1AR1D

Structure at 2.7 angstrom resolution of the paracoccus denitrificans two-subunit cytochrome c oxidase complexed with an antibody fv fragment
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
b'DIELTQTPVSLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQFLVYNAKTLGEGVPSRFSGSGSGTQFSLKINSLLPEDFGSYYCQHHYGTPPLTFGGGTKLEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Structure at 2.7 A resolution of the Paracoccus denitrificans two-subunit cytochrome c oxidase complexed with an antibody FV fragment.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Complex (oxidoreductase/antibody)
total genus 23
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1997-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ar1D00
1LEKB 1FPTL 4WENB 5FFLA 1DE4A 2X4PA 3MOQA 4PRPA 1KPUB 3QDHA 3WXWL 3GSRB 3PHQA 5CEZE 3KWWA 2GUOA 4I0PD 3SKMB 2VDKL 1OWWA 1CFNA 4WV1A 1PZ5A 2AGJL 2W9EH 3FO1A 4XCNB 1KEGL 4YGAB 5GS0L 3ULSB 3KPSD 1SJHB 2EYSA 1XT5A 3TVMB 5KG9B 1CGWA 4NZTH 5JOPD 4Z77B 3QDJA 5F7MC 4ZTPH 5E24E 1HXYA 4LFHD 4CN6A 5CGYC 2ERJB 2XQYG 3FN3A 5EZLB 5JW3H 2PYED 2DQHL 3RWGA 3KYOB 2IFFL 4JFED 1OD7A 1FORH 5F7NC 2JKXA 3QI9A 3QFDA 5HPOA 1I7UA 2AJXH 5DJ0B 4LSTH 5SWSA 4FFYL 3SDDD 4YFEA 1AHWB 5FM8A 3SDAD 4ZUWB 4R7NB 3AM8A 2NY6B 5HHPA 1KCVL 2Z31C 3WUZA 5FYJH 1RZFL 5A3IC 1NLBH 2JJWA 3T0AA 4M3JA 3STLB 1ND0A 2X41A 3GSNL 4J3WA 3LKOA 4QRQA 5D5ME 2FL5B 3T0BA 3BHBB 2P44B 4HMDA 2X4RB 3T2QA 3DPBA 3LKNB 4JB9L 3L5IA 3MROA 4QYOA 3Q0HA 2H26B 4KUCF 4XPTL 3QB7C 5AUMB 1JTPA 4U3HA 2QSVA 5TPWL 4CMMB 5IESL 3MRNA 1L0QA 3KPOB 4G9FA 4KPHH 4AG4L 4AM0A 1CGXA 1FAKT 5DJAB 1RJYB 4KKLD 2FRGP 1J88A 4ODHH 2CKBA 5TE4H 1IL1B 1AP2A 1KLFA 5IK3B 5C0GB 2WBWB 1NGPH 2C1PB 3CSYB 2FJFB 2H41A 5I8KL 1Q9OA 5FGCB 3VFSB 2VH5L 1MF2L 3RTQC 2A0LD 4OZFA 1CR9H 3H8NA 1XGQB 4RGNE 4PLKD 2NY2C 4G3YL 5TDNA 5DRZA 3WIFB 4HIHB 2BNQB 5DJZA 5J0BA 4P9MH 4WI5A 1I7RA 1YY8B 3WFDL 4JKPL 1Z9LA 1JPGA 4GW1B 1X5XA 3VXPA 3WEXB 3H9SE 4JFDA 1ZVSA 5D8JL 5FF6A 1MCSA 1J0HA 4KDVA 1T22A 2X9WA 4RWYH 4ZS6D 1E4KA 1HN1A 2LVEA 1UWXK 3DXAE 5IB5A 5JOFA 4X6EB 5LXGL 1CFVH 4HS3B 4U1IB 2APTA 4PJDE 4WY7L 1F6LL 4EKXA 2XQBH 5HYJA 1CGUA 1EVTC 2P5EA 4DTGL 4WO4A 1MFDL 2GJJA 1L0YA 2IJ0C 4Y88A 2AJUH 5KS9E 5IB2B 3SGDH 5D2NA 2IGFH 3BPLC 5J57B 1D7FA 1BBDL 4N0YL 3NA4A 4IRZH 3TNMA 5GGTH 3GSUA 3UC0H 2B0SH 4PP2B 4PJ5B 3EOAA 3IF1B 4HPOL 1IQDA 4TULH 4HWUA 5SX5K 3R8BB 4HG4K 4HIIA 4BZ1L 2MCG1 3VH8G 1IKFH 2X1OA 4U6HA 4QXGH 1S7TB 1V3JA 4WEBL 3MLTB 1HNFA 1YEKH 4W6XB 2QJDA 3NCEB 5DHVB 3V7AG 1S9KC 4G8IB 4TSCL 2HFFA 3O2WL 1NC4A 3WKNA 4ZTOL 1G9EA 4OB5L 3E2HC 2XN9B 1R3JB 4KROB 5D93B 1XCTB 3EFDH 3QUMA 2MKWA 4HUWA 4C4KO 5ETUB 3DIFA 4RISL 3D6GA 1G9MH 1W0YT 1A4KA 5IVZB 1MCDA 1U41A 1RULL 4OD1H 2R1XA 4MCYB 4F7MB 5F97E 4X6DE 3BD3A 3ROLA 3LD8B 2IBBA 1XR9B 3ARWA 4JREC 3MBXL 1D5MA 2NR6D 3SJVD 3QUYC 5D6DA 4O2CA 5DJXA 5TDPB 2HJLA 3V0WH 4Y7MA 3EGSA 5IB1A 3MUZ1 1QSFB 2B1AL 4OZIB 2X4NB 3BEVA 1W8NA 3GRWA 3IDNB 1U3HC 4LSRH 5E2UL 3WN5B 5DZLA 2VR5A 1EERB 2CDFA 4Y5VA 3V5DA 3OKEA 1D9KB 3EO9H 4IOIA 3QZWG 1LGVA 4NC0B 4C83A 2VL5A 3DBXB 4F15B 1NMAH 4JJ5B 3G08A 3RWHA 2HTKD 1I9IL 1A7NL 4Y19E 4P4KA 5H37G 3MRPB 3D39D 5DWUL 1LNUB 4XCEA 1M7IA 2FJHA 4P2QB 5LBSH 4YR6B 1MFAL 4WWID 1CICA 4Y1AE 3PDOB 5I73B 5CKGA 5GRJH 2FD6L 1EGJL 4KTDL 3P4NB 2DBLH 4X99A 4XAKD 4F8TA 3OMZA 4K3DH 1BQUA 2F5AL 3ZE2F 1GAFH 2WBJA 2HFEA 3T4AB 4UT6H 4X8JB 2JJUA 2X44D 1E4XL 5DJ2B 1M05A 1IEAA 1QRKA 3VU2A 4ORZC 3C87A 4GO6B 1ZT4B 4A2LA 3I2CH 1MAJA 3PWJA 4F58L 4ALAH 5B4MD 1K3ZA 3HI1B 3MJ8A 1ZS8A 4Q0XL 4XGZB 1K85A 4NWUH 3IDMA 3JTSB 5GISL 3D9AH 1JI1A 5J6GB 4L8SA 3MJ6A 5C2BH 1N4XH 4KMTL 4BSVB 4PJGB 5ACMA 2QSTA 5E70A 5F7LB 4EOWH 3LPFA 3NA9L 1P7QD 3C8KA 1MRCH 4OD3H 4DW2H 3UJJH 4MNGA 4ORGB 3X3FL 2YZ1A 1QRNA 3O6FC 1P2CA 5JPNB 4ODVL 3VA6A 5I1EL 5IBLC 4O02L 3O45B 3MRKB 1LHZA 3GEWB 4JKWA 3OJDA 3QIUA 2BVQA 1FVDB 2ZOKB 1WEJH 1D6EB 2EDQA 5BO1H 2ZUWA 2IADA 2DKMA 4NQCE 4GRLD 2ZWLT 1RZJC 3NABH 4PG9B 4NQDE 1JPTH 4Z8FL 3FFCD 4JE4B 2FB4L 3VRLE 3ZL4H 3N0PB 4UUJB 1NLDL 25C8L 3C08H 3E3QE 3AXLB 4NJ9H 3S9DB 1S7WA 3IAGC 1TETH 4PLJD 3T09A 1CXEA 4YHKL 3RHWK 2Z35A 1U8NA 3RPKA 3GHBH 3H42L 5CD5D 2X9XA 4HUUA 4XX1G 3QEQD 1KJ3L 3MV9A 4W6YB 3T8XB 2NCMA 3EYVA 1GGBL 1MCFA 5E56A 1IGMH 3MOBH 2NY5L 4WU5A 3B5HA 1I4FB 2YEZA 1KN4H 3KLHD 4KZEH 4NPYA 3G5XB 5L8LB 3DUHA 4IOFC 4PJEB 2YRPA 1S9YA 2CH8A 1I1FA 1W0VA 1MHEA 2YA2A 4DZBB 2EIZB 1P69B 4BSJA 2J3SA 3CFBB 1T89A 4PGDA 3QA3A 4OQTA 3F62A 1J05A 1CE1L 2RFXA 5IR1B 4NN5B 1P6FA 4LRIA 5C6PB 3B9VA 1DN2A 3FQWA 3P0VL 4NYLB 5IT2H 4P5MA 4LVOB 4WHTB 1KJ2H 1AGDA 1NMCB 2CXGA 2QADB 1T2XA 35C8H 3BGAA 1LDSA 2XZCH 1BQHB 4MS8C 4Z7NE 1LE9B 1GGYA 2XZQH 4Y5YA 4K3EL 3ULUD 4LK4A 3U79A 2R4SL 3F7VB 2JB6A 1XF3B 2XA3A 4LSDA 5DTFA 1ZAGA 1FGNL 1ZHLA 1I7ZB 3OR7B 2GTWA 1JNLL 1I7TB 1XAUA 3QCUH 3BMWA 4PB9L 3S5LB 3VXOB 3FONA 2BVPB 2XZZA 3DX8A 1AGBA 1FO0H 4WEUD 5INDB 4U33A 3QNYB 3THMH 3PWPB 1O7VA 3MACH 3RWFA 4DGIL 2NZIA 2BVTA 3B9AA 4OZ4A 1UJ3C 1NAML 1QPPA 3QEUB 3N9GL 3RKPA 2ZCHL 4LVNC 4U0RB 1RURL 2CDEA 3OHXA 4P5TC 3V4UL 1XIWD 2ATKB 4ZFZB 5TGBB 3RWJA 3V4PH 1R3LA 3K8KA 2FCBA 