1AR1D

Structure at 2.7 angstrom resolution of the paracoccus denitrificans two-subunit cytochrome c oxidase complexed with an antibody fv fragment
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
DIELTQTPVSLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQFLVYNAKTLGEGVPSRFSGSGSGTQFSLKINSLLPEDFGSYYCQHHYGTPPLTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure at 2.7 A resolution of the Paracoccus denitrificans two-subunit cytochrome c oxidase complexed with an antibody FV fragment.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Complex (oxidoreductase/antibody)
molecule keywords CYTOCHROME C OXIDASE
total genus 23
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1997-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ar1D00
3PJSA 3T0EB 5HI3C 1KC5H 3L5IA 2NX5E 3R1GL 4X8JA 3ZMRA 4AIZB 5ILTH 3NCEB 5CBEA 1B0GA 3HCVB 3O11B 4OKDA 4X80H 5J6HA 1J0YA 1F8TH 2ESVE 3CU1A 5IFJB 1YN6A 2OK0L 2YBRB 3D25B 2R1YA 3D0LB 3GJFK 3P9LA 2VXSH 3SDXB 1QBAA 5C92A 1JGLH 5TDPA 1FP5A 3D18B 4JDTH 3HZMB 1UWEH 2W60A 2ZG1A 4O5LH 1CLOL 4HS6A 4ZO7A 3W2DH 1P4BL 2E7HA 3CFCH 4TTDC 3VH8B 5TDNA 4Y4KD 4CNIB 3P0VL 4EIZC 1E28B 3KJ6L 1BEYH 2BVPA 3KYNA 1XFPA 4MCZA 4I18B 2IGFL 4P2OC 2KPNA 2OBGA 3VJ6A 3CPLB 1FYHB 1K5NB 2WINA 5E2TL 5TDOB 1MOEA 5IEKB 3B2VH 2DBLH 3S37X 1E6OH 3RQ3A 3RIFK 3GNML 4DOHB 1CT8A 1LEIA 1SJEA 2J8OA 4IBLT 2X4QB 4JRXA 2FR4B 3DJ9A 1EEZA 2AK4E 4OZGF 5F3HA 1G7LB 4FFWD 1FORH 4P99A 3LKPB 4J1UB 5D6DC 4J4PD 5ESAB 3H3PL 4UIKL 4F58H 2ZCLH 3RWHA 4KQ3L 4XCFH 2HFGL 4HJJL 5CS7A 3CZJA 3MJ8B 3X14B 5E99H 5BXFA 2FYYB 3G08A 3WFEH 3X11A 5JQ6L 4U1NB 2D9CA 1S7SA 4IRSD 1LEKB 1U8QA 1Q1JH 4Z7WE 3PWPE 4KZEL 4EDWH 3CMOL 1S9YB 2WUCH 4MJIA 4M7LH 5FYLE 2DJUA 3ZT6A 3TFKD 4HS8H 1S7RA 3NIFE 3V4UL 3VE0A 4G7VH 3VRIA 1SEBA 1U8QB 4JHZA 2J6EA 2VQ1A 3L3JA 4QRRE 4OLVH 4R4ND 4U2YA 2XT1B 3SKOB 5ITFA 4ZFFB 1S9KC 1CVSC 4LSPL 3H7LA 3AAZB 2VAAB 4BUGA 1FE8L 5ESAA 2IBBA 1KB5L 1XR9A 3IJYB 2M1KA 1G9NC 4U3CA 1UH4A 3WS6C 1F4WL 2C26A 3RFZC 1NGPH 2FBJH 1UJ3C 5HI4C 4D0BB 2F5BH 1LO0H 5I17B 1B4JL 4X9IA 4JY4A 4RMUA 3UPCA 3GRWA 2DLHA 1WFUA 3DNKA 5F7DA 1BLNA 4Y4HC 3X3GL 5A16B 3SDXE 1TITA 3AS0A 2F54D 3D6GA 1U8IB 2IF7A 3FT3B 3NCJL 4HZLB 4RAUB 3RNKB 4NO0B 1HSAB 5I66B 1KB5B 4GQ9H 4WNQA 1DQTA 4OZ4B 1GL4B 3ARRA 4ODTL 5B4MD 3IVKB 2P5EE 5DVNA 4KJWC 4L4JA 3TBTA 4ZDHA 4TPRH 3CVIH 1OVZA 3H9HB 5FYKU 4HUKB 4EKXA 2X4TB 3BSZH 5CJXA 1BFVL 3NTCL 3FOLA 2EH7H 1MHEB 4XRCA 4Y8AA 4BZYA 1VGEL 4MLSA 4HX1A 2IBZX 3SGEH 3O2DH 5C9JB 4JDZB 4MAYA 3WFCH 3BX7C 1S7WB 1A7RH 4P46C 4LDEB 4Y5XA 4J3SA 3TN0B 2ZOLB 1G9NL 1RAMA 1A6WL 3MV7E 5EU6B 4Z7QE 1S7WA 1T83A 4IMLA 4XCEB 3T1FA 4NGHL 3WUWB 3MOQA 4KI5F 4OQTH 1JGVH 5CD5C 4QTIL 3GSUA 2ZSVA 5KANG 4KQ4L 4EUPB 2VDKH 3ULSA 4YJZL 4DUVA 4M61A 4N1EA 5KJRL 1E0OB 3MYJB 4IRJA 4AIOA 2FX8L 2I07B 4ZFFA 3BKMH 5I71C 3H9HA 2BHUA 3N1PC 3P77B 5KS9A 1HNFA 2P5WD 4YC2C 1T7WA 1TVBA 5I74B 3M8OH 3OAYK 4FFZL 4R96B 2FATL 4LAQL 1JGEA 2KUTA 3LEVH 1K8IA 3L5XL 5GHWH 3VRIB 2BRQA 1T04A 4HAFA 4AL8L 5HHPB 2A6IA 4APQB 4MHHI 4HQQH 3QPQD 2A9ML 1LNUA 4KKCC 4BK5A 2K7PA 3FTGB 3OKMA 4IRJC 5IMMA 3BP7A 4TVPE 3LS5H 1QFWL 5D96B 2YOCA 2NY2B 3ULVH 3EJYD 5EFIB 1NBZA 4OZFB 1EO8H 4YHKL 2AEPH 3KXFB 3GKZA 4NT6A 4PBWD 5J13B 5J06A 3F7PC 1U3HD 5CEZH 4HLJA 5I8KH 1FN4B 1UZ8A 1KIQB 3D39B 5BW7A 4MWFB 1BJ1H 1C5CH 3QXDB 5SWZD 2EE9A 4X6DA 1JV5B 2P24A 4NHUB 1P4LB 3P0VH 1U92A 2JK5A 3ZDZF 1WFOA 2PXYD 2DWEA 2DQIH 3O2WH 1VENA 2J3SA 1ACYL 4HH9A 2EEBA 3RA7L 4NZRH 1KXTB 2CIKA 2GJZA 2JJVA 3FO2B 1OAKL 1RZ7H 1JNNL 2F19L 2PTTB 3IDIB 3LSOB 2CDGA 5I1KH 4YHZL 1MQ8A 3IETB 1NPUA 1EIBA 1UA6L 5IHBA 3VH8A 2GCYA 3I50H 4LEOB 4F15B 1N5AA 3KHOA 4EOWH 3WNLA 1NMAL 5GIRB 1S7XA 4ZOBA 1UB6B 5C0BD 3ULVD 2O26U 4NO2B 3LRSA 3NN8A 3E3QC 4KUCD 4L8SC 5EZOL 3RJQB 1A9BA 2D7TH 5TGBB 1PSKH 2APFA 4PJCB 4TNWK 5C0IB 5A1AA 1MCWW 1F6FB 2AJUH 1Y0LB 4JPIB 1B6DA 2ITDA 1XH3B 3C5SB 4CKVX 4MNGA 4NZTH 3V52H 1V3LA 4LVOB 3NTCH 2FHFA 3N85H 3RGVA 3ZKSD 5C09B 2NTFA 43CAB 1F6AB 3QDHA 1TJHL 1TETL 3F58L 5JXAL 3TIDA 5M95B 5IT2H 4QHMA 1XCTB 5EBLB 2EZ0C 1JRHL 5CGMA 3HNTH 3BPOC 1H3UA 4K8RD 5IEKA 5B22A 4QNPF 2PR4H 3OJVC 3GB7A 2H32A 1DFBL 1X5GA 3IGAA 4HMEA 4JB9H 2PO6A 3R06B 2NY6B 4WU7A 4XI5C 3HC0A 1OAUL 5D71L 3JV4A 3QHFH 4G6JL 4PJAE 2CO6B 3RDTC 5T3ZE 1J5OH 1OSPL 4RWYL 3INUH 5C7XH 4OLZL 3VDBA 5CEYA 1HWHB 1XF3A 5BOZG 3TNNB 4GW5A 4NQEB 4UILL 3BO8A 3TWCL 3MCLL 4J23A 4JHAL 1GPOL 3AM8C 3UJTH 2FJFB 5J1TC 4Z7OF 1KACB 2FATH 3KWWB 4OGAC 4LLAA 2J5LC 3C09B 2W9EL 3IDMA 3L7FA 3MLVH 5M7QA 1P2CB 2IGFH 2J7LA 3VXMD 4N0FA 3ZL4H 4HUUB 4LASH 4AYFA 4Q6IA 5L88L 5SV3A 2VR4A 5F7KC 1QHOA 3O9WC 4PLKD 3CUPB 5E1AB 1S7VA 1T1YA 3PWLA 1BM3H 4M62L 1Q9LB 2XKNA 5D8JL 2HT3C 3CVIL 5K93A 3U0TA 4IS6B 5KS9E 4UOJA 4MA1C 4XVJH 4NQED 4K94C 5I8OL 4UZGA 1EFXB 4MDIB 1A47A 3ARED 3VXSA 5GGTL 3P4NB 2UUDK 1MJ8H 3V0VA 4KQ3H 4HWZB 3PQYA 4YDIL 3UTQA 4EI5B 5JNYA 1K4DB 1GZQA 2NW2A 5MI0B 4LQ1A 4LBEA 4JM2D 1UACH 2F54B 4U2ZA 3IDNB 2FSEB 4QOKE 5JHDE 5ABDE 2NX5A 3S35X 2J6EH 1JGUH 2PW1A 5C0AD 1UKQA 1XR8B 1EK3A 3DV6B 4HS8L 1L0QA 4LHUG 1OF2B 1PVHA 4RQQA 5FDWB 4FQCL 3VGFA 2ENYA 5D7LE 1U8NA 