFHA 1OCWL 3WL9B 1AKJD 1C5BH 4WU7B 1UVQB 4X80H 3VDCA 2NY5H 1E0OB 4S1DD 2DKUA 2GJ6B 1S7XB 3CFDA 3O11B 3CMOL 5GJTH 5TDOB 5I30H 3HNVL 4WHTA 2HFEB 4OZHF 4P46D 4F7PB 5I1DA 4L3AA 1YEHH 1JHLH 3BMWA 4YXKH 4OLZL 2OZ4L 2X1QA 2HN7B 1OTTD 4JREC 3FKUS 4OD1L 1JV5B 2W9DH 1FVDB 4CVUA 3RJDA 4UTAH 3EO0A 5HYFA 4G8EB 2G2RA 4KHXL 4XVSL 2X05A 4KK5C 4NQCA 1CF8H 1BAFL 2FHFA 3OJDB 3TIEA 2ZOLA 4F3FA 4JM2C 1DTUA 4KQ4H 5HDQL 2FNBA 3DHMA 1IT9L 3BP7A 3PV6A 5DEFB 5HJ3A 5C0CA 1L0XA 3T1FA 3HE7C 3ARBC 3L95B 1EHLL 4L8CA 1MJUL 5IGXH 2JJSA 1G7QA 4CVXB 2KDGA 4AG4L 1IVLA 3RWDB 5LGKA 4HEPG 3R8QA 4OZGE 1Z6JT 5FA3B 5C09B 2Y07L 5I74C 2CIKA 4P3CL 4M1CC 1OQOA 3AU1A 1JTOA 3N9GH 3CFJA 1T2JA 1RULH 3QRGH 4GUPB 8FABA 3WDIA 2H2PC 1J0ZA 3NZHH 1Q0XH 2A6KA 4YXHH 3UBXB 5ETUA 3QIWA 1XGQB 1YC7A 2EXWC 5D2LF 4HJGB 4DGIH 4S1RL 3W9DA 3FO0H 4D8PB 1AO7A 3QEQD 4X6BB 5HHOD 3MJ7A 3MX0A 1WWAX 1D5IL 4NUGL 1BLNA 3WKNA 1LP9F 5FYJU 1GOHA 3VFSB 4JY4A 4RGMC 2PXYA 2PN5A 4LNRB 1EHAA 4XNQA 3ROOB 3FO1A 3BT2L 5ADOH 2CRZA 4QF1A 5GGRB 5DA4A 2R69H 4CN4A 3UPRB 5IFJA 3MACL 4GG6F 1INEH 1YMHA 4Y4HB 4KK6D 5DRXA 3IXAA 3MRDA 3PE9A 3BPLC 1BJ8A 3A0OA 3KR3L 4YNYB 3FB8B 5FDWA 5EZIH 1RZGA 3WS6C 2R23A 3GBLA 4YO0B 2VDNH 4ONFH 1D6VL 2EKSA 2UWEB 3WIFA 3U9PL 5I19H 4H20L 1QSED 2BSRA 3GGWB 5FYLH 4RMRA 5HDBE 2XY2A 2WWMD 3Q1SL 4PJBA 1BZ9B 2ADJA 5E9DB 4PJ9A 2H2SC 2AXFA 2Y4SA 4LIQL 4MYWB 3VGDA 3I6LE 4KJQC 4YDJA 1IKNC 1A7RL 2AVGA 2VJXA 4U1HB 3VA6A 2H32H 2YMXL 4E41A 3EOBA 1S5IH 3SO5A 1YY9C 3LKRA 3ARDC 3MRRB 5EU4A 1XGRB 3PP4L 4UT9H 1OAYL 1H3PH 2CJUH 4KKCD 2CKBB 5BO1H 5BV7L 3TT3L 4ZDHB 4HV8A 4HS8H 2XZCH 3KPOB 1HXYA 3OBAA 4ODHH 1JF5A 5DC4B 4ZPTB 4FFWC 1A3QA 1CFVH 1TJHH 3LIZL 4DAGL 3LKOA 1Q9LB 3BH9B 3U7WL 3VWKD 1T5WB 5CD3A 3ILQC 3ZTNL 1P4BH 3RWCB 1U8NA 3SE3A 1BGXL 3ULUE 4NO3A 4K7FA 3UZVB 1BFOB 4R7DA 4MGXA 4Y5XA 4CADB 5HY9A 2ZCKH 4U7KA 5BQ7B 5I1EL 2HH0L 4Z7VA 4ORGB 5DXWA 4N8PA 4FFYL 3DSNA 2CO7B 1GOFA 2L7JA 1FZKA 4QXUL 3IVKB 1IL1B 5I1LB 1LGVA 3VXME 3BPOB 1F2QA 1NCDH 1Y18B 1HSAA 1R5IA 5IEHA 1EJOH 2HKFH 4PTUB 5F7NC 1FGVL 5HHPB 5INDA 5JHLH 3ZHKA 4CVZB 4L9LC 5BJTA 1KT2A 5A3IC 4GQ9L 2X9YA 3O2WL 3WLWD 3EFFA 4JFED 5TPWL 5HI3D 3CFCH 3WE6A 3AGVA 2FIKB 5CMAB 5E0QA 1NFDB 1UCBH 2X89D 3KG5A 1MHHA 4YHNA 3FQRB 3KPRA 5DK2B 1JN6B 3QO0B 4D3CH 3O41A 4HW6A 3TN0D 4RZCB 1UJ3C 2AK1H 3RWJA 3BDXA 2A6DB 5CSZB 4X80L 3B9EA 2NY5L 3SQOH 4KKBC 4QLRA 3KWWA 4NN6B 2EH7H 4ODBD 2WANA 5D2NE 1IQDB 1I1YA 2E9WA 3KPNB 1C5DA 1YEHL 4LAQH 4DOHE 2CLRB 3H9HB 2BRQA 5TDNA 4ELME 4Z76B 1FSKB 3HC3H 4U2YA 1JRHH 5HI4D 1OAQH 1JI2A 1MI5B 5CCKH 4UTAL 4EI5C 4MNQB 1BBJB 4IOIB 4U31A 3U1SH 4MCZB 2K3TA 2WLYA 5F96L 2FEDD 4KQ4L 4P2QB 3PGCB 4OGXH 4WVRA 2B2XL 3TP4A 4APQD 4F58L 3QNZB 1MHCB 2DQHH 3GFUA 1CWVA 4S2SB 5IGXL 4G9FE 3TPUA 4MXQC 2ITDA 4QOKE 2X7LA 1T80A 2R2EA 3KNBA 2ZUYA 3HAEA 4LCCB 2OI9B 5FYJD 3OHXA 2R2BB 2QADB 5SX5K 4I48A 3QAZC 5MERA 2EDJA 3N9GL 5HVWA 2XKSA 1AD0B 1VEMA 5F72S 1PDKA 5IHZB 4HH9A 3NZHL 1CGUA 2GK2A 1QHPA 4YXHL 1H8OA 2DJUA 2Y36L 