4HIJA 4KHXH 4HWNA 4AENB 4NQED 3VXSB 2DAVA 1MY5A 1S7QA 4BSWA 4YHZH 1J1XH 5T1DH 3HNVH 2DYPA 1I1YB 1PKOA 2X1WL 4Y4FD 4HX1B 4R4ND 5HGBB 2GI7A 1EAPA 5J4MA 3FO9B 2PYFB 4OM1H 3W0WD 4Z7UE 4X7CC 1T66C 2ATPB 4FQXA 1PW3A 1NCAH 1SMAA 4XPFH 4R90H 4Y5XC 3VXMB 2BNRD 1JPFA 5FYJD 4CVXB 5FOJA 3IRPX 4ZXBA 4D0BA 4XC3H 1FZKB 3WSQL 1D5BA 2F53D 5EB9A 3C60D 3TZVB 5EOCJ 3QCTL 3BZ4A 3U0WH 4MJIA 3FO2A 3RZWA 5F9OL 3LPWA 4ZO6A 4ZSOA 5JIKA 1NCBH 3MNVB 2HYMA 4HKZB 2Y5TA 1BECA 2Z9TA 3ES6A 5E6IA 3I6KB 1QSZA 4O9HH 4KJQC 4OZFH 5HPMB 5H94B 4NZUH 4CJ0A 4NM8H 1BM3L 3NN8A 3TH4T 5FA4A 3B8SA 1DUYA 3H0TB 3ZO0A 2N7AA 4HKXB 4M3KB 2I07B 2C7UA 3TJEL 3O41B 5D1QD 5FM4A 2EH8L 5FHAH 4Y16C 2C1OA 3TO4D 1QHOA 1TCRA 3VWJD 3O3EB 3QEHA 2QQNL 3FOMB 4QRUB 1WWBX 5KSAC 1W72H 3GSOB 1WIOA 5F6IC 4DOHE 2UYLB 1R3HB 5J8OA 1T5XA 3EYFA 3I9GH 1YNLH 4YX2L 2LU7A 3EHBD 1X6LA 4N8CL 4QHKI 4XMKL 4PGEA 1EA9C 2HKHH 4A6YH 1LO5B 2D31B 3BGFC 1FFRA 1Q1JL 3P0YH 4HUKB 3O8XB 2WNGA 4PBWD 1TJIL 3RGVB 4MZ2A 4JEGB 1DBKL 2BOBA 1SYVA 1Q72H 4U6VL 2B4CC 5ADOL 4HIEB 4PJBE 3P30L 3RIFK 2QSQA 4O51B 2VDOH 2AQ3A 1CD1A 1S7RB 3F6LA 4HS8L 1LEKA 1HILB 2ADJB 3QIBA 1SMOA 3KPRE 4LGPB 3S98A 5HTSA 4HFWB 3D1MC 4MA8L 1KPUA 3GSRA 5KOVC 2ED9A 1GPOH 4OCXH 5T3ZL 4OFIA 1YZZA 3OBAA 1I8IA 3OPZL 1DQML 1SJHA 5EZJB 5HSFA 5E2TH 3TVMA 1EFQA 2GY7B 4PRNA 3VGEA 4S1SL 3S4SB 1TZGH 3WUWG 3QG7H 1CFQA 2ZG3A 2HTLD 1YUHA 1T83A 2YPVL 4GSDL 1OTTD 5EZLA 2IBZY 4WUKH 1RVFH 4OSUH 3BYTA 3KYOA 2GSGB 4O2FB 5E00B 4PJIA 2W60B 4R4BA 5F1IA 3QQ3A 2NY0C 2E3VA 3LIZL 4ZUWA 4L4VE 1HHIB 1EUUA 2D0FA 5DUPL 4ZODA 3GRWH 4PJAE 2IPTL 1C08B 4RBPH 1ZGLB 1M6OB 4M62L 4H1LA 4RGOL 1JGLH 3BHBA 4M6AA 1UGNA 4PFEA 3SE4A 4PUBL 4FNLL 1QFUL 1AXSB 4POUB 1EHLL 2ADIB 5JZ7C 1QBLL 2H26A 1DN0A 4X9BA 4KZDL 5AUMA 4UV7L 4OF5A 3O4OB 3LS4L 3HNSH 3NAAL 2EXWD 1FBIL 5BVJB 4GS7C 3T0EB 3BP6B 5DSCA 4HGKC 1REIA 5EDXA 3VRIA 2J4WH 1L9MA 5F9JB 1RJYA 5KZCB 2XTJE 5C0GA 3QWOA 4Z78B 3GJFB 1T1ZA 3WHE1 3VFWB 2G5BA 3U7WL 2LABA 3IRZA 3VFNA 1SY6H 2E8YA 2WLYA 1RFDH 4WUUB 5CD3B 3L5HA 3TNNB 2FEEI 1J10A 2X70B 2YUXA 4QTHB 4HIHA 1PQZB 5JHDE 4JRYE 2Z93A 5IEHA 5IW1B 4X7DC 4P9HL 4HXAH 3DX7B 2EDWA 3R0NA 2DF3A 1YY8A 5EU4B 2J1KA 4BQCA 3L3OB 4JZOA 2D4DA 4ZUVB 4GW1A 1A7BA 5ID1B 1UZ8B 5K93A 2VXQH 3HB3C 2K1MA 2JJTA 2JIXB 5JMRA 1NEZG 2AKRA 3LQMA 3PGCB 1F00I 2GJ6A 5F1NA 4HIXH 5I8EB 5D7IE 4Z76A 5T5FH 1IGFL 1PLGH 4Q74A 4G43A 2AI0H 3SKNA 4KVNL 1UZ6E 4WGVB 3G6JB 4YNYB 4JR9L 1CI5A 5D7KD 4H25B 5GS1B 3IDGB 5I0DA 1GZPB 5L2KB 4M6NL 2JELH 2FIKB 4C4KT 2AJSH 2FHFA 2R2EB 2VAAB 4PP2A 4PJ5A 3C8DA 1ZEAH 5E1HB 3LSOB 1KYOK 1MJUH 3U9UB 4U6TA 1R5IB 1C7SA 4S10A 1S7TA 3UPCA 1NH6A 4TSAL 1FAIL 3TBWB 1XEDA 1A7QH 3ECBB 2IPUK 5BV7B 1ITCA 5DHVA 3VXNA 1RZJH 4B50A 3DX6A 2KBGA 4Q6IB 3RZCB 2XN9A 4DKFH 5FV1L 1U91B 5ALBH 4W68A 4L1HA 1YN7B 4Q58C 4S2SA 1CLCA 2AJ3A 1EDQA 1YMMD 3VRJA 1D6VH 5JPMA 4JPVL 3B5TA 1BIHA 2UWEB 2OLDA 1S3KL 4L4JA 2AABH 2YBRB 1H3PL 3KDMB 3OL2A 3DXAA 3WHXB 2OMBA 4FHBD 2I25N 5ITBH 1NBVH 2HVKB 5TF1L 3U9PL 3HAEG 1XR9A 4LNRA 2DIBA 5EBWB 3HE6A 3VA2C 4ONHB 1INEL 3GNML 4OKDA 5AAMA 5KS9A 3FCTB 1GGCL 2VSCA 4PRIB 3QXAA 4JPKL 4XMPL 3U30C 1G7JB 4QTIH 2DLHA 5J3HC 1ZGLM 4F9PA 1DQJB 2LAGB 4RSVA 5FGBA 3DBXA 3EIFA 1MJ8H 3MODH 4IRJC 4NQTA 1YPZF 3I6LE 1EK3A 2PTVA 5I1AB 1JF1B 1U58B 2BRRH 3D0VA 2GFBA 5TQ2H 5E7FA 2BHYA 3O11B 5IJKA 1RMFH 3WJLC 1LNUA 3SY0B 3RKDD 4NO3A 5SX4I 4P2QA 1BVLB 1G9NC 2QSCL 3BYYA 4G8EB 3TBVA 4K3GA 5E4EB 1F3RB 3QDGE 5HGAB 1KXVC 3T0XA 4KQ3H 4OAWB 5IHZB 5DJCB 3TF7C 1KTLB 4FMKA 4JN2A 2Q76A 3UYPA 1FLRH 1FZMA 5I8OL 3AREB 3VXRE 1X5LA 5FA3B 4LVHB 5LKNA 1CD0A 4LSSL 5JXEA 1F4YL 1A6VL 1HKLL 1VPOL 3MRQB 4XVSH 1ZT4A 3DHMA 4O2EB 1V7NH 3C5JA 2H6PB 2EDTA 4DN4H 4LCWB 3GMNB 3WIIH 3QI9D 3HRPA 5J6GA 1MNUH 4MYWB 1HEZB 2EXYC 5T1MA 4PJGA 1T5WA 4PB0H 5CGYD 5D7LE 1AXTH 4POYA 3C9NB 4QRRB 4APQB 4MX7B 3IFLH 1KPRB 1UJTA 1GC1C 4G8GE 5EU3B 1O5DT 1PKQE 3A67L 2I60L 4YDIH 2JE8A 3SE3C 3GM8A 3I3EA 1WITA 3OKLB 5I15L 2NW3B 2FYYA 1IBGL 4FQLL 2FGZA 8FABA 3O45A 5A3ID 4P46D 1FNHA 2FHBA 4IDJH 4TSBL 3RX7A 4XAWL 1A2YA 3ARYA 2ZSWA 2YXFA 4PR5A 2QHRL 2VNCA 2A9ML 4G9FD 3F6IA 2Q1EA 4QO1A 1WISA 4Y1AA 5C1MB 2AK4E 4NO2B 4RBPK 1GRWA 1HHHB 3D87B 1RUKL 1PY4A 1J18A 2EE3A 3GBLA 1JWSB 4TPRL 4L8CB 3JWOL 4I77H 1TJHH 2NPLX 5KSBE 1TMCB 3L3GA 3IDYC 4L3EB 1WAAF 3FQTA 3C2AL 1DZBA 4RQQB 4LLVA 1QSEE 2FSEB 4XRCB 2C3VA 4NFDA 5ALCL 1FGVH 1TNNA 2NXYC 4FTVE 4GMSL 4M4RA 3FHAA 1MUJA 2IMMA 5FYKL 2NY2D 3GSXA 1I4FA 3HE7C 1V05A 3R1GH 4NNYB 5T3XH 3EO0B 4PJEA 4JY5L 4YE4H 2DQCH 3NZ8B 3EUUA 4K7FB 1JJUA 4YHML 4DZBA 1ES0A 2EIZA 1NJ9B 4OFKA 5HYJD 2CRYA 2X9YA 3CFBA 2P5ED 3QDAA 2OQJB 4GMTL 4WO4D 4LPYA 2F58H 5EU6B 1R0AL 2GTZB 4JO3L 5TFSL 5IR1A 2B8OT 5DD5H 2Z8WC 3HMXL 4K71C 4BFGA 3E3QC 4QRPA 3AAZB 1TJGH 1GVIA 3BD5A 1DLFH 2CK2A 4NQDA 5C0AB 2B4CH 3W9DB 2OJEA 3MRJB 5KVGH 1LE9A 2YS4A 5D7JA 2ENYA 5JTWA 3HR5B 1XF3A 1FN4B 4PREB 1I1AA 1G7IB 5HY9A 2BVPA 1NC4D 3MJ7B 3O4LB 1HWHB 2VXUH 4I18B 4E41B 4KK9D 5INDA 1EZVY 4M93B 3IFNL 3BH8B 1NGXB 4DFHA 1FRGH 5HYSA 2PXYC 4UU9B 1ZE3C 5CJQL 1DVFC 3PABB 2PTTB 3EYSH 4ZAKC 2DQFB 2BFVH 5I17B 1KJMA 3NFPB 1MELA 3BW9B 5FYLH 2ATKA 5TGBA 3CC5B 1T2JA 