2WUBH 1V7NH 4OQTA 4XP9L 5JLZB 1BOYA 1QFWI 1CE1L 2VXVH 5C08B 4N8PA 3QDMB 1NCTA 3G9VA 1HEZA 4IOIA 1GIGL 3TN0A 3EGSA 3C2AH 3UBXG 4YHYC 2JTDA 3H42L 3BWUC 2Y7QB 4LPXA 2WLZA 3QIWA 2EYSA 4PRHB 3L9RA 3ZKND 3BDXA 3DUSA 4ISVB 2QLVB 4UINH 3BW9A 1KV3A 4TNWF 2AJXL 2DQTL 2XWTA 3MRFA 5JPMB 4EI5C 4L4VD 3OKNA 4P2RE 1MUJB 2P5EB 4EQ3A 5DK2B 5T1MA 1CIUA 1INDH 1PFCA 2QSCH 2RCSH 1DL7H 1JYVA 3U36B 4MA1B 1ZTXL 3QZWA 4DKEL 4JO2L 4OUUB 2XZQH 4NZJA 3FB5A 1HNGA 5DURD 3F7QA 5IHZB 3FO1A 1DQQB 5C0FB 4XBPA 5IV2B 2K1MA 2HRPL 4Z8FL 3GI9H 4HK3J 1TTFA 4KJWD 2BSTA 5GRUL 3WFBL 3U7YH 3KNBB 5ADPL 5HHXL 5HHNB 1IAIL 4RRPA 1G7JB 2EYRB 2V7NB 2YPKB 2ZUYA 4MNHA 1J5OL 1UCBL 4CMHC 5KVFH 4ALAH 4HKJA 2NY5L 2VLRA 1OM3H 3T2OA 1P4IH 1TTUA 2IQAA 2E6JA 1Q9WA 1UVQB 2YD5A 1PEWA 1I1YA 4Z7OE 3RX5A 2O5ZL 4ZOAA 1X5ZA 2HH0H 1YN7A 5HHOD 5TPWL 4YBHA 4TSBH 3TO4B 4QRTA 2W9EH 4U1KB 1LO2H 1MJ7H 1I4FB 2W0FA 5CZVL 4W68A 1S8DA 5DJDB 2NY6C 4XP6L 3U30C 3NCBB 2QSQA 5KSAA 5L0QC 3KR3L 4Y5YB 3CDGA 3HNVL 4HS3B 1QSFD 4TUKL 2BSSA 2HA1A 4MQXC 1QSFA 3V7AE 4PD4J 3JV6A 1SJXA 4JG0H 1P84J 3MO1B 2W07A 3D39A 1JGDA 3NFSH 3P73A 4ZOEA 2W0KA 1DLFL 4JY5L 3OB0H 2FH6A 4NZUL 3T2PA 3QQ3B 1D7FA 3H3BC 2ED7A 1G7MB 4GLRI 2VXQH 3FRPG 3S4SA 5HHOB 4HWBA 5I1CL 4MA3B 4X6DF 2BY2A 1H3XA 3JTTB 4JM2F 4KVCH 2AI0H 1R5WB 2OYPA 3RWFB 1IBGH 2ZP0T 3G9AB 2BFVH 4N8VB 3ZDYF 5EORH 4Y2DB 1AHWA 2DIAA 3PWPD 3B9KC 3CSBA 5E2VH 3DXAE 4QXUH 2DS4A 4F3FA 2A77L 5IGXL 3SGKC 1HCFX 5DHVA 3RWJA 5KG9B 1HSBB 4XNUL 4HJ0C 1N7MH 4P9HC 4HT1H 1YPZE 5JMOC 3AS3A 4GRLB 4I2XB 1D5XB 5F93C 4OLUH 4YNYB 5CP7A 4DW2H 4ETYA 2Z31D 3V9FA 4MA8H 3MRJA 3Q3GB 4WHYG 2ZOKB 4F9PC 1RZKH 2C3HA 1PZ5B 2A1WL 1IM9B 5B39A 2JCCE 4BFIB 3VXUE 4Z0XB 1P7QA 1J8KA 1JNJA 4KMLB 1EA9C 1MY5A 1RMFH 3IFOB 3MYZA 4R4FH 4PP1C 1U3YA 4X4XA 2O61B 4JRXE 1KJ2A 4OSUL 4M7KH 2R1XB 3GJEA 1TETH 1S5IH 3PIQB 1ZSDB 5HPOA 5DJZA 2WNGA 3FN9A 4HKBA 1SHMA 5D5MB 4KY1L 3C8DA 4NBYB 1MQKH 3TBYB 4P49A 1FZKA 1G9EA 1I85A 5DI8A 1CICA 2XG4A 2NY2C 3GUTA 1FPTH 4Z7UA 1CDIA 2AJYH 5F97E 3SDAD 1IQDA 4OIIH 2ZJSH 3V0WH 3VRJB 4K2UH 2GTZB 1CWVA 5IF0B 1OAQL 4I0PC 2QQKL 2R23A 1Q9OB 3QAZB 2XPGA 5EIVA 1Z9SA 1EEYB 5K59F 1YJDL 3V6ZA 3VMNA 5F88A 4OTXL 1NMCB 5C70A 2P42B 4ALAL 1S7QB 4F57L 3IVKA 2FD6L 4PUBH 1CXFA 4G8FB 2XNAA 2YZ8A 5C8JA 1LD9B 5GGSY 4ORZC 4K8RC 4F8TA 5I71B 1FV1B 2BC4A 4M7ZC 4L3EE 5T33L 4X7SL 4XTRD 3U7WL 4LPWA 3HN3A 1EXUA 4EXKA 1QBML 2MPAL 2HTLD 3VFWA 1T20B 1CFTB 1DEEB 3AVEA 4XMLL 3NPSC 5D2NE 3D9AL 4N90D 4BYHA 3DXAB 3C2AL 5DRZB 4OZFA 2RQ8A 1WZ1L 4QRUB 3O4OC 4I1NB 1LHZA 4MVBD 4PRDA 3LQZA 2FO1A 4ODBD 2WP3T 3QI9B 5L7XH 3ZKQD 4PJ5E 4O02H 2J8UF 3PP4L 1I7UA 4ZD3H 4OCXH 3ARGC 3D3VD 1KCSH 2XTLA 4MNQD 1WCBB 1JWMA 1Z0MA 4KXZH 4S0SD 2YD4A 3QEQE 2D7PA 2A74B 3RWGB 3QNZA 1IQWH 2K7QA 3MRIA 4HGWA 3FFDA 1XF3B 1F3JB 2X41A 4N9GB 4RZCA 3WIIL 3BEWB 4MQ7A 3L3JB 2DQUL 3QI9C 3TPUB 3EKCA 1MFBL 4WI4A 5MEPA 4IRSA 5KVEL 3U1SL 4TNVK 3EOAA 1F42A 3Q6GH 1GRWA 5DC0A 1ETZA 3FO0L 2CJUL 3NPSB 1TZIB 5DUMH 3K4AA 1MI5B 3QFJA 4NQDD 1IC7H 4JFDB 1WK0A 3RWIB 1KTKE 4RFNB 4PJBA 3RVWD 4FMKA 4BQ8A 5KSBE 5T5NF 1FFRA 4YDLC 4Z5RA 2B1AL 4X6FA 5I9QB 1Z3GH 3MBEC 4JFZL 4QOKB 4ELKA 3HRPA 3BYTA 4M7ZB 3AFLA 1U6AL 1I7UB 4XHQA 1QOKA 1P4IL 5FYJU 1LE5A 1MHPH 2G75B 4YDLB 3B9KB 1T6VN 4PRNA 5D6CB 4HAGA 3FB7A 1WSST 5DVOA 4XHJC 3MBXL 4C83B 3SKNB 2SEBB 3RKDD 5ISZB 5TFSH 1H0DB 3WDHA 4RFOL 3DGCR 1GGIL 2C4FU 3MACL 4GRWF 4HK0B 3MLWH 1I9RL 4KK6C 4LNRA 1LO3H 3QAZC 3V4VH 1NAMH 1YQVL 3OF6A 3SE8H 5AD0B 3WLBB 3G5YA 3CFEB 3BGAA 1EAPA 1LEIB 1D5IL 2R2HB 5IR1A 2DYPA 3DRTA 3FHAA 3T0VA 4PTUB 2G60L 5H37G 2AJSL 2YKLL 3RY4A 4KGLA 2NY6D 4FHBD 1NDGA 2Q86B 2G5BA 1TIUA 4J3VA 2A6KB 5L0QB 1K6QL 4H8WL 4R6UA 5TQ0H 1L6ZA 1JPFB 1EMTH 4K8RL 1T7ZA 4M3JA 4L1DA 3U30B 3HAEG 3RI5F 1MUJA 2AXFB 1GCFA 5IW6A 4GT7A 1JGVL 2R23B 4PG9B 1HINL 5IBLD 2H26B 4YGAB 1F4YL 5HDBE 5ICZB 4OZIB 4W70A 1B90A 4ODSL 4KFZC 1CF8L 1S9VA 3VFUB 3CLFH 1TFHA 2MQCA 2HT2D 1C16A 1XGQA 3JXAA 1URLA 3UTTA 1EEUA 3SJVD 1QRNE 4LOUD 5C0AA 3WN5A 1KTLA 1WC7A 3OR6A 4YE4H 3GKWL 1WISA 5E2UL 5IB5A 2WWKT 4U4BA 1R3JA 3ME0A 4HIXL 4OLWH 1KIQA 2BK8A 3GK8L 2MWCA 3LV3B 5IJVA 4PJ9D 5GGRB 5HY9B 4C83A 3EJJX 4B7IA 1MSPA 2BSRA 2R9HD 4Y5YA 2RAMA 3AMKA 3CNKA 2V2XB 4L29B 4UDTA 4DN4L 1U42A 1D9KD 1YY8A 4UT6L 1D9KA 3OX8A 35C8H 5GGQH 4XCNB 5LXGL 1SYSA 3QUYB 4JKWA 1ZA6A 4TSAH 3V6OC 5E6IB 4HWZA 3UTQB 5JNYB 5HHPA 3ARBA 3KPNB 1AHWC 4ZUUB 3LKOB 5F6IB 5KVFL 2UYLA 4OQ1A 5FA3B 5EUKB 4NQVB 1S5IL 3MV9A 1S7VB 4RISH 5JW5B 1VA9A 1FH5L 5I1LA 4HZAA 5KSBB 1LE9A 3RI5K 1Q9WB 1BD2A 5EU7C 2CIIA 3A67H 4HCRH 1PG7L 2XPGB 1BX2A 2E7MA 4HXBL 2QQLH 3TYGL 4NSKA 1JK8B 3JTTA 4CADB 5HJ3A 3VXME 4M6OH 4LF3A 4NNPH 3S4SB 5C2UB 1Z9LA 5T5FH 4LQFL 5C0AB 2V5MA 2VERN 2L7UA 5FB8B 1ES0B 1NFDA 5MEQB 3UPRA 5EU7E 5C0DA 4S1DC 1ROWA 2I25N 1KENL 2GJ6A 1AGEA 1PBYA 2H9GA 3OXSA 4XP5L 4XPFL 1ZHNB 5J89A 2VLKD 3DRQA 3QEGL 2G2RB 4OD2B 3RNQB 5BMFH 4QRPD 5I8EA 3EO0A 1CXEA 1L9MA 2YD2A 4XGZB 3BXNB 1UENA 5GGVH 1UZ6F 1FYTD 3GRWL 3CDFA 3TBTB 4HJ0D 4M6MH 5C07B 3RGVD 5MHSE 1DN0A 1VKXA 3IDXH 4X6BA 1G7IA 4K7PX 4ONHA 1AP2A 1J0IA 4HFWB 4PRHE 4CU7A 4NQCB 1ZT1B 5L9DL 3QWOA 3PHOB 4MNHB 2Z92A 4TTDD 