3JTTB 4DK3A 4MLIA 4IIQA 4YR6B 5L9DL 3K0WA 3FO0L 3TBTB 3C5ZB 4U6YB 3GBNL 3T0ED 4XC3L 4HCRH 2R1YA 4WY7H 5JXEC 1CLZH 2W1NA 1RZKL 4GRWB 2E27H 3IS1X 4LLAA 5CD5C 3MV7D 1MFEH 4O4YL 3SPVB 4JFDD 2H9GB 1T5XB 1KB9K 3TZVA 4KKLD 4R97C 2OJEB 5ADOL 3NCCB 4J23A 2R69L 3VXTB 1SQ2N 2VXSL 3SHSA 3TBYA 3W39A 1G7PB 2J6EH 2OTWB 3QUMA 4IOSD 3V8OA 5FK9A 4P4KD 4YH6A 1HH6A 2OL3H 3ZKND 1B9ZA 3CSBA 1G9NH 4YFDB 5F9WC 1ZHNA 3RL1A 1FZOB 5GSVB 4OF6A 5DJAA 4NQTA 3AC0A 4G6FD 1QTYT 3WO3B 1NEZB 1BQLL 3DMMC 4LLQB 1U58B 3U4AA 2VDNL 1KJVA 4OI9A 3GI9H 4ONFL 3OB8A 3FQXA 4PRHE 4RFOH 1UWGH 3IDNB 4YHML 3FOLB 5I19L 1YEKH 1TPXC 4L4VD 3EDJA 2FECI 5FYLL 1AGDA 1KCSH 4OI7A 3KHOA 3LEXB 4NQUA 3QXDB 5K9KB 3GSQA 3K4ZA 4JFPB 4U6HA 4OZGA 5T3ZH 2EE3A 4GSDH 3GRWL 1N59A 1S5IL 2PW1B 5F1SA 5JA9A 3FT3A 4KI1A 3H9YA 2VQ1A 3BH8B 4MCYA 4OD2B 4UT9L 4HS6A 4OLWH 2B8OT 2ICWB 2CJUL 1H3PL 5BO1L 3RIAF 4YQXH 4FQQA 4OIBA 1KIPB 5TJWK 3WEXB 1G7IB 3WSQH 5EBWB 1S7VA 4BELD 1P4BL 4WW2A 4WTZA 4XVJH 3BZDA 3RQ3A 4I2XE 4NWUH 3S98A 2EDQA 5L0QB 1OQXA 1UH4A 1TVBA 2H26B 2ZCKL 3BDBA 3D48R 1U91A 1JPSH 4U2ZA 4X6CF 1W0WB 3KPLA 3O4LE 4LF3A 1UM6H 1N3NA 2X44D 2PETA 3BQUD 2AJZB 2VLRB 4ENEC 1HOCB 1A14H 1G9MC 3B5TA 25C8H 5CUSH 3QISA 3H9SD 4AH2A 4ZXBC 4JHAH 2JB5L 1C16A 4L3EE 4OLXH 1ADQA 3J8F7 3QULB 3VXQB 4X5XA 1IQWL 4G7VL 3PWPE 5F6IB 2ITCB 5B38B 5JHLL 3P9LB 3RZCA 3ARPA 4YPGA 5D1QA 5E6IC 3LVEA 1WCQA 1JHKH 4JG0H 4L4TE 3P77A 1CL7I 4X6DF 2DMKA 1J1OH 4ZFZB 3S3PA 4ONOA 4PRPD 3I2CH 4KPHL 1UCBL 5TE6H 1IFHH 1NUFA 1I7RB 3NCFB 4X8JA 4HDIA 4X7EC 2WP3O 1PEWA 4Y19D 2FATH 5GS0D 3F7YA 3RNQA 3RFZC 4M9PA 1B3JA 4CDGC 1LE5A 4FOMA 4X8XA 3IDIB 3AB0B 1NH6A 5DHVB 1I4FB 1X4ZA 4ZFGH 5ICZA 2W65B 1K4DB 1IILE 2R0ZH 2ATKB 3F62A 2IADB 2VLJB 4LAQL 4M8VA 4PGEB 4FXKB 3DV4A 4OAWB 3U0TA 3KXFD 5HHQB 3HC3L 1GZQA 2Y5TA 3GMLA 3MJ9L 2WBJC 1JRHL 1ORSA 4F9PC 1BQHB 4KTEH 1YEJL 4MJIE 3WO4B 3VFPA 4PJDE 3U1SL 4PJEE 1KIRB 5BV7C 1JK8B 5IVXF 3SJVD 1UXSA 1AY1H 5TF1H 1J87A 2BVTA 4OGXL 5LJYH 2VABA 1OVZA 2CD0A 1KB5L 2DQHL 2ZOKA 3PWLA 5T1MB 4HIEB 5FYJL 2QL1A 5EUOB 5LXGH 4OFYA 3CC5A 1WZ1L 2GTZB 1U8LB 4OCSH 5C0IB 4OD3L 5JDSA 3TIDA 3DRTA 4R3SA 3TFKC 1WWWX 5JLZB 4LOUC 5I0ZA 1B6UA 4KI5D 5BCAA 3OAYK 1CZ8H 5I9QC 2O93L 4HXAL 5HYSG 3VXMA 5EORH 4OGZA 2WUBL 3S34H 5DFVC 2WZPD 1NQBA 3ARUA 4I9WE 3BEVA 1BVZA 4KK8C 3T3PF 4QT5B 5HHME 4E42B 1A4KB 3BPNC 3TO2A 2MKWA 4HCRL 4NCC2 3KYOB 4WY7L 4DW2H 5C0DA 2E27L 3GSVA 1MFEL 5FO9B 1LE9A 1F6FB 1JIBA 1TZIA 5FCSH 1J05A 2B4CH 1KN2L 5I66B 5IOPA 5HYQA 1B2WH 2OX5A 1CT8B 4MQ7B 4Z7QF 2J6EL 2YD8A 4RGNB 1UM5L 3Q3GA 3VXOA 4P4RA 4OZIF 1PKOA 1U8HB 2FLBT 1G9NL 1KUMA 5D2NA 4XP4L 5HGAA 2NY4B 3V5DB 2NY5C 1ZHLB 3LKSA 1OTTC 4ELMA 3NACH 5DJDB 2IC2A 4JPIB 1ZWIB 4RMUA 1AQDA 4NWTL 5E99L 4M5YH 3RGHA 2HTLD 4I0PC 3GI9L 3HC0A 1OP3H 3FFCD 3WJJA 2VDRL 4RFOL 1UWGL 3I6GB 2ZSWA 3VFGL 3CAFA 1YEKL 3UO1H 1S7UB 4J6RL 2AK4B 4AEIL 4AM0B 5LCVL 3VE0A 1A3LH 1KCSL 2CSPA 4WTXA 1CTNA 2N1KA 1KELH 4G9FA 5C6TH 4RMSA 1H3WM 3QJHA 1HYRC 4KWUA 4FQHB 2Z35A 