1AR1D

Structure at 2.7 angstrom resolution of the paracoccus denitrificans two-subunit cytochrome c oxidase complexed with an antibody fv fragment
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
DIELTQTPVSLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQFLVYNAKTLGEGVPSRFSGSGSGTQFSLKINSLLPEDFGSYYCQHHYGTPPLTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (oxidoreductase/antibody)
molecule keywords CYTOCHROME C OXIDASE
publication title Structure at 2.7 A resolution of the Paracoccus denitrificans two-subunit cytochrome c oxidase complexed with an antibody FV fragment.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 23
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1997-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ar1D00
1BF2A 4I48B 3X13A 3S36X 3VA2C 1CICC 1NCAL 2P7TA 2EYRA 3L3JA 3IU4H 3MLWH 2IBBA 3ZE2F 1F4AA 4D3CH 3OAUL 2BFVH 3VG0L 1KCVH 2B4CL 5L88H 3UJTH 1NCTA 3G6JF 4JM2F 5FHAL 5TF1L 3D69B 4MAYB 1I3GH 1D9KA 2QEJA 4UDTB 4Z77B 3VXSD 4KJWD 4C59B 4HWBL 3VI3E 3HPLB 4OGZA 5B3NA 4YPGA 4TSCH 1T20A 2APTA 1TCMA 2GJJA 5FUCE 3FB6B 1PZ5B 4Z8FL 2YPLA 2NY0D 5E2UL 4PRHE 2W65B 1NFDA 4OI8A 5C0RH 1ZLVH 4IRSA 2MPAL 1Q9LB 3IU3A 1XFPA 4PJIB 2X4NA 4QOKE 2FRGP 2VDLL 4Y16A 2N7AA 3ZE1F 2I07B 5J56B 4GG6F 3O6KL 4U6VL 2HRLA 3RZCD 4UT9H 3MRKA 4F2MA 1GPOL 3CFKA 4AIOA 3CFDB 1BVKB 1GGCL 1UZ6E 3F8UB 4OIIH 3NN8A 2DRUA 1JRHH 5B3JE 4FS0A 1KCRL 1RK0B 1XCQA 4MA1C 2WWKT 1N5AA 4U1MB 4NGHL 5MEPB 1MCOH 1XGPA 2OZ4A 3MA7A 1S9WB 2OQJB 4JM4L 2YA2A 4QF1A 2GAZB 2FJGB 2WWMD 3DVNB 4LU5H 3WNPA 3B9DA 4F15B 3L6FA 4RNRA 3V0WH 5E99L 4LSTL 2A74B 2R9HC 2XNAB 4PG2A 1CLZH 5IVZB 1DBBL 2VKWA 4GAYA 4CAGA 5DRNA 2NY1D 1HINL 1HN1A 1QHPA 1MLCB 5E4EC 3RAJL 4Y19E 2YUWA 1U6AL 2DDQL 1UCTA 3KPLB 1TCRB 1IGYA 3AUVA 3QRGH 3VXSA 2VAAB 3GRWH 2DJSA 4M9OA 5T5NG 1FAIH 5FYLH 4M6NL 2P5WE 4NO2B 1ORQA 1E6OL 1NGZA 4M4RA 1JGVH 4JG0L 3QDJB 4GBXB 3PWPB 2V6HA 1M7IB 4ZUTA 2D7MA 4DZBA 3FFCB 3QA3A 4QXWA 5HHNA 1BFTA 1O5DT 4ODSH 3B9VA 4GKZB 3VRJB 1ZWIA 1JGEA 4K94L 5TDNA 1BFSA 5D93C 3MV9D 3DURB 4EQ2A 4R4BA 43C9B 4BFIA 5MEQA 5I0ZA 4XPTL 3MRIB 1YECH 5DJ8B 4XX1E 2ARJB 4YBHA 2KDGA 4XMKL 2NLJB 4HKBB 3QO1A 4DW2L 4P2YA 1FFNB 4KMQA 5KANI 5ICZB 3U9PL 1AQDA 1VFBB 3S9DB 1OTSC 3QXDA 3LS4H 3AXLB 5D1ZB 1IE5A 1CE6A 1PY4A 2DBLH 4IRZH 5C3LD 2GJ6B 1FJ1A 3J7HA 4OCSL 4H8WH 2R2CA 5C0JB 3QQNA 3BZEB 5ESQB 4CW1B 3C09B 3V6OE 2X4RB 1MCNA 4HPOH 4D0CA 1QQDB 1KIRB 3SPVB 1AE6L 4H0HB 5KVFH 2YXFA 3HE7D 5IUSA 1M7DB 1RUQL 5CJQL 3IAQA 4X0KB 4GH7B 1CVSC 1U8PA 3DPBA 2R56H 4GLRH 4HV8A 3I9GH 3T0DA 4TOYH 3VXRE 3KLHC 3NIGE 4RZCB 4QNPF 4P23D 4BELD 3BEWA 3C60B 1MHEB 2QADB 4CDGC 1CIUA 3GHBH 4K71C 4ZDHA 1GZQB 2FYYA 3PQYD 1MELA 3MRMA 4NQDD 3TZVC 1BWWA 3EYVB 1S8DB 1MJJB 1A21A 1T66D 3MV8D 1SYSA 3MV01 4PJAA 1LP9B 5ECJE 1ERNA 4HIIA 1P1ZB 2JK5A 1WAAF 3QAZB 4X9GA 4CVZB 4NHCH 4P3CH 3DNKA 5T1LA 4YBLC 1C08B 3KJ4C 5CKAA 2RB8A 2E7MA 4OLZL 4EN3D 4HIEB 1A6VL 5C3TA 3NIFE 4PJHB 5DC9B 1Q1JL 2C1OB 4LGSB 3I02B 4EXKA 4XP1H 5EIQA 2X9WA 4NDMA 3RHWF 1KTKE 3BQUB 1WWCA 1LNUA 1C5CH 4U1LA 1OP9A 2Y06L 1ZTXL 3WUZA 2B39A 2GTWB 4L8CB 3WN5C 5C8JB 3CFCL 3OKEB 4P4RA 5EPMA 3FT2B 1FGVL 2I60L 3RBGA 2Q3ZA 1YEDA 4KWUA 5IBTH 1OAYH 1MF2H 1OT2A 4I8DA 4NO3B 3MC0A 4YHNB 2EDQA 3WV0A 2CK2A 3TIDA 2AI0H 2XI9A 4X8JB 3IDJB 1N6QH 1KIPB 1R3KB 4P23A 3QXAB 1X5XA 5FYKE 1KJMB 3AM8A 4EKXA 3IFOB 2NCMA 2EYTB 3HAEA 1EIBA 3AMKA 2A77H 4WO4C 4Z0XB 4C83B 1Q8MA 1U42A 4NQDA 4NC1C 4JFDB 3OZ9H 1CFTA 2FB4L 4NPYB 3WJLC 1NCNA 2VDPH 2W0FA 1JGUH 5KSBE 1XH3A 2JELH 3BWAA 1J1OL 4I3RL 4Y5YC 2XA8H 4J6RL 3MNWB 1ZHLB 3ALWA 5C08D 3MV8A 5ANMB 5J7CC 3N85L 1NMAL 1Z9MA 3KYNB 1CR9H 2B2XH 5AZEH 1VPOL 1WBZB 2VLME 2VOTA 1EFQA 1LHZA 5DFVC 2G2RA 1I3UA 3P73A 1HSAA 1N6VA 4F7TB 4XNQB 5I66A 1G7JA 4I3SL 3LQZA 4EN3A 4G7YH 3UROR 3G6JB 1NFDE 4XMLH 4JM2B 1AGBA 3ARBA 3MO1B 4P5KA 4Z7QF 3ZDZF 5C6PB 1F2XK 2AQ2A 4ZAKD 1ORSB 4BZ2H 3NPSB 1ETZA 2R0ZH 5HPMA 1WZKA 3A6BL 4NM8L 5GGTA 1LEIB 5IQ9B 1YEEH 3BGFB 2A83A 4F9PC 1B9ZA 1ZHNB 5F1KC 2VLJE 1D5XA 1TZIA 3WNNA 1CBVH 4JQXC 3RGVD 4UOJA 1PG7L 4GG6B 1CLCA 4HJ0D 1F4WL 5EORH 1G0YR 4ZS6D 3CU1A 3SQBA 2H26B 1CTOA 3QUZB 4KI5D 3QQ4B 4XXDA 5E8OA 1CZ8L 3QI9B 3OXRA 4MA8H 1BAFL 3VDCA 3V9FA 4N0YL 2VZTA 3LAFA 5GS0C 3CVHL 5ALCL 3EGSA 1EBPA 2LAGB 4OLEA 1JF1A 4U7SA 2BVQA 2BVPB 1F42A 1XF4B 3LRSB 4XBPB 5DJ0B 1I8KB 2D3VA 2FJFA 1F5WA 1A14L 5E2TH 1T4KB 4ODXA 2X1PA 2XTJC 3RDTD 3NABL 4WFEE 5GGRY 4BYHA 2ZOLB 4NYLB 4HLZH 2P8LA 3ZHKA 4Z6AT 2HJKA 4YEEA 5C0AB 1OSPH 4C4KT 3SDYL 2ZJSH 4XNMB 5DJYB 1T0MB 5HY9B 2O5ZH 3S5LA 5CZXC 2YHGA 4MS8C 4NQXA 3VH8G 1G9MH 4X80L 4HLZG 3EW3B 4M5ZH 4N9GB 1CDHA 4ZAKA 3T4YB 1L7TL 1VKXB 5A2FA 4KTEL 5I76B 4F33A 2QQNL 3CFEB 1N4XH 4X6DF 2AJZA 4PP2B 2QHRH 5JO5A 4HWBA 5DUMH 4P2OC 1ZVSB 2EXYD 2LU4A 2ZWLT 3E8UH 3F65A 3QG7L 3P11H 4O58H 2GQHA 3MV7B 2GSGB 1BBJA 3ARZA 1FN4B 3KYOB 3T0ED 3TH2T 2OL3L 4WY7H 1F00I 3HNSH 4ESKA 2VLKD 5GSVA 1CLOL 3D18A 3P40A 2BRRH 2FLRT 3OJDB 5IMKB 4K8RL 3S35X 4X9BA 3SY0B 3UXFA 3WIIH 5ELIA 3DVIA 3OL2A 2NY4B 4DUWA 2D03L 5INCA 3CPLB 1E4KA 1O7SA 4L29B 5EU3B 2PW1B 2PTUA 3HRPA 2M2DA 2MHAB 5I18L 4R0LA 1QVOA 