3SKNA 1CVRA 1DUYA 1RUMH 1UXSA 4OT1H 1NBVL 3L3IA 3QNYB 5EU4A 4DEPC 4U6XA 1EZVX 1EZVY 4JFOA 5E24E 2Z92B 3HS0A 1SY6H 3DX8A 1MFDL 3ZE0F 2A1WH 1HHHB 4P57A 1BQLL 3EO9H 3MFGB 2VLMD 4WI6A 3SBWC 1W72H 4ODVL 4XMKL 3R4DA 2AKRB 3MROA 1MLCA 4QNPE 3VFTA 3U0WH 4Z7VF 4PV9A 5JIHA 1ND0B 4E0RA 5EO9A 5HYJB 3WLWC 1ITCA 1H3VA 3QISA 4GKOA 2DM4A 2VDNH 3DVIA 1IGCL 2AGJL 1I9IL 4Q9RL 1Z3GL 1AIFB 1PLGH 4YQXL 3RU8H 1MCRA 1QSFB 4G8GD 2EIZB 1IE5A 1LK3H 2G2RA 1P9MC 2DLFH 3CLEH 4OD2A 1R3IL 1G9NH 4PJXA 1T7YA 3KJ4B 4V1DD 2E27H 4PJEA 3MNVA 3L3KB 4OGXL 3AM8A 1Q9LA 3VU2A 4MLIA 3O6MH 2H6PA 1MVUB 3L6FA 3A6OA 3BQUC 3GSOA 1E4KA 1NEZA 3BPOB 1BVZA 3MRDA 4JRYD 2AVGA 3UTSA 1CLYL 3L5WB 4JAMA 4ODUB 1I9RH 4WO4A 2H8PA 3BN3B 2QTEA 3TO2B 3ZDXE 1YEDB 4RGMC 1NANH 4OAWB 3UMTA 1J12A 4HSQA 3QULA 4RIRA 1GC1C 4E42B 3SE9L 5DHYA 4V1DA 1RUAH 2VN7A 4K23L 1EVTC 4D94A 5C0CD 3BO8B 1I9JH 4MA7H 5FYLL 5IFHH 1BQHB 1M7IB 2XTJD 4LLQB 1ACZA 1U2CA 3HI6H 3QNXA 4W81A 2DOCA 4HQQL 3MNZB 4CVZB 3P4MA 5DJXA 1DJSA 2AK1H 1J8HB 5BVPL 3L95B 1JNLH 5CBAA 4Y16B 3O8XC 1OOAA 3KPOB 3RWEA 1Q94A 3DETD 3C09C 1JP5A 1EO8L 1HHGB 1JFQH 2IEPA 5FYJH 3MV9E 3T0XA 3T4AA 3FZUC 1OTSD 2F74B 3ULSB 2P8MB 3KYNB 4JQVC 5D1ZA 3GIVB 4WFFE 1T80A 1I8KB 4LK4A 1F3RB 1ZS8B 1MFCL 1JZ7A 1AQDB 3QUZD 1LDPL 3IKCA 5GRJH 5J11C 1KPUB 5DC9B 4RFOH 1CLZH 2PYEE 5EH1A 1WGOA 3B5GA 4BQ6A 5IWLA 5FGSA 4DZBB 3QWRA 4AEEA 4J12A 4QGYA 4Z95L 5C9JA 1WZMA 1UCTA 4P4KA 1YEFL 3NCMA 1ZXQA 1YNTB 1UGNA 4PJAA 4PREB 3HE6B 3LD8B 3GO1L 3K0WA 5A2FA 2YK1H 1RUML 1OF2A 4WWKB 4YIQB 3N50A 4LLMA 1TLKA 3U9UA 3TC9A 4N5UA 1AR2A 5E8EA 4XHJD 5TQ2L 4C55A 1BZ9B 1AGCA 5T1LA 1FDLH 1IC5L 4W6YB 5EU6D 3STZB 4G6KH 4PB9L 4HBCH 5ACZA 3L3GB 5I15L 1MCLA 3CLFL 2P49B 4GUPB 5TFSL 4DVRH 3DX9A 3Q5YA 3C08H 4ZQKB 4M43L 2VNCA 4BZ1L 1ZANH 4ZTOH 3K1DA 3RBSA 3QDGA 5I30L 4D0CB 5BJTB 1GOFA 4IS6A 4I4WB 5EZJB 1F5WA 5DUBB 3QHTC 5L8JB 2VLKA 2J88H 3HB3C 4JPKL 2C4XA 5FGBA 3VFNB 3TH2T 3UJIH 1EHAA 3WD5L 3QUXA 1ORSB 2KBGA 4EN3C 1UKSA 4JAMB 3NN8B 2GEEA 3H3KA 1RY7B 3BIBX 2P48B 1J8HE 1CL7I 4U3HA 3ES6A 4HUWA 1D6EB 3GIVA 3QHZL 3ORJA 1YPZA 4P3WA 5E5RB 2F74A 1XMWA 1WTGT 2IPTL 2DM2A 4FQXD 4JGJA 3GMNA 3NZHH 5MEPB 3TPUA 4X5XA 1VSCA 4JFPA 2VUOA 4PJ9A 5D7JA 4JKKA 4PJXE 1IEBA 4KKLC 4QXUL 1JMXA 1KCUH 1YN7B 5D96C 2V5TA 1NGXA 1OW0C 1T21A 4NM4H 5EZIH 1EERB 2Z91B 3NIFF 3V5HB 1CDCA 4KZEH 4C56B 4DWHA 5DRNA 2CMRL 2PXYC 4MXQD 1KEGL 3FL7A 1T1XA 4XCEA 5HDBF 1MWAB 5ITBL 3TBWB 2CLRB 1K8DB 3DV4A 3D3VB 2EYRA 2HP4A 2V7NA 1J9CT 3EYUH 1CFBA 1VACB 2X1XR 1X9QA 3MJ8A 3X14A 5GS2H 2BY0A 3LQZB 3QDJB 4M1DH 4RFNC 1NMBH 3MRHB 3EO1B 3WHE0 4J2XA 3TGXA 1XT5A 1JF1A 4FTVA 2M2DA 5IHZA 1B0RB 2JB5H 4UT9L 1N64H 2B0SH 3HAEA 1YEKH 4UQ2A 3VWKA 3FQWA 2VISA 1ZAGA 3F7VA 1X3DA 4BELD 4HIIA 3QUXB 3C6LD 2NY7L 5F9WB 4OSUH 5C0FA 3H9SE 1CR9H 3WFHA 3BPLB 1NLDL 3I3DA 3MA9H 5D2LB 3B8SA 2R1WA 4N0YL 4Z7VE 4YK4C 5FYKE 1NL0H 3BFOA 5DHVH 25C8H 5GIRA 2DB8A 3LRGA 5BS0B 2EDBA 4OZIA 3H9SB 4MHHG 5DK2A 3K8LA 1T83C 1U58A 1C7SA 2JCCF 4XP9H 3OAUH 3BP6B 3GMPA 4NYLB 5L6YL 1AKJA 2FX9L 2OTUA 1FDLL 2B4CC 2IPUG 2CLZA 1LMKA 4WFGE 4KK5D 4X7FC 4XMPH 3UXFA 3BZEB 1I8LC 1EVUA 4QT5B 3TV3H 5CEZD 4LLUB 5EORL 2VZVA 3D1MC 1SEQL 1HHKB 4IMKA 3W9EB 4FQLL 3MV7B 2D4DA 3MLTA 4P5MA 5HPMA 5KVGH 2PYEA 1JWSA 4XMKH 1OT2A 4NN7C 3JWDH 1T3FB 1IGFH 3K7UA 3BISA 4LIQH 4JM2A 4X9GA 1P4BH 3CFCL 2A9NH 4PGZA 5SV4A 1AXSA 2QSCL 4JDTL 4I5BA 1XGRA 4U1GB 4HMDA 3C8KA 5DHXB 1XR8A 2APVA 2NPLX 2DQFB 2IMNA 2Q3AA 2P8LA 4JFEA 4JFFD 5EU5B 5KSUB 2JIXB 2NYYC 12E8H 1IGMH 3QO0B 2BNRA 4ZUSB 4I8DA 3C6LA 4WO4D 1I1AA 1IRAY 5JA8B 4R0LA 5SX5H 4OZIE 4OI9A 3LQAC 2NY4C 3QPXL 3PWUB 4NO2A 1KN2H 5CJOL 3GEWB 4HIEA 4X6CE 2BVQA 1JIBA 3FMGL 1DSFL 1H8OA 4JQIL 1NGZB 1A4KA 2VE6B 4FQQB 4LCCB 2I9TB 2MHAA 4KK9C 3VGGA 3T4AB 3AS1A 3H3PH 4UIKH 3OBAA 1HSBA 4PLKC 2GK2A 5IFAL 1KJMA 2EKSB 2JELL 1DBJL 4MYWB 4WW2A 1MAML 4NCDA 2F5AH 3BVNA 4HHAA 1FO0L 1KTDB 5DHYB 3GSWA 3NAAL 5IB5B 3NA4A 2NW3A 3RJDA 3FQNA 3OR6B 4UB0H 1KLGB 1FZJB 4M1CD 3SEPA 3WL9A 2R15A 3PWNB 3O3AA 2E8ZA 3V5DA 2AQ1A 3TO4C 4PJ5A 3T3ME 1N3NA 1U3HA 3BI9X 5K33A 2PF6A 4WY7L 5FGRA 5C0JA 5IB1A 2XOTA 4YDKL 3VXMB 3SQOL 1RZGB 3TBSA 3SKMB 3VCLB 3FAXA 2YUWA 1F6LL 2NY3D 2I5YL 2VDRL 2DIJA 5EO0B 3OAZK 1G9MC 1TJIL 1FNFA 2W60B 2BC4B 4YXKL 3RZCB 4R4BB 5I76A 2R0WH 3SE8L 2F53E 4MJ4A 4GBXA 3SCMD 1J0ZA 4N0YH 3JV0A 5BXFB 2B2XH 4Y4FD 4NO3B 4NO0D 2I07A 1AGFA 2OMBA 5F72S 1QRNA 3FT3A 3R0NA 4ONFH 3SDYL 4WW1B 5HHNA 4I18C 1RIUL 3SCMB 3W81A 4DVBA 1KN4H 5F1IB 1O0VA 3GM0A 4U1LA 5D7SL 5GS0C 2VIRA 2X7LB 1ZMYA 3VFSA 5CCKH 1CD1A 3MLTB 4P5MB 3QFDB 4MNGB 4OFVA 5DI8B 5EU6A 4PJGB 1C16B 5GZNC 4UV4H 5D70L 3AMLA 1G7IB 3WIFA 3LKRA 3E2HC 5HYQA 3O9WA 4Q0XL 1WJ3A 3GSNB 1A64A 4KKLD 3SBWA 1CGSH 3EOAB 4PGDB 4PS4L 4X4XB 2PYFA 1ERNA 1VCAA 3IJHA 4GOSA 4PJCF 4N5EC 3WIHA 4OZFG 1ZGLP 3LSOA 4ZDHB 1NCAL 1C7TA 1A1NB 3QNZB 4HWNA 4Y4HD 4KY1H 1F02I 4PRIB 3WJJC 5IFJA 3QIBB 3GO1H 3MRJB 4GXVL 4DAGH 3LH2L 1QR1B 2A6DB 4U1IA 3RPKA 1N3NB 2IFFL 3W39A 3KG5A 4PJAF 5MI0C 1Q0YL 1D6VH 3TNMA 2BCKB 4TSAL 1CXIA 5ISZA 3EOBA 5INCA 4NOFA 2WSKA 5DVMA 1M1SA 5DZNA 5EFIA 1KPRA 1EGJA 1WVZA 4MXWL 1I3VA 3T3PF 1MCIA 3HZYB 4JQVA 4O9HH 