1UM4H 4QOKA 1BECA 4RA3A 5IV2A 1QOKA 4WTWA 1JYWA 4RFNB 5T3ZL 4N0CD 4GQPH 5J89A 4GSDL 3MRJA 3SO3C 5MEND 4W4NA 2Q86B 5I6XB 1QFHA 1AP2A 5ALCH 3FZUD 3U6RB 3QYCA 3DBXB 4OLWL 3CDFA 5DS8B 1KULA 4QHLB 1QG3A 4MAYB 5C0BE 2K7PA 1OT1A 4LL9A 2A73B 5JR1L 1S78D 2J5LC 4NT6B 2V2TA 1F3DJ 3GMQB 3LV3A 4XVJL 1DL7H 4N68A 3HPJB 4FXGA 4KVNH 1FDLH 4NWUL 1VPOH 1A7QH 1LEKB 4O2EB 1RZIA 4ZYKB 1RZKC 3MFFB 1QVOB 3T8XB 1NCTA 4NNPH 1JPSL 5H2BA 3LPGA 4LCWB 3HTLX 3M17A 5AUMB 3FO2B 4WHYH 5D1XC 1UM6L 4GJTB 1D6EA 2HRLA 3OQ3B 2VDMH 3MMEB 1BJ1J 1FV1B 1FG9C 1TTFA 5CUSL 5CIPA 1UKSA 4LVHC 4JHAL 3CZFB 4OLXL 5JOFB 2AJ3A 1T4KA 4FG6C 4TPRH 4W6WB 3SKMA 1A6AB 4LP5A 3GSXB 3BZEB 4RAVA 1JHKL 4JG0L 1HSBA 4P5KB 4PRHA 1SMAA 3UZEA 5JPNA 2MOVA 3DX8B 1J1OL 1QBLH 4R0LB 3EO1B 2GFBB 3QIBC 4LP4A 3I2CL 5TE6L 4LRIC 4D2NA 4EN3B 4Z77B 1CFBA 1TZHB 1U8JA 4ETQA 3F5WB 5AZ2H 1IEAA 1YN6B 4TULH 1FHGA 2WWMC 1F6AA 4G6JH 4CDHA 3T1WA 3QUXA 2VLKD 4UIKH 1DQQA 2UVFA 2NXYD 4ZFGL 2D7MA 4CW1B 3CD4A 4HJ0D 1ZEAH 4RAHA 5CEZH 2B39A 3RWHA 3VGBA 5BZWB 3DX7A 5J13C 1N4XH 4O2FA 1NLDH 3D39D 5CS7A 3VFWB 1UB6A 3G5XA 1JNNL 1NMAH 4NBYB 2DQDL 5E4IA 4PRNA 3B2UD 3TBWB 1FFPB 2Z0BA 3MNZB 2EDBA 1EK3A 4BH7A 4NKIH 1FIEA 3KHQA 2FGZA 3EOAB 4M4PA 4OQ1A 3GMMA 3A6CL 3JTSB 4IOFD 4QGYA 2CDEB 4RFEB 1AY1L 2X4UA 4NO5B 5DURB 4LEOA 1S9WA 5TF1L 5KSUA 1CFQB 1CG9B 3V8CA 2Y1VA 4JM4H 1I1CA 3VMOA 5C0JA 4I2XA 2YRPA 3RWGA 4K23H 3FT2A 2YPLE 4XWGL 5LXGL 5CBEA 2VZTA 3L5XL 4OCSL 3O4LA 4K94H 3QT2A 1KLUA 1XF1A 3R8BB 5JIPA 3CXHJ 4DN4H 1U3JA 5KG9A 4J3SA 5GRUL 1VGEL 5EORL 1MIEL 1MAJA 3EDDA 4L3EA 3CFDB 5IEKB 3S34L 1UJTA 5JQHC 4N5EC 4WHTB 3SDXA 3PWPA 1ITBB 5CP3H 3ZDXE 2NNAA 2BMKB 4JLRA 2P5WE 3V5KA 2W60B 3WLWC 1ZKAA 4L4TA 5EBGA 1JGEA 1JF6A 4HKJB 1LEIA 4YHLL 3HLAA 1PVHA 2XFXB 2HJLB 2G2RB 3GSNB 4PRDB 3WHE1 3TIEB 5KVFH 4PLKC 4O51B 4KDWA 3G6JF 1B2WL 3TN0C 4PD4K 5ALBL 5JIKA 5C0CB 4OZFG 2XACC 4GRLC 4YJZL 3B4NA 3ZE1E 2J7LA 1JGDA 1L0QA 4L8CB 2J8UB 3BWAA 1G7QB 4C83B 4MS8C 1KTRL 4MNHA 2ICEA 1GGIL 4JFQB 5JORA 3DNKA 3O6LL 2H8PB 3NACL 5HI4C 3DO7A 1U2CA 1QSEE 3CFJB 3SDDC 4JANA 5FHBH 1T1XB 4M5YL 3D2UA 2Y9RT 4MJIA 1I85C 4UNTA 3DIFA 2X4PA 4XWOC 3A6BH 4PJDA 1IGJB 4PJEA 4HK0A 3QIWB 5AZEL 2FEDC 2E7LC 3ECBB 3UO1L 1AO7B 4APQC 5C70A 1KELL 5C6TL 1B0GB 2DJ4A 3JZ7A 5C07D 3MRBA 4Z7WE 1UM4L 1OP5H 3MLSH 4PJ7B 1A8JH 1A7NL 2PXYB 3FRUB 4PB0H 4WEMB 4NFCA 3KS0H 5FGBC 5IK3A 4XNQB 3GIVA 4QF1B 5IHLB 4P0DA 2C1OA 3O2VL 1RHFA 3MXWH 5EOQH 3BW9B 3JVGA 3PGFH 2OR8A 1MUJA 4JQXC 5DRXB 2HLAA 3O6FA 1R3IH 2DQEH 3B8YA 4X0KA 3WD5H 1A2YA 1T21B 1K8IA 3AXLA 5D6DC 1RZGB 3T0EC 3IDJB 5BRZD 2DQIH 3LS5H 1FYTB 3QUKB 3JWOH 3U0WH 1CD9B 4F7EA 5K93A 5T33L 5M7QA 1NDGB 3PWJA 4MA3B 5T3XD 3UTQA 4KVNL 5F97E 4BFBD 1FDLL 4YC2C 3SGDI 1X5GA 1F90L 2ZP0T 3WIIL 3LDBC 3UC0H 1WGOA 4NNPL 4P2RB 2HLFD 43CAB 1BOGA 1Q94B 2GITA 5A2LH 4H25A 3DI3B 4P4KC 2ADJB 2VDML 4PJ9B 1HQ4A 2C3WA 1EXUB 1I3GH 4JFEE 4ZS7H 4AEEA 4U05A 3IYLW 3P40A 1U92A 2BX5A 3FB6A 2R56L 5DK0A 1GGTA 1YJDL 3EOBB 4XPTH 1A6TA 4KUZH 