3HZYA 3A6BL 3AY4A 1WK0A 1N5YL 1S78C 5CWSB 4D9QD 4ODXB 5MERB 2WZPD 1ZHKA 2O5XH 1OAZH 5ICXA 1I1YA 5FUCE 3HG1D 5HGBA 3LN5B 4CU8A 1TENA 3FO9A 3FAXA 4H1LH 3ZDXF 3WBDA 4UIMB 3VXMA 3O2DH 3OKYA 4OLVH 3BZEA 3LOWA 4IMLA 5I30L 2G60L 1IC7H 4G6FB 5J11C 4WW2C 5I1IL 5GGRY 4P2RD 2OXGA 1MJ7L 5CEZH 3PP3H 4U1LA 5H37H 2AXGB 2HVJB 5IIEA 1I1CA 1QSVA 5F7HA 4HHAB 4P4KD 3CH1B 2N1KA 3AS1A 1IJ9A 4FQIL 3R4DA 1KCRH 3MLWH 1RAMA 1A3RL 1NL0L 4LPTA 2AV7B 4MJ4A 4V1DD 3QWRD 1V3MA 4TVSa 4MHHI 4U1GB 2CMRH 2R0LL 2Y4SA 1MREH 2ZUQB 5HHMD 1C7TA 1B2WH 5D1ZB 2WBJD 3FB5A 4WFFD 1ACYH 2R56H 1AQKL 3O41A 3N85H 4AH2B 2HFGH 2YSSB 1N0XL 1J8HB 1P84J 1TZIB 5CIPB 1LK2B 3UTSD 2XG4A 1IQWH 4HWBL 1VACB 5EORL 3GSOA 4K9EH 3KR3L 2UYLA 3A6CH 3DLQR 1WC7A 3VGBA 4MNQD 4Z7UA 1S9XB 4JHAH 2LTQB 4NOBA 2FWOB 3RI5K 4AEHL 2YMXL 2NXZD 1MRDL 2EZ0C 4HMCA 2V9TA 5B8CC 5I66A 2XXCB 5DJYB 2ZP0T 3EDDA 3CVHH 1JTOA 4X8XA 4S1QL 3QWQB 5JO5A 4NO0B 1MLCB 2L7JA 3VMOA 1FHGA 1YECH 4P0DA 5D72L 2VZSA 1A6WH 1JFQH 2F54A 4E5XA 3CSGA 4PRHB 3CX5K 1E27A 2HMIC 4NHCL 2ADJA 1IC5H 1C8PA 3V4VL 3DV6B 4LOUC 3HUJB 3IJSA 5EC1B 5FHBH 1WZMA 4ZNCD 1B0WA 5L0QB 1BBJB 5T1KB 4I8DA 4GAGH 3I6GB 4ZOBA 4OBRA 4C56B 1AJ7H 2DM2A 4KV5F 3QFJB 2AJVL 4M8VA 1MHHA 1ZHBB 3S4SA 3JTTA 5CINL 4Z0BL 3MV9D 3P9MA 5D9SA 5DI8A 2ZCLL 4OZGB 4ERSH 4DEPC 2YD3A 3BPOB 1UXSB 5FO8B 2GSGA 4O2FA 5E00A 4K2UH 3KYKH 5F3BA 1QYGL 3O3UN 3M1BA 2RIKA 2PR4H 4M7LT 2MKLC 4OGAC 1UYWL 1JUFA 1SYSB 3LKRB 3BKCH 1E4KC 4O4YH 4PV8A 5MP6H 4QF1B 3C6LC 2P8PB 1FNLA 1C08A 5F88B 5ITFB 1QP1A 1WCQA 2I9TA 1ZA3B 1D3CA 2EDKA 4Y2DC 1AXSA 2G2RA 5DUBB 1NFDF 1IC4H 3GBNL 4XI5D 4PJBA 3JZ7A 3WFHA 2W9EL 4YFLI 5TQ0H 1HHKA 5IG7B 4OKVA 3DGGB 2VMFA 3KPRA 1VDGA 1YEGH 4D8PB 5BRZB 1DSFL 3BP6A 3VFRB 5C0EA 1BD2B 1IGYB 3CVIL 3QRGH 2ZZUT 4LCUA 5F9JA 5C0FB 5EO1A 3GJFA 1FL5A 4EEEA 3MBEB 4ZS7H 2AJZB 5ACZB 1LDPL 2A6IA 3MR9A 3CFDB 4LSTL 5C0BB 3TNNA 3BKML 1DJSA 1CGTA 4HC1A 4QTHA 3HI5H 4Q9BA 5FYJL 1KG0A 1NLBL 3SQOH 2PKDA 5EOQL 3MO1B 3ROOA 3OV6A 5EU4A 1CLZL 1EFXB 3EJZD 5I18L 2DQUL 1VADB 4ZUVA 4GRWB 3WLBB 4YHYB 2IAMC 4NUJB 2JIXA 3MGTB 4DJMA 5C09E 3BZFB 2GITB 3UTPE 3BE1L 1MWAA 3BZDA 3PL6A 3RVTD 5C0JA 3LQAC 1K6QH 2DYPD 4NKOB 3X14B 1EIBA 5DK0A 4HZLB 3H9YA 4P5TD 1BJ1H 1KB5H 4HQQL 4PJAA 5I8EA 4X9HA 5EC2B 4KPHL 5JLZB 3HPJB 3MCKA 3D85B 3MPCA 2EH7H 4EDXB 5TE4L 4ELME 2JB5L 5IW6B 4ACPA 2GSIA 5I1HH 4MJ5A 1WCBA 1N2RA 2CDGA 2UVFA 2LU4A 4J3OC 4YNYA 5LGHH 1IC1A 2OL3B 3TJHC 4HWEL 2XY2A 1WFNA 2AERT 3VFOA 2QEJA 3ESUF 5C0NC 2HT4D 1XF1A 4G8FA 5DD3H 3SN6N 4R0LC 2OM5A 3MA9H 5DMIH 1DBMH 5AEAA 1KIQA 4MJID 3V6OA 1YQVL 4FP8H 1Y6KR 4IMKA 1HSAB 5E6ID 3L95A 4HWZA 3PP4L 1T20B 1A7OH 3ECBA 4AEFA 2ZPKL 2Y7QB 1RZGA 1AGEA 2R15A 3KG5A 2PO6B 4H88L 4Q6IA 1OGAD 3MRIA 4WU7B 4LLUB 4BH7A 4Z95H 4FQQB 4LKCB 5A2JH 3KYMA 1ZTXH 3OAUL 3PP3K 4J6RL 2AEWA 5DRNB 3MXWL 4F9LA 1TVDA 3HNTL 4WI2A 4LEOA 3TO2B 5CJOH 1DBJH 2AJUL 2X89A 4M7KH 4YXLL 3LV3A 4ZNEA 4C58B 4ZUSB 2IGFL 5ENWA 2OSLA 4GBXA 3GMMA 3ARBC 1LD9B 4M1DH 4HUVB 5D7IA 3IXAB 3Q6GL 3MRLB 3RL1A 5F9WC 5EO9A 1XGPA 1CLYH 5E5UB 3DRQB 3QHTC 4OLXL 5T3XD 4XBEH 4U05A 3ZE2E 1K2DA 1Q94B 4J3UA 1HHGA 1EMTL 5J1AB 1YEKL 5CGMA 3MFGB 3SPVB 3X11B 4ZFFB 1KT2B 1F58H 2ZG2A 4HK0B 2F15A 3TIEB 4PJFF 1H0DB 3T65B 4CN4A 3IFOA 1PZUB 4I3GA 5DD6A 4KY1L 3KS0H 4OCNC 1J0KA 1QPXA 4POZC 3RNQB 5I1AA 1JF1A 1O0VA 4H8WH 4HKJB 1ADQH 5I1LB 1JGVL 4I0PB 1YJDC 1G9ML 3L3IB 3QIBD 4FN0A 3QIUC 3SY0A 3SCMC 2GAZB 4OLYH 1XZ0B 4OCLC 2VDMH 1BVLA 2Z0BA 1E0OB 3KPSB 3TA3D 2V5MA 4N9OB 4LIQL 2OTUB 5HGAA 4WEMB 2I5YH 3Q3GB 4OLUH 3GDBA 5D1XA 3EO1A 4LPUA 3NTCL 5HI4D 1Y6NR 5EZIH 1DQDH 5I71C 3WFEH 2APFA 3RJDA 5FA3A 4GG6B 1F4XH 4JFEB 4RAUB 4HUXB 4QT5B 4LSPH 1BIIB 4NT6B 4RAVB 3SDDB 1CU4L 5DT1H 4J1UB 4YBHA 3SDAB 3SOBH 3V0VB 3NMEA 1FC1A 5B39A 3HS0B 3L3DA 5DZNA 5FYLD 2J8OA 4YAQA 3EDJA 4PJCF 1B6DA 2AAVA 4ZYKB 1FC2D 1NMAL 5ISZD 3C9NA 1IAII 4FQ2H 4G6KH 1I9JH 4MAYB 4MX7A 4APQA 2P49B 1RZ8B 1U92B 4BH8A 3DO3A 4G7YL 4LQFH 1EJOH 4OLZL 3MV01 3BX7C 5BW7C 2NY0D 1R24B 2DWEA 3K1DA 5LBSL 3BRDA 4YHIB 5E03A 3OB0H 5DJ8A 4Z7VA 3E6HA 1C1EL 4F37K 4PRAB 1X5YA 3TN0A 2UY6A 1O7SA 1T89C 1LO2H 1FCCA 5E5RB 3L7EA 4ETQB 1SBSL 4K3DL 4PG2A 3OKDA 4JFYB 4UT9H 1T03H 1UA6L 5CSBA 4QHUB 1R3IH 3MUGA 3H9HB 1KN2L 4MXWH 3B2VH 2ICES 2LFGA 3QO0B 5BJTA 5CEZD 3G5YB 1S7VA 4CRPA 3QDGA 3IJHB 3S34H 1DBBL 2VITB 3I2CL 4ZD3H 2E8ZA 4S1RL 4BQ8A 3W5MA 4LCCB 3MLVL 4FZ8H 2YPKA 1BZQK 4Y5YC 4OZHF 2JCCA 4OI7A 1UACH 1WSST 1I85A 3D9AL 4GG8A 4M5YL 4L8CA 7CGTA 1CQYA 2ZOLA 2PW2A 1B4RA 1CGSH 2E7MA 4EOWL 2KPNA 5J6HB 2Q8BH 1MRCL 5EZOL 4RQQA 4XNYL 4DW2L 2FSEA 1UM4L 3CU7A 3VW3H 5C08A 1EAJA 3CXDH 4PJXF 2HN7A 1YN6B 3CFKA 1AXIB 1R3KA 3NCFB 1IILE 1YEIL 5D7LA 1F2XK 2DKSA 3C09B 4NNYA 1GGTA 4GQ9H 3FQUA 4ZDHB 4PBXA 4HSQA 1MFEL 1WEJL 4I3RL 4M7LH 2YK1H 1PKQA 1U95B 4QRTB 2CR3A 3O9WC 3O2VH 1YEHL 5EWIL 1N3NB 2R29L 3HB3D 4JCMA 3S35X 2IPKB 2DJ4A 3VMNA 3GI9L 1NUGA 1SJEB 4MVBC 1XH3B 3BP5B 2GTZA 4Z7OF 5I8CA 4NJ9L 5IVXB 2WQ8A 4J4PA 1MI5E 3FJTA 4XNXL 5IFHH 2DQGH 3AAZA 3OKNB 1RU9H 4H20L 1WWWX 5DEGB 1NCWH 3LH2L 3RWIA 3WS6C 3MLZH 3MRJA 4R2GB 4QXTA 3VWKA 5I75C 3GBML 5F21B 5JQ6L 1QFWM 1A3LH 4MD4B 1U8QB 1IAOB 