1AR1D

Structure at 2.7 angstrom resolution of the paracoccus denitrificans two-subunit cytochrome c oxidase complexed with an antibody fv fragment
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
b'DIELTQTPVSLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQFLVYNAKTLGEGVPSRFSGSGSGTQFSLKINSLLPEDFGSYYCQHHYGTPPLTFGGGTKLEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Structure at 2.7 A resolution of the Paracoccus denitrificans two-subunit cytochrome c oxidase complexed with an antibody FV fragment.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Complex (oxidoreductase/antibody)
total genus 23
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1997-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ar1D00
2ID5A 2HLAB 1CFTB 5AD0A 1MHCB 4XCEB 3NOIA 3EJJX 3KPRB 4K71B 4ERSH 1GC1C 5GSRB 1U92B 1WF5A 2WMPA 4GRLA 3OAUH 2OJZL 4YDIL 2YPVH 2NQCA 2P46B 3IDGA 3FO1A 3GIVA 1E0OB 1IBGL 1ZLSH 2GCYB 4RFOH 3PP3K 3GSNA 3ZKNC 2ZOLA 4Y5XB 3WYRA 3QIWA 4KUCD 3NMEA 3KPQB 4KGLA 2PTTB 2ZWLT 4NQVA 4F7CA 4Y4KD 3W0WB 1YQ2A 5JIPA 4WUUB 1OW0A 3F7QA 1M7IA 1AI1L 1IEHA 4E41D 4XNXH 1BVKA 1HDMA 2HN7B 3ARGB 4TVPL 4PGDA 3LPGA 5D7KD 2Q8BH 3HHRB 5I75C 3LKNA 3KPRE 1CD8A 3B83A 1VEPA 1IEBB 1YNKL 4P3DA 1IQWL 1D5MA 3CVHB 3UXFA 3M45A 1KLFA 5E8NA 3T3MF 1OARL 4U1LA 5C9JB 5L88H 2YS4A 3P4OA 5EOQL 3T4YA 1AR1D 4P2OC 3W0WE 1I7TA 1BBJA 4WUUE 1Z3GH 4PGBB 4AZ8A 1X5AA 1TZHB 4HS6A 4G8FB 4NNYB 3HB3D 4X7FC 1K4CB 4NM4L 4XNUH 1T7XA 1NGZB 2FJGB 3PABA 5C9KA 4NNXA 3ES6A 2AK1H 1I9JL 2VISB 5FXCH 1Q9LB 1QQDB 5DRWA 4N1HB 5I15L 3H0TB 1CE6A 3SPVA 2KH2B 3OB0H 2YBRA 2OL3L 4XH2A 1UKTA 4YWGL 4D2NA 1LO5A 2NNAB 2VR9A 2A9ML 2W92A 1L9MA 2YWZA 4GOSA 4HIIA 1A3QA 1QUNA 3GBLA 3EYVB 5DJ2B 4LSSL 4OTXL 3L3GA 2Z8VC 3WNLA 4EVNB 5E2TL 1CK0H 4JCLA 2EIDA 5I8EA 4KDTA 1UACH 4NZUH 4OJFH 5C3LD 2AJYL 3ISWA 4XMLL 1BF8A 3P4LA 1OSZB 4PJ5D 1CDCA 1RZJL 5CCKL 3QG7H 2DQEH 1BLNA 3ARYA 5AYUH 3QHFL 1TZIA 4KTEL 2AEQL 2VYRE 1DUYA 4JE4B 2X5PA 4MQ7A 1MI5B 2X4NB 3B9AA 4K7PH 4DK3A 2A73A 4HGWA 4OQ1A 4HIJB 4X6DB 3WEXB 2IFGA 1A9BA 3NCJL 1FLTX 2IQAA 4JVPA 3CFDA 1A7QH 2G5RA 1Y18B 1BVLA 1UWXH 2VC2L 1QFOA 