3MA9L 1M7IA 4WU5B 5LVEA 1R3KB 2OR9L 4FQ2H 3GMOA 5ISZE 4JM4H 3VGAC 4HCRL 2F5AL 3LY6A 3HC4L 5FYLD 2YUXA 3GMQB 2Z91A 3V5HA 4UB0L 1SMOA 2RJMA 1BD2D 3NAAH 4XPAH 4MCYB 3M45A 5FECA 4EN3A 5TE4L 1N26A 3KPNA 1A4KB 3TVMC 3E3QE 1A4JB 3QDJD 5L88H 2GHWB 1QR1A 3K3QA 2KKQA 4X7EC 5JW5A 3C6SA 5IK3A 3LAFA 4L29A 4P23D 1GH7A 1DLHB 5I19L 5EN2B 4JVWA 1G9ML 2XWJA 5JHDD 4WUUE 4KV5F 3PE9A 4M61B 4YHKH 3K8MA 3VW3H 5DEZA 1SM3L 4U05A 1GGCH 5E56A 4P5TB 4UT9H 2H2PC 4XX1E 2GAZA 4U7MA 1IM3B 4L3EB 4MJID 3QRGH 2FWOA 3KPLB 4NPYB 2NY7H 5L2KB 3U6RA 1FL3B 1QLEL 2G9HA 3T2NL 1UACL 4QRRB 4AL8H 5B8CB 1YYLH 4YXHL 2QQQA 1T4KB 4WJ5A 3CH1B 1XGQB 3BD3A 1OP3H 2HVJA 1XF2B 5J56B 4P2OD 5FUOH 5L2KE 2EICA 1VGKA 3I6GB 3QUMA 2R69H 1G7HA 2LTQC 3W5MA 3OKOB 2OJZL 5A2KH 1LQSR 2E8YA 5IV2A 2GJ6E 4LLWA 1E4XI 1BFOB 1LO5A 4YPJA 4LKXA 1UJTA 4NHCL 1BECA 3IU3A 3JWOL 4P2RD 3MRKB 4UILH 4Y16D 4RCAA 4X80L 4DZ8A 1A6VL 2Y25A 1WWCA 3AS2A 4OCWL 1UM4L 4J4PC 1AKJB 4KKNA 1U8IA 4JANA 2YZ1A 4V2BA 4ODVH 3DROA 3MRGB 1JE6A 1W0VB 4H8WC 1NAML 1YQVH 1UEMA 3ROOB 3ESVF 2Q3ZA 1WT5C 2X6MA 1ZWIA 1JHTA 1VFUA 4EDXB 3QUZB 5DRWB 1TVHA 3K46A 1ZOXA 3BIKA 4XVUD 3UPAA 4LIQE 4N9OB 1H8SA 2DQDH 5MENE 3SDDB 1DQLH 1CXKA 1G7MA 1JRHH 3HZKB 3QXWA 2Y36L 3BRDA 4XPFH 4UUJA 3RVUD 4ZAKA 3BP4B 3QQ4B 4DAGL 5GGUB 5GJSH 3MUGA 1HIMH 5I0ZA 2J4WH 1FIGL 4LF3B 3CZFB 4FQXB 2J2ZA 3PUCA 3UTZB 2DLTA 3IJSB 3QBTB 3DV6A 4NSKB 4FG6C 5LGHH 5I1IL 4NQUA 3L7EB 3SDAB 2NY0C 5HHME 4Q7DA 3TVMA 3EDEA 3HUJB 4X4ME 3ZDYE 4LRIA 6CGTA 1BBDL 1INEH 1QA9A 2HFGH 2HKHL 1FG2B 1AE6L 3WXVH 3ILPA 3TO4A 1QO3A 2W92A 1TJHH 4L8DB 4R9HA 2NY1D 4H1LB 3GSXB 4HXAH 1XGYL 4YHIA 4MXVE 4UAOC 4F3FB 2AEWA 4M8VA 1BF2A 1GGYA 4Z7NE 4GG8A 4LASL 3PG2A 3ARVA 1A2YA 3X12B 2DIBA 1RZJH 3D39D 4NRZB 4FQJH 4DKFH 4JVPA 2H2SC 1U9KA 5LXGH 5DMYA 4F15C 2W9DH 4K3DH 3QUXD 1YMMA 3SQOH 2XY2A 4HC1L 1OAXL 1BVLA 2C3VB 1EDQA 3DXAD 3RVWC 3O3AB 1OP5K 5GGTH 1ORSA 5DQDH 1YC7A 4GRMA 1DBBH 3S36H 1F4XL 3O6KL 4LSRL 1TVDA 4OB5H 4E9LA 5CGYC 5I1CH 3DO7A 1L7IH 5AWNH 1R3LB 4PGCA 4JFED 2VSCA 3QRGL 3RUGE 1A9EB 4G6FB 4LHJB 3DSNA 4R0LC 2ZUQB 3IAGC 1HXYA 4C56D 2E3VA 1HH9B 1A3RL 1MCEA 4I48B 2Y6SC 1MCJA 2J6EL 5CZXC 2CH8A 2V5RA 2DBLL 4RDQF 5ADOH 4PYGA 3VFGL 3MJGX 3OKKB 3AUVA 3NACH 4HH8A 1ND0A 4ONFL 1NC2A 1OGTA 2X1QA 4H5SA 2ZSVB 1QSVA 5CWSB 2CDEB 1CE1H 4GQ9L 1I7ZA 1ZVSA 2VITA 4AG4L 1KOAA 1NCDL 3V6OA 4QXGH 5MP6H 3RWDB 3O45A 3LDBC 4LCUB 4PB9H 4XAKE 4HBCL 4RMTA 4UV4L 5D70H 3TIEA 1ORQB 1ZA3B 2GSIA 2O5ZH 3G04A 4G6FD 1J10A 2R2HA 1A6TB 4I3SH 3ZHDA 1CD8A 1DBAL 5IR1B 3ULUD 1TJIH 3SDXF 1RURH 4M00A 3HE6A 1UWXH 4ZFGL 3VXUA 1U93A 4NUJB 3V6OE 1YNTA 4JR9L 3S5LG 1KCKA 4NKOA 4PP2A 2AQ2A 3UC0H 4M6ML 3S6CA 1AO7A 3IDNA 5DWUL 4PLJD 1KT2A 3K4ZA 3GRWH 3RRQA 4JM2C 5JQHC 4DUXA 3QZWB 1XGTA 5E9DA 1OTTD 3BKJL 3MXVH 1P53A 3MRRB 1C5DA 3I84A 4KKCD 3BH9A 2YWZA 3W9EA 5CUSH 2I9LA 3BOVA 2Y1VA 1JN6B 3OAZH 3SDCC 3ZHLA 2VITB 3SKUD 5KANI 5F7NC 5JDJA 2DQHL 4HLZH 1HZHH 4L8SA 5ILTL 4F7CA 5FFLA 3ILQC 5HXMA 4ZXBA 5CFHA 5KTEL 2DQCL 3EFDL 1NCUA 1U3HC 1KC5L 1ETZB 1BZ7B 3OXRB 3NIGE 3QIWB 3QHZH 43C9A 5F3BA 5D7KD 3B2UC 4JFXA 1QFPA 3HMXL 4GG6E 1F8TL 1I1CA 4PJ9B 4F80A 3EDFA 5D9SB 3OV6A 5ALCH 1BQLH 3R8QA 5E0QA 3DO7B 1CDYA 4PJ7B 3WMSA 4JFHE 2GUOB 4DTGH 3U4AA 1JHKH 1INQA 1DDHA 4PGCB 3QXAA 4KU1A 5T33H 5CZKA 2OTWA 1MIML 2BVUA 2WMPA 3QQ9D 4KZDL 2I27N 5KOVC 3U4BH 1QKZH 1MCNA 3E1F1 2NR6D 5DD0L 4CVWA 5E4EB 3IU4L 1YMMB 4X6DE 5E2TH 2HKFL 5I6XC 2ZWLT 3LRHA 3MODL 1KIRA 2FIKA 1MVUA 1CLYH 2UV3A 5FA3A 1CQYA 4OZHB 5I73B 1J87A 2AQ3A 4XPGL 4L9LB 1NMBL 4YZFF 4B5EA 4XNZC 3KS0H 4R4FL 2H41A 4PJDA 3OG4B 2Q1EA 5B21A 1FZMA 1J1XH 3LOWA 1MELA 1OAXH 1SM3H 3T1WA 4QWWD 4NWTH 1U8JB 4NFDA 2ZCLL 4K07A 3BAEH 5HSFA 1RIHH 2XNAB 4R90H 3VMPA 4G80A 3PL6A 1N6UA 3WIHL 5DFTA 3BUTA 3NOIA 4QRPB 1EV2E 2ZSWB 3MOAH 2FYYA 2EZ0D 3RKPA 5ADOL 3EBAA 2F19H 1AJ7H 3VDCA 4LKCB 3WNNA 5C08D 3UTOA 5J8OA 4LMQE 1N5YH 2HT4D 1G6RA 2GW5A 2BMKB 2FJHA 4CJ1A 4QYOB 1QZ1A 3DI3B 3UJJH 3KPPA 2UZIH 3PNWA 3C60D 4XB8A 2MKLC 1ZA3A 1MY7A 1T89C 2X4QA 3NZ8B 4R8WL 2VDML 5HHVH 2EXYD 4WEBL 3EZ8A 3PDDA 5BRZA 3RDTD 3HE7D 1GOHA 3HZKA 4QRPE 1MFCH 1QFHA 2BNQA 5IROA 4WI3A 4Q58C 5FCUL 4E41A 4RFEA 43C9B 5F3BB 5I6XB 3KDMB 4YXLH 4ZAKD 1CFNA 4S11A 2VUYA 3NCCB 2D31B 1UC6A 4UV7L 3BSZL 4PG2A 5FO8B 4OGAD 1TQCC 4JN2B 3MRGA 4H20L 4LCIH 1CZ8L 4POZD 3GHEH 3VA2C 3ALXA 3PGDA 2ITCA 3LN4B 3DMMA 3HMWL 1WBYB 3IDYC 4U1SA 1A7RL 4P0DA 5CIPH 3RIFF 1CG9B 3DX6A 4D9RE 1RVFH 1V8HA 4YNYA 4XC3L 1UJ3A 1XIWD 2V9TA 3RGVB 1S7TB 2CRZA 3MRQA 3FONB 2VL5A 1MF2H 2EH8H 3OKOA 4NIKB 4ZFOB 2QHLA 4J3WA 2ZCKH 5DJ2A 5EOTB 3UYPA 1E27B 3MV01 5IQ7L 3IAPA 3QDMA 3ULUF 3MGOB 4XVUC 1VFAA 4K7FB 3N9GL 4V1DB 3PNWB 2DAVA 1FNAA 2OTWB 4PJIE 4YE4L 1U91B 4LSSH 4KROD 4MMZC 4XNZB 4FFZH 3QEQA 3GSXA 4Q9QL 1J0JA 2IAMA 2C1OA 4XXDB 1UA6H 1Y6NR 2EDDA 5FOBA 4L8CA 3IDYB 2QQNH 4N0UE 1G84A 2ADIA 2QHRH 1WUNT 3I2CL 2DLEA 3NMEA 3OJDA 3KXFD 1YY8B 1HXYB 1OAZH 4KJYB 2C7UA 1JUFA 2VQTA 4QTIH 1EBPA 4FG6D 4AJ0A 2H1PL 3ARDA 4K9EL 4N0UB 3RTQA 1V3MA 1BOGA 2WK2A 5B3JF 5IESH 2E6QA 3O6LH 3BGMB 5F44A 3TEUA 3V4VL 2R0KL 3VWJA 5JW4R 4KVNH 2IBGA 4QRTB 4KUCF 4XNQA 4M4PA 3QCUL 5DMIH 3MLPA 1NQBA 