4RGND 3TEUA 3W81A 1GGUA 2YD8A 1KOAA 4I2XE 4E41A 3UPAA 4XP1L 3WL9B 3CJJA 1ORSA 1QSEA 2PTTA 5IFAL 3BPCB 4I5BB 1OGTA 2B5IC 4FTVA 1CTOA 2GW5A 4WJ5B 3PWLA 3H9SD 1B9ZA 3BW9A 4AEIH 4MWFA 4S11A 2W65A 1KJVB 2J6EL 2D7TL 1LO0H 3STZB 1A5FL 2NNAB 2GT9B 2YD2A 3DXAD 5CWSA 4LF3A 1KIRB 1W0WA 2PW1B 5IT2L 2IQAA 5IV2B 5JHLH 4U1MA 2M2DA 4BZ2L 1JZ7A 4M4PA 2EDNA 3N1MC 3HE6D 1LQSR 4P2CG 5CHNA 4BKLB 5F3HA 2JJVA 35C8L 5GRUL 1RZKH 2EC9T 5ABDE 3QXTA 5I74C 4J3XA 2XZQL 5EO0B 4UIMA 1JV5B 4HF5H 1T4KA 3NCJH 3EOTH 4OGXL 1MRFL 3IJYA 4K7PH 5E2JA 3KJ4C 2VXVH 3MV8E 5DHXB 3D39B 2ADGA 3E8UH 4HH8A 3BPNB 2IQ9H 4FFZL 3FRUB 5CSZA 4U2ZA 3FO0H 4JDZA 1KB9K 3U82B 4HHAA 2R39A 2JJSC 4YWGH 5J3HD 3FT2A 5HDBF 3EFFB 5E08H 3V4PL 4DK3A 4P3DB 4L3AA 1FL6B 2Q87A 5FECB 1UCBL 3MFFA 4L9LB 5TDOB 1T04B 4YJZL 4IRJD 4PRBB 5JW5B 2VR9A 2FJGA 4WI8A 3LEYL 1T0MB 1SJXA 3HNVL 1H9VA 2GY5A 2HRPH 2EYTB 3ZTJG 2MNUA 4WFHE 3BQUA 3O0RL 4OM1L 5FOBA 5C8JB 4PY8J 4PJ8C 2YSSA 1BQHG 4Z7WF 3P77B 4MA7H 5JXED 1KEMH 1JBJA 3T0EE 3GMQB 5CIPA 1MCCA 2FDBP 5MENE 1IM3B 3ARGD 5DO2D 1OVZA 3S5LG 1CXIA 5ID0B 3UTTA 3LS5H 4OFDA 5EUOF 2ERJC 3SGEI 1EEYA 3PDDA 1P7QB 1J5OH 3O6KL 4FZEH 5C07B 3AU1A 4NCC2 3G6DH 4I48B 2CKBL 4OIAA 4Y4HC 1NCBL 1QQDB 3JXAA 1J1OH 1XF5B 4LRNH 2A77L 3AGVA 4DVBA 3DV4B 2W0PA 4O9HL 1AHWC 4KK6C 3C6SB 3IETA 3OXRA 2NY6C 4TOYL 2FGWL 5D2LF 5GJTH 5ILTL 1MLCA 1GZQB 2CLVB 4GRLB 3S35L 4P3CL 4Z18A 4ZFOL 2OJZH 2Y6SC 3N50A 1VKXA 5GZOC 5EBMA 5CEYB 1A4JA 4Y19D 3LKSB 4WI4A 2ZG1A 4MLSA 3FFCB 4PRHA 3X13B 4IHOB 1PYWA 1K8IA 4JFQA 4Y1AD 4NNXB 3CMGA 3UJIH 5C0CE 1NMBH 1INDH 3HUJA 3MTRA 2CIIA 4XTRC 3ARUA 4OD2B 1MCQA 3C2SA 1JHTB 3G6JE 1F4AA 5T1LB 1X5IA 3QEQB 4YDKH 1FZJB 3JWDC 4QRSB 4XXCA 5E2WH 2VZVA 1KGCE 3I9GL 5L2KE 3QFJA 4JVUA 3LRSA 4NJAH 4JM2A 4BFIB 4JQXA 2CXKA 2WP3O 1B0GA 2GCYA 2VQUA 4DGYL 1P4LA 3QCVL 4YBLB 3SE9L 1W8OA 4N0UB 4X6CB 2EDRA 3P0YL 3RWCA 2CGRH 1XF2B 1A9EB 2CPCA 1CGVA 4RFOH 1UXSA 3RIAK 4KVCH 1DEEB 1Q72L 4K8RL 4LAQH 1CD8A 3EDEA 5J7CC 3VI4E 5TH2B 3VFVA 4PTTB 3MSPA 4X4XB 4X4YB 2QQKH 3FMGH 1H5BB 5BS0B 2O26U 3HCVB 2I26N 4NRZA 4Y8AA 1SYSA 4KK8C 5KW9H 3DUUA 4PJ7F 4QF1A 5DUML 1CDIA 3HE7D 4ODWB 2DWDB 5F88A 2N4IA 5GJSH 4QOKE 4GXVH 1KSRA 4OCXL 5EA0H 3ZZ1A 3QUML 3O6LL 4OGZA 4QRPD 3O81A 4NQCD 5CP7B 3P4OB 1CD9B 4UBDC 2VE6B 3MXVH 4NQDD 4OUUA 4D8PA 4CUCA 3VFRA 3LQAL 1IGYA 4UQ2A 4DQOH 1HQRA 3QG7L 4OM0H 1TQCB 3FFDB 2R2BB 5D7JD 1MPAH 1J1PH 1U8PB 4OSUL 2C5DC 4F37F 1YJDH 1JHLL 5ACZA 1I1AD 3B2UD 4KKAD 1P6AB 1OF2A 3DVIA 4E42B 3LMJH 2YPLE 1AFVH 1XIWB 4DN3H 2VDQL 3FB6A 3GRWL 5BZWB 3QULB 1S7SB 2HT3C 3TC9A 1T6VN 4NQEB 2YZ8A 4GXUM 3REVB 3CK0L 1JGLL 2VWEE 4Y4FB 2DTSA 1R5WB 4NC1E 1TPXC 1V7MH 3BZFA 3CLEL 1DVFD 3I02A 4ZAKD 2VABB 3X14A 2BNRB 3S4SG 1XGRB 1YC7A 2J4WL 3LD8C 5IMMB 2EDEA 4EDXA 3PWNB 1S78D 3C60B 4L3CA 3FQXB 3W11D 5JW4N 2OL3A 4YHOH 1OAYL 4OLWH 1OAXL 5IJVB 2FEEL 3EKCA 2OK0H 4NKDA 3EW3B 5J56B 2XA8L 1DQLL 2WWKO 3WN5C 1Z0NA 5ESVA 5IMOB 1MJJA 4HXAL 1D9KC 1G6RA 4WI7A 2FX9H 3CDYA 2VQ1A 3WO3B 4X6DF 3V52L 5F71A 3S97C 1U2CA 3X12A 4QRRE 3GMLB 3WKML 4IIQB 1CFBA 3OR6B 2PO6A 1QBML 1Z2KA 5CUSL 1WZ1L 4X5XA 4Q97A 3OKOB 4X4ME 5DEZA 5D1QB 4LLUA 4HIXL 1TLKA 3TO4B 3D3VA 4LKCA 3KNBA 4YHLL 5I73C 1NGQH 4LMQI 4HG4J 4F7PB 3VWJB 2X7LB 1JRHH 5E94B 2P8MB 4G42A 5INCB 4Q7DA 1JRHI 2AI0L 5EU7E 4ZQKA 3FB7B 4X98A 5GGRA 5AYUL 3O3DA 3J7HA 3TWCH 3FT4A 3SGKA 3X3GH 1WBXB 3UYRH 3ARDB 1FNSH 5E9DE 3MRLA 4OJFL 1ZEAL 1MJUL 4RFNB 1QZ1A 4J3VA 1UWEL 5EU5A 5J1AA 1NDGB 4D94A 4YDVB 2R8SL 5EPMB 4L3EE 3V5KA 1A7QL 1KXQE 3MRBA 4WTZG 1RUAH 1XGYL 3T77A 4UNVA 4OCYH 4MQXD 3TIEA 2WMPA 4NQXB 1M7DA 3CFCH 3GMRB 3HMWL 3O6ML 5BXFA 5JDSB 4YGVB 1Z9OA 5CLTA 3RNQA 3KJ6L 3H2WA 1C5CH 4CBPA 5I1LA 2FR4B 5E7BA 1D6VL 5KSVA 1KCUL 4YIQA 2VN4A 5GRZA 4M6MH 1XZ0A 2BDNL 1SM3L 1TZHB 5JUEH 4GW4B 5A43C 1UC6A 1I8LC 2MQCA 3DUSB 3Q3GA 1YPZB 4NQUA 1U8IA 5DJ6A 5KJRH 3RBSA 2E9IA 3QQ4A 4OQTL 5IHUH 4RNRB 5CJXC 2PYEA 4WCYH 4JFEA 4HGWB 3ZKMC 1BIIA 4NT6A 1YNKH 4RAVA 3SDAA 3K8LA 2RCSL 1RHHB 1HIML 4ZO9A 1AR2A 15C8L 1HZHL 2WINB 2R23A 5HI3D 5BZDB 1MCPH 1FDLL 3ZHDA 4ONFH 4BQ9A 1HQ4A 2ZCKH 5TQ2L 3SDCC 1RZ8A 5JOEA 1IVLA 1N7ML 1WAAE 2V7HA 3L3JA 1KCSH 2D9CA 5EN2A 2ZUSA 4MGXA 4R26H 1QLRB 5MI0B 4YBQC 1J87A 1XF4B 2XFXA 3IDJA 5HGGS 1JGDB 1K8DB 3BO8B 3LRHA 2VDLH 1N59A 1WT5A 3QT2A 3QH3B 1A6PA 2XWTB 2HJFB 3C6LD 3NPSB 4NN5C 5F1SA 1RZ7L 1FLRL 3KPRD 3K4DA 3DOSA 3WDHA 5HVHB 3HPLB 4Y4KA 4Y2DD 4NM4H 3GSWA 1IM9D 4X6BB 4LVOC 4HD9A 3Q5TA 3SKJL 4XVSL 3KLAB 2UV3A 5LQBH 2QADC 3VXUE 1V7NL 2VITA 3NPZB 5H2BA 2XWBA 5FUOH 3DO7B 2Q7NA 3L7FB 4N1EA 2J8UF 1H3GA 4LCCA 4J12A 1E4WH 3G04B 1NBYB 2UVEA 5HHQB 3T4YB 5MHSE 4G80B 2DLGA 2EYRB 2ITDA 4PB0L 1CVSC 3DROB 4U6XB 1N0LA 3IFLL 4OBSA 2KQNA 5C0DB 2V2WA 1JWUA 1HYRC 1VGEH 3P9LB 4FQCL 4H0IA 3GKWL 4ODTH 1EXUA 5I0ZA 4S0SD 1EBAA 2L4OA 2V5TA 1NSNH 5L7XH 2CRMA 4Z7NF 4ENED 4IDJL 3S3PA 4L4VD 3PL6D 1L7IL 4TNWF 3G6AB 5DQDL 1U95A 4HAGA 4UILH 2IAMD 4WW2F 4XPBH 3KPPA 4HV8A 5C3TA 3QUXA 2PNDA 4EDWL 5KVMC 4P2OD 3BP5A 1UB6A 3NZHH 5AZ2L 4MAUH 1JGUL 3VFGH 1F4HA 3ZTNL 5DMGD 4HH9A 4RIRA 4G6JH 3D18B 1E28B 5KN5B 1TJHL 1ETZB 1AQDA 4XNMB 2L0DA 3TZVC 5HYEA 3TJHD 3K74B 5HHVH 