1JPGA 1HK6A 3R0MA 5CZVH 2VAAA 3UJIL 4TUOA 4PLJD 2YWYA 1CGYA 2JF1A 4GKZA 4XBEL 3TA3B 1MLCA 1FVEA 4HV8B 3U0PB 3PXJA 4TULL 3LKOB 4JPVH 2Y7QA 3SE9H 1U8NB 3K2UH 4NO3B 3WFHB 2D7QA 4UIKL 3HRZB 3PWVA 2VZVA 4C4KT 1IMHC 5HY9B 3FQNA 5E8PB 1EJ6A 1RIUH 5EOTA 1RUKH 1BF8A 2C5DC 4Z7VB 5DT1H 1NJ9A 4HUMB 4KMLB 3RVUD 5KSAA 1NMAL 4YGAB 4LU5H 3ARGD 4GXVH 2AEQH 1LD9A 5C0BA 1YEFH 4J1UB 4O02L 2EYTB 2NLJB 2NTFA 2XG5A 2AEWA 4NKIL 1LO4H 4LHUB 1HSAB 1T7XA 1R5IB 3DVNB 3QHFL 3HCVA 4JKPH 4CAGA 1R3LA 1CE6B 4JM4L 3WE6B 1VFUA 5ISZB 4GKNB 4K23L 1TJGH 3HZKA 1MHHB 1CDYA 1OY3B 4K94L 1FYHB 1G6RL 3BGFC 4EVNB 3G5ZA 2DLIA 3HR5A 3O41B 1K4CB 3WHXA 4TQEH 4X98A 1Q72H 4CJ1A 5DD6B 4DN4L 1CXHA 5FA4A 1PJ9A 3RHWF 4RSVA 4LVNB 4Y2DC 1WZKA 3HNSL 1FG2B 2BOCB 1I1YB 4NJAH 3W0WE 1T89C 3P0VH 3K2MC 5D2LE 5F7YC 1LEGA 2DI9A 3IKCA 4YDLB 2Q8BH 4OFKA 4UDTB 1LMKA 4CU6A 3S5LA 3VFVB 5FV2A 5GS1C 4R4FL 1LP9E 4Y5VC 1S7WA 5KVFL 3U4EA 1IAIL 2UY6A 4P46A 2VIRA 3BVNA 3VWJA 5I1GH 4MJ2A 1EIBA 4LNVA 3MRGA 5ESAA 2JE8A 1RURL 1XGUB 4ODSL 2G75A 1FFNA 2WBKA 2R2EB 4RAUA 2JIXD 3CMGA 5HYIA 1BVLB 3TYFA 1EGJL 4HWBH 4HX1A 4ZMAT 1RI8A 2BERA 4KRLB 2CKBH 3DUUA 5IW3A 4RRPG 5MERB 1OAXH 5IHBA 4L4VE 1GVIA 1BM3H 5FHBL 2QHRH 3DYMA 1BOYA 1U95A 2QSTA 4H26B 2AV7B 4NOBA 2LE9A 3A6BL 5IVZA 5J57B 1P1ZA 4PJ8D 3MOBH 4IIQB 2YKLH 3IJYA 4G43A 5JW5A 4DJMA 1UG9A 3PL6D 1M1SA 4PJAF 3MGTA 3F6IA 5KVMC 4MMZC 5SWSE 3OKOA 3QDMB 1UQSA 4KV5F 2HVJB 4XC1H 2AJVL 1AGFA 3BSZL 1DQJA 1OLLA 1KJ2A 5ANME 3TJHD 3OAZK 1TZGL 1TNMA 2DTMH 3TZVB 1T0PB 4PB0L 1FNLA 4QRRD 3ZSTA 2MMXA 2Z91B 3TBYB 2C9AA 4YEEA 1KGCD 3MXWL 5EOQL 5DQDH 5FK9B 3PGFL 3DPBA 2EXYD 1HH6B 4R2GC 2MCG1 3ZLQC 4QHUA 4DKEH 3JXAA 1ZHNB 4OIIH 3O6MH 5DVNA 2DQEL 1ZANH 5DJAB 3RAJL 4R96A 2P5WA 4HEME 1QNZH 4F7MA 3RDTA 5T3XL 3CFKA 3NFNA 4H8WL 2DQIL 2Q76B 4ZUVA 3JWOL 5ECJE 3TT1H 4P5TB 1NCNA 4PJXB 4YBQD 5LGJA 4OJFH 4NDMA 5D7KD 2NXZD 3MLRL 2ZKHH 4GMTL 3FQUA 3A67H 1KTLB 4UV7L 4HUXB 4ZUTA 1S7SB 4B7LA 3H9SE 2Q7YA 2XA8H 2EEAA 1I1AD 5EFIA 2CLVA 4OCLC 1AFVH 1ZE3C 5SV3A 1MLBB 4Z5RB 1KCLA 2HT3D 3BP5B 1EO5A 4ZFOB 4OT1L 3SGJC 4ZS7L 3RKDD 1YYMH 3KJ6L 5ICXA 4F57L 4TTGA 3MV01 4NM8L 1OW0A 3U30B 5E8OB 1N59B 1QSEA 1YMMB 2GJJA 4LLVB 3FT3B 4GAGH 4XPTL 4Y19E 2HTLC 4KUZL 4MCYB 5CZVL 2E7MA 4HS6B 4WHYG 1CK0H 3QO1B 4MD0A 4LFHG 2M8XA 4GXUM 4MDJA 1ZMYA 1S7VB 4ZUUA 3SGEI 4DZ8A 1PQZB 1X5JA 3A6OA 4X9FA 1HHHB 3K2UL 2X4SA 4Z7WA 4AL8L 3KXFE 1TVBB 1RIUL 1RUKL 3LEVH 4JKMA 3KPLB 4LF3B 4CMMB 5L2KB 1GPOL 5DT1L 3VWKA 4YHYC 3VFNA 2IJ0C 5KSBF 1XR9A 3O9WC 1C1EH 4Y4FD 4O2CA 4GXVL 2A83A 3VD5A 4AH2B 1YEFL 3SCMB 2IPUK 5IJVA 1C16B 1I1RA 3PIQB 1P4LA 4GRWH 3RPIB 1WBXB 3RZCB 4HMCA 3RL2B 5KS9F 4JKPL 2QKIB 1FE8H 2HP4A 1MVUA 2FIRT 4U1IB 3P77B 4KI5E 1FN4B 2CGRH 3L3IA 1RJCA 3L5HA 1TJGL 2DL9A 3AM8A 2X70B 4NBXB 1RZFH 4OCRH 4MD4B 2LU7A 4YE4H 4N90D 1AGCA 3RNQB 5I71C 1DBAH 1YY8B 4TQEL 1XAUA 3QUZD 4PTTB 4JFEA 5BS0E 2VYRE 4G80A 3P0YL 1UACL 1ETZA 3VGHA 5ICZB 1INQB 1KN4H 3V7AE 4NJAL 4U1MB 2FX7L 3P0VL 2ED8A 3HG1D 4JM2B 