3JWOC

Structure of hiv-1 gp120 with gp41-interactive region: layered architecture and basis of conformational mobility
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
184
structure length
184
Chain Sequence
MKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords HIV-1 GP120 ENVELOPE GLYCOPROTEIN
publication title Structure of HIV-1 gp120 with gp41-interactive region reveals layered envelope architecture and basis of conformational mobility.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05790 C2-set Immunoglobulin C2-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jwoC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jwoC02
4U6VH 4P3WA 1KBGH 5DRWB 3LRSB 4LMQI 3GNMH 3QNYA 2OX5A 5DQ9B 1SMOA 1B4JL 4XC1H 1LVEA 1ZVSA 3D3VB 3Q1SL 2IPKB 4NYLB 2UVEA 3RIAK 4PJ9D 1I7ZA 3WKNA 4QRRD 3GJFA 3HG1E 1OTUC 4ZMAT 2ESVA 3DX7B 4YIQA 2HLFD 5IV2B 3TH2T 1X5XA 4P46D 1MREH 3PHQB 1F3JB 2QV2A 4JFQA 1HXYA 1MNUH 5ICXA 3BVNB 4F9PC 1CICB 4JY5H 5DRXA 4PFEA 4ZUTB 4ZSOB 1EAPA 3DHMA 3RGVB 4Q2ZB 1OLZA 1U3JA 4OQ1A 1HSBB 2FH6A 4C55A 1G9NH 2J7LA 4MD4B 4FQQA 1EFXB 3C5ZC 2R2HA 4N9GB 4NRXB 3PJSB 4ETQA 2XACC 4R26L 4CVXA 4DN4L 1KIRB 5ITBH 2AAVA 5CJQH 1XGYL 4EDXA 1HDMA 2R0ZL 5ENWA 1QFWM 1A7RH 3HI6H 3C5SB 1INDH 1HHHA 3G5ZB 3GSNA 3RVVC 2Z31D 2X89A 3RI5K 1NCAH 4A2LA 3HAEH 3RWDA 3ZDYF 3TBVA 3VG9C 3FO9B 5DQJA 4PJAB 1CGUA 2AGJL 4GKZB 5T5FL 3T1WA 2ZUTA 1WWAX 1N59B 4H1LH 1NEZA 1VFOA 4Q58C 1Q9LB 3FN0L 3LB6C 3RWIA 5JQ6L 5LWYL 3BRFA 2EDJA 2YPLD 1J0YA 1V3MA 2V5SA 1KXVC 3NN8A 2NY2C 5F9JA 3MCKB 1KTDA 4PJBF 1W0VA 3W39B 3TJEL 1G7JA 4U2ZA 1MEXL 4FQ1H 4JFYA 5ESVA 4X99A 2HT3C 3GIVA 3N1MC 4X6EA 4L4VB 2FL5B 3O3UN 3SDAA 2VABB 3FT2A 3H8NA 4PJIA 1ZANH 3EKCA 3PIQB 4DFHA 2Q1EA 4KJPD 3U0PA 2QQNL 4F37F 3MRNB 1FO0B 1LNUB 3O9WC 3RU8L 5IQ9A 3JUZA 1HQRA 2AXHA 4HX1A 3BKYH 3HHRB 4LQFH 1QSZA 3T4AB 4Z8FH 4S10A 4X4ZA 3RBGA 5DJZB 1QVOB 3KS0J 4WJ5A 3QDHA 4IDJL 4PJEF 4YR6B 3VFSB 1RULL 3T0DA 2L7JA 3ULVL 1CG9A 1H15B 1NAMB 3KXFD 1YUHA 5K9QI 1BJ1H 3VU2A 3O81A 5EU6D 3P77B 1ZTXH 1FE8L 1I1FA 5EO9B 3O6LH 4HK3N 3BHBA 1T83C 3FFCA 4U2YA 5KSBF 3MRFA 4HUXB 3HRPA 1Q72H 1WIUA 3MRQA 4OKVA 1GC1H 2H26A 4QLRA 5TQ2L 4DKFH 3W2DH 1U8QA 5F8QC 4HPOL 4JVPA 4K71C 1VGEL 3RZWA 1AQDA 2GSIB 4XNXL 5D2NA 2CUMA 3QJHB 2C3WA 3HI5H 1K2DA 4Y4FB 2BHZA 1K4CB 7CGTA 3S35L 5ISZD 5A2IH 4LIQE 4W68A 4HPYH 2D7TH 3D9AH 3QZWA 4EUPA 3N85L 1R5WB 3IKCA 2ICEA 5DYOA 2DKUA 2ADIA 1D5XB 2L4OA 4Y4KC 3UTPD 1CFNA 5BS0E 1N5YH 4PRPD 1PKOA 3H7BA 3P30L 4Y19E 3RVXC 3P4NB 4F9LA 4F2MA 1JNHA 3RFZC 3HZYA 3ULVE 1YEGL 3C87A 3JV6B 3HC3H 4Z95L 2GI7A 4LCWA 2K1MA 4M6OL 3BPLB 4MXWL 1HSAB 2M8XA 4N0RA 5DFVD 4LK4A 3KWWB 3HAEG 4WUUE 4LHUA 1H3PL 1TITA 2DWEA 4I3RL 2JELL 5F21B 3NIGF 4H1LG 1ZLWK 5ESAA 3OG6B 1XR9A 1FIGH 1JRHL 5IESH 3MTRA 4NKOA 4XZUB 3MRIB 1KCRH 4WFFE 1FP5A 4QXUH 1UWXK 4PJFA 2JK5A 5D5MF 1QO3B 3KPLB 3GMQA 2J8OA 3IFNL 4YBLB 3GMLA 4R7NA 2NCMA 1YY8A 2F58H 3O6FB 5IW6B 5EFIA 1OAQH 4M8QA 1T22A 3KPSD 3IJHB 1ONQB 3B9DA 1CZ8L 2WINB 2VUYA 1VENA 1JF1A 3OSKA 5FYLH 2IQAA 1K9TA 1LO0L 3NA4A 4JO3H 5A2FA 4OBSA 4NQDB 4HK3J 3W11C 3STBA 5ALCL 5J1SC 3GRWA 2GEEA 1G7LA 4PUBL 3P4MB 5I0ZA 1QYGL 3BP4A 3MV11 1FORH 2YMXL 1JWSB 4JVUA 5I76A 3RZCB 3ZE0F 4U1KB 2Q7YA 2VDRL 2OLDA 5D7JB 3C60B 1MHHB 4J3VA 3LRHA 1KJ3H 4ODHH 1ZHLB 4OLWH 4DVBB 3D48R 5A3IC 3O8XC 4G42B 4LSTH 4M9PA 3L6FA 1J05A 4NBXB 5JNYA 3LAFA 3QEGH 1MHPL 2DQJL 4TNWK 3ULVC 1U3HA 4GQ9H 1YEFH 4HK0A 4GBXC 3O3DA 1OPGL 4UV4H 2GAZB 5I9QC 3VJ6B 5KS9B 3TN0C 3GHBL 5HVFB 4FQHB 3OKNA 2X4NB 3QCVL 3VD7A 4EOWH 5IM7A 1S7TB 1AD9B 3UTQB 4D0CA 4WW2A 2Q87A 3QUXB 3I02A 1RZKC 4S0TD 2X4RA 3KYNA 1IGFL 5DMJB 4OUUA 4ZNEE 2XA8L 4XNZB 4P57A 4OD2A 2PXYA 2NY4D 2R4SH 4HCRL 5DMGD 1QOKA 4TOYH 1VGKB 5K9KB 1MH5B 1W0WB 4WWKA 2V17H 1I9JL 1E28A 4HS8H 4R4BB 1JGUH 1X7QB 1A6AB 1WAAE 2EE3A 2YR3A 4HIEA 2MJWA 2NY7L 2AV1A 2P48B 5HGHA 1LO5A 2H2SC 5HI5C 3QIUD 1CXKA 5HHPB 4U6XB 2AJSL 4K23H 4PJHA 3MREB 4KVCH 4HUKB 5GQBA 1MVUB 1HH6A 4MQ7A 5CEYA 1H8NA 4QHLA 4PB0L 3P9MA 4M93C 5ANMA 3RQ3A 3KLDA 4JANB 4LLWB 5MENB 4ZFFB 1WTGT 2NXYC 2Y6SC 3HE6B 3MJ7B 5MERA 5I6XB 1MRFL 4U05A 1WWCA 3MBEB 2YUWA 3PABB 3ARZA 4JKPL 5DUPL 5IB3B 1DSFL 3BKJL 4QXTA 4IRZH 3SDCC 1G6VK 1LMKA 2E7LA 4ONGH 4H20H 5EC1A 3X17A 2WQRA 3LHPH 3BH9B 2DTMH 2XRAH 4FA8A 4Y1AA 4X5WA 1WEJH 2CLVB 3MRCB 4N90D 1OGAA 4FQXC 4ZS6D 4HS6A 5J6HA 1QBAA 1K6QH 4B50A 1FNLA 3JWOH 2R39A 5FGSA 4EI5D 4JREC 3IDJB 1RK1A 2H32A 1KNOB 3FO2B 1XZ0A 2BCKA 3OWEA 4KTDL 1G7HA 3GSWB 2EEBA 2B1AH 5C0BB 2P5ED 4CU7A 2F5BL 3OJDB 4HIIB 3CFDB 4KJQD 3FOMA 5AAWA 4E5XB 3FT3B 2XWTB 2WUCH 4WI3A 1IM9D 4XVJL 3IU3A 2NTFA 1A7BA 4MNQD 4CRPA 2HMIC 3D6GA 3GKWL 3TV3H 5IFHH 2BJMH 2ZCKH 5EA0L 3SE9L 1GGIL 1T04B 2BNRD 3MRKA 3U1SH 5D96C 1T5XA 3EDEA 2YA0A 3BUYA 1UH2A 4PRNA 3TO4A 1BGXH 1L9NA 4NZRL 4AIZB 2AERT 2VLME 3I2CL 1TNNA 5SWZE 5ACZB 3NGBB 3JV4A 3UTZA 4F7MA 3CMOL 5FHAH 1JYNA 1YNLL 3SGDI 5EU4B 1FVDB 3QIBA 4X7TA 2J8UE 3HE7B 3PQYA 3SGEI 2VLJD 2VXQL 3B8YA 2GYSA 2E6QA 2WWMD 5D1ZB 4XWOD 4TUKL 3KDMA 3MOAL 4F7PB 4UILH 5HGBB 3OJVC 1VPOH 1Q9WA 4RWYL 3TA3B 2A6IA 4PG9B 4BQ9A 5HJ3B 2AK4A 2F74B 2X4PA 