2XTJD 5IQ7H 4NGHL 1ZHNB 4UI2A 5IBTH 3LQZB 4NN6B 2WUBH 3CLFH 5I76B 3ZDXE 3ALWA 1FGVL 2AEQL 4MD0A 4UNTA 3ZYOA 4XXDA 5IF0B 1S9VA 5DD0L 2YC1B 2Z91A 4Q2ZB 1IAOA 5EFIB 5FO9A 1WTLA 4MLIA 5JHDD 4JRYD 4BELD 2VTFA 2FLBT 4WFEE 5DDHA 4GRMB 4X80H 1YMMB 2D03H 2H2PD 3QJFA 1YYMH 3IDXL 4CADB 1JK8B 3BPCA 3JWDH 1F13A 5HYQA 3MCLH 1UKSA 5L6YL 1F6FB 1D5IL 3U6RB 1YDPB 1NANH 4KI5C 4XPHL 4L8BA 3JUZA 1KJVA 5IWLC 5F44A 3STZA 4ESKA 4RZCB 3BN9C 3SJVA 2E7LA 1U3YA 1KIRA 4UQ3B 5DFWH 1UM6L 2V9RA 4H5SA 5JIIA 2ADFL 3QHFL 1CQKA 5IV2A 4ZOAA 1UCTA 5DQ9B 4HUMB 3RFZC 2HRLA 4MD5A 1KUMA 1DLFL 3QXUA 4PJHB 1CIUA 4BKLA 4XBGA 1KACB 2ARWA 4M8QB 4ZUTB 4M7ZB 1CT8A 4GUPB 3ARBD 4PS4H 2COQA 5FAAA 4GKOA 4Q9RL 5C0IB 1DQTA 1MI5A 2XY1A 1I9RH 1T7ZA 4KXZH 5DVMA 5IGXH 1MCEA 2Z8SA 4ZUUB 1RY7B 4LCIH 4KXZI 4XB7A 3F12B 4FFVD 4OZGE 4P48A 1KJ2B 3LVEA 3O8XC 3RGVC 5T3ZE 1DE4B 2X4PB 4PRPB 2E6PA 3AB0B 3FRUA 2GJZB 3KWWB 2GUOB 5FCUH 2FEDC 1CFNB 5DA0B 4P3DA 1A0QL 4WV1B 1FL6A 1FYTE 1PZ5B 5I19L 3FO1B 4I2XA 4L9LA 5JW5A 1JTTA 4EN3C 5J13B 1A7PL 1OHQA 4POZD 2O5XL 1FO0B 2DD8L 3KHOA 1V3KA 3KYAA 3GO1H 1HKFA 5D1XD 2MCPH 2HKFH 5GGVY 2BSTA 2CD0A 3MLXL 1QUNA 1CG9B 2BXYA 3JV6A 5C8JA 2QQLH 2YR3A 4YUEH 4KTEH 1ZLSH 5ADPL 3QI9B 2DDQH 3T2NH 1I7UB 4KU1A 3PQYE 5IFJA 3VGGA 1P4IL 4KH2A 1BD2E 2CLZA 1MVUA 3E6FA 4U1JA 5HHPB 4X5WB 3VFUA 5ID0A 3W9EA 4NSKA 2APVA 2F8OA 1N5AA 1B4JH 5LAXA 5CEZL 1MIMH 3LKOB 4QRQB 3ULVC 4KKBC 4KV5E 2VUYA 3MJ9H 1NFIA 5GS0C 1CXHA 3C6SA 3MROB 4QYOB 2KUTA 3PV6A 4XHQA 4EZMA 1GGIH 3SBWA 4P46B 3PE9A 2HFTA 2LAAA 3MV8A 1Q0YL 3TN0D 1RIVH 2OR7A 4GRWE 3ZSSA 4DKEH 4GRLA 1VERA 4YC2B 3I6LD 1G6RH 1MREL 4G9FB 4AM0B 1NGZB 1F4WL 1B2WL 1AP2B 1PG7H 3X13A 4NZRL 5ERWA 5F7FA 1Q9OB 2CKNA 2DB8A 4NNXA 4LHQB 3RVVD 3ZDZF 2FATL 4OZFB 3QDGD 2X4QA 3NFSH 1OAQH 4HCRH 3T0EC 4K3JH 2NY3D 4K9EL 3QXDB 1OTUC 2ORBH 1JHTA 1J8KA 1NFDE 1H8NA 4UTBL 4YLQT 2DLEA 1I7RB 3CCHA 3VXRD 4OCWL 1XMWA 4NQVB 1JPGB 1GHFH 3RPIB 1NCCH 3CX2A 2NY1D 3VXPB 3W39A 2NY2B 5MENA 1T22B 2W59A 1CK0L 3N1GC 1W72B 5IB5B 1EO8H 5C2UB 1YECL 1F6AB 4UINL 5I2IA 4OGYL 2AJYH 2FX8H 4QXUL 5D7LD 1J86A 1A6WL 5HYJB 2R69L 4P57A 4PTTA 3NACH 3UX9B 4X4YA 2P5EB 4GAJH 4WO4B 3L1OL 4O58H 4G8GD 5LG1A 1B88A 4LLWB 4OUOA 2DQJL 5D2NB 4A6YB 2OX5A 1JZ5A 3VD5A 1KIUA 3TNMB 3GSUB 2Y36H 4YHPA 1EPFA 3EOAB 2AQ1A 1YEEH 1CGYA 4J4PD 3RUGB 5A2KH 1P5UA 2EC9U 3P11H 4U6HB 3DVGB 5E8DL 5AG8A 2M1KA 1AJ7L 1MFCH 5GS1C 1GOFA 3D69B 3RU8H 4WTXA 5JORA 5C0CA 2AK4D 5LWYL 4XP9L 2VXTH 1F45A 1IEBB 1TFHA 5EG6C 3WJJC 1T1WA 1KBGL 3VWKD 1NC4B 3BJLA 2IANE 5HD8D 5KSUA 4IRSA 3DSFH 5DLMH 3KYKL 1V5JA 4RDQG 3KAAA 4HUWB 3SDXF 5BV7C 2BOCB 1FL3B 2IFGA 2OTPA 1UZ6F 2PR4L 3IVKA 5GSVA 1A4KB 2EIDA 2UZIL 5IROA 3KVQA 3WO4B 1QSED 3E2HB 1S9WA 2DQDH 3RZCC 3QULA 1S7SA 4FTVD 1UH3A 4NQEA 3REVA 1S5IL 1IAKA 3LKQA 2Y25A 3GIZH 3PIQB 3ROLB 4A2MA 4P23A 4KQ4H 3P0GB 1R5WA 1D5MB 1UFUA 1U2HA 5DJXB 3MV7E 4O2CB 3W0WA 4DUXA 3HFMH 1IGJA 5K9QG 2HJLB 2R1WA 3VG0H 5IB1B 2HT2D 3K0WA 3BIBX 1BJ8A 3BEVB 1FCGA 5EOCL 1HE7A 2F53A 2SEBB 3C60A 1QD0A 2CDFB 4Y5VB 3V5DB 3OKEB 4IOIB 4FABL 2VL5B 1L6XA 5IJVA 4Y0GA 4ZS7L 4JZJC 3G08B 3RWHB 4W81A 4P4KB 5LVEA 2CO6B 2WIMA 4N5UA 3GSVA 2C3HA 3QQNA 4XCEB 3WS3B 2FJHB 1OOAA 2GKIA 1URLA 1NAKL 5IB4A 2F5BH 3DX9A 4CJ1A 1PAMA 3GMLA 2X4TB 5HHMB 1G7HB 5GHWH 3WD5H 3QO1A 2WBJB 3RDTA 3OKOA 5FUZL 1IKNC 4PJFE 4JPWL 3MGAA 5IM7A 2YD4A 1M05B 4XNZB 3U4EA 1KYOJ 1TCMA 4F7PA 2X7LA 5E94A 3UTSB 2XWJA 3K8MA 3IU4L 3PWJB 5HHXL 3I75B 3MJ8B 1SEQH 1ZS8B 3KPMA 3AREC 3IDMB 4MNQB 2IH1B 1KV3A 5DR5H 4L8SB 5AAWA 2YD1A 2NY7H 3LB6C 2J2ZA 2NXZB 1WBXA 4CMHB 4MSWA 1GSMA 5DMIL 4PJ8D 1CL7H 1ZANH 1IGTB 2OP4L 5L88H 4D0DA 1VFBA 4MNGB 1JPSL 1T3FB 4FQJH 1QRNB 1ORQA 1FFNA 2H2SD 1P2CB 1BP3B 1A7OL 4JM4L 2ITCA 4APQC 3OJDB 3MRHA 1RIHL 2BVQB 5GGUA 2KL6A 3ZYIA 3WFBH 5JXAL 4GKZA 2HWZH 2EICA 2XI9A 1QEWA 4Y4HD 4NQXA 4D0CB 4Z95L 4XVUD 2XACC 3S8WA 5JDSA 1ZTXL 5DS8B 4G7VH 4KAQH 4KK6D 4PJCE 4YGVA 1YYLL 4XCFH 2NY6D 1OAUL 1ZWIB 3VE0B 2EDBA 2EE9A 5K9JH 2FR4A 1DBJL 4M7KL 3RY6C 1S7WB 1Y0LA 5EU7C 1RV6X 3PXJA 2VYRE 3LEXB 4QHMA 2Z35B 1TZHA 3HZMB 4X4MA 5GZOD 1U8NB 2DN7A 2H1PL 1OP5H 2OR9L 3CGTA 1FIEA 2NTFA 4LAJH 3BRGC 2E6QA 5FYKE 4PGZA 5J1TC 1YPZA 5IVXE 3MV9B 3S36H 3EYVB 5CZVL 4JM2D 2DL2A 3VFTA 1CDHA 4QHKJ 4XTRD 4XZUA 4LSUH 2YEZB 4EI5A 3FQNA 4YHNB 1F58L 4NPYB 1LEGB 1OY3B 1CXKA 3MLSH 5K59F 2G9HB 4MXQD 2OBGA 2FX7H 2DTML 3LN9A 1I1FB 1YEJH 4HW6A 1W0VB 1MHEB 2AV1A 4NZDA 4JLRA 1CBVL 4OZHE 1CLOL 5DD1L 3OF6D 3QA3B 4H8WL 32C2A 2C3XA 2RFXB 2VLRE 1K4DA 2DJSA 1QLRA 1UXWA 4OLYL 1G7PA 4EQ2A 5B38B 3OG4B 1KENH 4JG1H 2A6KB 4PJXE 2I5YL 3GI8H 4KK8D 2NY5C 3ME0A 1A6UL 4BZYA 4PPTA 1DQDL 3RP1A 2H3NA 5ANMA 2JB6B 5DTFB 2BVYA 1FIGH 3L6FA 4X6BA 5K9KA 4DUVA 1INQB 3N1QC 3FONB 3ZHKA 4LU5H 3KLAA 4P59H 3SE8H 1X5GA 5F7EL 3DX8B 1AGBB 1OSPL 3SOBL 1G1CA 3BH9A 5GGSY 3TPUA 4UBDD 4Z7OE 1GXEA 4KUCD 5KVFH 3RAJH 3K3QA 4OZ4B 3LEVH 1IAIL 1EJ6A 2LQRA 2EYRA 2APXA 5CFHA 2BNUA 4HGMA 1G7QA 4F7CB 1CDUA 3DROA 3OHXB 4FQ2L 4IEFB 1I9JL 2YD5A 4BJLA 3RWJB 1YNTB 1R3LB 1B0RA 2I27N 4HIJB 3F65A 4I18C 1F5WA 4K7PX 3EZJB 4WHYG 1PSKH 1S7QB 3CXHK 4LASH 3AMKA 2DYPB 2EKJA 3TIDA 1KLGA 4P5TB 4L8DB 4HXBH 