5EU3B 4X6BA 3ZZ1A 3IAGC 3MRMB 1TPXC 3W5NA 3FFCD 4ELKB 4HSQA 3UTZB 4F58H 1T1WB 5JMOC 5JXED 2H2SD 1V8HA 2YPKB 5F71A 3MV01 5KZCB 1S9YA 3TFKD 5FK9A 5BRZB 5D9SB 3VGBA 1DQML 4ZS6D 3SE3A 3LD8C 4ZXBD 4OZGA 1FFOB 3HMXL 1XIWB 4MMXC 4OLVH 4S2SB 3WDJA 2X4RA 2MTPA 3G5YA 4UDTA 4WTZG 4TNVK 4LGSB 3GUTB 1MOEA 5GRUH 1H8SA 3GBNL 4U6HA 2AABL 3WNKA 1FORL 5D5MA 3QIBB 1G6RH 3FO2B 3L6FB 2E5EA 4KVNH 4OF3A 4UV7H 3D25A 1KIPB 1HINH 1IC4L 4R26L 1Q0YH 3IJSA 4XMKH 4NO2A 1YYMH 1QSZA 2DKUA 4PIRF 2RFXB 4PJCA 1JZ8A 3O4LE 2N7BA 3SE8L 5F7NC 4Q7DA 1DANU 4H0IA 1G9ML 4MS8C 1LEIB 2VDPH 4MX7A 3SOBL 4U1HA 3LKOA 1KEML 1U8OB 4QHMA 1BFSA 5J0BA 3TA3B 4KWUA 5FOBB 1N59A 3CFBB 5HGBA 4QWWD 5E7FA 2FLRT 1BQHG 3FRUA 4FHBD 4CMMB 4R4ND 3FN0H 1GZPA 4J4PD 5F8RC 4Z7WA 1NCBL 2MCG1 1KULA 1GOHA 1BBDL 3QFJA 4PJAB 2X42A 5DJCA 1U8NB 5D7JB 1LQSR 5C0RL 2FD6L 1QLFB 5E2UH 3MBED 3IAPA 5CILH 3WLBB 3SO3C 2HH0L 3G08A 5A40E 4W68A 4OIIL 4Q6IB 2CKBA 2K9UA 3EKCA 2BHZA 3CSPA 3H2WA 2HFGL 5C0BE 5FM5O 4KVCH 5KVGL 4ALAL 2Y9RT 3AXLB 2YA1A 4FMFA 5JW4Q 3QQ3B 4FFYL 4D3CH 1K2DA 3N85H 4KU1A 4MCYB 4XBEL 1HHHA 1CGSH 5HDQH 5DO2D 2F74B 4NFBA 5B4MD 5DMGD 2F53E 5F88B 3CXHK 3EYFB 4YK4C 4PJAE 4JFPB 1SY6A 4DQOL 3S34H 1BFOB 5F7UA 3MJ7B 1YJDH 4GG8A 1NBZB 3DRTB 3SE4C 2JJTC 5TPWH 1AGBA 1SYSA 4JFYA 2VDOH 1FIGH 5IFHL 1XZ0B 4UNVA 3RWJB 4NZDA 3LKPA 3V5KB 4C58B 4JZOB 4Z95H 4OIBA 1AKJD 1HILB 1T2QH 4LCIL 1PKQE 1IE5A 5IQ7L 2PR4L 1VFBA 5I76A 2VDKL 1G7IB 3MRGB 4YHZH 5DK3A 2FR4A 3LKSB 4KMLB 4LVEA 4NPYB 4YHOL 2FATH 2KPNA 4HUUA 2X4OB 3WFEH 4Q9QH 5GGUB 3MLSH 2WIIA 3QO1A 3P9MA 4LPYA 3VFSA 2FEEI 1NCDL 1KJ3H 4DTGL 5HYSB 2UUDH 4F15C 3LKRA 3GRWA 3O3EB 3UTQA 1U8QB 3X3GL 3DX9B 2GIYA 5DK0B 2R1XB 2IFFH 2Q6WA 3O2DH 4JDVB 2EH8L 3BYYA 3Q0HA 3KXFB 2HJFA 2ILLA 3WIFA 3NFSH 2Z8SA 1C1EL 4XP4L 1L9NA 2ADGA 4LVOC 3VG0L 4WUKL 2B5IC 4HWBH 4FXGA 5DRNB 4W6YB 1NFDB 3TBWB 2Q76B 3CVHH 4OZIA 5E6IB 4O9HL 4WTXA 5DJDA 4RRPA 4K9EH 1WT5C 1BJ8A 3BD4A 3K2MC 1JPTH 2F54A 1JZ6A 4XBGA 4QY8B 2X09A 3RWHA 3PGCB 3FB6B 5I1LA 1RMFL 2BVPA 3FHQA 3MRLB 5EO0B 3ZT5A 3WDHA 1S7SB 1TJIL 4P2YA 3BGMA 5CUSL 1E6OH 1ED3A 4YDKL 1OT2A 2IF7A 4DOHE 1MLCB 1KCRL 2DQCL 5I18L 4RA0C 3EGSA 