3U2SB 1JTOA 5J9PA 1AY1H 2FX8L 4YFEA 2Z93B 2A6KB 2VQTA 4HKZA 3VXPB 1EEYA 3FRUA 2GT9A 1I1AD 4HBQA 4QYOA 5FM4A 1AE6L 2E5EA 4KTEL 3BX7C 5DEGA 3EFDL 3IAGC 1HHJB 3VI4F 3QO0B 2EYRA 4XHJC 1IC7L 4Y2DD 4AMKL 3VFPA 3GJEB 2Q6WB 3EOBB 3L5IA 1BOGA 4JO4L 4IRSB 4NUJB 4J3XA 3UTTA 4CW1A 4Y5XB 5KJRH 4GRLA 2VAJA 4KDVA 2QKIA 3PWVA 4WTWA 5KG9B 1NGZB 4WTZG 2P24A 3WJLC 1RIUH 4ZOAA 4AENA 2NQCA 4AL8H 4PJ7A 2EXWD 1EH9A 3WLBA 1U8LB 3MYZA 3JTTB 4HWBA 4IJ3B 1X5YA 1CBVH 4TSCH 2OQJA 1IQDB 5DRZA 2NW3A 2Q3ZA 4L8SC 3HN3A 3P11H 4QTHB 5TDOB 4XVSL 5HVGB 5L2JA 5B39G 5D2LA 3QPQC 2RCSL 4HJJH 3HZVB 4EVNA 5T3XE 1MJ8H 1FL6B 1RJCA 2VLRE 3Q5YA 3PWJB 4EN3A 4I1NB 5KVFL 3L5XH 3QQNA 1CE1H 1F5WA 4FTVA 1FZOB 5FDWA 1CFVH 5JHDD 1YYMH 3H9YA 5TE6L 1CLOL 1LP9A 2DI8A 3GMPA 3HS0A 3QUML 1MIMH 4HEME 4IS6B 4P2RE 3KLSA 5L6YL 2FO1A 2IAMB 5CSZB 4HFWB 1NL0H 1F4XH 1QLRB 4PIRF 2R9HD 3OB0K 4K2UL 4KMTH 1GIGL 2IGFH 5DJAB 1Q8MA 4GRWB 1FG2B 2GK0A 1MCHA 1B2WL 3BKCL 4WEUD 4AQ1B 2R8SH 2ESVD 2ZUVA 2OL3H 2V7NB 5HHNB 1ZT4A 2AQ1A 5CGYD 1URLA 1DBMH 5MP6L 2GCYB 2VH5L 3CC5A 1F11B 3U4BH 1T1XB 4GLRH 2J88L 4PJCE 4U1IB 3WMSA 1NGYA 4JM2C 2O5ZL 4DAGL 4QRPB 2E8YA 4NNXB 3TBWB 3M8OH 3W9DB 4DZBA 5IBLC 1GGTA 3CXHJ 5K59F 4Z76B 1A2YA 1ZT7B 5E70A 4LSVL 3MV7E 2CLRB 3BP6B 3LIZL 2R0WH 2NYYD 4HKXB 5JPMB 3BSZH 4HFUL 4TUJB 4CN1A 3STLA 1EHLL 1IGYA 1ZSDA 1I85A 5DA0B 3LMJH 3LD8C 1NAKL 1QNZL 3GMOA 2X89D 4NNYA 4JRXB 3SDDA 1N4XL 5GHWH 1ITCA 4ZQKA 4Y5VC 4G43A 4NGHL 3GMMB 3GB7A 2APWA 4APQA 3UP1A 3AGVA 4TYUA 1TTFA 1BX2B 4PY7B 5CJOH 4XPTH 8FABB 5I1JL 4F3FA 1A1NB 3QFDB 4U1MA 3PWNA 2X4SA 2EDTA 4KK5C 5JLZB 1AGEB 3QDGE 2EDNA 2VLKE 3O6KL 2BRRL 4NNPH 5F6HI 4CADB 3SDAD 2YA1A 2HRPH 1XIWB 2IEPA 3MJ9L 2VUOA 3FJTA 4G8GE 4XXDA 3QHTC 1K8DA 1XF5B 1X5JA 3D0LA 3VWKB 3RUGB 1KPVB 4V1DB 5KVEL 3V5DB 2FBJH 1N7MH 1WBXB 1D5BA 1T66D 3MJ6A 1FJ1B 1MWAA 3BQUA 2ADFL 3WFBH 1GJIA 2J5LB 4B5EA 4NRZA 4XP9H 1SMAA 2Y23A 3VE0A 1S9XB 1FYTB 1Z3GH 2VE6A 4Y5YA 2XTJD 1S5HB 1WT5C 3HZMB 2FGWH 1U92A 1SQ2N 2APXA 4ZFOL 4IRJA 2CDGA 3FFCD 1SYSA 5FM8A 4NQVA 1CIDA 2P8MA 2OTUB 4LDOB 3GZKA 5TDNB 2JCCA 3SCMB 1BFSA 1EGJA 2XICA 5CFHA 5KVGL 4D0DA 3ETBF 4KXZI 2VDPL 1A7QH 2X7LA 3UTSA 1T5WB 2R0LH 2CUIA 4H88H 1DVFB 3H0TA 3QZWG 4OCMC 3CVIH 1A6UH 4U33A 3ZL4L 4Q9RH 3P9LA 3V6ZB 5HPOA 4K7PL 4FG6D 1H3WM 2NR6D 3ZZ1A 1HH9A 1I8LA 1NMBL 1PFCA 5DUBA 3E2HB 3PHSA 2ZCHL 1U8IA 2NY0D 5EC2B 4OGXH 2OZ4L 4MVBC 3FQTA 4GRMB 5FKPB 4YO0A 4K8RH 3Q2CA 3X14B 1HK6A 5C0CA 1NGXB 4LHUG 3TCLA 5CUSL 4UIKL 4LCYB 5IHZB 1L7TL 4M03A 4N8CL 2QSCH 4LCWD 1RZGB 5E2UH 1WFTA 4OZFA 1V8HA 4Z7OE 1X5LA 4CVZB 3WDJA 4LHUD 5EOTA 3CDFA 3OXSB 2O61A 5E2WL 1F6AB 3O4OB 4J8RA 3VH8A 3U9PH 2EIBA 1HYSC 3OKMB 1AXSA 4H26B 1EVUA 1H0DB 2H1PL 3VXUA 3V79C 4OM0L 5E8PA 4BJLA 1NDMA 1F90L 1YJDL 3HA0A 2QADC 3ILPB 2YPVL 5LCVH 4U6YA 3WKML 4EXKA 4MDIB 1FFPB 1OD7A 4TPRH 4YDVB 4NHCL 3O11B 2XPGA 4BSWA 2UUDK 5HHQA 3UYOD 1F4HA 2W59A 4MNGA 3MRRA 5EIVA 5EO1B 5FO7B 1IGIL 3ULVF 1MFCL 5IVZA 1CF8L 3P73A 4XI5D 1FNSH 5J13C 4RBPH 1P1ZA 5I1CL 4I18B 5IMKB 5DJCB 5HSFA 2P5WB 3ARPA 4UUJB 1MHEA 4Y8DC 1AXTH 3PF2A 1N6UA 3D1MC 3PL6A 4HWZA 4WCYL 4NN6B 5TF1H 3OXRB 3K2UH 3BN9D 2AEPL 3IJYA 4YQXL 2WWKO 2YSSA 3DO7B 4R2GB 5KAQF 3EO9H 3RPIA 2WK2A 4X4XB 5GISL 1WIOA 1G7MB 4NM4H 1XMWA 3VFOB 1L7IL 3NABH 5HGDA 3NZHL 4MCZA 4OLYL 3L3GB 4NN7B 1QR1B 3LCYA 2C1OA 5HTSA 4YUEH 3ARUA 1W8OA 5FF6A 3A6CH 3L7FA 4K3DH 4HG4K 1U3HD 4GXVH 3DSFH 5TH2A 3KYMA 5IVOA 2BSSB 2DYPB 4JFEE 4FFYL 3OZ9H 5ESQB 3C6LC 1R3IH 3HKFA 2IH3B 4XP4L 1C5CH 4P2OC 4U7KA 1JPFA 2VSCA 4YEEA 1BD2A 4JQVC 2R23B 5AUMA 4XVTL 4E41E 1J8HA 2X4TB 2PXYD 5GGQL 4BSVA 2FJHB 4L1DA 3ZDXE 4XPAL 2W0FA 5FO9A 1MRCH 2DLFH 5LBSH 1EBPA 2EE2A 3IDGB 1OAZL 1OP9A 1VFAA 1U8HA 5K9OB 1KIPB 3IFLL 4ODTL 3MSPA 4BFGA 4JHAL 4O2CB 1SBSL 4WO4A 3WFCH 3NVQA 5JDSB 3DRQA 2QLVB 4NHUB 4HV8A 4L4TB 2DQCL 1NLDH 2XQYK 4K94L 4KK8C 4JY6B 2HJKB 1H5BC 3O3EA 2EDBA 4PLKC 1Q94B 1RZ7H 4XMLL 5ICYA 4HF5H 3CMGA 5JZ7D 4H0HB 5TQ0H 4NT6A 5TDPB 1OGTA 5GIRB 2F53E 3I6KB 4TVSa 5C0AE 1WVZA 5AWNH 5DDHB 4PJGA 3WHE1 4LGPB 3IVKB 3C8HA 5FUCE 4JPVL 1Y18B 4GQPH 5I1LA 5E6IC 2HWZH 4YDIL 1BFVL 4YBQC 1JYWA 4ERSL 2EH8H 5FUZL 1TZIB 2CMRH 3MODH 3D3VE 1RAMA 4C56A 1IL1A 1M05A 4L29A 1LE9B 1PLGH 1VERA 3DARA 1IKNA 3OV6A 4FXGB 2AW2A 2Y9RT 4GAJL 1FDLL 5HYJA 4HH9B 3T08A 1FZKB 4I48B 2VNCA 4P4RB 4PTUA 5KSUB 1NUNB 3EGSB 3RPKA 1CL7L 3NCEB 4PTTB 2YN3A 5CINH 4LU5H 2YC1A 1DN0B 4RSVA 4Y1AD 3BXNB 1OGAD 4CJ1A 3NBNA 3W5NA 4OCYL 4ZSOE 4UT9L 1FO0L 5T1KB 3M1BB 2CGRH 2D7PA 4NKIH 1IAIM 1LO2H 3B9KC 1FAIL 4BUHA 4Z78B 2DAVA 2W60B 3MFFB 4CNIA 4DUVA 3X12B 4JAMB 5BQ7B 2WIMA 4Z77B 1NAML 3QIWC 4PV9B 4F9PA 4M7LL 1IAMA 2P8PB 5T1MB 4OAWB 2YZ8A 1BJ8A 4Q97A 3QWQB 2ADJA 3MGOB 1MI5B 1CT8A 1I8KB 3OL2A 3U30C 1LE5B 5I2IA 3QWOB 4K9EL 3C5ZA 4NWUH 4K7FA 3BMVA 1TVHA 4Z5RB 1NBZA 4S1RL 5F1IA 3ARBA 4PJAE 4WNQB 4Z7UF 1QFOA 3HUJE 2DQDH 1T89C 1C7SA 3V7MA 4FQJL 1J8KA 4XTRC 3TO4D 5C70A 3P4LA 3MRJA 4WWID 3BE1L 1DL7L 1S9YA 3G5VB 2MCPH 5DK0B 4ZPTA 4Q9QL 4CJ0A 5CEZL 2NXZC 4QHMB 4HWEH 1N2RB 4L4VE 3SKJL 4YJZL 1UQSA 1WFNA 3BYYA 5FUCC 5IWLC 1JZ2A 1U58B 4XP6L 1KEML 4ZO9A 3NCFB 2V6HA 2YD6A 1HHGB 