3UZQA 3NH7H 1EAPB 5GZNC 3DMMC 3MJGX 5DVKA 4KK5C 4LFHG 4UT9L 1JYXA 1FPTH 1JL8A 4CAGA 3QEGL 3B4NA 3B2VL 4D0BB 3WXWH 2QL1A 1D5BB 3CMOL 5CBEA 3S34L 5IEKA 2XPGA 1HDMA 4ELKA 3BZ4B 4MJIB 2AGJH 1C5BL 1KEGH 1MCOL 5IUSA 4FZ8L 5GS0H 1X6NA 4ZSOB 4YXKL 4KC3B 2DLTA 1U3ZA 2WIIA 3PNWB 3B83A 1FNAA 5A2IH 5KN5A 3ES6B 1FP5A 5E6IB 1CGSL 5C9JA 3VXUA 5C07E 4QHLA 4B41A 3LQZA 4EUPH 2DQHH 3ARQA 5I76A 3U2SB 2C3WA 2IFFH 3NN8B 3VW3L 1OGAB 1CIDA 4U7SA 3OAZH 3V7AE 3BFOA 5FA4B 1DUYB 1TTFA 1BJMA 2YC1A 4Q2ZA 3M17A 3MYZA 1PJ9A 4QY8A 1OM3H 2A9NL 4NN7B 4XPGL 3WFZA 1X9QA 2C7UB 1RZFH 4KJYA 3I84A 4GRMA 1NCDH 3ARXA 2C1OB 2YK1L 1YMMA 3EJYC 4U6YB 3GSNH 3ARFA 3QJHA 2DMCA 3U7YL 4CADA 1JK8A 3QEHB 1DFBH 4U1GC 5DVOA 3U46A 5DQJA 4JQVA 5D1ZC 5C09D 2VLME 4EJ1C 2R0KL 2Z8VC 1T5XB 3UTPD 3L5XH 4HJJL 4XPTH 3KHQA 1HSBA 3AS2A 4UQ3A 2DQGL 4LHUA 5TPWH 3Q1SL 4AG4H 4PGEB 3ARZA 4N0CC 3VGAB 3JVGC 2D3VA 3OSKA 4ZUTA 1IAMA 4GUPA 4HLZG 4HBQA 5I8KH 2LTQC 2Z4QA 3EBAA 2BOBB 4Z7WE 3NCYP 2VH5H 1MF2H 5C0IA 3VXTA 3ALXA 1Q9LA 3CDFA 4G3YH 1KLUA 5FKPA 1Y6MR 5MEQA 1QNZL 1KJ2A 3QIBB 4EIZC 3WFDH 4JKPH 1BEYL 2X6MA 3DGCR 4HJ0C 2GJZA 3BRFA 2BVOA 1OCWL 4I9WE 5BS0E 2QR0B 3TA3B 4LLMA 4XMLH 3UTZA 3ULVL 1UENA 1YA5A 4TUOA 3VCLA 3GMPB 4XP6H 5D2LE 1I8IB 3SKOA 5EIVA 4XNUH 1BF8A 1FO0A 4PRNB 2BZDA 2ICWB 4C54A 1CXFA 1CFQB 1FSKB 2BMKA 5DJDB 4DTGH 1C16B 1MFDH 1SBBA 1YUHB 2V2XA 2MQ3A 5L0QC 1SQ2N 3REWA 4AQOA 1CG9A 2E5EA 5E8PA 1MIEL 4PJIB 4R4BB 1DANT 4HF5L 3QQ3B 5F1IB 3U48A 1BBDH 4N0YH 3QHZH 3EOTL 4U7KA 5ISZB 4X5WA 2EECA 1OP5K 4JO1L 4GLRH 4BZ1H 1UM5H 4KRLB 4GLRI 3BPOC 4OFPA 3ZKMD 4G6AC 2B7DT 4H1LB 1CF8L 5IHLB 2VLKE 1G7LA 4YWGL 4TSCH 4OF3A 2P8LA 2Z31A 5AZEL 4WHCA 3O2WH 3WIHA 4PIRF 4P46A 4ZTOH 1DN0B 3C5ZC 3K81A 4JDTL 4HC1L 2BC4A 3SDCD 5DSCB 5F93C 3VRIB 1NGZA 2VDRL 4TYUA 3BKYH 4YBQD 1PEWA 3QWOB 1T1ZB 4Y4KD 2P24A 1FYTA 1RULH 2G5BB 1CDBA 2Y07L 4MA7L 3MLRH 3VFNB 1KEML 4UDUA 1H3UA 1KTDA 4GS7B 4PJ7E 2B1HH 2ZKHH 1MWAL 2WSKA 4N9GB 3QXDA 1M4KA 4BUHA 4RMVA 3MBXH 2Z93B 3RQ3A 5IEHB 2RJMA 3F58L 4FZEL 1EO7A 4KKNA 3G6DL 1Z9SA 4NQVA 4JZOB 3MBEC 3QIWC 4XX1E 3RPIA 1WVZA 3RTQA 4TRPH 5K9OA 2QADD 3CX5J 2H32A 3ET9F 2B1AH 3PQYA 4CNIA 2IBZX 5E2UH 4JHWH 2R9HC 4FG6C 3LRGA 2AKRB 4S1DD 2GJ6B 2P5WE 2GEEA 1W72A 5F1NB 3V2AR 4J3SA 4D3CL 1F6AA 2CJUL 5AWNH 3INUH 4TNVF 4JFFE 4Z76B 5CJBA 5D5MB 4G43B 1I9IH 1A7NH 4PJ9D 1X5AA 4HBCL 3SKNB 4JFZL 5DWUH 5HDLA 5BV7L 4LLWA 2UZXB 5IHBA 1KFAL 3BDBA 3MLYL 4A6YA 1MFAH 3SGDI 4OZIF 2R2HA 3UJIL 3QUXD 4QLRA 3WXVH 1A3QA 2FD6H 1EGJH 4KTDH 1WICA 1OQOA 4P9HC 2G5RA 4ZFGH 1MEXL 4BQ6A 1KPVA 5DURB 3BEWA 1MCLA 3NCBB 4MMXC 4NKMA 3RUGA 4YDKL 1LP9E 3IGAB 5E2WL 3DVGA 1SHMA 1E4XH 3MLUH 4R9HA 2VLJE 3D69A 1JF6A 2AXFA 4QXWA 3VXNB 5JIPA 4N1CA 1IEBA 3SGJC 4RGNB 4F58H 4XP5H 3DX6B 4YXHL 5FKAB 4RGMB 4Q0XH 1KELH 1S7XA 4KVCL 3AROA 5GSRA 5GISH 5CS7A 4G5ZH 2BOCA 1FL3A 2QQKL 3FMGL 4H0HB 4S2SB 3UJTL 2AJ3B 4ELMF 3NA9H 4N0FA 5EIIB 3H9SB 3VRJB 5JPMB 2GQHA 1RHFA 3X3FH 1RUML 4N8VA 3DXAB 1GJIA 3R8QA 1AI1L 3K4AA 3PIQA 5I1EH 4PJDB 4O02H 4LNRB 3OAZK 4GXVL 4W70A 3TFKC 4M43L 3HE6B 4TVPL 1WF5A 2D7NA 3HG1A 1OW0C 4MA1B 3MMEA 2VZOA 5KS9B 5DVNA 4PJGF 1GL4B 3EJJX 3BIKA 1MOEA 3TYGL 3QXAB 2J88L 2WK2A 4GKSA 4DQOL 4MCZB 4Z8FH 1NC2A 2FB4H 2SEBA 4TTDC 1MPAL 2X10A 3EDKA 3QUYA 1NLDH 25C8H 1EEZA 5EBGA 1BVKB 1MI5D 4P2RA 4YHKH 1T7YA 1JGEA 4JJHA 3H42H 1Z9MA 3D0VB 2GFBB 1U3HA 2ICWJ 2EEAA 4GQPH 4LIQE 1KJ3H 3UXFA 1G7MA 3WS3A 4NO3B 1NKOA 3PHOA 1T80A 2IANA 3TBVB 4IRJB 1U8JB 2V2TB 4FXKB 4JAMA 3QWRA 4V1DA 4KJWC 1PG7W 2X4TA 3TGXA 3ILQD 2WV3A 3UBXA 4U3CA 5B3NA 4I0PC 43C9A 1G7HA 1HNGA 1U8OA 4JN2B 2Q76B 1SY6A 1FZMB 3S37H 1I8KA 3FRPA 5M94B 1IMHC 3RNKA 5IVNA 2JK5A 1EEUA 2A6DB 2O5YL 2AK1L 3UTSA 1CE1H 3C5JB 3T1WA 1QFHA 3DVFA 3I75A 3ARGB 1IEHA 4EN3D 2LV4A 2R1YB 4YHOL 1CFSB 3MV7A 3P0VH 2IH1A 4MNQA 4OLWL 1BQSA 5T1MB 2OK0L 1T5WB 4PJEF 3ZSTA 2P1YA 3UO1H 1P9MC 3SDDC 1VESA 5EULV 1IGTA 1KB5B 3K2UH 1UADC 5LCVL 4NRYA 1T3FA 4P5KA 3G9VA 2FYYB 1FGNH 8FABB 1JNLH 2DQIL 4PB9H 1X4XA 1NGWB 5H8DA 4MAYC 4RAHA 4J7RA 5JW4R 1A2YB 3MV8D 4X0KB 4NKIL 2ZSWB 4DGIH 4D0CA 4PR5B 3O6FA 1JWMB 1NGQL 2DI7A 5GS0D 4Y1AB 1NAMH 5DS8A 1BFOB 1JRHL 1RURH 3FN0H 1U8KA 1ZWIA 3UEZA 3VE0A 2BERA 1DEDA 1XR8A 1OLZA 4KKLC 4R4FH 1TITA 2XT1B 3VD7A 4IBLT 1RUQL 3LEXA 3TWCL 3UCRA 1G84A 3HZMA 2BCKB 4JY6B 4PJFA 1R5VA 3RVXD 3L3GB 1FNSL 2A0LC 4WFGE 1T1XA 1VEOA 3CSPA 3FQTB 3S88L 4YEFA 4LLVB 1HCVA 2C3VB 4K7PY 1IGCH 4OIBA 4R97B 3T0ED 1MUJB 4OIIL 1LO4H 3GSXB 1QG3A 1QOKA 2X1QA 4YHNA 5MEND 3WSQH 1LEGA 5KZCD 2WUCH 3F7PC 4OCYL 3QCTH 2G9HA 5B3JE 2CUIA 5F9OH 3CFCL 2ESVE 2J8UE 1ES0B 4ZS6C 4Z0XB 1KTKE 3IB4A 3ISWA 4JDVA 3HE7B 3D2UA 1PBYA 4I3SL 1BVZA 4N5EC 2W9DL 1C5CL 3C09C 3B3IB 3JWOC 2H8PA 4M6ML 4WNQA 1BM3H 4QRPB 1A8JH 3BSZL 3CUPA 5B38A 3OTTA 3BIAX 5D71L 4NQDB 4EBQL 4PJCA 2A6KA 2Q8AL 4PBVC 2OJEB 3TJEH 1JHKH 4MB4A 5KJRL 2EH8H 4JGMA 5D7JB 5IHUL 4LKXA 5C0CD 5I1CL 3R06A 2D7PA 2QQNH 4WW1B 2VZTA 3EYOA 3GUTA 1I1AB 1INQA 5HY9B 2OI9B 1AGCA 1SJVA 2A38A 5SWZE 2MFNA 2VQTA 4IRSD 4R2GC 1KGCD 4YX2H 3I3DA 4XBPB 5HYSB 3NOIA 4KI5F 2AP2A 2W07A 1MCPL 1KJMB 3GJEB 4N8CH 4F7CA 5TE6L 4BYHA 4KKCC 4UIKH 1E6JL 4EIGB 