2FH8A 1MLCB 4NCC2 3VXPB 1JL8A 4JRWA 3MNZA 1RHHB 3PL6C 1OQOA 3QRFM 3CCHA 4WU5A 4HKJB 4K3GA 5EZJA 2ESVD 3UROR 4JQXA 3BPLC 2J8UE 1VESA 3B4NA 3EIFA 4PRBB 4P5KA 4OD1H 1CFSA 5CLTA 1AO7E 5C07E 2DDQL 4JEGB 3LS5L 5DEFA 5F9JA 3IRZA 3KLHC 3QUXC 5DD6B 4ODSH 4Z7UE 3QWOB 1X5LA 4PJ7A 4NRYB 4R3SA 1I8IA 2OJEA 1U8PB 4ODWA 1KTRL 4DK3A 1UM6H 3NA9L 4UMGA 3EYUL 1K5NA 4XP1H 5FV2A 2P44B 3V7AG 3O2VL 5EIQA 3GMPB 3AXLA 5DJ0A 1T7XA 3L3HA 4ZXBB 4L4TE 4Q0XH 1F13A 4U3XA 4D3CH 5HYFA 3OJ2C 3CFJB 5E9DD 1PZUB 3EW3B 5SWSA 4L9LC 1NCCL 2DQGH 1Y6KR 3ARUA 1YEKL 4MS8C 3IGAB 5FO8A 5CZXD 3V52L 5CMAA 2HWZL 4GG6F 3S37L 5E00B 3MJ9A 1IAKB 2PXYA 2IH3A 5ICXB 4KJQC 1JZ6A 2A6JA 3SGDH 4JPVH 5DK0B 4ETQB 1Q72H 5L2KA 1EJOH 2AV1B 3TCXA 1IFHL 4JKPL 5K9KA 3STBA 5CUSL 3BDYH 2ATPB 4YFDB 3LKNB 3DECA 4WW1A 4ELKB 4JFOB 3FN0L 1Q0YH 1JPTH 4ZUVA 5CINL 1MLBB 4DCQA 3D87B 5C0BA 1O7SA 3AU1B 3QIWC 5K9OA 4FNLL 3MOAL 5F9WC 1MJJA 1FIEA 4ENEC 1E4WH 3RNQA 3C5ZD 1T6WA 5DVKA 4EN3D 4KWUA 5FKPB 1I8IB 4YDVA 1ZLUH 3LPGA 4XWGL 5EUKA 1A7QH 4NN6C 3G5VB 4Y4FA 5DHVB 1IEBB 4QHUA 4YLQT 2PTTA 3HNTL 5TE7L 4J6RL 1RIVH 1RZGA 4H88L 4QF1A 3TBSB 5A43C 1C12A 1QSED 4P2YA 5E5UB 3GMRA 1MREL 3SDCD 5J12C 3BMWA 4QXWA 5JHDA 5JR1H 2P8PB 4UDTB 5AEAA 2MCPL 4LPVA 5HTSA 3T3PE 2G9HB 2DD8L 1IAOA 4XPTL 3NFPA 2B5IB 2P24B 4NHUA 4TNVF 1MRCL 4EIGB 3BDBA 2X5PA 3SKJH 5B3JE 4JCMA 5HYSG 1F4AA 1YEDA 1OSPH 2XTJE 5HY9A 4MGXA 1R5VB 1OGAD 2IG2H 3TNMB 4HUVA 1AI1L 1PX4A 4UV7H 4O4YH 2W0LA 1CL7H 4KKBD 2VAAA 3V95A 1QSEA 3B6SB 5K59E 2VMFA 1XGUA 1YEIH 3JUYA 1HHJB 1T04B 1ULVA 3HR5B 2Z4QA 1KTLB 1MJ8L 5FM5O 3TYFB 4YDIH 1AFVL 1CD9B 5I1AA 4JO2H 2YPLB 4B0MM 1T7VA 2HJLB 3L3KA 4GAJH 4IOFC 5SWZB 3ESUF 5C0RH 2NTSP 3WYRA 5I1LB 5CKGA 4DKAA 3QUKB 3CK0H 2Q7YB 1AXTL 2CKBH 3MV9B 1BP3B 1EAJA 2YN3A 3SOBH 1N5YL 1Z0NA 4PBVC 2AXFA 1X5JA 3TJEH 3BH8B 4A6YA 3LQMA 1EUTA 1CXHA 4HIEB 4APQD 4JRXD 2VDPL 1P9MA 4GJTB 1AD9B 3HZYA 3DURB 3IDGA 4ZMAT 1CQKA 4NKOB 5JOFA 4S1SH 4LSSL 1ZT4B 3QCVL 4WTWA 5DQ9B 2EDHA 4JFEB 5EU5A 2RFXB 3MRLA 4YFLI 5LBSL 4U0RC 5CSGA 3A6BH 5JOFB 3GBML 5MERB 3LVEA 2DL2A 2AV1A 2VH5L 3IYLW 1KXQE 4LCUA 3I6LE 3KR3H 2WWMD 3LN4A 4PJIF 4JDZA 4MAYB 4NKMB 2AEQL 5BZWB 2VABA 2OTUB 4OD3H 1ZEAL 5D1ZD 4LSUL 2Y36H 3IKKA 4NNXA 4GKSB 5D2LF 1MFEL 2BNRE 3FB8A 4D9QE 3OMZA 5D7LA 3FN0H 3HE7C 4JFFB 2BNQD 1OPGH 2VDMH 4H25B 2H9GB 1BQHG 1KF9B 5A40E 4GRWH 1QLRB 1QBBA 2AXGB 4RGNB 2X4RB 4MAUL 4WO4C 3VI3E 5BRZB 3RL2A 1LO0L 1NUGA 5CBAB 3O41A 4YUEL 3OR7B 4RMRA 5J11B 5DJYB 3V8OA 5A2LH 1FZJA 5E2VL 1U8MA 3TYFA 3D85A 4WEMB 3I6GA 1JF5A 1UWGL 1CN4A 3B9AA 1WF5A 2NY5C 2NNAA 3RPIB 5F1NA 1KTDA 3MA7B 3FOMA 1BLNB 3F7VB 1Z5LA 4PJHA 1ZHLB 5FKAB 4TQEH 4N8CL 3CCHB 4YHMH 1KYOK 5CIPB 3DVNA 5E95B 1WZ1H 3O6ML 1FL3A 3VDAA 2ATKA 3O6FC 1MCKA 3IFPB 4XNMA 1P7HL 2W9DL 3M07A 4PJ7E 1CL7L 3VGAB 1CLZL 4KC3B 1HOCB 3HG1E 2OS7A 2RBLA 4LEXH 4PJBB 4GW4B 3IFLL 3OKEA 5IB3A 3N1FC 4D8PA 1YNLL 1C8PA 1AD0B 4ZNCD 1RJLA 1IGIL 5DA0B 2WQRA 4JFHD 2Z93B 2F8OA 3NIDE 1MRFH 4HJGB 2OLDA 5FK9B 2IBZY 4G43A 1MHHB 4L3ED 4MJIB 5KVEH 3EOYG 3GSNL 1MCCA 1RZIB 3WFEL 1A6AB 4ZSOE 3WLWD 5KW9H 3W0WA 4RX4D 1NC4D 4OGYL 2VLRD 1T3FA 4QRSB 4FQXA 2HT3D 4OD1L 4P4RB 2X05A 4N1HB 3ARBD 3E6FB 2BY1A 2OCFD 4PY8J 3LKRB 5GGVY 4IMLB 3T1FB 4N0CC 1HH6B 1FL5B 3KPRD 4FZEL 3QP3A 1KULA 3EDJA 2XA3A 4YX2H 1S9WA 3TJHD 2YRLA 4K55A 1EHXA 1F58L 3H0TA 1G7LA 5I2IB 4YZFE 3U36A 2ARJA 1EEZB 2UY7A 2HT2C 5FUCE 4F7EB 4X7SH 3S3JA 4CW1A 1UM5L 5GRJL 4ELMB 2HMID 3QG6B 2AI0L 5CMAB 5GS0D 3F62A 4JFDE 2H3NB 1YECL 1ITBB 2A6DA 4OUUA 1IEHA 4DGVL 4PJEF 1Z2KA 2HWZH 3ZKMC 2LV4A 3L3GA 5I8CA 4JPKH 1NAKH 4FQJL 1WWWX 3BH9B 2J8HA 4Z77B 4ERSL 1RZFH 2BOCB 3VWKC 2F5BL 1N7ML 5D1QD 1L7TL 2FX7L 1XCTA 2GK0A 2GI7A 5IGXH 3NH7L 3LKSA 4UQ3A 4XAKD 5HHQA 3IXAB 4OLUL 4Z7VA 2FIRT 1O5DT 2BXYA 4JREB 2HLFC 3OAUL 4I2XA 2ADFL 1XCQA 4GRLA 5DQDL 3PP3H 1JFQL 3D0LA 5F9JB 3P2TA 1EHLH 3RVXC 1DTUA 4RMVA 1TJGL 2OZ4H 1YEIL 3QDJA 1H15A 5F9DC 1S9XA 4PRIE 3S96A 2OP4H 4G5ZL 4PJ5B 1OTSC 2AJVL 4LSTH 2NY4B 2XYCA 4NO5B 1FL5A 3ZE1E 3MJ9H 1BFTA 1Q0XH 4G9DB 2CD0A 1CFVH 1S3KH 1KG0B 4MJ5B 5F7FA 3UYRH 3HHRB 4Y5XC 5GS1B 1KNOB 7CGTA 1YEJH 4OM1L 2HTKC 1ZANL 2CKBA 3QH3B 4ZUWA 2HJFA 4ZTOL 4IRZH 4O00A 1J1PH 1LGVA 4TUOA 4Y19A 3L3OA 3S8WA 1T2QL 4KZDH 2IAND 5IHUH 4RMWA 5HDQL 3HA0A 1L4IA 3MV8B 5IKCA 5FF6A 4CMMA 5AUMB 2JJUA 1FPTL 3QCVH 2Y06L 5TQ2H 4ZPTB 2FLRT 3GGWA 4ENED 1UEYA 1DSFH 2W91A 4OQTL 4L3CB 3SKMA 3VCLA 3STLB 5KJRH 1DANT 4YFLF 2OL3B 1LEKA 3VXMA 5IT2L 3RHWK 5I1JL 4KROB 4CVZA 5I1EL 3DUUA 5HYJD 5KSUA 5IUSA 2YPVL 4ZO6A 5EOCJ 3QCTH 3WO4B 2AJSH 3WNKA 3DHJA 3VD7A 1FVDB 1I3GH 1E6JH 5F6HI 2VWEC 5C0RL 3MV8D 4ODUA 3PWJB 3T0AA 1HINH 1AQKL 3U7WH 1IGYB 5DS8A 2UVEA 1B0WA 4LPUA 1NLBH 3RVVC 3WUZA 1K8IB 1IGJB 1DQQA 4M03A 3ZDZE 2D03H 3BP5B 4QCIA 5FA4A 2CPCA 1LO4H 2PO6B 3R06A 1II4E 2DD8H 4OF0A 4KKBC 4AK1A 2MFNA 1S9VB 5D9SA 3VFUA 4YAQB 3V6ZB 4DKFL 3RZCC 2ZPKL 1U6AH 2XWBB 4D0DA 4Y19B 1TDQA 4OLYH 4B41A 3D0VA 3ULVF 4IOFD 5IMOB 1HI6A 3PXJA 5AYQA 3GIZH 5A2JH 4JFFA 4AM0B 2CK0H 3R0MA 4PV9B 4DGYH 3MBEB 3FO9B 3B9KD 1GJIA 3BEVA 4PJCE 5C0NC 5KBNC 5CHNA 3G6DL 4MJ5A 3HTLX 4LVHB 3TBYA 3OF6D 3OJMB 4YO0B 4HW6A 5K9KB 