3NACH 3QIBD 2Q8BH 4HQQH 3PQYD 1JGLH 2OK0H 1RJZA 1KXTB 5E2VH 5D1QB 15C8L 2KQMA 3BO8B 1XCQB 3CUPB 5E8EB 3SHSA 3UPCA 4AYFA 1FVCA 1JZ5A 3KPRB 2ARWA 2VL5A 3WD5H 4V2CB 1I7RB 4XWGL 4YDKL 3P0VH 3UX9B 1QSFB 1QPPA 4OLUH 3FONB 4HXBH 2VDML 1IARB 3ROOA 2F19H 3O9WA 3PE9A 4JFDB 2AK4D 4G9DB 2P8LA 3IRZA 3S96A 1FHGA 3MBXL 2PR4H 2JIXA 3PHOB 4YE4L 3IU4L 4MXVE 4UT7L 1YMMB 1IJ9A 1U8KA 3EOAB 1D6EA 4L8CB 1MRDH 1AQKH 1H3XA 5D1XC 1DQLH 5IIEA 3OAZH 4R3SA 4KVNH 2DBJA 4YK4B 5GS0H 1AIFB 3U36B 5T1DH 2OM5A 4XC3L 1YQ2A 1ZGLP 3PWLB 4KKLD 2J8UF 3ARWA 1T83A 5C0FA 3VFTB 1QQDA 3EYOA 1NGQL 4GRLD 2IANA 3RNKB 1KPUB 3DMMB 2DBLH 3SO3B 3C09C 4DVRL 5HHME 5C08E 4P9HC 5EZOH 4JZOA 4X6DB 5CLTA 5CBEA 2KH2B 5C9KA 5F9WB 4Y4HC 3GMNB 3GIZH 4W81A 2ZSWA 2FWOA 5A2LH 5F88A 2EZ0D 2JJVA 4ENED 3MRBB 4N8VG 5J3HD 1WZ1L 4YX2H 3CK0H 4EN3D 2KZWA 4KI1A 1ZKAA 1FAKT 5C71A 3FO1A 1NBYA 3PXHA 4FTVD 5EBWA 4X6CB 3RA7H 2W0PA 4MA3A 4LKXA 3G6JA 4ALAH 1A7NH 2ZNXA 4LKCB 4BFEA 4OFDA 4HLJA 4UQ2A 2CD0A 2EC9U 4KJYB 5F1NA 3UXFA 1FNAA 4PJXA 4LLVA 2ICWB 2FEEL 1A9BB 2GTZB 5DD0L 3ROLB 5LQBL 3BPNC 5I1DA 1KTLA 3N0PB 2EECA 1A21A 1U9KA 4K9EC 4OI9A 3QWRA 5KOMC 3T1FA 1MCQA 1GCFA 2VDNH 4U6HB 5C0IA 4RAUA 2B20A 5TGBB 3IDXL 2AJYH 4MB5A 2W9EH 2QBWA 2DQFA 5T3ZL 1UG9A 5SWQA 2APFA 4P23B 4U1NA 4JKWA 1XGTA 3GGWA 3FCTB 4KKNA 6FABH 1WLHA 4FMFA 4ZTPH 4NQDE 5J6GB 5J1AB 1VA9A 2XNAA 3MLXH 1FH5L 3MQIA 2A2QT 4BZ1H 2ZZUT 3FRPA 5BRZB 3W9EB 1H8OA 4NBYB 5CD5D 1QEWB 2BSTB 5C6WH 4XNMB 1IM3A 4YXKL 2YD5A 1L0YA 3KNBB 4KDTC 3L7EA 3VXME 4OLVL 5DJ0A 3T8XA 3UBXB 3VRLE 5LAXB 3IDYB 5D6DC 5HI3D 3K1KC 1F4YL 1QRNE 1K5NB 5F7DB 3SDDD 5CWSB 1WBZB 4TUOB 2C4XA 1VACA 2WANA 3O2WH 4OZGF 1I1RA 3W81A 1I1YA 4APQD 3M07A 1D5IH 4S1SH 4ZUWA 1G9NL 3BP5A 4TTDC 3TBSA 1N64L 4HLZG 5D70L 3V4PL 2J3SA 4W4OC 4PJCF 4XP1H 4LVNB 2LQRA 4LLMB 3BWAA 2HFFA 5BO1L 5AG9A 4RX4A 5C0NC 1SJXA 2DD8H 2MNUA 5T3ZE 1HXMB 2CJUL 2DQGH 3GKZA 3HI6L 1U91B 5DQDL 1RPQA 1X44A 2YKLL 3MOQA 3PP3K 1NCAL 5JW4M 3FAWA 1R5IA 4U1HA 5IVNA 4WUUA 1GPOL 4ZFGH 4NO0A 3VMPA 1T3FB 3ARQA 4U1JA 3BQUD 3I9GH 3MNVB 4OFKA 4X9BA 4FRWA 2DMCA 5EZJB 4JG0L 4FP8H 4BFIB 4PJ9B 1TJIL 1E4KA 4HC1A 4QRRB 4JQIL 3MLTB 4MQXC 4LSRH 3DNKA 4MXQC 4S2SB 2DLTA 4IRJD 2LAAA 2UV3A 1R5VB 4P46B 4DW2H 4JHZA 5MENE 4NZTH 1CL7I 5ID0B 1AR1D 2O5XH 4UIMB 4U1LA 4G80A 3QRFM 4WFHD 3ZT6A 4OCXH 1A3LL 3TT3H 4QRQB 5CJ5A 3KPQB 2VXTH 1UCBL 2YEZB 3ULSB 4LQFL 3DYOA 3INUL 5ELIA 5F7WC 3RZCC 3UTSD 1IC5H 3EW3B 4JDTH 3EYVB 3QUKB 4DGIH 4P2QA 1P7HL 4KKBD 4PRHA 5D7JC 4GKSA 4LCCB 5HGAA 3ULUD 3MRGB 2V5RA 3IF1A 1HYRC 4HJGB 1FNGB 4OD1L 4O5LH 1ZTXL 4JR9H 4HGWA 5KSBB 1KLUB 1RJLA 1FC2D 4M4RA 5GRVL 2VJXA 5DJDB 3B43A 2ZP0T 1TJHL 3TESA 2VSDA 2Z31B 4KY1H 1R24A 1Q72L 3SDCA 3WL9A 3CSBA 5GS2H 4DKFL 2QQKL 3TPUA 2CIKA 3W2DL 1VEMA 1VHPA 4OZFG 1T2JA 4FFVD 5L0QB 3GM8A 1LDPL 4BFBD 2OSLA 3AUVA 5C0CD 1NCBL 3NOIA 3F62A 4MMZC 3STZA 3VH8G 1DR9A 2KQNA 4WHTB 2XWJA 1IE5A 4FQXA 1GOHA 1M7DB 5TE7H 3ZYOA 1ORSB 2Q3AA 35C8H 3H6JA 2ZOKA 4M62H 3OKDB 2D7TL 2ATKB 1OAXH 3FQXA 1BF8A 2ZUUA 3B8SA 4KUCD 3MMEA 2J4WH 2MFNA 2BVOB 4O58H 4Q6IA 5C1MB 4ZNEA 3QEHA 2EYSB 4X98B 3BT2H 2NY3C 3VXUD 43C9B 3MRMA 2OCFD 2Y07H 1NCCH 2Y4SA 1T6VN 3VXRE 2NNAB 3HR5B 1CTOA 1T2QH 4YDLB 4R7DB 5HBBA 1EAJA 1LK3H 2R29L 3KXFB 2L0DA 3HC3L 4QRTB 4F33B 1DUZB 2NY6D 1I8IA 2Z4QB 3LKSB 3O3BB 4UT6H 5EU6B 5BCAA 1NJ9B 5IFAL 2H8PB 3MCG1 1KN2H 3V8OA 1Q9KA 5CHNB 1ZA6B 3MBEC 1G9NC 4KTYA 4LNRB 3IJSB 5FCUH 3FQRB 5EBMA 4LARL 1RK0A 1I7TB 2BVEA 4IMKC 1XF3A 2KKQA 2DL9A 1CFSB 3D2UA 3LS5H 1YMHA 1FIGL 1MJJB 5D5MB 5IESL 4C83B 1J11A 3WNMA 3PL6D 5H35A 2ZUXA 4X0KA 4LLDA 2AXGA 2RFXB 4TSBH 2FSEB 4ONFH 1JWUA 2B39A 1MFAL 2A1WH 1TCRA 4KZDH 1HI6B 1MLBA 3DUUA 4KQ3L 2F58L 5DHYB 2GKIA 1MFDH 2BNQA 1W72H 2QSVA 3SQOL 5ISZB 1OAQL 3G9AB 4KDWA 4NBZB 2DIAA 3S4SA 5FK9A 2HJFA 3WEXA 1P7QA 4TSAH 4X6BB 2OP4L 1FRGH 3GUTB 3RIFF 3F5WA 1FYHB 2IALB 1MFBL 5JW4Q 2LU7A 4Y8AA 3QA3A 4YPGB 4YFDB 2GIYA 1ZA3A 1BPVA 1EHAA 3SPVA 1RIHL 2G60L 4OKDA 5EOQL 9CGTA 2VKXA 2GJZA 4HSQA 1CE6B 4KKAC 1WC7A 1J1PL 2V2WA 1BD2D 1FORL 2UWEB 4OIIL 3WS3B 5DGQA 4JB9H 4ZXBC 2PNDA 1J8HD 4I2XA 3WIHH 1HIMH 2IPUK 3R0MA 4OLWL 3IDIB 1NSNH 3DTXB 3SY0B 3QEGL 4WO4D 5GSRB 3MLSL 4QOKA 4GQ9L 1YEFL 1ZHBB 4OQTL 4UV4L 3C9NA 5K9QG 3RVWD 3V6FA 4P3CH 4M7JH 4G6KH 2J2ZA 1BIIB 3QSKB 5TJWK 3ARFC 1FFNB 2FEEI 1FFRA 1XF1A 4YHIA 3WJLA 4WEMB 4DQOH 3LN5A 2HVJA 2PW2A 4HXAL 3HE7C 4ISVB 2BSRB 4NO5B 3QXDB 1GC1C 4LCIH 4FQPA 4L3EA 1L6ZA 4R4ND 1U8OA 1G6RH 3WSQL 2IWGA 4FXLA 3KPSB 3K4DA 3D85A 5SWZA 5F93C 2KDGA 4L8SA 3BKML 4LSQH 3VD9A 5D1ZC 2R4SL 3Q6FB 5AZ2H 1RMFH 1VCAA 3ZKND 1TNMA 4LSUH 4W4NA 5TFSH 4X7SH 5HYSA 4HS8L 4C56D 3TA3C 3MA7B 1MY7A 2Q20A 5E4EB 3WCYA 5CCKL 2O26U 1QFUH 5HYJD 4GRWE 1XGUB 3GJFH 3LEYH 2EDOA 3KJ4B 5IW1A 4KVCL 4JKKA 3TT1H 1QBML 1T03H 1D6VH 2C7UA 4J3OC 5FYJD 3O2VH 1AHWC 1QSEB 1MELA 1MCNA 1CWVA 3VXQB 5JDJA 1OTUD 1H3VA 3RVTC 2GUOB 4Y5XC 4OZHB 3WV0A 1YN6A 3DV6A 2DJSA 3SOBH 2DKMA 1OAYH 3U0TA 3VD5A 3E6HA 4IRZL 3Q1SH 4ONGL 4JDVA 4GMSL 3MV9A 3IYLW 5ICZA 3LHPL 4JM2A 1NFKA 5DC4B 3F7YB 2N1KA 1XGRA 1SJEA 5IJVB 2DTML 1HHKB 2NY4B 3OKEB 3HRZA 3C5ZD 4L9LC 3QCTH 4I4WA 1R3HB 3HMXA 