4TSAL 5F96H 1DQTA 3I2CL 3OX8A 5BV7B 4FQ2H 4MAUH 5J9PA 1R5VA 4NO0D 4OLUH 4HWEH 1UB6B 1K4DA 1VDGA 2UZXB 1XR9B 2VR9A 4LF3A 3CD4A 3LKRB 4NP4H 3QDGB 4HS3A 3UTTE 3EYOA 3SE8H 3HA0A 2JTDA 4N5UA 3DX9A 1FFPA 4LLDB 3EOBA 4HD9A 4YH6A 3MRPB 1QSEB 4MXVE 3BP7B 1I1RA 1I9RL 3GIVA 4CL7A 2X4SA 1YMME 1FC1A 4PJ9D 1IZKA 5DJAB 3BD4A 5C2BL 3PHQA 5E5UB 2KBGA 2D7TH 3HG1B 5DUPH 1NDMB 4YO0B 3EKCA 4QRSA 1U8MA 1DBML 1R5WB 1AXTH 1DQLL 3T0EA 4UIMA 4TUJB 3T3PE 5A16B 2DWEB 2OZ4H 1BHGA 3QUXA 2VLKA 4S1DD 3RWCB 3EHBD 3GMPA 4XTRC 5J11C 3E6HA 3G9AB 3GI8H 3V0VA 3KLDA 1A5FL 3P77B 3LD8B 2ICWB 1X4ZA 2Z9TA 3VCLB 1IEHA 1N5YH 3STZA 4QRPB 5C86A 1TQBC 1IC4L 5F9JA 4ZFOL 3WO4C 2P5EB 4LSPL 5DR5H 4JR9L 5C0FA 3C08H 3BIKA 3RTQA 5MENB 3IXTB 3W0WE 1PAMA 1BX2B 2E7HA 2BXYA 4G80A 4NO0A 1KCUL 4PJGB 1MAJA 3LCYA 2VITB 1MCSA 3BEVB 3CK0H 3QNXA 1L7IL 5I8EA 5HHQB 1BFOB 3DVGB 4HT1H 1KEML 2ENYA 3L95B 4KROB 3GSVA 3QSKB 4WUKH 4Q6IC 5IJKA 2EDYA 1DBJL 2E9IA 4LVHB 5EO9A 3DUUB 4PJ9A 4L9LB 1GGIH 4L4TB 5DLML 1S5IL 4KMTL 2H41A 2R69L 4GW5A 3WLBA 3O0RL 3QIUB 4WENB 3W5NA 5HD8C 4M8QA 2CH8A 3KVQA 4ENEC 1OAXL 2VXSL 3OMZA 3GJFA 4NRZB 4ONFH 5I8CA 4DN4L 3SQOL 1JPSH 3WHXB 1JNLL 1JWUA 4Q9RH 1HIMH 4LP4A 1MAMH 2ENSA 3MQIA 5D1QD 5IROC 1KSRA 4PGDB 2EH8L 4KK5C 4NQVA 3PWJA 4IM8A 4FQXC 5ILTL 3LPWA 2PETA 5D7SL 4W4OA 2OXGA 3P9MA 4OZFA 3HR5B 4UMGA 3LKSB 4V2CB 1AP2B 2PYEE 1LE9A 1S9YB 5A2LH 5DEFB 35C8H 2VNCA 1ZK9A 2CUHA 4BFEA 4W6YB 4DKDC 4P9HC 3SGKA 1SEQH 4EBQL 5EOQH 3PHSA 4OZIA 4WW1A 4RGNE 3H9SB 3UO1L 4B50A 4JZJB 1CGSH 2FH6A 3PIQA 3MJ8B 2DQDH 4Z7VE 5SWQA 4Y88A 3KPRB 3RU8L 1JZ2A 5DZOA 1OW0C 3P0YH 5T5NF 5I8OL 5TE6H 2PYFB 4N5ED 3LS5H 2FEEI 4QXUH 3BSZH 2HKFH 1OB1B 1CYGA 1A7OH 1AD0A 1T1WA 3MXVH 1EFXD 4Z0BH 2VXVH 3IDIA 5EG6C 5CLTA 5IFJB 5ADOH 3UPRB 1N8ZB 1RK1B 3C8HA 3UJJL 2Z31A 4JANB 3U83A 2YKLH 4X4MA 3E3QE 4M62H 1NFIB 4CVXB 4NNXB 1LO5B 4ZUWA 4MD4B 4DAGL 1NEZB 5IQ7H 3N1FC 2DLHA 2CXGA 2XICA 3MUGB 2ZCLH 2FECL 3EJZD 1ITBB 1FBIL 2RHEA 5LQBH 3SDDB 1C16B 4FFZL 1J1XH 1H5BC 4B53A 2D31A 5T3XL 4Z7WF 3MJ6A 4ONGH 3VFTA 1A7PH 1MCFA 5D1QA 3T1WA 4ZYKA 5K33A 4KZDL 1UXWA 1BM3L 3GKZA 5KANG 3IDXH 2LE9A 4FRWA 2WBJC 3O2WH 4OI7A 1WICA 2BCKB 3P0VH 3QYCA 3VD7A 1X5GA 4PJ8B 5IHZB 1AGCB 1G7MB 2R29H 5KVDL 4HXAH 2E9WA 4HLJA 3H42L 5ETUA 5HDBF 5IP4A 2NNAA 2OJZL 1QRKA 4JPKL 4M8VA 2AJXH 4NFBA 3X3GH 2Q7YA 1WBYB 3U7WH 1LO4H 3C2AL 1WZLA 1DBKH 3PABA 1JGDB 3VDBA 3MLTA 4FQCH 3TWCL 4Y4FB 1VERA 2H8PB 4BZYA 2H9GB 4EJ1C 3LKPA 5TGBB 3U0TA 1UYWL 4PJFF 3AS3A 3VI3F 4XCYA 5E8NB 4X6DB 5CEXA 4OM1H 4F58H 4ZSOB 4PRAA 1EFXA 3O2DL 2NW3B 3HRZA 5I1AA 4LSDA 1KPUA 2WK2A 4YHLL 3HAEG 3NMEA 2F53E 3MRHB 2GY7B 1ZA3A 3B9KC 2UY6A 4K23L 3NH7L 5L6YL 4M00A 3HI1A 1U2HA 3BYTA 3EFDH 3UCRA 5BRZE 2ZOKB 4K8RD 5J12C 5J0BA 1CG9B 4RMTA 2DQUL 1UZ6F 1F6LL 2V7HB 4G9DB 3WS3A 2R8SL 4P9MH 5E9DD 1RZFL 3WIHH 2MCPL 3UZVB 4JFYA 4OCXL 4WWKD 4QOKD 1J11A 2NY2C 3FQUB 3ULUE 1LD9A 3QJFB 3V5DA 5DA4A 2HFGH 4HFUH 3CVHA 4HK3N 1OAKH 3GSQA 3DHMA 4Q9BA 2NW2B 1KF9B 1T83A 2XZCH 3K0WA 5AZ2L 1KNOB 2V17L 1ZT1A 3NA9L 2IPTH 4NSKB 4OLXH 3BKMH 2VL5B 3O45B 4OQ1A 4Q7DA 3EO1A 3H3KA 1HSBA 3DARA 3NGBB 4RIRA 4GAJL 4D8PB 2VQ1B 3SKJL 2FIKB 1IC7H 4NWUL 5IV2B 5MEOB 3N9GH 1T3FB 4PUBL 3JTSA 3VRLE 1YEIL 1JHTB 1WISA 5AD0B 1Q0XH 2X4OB 4XVTL 2J8HA 1HHIB 1HH6B 3I50H 2BC4B 2NXZB 1LK3H 3GZKA 2LABA 2I5YL 1MCHA 1D5BB 4FN0A 3VXMB 2YD1A 1Q94B 5L8JB 5SWSE 5DJXA 3WEXB 5DYOB 1F4YL 5I1HL 4P4KC 4OCMC 2C1PA 4JGMA 2WWKO 4N1CA 4U0RB 4LCCC 2EO9A 3BN9C 2EIBA 2W07A 5DD1H 3WD5L 2UYLB 2R2EA 5EUKA 3SE3A 1NCAH 1EAJA 5IW3A 1FG2B 1UGNA 3H7BA 3PGCA 5FKPA 3RWDB 1RV6X 2Z8RA 5E9DA 1YEGL 3MLSH 5TF1H 3O41A 1J10A 3H9YA 3NZ8A 1R3HA 3PHOA 4WWKA 2WLZA 3OF6D 3S5LG 1EV2E 1HXYA 4PFEA 4HWBH 2WANA 2YRZA 3VXTA 1I8MA 3TBWB 4H5SA 2DB8A 2I9LA 3DV6A 4MA3B 4JGUA 5KAQG 4RX4A 4JFQB 3BDYL 3QEUB 2Y6SD 1H3PL 5DTFB 3ULVL 4OLWH 3WFEL 2XN9E 1B0RA 3EAKA 4HWUA 1YJDL 3VFGH 2ED9A 4JFZH 4R2GD 2P43B 4Y5VB 2XZQL 3R06A 1J1PH 4MJ5B 4NKDB 1CDIA 3D87B 4WU7B 3NIGF 1WJ3A 2EXWD 2NY3B 4PREA 1GGCH 4NN7B 4KTYA 2FWOB 3QQ9D 4U6HB 5FGSA 3WL9A 3QCTH 1E28B 2YR3A 1X7QA 4Q9QL 3CLEL 3U36B 5CUSL 1MWAB 3BW9A 3LKOA 1FGNL 1X44A 3R1GL 5L0QB 2FZ3B 3FB8A 3DIFB 1SJEB 1ES0B 2QHLA 2X44D 4IRJD 1Y0LA 4JM4H 1BFVL 3HB3C 3U1SL 3FB5B 5HHVH 4LLWB 4LDOB 4LPWA 5CFHA 5E99H 1CIDA 1MFAL 3KPQB 1INQB 3VW3L 2HJLA 5IBLD 1QFWM 1V7NL 2YD2A 4UQ2B 1CGYA 3B2UD 4KRPD 4ELME 4LVOC 1HINH 4Q6YA 1MCDA 1JTOA 4G9FD 5E6YA 4XP5L 3O3BA 3RAJH 4ZFOA 4WCYL 2BRQA 2DDQH 1RHFA 2Z91B 4HW6A 4WI4A 3VXQA 4GW4A 4IMLA 2SEBB 3OF6A 3OAYH 1WZMA 4M6NH 5FO8A 1E6OH 4R4NC 1HHJB 4JZNB 5DK0A 4OUUB 3TN0A 5H2BB 5KVGL 3G08B 5EOCL 4NRXA 2VLLB 5DD0L 1LEGB 1R24A 4H88H 4EOWL 1XF5A 2YN3A 5T3ZH 3FMGL 4X7SL 2EYSA 1YQ2A 3VRIB 1AXIB 1GL4B 1U8JB 2K7QA 3VFWA 4AY0A 3I3DA 4X5WB 1ZVHA 3WS6C 2H6PB 2YPVH 4I18C 5IB1A 3QG6B 5FOBB 2V2WA 2WIIA 5TQ2L 5M94B 1SBBA 3VFVA 4XMKH 4Z7WB 1KXQE 1E6JH 1RUAH 4DVRL 3AS0A 5T3XD 4U1KB 1P2CB 3U9PH 1MY5A 3IVKA 1A6ZA 4IIQC 3X12A 4IRJA 4M93C 4XB7A 1G6RL 2YOCA 2PO6D 4OCRL 1TPXC 3FN0L 7FABH 4M6OL 3O8XB 3O3UN 4RAVA 5T5FH 3U4BL 3LEVL 2E3VA 3PWNB 4KQ4L 3RIFK 1HHHA 4G9FA 4DKFL 4L1HA 1AE6H 1UADC 5AAMA 5F72S 5I8KH 