5AD0B 4NN7C 3T0DA 3DXAD 4IRJD 1T89A 1BOGB 4OZFB 5DI8A 3SDCC 3KPOB 2YR3A 1G9NC 2YOCA 3LIZH 3O3BB 3QUXD 1J0HA 2NY2D 3TVMB 5GGVH 4YXHH 2DQHH 1J1OL 2MMXA 2D7MA 2EDDA 3S3PA 3NZHL 1UXWB 1JWSB 3GSNB 2ZOLB 4FTVE 4XAKE 2ZCKH 1IGML 2ERJC 4WI6A 4AMKH 3V5DA 1HH9A 1GAFH 4K23H 4WDIA 3DURA 4RX4D 3LZFH 1U6AL 3VI3F 3LN4B 4H20L 1HDMB 4PGDB 3LHPH 3MRKB 2YD3A 3LKNB 3L3JB 1SVCP 2G60H 3STBA 1CD0A 4TSAL 5FYLE 4QXTB 4GAYA 1UM4H 3GKWL 1OP5K 1F4YH 1MQ8A 1D5MB 4HCRH 4YXKH 4HFUH 4F3FA 4U1SA 2XACC 5E8NB 3IB4A 1DBML 4R4FH 1CXEA 4EQ2A 3P30L 3SKJH 1JPGA 5F96H 5AZ2L 3T0XA 3T4YB 3BN3B 1C5CL 6FABH 3WN5B 3WFZA 4XT1C 3O4LD 2I9TA 1BBJB 1DQLH 1FGVL 1LWRA 3NZ8A 2BNQA 3M8OL 4F33A 2ZUUA 4J6RL 1CN4A 5J13B 1B2WH 4JO2L 1UEYA 1AC6A 1ZVHA 2XRAL 4ONFL 5HVGB 1DQTA 1QSVA 4M7JL 3ZKQD 25C8H 4NNXB 4ONOA 3ILQC 1RFDH 4HMEA 2YA2A 5ADOL 2Z35A 2DYPD 5DRWB 5DMYA 2XKUA 3RWGA 5KG9B 3SPVB 4I0PB 4XH2B 3UTSD 5LGJA 1H3XA 4GSDL 1A3LL 3SY0A 1P4BL 4BZ1L 3QDHA 1VEOA 1U3HC 2HTKC 3BJ91 4NHUA 5DJ6A 3X14A 5C7XH 4WCYL 4RAUA 4HIIB 1FP5A 4LSPH 4JJHA 2F19H 3OJMB 1FNHA 2JKXA 4WW2C 5MI0C 3HS0B 5FO8B 3TBYA 3WE6B 4RMTA 1XGPA 4TOYH 4L29B 5C6TH 3CGTA 1YQVL 4H26A 1EZVY 3BHBA 4MXWL 5C0BD 5H94B 5HPMA 3DARA 3ZHLA 3KJ4B 2CUHA 4CAGA 2NY5C 1W0VB 1JRHL 1J05B 2F53D 5EZOH 3UBXG 1QLRB 1BLNB 4HD9A 1WSST 4KDVA 4H1LH 2XYCA 1DTUA 2X2YA 1B0GB 2XZAH 1X9QA 1TZIB 1J1PH 4ODHL 4MQ7B 5E0QA 2P44B 2R0LH 1IQDB 2CDGA 1J86A 2A73B 2G2RA 4HGWB 5SX5H 5EZJB 4P2QA 2XTJC 3LEVH 3NPSC 1XF2A 32C2A 2GK0A 2IQAB 1MRDH 4LEXH 3CFDB 3LS5L 4W4OC 3WKML 5ID1A 3B9KD 4WEBL 1G7LB 1AQKL 1U8KB 1MLBA 1BVLB 3MMEB 2VXQL 1N7MH 4X6BB 4F9PC 1NC4A 5H37G 5JMRA 2J5LC 5K33A 4IM8A 5KVEH 1BOYA 5GISH 1CICC 3IDUA 3QUML 1OF2A 1IC7H 1UKQA 1CLCA 1IARB 1ZK9A 4QGTA 5E95B 4XVJL 4X6DF 4UAOC 3BZEA 4ZAKC 4LLDA 2VZUA 3QI9C 4GKSA 4X6EA 1GGUA 3MA9H 4G43B 1OGAA 3E3QE 1T4KA 5DTFB 4OZGB 1OCWL 4LLMA 2X4RB 3RL2A 1Y6KR 3ZMRA 5IWLA 1X6NA 3RZCD 4IJ3B 3A6BL 4H25B 4CKVX 1H8OA 3WJLC 4F37F 1ULVA 4POZC 4U6HB 5D5MB 4OGZA 4MXQC 4FQ2H 1CIUA 4Q9BA 4K7FB 5IMLA 1EZVX 2I25N 4WGVB 3IDXH 2BHUA 4HG4J 2BZDA 3MREA 1R0AH 1RZ8A 4PLOB 3ULVC 4Z6AT 3QB7C 4D0BA 4EDXA 4NO2B 3RA7L 4OLZH 4KI5C 4WGWB 