4D2NA 3V4VL 4OB5L 3VFRB 3CDGA 3FT4B 4XPFH 4R90L 1FVEA 4M7KL 3ALPA 1CGYA 2VRAA 5C0RH 5L8JB 3RVVD 3X13A 4UQ3A 3QIUB 5B3JE 1KJVA 4NQEA 4JFFA 1UM4H 3LDBC 4ORGA 4R6UA 4R26H 3R1GL 5CILL 4Z7VB 3TC9A 4DN4H 8CGTA 1XGYH 2XKSA 3BGMB 4RIRA 3OAUL 4B0MM 3RUGE 4V1DE 2RHEA 1B3JA 4NQSA 1UWEL 2XWBA 4Z9KB 2ZCKL 5D7LE 3VGHA 3KGRA 1PZ5A 2HT3D 2D31A 2A77H 5HD8C 1FCCA 1BGXL 2AGJH 4P2RA 1JL8A 5DMKA 3OKLB 5T5FH 3TH4T 1CLCA 3NFNA 3FN0H 1FYTE 3O9WD 5JQ6H 4PJAF 3OTTA 3BPOC 2F9BT 4MD5B 5EUKB 1FNHA 5EIQA 1L4IA 2EH7H 1PX4A 2JIXD 4E9LA 1MEXH 5FHAL 3AREB 2EDXA 2MKLC 4ODXB 5MEOA 1RY7B 5F7FA 4ONHB 5GSVB 3QH3B 5IEHB 4EI5B 2QQNH 1MCEA 3RTQC 3O45A 3RU8H 2N7BA 1NEUA 4HZLB 5DSCA 4LRNL 3UC0L 4CMMB 1T2XA 2BVPB 4P59H 4LEOA 1L6XA 1WCQA 3GSVB 1WT5A 1PJ9A 1DQJB 1IAKA 2P5EB 3MPCA 4UILL 1OQOA 5CIPA 1C08A 1ETZA 2VITA 5MI0B 3MLUL 4I5BB 4IDJH 3P9WB 3VFWA 5CJXA 2IAND 1RULH 4PRBB 1AKJA 3MV7A 3JV0A 3U6RA 1KG0B 3UCRA 1IM9B 4M00A 2VN4A 5E24E 3VW3L 2EDLA 5GZOC 3SGDH 1AGFB 5FOBA 4MNQB 1GGYA 2WIIA 3QXTA 3DURA 3BIBX 2CIIB 4XMKL 3HTLX 3SGEH 5JOPE 4DK3A 2VDLL 3B83A 2BNRB 4ZTOL 4OGYL 3ZHLA 3QPXL 4PP1C 5TQ2H 1D5MA 3G5YB 1MCIA 4RAVA 3AAZB 3UAJD 4XNXH 1FL5A 3VMOA 4LAQL 3HNTH 3DOSA 5JW5A 3VWKC 5KJRL 3SN6N 4G8EA 2G2RA 5D93C 2Z35A 1BFOA 1PQZA 4ODUB 3QYCA 2VXVH 3QAZC 4YNYA 1PKQA 2HH0L 5C8JB 1F42A 2XZCL 4AL8L 3C6SB 2VLKA 5LGJA 2D9QB 3OKYA 1J0JA 3P3YA 3TVMB 1CBVL 4TSCL 3EO0A 5F9AC 2A6DB 1SYVB 1CLZH 1YC7A 1RUQL 3BESR 1NFIB 4G3YL 2CR3A 3L5JA 2WP3T 4HJJL 1P7KB 4MGXA 5B38G 1S7SB 3TYFB 3QWRD 3QQ4B 3SCMC 3VRIB 1YEGH 4PGBB 3U0WH 1JHTA 3NAAL 3JWOC 1W72B 4KK6C 5IVXB 3L5XL 1CE1L 4M6OH 4MXWH 2P7TA 4BH8B 1T4KB 4ZFZA 5IMLA 1U8NA 4HKJA 4I3RH 2X5PA 1DVFC 1YNTA 5IROC 1I1AB 2HJLB 1JN6A 5SWSB 2P5WE 1YN7A 3QUYC 5GJSL 3TNMB 1F4XL 3QEUA 3NFPA 1JHLL 2OMBA 3L1OL 3X3GL 2NY1D 1CD1B 1UB6B 4Y2DB 5JW3L 2B4CL 4PJDF 5C0DB 3D39A 3E6FB 1FZJB 1T20B 3E2HC 1K8IA 3MNZB 3IFNH 2V2XA 1KB5A 3SJVA 3UJIL 4CDHA 1DBML 4UU9A 4WV1A 2ARJA 3QQ3A 1BHGA 4R97B 3IKKA 4L3CA 3U4BL 4OZ4A 3VGGA 3BJLA 3PNWA 4WGWB 3LY6A 3VXOA 4ESKA 2I26N 5INCB 3PP4L 1LO0H 2C26A 1A4JA 4QXGH 5E1HB 3RWCB 5IOPB 4OI8A 1B0GA 3FHQA 1AR2A 4DZ8A 2R0WL 4PLJD 3O4OC 4MB4A 4F15B 4R0LB 5A3ID 1OTSC 3GMRA 5JW4N 4PUBH 3BSZL 3CFIC 4RX4D 3QG7H 2ZUQB 5FYKD 1ZHNB 4N0FB 4JGMA 4URTB 5JHDB 2VDRH 3K0WA 1E27A 3C6LA 1VFUA 4IMLA 1BZ9B 1Z5LA 4D8PA 5KAQG 4OD3H 3RHWF 1ZEAL 5GHWL 3T0VA 5E00A 4WUUD 1JTTA 1XH3A 3QNYB 4KK9C 1AH1A 3EDFA 4NO0D 5IR1A 2HFGH 4L4TE 1ZVSB 2DQJH 4JQVA 4FMKA 3RVUC 1OPGH 5DJ2A 4XPTL 1I7ZB 3GHBH 4X8JA 3GJFB 1A1MA 2ESVB 3QCVH 4OV6F 5DMYA 3CD4A 5KS9F 3QHFL 1YEDB 4I18C 1HXYB 4JFQB 3S36X 2RGSA 3K7UA 5BZWA 3L3KA 5AAMA 5DRXB 1EAPB 3MXVH 4DGYL 5I16A 5HI5D 4HCRH 1H5BA 3CSPA 4NUGL 3FB7A 4R2GC 1HZHL 3TJHC 4FQQB 1I8MA 1DE4A 3SBWC 4P2QD 4PRHD 2R2HB 1I9JH 5GPRA 3MR9A 3DVGA 1EJ6A 4CVXB 4BA8A 4NN7C 2NY7H 4NM8L 1A5FL 5EWIL 4EDXB 5ENWB 1TVBB 2NXYD 1FLTX 1EUUA 3LKPA 4P49A 2ARJQ 2AJSH 1HHHB 3GSNB 5HYQA 4NQCE 3QISA 3UJJL 4DK6A 4ACPA 1N3NA 1QBLH 1IRAY 2R1WA 2D7NA 3RWDB 3SDCD 3TBVB 5DQJB 4GG6E 5E6ZA 2HTLC 3V5HB 4M9OA 3K2MC 1NEZB 4X9IA 3SKMB 5HHOA 3RWIB 5DI8A 1MRFH 1IFHL 4MA1B 3NN8B 5E6YA 2I27N 1UXWA 3WDHA 4UOJA 3GI8H 1KTDB 1W0VB 3MOBL 4FQXD 5CP7A 1DQDH 1G7JB 3WLWC 4JFYB 5ESVB 3BKJH 4JFEA 4X99B 3GIVB 4X6EB 1WV7T 2D0FA 3SDAB 1X5HA 3FT2B 4PJIB 4R96A 2YK1H 2M2DA 3B9KA 3SKOA 3U0PB 2EDKA 3ZHKA 4C59B 2B5IB 4OF3A 2C9AA 1OAUL 4GAGL 3QFJA 5IQ9B 1HQRB 2BY1A 4G9FA 4HX1B 4E41A 1EO5A 3IS1X 4WFEE 3QIWA 1HOCA 1KELH 4KXZH 1JHKL 1N0LA 4RRPA 1JPSH 3TWCH 2BHYA 2DN7A 4WJ5B 1U36A 1ZLSL 2SEBA 3IDMA 3F7QA 1CG9B 3U9UA 1YUHB 43CAA 3WUWG 5I1AA 2HMID 3V5KA 1V3LA 3NCYS 2F5BH 1I1FB 1FFOA 2XTJB 4TNVF 3PGCB 4EQ3A 1OD9A 3BHBB 3WO4C 3MLZL 1T89A 4V2BA 1FGNH 4H25A 3LQMA 3MRFB 2E7CA 1VFBA 4I0PC 3SE8H 3MRQB 4OKVB 2DJUA 5DC9B 3D2UD 2AABH 4NWTL 2AI0L 1DBKL 5C0AA 1U8QB 3KPRE 3GKWH 4UMGA 1AQDB 1QSFE 5D2NB 4NN5C 3ZTJH 3LRSA 4MJIA 1HCFX 3QQ9C 1K2DB 4J4PC 4XVUC 1EX0A 3R4DA 4NZRH 5HDQH 4KQ4H 2GQHA 4JFDE 2BNQD 2IPKA 3I2CH 4ELKA 1GHFH 3DETD 1DFBH 5I8OH 1P7QD 5ERWA 5I71B 4U3CA 4EUPB 3QZWB 4IIQB 3B2VH 4POZD 1SBBA 3IKCB 2ICEB 5A40E 5DYOB 5IV2A 2ADIB 2J8HA 1C5DA 1WIPA 1YNLH 5EO0A 2X40A 1MQKL 1CFNB 1F3JA 2NY0B 2XXCB 3WFDL 1CLYH 3H7BB 4D9LH 4F2MB 4ZUUA 1B6DA 5GZNC 1JNHB 1AXTL 2VXQH 1P5UA 4UOW1 5TF1L 3HZYB 3UPAA 3NH7L 2ZNWA 3EHBC 1PX3A 2A38A 3THML 4JQXC 4TUKH 3V9FA 2AVGA 4LCWB 3EO9L 2FIKA 4J23A 5EUOA 1KPRA 2W0LA 1JIBA 1AJ7L 5D1XA 3NABL 3ORJA 4X6DE 4KAQH 1CVRA 2H45A 1T1YA 3VWJC 5ESAB 1KOAA 4XHJD 2C3XA 1XR9B 2FX8H 4HUWB 5GRUL 2HKHL 3L95A 1ZLVK 3MRHA 2J1KA 2A0LC 4QOKD 3K4ZA 4K3DL 4GXVL 4NKOB 5GGTA 3BGFB 3VCLA 5HY9A 2I9LA 1R3KA 4PJFB 2JK5B 2OJEA 3GMQB 4AY0A 1C5CL 3EFDH 3GMLB 4R7NB 1I3GH 3HUJA 1IC7H 1N59A 1TJGL 4I77L 2HT2C 2V2TB 1P4IL 3P0YL 5EFIB 4M8QB 1T22B 4L3ED 4X6CE 5HYSG 4YWGL 2WBWB 1F97A 2VLMD 4JO4H 3D85D 3GSUB 5SWZD 1CXIA 4Y4HA 2GHWB 3QP3A 1MRCL 1JF1B 5J8OA 2IQAB 3QPQD 2VISA 4PJ8C 3WFCL 3S3JA 2BOCA 4N5EC 1KFAL 3ES6A 1F3RB 1U2CA 1G7LB 3MRDA 1ERNA 3RNQA 1XGQA 3BP4B 5FFLA 5L8LB 4XVSH 4BM7A 4HF5L 1KTKE 2MHAA 2W9DL 2Q7YB 3S5LA 1FN4A 5TQ0L 1INEH 4BKLA 1H15A 4IBLT 2D03L 