1RUQH 1JZ7A 1M4KA 1NFDF 4LQ1A 5IESL 4TVPE 1CF8H 1FVCB 1S9VB 4B0MM 2VE6B 3WUWA 2HFFB 2G5BA 3IB4A 4PJFB 2HG5A 2CMRH 2XQYG 5FYJE 3LB6C 3B3IB 4U49A 2VLMD 3MFFB 5IJVA 1ZS8B 3QIWB 1I7UA 2N1KA 3D3VE 1PBYA 5IKCB 4KHXH 5E5MA 3PL6C 2DLGA 2DTML 2A73B 1ITCA 3C8KB 4PRHB 1PKQE 4OCYL 1CVRA 3H3BC 5L2KE 2O5YL 1CS6A 5D1XD 4HFWA 3THML 1KEGH 2APWA 4EVNB 4OZFG 4X98B 4NT6B 4H20L 5B39B 3B5HA 1FFRA 5B8CA 5JORB 3U6RA 1IM9B 3QQ3B 3WE6B 1AHWA 4UZGA 2QSQA 5F89B 2Y5TA 3K8KA 1R5IA 4KUZH 4D9RD 5DQJB 1D6VL 2X42A 4LHQB 3FOMB 5I19L 2Y23A 4GKOA 5GRUL 1Q1JH 4G8EB 4PGJA 1TTFA 3SGDI 5BZWB 4KUCD 2HMID 3TO4B 4BQBA 1K85A 1UJ3A 2PO6A 3PP3H 6FABL 3BPOC 5EC1B 4LCUB 2MMXA 3K2UH 2Q6WB 1HDMB 1WEJL 2YUZA 1YEHL 4YXKL 2GK0B 5CBAA 2IAMD 4GXVL 4TNVF 2I60H 3QFJD 3OAYK 4KHTH 4ZODA 3KWWA 4Y19B 2EC9T 3N0PB 4WFGE 5M7QA 4JFHE 3SGJA 5EOTB 1GGBL 3LKNB 5DI8A 3NFPB 2P5WB 4U1IA 4F7MB 2W9EL 1XGUB 3TBVB 1KBGL 4JZOA 5BS0E 2DTSA 5TPWL 3Q3GA 2HVKA 3O2DA 25C8L 3BH8A 1D5ZB 3S36L 2FB4H 3VXUE 1ZOXA 1NBYA 4N1HB 5DVOA 4KQ3L 4UBDD 4QWWD 2RBLA 1J1OH 2CRIA 5D1XA 5JXEC 1Q72H 2O26U 5KOVC 1NMAH 3QEQE 4LSVL 2HVJB 3S96A 1FO0L 1IGJA 1H8SA 2YEZA 4XP9L 1VPOH 5GGVL 4H8WC 3TJHC 2CDFB 4ORZC 1CGXA 5DHXB 4EEEA 3WFBL 3V6ZA 3VFSB 4LBEB 4I3SH 5J6GB 4B5EA 5I1IL 5SWZE 5J1AB 3MOQA 4C4KO 4PV8A 3GMNB 3A6BH 3AB0B 1T5WB 4PJ5D 2ZUYA 4N68A 1XF2B 4W4NA 2W1NA 2WQ8A 1JK8B 1Y6MR 4MLSA 3CSPA 1V3JA 5JPMA 2HRPL 4UDUB 3C5ZC 2XQYK 1JHKL 3WNLA 1A0QL 1LDPL 4MXVF 3ULVD 3ECBA 3GJFK 2EDEA 2H1PL 5E8PB 3W9EA 3QO0B 1F3DH 1VHPA 4LAQL 1DQMH 2A6KA 2Q8BH 3N1MC 4IDJL 4KZEH 2E5EA 2AV7A 4LEOA 2QSTA 5C0CD 1OTUD 3M1BB 5DJ6B 4XMPH 4UILH 1LE5B 5HHOD 3VXRB 4AMKH 4DWHA 4MB5A 1TITA 5CEYB 2IGFL 1GOHA 3HNVL 3SCMB 2BK8A 3IGAA 1YN6A 4J1UA 3RIAK 3RWHA 1CD9B 1JWMA 3UYRH 5ISZD 1W0WB 4OGYL 4H25A 2KH2B 2KZWA 4NQUA 1VFOA 2QTEA 4Y5XC 4DCQB 5CBEB 3R0MA 4YDKL 1T1XB 4UT6H 3CVHH 1A4JA 3OJVC 4LCYB 4N8CL 1D5MA 5JIPA 1UH4A 3OKNB 3HNTL 5EUOA 3GI9L 1A6TA 1KLFA 4MHHI 4U2YA 3QUKA 4F7PB 4MAYC 2MKLC 5D2NA 2CDEA 3SO3C 4QRUA 3O6FD 2MCG1 4JN2A 1AD9A 3PDDA 3Q1SL 3PP3K 2X4TA 3U7AA 4X80H 2DMBA 1ED3A 2IH1B 4K9EH 1L7TH 3FT3B 3W9DB 1UM4H 3R4DA 4KTEH 5HI4C 1NUDA 2QQNH 2Y7QA 1IGFL 4AK1A 4OZGE 4KTDH 5AG9A 5DSCA 2HN7A 2J88H 2Y1VA 3S97C 2QR0B 2EDBA 3F5WA 1RJYB 1QEWB 1WBXA 2ZUXA 2WNGA 2OL3H 4C56E 3ARFB 2HA1A 3D6GA 3EFFA 5F9WB 1RUPL 2C9AA 1FFOB 2ZG3A 4MCYA 5DQ9A 4U2ZA 1CLOH 1QA9B 4X6FA 5F88A 4XNUH 1XIWB 1CICD 5BVPL 3TVMD 3C2SA 1XR8A 4YHYB 3RWGA 1HKLH 3CDGA 1KN4L 2G75B 4UNTA 4OKVA 5HHOA 4XC3L 1S3KL 4G8GE 5E6ID 4M7KL 4KK6D 1OAZL 5CAYB 4XCEA 5B22A 5JMOC 1VFAA 5ISZA 2EE2A 3L3JB 3DGCR 4JN1H 2BNRE 3ZE0E 2P47B 3WNKA 5E2JA 4XNZC 3WXVH 3JWOL 1X5LA 2BHUA 4ZXBD 2ITCA 3IFNH 5KSBB 1NAML 4PRPE 2ZSWA 2CXKA 4UV4L 5C07E 5D7LE 1B0GA 5GS1B 5DMJB 1EEUA 1NCWL 4NRYB 5FM5O 4FZEH 2ADIA 5D7KD 2VH5H 1GYAA 3U9UB 5I17A 5T1DL 4BUHA 3O6FA 4HIHA 1UEMA 5C2BH 5EIIA 1N3NA 1NFDB 3JV4A 12E8L 4Z7VF 1ACYL 1R3JB 4IRSB 4XAKD 1AH1A 2OYPA 1JL8A 4L5FH 3CH1A 5IMOA 3IFPB 1ZLSH 5IFAH 2ZUSA 4Y16B 1DQLH 3S4SB 3S37H 5IW1B 3PWVB 2JE8A 3ZTNL 2HP4A 1BJ8A 4HHAA 5DHYA 1CICA 2X4QA 1U8IA 1XCQB 1N5AB 1P6AB 4J23A 1QYGL 3TA3D 1A5FH 2VLJB 1LO0H 1AFVH 3U7YL 1QBLL 1MJ8L 2ARWA 5KJRH 1OOAA 2PUQT 4RDQF 3FO0L 1IC4H 2OP4L 3L6FB 4RNRB 4Y8DC 5E6IA 4TSBH 1DCLA 4KGJA 3JVGC 4LKXB 4LSPH 5HVFB 5JA9A 1YEJH 5DRNB 1NSNL 1OARL 1QFWL 3CX5J 3O6ML 1BBDL 4YHKL 2Q76B 1KCKA 1DUZB 3KYMA 1G9MC 3NTCH 4X6CE 2JJWA 4ZXBA 3QHTC 1KXTB 5ID1B 2IFFH 4E41D 1G6RA 1XZ0A 4KRNA 5K9JH 3MRCB 2BHYA 2K3TA 1KEMH 3RIFF 3BP6A 5ESVA 5IBUG 3RPIA 4WTXA 1NGZB 5J3HC 1WIUA 4OUOA 5DVLA 1DVFC 5I74C 1A9BA 2NY7H 1JNHA 1YC7A 5DLMH 5HHNB 1S5IH 4KMTH 2CUIA 5D6CB 3SN6N 5KVEL 3DRTA 4OF0A 4JPWL 5L2JB 1IAKA 3GUTB 1JGEB 3VGGA 4HCRH 4R3SA 3W39A 4J8RA 4Y2DB 3SQOH 1NBQA 3WBDA 4M6AA 1JNLH 2VXTH 5DK2A 5CMAA 4O2FB 2J3SA 3QPQC 4FTVD 4R7DA 2AJVL 2WUBH 2EH8H 1D9KC 1CK0L 1F97A 4P3DA 3GKWL 3QR2A 2GSIB 4LSRL 2FHBA 4JGJA 2IBGA 3MBEB 4U3XA 5IK3B 1IILE 4WUUD 4U7KA 1Q9WB 2YK1H 5DT1L 4QXTA 5ADPH 1QRNE 4YZFE 1IGTB 1KTRL 4CJ1A 1ONQA 4FQIL 4OIBA 2XWBB 5D71L 3UO1H 1Q9OA 4PYHA 4GRMA 4NBYB 3BQUC 5TDOA 2GY5A 2WSKA 4O4YL 3RL1A 3F7YB 1QBML 2XA3A 2P45B 3VGHA 4MWFB 4Q0XL 4E41A 1U2CA 1U8PB 3ULUF 4JRXD 3WUWG 4JDVB 3GMMB 2YRLA 4J4PD 3UTTB 4QY8A 3X14A 3BEWB 1U3HC 4OGXL 4WEMB 5EBMA 3V0AC 2DQFA 2VXUL 2FYYB 1DN0A 3MTRA 1YMMB 2V5YA 3QEHB 2B20A 4FXLA 1U3YA 3G04A 1NLDH 4JKLA 1ZSDB 1ZT7A 3MRNB 1FBIH 3GHEH 1KT2B 3L3DA 1MI5D 4WU5A 2EIDA 2Q8AL 5ITBH 4FFZH 3VRLF 5EUOE 5D5MA 4I77L 3NAAL 1SYSB 2XKSA 3UTSD 4U1SB 2YBRA 5T3XH 5D2NE 4FTVA 4HIIB 3LRGA 4KZDH 2ZUQC 2J6EH 1IKNC 4PJEE 4KJWC 5T1LB 4DOHE 1BVZA 4HJJL 3JV6B 1BIHA 1HHKB 5FYKH 4BZ1H 4MNGA 4WUUA 3B8YA 2JLLA 4XRCA 4JLRA 3TYGL 4DFIA 1Z5LA 1G84A 2FH8A 4NDMB 3OXSA 2OJZH 4JPKH 4QHUA 1BZ9A 4XC1L 1FO0A 4CJ0A 3C2AH 4OGAD 1EJOL 4GW1A 3MLRH 3NPSC 1NC4D 3DMMB 4LSUL 4X7TA 3RZCC 2R2HA 4KU1A 1RZ7L 5JHDE 4WO4D 1MQKL 3T0AA 1FZOB 3W0WB 3BGFC 1YEDB 7CGTA 1S7SB 1UYWH 3DTXA 3QWOA 4EIGB 3TZVA 5SX4I 5ERWA 4M3KB 4JRXA 5D2LA 3IJHA 3KS0H 4I9WE 4NNYA 2CDGB 3TIDB 1WT5C 5C9JA 4PJBE 5HHXH 1AXSB 3S35L 3FKUS 5HDQL 3QUYD 4RMRA 3BRDA 4J3VA 1A6UH 4GKSA 1F3JB 3KPSE 3HAEB 