2ATPA 3D0LA 4TSBL 1SYSA 5EPMA 5F7LB 5JO5A 2Q8BL 4P3DA 1YJDC 4NO0D 4UILH 2O5YH 4AIOA 3HE7B 5K9OB 2OTUA 1CDIA 1YUHB 1TVHA 2KPNA 1H3GA 2X1WL 2NQCA 3VFTB 3DYOA 2DLHA 2EDRA 4DUWA 3LKQB 2FEEI 5T1LA 5D7JD 5I1GL 2VABB 5TGBA 5JOEA 5I74B 2ZOKB 1XGTA 5D72L 4JRXB 3MOAH 3I50H 3CC5B 5JZ7D 3L5WB 1DFBH 4HJ0C 3DJ9A 5DMIH 4OFVA 1YNTB 1RUAH 4YDKH 3M1BA 4MZ3A 4P23D 2APVA 2CKBL 2XA3A 4OQTH 5EN2B 2OLDA 4RBPK 1CDJA 4WFFD 4IMKA 3HS0A 1AD9B 1U3HD 3AMLA 4R4BA 1YECH 3MOBL 2YKLL 5EU3B 2PR4L 3V0VB 4UTBH 5DO2D 2GSGB 4R90L 4FQCH 1QSFD 4RGMB 1MWAL 4G9DB 4FQ2H 3EYFA 3EAKA 5MENE 3B9KC 4U6VH 4XC1L 5C0DB 1C08B 3MLTA 1JZ2A 1LE9B 3GI8L 1TZIB 2G5BB 1RK0A 5B8CA 2A9MH 1MQ8A 2DTML 3BPLB 3O8XC 1HHIB 5HYQB 2BOBA 4YAQA 3VCLA 1U8QA 5A16A 1SJHB 4IHOB 1WFNA 4XXCA 1LWRA 1QR4A 3VXOB 2LVCA 1ACZA 1KC5L 4P4RB 4DKEL 2WK2A 3MCKB 1EEZB 3P4OA 5HGAB 5K59F 4NN7C 1AHWA 3O6ML 4OZ4B 5D7LB 3MV7A 3DGGA 3W0WA 1ZANL 2VISA 3GHBL 3LKSB 4DWHA 5C7XL 3G9VA 5D2LA 2DIAA 4ELMB 4HAGA 3MLXL 1V7NH 3O2DH 4S11A 1AQDB 2E6QA 1OGTA 4M7ZC 4UT6H 1FZJA 1QFWH 4G6KH 4MB4A 3ZTJH 4AEHL 2YXFA 4GW4B 1LP9A 4YHIA 3HUJB 4Y16C 3VH8G 2ZSWB 2ARJQ 2XXCB 2ZKHL 3LAFA 3VXUD 3ES6A 3E1F1 2DLFH 4U1GC 4LSUL 5DHVH 2F74A 1R0AL 3G9AB 1J5OL 4Q9QH 3VE0B 2G60H 2GKIA 1JMXA 3ZYOA 4X7CC 4Q2ZB 15C8L 4QRTA 1E4XH 2C1PB 5C9KA 4R8WH 2P8LB 4U1SA 3ARDB 3F12B 5EOCH 4OFDA 1CS6A 1U8OB 2E8ZA 4Y8AA 5SX5H 5F1OB 1BZ7A 1JBJA 4G8IA 4AIZB 4Y7MA 4LPUA 4L4VA 5DD0H 1I1FA 1KG0B 1ZTXH 1S9VA 2ZPKH 4JPWL 1AP2B 5CGTA 2NCMA 2FL5A 3CU1A 2ZJSL 1UC6A 3OGCA 1QR1B 4X6DE 5CSGA 2JJTA 4L3CA 1PG7X 2VWEE 2ARJA 2WUCH 2P4AB 3RI5F 1T83C 3H0TA 5SWSA 2V17L 2R4RL 4J3UA 4FXLA 3V52H 3LV3B 3ARFD 1UH3A 5ANMA 4AT6A 2O61B 1JYNA 2WBWB 3TVMD 1RZIB 1B6DA 2BFVL 3QXAA 1HHJA 3LEVL 4FABH 1RUMH 5J12C 3WNMA 1FORH 3M17B 4OGAD 4PJGF 5D93B 3FONB 4ODUA 4XTRC 5HHXH 3RWIA 2BNQD 3KPSE 1VA9A 3K3QA 1UFUA 5DEGB 1C1EL 1CIUA 1DN0A 5GIRA 1EEQA 3VI4E 2F8OA 5DZLA 3ULVD 5ESVA 4HIIA 1FL5A 2AJ3B 5T1DH 2B5IC 3QG6A 5E2UH 2IBZX 3UYRH 1FE8L 5IVXE 3LN4B 1KNOB 1A7PL 2XKNB 5TH2A 3BQUA 5J11C 4H8WC 1YA5A 2CGRL 4ESKA 3JWOC 1IZKA 4JZOA 5C0GA 2Q87A 1J8HB 3KPMA 5CZXD 3H9SA 1MCKA 4ETQB 3I75B 1RZFL 3L1OH 3QZWG 4OCRL 3QFJB 5AD0A 3KLDA 1RD6A 1B0WA 4PUBL 3CDYA 2C4FT 3T2QA 1Y6MR 4OIAA 3QWRA 1IEBB 2ZUTA 1DQQB 5J6HA 4O9HH 3SDAD 2DQFB 4LCIH 5H94B 2PO6D 1KN4L 1EBAA 1OTSC 2WIMA 2AP2A 4ZFFA 4RX4A 4BQ9A 5I16A 1HI6A 4U1NA 4MXVF 3DX7B 5D4QA 1KIUA 1YEEH 4O2FB 4Y19A 1R24B 1UB6B 3G5XB 5E03A 5F1NA 3T3PE 1WTGT 3LQZB 4PLJC 4LSRH 3OKDB 4HWZA 4HZLB 5LVEA 4NFDA 5EO0A 3IJHB 1RIHH 4LDOB 1WJ3A 4MXWL 1WIUA 2X4UB 4LEOB 1S9WB 5KSUB 1LK3L 3HMXA 3BZ4A 4LPTA 2R2HA 4QYOA 2NPLX 3KXFA 1I75A 3P4MA 5T5FH 4G3YH 3BN9D 4Z7QE 3CNKA 1I8MB 3MOAL 1TMCB 5CBEB 3V6FA 5FM5M 1XIWA 3QQ4A 1YNKL 4QRUA 3PQYB 5FO7B 3GUTB 3KPPA 5DI8B 1RUAL 1RJYB 4YDKL 1FO0B 5BVJB 5B21A 4DKFH 3L3KB 3S35X 5F1KC 5TQ0H 2FCBA 3DARA 2ZCLH 2R0LH 1U8MA 1BFVH 1DUZB 3ISWA 4H1LB 3ARGC 2YOCA 5GS2D 2XZZA 4L3EB 3T65A 2AV1B 3MLYH 5E2WH 1KXQE 4EDXA 3SDXB 