4YK4C 1WJ3A 1NMAL 2FJFA 3L6FB 5KVFH 1J05B 4K8RC 5DHVA 3S7GA 3MNWA 4CU6A 3D25B 3U83A 4WU5A 4HK0B 5TE6H 3RWEA 1CLOH 3O3DB 4B53A 3QUMH 2EH8L 5BRZE 2CMRL 1YYLL 4JLRA 4HUNB 5L6YH 4Z0XA 3OKNB 5DJXA 4PP2A 5IM7B 4HIJA 1MCLA 4D0CB 4WW2B 3DMMC 4L1HA 4XAKE 2WLZA 2XI9A 4YFLI 3I02B 3MV9D 1BVKB 3I50H 2X4RB 2ITDA 3KYNB 4JM2D 5E8DL 4OUUB 3U48A 2Z91A 4JFXB 4P57B 1B2WH 3BKCH 4OD2B 5D7SH 2PXYB 4LU5L 3RL2A 3ILQC 5IBLD 1J1XL 1D3CA 5MP6H 3SGJC 3ARDC 4GRWF 1M7IA 5GRZA 3TNNB 5CSBA 3ALWA 4WWKB 1ZS8A 1OT2A 5AZEL 2BXYA 1SY6A 2RB8A 4M1CC 4B7LA 4HIEB 4KDTA 5C08A 4PBXA 1HINH 1C12A 4IHOA 4RFNB 5HGHB 5ADOL 3ZSSA 5D6DA 3SQBA 4NQED 4PJHB 3PG2A 4JFFD 4N0UE 2A74A 4FN0A 4LSVH 2FATH 1NBVL 1HH6B 1DQQA 4MQ7B 4NO2A 5CEYB 2DM4A 4JGJA 5BW7C 2E27H 4QHLB 4HFUH 1KJ2A 5T3XD 5ANMB 1EHLH 5FGCB 4AH2A 5DJYB 2W92A 4NWUL 1ZAGA 3KWWA 5MERB 1NAKH 4D94A 1QNZH 5T33L 4QGYA 2DQDL 3EOTL 1BZQK 5C0GA 2XQYG 3CVHA 4NGHH 4ELMA 4P2RD 4QXTB 5F96L 4XZUA 4CMHB 1IVLA 3O4LA 5TPWL 2MCPL 3I3EA 5EC1B 3PGDA 4QTIL 4HWEL 4NZJA 5I1JH 3ZYJA 1TXKA 4D9RE 4NSKA 4N0CC 1IKFH 4HW6A 3VMNA 5IHBA 4Y1AB 4X5WB 1LILA 4PREA 1OGAB 2BRRH 2ATPA 3O6KH 4HS6B 5J6HB 4LEXL 2C5DC 3AY4C 5IW6A 4FFWC 2Q8BL 3M17A 3O2DL 3MJ9H 4YHML 2OK0L 1RK1B 2H32B 3BIKA 5E2VL 1ONQA 4PJEE 1XZ0B 2BCKB 5KVEH 5CZXC 4LF3A 1G7HB 2CKBA 1OF2A 3G5XA 3IDYC 4OLUL 3FOMB 2X4UA 5DS8A 2ADFH 4LOUC 4F80A 5HXMA 5KSBE 1AKJD 1ROWA 4HGMA 1KJMA 1YEJH 3MV7D 4PGEA 4S1QH 3IU3B 4KJWD 1JWSA 3VFVA 2NTFB 3RZCA 3IFPA 5IBUB 3DX6A 2WV3A 3ZKMC 3MA9L 3VXMA 1A1OA 1JJUA 2WBJC 2FHFA 2DWDA 2PW1A 1DQLL 3MRKB 1T5XB 4KVNL 5GS0L 3BUYB 1QRNA 3QUZB 3WUZA 4PRNB 3TO4B 1DANT 3H9ZA 4KUZH 4UNTA 3FL7A 2VZVA 2VDPH 4BQBA 5I1GH 1HHIA 2VLLB 1EHNA 5J11B 3T0BA 3L3DA 3VGAC 3C2SA 3FZUC 5KN5B 3JV4B 3UTQA 4F7MB 3ZL4H 4MVBD 2DBLL 3KJ6L 1RV6X 3BPCA 1O0VA 1WF5A 3QIBB 4X7TB 4POYA 2VLKD 3B9VA 5I73C 4JFOA 3PQYB 4K7PH 1R0AH 1SVCP 3CIQA 2Q86A 5CZVL 2BFVH 3KDMB 5J12B 5C0EA 3DXAA 3QG6A 1AGCA 1OTTC 3L3JA 3U82B 4P46C 2C4FU 3VDCA 4UTAL 3LKRA 1Q9WB 3RWHA 1MQ8A 3DROA 4JZJC 1Z2KA 1HYSD 2A6IB 5CUSH 1F00I 3CK0L 4UIKH 1DBBL 1PEZA 1L7TH 2AK4B 1D9KB 1ZK9A 2X4PB 4XAWL 5J9PB 3J8F7 4NFBA 5J4MA 1EEYB 3FRUB 5FA4A 2GT9B 2QADD 4LCCC 1UVQA 1X6NA 4QYOB 5D5ME 4JFPA 2XZAH 1O7SA 5DEGB 4KWUA 3OHXA 4PY8I 4NKDA 1OAKH 2EYRB 4IOFC 3VFPB 2H1PH 1K3ZA 4OM0H 3D39D 1BOGB 3V4UL 1F90H 3PABA 1UGNA 2E9BA 1YJDH 3UTTB 3BGAA 4CBPA 4IMKA 5ISZE 3SJVD 3MUZ1 2YPVH 3MLYL 2QKIB 2ZSVB 3PWVB 2BK8A 2P24B 2W9EL 1FGVH 4AENB 3EZJB 2NLJA 5I8EA 4PJ7B 4ZUSB 3WLBB 2VDOL 4MAYC 2OQJB 5DRZB 1IGIH 1X4XA 2NW3B 1MFCH 1LO4L 5GRWA 1CF8H 1UZ8A 5F8RC 4BZ1L 1PG7H 5D2LB 1ZE3C 5I1CH 4EVNB 3HAEA 3OJMB 3AM8A 1KNOA 4U0QB 3U46A 2HLAA 4KJPC 2AEIT 4RA3A 4OBRA 4H1LA 4EN3B 1F2XK 2AEPH 2Z8VC 1YEIL 3LZFL 4FTVB 1OP3K 5FDWB 2GJJA 4M02A 3X3FL 5C0JA 5DTFA 3C6LD 3FOLA 5GISH 1LP9B 2ZOLA 3GMPB 3HS0B 3FT3A 1QTYT 4PV8A 1Z9OA 4OLYH 3O2WL 4RBPK 3BEVA 4XH2A 2R69L 5CSGA 5FECA 1IEBA 5I8KL 2XQBL 5IMOA 3MUJA 4ZXBA 4K3HA 2XA3A 2HKFH 4FFYH 4EIGB 1CK0L 2GK0B 5BVJA 2JJSA 3MX0A 4XP4H 1ZT4B 1TFHA 3KPSE 3VXRA 3CC5B 3V6OE 2DD8L 3H3PL 4DUXA 5GS0C 1CFBA 3NPSC 3LOWA 4XVTH 1NGYB 2A73A 4M61A 4KK8D 5FV2A 4XPAH 3ARFA 4OTXH 3K4AA 4DZBB 4ETYA 3IFLH 1GGBL 4JHAH 3RDTC 5M7QA 1SBSH 3D69A 1EHXA 1TENA 4X5LA 2EDQA 5E95B 4QRSA 4Z7WA 2DQCH 2E7HA 2IFGA 4K94H 3STLB 1IGYB 4FZ8L 4L5FL 1ZSDB 3IFOA 4JE4B 4YBQD 4LFHG 4OLEA 4ZOEA 5DJ6A 1BREA 4HZAA 3RWFA 4W70A 3RY6C 3TA3A 3GMOB 4NNYB 3BD5A 3H9SA 2X70A 1QSEE 1TZGL 2K3TA 4I0CC 1UJ3C 4ZQKB 1SJHA 2MOVA 1Q0XH 2XN9E 4G43B 4K3EL 4YHYB 3GB7B 4APQB 4ODWA 4OZHE 3DUSA 1NDGA 5IP4A 2VXTL 2Z93A 1QHOA 5CD3A 5HHOD 1BFVH 1IC5L 2DQEL 1MPAL 1GGCL 2IPTH 4J3SA 1BBJB 5SX5H 4AQOA 4DGIL 5FUZH 1MAKA 4F3FB 1UZ6F 1HN1A 3PWNB 2X4SB 4QXWA 1HILA 4U1MB 3BOVA 4JFED 3L5HA 2E9JA 3QO0A 1FDLH 1AHWA 4ZAKC 1M71A 3B9KD 3QDAA 4JR9L 4QNPF 4X6FA 2D0HA 3B9EA 4XXDB 3T0WA 1K8DB 1CL7H 5C9JA 3QFJD 4PS4H 1P84J 3D0LB 1OSPH 2K9UA 5GGSY 4G9FD 4E41D 3CX5K 3KLAA 4OCYH 4UT9H 3QIWD 5HDLA 1D5BB 3FMGL 4WY7H 1RUML 1A4KA 3WXVH 5IF0A 2DI9A 1MWAB 3BQUB 1JPGA 4X7CC 4PG2C 4KMLB 3HPJA 4NRZB 1ZHKA 3V6OC 5TDOA 3VE0B 4ZOBA 2VE6B 4L9LA 4Y5YB 4Z7VE 5AG8A 4F37K 3IXTA 1U92B 1TVDA 3SDYH 35C8L 4IRJB 1FL6A 2CDGB 4M7LH 1SYSB 2KPNA 4NQVB 4XTRD 2P8MB 4B41A 1J87A 4Z7NE 2HA1A 4X4YA 2BZDA 5C0AD 4XNQA 1J1OL 2AV7B 2L7UA 3KJ4C 3RBSA 4D0DB 3UTSB 1K4DA 2Y07L 1IGCL 2BC4A 4BYHA 1NCCL 4MJID 1BP3B 3LH2H 1UXSA 25C8L 5IEKA 1LK3L 5I30L 1EEZA 1S9WB 3QDJE 4YC2C 4UT6L 4YZFE 1RFDL 2ZWLT 5A16B 3P9LB 3GSOA 4QT5A 5CEZH 3SKJH 4OGAC 1HH9B 4XP6H 1TDQA 3PWPA 5I1HH 1U8IB 1MAML 3LS5L 5FO8A 3FQTB 3REWA 2IG2L 4YO0B 1NLBL 2GW5A 3MJ8A 5C0CB 3TCLB 1KCSH 4NNXA 4TSBL 4LVOB 2V9RA 2FHBA 4XWGH 4XP5L 4YDKH 1DEDA 4OZFB 1JBJA 1UM6H 5EBLB 4J1UA 2CLRA 5D1XD 1W72L 3JTSA 5EOTB 2VDMH 2O61B 4HKXA 3RTQA 2X6MA 4TSAL 4J8RB 3VH8B 1DBAH 1EUTA 3UROR 1ND0A 1WZMA 2R1YA 3IU4H 4UT7H 2BNRE 1LEGA 3VXUB 5C7XH 5E8PB 1NDMB 4C4KT 1OP5K 4R8WH 4YH6A 4XCYA 4U6YB 4XC3H 5D8JL 4TVPH 4U0RB 2NY6B 5EN2A 1XF2A 2XPGB 3LQZB 4BSWB 4QO1A 5HHQB 3DVNA 4Y4HD 3FO0H 4MNGB 3EUUA 3MRRB 1FSKC 5FXCH 5JLZA 2FX9H 1KACB 5IVZB 3I75B 3P73B 2C3VA 1I3RB 1I4FA 2R1XA 