1YNTA 1QO3A 3HZYB 1Q1JH 2BHUA 5C86A 1P7KB 2BY0A 3KPQA 4M48H 3ILPB 1A6AA 2DI8A 4PRPE 4X4ZA 3H6JA 1ZHKB 4JRXE 5T5NG 4ZPVA 1MFNA 1UJ3A 2NX5E 4K3HA 4LARL 4IJ3B 4U6VH 4ZAKB 4P23D 5ICXB 4OZHA 5ADOH 1EVUA 4U31A 4P5TA 5E1AA 4L8DA 3P30H 3VJ6A 4PGCA 3BISA 4HS8H 5C7XL 2XNAA 1HHJA 3B5GA 4UOW0 2NR6C 5L8JB 1PY9A 3BZEB 3MUHL 3QDJE 3WIHH 4F8QA 2BJMH 4MA8H 2W0FA 4QOKD 2MHAB 4IMLB 4QCIA 1UH4A 4B0MM 5LQBL 4PJXA 5FUOL 5T3ZH 3WV0A 4U2YA 1T0NB 2NY4D 4Y5XA 1A14H 4U1LB 5DRWA 3OPZH 4XWOD 1DQMH 5SWSE 3PNWA 5IIEB 1HOCB 4XB8A 4S1SH 2VKWA 4EVNA 5A40E 2J7LA 3GIVB 2YPVH 5C9KA 3B9KC 1UEYA 2HTKC 1WBZB 3MYJA 3U2SA 1X5FA 1OGAA 3BPNC 3P3YA 4ODTL 2EE6A 3DTXA 5DF0A 1EZVX 1NSNL 2YPLD 5L7XL 3FB5B 3RDTD 2H32H 3HZVA 3ARRA 4F57L 4U6YA 2IPTH 4LLDA 1BJ1J 4M62H 4JFPA 4RRPG 4XPBL 4RGOH 3MX0A 1MHCB 4C55A 4V2CB 4PUBH 5FXCH 1QFUH 1HYSD 4J8RB 1WC7B 2ZJSH 1EHLH 3MZGB 3ULVF 4Y16A 4Z7UB 2KZ1B 4KZDH 4WWKD 4UOJA 3LS4H 3NAAH 1FZOA 1FBIH 5KSAA 4XWGL 5I66B 3CH8A 2NYYD 3MRRA 4L4TE 3MUY1 5F9DC 5JO5B 5IQ7L 4GRWH 3RY5A 5HHOE 3PUCA 3U7WH 1YMHA 4NNPL 3QPQC 4JZNA 3QQ9C 1OL0A 5CGTA 2F54B 3R0MA 4JFDE 4E5XB 4BFBD 5EOTB 2BY1A 1UWGL 4YPGA 4X5LA 1E27B 1WFTA 3VH8A 5CZXC 4P9HH 5F8QC 1S7UA 3MCG1 1B90A 1U42A 4QRRD 3IJSB 3VG9B 2P5EE 5F96L 4CW1A 2QR0A 3TA3A 3BESR 1OP9A 1EHAA 3GMPA 4NC2B 5IKCA 3ABZA 4KJPC 2ARJQ 1MHHB 4M1CD 2ICWA 3JTTB 1U0QA 1P53A 4U1HA 4F80A 3P9MB 1HI6B 2BRQA 5DJDA 5D9SB 1C16A 5CD5C 4KVNH 1EH9A 4DOHB 1U3JA 2DLIA 5DI8B 5HJ3B 3TPKA 1KB9J 4PS4L 3G5VA 4URTB 4EI5D 4M6NH 5F3BB 1MFBL 3M1BB 4Y89A 3ZDZE 1MLBA 4LVEA 5E9DD 5ISZA 2PN5A 4YBLC 1JUFB 2NQCA 4GW5A 2CQVA 4U3XA 4OI9A 4PV8B 2X4OB 1RUPH 2I9TB 3KS0J 4TSAH 1FAIH 4L3ED 4MQSB 4ZPTA 3RGHA 4Z7WA 1ZLVH 1AO7E 1TTUA 5FCUL 1ZVHA 1IAIM 3G6JF 2G2RB 3O2DA 1U6AL 1H5BC 1QFPA 2IALA 4LCYA 4PJBB 1Q9WA 3WFHB 4K94L 3QZWA 5F7DA 1HHKB 4B7LA 3C6LB 4OKVB 5EUOA 3KPRB 5E5MA 4KWUA 3WLWC 4UB0L 1QR1A 4MXVF 5C0EB 1IM9B 3HHRB 4LCUB 3NCYS 5MEPA 1CS6A 5EO1B 3WMSA 1FL5B 3LZFL 12E8H 1S3KH 1ZLSL 5D2LA 4JQIH 3VI4F 2DKUA 1H3PH 3ULUC 2A6IB 3NIGF 2ZUXA 3MR9B 3UBXI 2H45A 2J8HA 3B6SA 3WYRA 2X4UB 1QLEH 4N9GA 3U9PH 3DYPA 4N8PA 2EO1A 1TQCC 1S5HB 4LSQL 1KG0B 1INEH 3GNMH 2R0WL 3V79C 3ROOB 2DIAA 1GGCH 4OF7A 2OL3L 1NGYA 4JPKH 3KXFE 2UWEF 4XMPH 5FO7B 1XIWC 3V6BR 1MWAB 4L4VB 3PL6B 1Y18B 4FFWD 5C0JB 1BOGB 3G9AB 5KAQF 4DKEL 5DK0B 4YDLB 4PJAB 2DOCA 1G6RL 2H9GA 3MCKB 5BOZG 1A7RL 5D5MA 2IAMB 3SDXE 2VLKA 3IDIA 4LGRB 3BI9X 3T04D 3WE6A 4Y4FC 2GSIB 2Y5EA 1DL7L 1WCBB 1N2RB 2CDGB 1F90H 1FV1A 1FVEA 4MJ5B 4O5LL 4OFYA 4P2OB 4R4NC 5D4QA 1G0YR 3L3HA 4U7MA 3CVHA 3QG6A 3VFOB 1QFOA 2QSCH 3UTQB 4G8FB 5GGVH 3CAFA 5DEFB 3DMMD 4K23L 2Q6WA 1KIQB 1MSPA 3C5SA 2VL4A 3QNXA 1LO3L 2XTJB 2N56A 3IGAA 2LU3A 3BP4A 4LQ1A 3L95B 4HWZB 4LSSH 4NUGL 1VPOH 3BKJL 4PJ7A 4MQTB 3TBSB 1RZGB 5GRXG 3HR6A 1AGEB 3VXUD 2B2XL 1T2QL 3V6FA 2IPUG 1F8TL 2DQEL 3QNZB 5FKAA 2HJKA 2K7PA 4G6ML 3MRIB 1QRNE 4JRYB 4XCYA 1UQSB 3MRDA 4BH7B 3CDCA 1CFTA 1XGUA 3KYMB 5MHSD 2P43B 4G6FD 1JZ3A 4HDIA 3HI6H 5DFVD 4LEOB 5GGQL 4O58L 4IIQC 4ODSL 5EIIA 3H9SA 3VD9A 4S0TD 4F2MB 3LV3B 3ARFD 3QUZC 5ENWB 2CK0L 2P42B 2OSLB 2P5WA 4GBXB 5D1QC 3GMMB 5I15H 3TO4C 2PETA 4M61A 4JFFA 4OZFG 4PJDA 5D7IB 3VWJC 3RL1B 5EO9B 1XGPB 1EHXA 1YEEL 4TSBH 4XAWH 5C3LD 2DI9A 4LHUD 1FFPA 1K2DB 4HEPG 1HHGB 1QFWL 2QHRH 3D0LA 3N1FC 2A9MH 1MFCL 1DANU 4HLZH 5KVDL 2E7CA 1JNJA 5I1JL 3DI3B 3IFPA 2VXTL 2Y23A 4MCZA 3ARDC 3MV9E 4R6UA 5DGRA 4F7TA 1U8MA 1LK3L 4LGSB 4RFNC 1RUKH 1K4CA 3S36X 3DJ9A 2C26A 1BVKA 4WRLA 3IFOB 5DLML 4L5FL 2DL9A 5DD6B 3JWOH 3AMLA 4YPJA 1I3VA 9CGTA 1GYAA 3ZKND 1UB5B 3S96A 3DHJA 5F89A 3QYCA 1C12A 5ALCH 3P73A 4GMSH 4IRJA 1U8JA 2ICCA 2V2TA 4I4WA 4FXKA 5FYKH 3GIZL 5ICZB 4D2NA 2AEPL 1VFAB 4JY5H 5D1XB 3EO1B 4WFED 3WJLA 2QTEA 1BZ7A 3HFML 4HJ0D 4YHMH 5J9PA 3M07A 3VG0L 4OCSH 1BGXL 2A6DA 1OWRM 4GMTH 1DCLA 4X6DA 2VXSH 4UT7H 4EXKA 1R0AH 4JO3H 5IB3A 3ARGA 5TFSH 1OB1A 5B39B 3FQRB 1FG2A 2HTLC 2R1YA 1KCLA 3L3DB 3P4MA 1EO5A 5A2LH 4YAQB 1OTTC 1CFSA 2EDXA 4DVRL 1GIGL 2DMBA 1GCFA 1G9MC 4Z5RA 1VENA 2IF7A 2EKSA 4ZOCA 3CFEA 2CIKA 4BH8B 1HINL 5T1KD 1JP5A 2KDGA 1KB5A 1XCQA 3KLSA 2FBJH 4KRPB 2NLJA 2DWEB 4NBYB 5DJ8B 4JY4B 4Z7VB 3RWDB 3VDAA 3E6HB 1CWVA 3TN0B 4PV9A 2Z31D 4OQ1A 4JPIA 3STBA 1J9CT 1NGWA 3IKCA 3L7EB 4NO5A 3U7AA 4JANA 3OKDB 4Y19A 3IFNH 5K59E 4G6AD 4X0KA 2CSPA 5MI0C 3MUGB 5T3ZD 3SE3A 4IS6A 3TV3L 1KIPA 1JWMA 5BJTB 1BFOA 1S7VB 3QDGB 4YFDB 4K55A 3C5ZD 2NY3B 2ZNWA 1FYTD 3GHEH 1ZLVK 3A6BH 3TBYA 2YPKB 3NPSC 5IW3A 3MOAH 1N5YH 1FH5H 1F42A 2JCCB 4KDWA 3U1SL 3VXRB 4GG8B 5DR5L 5HVHC 1X4ZA 4JY6A 2BCKA 2NY7L 4OCRL 5D7SL 2AW2A 2PW2B 2ZOLB 3OJ2C 4HZAA 1NUDA 1BF2A 4F33A 2NY1B 2IH3A 2DJUA 2J12B 1ZANL 4AIZA 3F8UB 3RTQD 1BFSA 1MAML 3PQYD 5C08B 1BD2D 2HN7B 3CFKB 1R3KB 3TT1L 5D7LB 2G60H 4KFZC 3FQUB 5I1IH 4W4OC 4G8GB 1TVHB 3SO5A 1PX4A 1PKQB 3QIWD 2DICA 4G9DB 1MJ7H 1IGIL 1B3JA 4Z0XA 4GAYB 4GOSA 1FFOB 3QDME 4G7VL 3HE7A 2R9HD 4XCFL 2NZ9C 1RQ5A 5CILL 2Y06H 1EEQA 3B3IA 4FQIH 1A47A 5I8CB 1RI8A 4I1NB 1NL0H 1CTNA 1EFXD 1Q9KB 3OAYH 1H15A 4NBXB 4YZFF 4NQCA 1JZ2A 3JBG7 1SEBB 3CFIC 2AK4B 2JLLA 5E8OA 3RWIB 1WJ3A 1AQKH 1FLTX 4QXTB 4NDMB 1N0XH 4KUZL 3VWKB 2HH0L 