1I8IB 2EIZA 2GT9A 2WWMC 4HGWA 4JVUA 3DI2B 3MLZH 2YC1B 2YD3A 1WITA 4JFFE 3GNMH 4PB0L 5EZLA 2WAHA 3QUZC 4YFEA 5IB3B 1JFQL 3QI9C 5DF0A 2W0FB 5BW7C 1YPZA 2BOCB 4TYUA 2YA0A 5EO0B 3RIAF 3ARGD 4IOFD 4NZTL 3UTSA 2DQUH 5IEHB 4M6MH 1B2WL 3ILPB 1U9KA 1NC2D 1RUML 2VB5A 1RZFH 2BJMH 1G6VK 3SGDH 2G2RB 2X1OA 3P73B 5JQ6L 4MQSB 2AK4D 1KJ3H 3WN5A 4OM0L 2E6PA 4OD2B 3ARBB 3FFDA 4QHNB 1R3IL 4OAWA 4P5KB 2PYEB 4MSWB 5TQ0L 2RCSL 1ETZB 4L9DA 2ADGA 2EE3A 2R1YB 3BP5A 3WDJA 4LHUB 3KJ6H 3WFHA 5AZ2H 3RY4A 2ICWJ 3GSUB 1IC5L 3FO2A 5CD5D 3OKMB 2V17H 4ELMF 2AEQH 5GISH 1WTGT 4RGNB 3MLXL 3WFCH 1NC4A 3EO9L 2A83B 2XV6B 2KPNA 2VXQL 4L8BB 4WO4A 4GAJH 5FA4A 3SKJH 4Z7VB 4GMSH 2V5MA 2OCFD 3GSRA 1J8HD 4JQIH 4PUBH 3ARDD 4MCZA 3ARQA 3WJLA 2O5XL 3BO8A 3KLAB 4XVTH 3QUML 4Y5YA 2XWTA 1RJLA 3K46A 5ALBL 5L7XL 1PYWA 5F6HJ 3ET9F 5J6HB 3QUYA 4JO3H 4ZD3L 1F6FB 1UWGL 4XXDB 1IKFL 4UAOC 5E8OB 2X9YA 2XTJD 5I1HH 4C57C 5I1JL 1XCTB 4K3DH 4M61A 3GO1L 4L3ED 3DETD 4N0RA 4BH7B 1A1NA 3WD5H 4Y2OA 5EU4A 3X17A 2BY0A 1JF1B 2FATL 5HHME 4TPRL 3HE7C 2A6JA 4ODXB 4E0RB 4JDTH 2B1AH 4P2OD 4PD4K 1DE4A 2P8LB 5D96C 1J0IA 1QFWI 1LDSA 4RA0C 1Q0YL 4KKAD 1W0VA 1J86A 1BZQK 5GRYA 4F9PA 2ZZUT 3S5LB 1S78C 4NQXB 4G8FA 5IB2A 1NAMA 3BDYH 3V4VL 4I0CC 4MQ7A 4HQQH 4YHPA 3RNKB 1D6EB 2AJZB 3IJYA 3SJVE 3LIZL 2Y07H 4HUXB 1YJDH 1FL5A 4XGZA 3BPNC 2JCCA 3MLYL 4DTGL 2N56A 3O2VL 5GSRA 3HUJE 5E7BA 3MR9A 1AQKL 2XZQH 1N7MH 1TVBA 4P2QD 5GSVB 3D18B 1CE1L 5LGJB 3FZUD 1J8HA 5TF0A 5I30L 5IVXE 3VXPA 5HYIA 2EKJA 2BVOA 4WHYG 1CXKA 4AEEA 4Q9QH 4NJ9L 1IT9H 2DIBA 5D9SA 4EN3C 4GG8A 2V2XA 1H0DA 4MMXC 2ZUTA 5GGUA 1FGNH 4NHUA 2R2BA 1JMXA 3R1GH 4O5LH 3E6FA 1BFVH 2F53B 4OFVA 3TPUA 3IXAB 3U1SH 4TVPD 1M71B 4OJFL 2Z8WC 4L3EA 3LSOA 1OGTA 2E7BA 5J9PB 1MFAH 3VW3H 1WGOA 4RMUA 2AXGA 5LJYH 5BRZB 4M7LL 4YE4L 4LF3B 1HH9A 5EA0L 1AR2A 3EYOB 3QHFL 4MNQA 4WCYH 3DX9B 4LCWA 4P2OA 3RY6C 1EGJL 2X4SB 1KTLB 5K9KA 4P57A 5C09E 1PSKL 4LVHC 4NCC2 1FIGL 2UUDK 4L9LC 3U79A 5MHSD 5KVGH 5ESAB 2QL1A 3NACH 5EOCH 3ZZ1A 5DD0H 1L0QA 4S1RL 3ZDYF 3RWJA 4LQFL 3D39E 4AZ8A 3CXHK 2FR4B 4EOWH 1UCBH 4UIMB 4X7SH 1VB9A 2Y36L 4X7DC 3QUXB 2ZSVA 4P2QA 4XVSH 3BUYA 4PIRF 2W60B 1MH5A 3GMPB 4PJIE 5CJ5A 1A02N 1FRGL 4XPGH 4KPHH 3V0VB 1CFSA 2JJSC 5TQ2H 4FFVD 1AR1D 4CU8A 1RFDH 3STZB 4NQCE 4NKIH 4WEBL 4UT7H 5F9JB 3W81A 4D0BA 4ZAKC 2VABA 3SDAD 4Y4HB 1CD1B 3ARPA 5H94A 5SWSB 1U8HA 1N59A 3RTQB 2ZUVA 1QNZL 2HWZH 1W72L 2IC2A 4J12A 5CJOH 3FN0H 1BZ7A 4NO0B 5GGSA 1IFHH 3HC4L 3BKCL 1YEKH 4R8WL 3GB7A 4XNXL 4KQ4H 4HGMA 1YUHB 4ENED 1RU9H 2EC9U 1MEXH 3VGAC 2B7DT 4PTTB 3GSVB 3RGVC 3BZ4A 1NAKH 4MDJA 4HJ0C 3U2SA 1BGXL 2NY6D 2HH0L 1E0OB 1P4IH 2XY2A 1E4KC 1MFCL 2P24A 4K3GA 4KI5C 5LGKA 3WLBB 5KTEH 4QHKJ 4HULB 3U0PA 5ACZA 2OI9C 4M8QB 3GJFB 2ATPA 5HI5D 2EEAA 5I8CB 4P2RE 5BOZG 2XN9B 4OLYL 2H2SD 4AG4L 5GS3A 3AAZB 1SYVA 3IETB 1TETL 3CC5A 1GRWA 2O5YH 3GSNA 1RZIB 5D7IA 2KL6A 3A67L 4PR5A 3THMH 4EI5B 1S7TB 2B0SH 5IG7A 1G7LA 5CP3H 1EVUA 2G60L 3SE9L 4H20H 3P9MB 3RDTC 3L9RA 2AV1A 1F90L 5IHUL 1U8QA 1LE9B 3BZFB 3T1FA 2FX9L 3SOBH 4U1JA 1DJSA 5JW3L 1Z0NA 4HG4K 1I9JL 3HZYA 3O6LL 1D6VH 1TJIL 4JHAH 2JIXD 2NTFA 3DGGA 4WW1B 4PJ8C 1P7KA 5CCKH 3SDAA 1G7HA 2R4SL 1LILA 3PIQB 2EXYC 4Q6IA 3T3ME 3U48A 3K8LA 2XKNA 3T0EC 4ODTL 4L8SA 4Y4FC 1I1FB 1WEJH 2F15A 1YEHH 4YXKH 4AEFA 5IT2H 1WCBA 2J1KA 3GMRA 1DFBL 1T1WB 2FHFA 4ELMB 2EICA 3IU4L 3MLWL 5I1GL 3IDGB 4N8VG 5DEGA 1BQSA 4D3CL 3CFBB 1KCVL 1P4LA 5L88L 2Z31B 3UJTL 2F8XC 3OG4B 4XBGB 5IROA 1I3GL 1JPGB 3I75A 3KDMB 3BVNA 2DQCH 4OZGF 2CK0H 4TSCL 1QLRB 4O2EA 2ATKA 1VACA 4LLQA 3MNVB 3S36H 2C4XA 1I7ZA 1KGCE 3CSYA 4KQ3H 3L7EA 1VADA 4ZYKB 5HTSA 5C0RL 4O2CA 1T7YA 4ZPVB 1IQDB 5C0GA 1UXWB 4OT1H 2RGSA 4LSVH 8CGTA 3IF1A 1QZ1A 4YXHH 1L9MA 4XP9H 5KS9E 1LP9E 2NX5A 4K2UL 2YRPA 5FHBL 1PW3A 3Q5OA 4UT9L 4QHMA 4N1EA 3CAFA 1OW0A 1WFTA 2NNAB 5JIKA 5HYSA 2JIXA 1T80A 4Q58C 4PY7A 2ESVD 2Q7YB 1JRHL 3ZE0F 1FHGA 2MJWA 4ZUVA 3MLTB 1VGKA 1MCOL 5CWSB 5BXFA 1OHQA 1T04A 1RPQA 1IEAB 5DMIL 2DQJH 3CCHB 3AS2A 3LKPB 5GPRA 3VWKB 4S1DC 4XCYB 3NGBC 3X11A 43CAA 5CEXB 1WZ1L 1CLZL 1A0QH 3ZYIA 2ERJB 2H3NB 3HRZB 2H1PH 5GZND 5I1AB 3JWNC 1KPUB 1H5BA 4GKNB 4RFOH 3V7AE 4F37F 4EI6B 4JG1H 2FBJH 4IDJH 3FQTB 5I16A 2NXZC 1ZA3B 2EE9A 4Y1AD 3MYZA 3SGKC 2E6QA 1U92A 5JLZA 3GRWL 1FAIL 5FYLL 4ALAL 3GSOB 1EHLH 2IGFH 4AYFA 3HNVH 5KZCB 3MRRB 1NKRA 1ZHKB 2E6JA 2WBJA 1JGVL 1SY6H 1T22B 1OP5K 4OGYH 5GGRA 3D3VB 4HBCL 4I2XE 3RVUD 3DX6B 4MNQE 2O93L 2V9QA 1K2DB 3E1F1 2FO4A 3ROOA 4JFOB 1GIGH 3KPPA 4FG6D 4ODSL 1TQCB 3EYFA 4R7NA 1PKQB 3L3OB 3L5XH 1SHMA 3RL2B 5L2KB 3HNTH 2VAJA 1I1AB 3ABZA 4S0SD 1NGPH 3GI9H 3LVEA 5A2JH 5GIRA 1INDL 5I2IA 1Z0MA 3V5DB 5TH2A 5EU6D 2ICCA 1YECL 2YD7A 2ITDB 1S9XB 1FZMA 3VXOA 4CN6A 5HGHA 2ESVA 5EU5B 4CVUA 3Q1SH 4E5XB 3G6JE 5FF6A 2EDRA 4J7RA 4Y4KD 2EDFA 3ZKMC 3G6DH 5CEZE 4X5XB 4JFEE 5SX4H 3P4LA 5D72L 1A7RH 1A1MA 1HSBB 3HZKA 2AK1H 2D2OA 2DBLL 1DDHB 3DXAD 2EDWA 4P4KD 4IRZL 2XFXB 3JTSB 4JKKA 4HUVB 1S7UA 3BN9D 4H8WL 1FZKA 4P48A 4PPTA 2NXYD 1SVCP 4X6EA 2ED7A 2NY3C 4HPOL 2R1XA 4GS7B 5BVPH 4NN7C 4RQQB 1BLNA 2YZ8A 4HUMB 3KNBA 4HKXA 5KVFL 5EBWA 3TO2A 5DJXB 4Y1AA 3ZE1E 1QSFE 4CMMA 2R56L 2C1PB 2BSSA 