2YA2A 1NANI 4I8DA 1P1ZB 3GI9L 3V95A 3OAZK 3S5LG 1MHEB 2MMXA 4HWZB 3PL6B 1BMGA 1EO7A 3RGHA 3RUGA 1U8PA 4P3CL 4X6DF 3BJ91 4G6KL 5E8OA 2R2CA 3V5DA 3IJYB 2CRMA 3AREC 3IB4A 5D7LA 3RPIB 2X09A 1FJ1A 4DQOL 4MB3A 4M1DH 1JNLH 4A6YA 3FKUS 4LCIL 4L9DA 5HGDB 4MCZB 4PJ5E 4O51A 5FHBL 2C1OB 1BQLH 2FNBA 5FF6B 2CK0H 3L7FB 4M6NL 5SWSE 4LSUL 5TH2B 4NP4H 3KYMB 4QKXB 5TFSL 5EORH 5BJTA 3CZFA 4AEEA 4XNYH 1LD9B 1S8DA 2H2PC 5I75C 4X8XA 1JPFB 2AK1H 5DD0H 1BD2B 1T7ZA 4HUUA 5LQBH 1ED3A 3G6DL 5AUMB 1A9EA 1J8HB 2VTFA 4O4YH 5IROA 3U7YL 4BSVB 3NFSL 1DUYA 2W0FB 5FO9B 3QUYA 1INQA 1VFAB 1U8HB 3OPZL 3IDXH 4EDWL 5B39A 1KCLA 3O2VL 5ALBL 7FABL 2EXYD 3GSRA 5T3ZH 4WO4B 1T1ZA 3LQAH 5JOFA 3DRQB 2CH8A 5HHMD 1KCUH 4HV8B 5C08D 4WHYH 2PO6C 2EEAA 1FH5H 3SOBL 5IB2A 1OAYL 3O3EB 3RKDD 2W91A 5ICYB 4ZODA 4GFTB 4NT6B 5C2BL 5JMRA 1OGTB 3QJFB 5FYKH 4MD0A 3TVMC 4YXKH 5JHDE 5FGBA 2IPUG 5IK3A 2O93L 4PJGB 4TN9A 3GSNL 4P2YA 4OLVH 2YPKA 4XWOC 3LKOA 5BZDA 1ODAA 2R4RH 5I1LB 4XB8A 4CVZA 4LLQA 3QCTL 5E5UB 2APVA 3CGTA 3U7WH 1F4YH 1GL4B 3UJTL 4RMTA 1UFUA 4ODVH 4C56B 5DGRA 5DR5H 1IL1B 1F8TL 1M05B 4L29B 4XPFL 1S7VA 2WAHA 5C0ND 5GXBB 1B0RA 1N6QL 5HYJB 3O4LD 4XPHL 1T7XA 5FOJA 2VL4A 5C0RL 2MQ0A 2ESVE 4H8WL 4PTUB 1N64H 3QI9B 3PV7A 5D70H 5DA4A 3V4PH 3SDXA 3WNPA 4NPYA 1UM4L 3HB3C 4LLUA 1J88A 1WWWX 1KTRL 4OJFL 1IGTA 5BO1H 3O11A 2CJUH 4Y2DC 5DQDH 2EYTA 3CH1B 2YKLH 2OYPA 1VKXA 3KPPA 4CNIB 1KV3A 2A77L 4MXQD 3DPBA 1GPOH 3ELAT 3F12A 4R97C 5DF0A 4I18A 5DJCA 1J0ZA 4JG0H 2H9GA 1E4XI 1QFWL 3C8KB 4DFIA 1TJIH 2ADJB 2EH7L 2CPCA 2H3NA 3LKNA 3T09A 1CT8B 4JQIH 3RZCD 2PYFA 4AIOA 3F58L 3C5ZB 3EZ8A 4K7FB 1E6JL 1TVHB 3LS4H 3VXMD 1NBZB 1EXUA 5F1IB 2CRIA 3ARBB 4CUCA 2NZ9C 2IF7A 4WI8A 4NOFA 5IB5A 1MHCA 1QRND 4YPJA 1OM3L 3W82A 3MRJB 1HNGA 1DQMH 1A3LH 4DKEH 3TBYB 3I84A 4P59L 1OY3B 3T4YA 1UCBH 1S9YB 4MSWA 3INUH 4ZPTB 5DFWH 4ELMF 1Z0MA 4QEGA 1UQSB 4Y16B 4P5KA 2ORBH 1V7MH 4RAHA 5A1AA 1GZQA 1UENA 4OD1H 1LDSA 5GGVY 4WHYG 4P2CG 2P1YA 5F6IC 1G0DA 2FJHA 1TJHH 2EEDA 4G8IA 1FVCB 2VL5B 3DXAD 2QQLL 1KIPA 1C1EL 2QQKH 4UINL 1LDPH 2X10A 5C07E 3ROOB 1NCBH 4RMUA 3O9WB 2XTJE 5M94B 1F4AA 3BD3A 3HNTL 2P8LB 3M45A 3S96B 2NY3D 4XHQA 2JIXB 1PDKA 5BVPH 2VZOA 2VXVL 1NPUA 3TIEA 1U8KB 2OL3A 1D6EB 5IIEB 4GW1A 2VKWA 4PRDA 4R3SB 2GITA 1CLZL 2ZJSL 1S78C 1P4BL 4RFEA 1UACL 5B21A 4M5YL 3QEQE 5D7IA 3K74B 3Q48A 3Q0HA 2DLGA 5EB9A 1QQDB 5F44A 3EYOB 5F9OL 3VG0L 4I0PA 5ITFA 5B22A 2IANB 3U0WL 2R29H 3CNKA 3KPMA 1FZKA 2UY6A 5GRJL 3MLPA 5IFAH 5DRNA 4JZOB 3DV4A 2KL6A 5CBEB 3C5JA 1DN0A 1RIVL 4RMQA 3TIDA 4YGAB 4G7VL 4LARH 4J4PA 3TM6A 1AO7A 2ZSWB 2FWOB 4U6TA 3V7AE 4NQCA 5F88B 4PJDB 3GRWL 4OT1H 4DN3H 1MSPA 1XF4B 4KHTH 1G84A 1XGPA 4GG6A 2B5IC 4JO1L 2AJ3A 3Q6GH 4M1GL 1CI5A 3X12A 1MFAH 3FO1B 4JAMA 1NBYB 4YGVA 5IHUL 1FIEA 4KQ3H 4MA3B 4LKXB 3G6JB 4PR5A 3SQOH 1T66C 2UZYB 3F7VA 1KLFA 1BLNA 4HJ0C 4UQ2B 2OP4H 4RDQF 5ILTH 5F1NB 4KKAD 1MOEA 4PJXB 2VAAA 5E1AA 4RCAA 4JQXA 4LLVB 2X1QA 3T77A 5L2KA 1LE5A 1MCRA 1UEYA 4PJFE 1DJSA 1MFBH 1NGWA 1B9ZA 4KKCD 4ZXBD 2XTJC 4QXGL 1UA6L 4Z18A 5I1DB 4OZIA 1KTLB 3C08L 4F57H 1RIHH 2G60H 1PSKH 5EOQH 3T1FB 3VWJA 1B0WA 2NMSA 2X2YA 1A7OH 4F7TA 5C0IB 3VXRD 1J1PH 4RAUB 3BI9X 4GRWH 3I85A 1CDJA 3QG7L 5DK0A 4OIIH 4F58H 2RAMA 3K80A 2DQFB 5SWQB 4U1NB 1XGTB 3GGWB 3Q5OA 5EG6C 2UWEF 2RQ8A 1U58A 3RAJH 2WSKA 5HYIA 3IETA 3ARFD 4OD3L 2XNAB 3I6LE 3TZVC 2AEWA 3CFJA 4AK1A 2HFGL 1U93A 4O02H 2NW2A 3MUHL 3U7AA 3CSGA 3MLSH 2NY1B 5EDXA 3S36L 3D18B 1EK3A 5I71C 4OQTH 4MJ6A 2NX5B 4IIQC 2GJ6E 1IM3B 4NIKB 2MSPA 5TF0A 1RUPH 3L7EB 3EFFA 2VB5A 5DJ0B 3T8XB 4PJ8A 1BJ1J 2NY0C 3FONA 3RY4A 3TA3D 4UDUA 4HXAH 3H9SD 3ARYA 3QHZL 1VACB 3WSQH 4Q9BA 1WCBA 3MXVL 4MJ5A 3BKMH 1I1YB 5C09A 4ZUWB 4M7ZC 1VADA 3BP5B 4QCIA 3TBSB 2NPLX 2DQIH 5CGMA 5GGUA 2VZUA 5C3LD 5F7KC 5CCKH 1KUMA 4NQXA 4UI2A 5K9JH 3BWAB 2VXUL 1TCMA 4U1SA 2HFFB 3QB7C 3UPRA 1ADQH 4HS3A 4JKMA 1QR4A 2B1HL 2PCPA 5KANG 2IBGA 3EDKA 5BXFA 1MUJA 1JZ8A 3NCMA 5DEZA 1KULA 3RVTD 2BMKA 5EZLA 2VIRA 1X5KA 3V0VA 2H6PA 1FBIL 4TTGA 1QBMH 1QBLL 3MACL 3GHEH 4U1HB 4LPTA 1F4WL 1KPUA 1YEKH 4MQTB 4NZUH 4WUUB 1FZMA 4NO0B 2QSTA 2VR9A 1ZMYA 1VEPA 2ITCA 2DQTL 4OFIA 1MCFA 3L3HA 1DBJL 1AGDA 4PJHE 3GI8L 4LSSH 3MRLA 4QHKJ 1DQDL 2FZ3A 3SGJA 3ARDA 4OZHF 3E3QE 2GY7B 5ANME 4GMSH 2YK1L 5FGCE 1F13A 4Z7UE 3BZ4B 1P9MA 4U1LB 3ESVF 3CFKA 4G80B 2FH8A 3WN5A 4O2FA 4X6CA 5IKCA 3O6ML 2ZCLH 1KELL 5FYLD 4JM4H 1NKRA 4P2QB 4PRHB 5ADPL 1JPSL 4GKSB 3K81A 3TWCL 2FCBA 5HGAB 3V4VH 2NY5L 1ZWIA 1H9VA 4OB5H 5BW7A 2V5MA 1NUGA 5FGRA 4M93B 4R90H 3PV6A 4M7KH 5FKAA 2JKXA 1SM3L 2NXYB 4M43L 2RIKA 4HGWB 4Y1AE 1UB5A 1RJLB 1OGAE 2QHLA 2D0GA 1CGWA 2A9NL 1EIBA 2FLRT 4F8TA 1QFWI 3K8KA 4PRAB 1FGNL 3R1GH 5CILH 4GW5A 3PWPD 3SE8L 1R24B 3LSOA 3DWTA 4ZG1A 3SDCB 4LSPH 2AABL 3WL9B 5MHSD 3OAUH 4Z7VF 3TPUB 5I1EH 2CIKB 5ABDE 3G08A 2Q8AL 1JWMB 2OSLB 2IMMA 1UWEH 4M5ZH 4UOW0 5J6GA 5J1AA 3STZB 2PXYC 4Z7NF 4HHAA 1A14L 4P9MH 2UZXB 3O0RH 2Z9TA 2XWJB 5E9DA 4FQXB 4YHPA 3AY4A 5BRZA 5HDQL 4KQ4L 4I9WE 1UYWL 1R3LA 4WWKC 1KCKA 5GS1C 1GHFL 2ZOKB 1DFBL 5I8OL 3RTQD 5C6TL 3JVGC 5DC0A 3PDDA 3FQXB 3MMEB 4WI6A 3B2VL 1PY9A 5JXEA 3DHJA 4RFNC 1L0XA 4JZNA 