2GJZA 1YECL 5I2IB 5C08B 2AJUH 2NNAB 2H6PA 5FO8A 4UTBL 4JLRB 3PP3K 1W72L 2E6JA 4XHQA 4DQOL 4FQCL 5MEPA 4L4TB 3NCMA 4FQ2L 4PJHB 1RZ8A 1JGEB 1X6LA 1LEIB 3CSGA 4O00A 4OUUB 4HWEH 5D5MF 1EX0A 3AY4C 5CJOL 8CGTA 4TVPD 3QI9D 2BC4A 5C6WH 4ZOAA 1NGWB 4X4YB 3FT4B 1HWHB 5C2UB 1EFQA 1OPGH 1PYWA 4P2OC 5SV4A 2DQJH 2JCCE 2X4TA 5GGUB 3BWAB 1A47A 5BRZE 1KLGB 3DMMB 4U0QB 1RHHA 2R0KH 4N0UE 4WI8A 4ACPA 2BVQA 4S10A 1FJ1B 1NBZB 3QXVA 4BSVA 1OAKH 5IVNA 4XCFH 4HIHA 1XFPA 1P53A 1G7HB 3DO7B 3FCTA 1KEGH 5IWLA 3EJYD 3FQTB 4UT6L 1QFWL 1FL6A 3O3BA 3MGOA 4M7JL 2Z4QA 3DIFB 1LNUB 2X4PB 4PJDB 1QD0A 3IFPA 1G7LA 4JFYB 5C8JA 4NM4H 4W4OA 5IMLA 2AXGB 2I9TA 4DCQA 5C0FB 3CU7A 2G60L 3PDDA 3REWB 4OKDA 2R39A 5IP4A 2DKMA 4Z7NF 3MRBB 1HKLH 1E4XL 1AXTL 1T04B 1VERA 5EOCL 4RQQA 4HC1L 4M7KH 5JHDE 1J0YA 5D6CA 3GIVB 2N4IA 4FQIH 4OM0L 2C1OB 1R3KA 4EUPG 5DD0L 1ZTXL 2ZPKL 3Q5YA 3O6FB 2XZQH 4PRBA 3V5HA 4KY1H 3OPZH 4X0KB 5CZKA 2ZZUT 1A2YB 5HHMB 3QDJD 3V2AR 3AXLB 1W0VA 3SBWC 2F19H 3G5YA 5MENA 1WC7B 4PGBA 3V52L 1PG7W 3CVHA 4ZO6A 4F7EB 1ZLSL 3PWJB 1YNLH 3BPCA 3WDJA 3WXWL 3WFDL 1CXIA 4U7MA 4ZXBB 1C12B 3QPQD 4FABL 1FORL 1OF2B 5ENWB 1BOGB 2NY3D 1F3RB 1HINH 2VE6A 2W0FB 5HHXL 4H25B 4UAOC 3BPOC 4M61A 3ULVL 2GT9A 1HQ4B 4N1CA 1V3KA 2PTVA 5E6IB 3ZE0F 1SY6L 1VFAB 4NHUA 4FMFA 4JO3L 4YHOH 3LMJH 2YBRB 2WIIB 1N5YH 3NCJH 5T1DL 4L1HA 2XWTB 5DK0B 3EHBD 3DLQR 3IRPX 3GSNH 3R0NA 2XTJD 5E2UL 2NW3A 2AXHA 3VRLE 4YBQC 1JPGB 2KKQA 1E6OH 1I9IH 2VAAB 4WFED 4GKZB 3RBSA 4NQCD 3F7PC 5DJ0A 4IRSD 3X11A 4N8CH 1GZPB 1I1AC 1WIOA 3L1OL 4UNUA 2HKHL 1FC2D 4DTGH 5L6YH 3TCXA 3CGTA 3DRQA 4ZPVA 3JV6B 3HE6A 2UYLA 4DGYH 2UUDK 1SM3H 4HFUH 1R5WB 4E0RB 3RTQD 2WBJB 4Q9RH 2D31A 4D9LL 2XPGB 1X7QB 5DMGD 3EJJX 2MNUA 4ONHB 1SEBB 4G8GD 1YEEL 3O45B 5E94B 4XMPH 5BV7B 3U36B 2ZG1A 2IGFL 2XNAA 3DURA 3Q0HA 4QXTA 5KSAB 4M6NH 2EIZB 2LVEA 4JZJC 4X6DA 3VFMA 2HT4C 2VLME 5EH1A 5ACZB 5EUKB 2QQKH 5I8EB 1MJ8H 5KVEH 1N2RA 2DJSA 5HBBA 3O3AB 5I1AA 1OM3H 5CJQH 4CUCA 3G6JE 5IB4B 4MQXD 3W82A 1GSMA 3GJFA 1EO8H 4OB5H 5T5FL 4G3YL 4K3JH 4LCUB 5IB5B 2DD8L 1BFTA 2D0HA 5I9QB 4TSAH 2OI9C 3QEHA 2QADC 4LASH 3WXVH 2P24A 5DJXA 4K3DH 3IDMA 3G5ZB 3IETB 3C6SA 4NQXA 3WHXB 4OTXH 4X98B 5IG7B 3P4LA 2ZCLL 1BFVL 4Y4FC 4N8VB 4L8SA 4FRWA 3BPNB 2ADGA 3MRCA 1QACA 1MOEA 5E4EC 3MLYL 5E2WL 3TO4A 4YFLF 3PWNB 5EO9A 2EDOA 2EC8A 1ZA6B 4Z0XA 2KZ1B 1HZHH 3LHPH 4POZD 5IVXA 4UQ2B 4HFWB 4OF7A 3IKCB 1S9KC 3RVWD 1OHQA 5CEZD 1H5BA 5ILTH 3ET9F 4TVPL 4A2MA 1AKJB 4JKWA 2XY1A 2DWDB 1NDMB 3MODH 5DZOA 4HWEL 1KGCE 4FTVD 3O3DA 1UENA 3MV8E 2I27N 2ZWLT 1U8IA 1AC0A 1FCGA 4OFPA 1M4KA 3BVNB 1E28A 1GGCH 4C4KO 1OPGL 3QUZC 2DQJL 1CN4A 1G6VK 3DETC 4HAFA 5FEBA 3X12A 1S5HA 1Z9OA 1OAKL 4RAUB 4ISVB 3BOVA 3MTRA 4K07A 2VKWA 2FO4A 5D7KE 2P45B 4XCFL 4E41D 1QA9A 3TYFB 4LKCA 3MV9B 1DEEA 4UBDC 1AR2A 2HMID 3DUUB 1KEGL 2BNRE 1G0YR 4UDUA 4QTHA 1U95B 3S9DB 3VMPA 3OJVC 4OLEA 2UWEF 5FUOH 5IVZB 1CFTA 4Q7DA 4NM4L 3ESUF 5GPRA 4DUVA 3RY6C 2H3NB 3PNWA 1X5YA 3OKOB 3BO8B 1P9MC 3IT8D 1UQSB 