4YDIH 3ARSA 4TOYL 3MGOA 4M7KH 2HLAB 3OPZL 1OAZH 2EDTA 32C2A 1EZVY 1UZ8A 3KYKL 4YK4B 5BS0B 2JKXA 1JZ5A 4IOSD 1NMCB 4V1DE 3H7BB 3PGCB 4BQCA 5FKPB 1YY9D 5J89A 3JWOH 4G6JL 2IQAA 3MRJA 3VXUB 4N5EC 4B41A 2IALA 1NAMH 5FGRA 5DDHA 3NZ8B 5JNYB 1LGVA 1CDGA 3FQNA 3LY6A 1HXYB 2ICES 4XBEH 3OWEA 2EDLA 4JO1L 4WRLA 1NCWH 3QEQB 3S37X 5HHPA 3VXTB 5I1KH 2D0GA 3DV6B 4YZFF 5EU6A 5I75B 1BOGA 3REVA 5JTWA 5DMKA 5K9QI 5EB9A 5GGQH 4BKLB 4NKMA 4NHCL 4P3CL 1B0RB 3CZFA 3AREC 4UUJA 3SKNA 3EJZC 5L8LB 12E8H 4XVJL 1ACYH 2KZ1B 5SWZB 1EGJA 4AIZA 3Q5TA 5F7LB 2VDMH 4FQQB 5CIPA 3R06B 4OCWH 3OBAA 1QRND 1X5KA 1HXMA 3DXAA 3HB3D 5KSAC 4P4KA 5A3IC 2M26A 2MQ0A 2E8YA 3GSXA 15C8L 4LCCA 3ZMRA 8FABA 1C5CL 5H35A 2EIEA 4LARL 5CSGA 1OP3H 3UZEA 1DZBA 1PX4A 2ZUWA 2DLEA 5E00A 4L4VA 4NC0B 4EDWL 3BW9B 3FONA 1VEPA 1QYGH 4U1GB 5E70A 1JYWA 5E1AB 1Y0LB 1QBLH 2DKUA 1PJ9A 5IBTL 4ETQA 1CT8A 1MF2L 5DRZA 1MVUB 1WUNT 4IS6A 2VDKH 4I1NB 2D9QB 2OP4H 5BVJA 2AI0L 5EUOF 3B9AA 1NGQL 2PCPA 1XGQB 1JN6A 2VUOA 4AM0A 5HJ3B 4F3FB 1NSNH 1QFWH 4NFCA 3NOIA 2A77L 3O6MH 1BBDH 4YHKH 5FUZL 3UTZA 2FX7H 3NFNB 3KXFA 1DBAH 1FNGA 2GJZB 3OZ9L 4K9EC 3UX9B 2VDPL 4IMLB 2JELL 1MAKA 4JY4A 1W72A 2VLRE 2CRZA 2JF1A 3VGEA 4D9QD 1RIHL 3DROB 2AQ1A 5DK0B 2B2XL 3TN0B 5AZEL 1QSEE 1ACZA 1G7PB 4XCCH 5E08L 1HWHB 4MD0B 4DN3L 5C6WH 3X3FH 1XF5B 2OM5A 1KENH 4G7YL 5FUCC 3SE3C 4XMLL 1WC7B 1FYTE 3HG1E 4QRRD 3L5WA 4PGEB 3MUHL 4MJ6A 5DD3H 4WFHD 2R0ZL 4PJCE 4OZGB 2NX5E 2AKRA 5IMMB 2CLVA 5DRXB 2R1WA 4PJBF 3O9WD 4PJXA 1KPRB 5EN2B 4GAFB 4Y0GA 1CK0H 2V2WB 2V2TA 1YEEL 4WWKC 4TVPH 4C56B 3GKWH 4L4JA 4X4XB 4HKJA 1HHGA 4KI1A 1XGRA 1I7RA 3PF2A 4LSRH 4U6XB 3TJEH 5FYJH 4IRJB 1CBVL 1R0AL 4I4WA 2AEPH 5DT1H 4HUNB 5IW6B 4Z18A 3TPKA 2EDNA 2ORBH 4HDIB 2ADJA 3G5ZA 4FQIH 3O4LE 1GSMA 1WAAE 4GRWE 4G8GB 5C0DA 3TO4C 4XP6L 3EJYD 5DJDB 5HYJD 1WVZA 2BNRB 5MENE 1JRHI 3RX7A 2VDOH 1T6VN 1DLHA 5MP6H 5EO1A 4Z76A 4Q0XH 4PRPB 3GGWB 5KSVA 3MRGA 3HC0B 5C07B 5D7LB 1MPAL 5E24E 3HCVB 2G5BB 4L8DA 2HG5B 2FSEB 5E2TL 4OGXH 3WIFA 3WS6A 1QTYT 4I18A 1I7UB 4FQPA 3V7MA 1A6AB 5F7HA 5E5MB 2EEBA 4L4TE 1I9IL 1OSPL 5FKAA 5FCSH 3V4UH 4PRDB 2O5ZL 1A64A 2K9UA 2C7UB 4A6YH 1HQ4B 4PRNB 5IGXH 1G7IA 1AO7D 4QRRA 4M5ZL 2YMXH 4RFEB 2Q8AH 1JZ3A 1N0XL 4R6UA 1X5ZA 1F3RB 2IWGA 1MLBA 1A3RH 4NUGH 5C1MB 1H3TA 2Z93A 5DUML 5FYLD 3QDMD 1TVDA 1S5HA 2Y5TB 3QH3B 1U8KB 1R5IB 1U58B 3QIBD 4HJJH 4PGBB 1NUNB 3RX5A 2Y6SC 1U8OA 1DQJA 2BRRL 4JHWL 4JRYA 5ICYA 4TTDD 3IKCA 3H7LA 2CRMA 2BOBA 4Q2ZA 4DK6A 4R2GC 1A9EB 4CMHB 1S7RA 3UBXB 3F7VA 4LMQE 3VXNA 3PNWA 1ZHBA 4WV1B 4LSUH 3TF7C 3CSGA 3OGCB 2KKQA 4ISVB 5CBAB 1RZ7H 1MQKH 4LPUA 2P8PA 2GYSA 5IB5B 4X4YA 2A1WL 3PL6A 4X6CB 5GRJL 3C9NA 4O9HH 1S7WA 4YUEL 5CZVH 1HQRA 4HKZB 4KDVA 3VFNA 2LFGA 3F62A 2XKUA 1REIA 1NCBH 5D7JD 4NP4L 5E2WH 3S35H 5JXED 4U1IB 5HVHB 3EOTL 3SE8L 1BD2D 1KYOJ 2Y5EA 5AWNH 3HI6H 3TJHD 3BJ91 2HVKB 2BDNH 3D0LA 2X2YA 4JE4B 3CVIH 1JFQH 2X05A 3RWFA 1OLLA 2D7TL 4LLVA 1AO7A 3MRDB 4KRPC 3B2UC 4BSVB 5EIVA 1IMHC 1F02I 5DUPL 5IVXF 5B38B 4HJGA 4YHML 3UDWC 5I15H 3S96B 5I1LB 1U91A 3GRWA 5EULV 1IGJB 1QPPA 2PTTB 2IH3B 3RNQB 1MJUL 1OF2A 5DMYA 5CHNB 3QDMA 2F54E 4G8IA 1TMCB 4HH9B 5HYSG 3V6ZB 1WLHA 2GKIA 3QIBA 1P84J 5FB8B 1BJ1J 1WQVT 4J3TA 4S2SB 3T65B 4OM0H 5HGBB 3P9LA 1PQZA 3WO3B 1R3IH 3GI8L 1AGEB 2DYPD 3PJSA 2OTWA 1N5YL 4LL9A 1AKJA 1IC5H 3QJHA 4QHLB 1P9MA 3P4NB 2QKIA 3MLXH 3EJJX 5JPMB 1CL7L 3O3EA 4HUUA 3VFUA 5DR5L 2PXYD 4YHIA 1OGAD 1J5OL 3C08L 3Q6GH 5BQ7B 3ECBB 5IM7A 4L4VE 5B8CC 3IJSA 3MA9H 3IS1X 4RGMB 3D85D 3HZMB 1AHWC 4JREC 2CRYA 2AV7B 4LEOB 3UTPE 3QUMH 1A7QL 5EC2A 5DA0B 4ZSOE 5D70H 2B1HL 5JXEA 3GMOA 3B5GA 4YHYC 1BD2A 4NC2B 4HS8H 4ZD3H 2W59A 3V6FA 4YAQA 1RHHB 3DV4B 3LN5B 4IJ3B 3IGAB 1JWMB 3DUSB 4MAYD 5I1JH 2PO6C 2YS4A 3VWJC 1IAMA 4HMDA 4FXKB 1MRDL 3MREB 3DX7B 1QKZL 3OKLA 2GCYA 1JUFA 4X5LA 2P1YA 5I1DB 4UOW0 4P5MB 4TPRH 3IYLW 5EUOB 4JDZA 2EDJA 3LH2L 2COQA 4Z7UA 1A6TB 3TCLA 2AJ3B 2B5IC 5D2NB 1QLFA 1GGYA 2MWCA 1HIML 4OZHA 4S1QH 2D9CA 1A6PA 5F7FA 1Q0YH 2V9RA 1KG0B 4JN2B 1AD9B 1UVQB 2FEDD 3C5ZA 3GBNL 4Z5RA 4DOHB 1MSPA 1CU4L 1ED3B 2XTLA 1CFVH 4JFXB 3V4VH 3CDFA 1C8PA 2GW5A 4F8TA 3VFRA 3VFOB 35C8L 5D2LF 3LIZH 1EX0A 2HN7B 3GMLA 3MLYH 5EOQL 5F3HB 1WBXB 5D1XC 1AQKH 2PXYA 1OGAA 3EFFB 4BSWB 1MREL 5IIEB 4YGAB 5F88B 4X6FB 5F1NB 1CE1H 4PGZA 5JHDB 5I30H 3HS0B 3OKOA 3IDNA 2W9LA 1XR8B 3CFIC 2XWJB 4I48A 3P30L 1YPZF 3P0YL 1M6OA 2DS4A 3LS5L 4QXUL 3BSZL 3T0VA 2APFA 2X7LB 4WTZA 1CDUA 1A7OL 1O0VA 4PJBB 4QXGH 1DN2A 4Z0BL 1K3IA 2HMIC 4HUKB 2W0LA 3PE9A 3D69A 1VFAB 4MAYA 4YDJA 3KPSB 1C5BL 4OCNC 4HX1B 4UDTA 1YYMH 4OJFH 5HGDA 3UAJD 4JFFB 2AS5M 5SV3A 5IQ7L 2ITCB 3QDJD 4GBXD 4YE4H 3PWPD 3IAPA 2IAMC 1PZ5A 2BHZA 1KFAH 3FFCD 1F8TH 1J1XL 2CIIA 3GBMH 4JAMA 4Z7OF 1P53A 5F7DB 4ONGL 1A7PL 1W0YT 3HN3A 2HKHL 5CIPH 3Q2CA 3SDCB 5KSUA 1K6QH 1P7QA 2DI8A 4NQEE 2I07A 4CU6A 5EIIB 1JHLL 2VO5A 3JV4B 3T3MF 4EUPH 1FIGH 5ICXB 3I6GB 3P0VL 4DJMA 1BVKA 3W2DH 1GGUA 2A9ML 3CH1B 1HNFA 3HKFA 4O51A 4S1RH 1C1EH 2VDRH 4LQFH 4EUPG 1KCLA 4QWWC 4V2BA 3X3GL 3GK8H 1QFOA 4NQSB 5MEPA 2Y36H 1DBKL 4I0PB 4Y2DC 5LBSH 1S9WA 2OQJA 5D1ZD 5DO2C 2UZYB 1GOFA 2GAZA 2FJGA 1S7XB 2X4QB 4FOMA 1BVLB 