4Q6IB 3UBXA 2MTPA 4LQ1A 3QEHB 2MWCA 3ARGC 3D5OF 1MAJA 4YZFF 3MRMB 1CLYL 4D9LL 3MV8A 3NCBB 4XBGA 2QEJA 3E3QC 1AP2A 4LRNH 3UC0H 5GZOD 2OR9H 4X9FA 4ORZC 1I8IB 3TH3T 3R06A 3E1F1 1A3QA 2WBJA 3IDNA 5FYJU 2EDFA 1Q9KB 3MLUH 4JPKL 3S37X 5D96B 5EBMB 1OCWL 4KAQL 4PP1D 1RK0B 3EDJA 5F3HA 4N0UA 1XF3B 1MIEL 5HVWA 4EJ1C 3R8QA 3VW3H 3AS1A 3D2UB 5IJKA 1YMHB 1ZT1A 2E7LC 1OW0A 4JPWH 2DMKA 1E4WL 4S1DC 5H35B 4XMKH 4RMVA 4X0KB 1KGCE 3SO5A 4LLDB 2AXGB 5SX4I 5KVDL 4LLAA 1JWUB 4PPTA 3MUGA 4A2MA 2VDLH 2E3VA 1TCRB 4ZTOH 4OGYH 1NGPH 1MLBB 1I3GL 3QPXH 5D7LD 3DUUB 1G7PA 1NFDF 2Q7NA 2VYRE 3EYFA 4HKBA 4P99A 2BNQB 4PJBA 3DX9A 4FQLL 3MNVA 3BDYL 3P2TA 3S4SB 5FK9B 1LEIA 2HJFB 1F2QA 3WEXB 4KV5F 1P7QB 1KIUA 3VXSA 5KSAC 4LAQH 4FQIL 4J3UA 5LGHL 3F5WB 2V5YA 1YZZA 3VGEA 3AS2A 1J5OH 2G5BB 2HH0H 3DYMA 3QA3B 4HBCL 2IFFL 2XZCH 4JZJA 4NDMA 1ZA3B 4ONOA 1IT9L 3SPVB 4KK6D 3DSNA 4XGZA 2GJZB 3MCLH 1WC7B 2Y36L 4D0BB 1RUQH 2V2WB 3UTTE 5D4QA 1N0XL 4G3YH 2BVTA 4PJEA 4XCCH 3NIFE 1ACYL 4I2XB 1INEL 1IEAB 2X4QA 3QUYD 3ZLQC 4PJ7E 3NAAH 3QUZC 1SEBA 4MCYA 1S7QA 3TO4C 4QWWD 4K3JH 1I7UA 3S88L 4MHHG 1QLFB 1B4RA 4N8VA 4QOKB 5MEQA 4PYHA 5J11C 5IVXF 3C9NB 3V6FB 5D2LE 2FEDC 4YHZL 5IFJA 2A83A 2NZIA 3OX8A 5GJSH 5JOPD 4XX1G 1MF2L 4YHIB 2Y72A 1JHLH 5GJTH 3L1OH 3X3GH 3LN5B 2HVJB 5JW3H 2B4CH 2PW2B 3I50L 4FTVE 1GH7A 4L3EB 1JGEA 4MAYA 1U8OB 4M3KB 5DVOA 3RL1A 5DT1H 3RWJA 3EYQC 4WHTA 5D7SL 3L3IB 4OZGE 3D85B 5SWZB 4L8SB 4RWHA 3V52L 3A0OA 4RMSA 5J56B 3UJIH 3MLWL 1J9CT 1EA9C 1BVZA 3G04A 1L0QA 1OTSD 1VFMA 5JORA 4QRUB 2BVOA 1HQ4A 4M6AA 1D9KC 1HINL 3PP4H 5L7XH 2EYSA 1LEKA 5HPMA 43C9A 5HVHC 1BECA 3B3IA 2C1PA 3RP1A 1KB9K 1ZGLM 4P4KC 4O2EA 2Z92A 5IW1B 3T0EA 1EEUA 2FATL 1A6TA 4G6MH 1OB1A 4PGCA 4KK9D 4DOHE 4R7DA 5DUMH 5DK3A 3E8UH 2E27L 2C7UB 1NC4A 4LCUA 4QRTA 3LKSA 2JB6B 3FN3A 3RVUD 4H0IA 2CRYA 4JFZL 3FQWA 4RGNE 4MA7L 4C57C 1I7TA 1YN6B 1ZEAH 4JFHE 3ZT5A 3DV6B 4AEHL 4F7EA 5F7MC 5T1LA 3U0TB 1CFSA 1MWAL 3E6HB 3N9GH 3K46A 1A6PA 1EPFA 4X9GA 1KENH 5D5MA 1DN2A 4JDVB 3MV9B 3VD3A 5ICZB 1P6AB 2RFXA 2I60L 1XGRB 4AEIL 1SJEB 4R2GD 5HYEA 1IKFL 2P45B 4BZ2H 3BP7A 3HRZB 1IAOA 2EDHA 4I4WB 3RDTA 3QHFH 1Q0YL 4L8DA 3K8LA 4KRPC 3KHQA 1EGJL 4X6BA 2ERJB 3ZTNL 4WI2A 1RZ8A 3CDGB 4DGYH 3CPLA 1WGOA 1FVEB 1J10A 4EN3C 3N1QC 4NUGH 3TPKA 4BK5A 1GZPA 2FB4L 1HZHH 2I07A 3ULUL 1JP5A 3X13B 4UTBH 4UQ3B 1CTNA 5IHLB 3RY6A 3CFCL 1KJVB 4NQEB 4JFFB 1KIQA 4ZPVA 1ZGLA 4ORGB 1UJ3A 2HTLD 1YEJL 4NM8H 1JNJA 1A5FH 5EWIH 4S1QL 4J7RA 4LRIC 4RIRB 3G6AA 4GUPA 4BQCA 2G9HA 4NQSB 2XWBB 3UJJH 1OSZA 2YD1A 1I75A 3WLWD 4NFDA 1PZ5B 2D31B 2WP3O 4UBDD 1RJYA 4ZAKA 1U8MA 4KUZL 4MAUL 3MV01 4P2RB 5DMKB 4HMDA 5I1GL 4Z7QF 3NFNB 2APBA 2F54A 4BUGA 1IFHH 4M3JA 3I3BA 1FL3A 3DRTA 3MOBH 3K3QA 1QKZL 3ECBA 1TETL 1MCKA 4RGNC 5ID1A 4GG8A 5MEOB 4WFHE 3GSQA 1ZVYA 4G6JH 1RSFA 4PG2A 3WFHA 3QDMB 1G9MH 5FA3A 3O45B 1R0AL 4XNUH 4PJIF 4YBHA 3EYSL 3UTSE 4GAGH 1OAUH 5DSCB 4Z6AT 5I17A 1UT9A 1A0QH 4AG4L 2BFVL 4LEOB 1I85C 1F6FB 5CIPB 1JHKH 4KPHH 5B8CC 5FYKU 1IBGH 1ETZB 2VITB 3BH8A 1NCWL 3MA7A 3D0VA 4I0PD 1S7UA 3VFWB 3WIIL 2DB8A 1ZLSH 3QCUH 1AKJB 4GKNA 1TZHA 4RMRA 4DEPB 3U6RB 1XCTA 1MCOL 5FOBB 2WIIB 5FB8A 3DURB 1AGBA 3MLZH 3AS0A 3GO1L 1NMCB 1CDHA 4J4PD 1AO7D 2XZAL 4XVUD 4NQCD 5L8KB 5C0CE 1BBDL 2EDYA 4KROB 4NWTH 1D5MB 2AI0H 4AT6A 1OAKL 1DBKH 1QSEA 4RAVB 3R0NA 3VXQA 2XN9A 4U3XA 3VXTA 1FL5B 3H3KA 5INDA 2YD2A 3ZKXC 2FLBT 5JW5B 4NJAL 4G8EB 3EOYG 1JK8A 5JR1H 1V05A 2G2RB 2Z35B 2VXSH 2CDEA 1BFOB 1PQZB 2EIZA 2QL1A 5EPMA 1FGVL 3HI1A 4YNYB 1PKQB 4RFOH 2E9WA 3BQUC 5LGJB 4IEFB 4WTXA 3EHBD 3FB8A 5E08H 4P5TA 1ZLUH 2XG4A 5L2KD 4KMQA 2EDDA 4PD4J 1MQKH 4H5SA 5DLML 1PG7L 3WFDH 1V7NL 3BISA 2D9CA 3ZYZA 4WFED 3IGAA 3GBNH 5CLWA 3VWJD 4I3GA 3NH7H 4XPGL 1JHTB 5D7IF 3THMH 4MNGE 2A0LD 3WO3B 2P7TB 3EJYC 3AXLA 1AJ7H 1OARL 4ZFZB 5IMLB 1S7XA 1U8NB 4HKJB 1YNTB 2QADB 3VGFA 1JN6B 2D7QA 1MLCA 3QNZA 1R3JB 5DD1L 5DJ8B 2HT2D 3QEUB 5GRUH 2HKHH 5CMAA 3NFPB 1RHFA 4J3TA 3W0WA 4DJMA 2ED7A 2HKFL 3D39B 1I8LC 2LV4A 2ZG3A 1K8IB 2V2XB 4N0YL 1KB5B 1RURH 3SJVB 4PJ8D 1FCGA 3VDBA 3VA6A 1A6ZA 2YBRA 4UU9B 4WV1B 4PJFF 4XCEA 5J13B 2ARJB 3QQ3B 1TJGH 4I77H 4L3CB 1P4IH 3P0YH 1EO8L 4N5ED 3Q5TA 4OZ4B 3UO1L 1LK2A 1YEEH 4YWGH 4HUVA 3QDJA 3PNWB 2DQUL 2JB5L 4LVOC 1I3VA 5C09D 3VXOB 1JUFA 4YHKH 3PDOA 3AREA 4OTXL 2BX5A 3H9HA 2PKDA 2UYLA 1WBYA 4PB9L 2PN5A 4E0RA 1B0GB 1EDQA 3B6SB 4DZ8B 4GT7A 1KFAH 3CX2A 4RGMB 4K8RD 3TCXA 1QSVA 3BD4A 1RHHB 1J8HE 5F7YC 1DQJA 5DEFA 2O5YL 5CJBA 2W9DH 5CKAA 1E27B 4WW1A 4IMLB 3MC0A 4D8PB 5FYJL 5D72H 3NPZB 2D03H 5E00B 1NMAH 1XH3B 4JRYA 3LV3A 1Q0XL 4XRCB 4E42A 1AGFA 4KI5D 1G1CA 2IPTL 3EAKA 3OBAA 5DJ2B 4GJTB 3ILQD 3ZE2E 4UDTA 1YYLH 2P44B 4X8JB 5JO5A 1A1MB 3ARDD 3L3OA 4M6MH 2VDQL 4JJ5A 2BSED 1G7QA 4WHCA 4PJGE 4EXPX 4EIZC 4WW2F 5E8DH 5BZWB 3L3KB 4FABL 1S7RA 2PO6A 5I16B 4PS4L 1OSPL 4LBEA 5FEBA 1J1XH 1H5BB 1Q9OA 5F1OB 3FB7B 2DDQL 1I8MB 1DE4B 4GAYB 4OCLC 1YJDC 3CVHH 3AU1A 3N1GC 5AZEH 4WY7L 2ADGB 1EJOL 5HYJE 3WXVL 3FQNA 3MR9B 5ACLA 3DVGB 4YDJA 2BOBA 2PYEB 2WNGA 1PYWA 5ADOH 3LKPB 4F7CA 3EJZC 2JJUA 3U79A 3WYRA 3SDYL 4XMPL 2BY3A 1NBVH 2EDRA 5FYJE 1N3NB 1CXEA 4PRIB 4PJHF 2R1WB 