4PS4L 5FYKU 1AGFB 2IAMD 4A6YB 1HKLL 2F5AH 1DQJB 4PP2A 1WWBX 4JHZA 1WFTA 4BUGA 4N0RA 5IQ9B 1HYSD 4M7KL 2BHZA 3ZTJG 4P23C 3NGBC 3DX9A 4X9HA 5DTFA 4M5ZL 3TBSA 4GW1B 3QEQB 3CH1A 4JQVA 1GGBH 5HHOB 2EE9A 2FLRT 2J5LB 4QHUB 1U3HC 2X4QB 1CIDA 4UIMB 4KJYA 5K9JH 1RZ7H 2XZQL 4I3RH 3M07A 4DZBA 3N0PB 4HQQH 3EIFA 5DRZA 4R96B 1L7TH 2AKRB 2JJVA 3DUSA 4F7MB 2I07A 3L5JA 2F19L 3HI1A 4ZUVB 5J9PA 4ZTPH 1BQHG 3EZJB 4NDMB 3T2NH 3QQ3A 1UEYA 1YNLL 4OGYH 4R26H 5E8NA 4JZNA 1RZJC 3OKEA 4V1DB 1BIIA 5FYLE 3MRMB 4LVOC 1FL3A 2JCCA 1VACA 1HINL 2BY0A 5BRZA 4KDVA 4N0UA 2IH1B 3MQIA 2MWCA 5FM4A 3MLUH 5ICXB 4S1SH 2X4OB 4YIQB 4LQFH 2D2OA 3LMJL 4UQ3A 4BZYA 4UOJA 5I1IH 3NCJL 5DRNA 3O3UN 2HVKA 4BQ8A 3S36H 4F37K 3IJSB 1I9IL 3LKPB 2GK0B 1NFDF 1T6WA 3CSYA 1V5JA 3P3YA 2K7QA 4WO4A 1CI5A 5FHAH 3BJLA 3HB3C 4DTGL 2V9RA 3OX8A 3AB0C 2CRYA 4DGYL 1SM3L 4LK4A 4HFUL 2C3GA 3DVFA 4R6UA 5GGTA 1IC5L 2PTTB 1Q9WA 2YUWA 4Q9RL 1NCBH 4ELKA 1FPTL 5TFSL 4YWGH 3HMWH 5DC0A 4YHKL 4DVBA 2IBGA 4KJPD 3VWKB 2LAAA 2FZ3B 1OTUC 1XR9B 2EH8L 1CICA 4M6NL 4O2CB 3MBEA 3KYNA 4KU1A 2NZ9C 5ID1B 2R2CA 4X9GA 4WV1A 5I76B 1MJ8L 4DGVH 4BM7A 5KVEL 1K5NB 1WBYA 5IR1A 5HPMB 5KW9H 1YQVH 1OM3L 2RIKA 5CJQL 3HZYA 2D03L 1MVUB 4LLDA 4NQED 5HGHA 5D1ZD 3QHZH 1EO8L 2VXTH 4K3JL 4E5XB 3MJ8B 4X5WB 4IS6B 2XWJA 3HZMA 3OXSB 1MPAH 4OCYH 1S7QA 4LASL 3KYMB 4X7FC 5EC2A 2R1WA 4OGAC 3WXVL 3INUH 4K3DL 5C86A 5BOPA 4UNVA 1LO3L 4MLSA 3MC0A 4OTXL 3BAEH 2IALA 3SKUD 1RJLA 3D69B 3CX5K 1A1NA 4P49A 2AJSH 4JFEB 1FBIH 5HGBA 5D7IE 1KLFA 3ULVC 5IKCA 3OR7B 5DD3H 3E3QC 2HFFB 1T22A 1ZSDA 3DVGA 5IUSA 2IPTH 1KFAL 1PLGH 2ATPB 3D0LB 3PV7A 4AENA 1SYSB 4PJAE 5JO5B 5ILTL 3TN0B 1P7KB 5EIQA 4GRWF 1CBVH 2V9TA 3BRFA 4F7CA 4KV5E 2ICCA 1TVHB 4FNLL 1HDMA 4PIRF 2P48B 3RJQB 2R29L 5MI0C 4UOW1 4PR5A 2WNGA 2VXQH 4Q74A 3BUYA 5ITFA 5IESH 3D0VB 4GAYB 5FYKH 2V5MA 1FH5H 5FKAB 2RCSL 4Y4KA 3S4SG 3SDAC 5DJ6A 2XYCA 3SDDB 2PO6C 3QXTA 3S88H 3CZJA 1F4XL 1CD1A 1KTDA 3NFPB 4WFHE 2M2DA 4AQOA 4HUWB 3NA9L 4GS7B 1JGUL 5SWZE 1D9KA 3VXUE 3IFLH 2PW2A 1MY7A 4APQB 3RBGA 4Y4HD 1X5FA 5ABDE 4PGDB 3MSPA 3D87B 5FUOL 1CGWA 5IROC 3EW3B 4XBPA 5C3LD 3RX5A 4NP4H 2P8PA 3KYAA 1ZT7A 1KB5B 4O5LL 4KDTA 3G6JA 2CDGB 2E9BA 1G7JA 2DWEB 2EYSA 3BN9C 1DR9A 2F5AL 1UZ8A 1RK0B 5B8CB 1PY9A 5I8CA 4PJ8A 1KXTB 5CHNB 4OKVA 5I6XC 4I18A 3S97C 3VCLB 3JUYA 2VLLA 3PL6A 1TQCC 1U8QB 4WI2A 1ADQH 1GGBL 4WEUD 3T0EB 3VI3F 4NO2B 4MAYC 4RGOH 1RZ7L 3FN3A 1AHWB 4NUJB 3LEYL 3MV7B 4XGZA 5E8EA 4JFDB 5C0AE 4M43L 1ES0B 2KQNA 4YC2B 1L7TL 5D1QD 1T2XA 4QRRA 1OGTB 4CN6A 3IGAA 5KSVA 2E3VA 4GLRI 5HYSA 1O5DT 2A6JA 3MV8A 4P4KB 5DHYA 5EBLA 3T2NL 4YHIB 3ALXA 3KLSA 1OB1A 4TSCH 3O81A 3C6LD 4R26L 5E5RB 3MNWB 1S8DB 2OXGA 2LTQC 2ORBH 2F74B 3JV4B 4NNYA 1L6ZA 1TJIL 1DBJL 4G6FB 1F6LL 3PABB 4QRTB 5BOZG 1JVKA 4QHNB 3BGMA 1F45A 3I6LD 5B3NA 3ARSA 1XEDA 5JPMA 5KSBE 3MLUL 4S1SL 4P2YA 1BZ7B 5I1IL 4G8IB 1H15A 3O3EB 3EJYC 3V0WL 2J4WH 5F7WC 1JGLH 2FL5B 1LILA 2OQJA 1EDQA 3PHQA 3ULUH 5AYQA 4L3CB 4WW1A 4PJIB 5FHAL 3H0TB 4LGRB 