5SV4A 1U8IB 3TT1L 1DUYA 3KAAA 5FOJA 5EFIA 2GJ6D 3T77A 2A74A 2XNAA 5IVZA 4L3CB 4ORGA 4OM1L 1H9VA 1JNNL 3QCUH 4WEBH 1MLCA 3QULB 2F58H 1SMAA 3C5JB 3ZKSD 4YR6A 2IANE 2CLZB 1YNLL 1K9TA 1MFEL 1QNZH 1W72H 2VAAA 1T1YB 4LLYA 2DI9A 1DVFD 5FFLA 2LU7A 3BKCH 2FGWH 3EFDL 1EHNA 2GEEA 3QDJA 2QQLH 3C60D 5JOPD 3PWPA 5KS9F 1M7IA 2ICEB 1G6RB 2W0PA 2QADD 4UV7H 2C3HA 3FFCA 5HHMB 1YJDC 4GKZA 1B6DA 1KJ2B 3ZKXC 5EZOH 4EDXB 1BQHA 2YD9A 5K9QG 1BGXH 2HH0H 3DURA 2UVFA 43C9A 1MFBH 4K55A 1YMHB 3AC0A 1VFMA 1BEYL 4LFHD 3MRIA 5DJ8A 1IAKB 4HFUL 4YDVA 1OAKL 4R3SB 2W38A 3KG5A 4WDIA 3W39B 2XZCL 2NLJA 3MYJB 1FFNA 3SJVB 3P9WB 4MB3A 4AG4H 4JKWA 4R7DB 3KHOA 5ICZA 1VFBA 2VZUA 3JVGA 5D1ZA 4MDIA 2IPTL 4OLXL 1KJVA 3BKML 3TCXA 1SJHA 2C5DC 2DLIA 4JVPA 2NY5H 2G60H 3BI9X 3SE9H 3AU1A 3TP4A 3BMVA 3BQUD 1MY7A 2YSSB 3P4OB 4K7FA 5IHUH 2GJ6A 5CGYD 1KB5B 5E4EB 3N9GL 5C0JA 5IVXB 2EZ0D 5ESQA 5JW3H 4CW1A 2X4UB 4QXTB 4PRIA 1I9JH 2X4RA 1Q0XL 3O6LH 1WFUA 2JJVA 5DS8B 1TJIH 1KIRA 1ONQB 3ARUA 3I50L 4G6AD 3SPVA 2XOTA 1FCCA 1LK3L 4XWGL 4AEIL 3GMQB 4X0KA 3HE6B 1I1CA 4GRMB 4UNUA 5HDLA 4MJ2A 1DVFA 4M7LT 3MOBH 3BN3B 1QO3A 4M4PA 3ZKNC 5FO9A 3C60A 1T89C 3DMMC 2Z4QB 5C0BE 5GZOC 4D2NA 5HDBE 5IMLB 1GZQA 5C9KA 3OV6A 4HF5H 1F13A 1DFBH 1WV7T 2RQ8A 1IQWL 2MNUA 1YYLH 4ONHB 2XZZA 4JO2H 5I1GH 1KELL 3TVMC 4JFDD 4LVNC 4QY8B 3SBWC 4OCLC 1NFKA 5D8JL 1CL7I 5EBMB 4N9OB 1SBSH 3MLSL 2OR8A 1DN0B 1RUKL 1S8DA 1MJJA 4RWYL 1X5HA 1OM3H 3G9VA 5E6IC 4U31A 2CGRH 3QFDB 4KK6C 3G04B 4PJFE 2J4WL 4XWOD 5C09B 1ZT7B 5KBNC 2F8OA 3L3DB 1K4CA 4CVZA 4WU5B 3MUJA 1U95B 1C08A 4OLWL 4ZXBC 3D39B 3VG9B 4JM2D 4PJHA 1HILB 3VFGL 2C1OA 4JFZL 3I02A 5CEZD 3H8NA 4G6KH 5FECB 2EDDA 1RZJL 4MD5B 3AGVA 1MHPH 2FGZA 1J1PL 3BQUA 1H15B 4K2UH 1A4KB 3ME0A 5FHBH 5IR1B 3CSBA 4Q74A 4AQOA 5F7YC 4WW2C 1Z5LB 2GTWA 4L8CA 3NBNA 5C8JA 3T08A 4A2LA 3QCTL 5KVMC 3MLVH 1FO0B 1FVDB 3FT2A 4NN5C 4HIJB 4NQCB 4YXLL 1OVZA 5FA3A 4NO3A 1U3HA 5LGHH 5DMIH 3MV11 4K71B 3PDOA 4X8JA 1KIPA 4RGNC 1R3KA 2Y9RT 3QXAA 5HHVL 3RJQB 1KJMA 4UI2A 3DTXB 4GXUM 2ZPKL 3TZVB 3QUZD 2IQ9H 2EYTA 1WZ1H 1T0NB 2IPKA 3QI9D 4Z0XA 4C83A 4H26A 2BVYA 4NO5A 4XPHH 4UB0L 4JFDA 3TA3C 5F6IC 3PWLB 4KVNL 1OY3B 4NZRH 4GKSB 1IM3A 3LEXB 3QNYB 4AQ1B 1KIUA 1IKNA 5ANMA 1ZEAH 5FV1L 2J5LB 3KJ4B 4ALAH 3KYNA 3DYPA 3BD3A 1WBZA 1YPZB 4MJ4A 3PGDB 3Q48A 5BJTA 3K2MC 4HBCH 5C0AD 4KK9D 4XCNA 1ZVYA 4PRBB 5FK9B 4P2RB 5JDSB 5DURB 4H88L 1T0PB 3MO1A 2DQTL 4OTXH 2J12B 5T3ZL 1ORSA 3QWRD 2D0HA 2IFGA 4WHCA 1UT9A 3TV3L 3BKYH 4YBQC 1INDH 3RZCA 3RWEB 5BMFH 3MV7D 5IQ9A 1NBZB 1NCCL 2YPVL 3TLRA 5L9DL 1NMBH 1ZHNA 5TE7H 1JI2A 3WFHB 3IDMB 4CADA 3FO2B 4I5BB 1E6JL 1WT5A 1IAOB 1RUAL 2AABH 4MJID 5D72H 3RVXC 5LAXA 4G42A 3L3KA 3PGFL 4GG6A 4WO4B 2X89D 2NY4D 3ES6B 2H26A 3QUZA 7FABL 2VQUA 3MNZA 2IEPA 3QQ4A 4MCZB 4LLUB 3QI9A 3BO8B 5BW7A 5T5FL 5F7NC 2ZG1A 1RJLB 4H1LH 3LV3A 1PYWB 4LPVA 5I1EH 2MTPA 4GQ9H 1AGFA 5I8KL 4H1LG 2P49B 3BRGC 2BVPA 1XF4A 3LRSA 3QDGD 1I8KA 1CF8L 1A7BA 2DF3A 4LNRB 1T4KA 2DLTA 3GSWB 3OPZH 4YHZH 1A1NB 5EU4B 4PJCF 2CMRL 4NOBA 3T2NL 2XRAH 3KYKH 4AT6B 1QSED 1S78D 4NYLA 1F4XH 5C0AA 1ZLVK 2WUCH 4CN4A 4HWNA 2QQKH 3G5XA 4XNMA 5DJYA 1T0MA 4KHXL 4G6JH 4RAUA 2E7CA 5HY9A 4OF5A 2GFBB 4N9GA 3T4YA 4PV9A 4M1DH 1DE4B 3HR6A 3SGEI 1WIOA 4WJ5B 4J4PC 2BNQE 3CFEA 3MV9A 1QR1B 1W0VB 4PP2A 4QGYA 3TIEA 4JO1H 5IEKA 1KEGL 1ZVSA 4HS6A 3MV7A 5KS9B 3U4AA 1FN4A 3KYOA 4G8FB 1I4FB 3BE1L 3U0WL 2XG4A 4GRWF 3NCYP 3IJYB 1WTLA 2Q7NA 2IMNA 2H32H 4KUZL 4XGZB 3GM0A 4XVJH 2OTUA 2WQRA 2ICWI 5GSRB 3SDXA 2JJUA 4MJIA 1ND0B 3MR9B 4KRMB 1QLEH 5IMKA 3SY0A 1F6AA 4QGTA 4LIQE 2X89A 2D0FA 4FQHB 1N2RA 4U1NB 4QRPD 3CPLA 3O3DA 5EU3A 15C8H 2P5ED 3VXPB 5HYFA 1DEEB 3K2UL 4LARH 4PRIE 3EDDA 4WTZG 5AG8A 4GG8B 5MEND 2V2XB 4EDWH 4QRTA 2D4FA 2I24N 5GGUB 4NHUB 4X9FA 5F6HI 2R2BB 3HE7A 3E6FB 2CQVA 4KHTL 1XR9A 3TPUB 1T5XB 3LKRA 4O00A 3NIDE 1GXEA 3QDGA 2DOCA 1YY8B 4KMLB 5IWLC 4OGAC 1OGTB 4Y4HC 1NGQH 4U0QB 1L0XA 1E4XI 3C5SA 4LLDA 3TC9A 2AXGB 2PN5A 1IEBA 3PQYA 4M48H 5FUZH 5DJAA 4I2XB 4L4TD 2FO1A 3VMOA 5LKNA 4MNQB 4G7VH 3LQAH 4LCWB 1IGIL 4P2OB 1J87A 5ACMA 3QEGH 4NBXB 4X6BA 1NDMA 1UKSA 1KLUA 1A3LH 4OB5L 4QKXB 4H0IA 4ZNCD 4LPXA 5K9KB 3DYOA 2XY1A 4NWTL 1Q72L 2DBJA 3QUYC 5GJSL 1MWAL 1OCWH 1RIHH 3RWIB 4TUJA 3MUZ1 5A16A 4MA7L 5E08H 2E9JA 3RWCA 4DN3H 1UKQA 3FQRB 1F58H 5J4MA 2YPLE 2Y4SA 1LQSR 5TFSH 4DK3A 3V8CA 1SJXA 3ARGC 1H3XA 3P77A 2ICWA 4IOFC 3MMEB 4BFBD 3VCLA 1N26A 3WIHA 1OL0A 1DANT 4JFEB 3QNZB 1VESA 2FEEL 2XQBL 2J8UA 3IRPX 4QRPA 1CCZA 5T1KD 1IAIM 2P5EA 1CFSB 3H9SD 3BOVA 3JWOC 2BP3A 3FRPA 4HMEA 5HGAB 1NGXB 2VABB 3KPRD 4PJGA 1R0AH 1YZZA 2Q8BL 1DQML 3FQXB 3RY6A 2A2QT 4KZEL 3QWQB 1MRFL 5CD5C 5HHQA 1KB9J 1BFOA 1QSFB 1FL6B 3DVGA 4MZ3A 4XMPL 4UILL 5GGSB 2FX8L 4AMKL 4XP6H 1I1YB 1JWSB 4W6XB 4QEGA 4L9LA 5DJ2B 3LRHA 3UYRL 4V1DB 3T2OA 3ARDC 4BK5A 1KIQB 4GUPB 1BQHG 3MRQB 4UT6L 1EH9A 1UM5L 4NRZA 2DM3A 5C08A 3VXSE 3SDDD 1MPAH 4GMTH 4YNYB 2P24B 3WHXA 3MROB 3NCJH 1RI8A 1KPVB 1RJZB 4KK8D 4GJTB 4RGOH 5ACZB 4PGDA 4K3JL 2JJSA 4RBPH 1IGMH 5ID0B 1I9IH 3DETC 3HR5A 2BMKA 3TT3L 1JPFB 2Q1EA 1AP2A 2CIKB 4EXPX 3EYSH 1DQDL 1S9YA 4Y7MA 4OIAA 5DEFA 4K9EL 4PJ8D 4NQTA 4XP4L 1N0XH 