3TT1L 4OZGE 1AGCA 4HS8H 4D8PB 5ICZA 3WD5L 1CLOL 2CK0L 1TJGH 1YY9D 3K46A 5DFVC 2R9HC 1JGEB 1SYVA 2FWOA 3U0PA 3QUYA 2DL2A 5J11C 4JGUA 5CJQH 5E03A 4UILH 1V3MA 4XPBH 5DD3L 3IJYB 3LKOB 1RIHL 4QHMB 4MA8L 3F7PC 4N0UA 5IF0A 4GKNA 4JY5L 3MRFB 5D5ME 3BDXA 4F57H 2WQ8A 2IGFL 5E4EB 3DO3A 4NIKB 4FQXA 1GZPB 3PHSA 1EVUA 1GIGL 5TQ2L 5L9DH 5DJCB 4WEMB 3TCXA 5DA0B 2QKIA 3B5GA 2FL5A 1DSFH 5C0DA 3CK0L 2EYSB 4PJCE 4GW1B 2FEDC 5HHNA 2RCSH 4YHKH 4F2MA 5C8JA 3WJJA 4FTVD 5IMMA 3Q1SL 5DJ8A 3UO1H 4PJFB 4JVUA 3I6LE 4JO4L 3SDXA 2BVYA 1BAFL 5D7SH 2YD7A 4HH8A 3IXAB 4PTUA 1K2DB 3K8LA 3HAEH 3X11A 2W9DL 4PJAF 2KZWA 2OTUA 5TGBA 4OD3H 2DKMA 4Z7WE 5FYLD 3JWNC 4JZJA 4M1CD 2X44D 4LEOB 3QFJE 1N6QH 4GRLD 2BVQB 2XXCB 4QCIA 5DD5H 3C6LC 3KPLA 5GIRB 3QIWD 4DZBA 1AGBB 2CR6A 1SYSB 3G6AA 1U8MB 3I3EA 2JIXA 3OGOE 5EWIL 5F9WC 3O6ML 5HXMA 3TT3H 5CINL 4XPTH 1K4DB 4OZHA 2AI0L 1KPVA 1VFBB 2V7HA 4PS4L 2A0LC 2EXYD 2VSDA 5FYLH 5K9QI 4PJ9B 1CDHA 5I1EL 1NCCL 2AXHA 5GPRA 4EUPG 4ISVA 2CIKA 3P9MB 3KDMA 4IRZL 1OSPL 2F58H 5TH2A 4MHHG 5DT1L 1IZKA 3LKRB 1HNGA 5AWNL 2J7LA 3UTQB 3K4DA 4QNPE 4YFLI 1F5WA 1I1YA 4UQ3A 4WFEE 4NKOB 3TH2T 4O58L 1NBYA 5GGTL 3JV0A 3RGVC 2V5TA 2FSEB 5SV4A 1IAII 2Y6SC 4HG4K 2ZUTA 3D69B 3KYOA 4YUEH 5F7DA 5F97E 4CBPA 4KJWC 4ERSL 1FRGH 4QT5A 1UQSA 3OAUL 1PDKA 2DM4A 1ZGLP 3DX7A 2C3GA 5HHVH 2V6HA 2YPVL 5JHDB 1KYOJ 2GFBB 2UWEA 1ZLSL 2J8OA 4RFOL 5DJDB 1AGEA 1MREH 3NFPB 4HJ0D 3QH3A 4ZUWA 3U7YH 1SBBA 2F54B 2AV1A 4L9LA 4XBGB 3RAJH 4LP5A 5I1LB 5JORA 4ODXA 3T0EA 4URTB 2BVPB 1TNMA 5GGRY 5D1QD 3BGMB 4G8GB 1RZIA 4XNXL 4AENB 4BUGA 2NR6C 2Q8BL 1KN4H 4NJ9L 5EZLA 1NFDF 5LCVH 3DPBA 3OJDA 4MA1C 5T3XD 1NMAL 1OOAA 4OZIE 2NX5D 5DI8B 1IT9L 5INCB 3FMGH 5L88L 3BIKB 1ROWA 1BWMA 2V2TA 1CT8A 4MJ5A 2F54E 3VFRA 4PG9A 4LGPB 1IC5H 3NIDE 4U1JB 5GRXG 5IR1B 3C9NB 3FQUA 1Z3GL 2AJUH 5I1IH 1G1YA 2FCBA 4WDIB 3MNZA 1J8HA 2A1WH 1TZGL 1GPOH 2W0PA 1JMXA 3B2UC 4O51A 1IKFH 3KWWA 2AK1L 5GS0H 1YYLL 5T3XH 4O2FA 4KKLD 2WZPD 3TNMA 4R2GD 1F4WH 4CMHC 3S37H 3O41B 3TBVA 1N5AB 3SDDD 5TE7H 3B2VL 2EC9T 4C4KO 4F3FB 1ZVSA 4HKXA 1T1ZA 5C0JB 1C5DA 1LK2A 1E27B 1P5VA 5IFJB 1CK0L 2YD2A 2I5YH 3VXTA 4HJJH 4JM2C 3SKOB 5FM5M 