4C57C 2X89A 3FHQA 2VL4A 3T08A 4ETQA 3WIIH 3P4OB 3MODH 1DQDH 3TCLA 1HHIB 2CLVB 5HYIA 4EJ1C 1F6AA 4KK8D 5JIKA 1JPGB 2XN9A 5D8JH 2VZUA 4TULL 4OD3L 5IJKA 4BH8A 2UWEF 4J3TA 4M1GH 3ZO0A 1MHCB 5EUOE 4ORGB 5LGKA 2GJ6D 2HVKB 4XNXL 5KVMC 2GFBA 1BIIB 1E4XH 5EBMB 5HGBB 4ZQKA 1TJGH 2OZ4L 4DFHA 2CLRA 3DV4B 4XBPB 2Y07H 3RTQC 1F4YH 3VXRD 3RWDA 2EO1A 2FSEA 4GMTL 1S7XB 2D7TL 1KPVA 3RVUC 3TYGH 4DKDC 4OCMC 3S3SA 5KVGL 1SQ2N 2ESVA 1U92B 3U9UB 1N4XH 1UWGH 2DQEL 3N85L 4OZHA 4D0DB 3KYAA 3UTSE 2R0LH 2PKDA 5J4MA 3CVHB 3T09A 3RU8L 2UZYB 4LLYB 4NNYA 4IMKC 1VPOH 2EXWC 4DGIL 3U4EB 4I0PD 4PRHA 4B7LA 3O8XD 4OLEA 4KKAD 4PJDE 4TRPH 3FOMB 2Y06H 4I3GA 1KB9J 4M6NL 1MCOL 2FNBA 1OPGL 2P5WB 3BQUA 3P0YL 3FZUD 1XEDA 4QRSA 3TFKC 4Z7UF 3DIFA 5KVDL 5TE6L 3VXOA 3QUML 5DTFB 5CJOH 4QO1A 4I0PB 4HIHA 5GRYA 1MEXL 3INUL 3OKDA 5I1JH 5SWQA 3OKLA 5HVWA 5ITFB 3SKOA 5KZCD 4YUEH 4KJPC 1I7TB 2P8PA 4OZHF 2IADA 3JTSA 2HTLC 2CRYA 1MVFA 1MIEH 3GKWH 4P2QE 4KHTL 1A4JA 1KJMB 2EKSA 2XQBL 1YPZF 3FQXA 4EN3B 2YPLE 1CGTA 4MVBC 3GGWB 2AK1L 4Y88A 4YK4B 5CEXA 1D5MB 3NGBB 1OB1A 4HDIA 1JPST 1KCVH 4R0LB 3VFPA 1BWWA 1RU9L 1CGUA 1ZGLB 2VDOL 4MJIE 5GJTH 3PWUA 2BRRL 2HKFH 2CK2A 1OM3L 4O2EA 1AO7B 5KZCB 4XVJL 4KV5E 3CUPA 5E1AA 1QQDA 1KPRB 1JNHA 5EO1A 2CR6A 4NQXA 5AZEH 4Z7WB 3CXDL 2VDNL 3UDWC 1KT2B 4Z7QF 3WUWA 2YXMA 1BMGA 4U6HA 4IIQB 4XRCB 1FAIL 3IF1B 4OBSA 3TLRA 4U7KA 4Y4KA 2GSGA 1AO7D 1U8HB 4OF8A 1CU4H 5DD3L 1YECH 3CFBA 1ZT7A 1PG7H 3QDGD 2HFTA 3PV6A 3SGEI 5DEGB 1PEZA 5ID0A 5IIEA 1KJ2B 3ROLB 2E5EA 3U48A 3DHMA 6FABL 1H3WM 4L5FH 4H25A 1UWXK 1VFBA 2QEJA 2WP3O 1MNUL 3UJJL 2Q7YA 3QDGB 1I1FB 1EX0A 1HI6B 5TDPB 4KMQA 1RULL 3JVGC 5B39B 5JW4N 2OXGA 3FAWA 4RGMB 4I77L 4Z76B 3F5WB 4TTGA 3IDIA 2OX5A 3HZVB 5GSVA 3LEXB 5HYQB 4RWHA 1BJ1J 4HJJH 2FEDD 4X8JB 3GJFB 1AY1H 1RJCA 5SWSE 5IJKC 4GQPH 1NDGB 2Q86A 3D2UA 3C08L 4Y4KB 4WFED 5CD5D 1IC4L 1D5ZA 4XPAL 1P4LA 4WWKA 4OM0H 4X9FA 4U1HA 5D1QC 5HJ3B 2HVKA 1HQRB 1M71B 3RVVD 2VXSL 1BZQK 4WFHE 4QXTA 3RIAK 4TUKH 2EE6A 1MWAA 4YHLH 3TT1H 5J57B 4MNQA 2XIDA 2VRAA 3B9VA 4ODHH 2EDRA 4LSPH 3C8HA 4D8PB 2A73B 2MSPA 1SYVB 2KDGA 1TZIA 5EG6C 1EFXA 1IAII 1X7QA 1T5WB 4E5XB 1MPAH 1T1ZA 4LOUC 1MFDH 3HRZA 3P0YH 1ZHKB 1YY9C 3A6CH 4X7CC 5ESVA 1FG2A 5ENWA 3PDOB 5IVXE 3WHE1 5HBBA 5JTWA 2VZSA 5FYJE 4P4KC 1QA9B 2ZKHH 8FABA 3MV8A 5IKCB 3LZFH 4L8DA 4Q74A 4XBGB 2N4IA 1WICA 3EJYC 3PHQA 4OZHE 4JPVL 1L6XA 2EECA 3VI4F 3NZHL 1XGPA 4YH6A 2EDOA 3LIZL 2NY5H 2VWEE 4Q6IB 3UTPD 3C9NB 3U0WL 3V2AR 1KBGL 3NABH 4K71C 5DMJB 3WXVL 1RFDL 5HYJA 2X4OA 2DM7A 3G5XA 4UNVA 5GS1A 4K3JL 2R0ZH 4WCYL 4HXAL 4OF5A 3BQUB 4ZS6D 1D9KC 1AQKH 3X11B 5HDQH 4P59L 4NHCH 1IM9D 4PRDB 1TXKA 5IVXB 5CP3A 4NQEA 3LPFA 5DC4B 3DX8B 1JCKA 1CIDA 1VFMA 3RUGB 5HD8D 3LHPH 5BQ7A 1TPXB 1IKNC 2PCPA 1GXEA 2YN5A 4JO1L 3OTTA 2NQCA 5AZ2L 2FO4B 3Q5OA 3ISWA 1VGEH 4POYA 3EYQD 4L3AA 5I1GL 4X4YA 4NZUH 1C1EH 1GGCL 4I4WA 3BJLA 3VXNB 4OI7A 3DX6B 1MREH 1HOCA 3GBMH 3DMMB 1SYVA 3FQRB 3PGFL 2VABB 1MCDA 3D9AH 1IVLA 4O2CB 4DEPB 3AU1A 2JIXA 3DVFA 2WIIB 4A6YL 4XBEL 5CEZE 2VLRE 3O81A 1G1YA 4FFYL 4M6NH 4F7MB 5J6HB 3JWDC 2OSLB 3QQNA 2BNUA 1ZEAH 4S1DD 1FC2D 1OT1A 4X9HA 5C0BE 3ULVE 3SDXA 2F53B 32C2A 1RK1B 4PG2C 4HIJA 4OV5B 5HI5C 1LO4L 5F6IC 3ETBF 1FZKB 5F21B 3FT2A 2NXYB 2QSVA 4NFBA 1JPGA 3GSQA 1N6QH 3AC0A 3EDDA 5ESQA 2AXHA 1ORQA 4P23C 2YUVA 3OR7A 4MAUH 3U2SB 3KYOB 5SX5K 4LSQH 3DMMD 3ZSTA 4NM8H 1YMHA 2ZOLA 1K2DB 4LCYB 4XI5D 5ANME 5KAQF 2VDQL 2GCYB 4JFDA 4YFEA 4NDMB 3W0WD 3SCMA 3TH3T 3OPZH 4YBLB 1XCQB 4HKZA 2X1PA 4JZJA 1AP2B 4HFWA 3ARZA 1PZ5A 5DWUH 2C7UB 5D7LB 3GBNH 2NW2B 2EH7L 2X42A 1NGWA 4U49A 4GBXB 2QL1A 4O2FB 4WHTA 3HR5A 1ZT7B 5AD0A 3HLAA 2XG5A 4WV1C 1HKFA 1OLLA 4NWUL 3S98A 1IMHC 4JQIH 5FIEA 3VG9C 3O4LA 3QYCA 3MACH 3MLWL 2QKIB 4K2UL 4MMXC 1ZHNA 2E9IA 1VFAB 1RZJC 3IAQA 5LGHL 3V5KB 3ARXA 5EU3B 4DVRL 1QPPA 2YXFA 2LU4A 2VLJA 2KH2B 1E4WL 3KPTA 4U33A 3S5LB 4O51A 1H9VA 3MLZH 4WUUA 3FFCA 3CX2A 1S9WB 5F7DB 1AHWB 1A7QL 3QZWG 3W0WE 3V5KA 5JA9A 4HIHB 2X4PB 4LSUH 3SCMC 5INCB 5C3TA 1UG9A 1MAJA 3OWEA 4MX7A 4WHCA 3T04D 4J8RB 5MEOA 5DZLA 5DYOB 4YDJB 3C5JA 3L5XH 1SJEB 3DYOA 3TO2A 4XZUA 2DRUA 3ARYA 3RWCA 1PSKL 3MFFB 1KCLA 5ITBH 2H26A 4NQVA 1RJLB 1V5JA 1MLBA 1M05B 1CTOA 3LKOA 4NKDB 4KUZL 2UY6A 3ELAT 3UTZA 3HC3H 5IF0A 1KIPA 3F58H 1S8DB 5DJDA 4OI8A 2VDKL 4P2QB 4PJFF 4RA3A 2JLLA 3RY5A 5L8LB 5D72H 3WSQH 4KRLB 2FX8H 1GYAA 2R39A 4OUOA 4LCYA 5IMKB 4YBLC 2MCG1 4P5TD 1CFQA 4Y5XB 3BKYH 3BRGC 3G6JE 2ATKB 3RVTC 3PGFH 1FSKB 3ZKNC 3O2WL 5EOTA 1MWAH 3KGRA 4MD0A 2NY1C 1JRHI 4XBEH 2DQUH 4M9PA 5FM5M 3RWHB 4ZTPH 5T1KB 2DKSA 3O2DA 32C2B 2BX5A 4UIMA 1F00I 1FG9C 2O5XL 2XTJB 5TJWK 2X4TA 1JWSB 4MD0B 4OLZH 4ZXBD 1AKJD 1YNLH 1LE5B 1QNZL 3AXLB 5DJ0B 2B4CL 1HE7A 3K2MC 1RI8A 1GGUA 4N68A 4PRPB 3LRSB 3MR9B 1U3JA 2O5YH 2OI9C 4X6FB 4LMQI 1DBJH 1RZ8A 4PGBA 4QHNB 4S1SL 1QFWM 5HVGB 4FMFA 5C07A 3A6BL 1X5YA 2XRAL 4P2OA 4ODXA 4NKIH 5LBSH 4NKDA 3QJFA 1NLDH 2IAMC 3PWPA 3MRPA 4OF7A 5MHSD 4Z7UB 4ZO9A 1FGVL 3O3DB 3G6JA 1YEEH 4I48A 1V7ML 4XCYA 3CIQA 5JXAH 3FKUS 1ZK9A 3EGSB 2R1WB 5C6TH 2DI7A 4LLVB 1ZVHA 1R5WA 5BZWA 3L9RB 5DO2D 3B9EA 4YHZH 3OHXA 1TPXC 1XZ0B 3VXPA 3LH2H 2V7HB 5HDLA 