5E2JA 4X99A 1MFBH 2CRIA 4FFZH 4NKQB 4I0KA 3OAZH 4KTDH 5ANMB 4KHTL 2IEPA 3R06A 1A4JB 5DJ2B 4TUKH 4LMQI 3QXAB 5D71H 3L6FA 6FABH 4YWGL 3VGAC 1W8NA 3G08A 3LZFH 3HMWL 3UMTA 2KL6A 1MFDH 5TF0A 3VXMD 3GSRB 2ADFH 2IANE 4KGLA 4XI5D 3QQ9D 1YQ2A 3OKLB 1FL5B 3ETBF 3KDMA 3WJLA 1DLFH 3QG6B 1HCFX 1KEMH 2ZUXA 5KW9L 1I8KB 1YQVL 3QG7L 3OKNB 2QQQA 1ONQB 3DROB 5TH2B 3QHZL 5EUOF 5FIEA 4JZOB 5GRVK 4OCYL 3NIFF 3H9SB 2DTSA 5ICYB 3CK0H 4Y2DB 5A2KH 1L6XA 2GAZA 1WK0A 4KH2A 5HGGS 2FX9L 2BNUA 1IBGH 3BAEL 1NCAL 1RQ5A 4FMKA 2D7TH 4L5FH 2H32A 4LMQE 2VTFA 9CGTA 4NQVA 2DQGH 3NABH 4PRPB 4XRCA 1HNGA 3EHBC 2G9HA 1HI6B 4H5SA 5I16B 4FQ1L 3VXSB 2MPAH 1KIQA 3B83A 3O4OC 4Y19B 2BVOA 5E5MB 2IPTL 3NBNA 1ZS8B 1PLGL 2SEBB 3DV6A 5BVPH 2JK5B 2F54E 4Z78B 1R6VA 1UWEH 3P4NB 3H3KA 2IF7A 3CLEL 4XH2A 5HYJE 3HN3A 4MD5B 5IESL 4ZFOL 3QFDB 2JJSC 5FYKL 3X3FH 5E2VL 3KXFB 4N9GB 1CGSL 4U1JA 5KBNC 4QOKD 5DSCA 3QQ4B 3MRFA 3KS0J 4CNIB 3VXPB 1E27B 3KPPB 3ROLA 1INDL 3IXTA 1AIFA 3GM0A 3UTTE 3G6DH 3PHOA 5K59E 5JDJA 1NSNH 1L7IH 3SJVB 4GFTB 3VXNB 3IFLL 5D7JA 2IBBA 2PCPA 3QIWC 3SE4A 1U41A 4IBLT 5LG1A 4EDXB 5C0EA 5TE7H 4H88H 1JZ6A 3WUZA 4NP4L 1J88A 2H6PB 5FO8B 2CR3A 1K3IA 1HXMA 4MQXC 4OLYL 5IJKA 2RFXA 3RGVD 4K7PX 4Y2OA 4HHAB 1FNSL 3CH8A 5K9QG 2HWZL 3IF1B 4MDIA 2PXYC 2V7HA 3FFDB 2X5PA 1NGXB 4D94A 1GIGH 2Q8AH 2BC4B 2FR4A 4L4JA 4CL7A 3MNVA 4WCYL 1BHGA 2QTEA 4MQSB 4JN2A 2QSQA 2AEIT 5IW1A 3MXVH 1ZA3A 3QDJE 1ADQL 1N6UA 3SDYH 1Z5LA 1UXWA 2H45A 5D7IA 1IE5A 1D5XB 2BVQB 3OKKB 4FQXD 4MVBD 4BSVB 2FGWH 2W92A 1KJ3H 2APFA 1AQKH 4POZC 3IU4H 2F58H 2WAHA 1VFOA 3RVWC 3IDGA 2EDEA 1TDQA 4PRHD 1QQDA 3O3BB 2WINA 3MGOB 2Z4QB 2HTKD 3OZ9H 1UYWH 5F7KC 3S37H 5JNYA 4TSCL 2I24N 3BJ91 4LHUG 3BN3B 5I15H 5IMLB 5E56A 1T1YB 3K4DA 2MCPH 2EYRA 4HUKB 4PJ9C 3T4YA 4XCCH 1ED3A 1A1OA 2BJML 3V6OE 1HHGA 4ONGH 4PJGE 4NSKA 1IM9D 1GC1C 4P57A 3FFCB 3Q2CA 4M8QA 5SWZA 4WFEE 3V9FA 3VXUA 5I75C 4RBPH 2FRGP 1T7VA 4NNXA 4OZFA 3U2SB 2FSEA 1IAMA 2QQLH 4IRZH 5J6GA 3VW3H 4X9IA 1AE6L 4ZS6C 5DUBA 3T09A 1BFSA 3WNLA 3ULUL 3GMRB 2EDHA 1EAPB 3SKJH 4HCRA 2QSVA 4QEGA 1DVFD 5CLWA 1W0VB 2DI8A 3RVXD 4XAWL 3SE3C 3UTPD 1A7OL 1JNHA 5MENB 5MEOA 2DMBA 3REVA 4HKBB 1MFBL 4FFZL 4G8GE 4Y5XC 1JYVA 1ZVSA 4JO1L 3OMZA 1AGBB 1AXSB 1FO0H 3BPCB 1S9XB 4YHYB 3O4LD 3O9WB 4TUKL 5C9JB 2J6EA 4H1LH 1AXIB 3IU3A 1Y0LA 2OL3A 4LLMB 4LLWB 5D8JH 4CN1A 1ZLWH 2VE6B 5KVGH 2FO1A 5CEXA 4MXVE 5GGQL 1MFDL 2EDTA 4K3EH 4M61B 2GT9B 2ADFL 1T1WB 5DZNA 3ARFA 4GAFB 5C0AA 2VR5A 3PWPD 4W70A 3SY0B 4GBXD 3TVMA 1IAKA 4LEXH 3UTZB 1DLFL 5GSRA 5CJXA 2NW3B 1KEML 1NGZB 3WUWB 1A1MA 2NX5E 3LQAH 1HEZA 3PGDA 1FAIL 5I71B 1TITA 1U8KB 1WFOA 5EZOL 4XCEA 4YXLH 3BISA 4HBQA 1NBYA 4GAJH 3ZKQD 2EZ0D 3RUGF 1GHFH 2QLVB 3MLZL 4M62H 3DRQB 4OLZH 4ZPVB 2OZ4H 1GCFA 1IBGL 5FKPA 3S7GA 3HC4H 2W9LA 4TTDD 2NYYD 1ZHKA 2D7TL 2Z31D 1VGKB 4L5FL 1I7ZA 5KSBA 5CEZE 3VJ6B 1A64A 3BP4B 2RBLA 4KHXH 4QRPE 2VAJA 2D31B 4RMQA 2DQGL 3NABL 1HHKB 3NZ8B 3MFGB 1UWXH 4FTVE 4JY6A 4BZ2H 2MPAL 3KGRA 4YDLC 3STLA 3TEUA