3QJHA 1UACL 4KZDL 3NZ8B 4NZUL 2IBGA 4OJFL 4F33B 2W1NA 1RVFH 1S7XB 4Z0BH 3O2VH 3IXTA 4LCUA 1D9KA 3ECBA 4FQIH 1O0VA 1IL1A 4I77H 1SBSH 3T04D 2CH8A 5D72H 3QG7L 2DQEL 4V1DB 4HIHA 3RVXC 5EU7C 2EECA 4HLZG 2Z35B 3C2SA 1U95B 4U2YA 1YC8A 4BSWB 5AYUL 4Z7VA 4GQPH 1BD2A 1GSMA 1CVSC 2WWKT 2VL5A 1KCUL 3X14B 4U05A 3TBSA 4K7PL 4EIGB 3JV4A 4YHYC 3ARFC 1M1SA 1OTTD 2BNQE 2Z8RA 3FQTA 1KG0B 1A7QL 4H26B 4QYOA 1KYOK 2HFTA 4ZOCA 3BHBB 1BHGA 1RIUL 3GMOA 3IJHA 1QD0A 3I6LD 5GS1B 5IEKA 3ARPA 2A77H 2HKFH 3BH8A 4LSDA 3AMLA 1A22B 4KMTH 4LHUB 2XWTB 2DM2A 3ZKSD 1AIFA 3QFJD 4FP8H 2JF1A 4OI9A 4YXLL 1J0JA 3PG2A 2RQ8A 2DB8A 2H6PB 4OLVL 5ESAA 2D0GA 2VKWA 1Y6NR 2Q1EA 4QRUA 4LARH 2F5AL 5SX4H 4P2QB 5GRUL 4APQB 1GC1H 5E2WH 3RPKA 1XF2B 2X89D 1N64H 2ITDB 4GQ9L 5EU6A 5JW5A 3BEVB 2P43B 4QOKD 2AJSH 3MGTA 5D6DA 1U2HA 4KRPD 1MLBB 3DMMC 1G6RL 1M05B 1F3DH 4KVNL 2OJEB 1NC4B 4UV7L 1AE6H 1HINL 2MQCA 1XH3A 1F3JA 2FHBA 4J3WA 1B9ZA 1Q0YL 4XMKL 1YYML 1YEIH 3BMVA 3G6JB 4ZOBA 2BC4A 2K1MA 3TV3H 5DHYB 1H3VA 1Z5LA 4LLDB 6CGTA 3KYAA 5FKAB 5I8CB 2CKBH 1X5HA 1OGAB 4WFED 5K9JH 2XNAA 5TQ0H 1UM5L 3VG9C 4JFED 3KR3H 5F44A 3HZMA 1RUQH 4K7PY 2EE6A 5EOCJ 1IAOA 1RZ7H 5K59F 5T33H 3O9WA 4CVXB 2P1YA 1EK3A 3FN0L 3O6LL 1OP3K 4QHLA 1N5YH 1SY6H 3KHOA 3BPLC 4I5BB 4FZ8H 2A38A 5DMKA 4BJLA 4P57A 2W60A 5DA4A 4OZGF 4FFWC 5ID0A 5CILL 5EBWA 4D0BB 3BGFC 4U6TA 1PGRB 3OQ3B 1OGAE 1R5VA 1AGCB 3QO0A 1HN1A 3D0VA 5ICZB 3CFKB 4KVCL 5IB5B 3BX7C 1F4XH 3QUYB 1PFCA 4D3CL 5D5MF 5HHOA 1JNJA 1KXVC 1CGSL 3MRCA 2DQUH 1T1YB 4P5TC 4HZAA 1OB1B 2ICEA 4B53A 3GSRB 3S96B 4CU8A 5HDQL 4N0UB 5IF0B 4PD4J 4GKNB 2PXYC 2LE9A 4MNQA 4LSUL 3MO1A 4QRPB 3QXUA 3S34L 1YJDL 1EHXA 2XWBA 3F62A 3GRWH 4LCCA 3HRPA 4QKXB 4ODWB 2VDOL 2CLVB 5E8OA 4F9LA 2DI7A 2EC8A 3PE9A 4QRSB 5CP7A 3Q6GL 4Z95L 3FT4A 1T2QL 3DWTA 5DVKA 5IMMB 5DJ8B 2E7LC 3ZTNL 2PW1A 4ETYA 3U30C 1YEFH 2PW2B 4PJ8C 3QNZB 4YHZL 3SDXB 5C07A 2B0SH 1MFBH 1JZ5A 2FATL 3W9DB 1CBVH 3WFEL 4Q9QL 3DX8A 3MLSL 2J12B 4FQLH 4IOSD 3LQAC 4X9FA 1KJ3L 4I9WE 2A83B 3WHE0 1YEHH 5D6CA 4K7PX 3VXPB 3I84A 3VU2A 1U93A 2JJSA 3LPFA 4G6FD 2IFFL 4YHNB 2DRUA 3O2DL 4KHTH 4PJFF 4MQSB 4JQVC 4M3KB 4DZBB 3ZSSA 3G6AB 7FABH 