2FX7L 3VXNB 4O00A 1IAIL 5E2JA 5EU7E 4PJ5A 5LVEA 1YPZA 3HZKA 5HHOB 5DI8B 1BM3L 5T33H 4N0CD 1UXWB 1U95A 3LH2L 2ICWJ 3EOTH 5SWSA 5E9DD 5CP7B 3QR2A 5BRZD 4FFWD 1JI2A 4JFEB 2V7HA 3D87B 3UBXG 5F96H 1KLGA 2VZTA 5TPWH 3KS0H 4R96B 5D71L 3B9KB 3SKOB 4XAKD 2AJUL 1M7XA 1XAUA 4QTIH 4Y0GA 5CZXD 5JXED 3RVWC 5FM5M 3QFJB 4WDIA 2GTWA 4G9FB 4E41B 5I1HL 3WIHA 3OF6A 3AC0A 4LEXH 5CP3H 3LRGA 1HOCB 1RUKH 3O2DH 3MV8D 1CU4L 4YHMH 3KHOA 3CCHA 1YECL 4XPBL 3KPNA 1KCSL 2SEBB 3IDMB 2X4OA 3U9UB 43CAB 5I1AB 1JGDA 3ZSTA 3V5KB 4X7DC 3UYRL 2WBJD 1UM6L 1E6OH 1BAFL 2J6EH 1CICC 4H25B 4LASL 1A7PL 1WFUA 2R15A 3RGVC 5FIEA 1VFBB 1DBAL 1IKNC 4Q0XL 4P0DA 1G6RA 2MQ3A 3HG1A 3MA9H 3QI9C 5C7XL 4GO6B 4K94C 3FZUD 4OLZL 1S9VA 3TFKC 4MJIB 4K3GA 2YOCA 4R8WL 4ZUVA 4TVPL 4OCWH 1ACZA 3ZKQD 4ELKB 5CEZE 5ERWB 3VXSD 3FO0L 4TQEL 5EU7C 1C7TA 2FX9L 3S8WA 1IILE 2IQ9H 1C5DB 5EO0B 1OTTD 4HH8A 4D9RD 5JUEL 1YEDA 3KJ6H 1RUAH 4Q6YA 4KZEH 3HC0A 5DK2A 4ZUUB 3CX5J 1HEZA 2PTTA 5B4MC 2EKSA 4RGOH 5GGVL 5CZVH 1QZ1A 3CDCA 3T2NL 4HIXL 1EMTL 3CXDL 2IANE 2FIKB 4HAFA 5EUOB 1KPRB 4M1DL 3ARBC 4UTAH 3IDUA 1JNLL 3RIFK 5D1XB 1ITBB 1KC5L 1TQBB 1JYVA 3HNVL 2GFBA 1DBBH 3MUY1 2A6JA 4OIBA 1TVBA 1T1YB 4JN2A 3IAQA 4IOFD 4XAWH 4Y4KA 2FO4A 3L95B 1BQLL 3MRHB 1CDUA 5ETUA 5I8CA 1NANH 2CK0L 1UEMA 4NP4L 3VCLB 4PJDE 5EU5A 5HY9B 2I9LB 5EORL 1R3KB 2X9XA 4Y16C 1V3JA 4XNYL 2OJEB 3HFML 4X5XA 4HD9A 3V5HA 4GOSA 3C09B 4TVPE 2AK1L 3HUJB 4AIXA 3SKMA 4DTGH 1JNNL 2EKJA 3BFOA 4MAYD 1QA9B 1I9EA 3V4UH 3G6JE 4O4YL 4Y4HB 1DP0A 1EBAA 4LP5A 3S9DB 2IADA 2F5AL 1CXLA 3MLYH 1QBBA 1P84K 2VISB 4C58B 4PJXE 4LIQL 3NIFF 4NRYA 1CR9L 5LG1A 5B38A 3LQAL 4NKMA 4TULL 2BOCB 2VDOH 4XCFH 2DRUA 1KCUL 3ES6B 4ZO6A 3MRDB 5IG7A 3RNQB 4PJ7F 5AYQA 1LO4H 4Y4FC 5C6PB 2C3HA 1XGQB 2GY5A 4NQUA 1ES0A 5EZIL 4R4FL 2MHAB 3T0ED 1CFQA 4PGDA 1CDIA 3S5LB 1FN4B 1BZ7A 5E99H 2BVQA 2FYYA 3BEWA 4OIAA 5FYKL 4BKLB 3BZEA 1CD9B 5D2LF 1NC4D 4LPYA 5F3BB 2APTA 2FJFB 5C07A 1YEIH 3LZFH 5DHVB 4FFZH 3MNWB 2BDNL 2DL2A 2R4RL 3PGCA 3X3FH 3BPNB 2QSQA 1JV5B 3U7WL 4WU5B 3RWEB 3WBDA 2VC2H 5KBNC 4JLRB 1RZKL 4ODVL 3TEUA 3SGKC 5T1LD 3MYJA 4Z0XB 5DR5L 2DM7A 5DJXB 3LN4A 1LP9F 4PP2B 2NX5E 2R69H 4HIJB 1Y6MR 2PUQT 1MCCA 2XQBH 4JCLA 5I8KH 5KS9E 5GS0D 3BPLC 2ID5A 4WRLA 4RDQG 4HC1L 1UJTA 2ITDB 2W65A 4RZCA 1CK0H 2EIEA 2Z91B 4HIHA 4ZDHA 3RL2B 5BS0A 3TZVA 3O8XA 3QEQA 2DLIA 4Y19A 1CFTA 1RQ5A 4YEFA 2F8VA 3RDTD 1M7IB 2HVKA 3H3PH 1NC2A 3FTGA 1ZS8B 2FR4A 4GBXA 3UAJC 4CGTA 4IIQA 3WE6A 3TN0A 5HHMB 5C08B 4BQ6A 4YBLC 4CVUA 4IHOB 1C12B 1YA5A 4ZO8A 5E5MA 3VRJA 1GGBH 3O6FC 4MYWB 2A74B 4U7MA 1DQQB 1EZVX 3V8CA 5FYKE 1A6WL 4NO2B 1BF2A 1FNEA 3NCCB 2I25N 2LU3A 1KJ2B 5F7NC 4FZ8H 4L5FH 3V2AR 1FFQA 1NBQA 3KAAA 4YHLH 3T65B 4AH2B 4DCQA 3LS4L 1BWWA 4JY4A 3NCJH 2Y5TB 2DQHL 1T21A 1TZGH 5C0GB 2B8OT 1D5ZA 3CVHB 4HUWA 1DQML 4ZAKD 5J1TC 4DKEL 4K3EH 4CVWA 4ELMB 1P4LA 4JO2L 3O4LB 3HPLA 2F54D 1J7VR 2DQEH 3PGFL 1MPAH 1GGCH 1ORQA 3PGDB 4WHDA 3C60C 4FQCL 1F3DH 1WWBX 3VFNA 4NSKB 1E4XH 2D7MA 2ORBL 1V7ML 4QHUA 4JEGB 4PREB 2ATPB 2E7MA 2V2TA 5D7KD 3KLHD 3M17B 4LPVA 3S97C 1UKQA 2NY1C 1PG7W 5E94A 2GK2A 3GSUA 3O41A 3BIKB 2F8OA 3S3PA 4M7LT 2B0SL 4P2QE 4PRHE 4LF3B 5SX5K 2CKBB 4Z0BH 1IAII 5IT2L 1OF2B 5E2TH 1DDHA 4XBPA 1U8JA 3G5XB 3QUXC 3FMGH 2JJTC 2X9WA 1RUMH 5H94A 2R2EA 2X4UB 5C0BE 5DS8B 5I18L 2XKNB 1OQXA 4XNZC 3OR7A 2YPLB 1KJMB 4PGEB 3VFVB 3LQAC 3V0WL 2GJ6A 3OKKA 3IFPB 4JN1L 5BVPL 3DX6B 3LEXA 4HULB 3VXMB 1A1OB 12E8L 3T3ME 2DWDB 2PW1B 4PLJC 3WHXA 3DYPA 1KT2A 1QRNB 3NZ8A 1QSED 2D4DA 4QHNA 2JCCF 1J1OH 2JE8A 3D25A 4JVWA 2LU4A 1NCNA 1HHIB 2XN9D 1AD0A 1CGTA 3CSYA 4OGAD 3L5WA 1IGCH 3L3DB 3LPFA 25C8H 2EIDA 5I30H 3ULUF 1RFDH 1BVKA 1WAAA 3BPCB 3HE6C 4CDGC 3MO1A 5MEPA 4JFOB 2XY2A 5I6XC 4JFXA 2ZG1A 4P5TD 5JPNA 5IMMA 2UVFA 1E4KC 4CKVX 1PD6A 5I0DA 3MJGX 2Q86B 3WUWA 3VGDA 3RIAF 2ICES 5C0EB 1AI1L 1MAMH 3TNNA 2HFEB 3DXAB 3QG6B 4OT1L 4DN3L 2YUVA 1AGCB 4WENB 5EIIB 5HDOA 5GS1A 3L3JB 3CFEA 4P3DA 2IG2H 3LKRB 4ZOCA 4KHTL 3RWHB 1NLBH 3DROB 2HN7A 3JVGA 4YAQA 5HGGS 2HG5A 2AXJA 3Q6GL 2P4AB 1T7YA 2CK2A 5EOCL 3FFDA 3OAYH 3ARGA 1J18A 1YY9C 2NY3B 3HC4H 4XP5H 1I9IL 1T0PB 4KH2A 4NO3A 1Y0LA 1DTUA 2X1PA 1KN4L 5FA4B 2F15A 1F02I 1UVQB 4JFPB 5ILTL 3C8DA 5E7FA 5C92A 1RU9H 3OHXB 5KTEH 1W8NA 4DGVH 1RZFH 4Z7UA 1II4E 4NKDB 5DJYA 1YQVL 4ODSL 1X5FA 3HCVA 3RJDA 3W0WD 4KUCF 4HCRA 5H2BA 4PRPB 2BNQE 4F57L 1PSKL 4A6YH 2LVEA 5I66A 1EZVY 3A67H 1A7OL 1U2HA 3RI5F 5D8JH 5I1KL 3OGCB 5JIPA 4F58L 2Z8SA 2NLJB 5I8EB 1JGVH 1SEQL 2IH1B 2VQUA 3QDJD 3WIFA 3RAJL 4JDZA 1X6LA 3ARED 5JW4R 4WU7A 2Q76A 1VSCA 1UZ8B 3GI9H 4O02L 1BEYH 3KYKH 1BWMA 3HAEB 3OQ3B 5GS2D 3NGBC 4PBVC 3U46B 5KSAA 3QRGL 2HLAB 4LPCA 4H1LB 1F3DJ 4I2XE 3QULA 1RUPL 4EI6A 4Q6IC 4L8BA 2AXFA 3ARRA 5C0JB 1IGJA 5DTFB 3CJJA 3RWGA 3FOLB 2ZOLB 1P5VA 1YEHL 2ENYA 3V0AC 2H2PD 4PV8B 4QOKE 4M8VA 4JRYD 3SKNA 5FHBH 3BEVB 4XH2B 2OJZH 5FECB 1IEBB 5IMOB 4M6NH 1U3ZA 4ZXBB 5HHVL 2DQIL 1QD0A 3OKOA 3FB5A 5LXGL 5BVJB 3MLRL 2AP2A 3QUZA 4N1HB 4L3EE 5K9JL 5HHXL 2J8UA 1X5AA 1ADQL 3VXRB 5JOEA 5DD6A 2VLLA 4RISH 3RHWK 1PY4A 3G6DH 2PO6D 4M61B 2A73B 4LDEB 5E0QA 3U7YH 5KN5A 2AKRB 3NFSH 4NKQB 5F89B 3HMXL<