3GSNB 1UM4L 3I84A 4OLVH 5T1KA 9CGTA 2AV1B 4KTDL 2BNUB 3K4AA 2J88L 3H9SA 4OFPA 3T1FB 4Q97A 3OHXA 4ZFFA 3REWB 3L7FA 4KKAC 2BVEA 4Y4FD 5F8RC 3LDBC 4D94A 5E8EA 3LMJH 1P7KB 4XNUL 3KPRA 4Z78B 2VYRE 2DQGH 3P3YA 2PYFA 4HXBH 4JHWH 3RGVA 4GO6B 5T3ZD 1OB1A 1HKLL 3GBLA 3RY5A 2XKNB 3MXWH 4PYGA 3QRFM 2WINA 3UPRA 1N8ZA 1JI1A 1RK1A 1G7QA 4YPJA 4R26L 4JANA 2ZUUA 1UWEH 1WCBB 4CNIA 1NFIA 1ZV5A 4JN1L 3FZUC 4NNXA 4MD4A 4ZUSB 5DEGB 1NEZA 1OTTD 2A1WH 5GRJH 3WXVL 3MUGA 3VE0B 4YUEH 2QQQA 2ERJC 3IFNL 1JCKA 3SDDA 1C16A 3ZYOA 4F7EB 4KKBD 3BVNB 2VLRB 3EOTH 4FQXB 3EYQD 3PV6B 5FUOL 1MOEA 1P7HL 4YIQB 4FZEL 3RDTA 2VH5L 1TXKA 1QBAA 1X5AA 4O2EB 4QHKI 1Q9KA 1VACB 2LQRA 2PKDA 3V5HA 1I7ZB 3UTQB 2Z92A 2G5RA 2BCKA 4DGIL 1UXSB 5E56A 4PJ8A 5IHZA 1AGCA 1FYTB 1BF8A 4OSUL 4L5FL 4JPVH 4YHMH 3IKKA 4WNQB 3NFSL 4BQ9A 1ZLSL 5IFAL 3NCYS 4PJAE 4PJCB 2NX5B 1MJUH 1WBYA 3CMOH 4R9HA 1PZUB 4HIXH 1JGDA 3S37L 1I1AC 3MZGB 1R3LB 4Y4FA 2H8PA 2H9GA 5JW5B 1KTDB 1I7TB 3H9HB 5E94A 4PY7B 1EO8H 3M8OH 4ZUUB 4RWHA 5TGBA 4ODHL 1G0DA 4WTWA 1VFUA 4ZS7H 1ZGLM 5BXFB 4X6DA 1LO0L 1XMWA 5CGMA 1AFVL 3UYOD 3BP4B 5GRZA 5KJRL 1IL1A 4K7PH 1MUJB 2NXZD 3QPXH 4AH2A 3I6KB 3O4LB 4GRWB 5FXCH 3N50A 4TSBL 1CL7H 1V3MA 1FC2D 3VXMD 5DQDL 3MRHA 4ODUB 1J5OH 1OWWA 4ZTOH 1YEJL 4UQ3B 3RVTD 3HLAA 5BZDB 1H5BB 3NTCL 4FFVC 1AR1C 4QYOB 1A7QH 4MX7B 1YEFH 2IFFL 2B1HH 5DJCB 4RBPK 5K9JL 2RR3A 1HK6A 3MJ7B 5FV2A 3SDAC 4G9DA 2DKSA 3P0GB 4YHOL 3STLB 2WBJB 5CEZH 5J13B 2OMNA 4GFTB 4M5YL 4P2CG 1HEZB 3NCBB 3VD9A 2AXFB 1SJVA 4NQDE 2NY7L 4L8SC 3GJEB 1MRDH 4R90L 4DFHA 3FQUA 3VJ6B 3QJFA 4MMZC 1QKZH 4YK4C 3ROOB 1NMCC 4R7NB 4ELKA 1FZJB 1C7SA 4YDLC 3HHRB 3MV8E 3ZKMD 3S88L 5CZKA 4HCRL 3LH2H 5H8DA 1L6XA 3T8XA 1KNOA 3W11D 3LPGA 4AENA 1XGYL 2VXTL 1MVFA 4NSKA 2NY6C 2VL5A 5EZJA 2IADB 2WUBL 1TVHB 2CKBB 3GBNH 2VQ1A 2FIKA 5FF6B 1CU4H 5IV2A 5MEOA 1T3FA 4HWZB 5HI5C 1JHTA 2NY3D 5AD0A 2X4OA 4UINH 2J8UE 2H2SC 2YK1L 3HZKB 5C92A 5ADPL 3B9KB 4OV5A 1NCDH 3VXMA 2HT3D 1Q94A 5J8OA 1S7UB 3WEXA 5DYOA 1EHXA 1A22B 1MREH 5J12B 4DGYH 1F45A 4IDLA 4EZMA 1C12A 4PGCB 5BO1L 1HOCB 3P30H 2YD5A 4Y1AB 1FG2A 3MGAA 4E42A 3H0TA 4NJAL 4CMMB 4KAQL 1VENA 1CFQB 2JB6B 2NY2B 5KN5B 32C2B 1C5BH 3I6LD 2BERA 3K4DA 4POZD 4ZO7A 2IQAB 3TBWA 3OR6A 4DQOL 4R4FL 1NLDL 5DVNA 5DD6B 2ARJQ 1EBAA 3ARED 1FL3A 3QEUA 4GSDL 5DDHB 5C08E 3GHEL 4LKCB 5DTFA 4ZPTB 5ITBL 2R15A 4JJ5A 5MERB 3ESUF 4X99B 5KSAD 3CX5K 2F54B 4Y5VA 1EXUB 5A3ID 2HKHH 2F9BT 1A1OB 2J6EL 4K3EH 5IF0B 4NKMB 4DVBA 4NUJA 4MJ5A 4NKDA 1JHLH 1A47A 4AIZB 4WU7A 3RFZC 5FYKL 4BZ1L 2A9MH 4WFFD 2FWOA 4U6HA 4P59H 5HYQB 4KJQD 1RSFA 3GEWB 3U36A 3LN4A 3RKDD 3BFOA 5BV7H 1A6WH 4I3GA 3GSXB 3BDXA 8FABB 1SJEA 1ES0A 3DIFA 4KKNA 5H35B 3MLRL 3SEPA 2DD8L 1J7VR 3JTTA 2EDXA 3FB5A 4FQ1L 4G6FB 4PD4J 2HJFB 3TT1H 4L4VB 3KPQA 1INQA 3O8XD 3C6LC 4Y89A 4M43L 3D2UD 3OB8A 3G6AA 4UQ2A 1CT8B 5JA8B 4IS6B 3KR3L 2AGJH 5TE4L 1JNNH 5BVJB 2NQCA 2AP2A 5HHXL 3TNMB 4KI5E 2NR6D 3S6CA 3O4OC 4HC1L 2UY7A 5FCUH 5BCAA 1A6UL 2SEBA 3SGEH 4OZHF 1RIUH 1YNLH 1MFEH 5JPNB 3UTZB 5I9QC 5BOPA 1TZGH 1RZ8B 5JOEA 3MLZL 3KXFB 3G5YB 3GNML 4LGPB 2CKNA 3AREA 4OUUA 5DUBB 5H2BA 4BH8B 4C55A 1SEBB 1WK0A 4LHJB 1JPST 1EJ6A 1MFNA 3G08A 4HH8A 3QIWD 4MB4A 4D0DB 5GZNC 2FL5B 1LEGA 3FN3A 1FLRL 4M6ML 2FBOJ 4HK0B 4PRHD 5KSAA 2Q86B 3I3EA 3VRIA 4XB8A 2BJML 1T03L 4TULL 5I71C 3TBSB 4X5WA 1QACA 3EO0A 2H6PA 1BEYH 1KJ3L 3ARWA 5DHVB 4P46B 3QG6A 2R4RL 1IM9D 2AW2A 5FOBA 3N06B 3RVUC 3SKMB 4Z7WA 1RZGB 3KJ6L 1CDBA 4FG6C 4U1KA 3RBSA 1P2CA 1II4E 3T0EE 3ULSA 1IAIL 2AEQL 5GISL 3RKPA 2XPGB 2UWEA 4JCLA 3WFCL 4FHBD 1G1CA 2VLKE 3TO4D 4P5TB 3FRPG 4IHOA 1I7RB 4LVOB 4JPIB 1XAUA 4GMSL 4L1DA 2NZIA 5K93A 1E4XH 3D2UA 4I4WB 3GFUA 4JQIL 3DECA 5FIEA 1UWXH 3HMWH 3MRLB 3OKDB 4Y4KC 2YN5A 3G5ZB 2LTQC 2CPCA 4AEIH 4XWGH 3TBTB 3V5KB 5CKGA 4JO3L 5A2IH 4URTB 4Y19D 2OL3A 1FVCA 1S9VA 1UG9A 1UH3A 2VE6A 4KV5F 2HFFA 3FJTA 4K3DL 1W8OA 3G5VB 2P5WD 2GITB 3EOYG 3B3IA 3MFFA 2NXYC 1ZS8A 1T1ZB 5IVNA 3QXTA 5T1MB 1BWMA 2CKBH 3LEYH 3MRGB 5KSVB 2I9TA 1IQWH 5IKCA 1KELH 2QLVB 4L8DB 2X4PB 5D8JH 1Y18B 3C8KA 4PRHA 1LWRA 5K9OA 4JDTL 1CXLA 1T2QH 2B1AL 2FD6H 1RUKH 4RWYH 3K4ZA 1A8JH 5HVHC 1NLBH 4X7EC 4EVNA 4LRNL 4QOKA 1UM6L 4NQEB 2J4WH 5B39A 4MXWL 1CGVA 3WE6A 4B7LA 4HZLB 4IIQB 3EYUL 1YY9C 1AI1L 4M93B 2VZOA 4HQQL 1B4RA 2M1KA 1MCQA 1K8DB 2Y07L 1BREA 1TPXB 4G8EA 3TO4A 3FB7A 1RZJH 1A3QA 2DL9A 1N7ML 5DRWB 5EC1A 4LCUA 5C0EB 2VDQH 4M7JH 4XAWH 2Q6WA 4FNLH 1HDMA 4JRYB 1SQ2N 5ICYB 3JWDL 5CP7B 2OJEA 2GK0A 1JYVA 2BOBB 4IMKA 1IT9L 4OZIE 2AXHA 4YXLH 2Q20A 2XXMB 5SX5H 4Y19A 3S98A 3F7VB 4O5LL 3PNWB 2IANB 5EOTA 1DSFL 3BD5A 1EAPB 1ZLWH 1NEZG 3LKNA 3DBXA 2P5WA 3VXRD 3U30C 1OQXA 3PL6B 1A7NL 2QJDA 2ZPKH 1XGUA 1S7WB 3TBVA 1B88A 2IPUG 2PNDA 1FV1B 1S7VA 2EDKA 3VFNB 1JTPA 4UB0H 1D5ZA 4ODVH 4W6WB 2LU3A 4PG9B 5FDWA 4KVNH 5TJWK 3EOAA 1LO2L 4JQVC 1EA9C 1FSKC 4X4ME 2NY5C 3D0LB 4G3YH 2HVJA 5GQBA 3C8DA 3SKOB 4MNHB 3DO7B 2CDFA 4LLVB 2XT1B 3QCVL 2EDHA 1PFCA 3VFSA 3NACL 4LBEA 3RHWK 5J6GA 3O3AB 1OD7A 1OF2B 3BPOB 2QV2A 2WW8A 1UCBL 2DQTH 4G8IB 4RFNC 4TQEH 1GH7A 4XI5C 3GMNA 3TV3H 4XVSL 1SM3L 3FT4B 4TRPH 3NIDF 4XPGL 1XF2A 4NKOA 4KPHL 1NCCH 1JK8A 3RUGA 4HEPG 