3NFSL 2WBWB 3GB7A 2BMKA 2PN5A 4JVWA 2D7NA 1DN2A 1N0XH 4TSBH 5IHLB 4YHLH 2V7HB 5FF6B 1X5YA 3I3DA 3RPIB 4OGAC 2EDOA 2JCCA 2R4RH 4M93C 3HR5B 3WL9B 1IM9A 4HH9A 4K9EL 1VKXB 1MFAH 4QNPF 1JPTL 3TLRA 5F9JB 4P99A 5B22A 4FQCH 2VTFA 4I13B 4YBLB 2EO1A 3MRBA 1CGXA 4AQ1B 3HZVA 3HG1A 4MS8D 3N9GH 1E6OL 1NBYB 1QA9B 5A2KH 1QKZH 1YA5A 4OZHE 5GJTH 1EO8H 2BNQD 3VD3A 3MROB 2LU7A 4JCMA 2WUCH 4HEME 5E9DA 1AXIB 2K7PA 2APWA 3G5ZA 5F7DB 5D96C 1YUHB 2WINA 1UB6B 4BFEA 4QT5B 3LIZL 3LN9A 2DQHL 2ICWI 1KUMA 1XR8A 2UWEB 4LHQB 5I73B 1AGEB 2EZ0C 2PKDA 1UCBL 4CL7A 3K4ZA 3QH3B 4AMKL 3ZKXB 1GAFL 1IAKA 4L4VA 4ODXB 1I8KA 2AAVA 3JVGA 4K23L 4PD4K 3RTQC 5M95B 5IJKA 2OK0H 3GO1H 4P49A 3QFDB 5HDBE 2A9NH 5HY9A 5CHNA 4LKXA 4ZMAT 1FYHB 3LHPL 2RBLA 5EZLB 1G0YR 3NGBB 4Y19A 5BVPL 2G60L 3LOWA 3NAAH 1BZ7A 3BISA 3OJDB 5EUKB 1F4YL 4JDZA 4HCRL 4YXKL 4LVNC 1KTLA 2QADD 3WO4C 2UWEE 1YNLL 3VWKC 1CE1H 3BPNB 4R4FL 4JAMB 5EOTB 1IGTA 3G5VA 2DI9A 4Y2DA 3SKJL 1P2CA 2V2TB 1WAAA 3N1MC 1A1OA 1NBQA 3DGGA 3T0EE 6FABL 5LJYH 4OI8A 1M6OB 3OWEA 1DQLL 3FQUB 5DC9B 4D0CA 1H9VA 5C08D 4ZQKA 1RHHA 3KYKH 4CW1A 3T0WA 4NQCA 1B2WL 4MWFB 5T5NG 3MNZB 2EDBA 1N26A 4MLIA 3AMKA 1H5BA 4O51B 25C8L 5DUPL 4A2LA 1RFDL 2Z92A 4O2FB 2E9WA 3OKYA 4NO3B 1ZVYA 2R2HB 3QUZC 3TNMB 1A6ZA 2B2XH 3OJ2C 2QSQA 5KVDH 3TBVB 4LQ1A 2FIKB 2Z9TA 4R96A 2F19L 4NKQB 4J12A 4TOYL 2ED7A 3SBWC 5C6TL 3I3BA 3CLFH 4RGOL 2IPUK 2NY1D 2QLVB 3VXTB 1J8HE 2Y06H 3QJHB 1EFXD 5GQBA 3OR6A 1IAMA 4M7LH 4ODBD 5C0FB 5CEYB 5HVWA 2DMBA 1D9KB 3ROOA 1CF8H 4HIHB 3RDTC 2E8ZA 5EZOL 4A6YA 2CQVA 4PJHB 2APBA 2NY3B 1D5ZB 1FAKT 4Z7VB 4MDJA 1BD2B 1J1PL 3IFPA 3D39B 4JFXB 2VL5B 2XY1A 2VLRA 2R0LL 3TBSB 1ORSA 5EA0H 4WI4A 3JV4B 1Q72H 3W9EA 1TVHA 3C08L 1I3VA 3LEVL 5F7YC 1KJ2H 3DIFA 1MRDL 1CD1A 4LEXL 2CMRH 1HOCA 4JQXA 5D71H 4WHYH 4R8WH 1JYWA 4NC1C 3FT2B 4YQXH 2OI9C 5E1HB 1VA9A 1N7ML 3IJHB 1E28A 3I6GB 1UKSA 4M8VA 3C09B 1G9MC 1R5IA 1AGFB 1U9KA 3V4VH 4FRWA 2DLTA 1T22A 1IC7L 4FQXD 3DETD 1WEJH 4Z7VE 5DGRA 1BD2E 1M4KA 3MJ8B 4TYUA 5GRWA 3AU1A 3MOAH 2D9QB 4PRPB 4LVHB 1MCQA 3L3IA 1ES0A 1I3GH 1U8IB 5F72S 5BCAA 4MA3A 3L1OH 1BQSA 1P6AB 4HK0B 1S7VA 3O2WH 1LDPH 4OKVA 3CD4A 3P4NA 3CFCH 