3FFCE 5AZ2H 5GRWA 4G42A 5CILL 2VXTL 5DLML 1OGAA 4NBZB 5DMGD 2O61A 4UOW1 2VDRH 5C86A 4FZ8L 2IPKA 4PGEB 4YHPB 4PJ8D 1KLGA 2Q6WA 1N0LA 2Q8BL 4HS3A 5D4QA 1L0XA 3UAJC 4L8BA 1W8OA 1IT9L 1HILB 2PW1B 5LQBL 3SE4A 4JGUA 4ZFZA 4XPHH 2UYLB 1LP9A 4P3CL 1H5BA 3FT4A 5DDHA 4BQ9A 3PDOA 4NCC1 4PIRF 1U8JA 4GW4A 3EJZD 4CU8A 1IC1A 1ZHKA 3MX0A 5J6GA 5FM8A 3BZ4A 3QDMD 3DX7A 3QXTA 2ZG2A 3P4MB 5DJXB 4GKZB 3QUKA 3ARDB 5GISH 2DQJH 3U4BL 1WITA 3QNXB 1I7RB 5EBWA 3LN9A 5F88B 1OTTC 1MIMH 4XNYH 3QO0A 3ZL4L 1OWWA 1A3QA 2IQAB 4UOW0 2HG5A 3BZFA 4Y2DA 2RB8A 3JWNC 1UYWH 5BV7H 1I7TA 1NUFA 1OGAE 1FYTB 1T1YB 3O4LE 3PWLB 3LV3A 2V17H 4DN4H 1YA5A 3DSFH 3X3FH 1T0PB 1YEGL 3BHBB 4O5LL 2R2CA 2R0KH 3LKNA 3FJTA 5GGUA 1JGLL 1C1EL 4OJFL 5DD1L 4Z6AT 3HI1B 5IB2A 1YNKH 2WINB 3LIZH 3U9PH 5DJZB 3QIBA 1SVZA 4AENB 3S96B 1JYWA 4Y4KC 5AUMA 5D6DA 1TCRA 2CLZB 2PXYB 2CDFA 3ARSA 5HGHB 3GSNH 1MH5B 1MWAL 3IFOA 5IW1B 4LHUA 4P59H 2HFFA 5BS0A 1D6VL 3S4SG 4HKZB 3G5VA 4Y4FB 1WIOA 3RY6C 1WZKA 1R0AL 4LU5L 1WBYA 3GBLA 1OHQA 2R4SH 3QEQB 2Z8VC 4O2CA 4QHNA 2ITCB 1F2XK 1OWRM 5GS0H 1KENH 5IB4A 1HEZB 1Q8MA 4IOIB 3NPZB 5I66A 4IHOB 2P4AB 1N0XL 2I5YH 2CO7B 1HQ4A 3G5YB 5IOPB 3T0EA 3ARPA 4Y5YC 4JFQB 2WLYA 3GSQB 4RMSA 2AGJH 3WKML 1X6LA 5K9JH 5E8OB 1S5HB 1UM5H 2DQGL 2NXZC 3PGCB 5A16A 2PETA 1FSKC 2NX5D 2V9QA 3O4OB 2XICA 3MSPA 5CZVH 1JNLL 1IEAB 1KCRH 5LJYH 5HDOA 3O3BA 2BHZA 3KHQA 1SY6A 3FB7B 1DBML 5EUOA 1YEHH 3T0ED 4GRLC 1T1XB 1EJ6A 4MSWB 3T0DA 5DLMH 5T1MB 3TT3H 5DQJA 3TBWA 4CMHB 5D1XA 5JOEA 4EZMA 1HIML 1SJHA 4M3KB 3ZE2F 4S1RH 1OY3B 3GNMH 4CW1B 1F90H 2Z93A 3WFBH 1DVFB 5JQ6H 1AGEB 2AJVH 4JRYB 1INEL 2BNQB 2HKHH 4EI6A 1E4KC 3SGDI 4QHLA 1U8PA 2R56L 2BVOB 1MJUL 5JHLH 1T5WA 1H5BC 1D5BB 3F8UB 3LB6C 3WE6A 4HT1L 4RQQB 3W2DL 5FDWA 4JRYE 2Y5TB 1CZ8H 5GSRB 4M7JL 1TQBC 1ZLWH 1GC1L 1D5BA 5FM4A 5ID1B 4JO3L 5TE4H 3MMEB 3WHXA 4N8VA 1NBQA 4GMTH 4OLXL 5E08H 1OAZL 4OIBA 3MUHL 3U79A 2ID5A 4KK9D 1XGPB 4LCWB 1YMMD 5INDA 3O3DA 5BJTA 4K3DL 5SWZE 1J8HD 2MKWA 3FRUB 1G0XA 2L0DA 2P43B 4PLOB 5DUBA 3DVGB 1BFVH 5TF0A 3LPWA 2V2WB 4GAFB 3P73B 4MDIA 3HRZB 5ELIA 3BZ4B 3MRDB 4XPBH 5L2JA 2H32B 4ELMF 4IHOA 2XI9A 4N0UA 2E6PA 5C3LD 2HRLA 2VJXA 1QLRA 2AXGA 3VXQA 1RUAL 3RP1A 1BFOA 3ET9F 1T66D 2YSSB 3WCYA 1Q1JL 4DCQB 1JPSL 2DQFA 1U2HA 4GSDH 4LPYA 3WNPA 5B38A 1HYRC 2ADIB 1I1FA 2PW2B 2QQKH 4JZJC 1V3KA 1KLUA 2HLAA 1FVCA 3NCFB 3VXUB 1KELL 4C54A 1T4KA 4RAVB 4E41B 5DFVD 5E94A 3BRFA 4G9DA 4HKBB 3N1GC 5D5MA 5DK0A 4Y7MA 5E9DB 2VLRB 1JVKA 1HQ4B 4QTHA 4MD5B 4JFFE 4PFEA 3NFSL 4G6AC 4KPHH 5E94B 4KHTH 4OBRA 4JREC 4MQTB 1QFOA 4IJ3C 3QT2A 2JCCA 3T0WA 2OZ4A 2LQRA 1QEWB 4FQ1L 1RMFL 4XP4H 4F7CB 4BFIA 1FYTA 4YHNB 1OCWH 3DLQR 2EC9U 1NGPL 4G8IB 1KEGH 4N0RA 4NNXB 4CVXB 2EC8A 3PL6D 4QRPA 3WJLC 4ZXBC 3QG7L 5BV7L 1PD6A 5ID0B 4R2GC 4OF6A 5ICYA 3HE7A 3V0VB 3FQRA 3IS0X 4PJDF 3L95A 1GGTA 2VLJE 2NR6C 3QSKB 4PPTA 4K7PY 4U1JB 5GZND 1NGYB 1Q72L 1EJOL 3ZKXB 2HTKD 4Y16A 3KLHD 5D1XC 1HZHL 4IIQA 4PRID 5E4IA 2OL3L 1DE4A 4TOYL 5DURB 4R26L 5F70A 3SY0A 3LMJH 3X13A 4NGHH 1Z9MA 5CINH 3VI3F 5LAXB 2ITDB 1ZT4A 1JPTL 3FFCB 5DQ9A 4KQ4H 2O93L 1JHLH 4X6EA 1RHFA 4QKXB 1AGBA 3K1KC 5JHLL 5JLZA 1QSEB 4S1QL 4PJBE 1U8LA 1ZGLA 1UB6A 25C8L 4WI7A 3HG1B 5J1AA 2UWEB 2Y5TA 3PP3K 1JYNA 5A2IH 3G5ZA 1QPXA 3W0WB 1FL6B 4MNQE 4UDUB 4FABL 4JFZH 1QKZL 4KJQD 4PJIA 5ACLA 1MQKL 4ZFOL 1DQLL 4PJ8C 2MCPH 3HNSH 3PHQB 3C60C 4PR5B 4Y2OA 1DBAH 5D7IE 2FGWL 8FABB 4PJIB 5F1OB 5BS0E 5BZDB 3QUMH 4L8SB 4KHXH 5C0CB 2C1OB 4KI5C 4XXDA 1RPQA 4LP5A 5L2JB 2FRGP 5DTFA 4PGEA 2NXZD 1CR9L 4P46A 5E8NB 4PJEE 5I8KL 4EBQH 5DQJB 3M17A 4P57B 4BJLA 5GS1C 3MRRA 5IVZA 1VADA 2NMSA 1XGTB 2ZNWA 3P11H 1G7PB 3F12A 3MV8E 3TIDB 5K9QI 3SGJA 1S9XB 5AG8A 1DANU 4H8WH 5F7MC 3FQTB 4K8RH 2MQ0A 2BP3A 1GAFH 3FTGA 3OKMB 2CGRH 2NLJB 3OZ9H 4WI5A 1MPAL 4RGND 3UYOD 4Q2ZA 1RUKH 1A6TA 1RU9H 1UXSB 3IXAA 1I3RA 5C0IA 1KCVL 1PY4A 4M5ZH 1NGYA 2GK0B 3RGVC 5T1LD 1BWMA 1WCQA 1A7NH 4KK8C 5BS0D 3FB5B 4R4BA 1WTLA 5F9AC 5AZEL 2QBWA 4WTZG 2BY3A 3GI8H 5JMRA 3LN5A 3T65A 3V6FA 2Q76B 3GK8H 3LEYH 4JPWL 5CJXC 5I1DB 1M7DB 3CH8A 4NP4H 3HI5L 1TQCB 4D9RD 3GSNA 3CVHL 3L5JA 1ACYH 1CGVA 3RA7H 1YN6B 4PREA 3OL2A 4FP8H 4BUHA 5C0DB 1ZGLM 1RZ8B 1IILE 3T77A 5KAQG 2DWEB 4NZRL 2JE8A 5DF0A 5C08E 1WAAE 3CFEA 3SDDA 1IKFL 1PJ9A 1NCWL 1I3RB 3E6FA 2IWGA 4NQSA 4DZBA 4XPGH 2J5LB 5J1SC 3NACL 2YA2A 3MV7D 4HIJB 2QADB 2X4OB 4Z7WA 4M5YH 1TCMA 3EFFA 4K3EH 4I77H 2ZCKL 2F54A 3EYFA 2GITA 3MOBH 5GGSA 4LSTL 2GJJA 4KKAC 3MXWL 3KPLA 4JY6A 1H8NA 2MHAB 2XFXB 2YMXL 4P9HH 3M17B 1CF8H 5I76B 4WNQB 5IB3B 5ESVB 4LBEB 4P46B 4S1QH 4HDIB 4LVNC 1LO3L 1N2RB 1LO5B 5T3XE 1MI5A 1T21B 3HLAB 1KJ2H 4PJDB 1KELH 3V79C 3MLRH 2QR0B 3MV11 2Y23A 2EDQA 4G9FB 4R8WH 4W4OC 3G08B 2XKNB 1YJDC 1FVEA 4ZPVB 1GC1H 1KYOJ 1BJ8A 3K2UL 2QADD 5AAMA 4ZFZB 5DFVC 3MYJA 4IRJB 4JY4B 2C9AA 12E8L 1IGML 4WI2A 4GG6A 1WBXA 2EDXA 3S5LA 5ECJE 5EOQH 4LVOC 2DTML 3HI1A 3KAAA 5LWYL 1CGSL 2ZUXA 1WBXB 2AJZB 1BVLB 2C3VA 3LZFL 3UX9B 1OGAB 3MJ6A 4GW1B 4WDIA 2DLGA 4X5WB 1HHKA 1GPOH 3KWWA 4MS8D 4PRPE 5DJ6B 1NC4B 2ADJB 2H6PB 4O58H 4QGTA 2VDLL 3GHEL 5HVHC 4O2FA 1J1OH 4XH2B 3KS0J 5FF6B 5IM7A 1DEEA 1TVHB 4FXKB 1FO0H 4RISL 3TNNA 