5L9DH 4OI9A 1C5DA 4UDUA 2OTWB 3ARFD 3VI4F 1JVKA 3V6OA 4HCRA 1AKJB 1EEZB 1RFDL 1XIWD 1ZA6B 3BPLB 3B6SB 4NKIL 4UT7L 3PGFH 4YHIB 3P4MB 2ZG2A 3L3GB 2OTPA 2AVGA 3M1BA 5DJ6A 5IM7B 1EEYB 5AYUH 2HWZL 1LE5A 2R23B 3VWJD 3O9WC 5CJOL 3WSQH 5CEYA 5ACLA 3L3IB 1IFHL 5DWUL 5FYKD 5C0BB 1YEKL 5EC2B 1W0WA 1XGTA 3IFLL 2B8OT 1RY7B 5CBEA 5DHVH 1B90A 3UDWA 1RU9L 1MEXL 1T1XA 4RMWA 5J57B 4LCYA 1MCPH 1NAKL 2FCBA 5HXMA 5D6DA 1FLTX 2FJHB 3OKNA 5GGTL 1CDYA 1P4IL 5B4MD 3EJYC 4F7PA 3F6LA 4POUB 3LZFL 3T2NH 1WSST 5KTEL 1JUFB 4RMSA 4MXQD 2VISA 4CVWA 3BUTA 1OQOA 4JDZB 2LVCA 1NJ9B 4C58B 1CWVA 3NZHH 4KKCC 2VSDA 1MRCL 1QLFB 2IH1A 2RFXB 4OZHB 1QFHA 3FT3A 4IRSD 4S1SH 1KLGA 3BYYA 4F7CA 3C5ZB 5IB4B 2B0SL 3ROLB 4B7IA 1NDGB 1NGWB 1QEWA 3BE1H 3SDCC 3U0WH 3ARFA 3SOBL 1UB5A 4KY1L 5F70A 4G43B 1FFOA 5F9OH 1QA9A 2IPUK 4P49A 4DKEH 1RZKL 4D9LL 3GMLB 1SVZA 4X83A 4JHAL 2HFEB 1DANU 2UV3A 2VLJD 5CCKL 6CGTA 5L8KB 2HTKD 2J6EA 1MHCA 4BSJA 3C6SB 2A6DB 3VWJA 4XHQA 4I0PC 4NFDA 5DGQA 5FGBC 4TUOA 4Y5XB 2OR9H 2VWEE 4NIKB 5E03A 5ENWA 4YEFA 1M6OB 3QIBC 3UC0H 3ZDYE 3K81A 2F5AH 5IT2L 1IAII 4KJYB 4TTDC 1NEUA 5KSBA 5DGRA 1AIFB 4WHTA 4YDJB 2X09A 4FABL 1UEYA 1DQQB 4JKMA 5HGDB 3E2HC 5C7XL 3SO3B 5GS1A 4UIKL 1K8IA 1P9MC 4NRYA 4RAHA 3U9UA 2DQCL 2Z8SA 2CK0L 4WFED 1OWRM 1RVFH 2V5RA 1S7QA 2CIIB 3HPJA 3TYFB 5A43C 4YLQT 4JAMB 5CSBA 1IGIH 5E9DE 3P2TA 2P42B 1R3JA 5HDOA 3D25B 4HC1A 3MFGB 5D7JC 4OB5H 5KSUB 3IFPA 1P7QB 1WWAX 4NWTH 4Y2DD 4I0KA 5GJSH 2D7QA 3HC3H 1MWAH 4S11A 4OT1L 3IDYC 4M7ZC 5DO2D 4YXHL 1EDQA 3S4SA 4MA7H 5IW1A 3M17B 3PWVA 4U1HB 1EPFA 2EKSB 4O51B 4LCIH 4GRLB 3F12B 2A6IB 3TGXA 2VLJA 4ODBD 3MBED 5F9AC 4X8XA 2Q87A 2WM0A 1X5JA 4OZ4B 2XQBH 4APQC 2I27N 2DQJL 1DUYB 3MODH 5EFIB 4LKXA 4M3JA 1C7TA 5T33L 4NCC1 4XNZB 3T77B 5E0QA 1CTNA 4ORGB 1CXFA 1JYXA 2IAMA 2Q76A 1DUZA 3QFJA 4I13B 1QFUL 4CDHA 1ADQH 5KG9A 3CX2A 3ULUL 1M05B 4U6YB 4YR6B 1O7VA 4RFOL 5ID1A 1TENA 4JG1L 2FBJL 3IT8D 1BIIA 1MRFH 3MRCA 4LLYB 3SHSA 4ERSH 3UTTD 2DQHL 2FX8H 3MJ9H 4Z95H 3HE6C 1N64L 5DJZA 2PXYC 1EHLL 3D48R 4PJAF 1T6WA 3CJJA 2Y72A 1SY6L 1WCQA 5IHBA 4K7PY 1OT1A 1YMMD 2OX5A 4UTAH 3MCKB 5D6CA 2GUOB 2A9NH 1PEWA 4QTIH 5DXWA 1GIGL 5L2JA 3SDXF 1UM5H 3BZDA 3GUTA 1BQHB 4Y2DA 2BNQB 3L5XL 3WCYA 1NGPL 2GTZA 4UNVA 5C6TL 4O2FA 4K3JH 4YDVB 4WDIB 5LCVL 1FNEA 5T1LD 3OKKA 2GSIA 3TT3H 5DC4B 1E4WH 3MBEA 1DQDH 5IK3A 3AY4C 4N0CC 4XP4H 3VH8B 4MDIB 1AJ7L 3G6DL 1Q9WA 1KJVB 1OLZA 1SJHB 1XT5A 1A7RL 3VG9C 1IGTA 1V7MH 3AU1B 3NPZB 4K7FB 2AK1L 1PX3A 4PJ5A 2XWBA 3RUGE 3J8F7 1ODAA 2YUXA 3O11B 4FQLL 2AXJA 5F1IB 3ZKND 2FEDC 3BHBB 3DMMD 4PRIB 2PR4H 2VMFA 5GZOD 3FCTA 3F7YA 5KW9H 4XCFH 3LQAC 2WMPA 1MHHB 3W0WD 3WHE1 3DSFL 3DX8B 4MWFA 1CXIA 3RQ3A 4BK4A 5A2KH 2CLRA 3MPCA 4JDVA 5C0CA 1DVFB 3GMMA 5GGSY 5I74B 3BIBX 3UTTA 3LPFA 1QO3B 1BECA 4YDIL 5FO9B 5I6XB 4XHJC 4N0FA 4R26H 1TZHB 3CXDL 3JBG7 3X13B 1DEDA 1I8LC 2P7TB 2EYRB 1YMMA 5FM8A 4F15C 5DFTA 3QEHA 1L4IA 4G9FE 4YC2B 1HWGB 5JIHA 1ZSDA 3MRNA 1KT2A 1CDCA 2EH7H 1D9KB 3QXWA 5B39G 4U1SA 5GHWH 4F80A 1Y6NR 3MBXL 2J8UF 4XBEL 5FUOH 4YPGB 5I1KL 1T20B 1K4CB 5C0NC 3UAJC 5K59E 5DEZA 3TFKC 5I1CH 3V52L 2J5LC 4XPBH 5GGQL 1V8HA 2YPLB 4JO4L 1GGTA 3JV6A 2G9HA 1KULA 1HHKA 4GBXC 4DGIH 3ARBD 2PYED 2VN4A 3WJJC 4PJGF 1FQ9C 4OSUH 3IU3B 2VDML 3CFJA 1ZXQA 4K7PX 4JHZA 4R96A 2X5PA 3NFSH 5EZIH 2X4NB 4LHUD 4OCWL 2QSCL 1KC5L 1P5UA 1I75A 3VU2A 3MRKB 4F2MB 1T7ZA 3CFKB 4RGND 1FCGA 1T89A 3DMMA 3OR7A 3NN8B 1UENA 4LLMA 1KXVC 5T3XE 1FZOA 3W0WA 2X70A 4OD1H 1S7SA 4ODHH 3TVMA 2PW2A 3QT2A 3SBWA 1XGPB 3MA7B 5FA3B 3WLWC 1U3HB 2HT4D 2CDGA 3FRUA 4QF1B 3PDOB 4YGVA 2GI7A 1AXSA 2VDKL 4LP5A 1MCLA 3L1OH 2R0LH 3D0VA 5D1ZC 1F3JA 5DQDH 2IPKB 1I8IA 1ZGLA 5C70A 4H26B 4GAYB 4NO5B 2YC1A 1P6FA 5IB3A 2FX7L 3ZLQC 3AROA 1DBAL 3BGAA 1RIVH 2BOCA 1IM3B 5EO0A 1JF6A 3C09C 1YDPA 3FTGA 2ZUQB 1IGYB 3WXWL 3VXSB 5IEHA 5KAQF 4NNPL 2CJUL 1NH6A 3ILPA 4YHOH 1YQVL 1ORQB 1QBBA 4XX1G 4YBQD 5EWIL 4M5YH 5BJTB 3IS0X 4ZUTB 2VR4A 4OF6A 4XCCL 4WW2A 4XCNB 5F93C 5CS7A 1JGLL 4DZBB 2NY0B 2RIKA 3QA3B 4KKLD 4R90H 3C60C 3X3FL 4OD2A 4QHNA 2APVA 2ZCHL 2QADC 2PYEA 1KENL 4U6TA 4MSWA 3QHZL 3BIAX 3RA7L 1ZWIB 3S88H 2R1YA 5TDNB 4LHUA 3HMXL 4R4BB 3RVXD 4BFIB 3S8WA 5DD3L 3GSUA 4HPYH 3RZCB 3OKMA 1XGYH 5JUEH 5MEQB 4Z7NF 1KOAA 2DIAA 2E27H 5GRVL 2AEWA 4KI5F 4PJ7A 4L8BA 4TVPL 4D9RE 1X5FA 4Z7VA 4CADB 1EMTH 3QO1B 3TJEL 5A40E 3QAZC 3TA3A 2ZKHH 5FYJL 5E95B 1AQDB 4MQXD 5F97E 5LAXB 1H3UA 4G42B 3L3KB 1UQSA 3QXDB 3KLAA 2AEPL 3ELAT 1CE6B 3MOAH 5CP3A 5ITFA 2ORBL 5J6HA 2GHWB 1FORL 5FM4A 3MNZB 1FJ1B 2HYMA 2YD4A 4JFPA 2F53D 3W5MA 3MACH 1XCTA 2NY1B 4H0GA 3LV3B 3QFJE 2VSCA 4D0CB 5CGYC 2DAVA 5AAWA 4BH7A 1G0XA 2EZ0C 5BO1H 2VDOL 3L5IA 5GS2H 5E2VH 3UJIL 1AGFB 5MP6L 1DL7H 4KGLA 5BRZD 1YNKL 4QO1A 4QTHA 4NJAH 4KAQH 2BSED 3HI5H 1UFUA 4G6AC 4HV8B 1MIMH 4E0RA 2YXMA 2APXA 4N8VA 1J0YA 4BFGA 1G9NL 4IOIA 4LIQH 4ZDHB 3LQMA 2RAMA 5IOPA 3G5XB 4N0UA 4RAUB 3MRMB 2XXCB 4LSQH 1PLGH 4DQOH 2DMCA 3V4UL 2X9XA 4R4FH 5EU7C 3ULUD 1JP5A 4PV9B 4GSDH 4A6YL 5IGXL 1AGDA 2YMXL 4QT5A 3MV9B 3RNKA 1D6EA 3S34L 3TIEB 3OKYA 5IEKB 1HNGA 4HUXA 4HS6B 4PJAB 5F9DC 2HLFD 1GZPA 1A3RL 4NUGL 5F71A 1MJ7H 2JK5B 3OG6B 1NANI 5JHLL