2DLHA 2VAJA 4O2EA 4PV8B 5JW5B 3ELAT 1ZLWH 1ZSDA 2EIZA 4X7CC 4FQ2L 3BP6B 3F5WA 1DVFC 1FG9C 3S35H 3LS4H 1EDQA 2CPCA 1R0AL 2HG5B 4OLZL 4IDJL 4WHDA 4YHIB 3UAJD 5C71A 1QSFA 4HS8L 1VPOL 2BC4B 3IU4H 3JV5A 4L5FH 3TP4A 1EA9C 2YHGA 1Z5LB 1TJGL 5K9OA 1AQDA 1BP3B 4R3SB 5SWSA 4TUJB 2JIXD 3W11D 2XNAB 4UILL 4XPBL 3D1MC 4P2OA 3CUPA 3ILQD 1OPGH 5EU6E 4NSKA 3QEGH 2NY0C 4DZ8A 4RMRA 4YC2C 4I4WA 5EC1A 3G6JF 5L9DL 3F7VB 1J0IA 1NAKH 4L4TB 3PGFL 4ZTOL 5DMKB 5IVOA 1DSFL 2W60B 4KKNA 2P5WB 4YHKL 3E6HA 1G0XA 5EBWB 4NN6B 3UO1L 1I7ZB 5FFLA 2OXGA 2DDQH 1R5VB 3TO2A 3EOTH 3ILPB 1GZQA 5D7SL 3P73A 5LG1A 4AL8H 4LOUC 4XWOD 3IU3B 2KL6A 5BV7B 4F80A 2LTQB 3FCTA 4JFDD 3QEUA 4JREB 3R1GH 3HA0A 5C6WH 4KK9C 1EEZA 5DD5L 1PX3A 4XCNA 3QUKA 2PYEA 2XWBB 3S3JA 4LCCB 3S36H 1NMCC 4OCNC 3QRFM 4CDGC 3I6KA 3T0ED 5FA3A 3CX5J 3TT3L 2W59A 4HC1A 4XPTL 3FT4B 4XVTH 4I1NB 5CBEA 2OS7A 4JFHE 3OKDA 3Q6FA 2NY5H 4PUBH 5HHOE 1MJJB 2DM7A 1FYTA 3VXOA 3I85A 4M62H 5C07B 1I1FB 5FYLL 2X9WA 2AXGA 1G7MA 1CICD 4AK1A 5C0AA 4MNQE 3DX8B 3KJ6H 3LRGA 2QJDA 3B8SA 3T8XB 3TH3T 1JI1A 2F58L 4ZAKD 5C09A 1MFEH 2V5RA 3MRHA 2GY5A 3TO4B 4KROC 1T3FA 2AXFA 3GHEL 5ETUB 1RJCA 4K3EH 1QHPA 4HKBA 3BN9D 3SDXF 5EPMA 4DKEH 3FTGA 4YNYA 4HZLB 1I1CA 2BMKB 4U1GB 3FQXB 3D5OF 4YUEL 8FABB 1LK3H 1J8HD 4HF5H 3QDGD 3EFFA 1X5KA 3X12B 5F9AC 4M6ML 1KJMA 1QYGL 1FRGL 1AO7B 5MENE 5HHVL 2JCCB 3VFUB 5HDLA 4WI9A 1LVEA 1JF1A 3WNMA 4HH9B 4KI5D 1I7UB 4Y1AB 3U7YL 5GS2D 3JTTA 4EDWL 2YZ8A 5JR1L 4WTWA 2VXTL 5HVHC 4KDWA 1F6AA 5DFVD 2R9HD 3HZVB 3HG1B 5DSCA 5CGMA 4D9QD 4OCWH 3U0TA 2OZ4A 4I0KA 3HUJB 3V0AC 2C3VB 5LCVL 3QCUH 4B7LA 4DN3H 5GSVB 3U2SB 1P1ZA 5E6ZA 3KYNA 2EDLA 3T1FB 4JG0L 4U3CA 3LB6D 3BKYH 1K8DA 2ZSWA 3FMGL 1ZGLA 5GS2H 1XR8B 1OLZA 2FEDD 3TBTA 4OCXL 4Q97A 4LLWA 4U6YA 3HG1E 5C6PB 2GEEA 3ARSA 4QRRA 5I1IL 4L4VB 1I8KB 4MB3A 3WNNA 1KIQA 1RAMA 1V7MH 4PY7B 2A1WL 5FIEA 1NCWL 1GPOL 5GHWH 4PJIA 4WU7A 4NKIH 3NCCB 3SCMC 5T3XL 3VFMA 5HY9B 4LKXB 2WWMC 2VXSH 4HPOH 5E9DE 2XKSA 5J12B 1HYRC 4Y19B 1F4WL 4LFHD 4MAYB 1NKRA 5F1OB 2UWEF 4OM1H 1Z9MA 4FFVD 5TE7L 5HHQA 4PJBA 5INDB 5C0GB 4U1NB 1FGNH 4B0MM 3HE6C 3IETA 4XI5C 3G5VB 5FGBC 2ENSA 4KK8C 5J1AB 2APVA 