4B5EA 3UDWC 1ADQA 2CUHA 1L7TL 3D85D 3N1PC 4KDTC 4WW1A 5CBAA 4JG0H 5KSBB 3VD4A 5DGQA 4NN6C 1YEJL 1M71B 2ICWI 4AEHH 1V3LA 1ORSB 1QSEB 4XBPA 4ETYA 3PWVB 1MRDH 4JKMA 1A1OA 1OGTB 4FTVB 3WUWA 4UV4L 3TT3L 3GJEA 1AD0A 3RVWC 3PWLB 4LHJB 4MWFB 4L29B 2W65B 5FDWA 1N6VA 2VRAA 4YQXL 1P7KA 4LF3B 1W0WB 3ILPA 3QUKA 2IQAB 2PXYA 5GS3A 5D72H 1DVFA 4U1MB 1FYHB 2ESVA 4ZAKA 2J8UA 4JGJA 5C0RL 3JV5A 1KENL 4JG1L 4BQBA 5CHNB 3GI8L 5F3HB 2F74B 2V9QA 1BAFH 4NHUA 4NHCH 3A6OA 1A6TA 3OZ9L 3V4VH 1T4KB 2VDNH 1FIGL 3KLDA 2MHAA 1NC2D 3MUJA 3TFKD 3EYUH 3TCLA 1TVBA 4LU5L 3PHSA 3QUYD 3IJYB 4RDQF 4YH6A 5I74B 1T0NA 4M7ZC 1RSFA 3PGDB 2ADGB 3RAJL 1I1RA 1U36A 5C6TH 5CSZB 3PJSA 1U3HD 1CDCA 1HOCA 4JDZB 5IQ9B 1MQ8A 4TTDD 1M7XA 1VEMA 3FT2B 3GIVA 4LDEB 2DQTL 4WW2A 4TUKH 3MFFB 1N8ZB 2ZCLH 1WBZA 2HLFC 1F3DH 2IAND 1QR4A 3PWUA 5CMAA 3HUJF 5SWZA 2FJGB 3RKDC 5B38G 3CZFA 1A1MB 3K80A 1QYGH 3OGCA 4NRXA 3W82A 4HXBL 3BQUB 3BAEH 1UYWH 2YN5A 3KGRA 5FOBB 4WV1C 4DCQA 1YEFL 5J13C 1OSZA 4KJWD 1N26A 1WGOA 3QSKB 1RK1B 4JRXA 2NX5A 1MHCA 4Y2OA 1Q38A 4OZGF 4J8RA 1NEZA 3BVNA 3GBNH 3UTTB 2M26A 2V17L 1EEYB 4PJ8B 1QKZL 3MV7D 5FGCE 3AU1B 3QI9C 3QP3A 1X5ZA 4DUWA 3RWEA 1DSFH 2XQYK 4DVBB 2BNQE 3CVIH 2VLLA 3IETB 4PY7A 3AM8C 3OXRB 1ZSDA 2A74A 3V5HA 1J12A 4JO2L 4X7SL 3H3BC 3PF2A 4Y4HB 1ED3B 1LDPH 5E99L 5B8CA 4CL7A 1DUZA 4XPAL 1OM3L 1VKXB 5EBMB 3BKMH 1A4JB 1ZOXA 1CDYA 5EOTA 4NIKB 2GJ6E 1PYWB 3O6FD 4P46C 1NCDL 3AS3A 5EOQH 1K8IB 2A73A 4JFQB 1CLZH 3MA7A 5IBLD 5I18H 4C59B 2DQUH 1DFBL 3BP7A 4MAYD 2R0ZH 4HEME 4YC2C 2CIIB 1ZGLP 2XKSA 3RBGA 2R2CA 3LHPL 3L5XL 3BE1H 4LLQA 2ID5A 3LRSB 2KQMA 4JM2B 4HQQH 5L2JA 1MCNA 4PJ5E 1B0GB 2GCYB 3WNLA 1P4LB 1HI6A 2JB5H 5HJ3A 3RWCB 1AC0A 1TTGA 1OT2A 4UTAL 4GRWF 3RL2A 4HWEH 3PGFL 5JNYB 4Q9QH 1F3JA 1Z5LA 2VISA 1EX0A 2A6JB 3OJVC 5D70L 3VFVB 1BZ9B 4M5ZL 1CDGA 3HAEA 3BD4A 1D5ZA 2QKIA 3ULUL 1I3UA 2BVEA 5GQBA 4WI3A 4NRZB 4ZFOA 4ZO7A 5I1KL 4L4TA 1YQVH 2XN9E 1NBZA 2MTPA 2Q3ZA 4XC1H 3DUUB 5HHOA 4H0GA 3D2UD 2X4OA 2Q86B 3WNPA 4P4RA 3PP4H 4IOFD 2ZPKH 4DZ8A 4XMLL 4WTWA 4XNQA 4WO4C 4H88H 4XP6L 3C6LA 5D2NC 4XNUL 2CRZA 3M8OH 3VFPA 4NZTL 4OUUB 4N5ED 3IAPA 4Y2DA 1AGFB 2MJWA 3OAUH 4ZTPL 4J6RH 1IM9A 4UQ2B 5EUKB 1HQRB 3MXWH 3ZE0F 3HNTH 4RFEB 4OV5A 4K8RC 4YXLH 5JW3L 2Q7YA 1FORL 5E4IA 3L3KB 1I9EA 1QSFE 4R96A 2AJXL 2Z92A 4OZIE 3OAYK 4QNPF 1OF2B 3QHZL 5ESQB 1G9NH 2X4UA 4CN1A 4MS8D 3Q6GH 2MMXA 5FYKD 1MH5A 1S5HA 3L5WB 1UM5L 4OLXH 1HXMA 3FB6B 4KK9C 1EMTH 3EOBA 5FYKU 2N7BA 1K5NB 4OV6F 3KPTA 5IP4A 4XH2B 4R3SA 3IS0X 4UZGA 3VI3F 3BJ91 4R2GD 1I3GH 5FO7A 5JW4M 4P2QE 2YWZA 3GMOA 4L4VA 2QBWA 3I02B 1Y18A 2FO4A 3WO4C 1BOGA 4KKCD 4KY1H 2VO5A 1QLFA 1FJ1A 3F5WA 1AO7A 2IAMA 3BKYL 1JGVH 4MDIA 4ODHL 2VLRD 4L3CB 4E0RA 3BUYA 1TPXB 4R7DA 4P2OA 3ZT5A 1NGPL 3HTLX 5D6DC 1RIUH 1GC1H 3MLRL 1JI2A 3S37X 3UTQA 2B1HL 4NKDB 2ZKHL 4LIQH 5DEFA 3S3JA 1CR9L 1T66D 1LE5B 4QEGA 5ESVB 3NTCH 4Y5VC 1MJJB 1J0YA 1G6RB 4P9ML 2APWA 2VQ1B 4DKDC 1YY9C 2YA1A 4PJGE 3X12B 4TRPL 4R0LA 4TTGA 4FA8A 3MRGA 4B53A 4N90E 4H1LG 4TUJB 3TBSA 6FABH 4RMTA 1CU4H 4JHWL 4P4KC 3QNZA 4RWYL 1TQBB 5JHDA 3MZTA 4JRYA 4X5XB 3NGBC 1UQSA 5IOPA 5HYFA 4Q9CA 2D0HA 5AWNL 3D3VB 3INUL 1CICC 3KNBB 1CFVL 1FNFA 4KJQD 1MY7A 5TE7H 2XQBL 1KNOA 3B9KD 4G42B 1X7QA 1MVFA 3ZKQD 3KXFA 2CLRB 3U36A 4DWHA 1I8MA 4G7YH 4OLZH 4ZQKB 4F2MA 4GG6F 1UVQB 4X98B 5GGRB 2I9LA 2WBJC 5C09B 3O3DB 4JHBA 2WANA 4XNZC 4IRZL 1C1EH 3WXVL 3FT4B 1H3TA 1RJLA 5GGTL 3UC0L 2B0SL 3LDBB 1AIFA 4ZFGL 4FQHB 4FS0A 4TULL 4MHHG 1SBSH 4M1GH 4HPYH 4Y16D 3SDXA 2J5LC 4ELMB 3UAJC 5JIHA 1UA6H 1IKFL 2YUZA 5EU5B 4QXGL 5KSAD 1KN2H 3ARBA 3MLUL 1ZKAA 4L8SC 3V5KB 3MRBB 2ICEB 1OARH 2NXZC 7FABH 3T77B 1BREA 4CMHC 1DBBH 3ZE1F 4XP5L 4S1RH 1KELL 3MLVH 4QGYA 4WI6A 1M7DB 1ZT1B 5IMKB 1ULVA 5C70A 3IU3A 5BXFB 5KBNC 4M5YH 3ALPA 3EFDL 1AKJA 3D5OF 3OKKB 4CVUA 4F7EB 4G5ZL 4PJEE 5B21A 1UB5A 5C07D 4DKAA 4WGWB 3QPQD 5KSVB 5EZOH 4YIQB 3JV4A 3QQ9D 4XNYH 1TXKA 2W0KA 1UM4H 4OD1L 5GPRA 1VHPA 4AEEA 3F7YA 1NKRA 2R4RH 5J89A 4K07A 4J2XA 3FT3A 5ICZA 1YEIH 5CZXD 1VFAA 3FOLA 1ONQB 3DWTA 1U8IB 4M7JH 1MFEH 5DJ6B 3SCMA 4I3RH 4QRPE 3QQ4B 4XHJC 4GT7A 3BDXA 2PYEB 1YEHH 3V0WL 5EWIH 4AJ0A 2R29H 1MCJA 3O3BB 4NP4H 3CPLA 2BVUA 2HA1A 4LSRL 2VIRA 3GI9H 4RX4A 2V6HA 2VLMD 3HC3H 3G5ZB 3EO9L 1AC6A 3FQRA 4UDTA 3I50H 4KJPD 4MA3A 3OQ3B 4XNXH 2R23B 2Z8RA 1HQ4B 1LMKA 4H20H 4CVZA 5T1LD 5I9QB 2V7HB 4IM8A 3LH2H 3HC0B 4AT6A 3L3JB 5EN2B 3PWPE 4W6WB 2XFXB 5DRXA 3OWEA 3IDJB 3GBMH 4JY4A 3RWDA 5GRJL 5JQ6H 1MQKH 4RA3A 1N59B 2FBOJ 4YK4B 4N68A 2DBLL 4NZJA 5IVXF 3SDCB 4ODUA 1GAFL 4LRIC 5BW7A 1JYNA 1IE5A 3VXSE 4XP1H 4XI5C 3S37L 2FLRT 3BUTA 4UT6L 4Y4KB 3GSWB 5IFAH 2X4SB 4I9WD 5BS0D 1FFQA 2YD9A 5JZ7D 3D25A 2XV6B 5H2BB 2XWBB 4ALAL 2J6EH 3VXME 2D7TH 1A5FH 4NWUL 5T33H 3WLWD 1EHNA 3O3AA 3VXRA 5C2BL 1N4XL 5DYOB 2ITDB 1RJZA 4BZ2H 2BSSA 1OQXA 4HKBA 3GSQA 3E1F1 3UO1L 5GRUH 1JVKA 4F3FA 2V2WB 4DAGH 1JWUB 3K2UL 3FB8A 4LLYB 4OD3L 3UJJL 3V6ZA 1EXUB 1BMGA 4EI6A 4IDLA 2W0LA 3EJZC 4Z9KB 4OGXH 3HZKA 1MRFH 1ZA6A 3TBTA 3W2DH 4PJ9B 4G8GA 1TVHA 5BO1L 4G9DA 2MOVA 4GAYA 3NABL 1FFOA 4FFZH 1IFHH 4NBZB 3KPPB 3MRFA 3RVTC 2VLKD 1JPTL 4HV8B 4KI5E 3QUXB 5IMLB 3FN0L 2OTWA