3FOLB 5E6YA 3MRQB 3ZYZA 4ZPVA 4UU9B 1PQZB 5J9PB 1U58B 1WIPA 2RGSA 3ROOA 1UJ3B 2EH8L 1TZGH 3IU4H 3DX7B 2XFXA 5EZLB 3MV9D 3TA3D 2A73A 3C60A 2R2EA 4WU7B 3HE7B 5GS3A 3LHPL 4Z77A 4ELME 4Y0GA 3O4LD 3MJ9L 3EOTL 4O9HL 5IEHB 1R3KA 4FXGB 1A0QL 3EFFB 2IC2A 5LGJB 3QFJE 4I2XE 1CD1B 4QY8B 1X5IA 4HUXB 4OLYL 4U6VL 4EUPA 1CS6A 4PTUA 3ARGB 4S2SA 1I9IH 1MCHA 4YIQA 5J13C 1T66C 4PJGE 4G8GB 2RCSL 4UIMB 2A83B 4NP4L 3VA6A 4W4NA 1PLGL 4YQXH 2EO9A 3R8BB 2ZUSA 4YXKH 1E6OL 4KDVA 4WGWB 4D0BA 2DQTH 2XZCL 5FUZL 2DMCA 1P1ZA 5DT1H 2VZTA 3OHXB 5HHMD 2HRPH 2VLKE 3B9KA 3F7YA 4G3YH 1CGYA 4P4RA 1PX3A 5C07D 1LDSA 2WW8A 2BMKA 2UZIL 1KFAL 1KIUA 4DKEH 5EOCL 5DMIL 15C8L 4G6AD 4K9EC 5BRZD 4PJFE 3RDTA 4WEBH 4YX2L 1KB5H 5E70A 5MENB 5I1EH 3FB6A 1IM9A 1U8OA 3BPNC 4ODXB 2W0PA 4N1CA 2PO6C 4RGOH 5T5NG 4CVUA 4LVNB 3UBXB 2VKXA 4OZ4A 1IGTB 3P11L 3H0TB 1Y18B 3Q1SL 4N8VG 4PLJC 3BP5A 4QCIB 5D5ME 4XC1L 3Q48A 5C08A 3P3YA 2AK4D 1HYSD 4M48H 4TN9A 5BVPH 3QFDA 4X7TA 5GGVL 4IDJH 4AEHL 5BCAA 2ICEB 5JDSB 3FQNB 1CFSB 4MB3A 1YDPA 4M02A 3DBXA 3WO4C 3ZKMD 3GMOB 4NQXB 4IRZL 2VZOA 3VWKD 2O5YL 2A38A 4DGIH 3D3VA 3D69A 2E27L 1UM6L 1FNGB 1IAIM 3NA9H 3LKQB 1NGQL 5EOQL 1NSNH 4X6CF 1WFTA 1NCBL 3WEXB 5JORA 1KEMH 3SKJL 5CSZB 2FGWH 5JW3L 2DI9A 4LRNH 3VFPB 7FABH 3B2VL 3HNVH 4J3OC 4ZNEE 1DP0A 3GI9L 3L5WA 4UTAH 3BVNB 3VWJC 1NEZB 4FQIH 2DMKA 2XV6B 1BOGB 1OTUC 4B53A 3LCYA 4W6XB 5BZDA 2E7BA 5C8JB 4NN6B 5HD8C 4F33A 4NQDA 1PG7W 1DVFA 5JXEC 5IWLC 3RAJL 4I9WD 1U8OB 1E6JL 4FQQA 4LGRB 2I9TA 4JKPH 3EYQC 4EVNB 4KAQH 2H45A 5E8DH 4DJMA 5J1AB 3HPJA 2NY0B 4L8CB 1G7QA 4WFFD 1Q9OA 4YHPA 3MA7A 4NBXB 3OZ9L 3ALWA 4WUUD 3G5ZB 1S7SB 5D1ZC 2DLFL 2A77H 2CUMA 3D39E 3I2CH 1IKNA 5C0EA 4LU5H 4K9EH 4ZUSA 1YMHB 3TCLB 1AC0A 2P8LB 5T1KD 4Y5VB 5H37H 2D0FA 2FECI 2CSPA 3QDGE 2N7AA 5ICXA 1G6RH 2XACC 3KPMA 3IF1A 4XXCC 3OAYH 2BDNL 3O2DL 3F5WA 3PGCA 1T1WB 3EYOA 1FJ1A 3BP6A 2CK0L 1MCFA 1I1AD 4WW2C 3ARQA 2HN7A 1LDPH 3A0OA 3FQUA 3U46A 2J88L 4F7PB 5ALBL 3T2QA 3WFCL 2JJSA 1EH9A 4U0QB 4BQBA 1EFQA 1VEOA 1VFBB 2A9MH 3AY4A 1KPVB 2YEZB 2E9WA 1DQDL 2DI8A 5D7KE 3VXUD 2X9WA 1I1AB 2W59A 5GJSL 4G7YH 1T22A 4RRPG 3DPBA 5AYUH 2DYPB 1QFUH 3DRTB 3U83A 5E2WL 4PYHA 2LFGA 1IKFH 4Y1AE 2D2OA 5DJ8A 3TN0D 1YQ2A 2GFBB 3EO0B 2ICWI 3H9SA 4WFGD 4AY0A 5LWYH 2O5XH 3DUSB 3HZMA 4ISVA 1W0YT 2D31A 1A7OL 2AJYL 1CFNB 4PRAA 1J7VR 1HH9A 1ONQB 4H26A 2VKWA 2ERJB 4LAQH 2NYYD 1QRND 3L1OL 3Q1SH 1B0GB 1A6VH 3HCVA 3O11A 1A6UL 3DURA 3TBVA 4TVPD 4CAGA 3KVQA 2X4UB 4L4TA 1CFQB 4WENB 1IC5H 4M48L 1PYWB 4Y5VA 3S9DB 4GBXD 1S7UA 4P5TA 3CVHH 2AP2A 4EQ2A 1R5VA 4C56A 5F7YC 1AXTH 3QI9D 4F7TB 2Z35A 5I16A 1A5FH 3QWRD 3HG1D 3CDGB 3QO1A 2R8SL 2YA0A 1IARB 4N8CH 2LU7A 3U4EA 1K8DA 3MO1A 4NO3A 1CK0L 3ARFB 4X5XB 3C6SB 2IANB 5SWZA 5EZOH 3VXQB 1HXMB 4N0CD 3MZGB 4ZSOB 5JW3H 2YPLA 2ENSA 1JTPA 2JK5B 1KLFA 2CKBB 3DVGA 3QH3A 4XPTH 1WWAX 4X6DB 4UTAL 2JB5L 3EAKA 4M1CC 1ADQH 1RUQH 3WJJA 4XCNA 1YJDH 5I75B 4HPYH 1A7PH 4KGJA 4YHYB 1D5IH 2UZXB 4KTEL 4X98A 5CJ5A 2Y72A 1MI5D 4IJ3B 3JTSB 1NBZB 1OAKH 4MQSB 5C2BH 3O6FA 5HGDA 3BKJH 3MXVL 5IQ9B 3VFGH 1AFVH 1IQWL 4NRXB 3I75B 3S97C 1Z9OA 3B3IB 3MMEA 4KH2A 1AE6H 3FCTB 2FR4A 1MIEL 3EOBB 4LP4A 5F1NB 1ZLVH 4BH8B 4K3JH 3VFMA 4HV8A 4H0IA 4QF1B 4F8QA 5JW4Q 1BBJA 3WN5B 3SPVB 3UZEA 1A22B 2DJSA 4IEFB 4M9OA 1QO3B 1DQJA 4YR6B 1GGBL 4PV8B 2FECL 3ARGD 3WN5C 2IQ9L 4QHLB 5E00A 1NGWB 3JWDL 1MJJB 1TMCB 2F58H 3BKCL 4NZTL 2BDNH 4C4KT 4C4KO 3PABA 1B4RA 3L7EA 3K80A 5CJQH 3SDAA 5IG7B 3ULUL 1HYSC 3FB6B 2F8VA 5F9OL 3FQUB 1HWGB 4HC1H 4MSWA 3E8UH 3FB8B 3P4LA 2JIXD 3SDCA 5HHMB 5IMLA 3O9WB 1RQ5A 2MQ3A 2C3GA 1K6QH 3U0PB 3TT1L 3LS4L 4ODWB 1H3PL 3C6LB 4Q97A 5E1HB 2ZNXA 4ZG1A 2OQJA 4GS7C 2VLLA 2A6JB 1KJVB 1NCBH 1P84K 3CFBB 4U6YB 3KPPB 3TJEL 5KTEH 1ONQA 4H26B 2CRIA 3F7RA 3FCTA 3KPRE 4TSCH 1TQBB 4N5ED 4NQCA 2ZKHL 3CSYA 2FL5B 3CFJA 4GXUN 4A2MA 2VXUL 3G04B 1JTTA 4YHOL 3TWCH 4O2EB 3P4OA 4JHAH 4DUWA 2XWBA 1SBSL 1K3IA 1WT5A 4HUMB 4KK6D 3KXFE 4I3SL 4GSDL 3TESA 5IMKA 3KPOA 3HUJF 3HZVA 2CDEA 5GSVB 1AJ7L 4NQCE 2EDLA 3FN3A 2B20A 4R3SB 2Q8AH 4BQCA 5B3NA 4M8QB 3MBEA 5GZOD 1YEJL 5JO5A 3OGCA 3QIUA 5GRZA 4P2QA 5C0CA 4NQEE 1IC4H 5GQBA 2Q87A 4LLDA 5DS8B 1M6OB 1UZ6E 3FRUA 2XZZA 4MQ7B 1HXMA 4FABH 2GJ6B 2A9NL 1NL0L 1BQHA 1FNHA 5D7IA 3CH1A 3LKQA 4HH9B 4UTBH 5HYJE 1C08B 4CN6A 2AJZA 5FB8A 5IBLC 4MCYA 5FECB 2Y5EA 1XGUB 3ZLQC 4XP5H 1WBZA 4AQ1B 3VXTA 3DBXB 5C0AE 3C5ZC 4N0FB 4UQ2B 1B88A 1KXVC 3GSWB 2ADGA 3KPSB 4XMPL 1I1AC 3VD4A 4X6CA 1SVCP 5GRXG 3WNOA 5KSVB 1KN2L 3UTSB 3VWJB 3UTTB 3EFDH 3KLAB 2W1NA 1QG3A 1RZFL 2EKJA 3IDJB 3PXHA 4D9LL 2P8MA 3UZVB 1Y18A 1QYGL 1MCSA 1UH3A 4GKZA 4UAOB 4MJ6A 5FGBC 4PTTA 1A2YB 3EYSL 1JHKL 4PRAB 1P7KA 3RAJH 3K8KA 1AD0A 4PJ9C 2F9BT 4H0GA 1SMAA 3I6KB 5ENWB 3VGDA 4ZS7L 2ADFH 1KUMA 2PTVA 5JO5B 4OCLC 4G8FA 3DX9B 1T2XA 3CFKA 4LARL 2AKRA 4WHTB 4ODHL 3QEUB 1NBVH 1TVBB 5I8CB 3AREA 2YEZA 3E6HB 5F89A 3VXSD 3IFPA 3VWJD 4OLXH 5C1MB 1DUZA 1A6ZB 4FZEH 2X4SB 4UINL 4HWEH 1JYXA 4G8IA 3HS0B 3RTQD 2PYFB 3P9MB 3HMXA 4RIRB 5D7LD 1WLHA 5C6PB 2FL5A 4CGTA 5I18L 4JM2B 4PS4H 4PRHD 1KNOA 4I0PA 5F9OH 4I0KA 4U1HB 3RUGF 2AAVA 4H20H 1FC1A 4P4KD 4BFGA 4GAYA 1P69B 1LO2L 1PYWA 1J86A