5HGDB 2BRRL 2I5YL 4L4VE 4E5XA 4HJJL 4ZFZA 4D0CB 2YPLD 1RHHB 2VITA 4YO0B 1RVFL 4Z0BL 2A0LD 2JJTA 3B6SA 4FQQB 4NQCB 4GKZA 5IP4A 5E8EA 1G0DA 4NT6B 1GGBH 4Y19E 5D1XC 3D9AL 1K3ZA 4FQIL 1PJ9A 5A3ID 1H5BB 1MWAA 4I77L 4KAQH 1KXTB 5EU6D 5D72L 5CD5C 3ZTJG 2Z92B 5KVMC 4L3EA 2I60H 2R29H 2D4FA 1KEGH 3HE7B 2IMNA 5IBUG 3AREC 3CVIH 5FA4A 3RU8L 2BVOB 3VFVB 1YNTB 1ZA6A 1RZFH 4YHPA 4BFIA 4X5WA 4I48B 2ZG2A 3H9YA 5A2IH 3KPTA 4EI5D 1WAAE 3CFIC 3OSKA 4R96B 1YEEH 2NMSA 3CIQA 4HX1A 4R0LB 3O4OB 4LASH 2W65A 4R7NA 2UYLA 4DUWA 3DV4A 1RPQA 5T1MA 2FIRT 4Z7QF 4NQCE 3SDDB 1U58A 3QQ4A 4JFFA 1XGTA 3PL6C 4OBRA 4Y4FD 2A77L 4G9FD 4M9PA 3ORJA 2WBJC 2HKFL 3SDAD 3U36A 2X4TA 3OR6B 3PWVA 2XFXA 3OKEB 4IMLA 3L7EA 4M4RA 5A2FA 1RUKL 3O9WD 4NQDB 2NY4B 4QHNB 4Z5RA 1I3UA 1AXSB 1WFUA 1CFBA 1BGXH 4A6YB 4FP8L 1KB9J 5DRXA 5DVOA 4MDJB 3RKDC 1RD6A 3IFPB 2DS4A 4AY0A 5DWUH 2VLRB 3QIUB 1A6PA 5CJXC 1ORSB 4Z76B 4LARL 2FJHA 4EI6A 3PIQA 1OP3H 3W9EB 1LO4H 3QT2A 5D4QA 1GC1L 5DS8B 4N5ED 1T0NA 5E2WL 3QHTC 3VW3H 2Y36H 1N64L 3DIFB 4JFHD 1CGTA 5HHOD 4M1GH 1T0MB 1S7UA 1E28B 2X70A 4PJHF 3MLPA 5MEOA 2WNGA 1JWMA 1AE6L 3CDGA 1SEQH 4Z7VF 1R5IB 3FAWA 4GG6A 4M7KH 4XNZC 4I18C 3PHQB 5EO9A 4GBXC 4MNQD 3ZHKA 4LRIC 4UMGA 1YEIL 3HNSH 4NO5B 4FNLL 4HUVA 3CH1B 4M3JA 1OTSD 3TYFA 3AU1B 4FMKA 2CKBL 5D2NE 4HFWA 5K9JL 1KTKE 2AJXH 5TQ0L 3VRJA 4NO0A 5BVJB 3KR3L 4MA3B 1NL0H 3JWOH 1GVIA 1RUQL 3H3KA 1KF9B 3IS1X 1C5BL 4L8DB 1JUFA 3P3YA 2XQYK 4CVUA 5T33L 4JHZA 3ARBC 4OKVB 5EU5A 4FQHB 1L7TH 4O2EB 3RVWC 1ZSDB 3RIAK 4JRYB 2VLLA 3F5WB 1N5YL 1SY6L 5D1ZA 4FZ8L 4G6KH 4MZ2A 5IOPA 5L6YL 5MEND 2ZPKH 5I75B 5EBLB 1XR9B 5HGHB 5HI4C 4OD1H 5GRVK 1TETH 2AEIT 1IGFH 2ARJA 3EOAA 3IGAA 5D7LB 4JM2D 3BJLA 1OAXH 1GGCH 1FO0A 4G5ZH 4JANA 4E42A 2GUOB 2YSSB 4WJ5B 3IFOA 3K0WA 5DZNA 2FJFA 4DEPC 3QNYA 5T5FH 1VHPA 2DQUL 4P2OB 3O6FC 3CUPB 4L8CB 4NSKB 1FVDB 4DZ8B 2HT2D 2XXMB 2CRZA 4ZODA 1MNUH 3GRWL 1IM9D 5BS0B 4BZYA 1MCNA 3QAZC 1N8ZB 3EDJA 2H9GA 5KS9B 4UUJA 5I9QB 1DBBH 1DBKH 1QSFE 2LQRA 1HQRA 5J3HD 3C8KA 4NM8H 3GMRA 3HPJA 5J56B 5SWSE 3EAKA 1U3HA 1FH5H 1NGXB 1FJ1A 1N2RA 5CD3A 1YEFL 1VCAA 5CFHA 1KB9K 4GRWE 4RGNC 1MFBL 3P73B 4JQIH 1ZAGA 3RWFA 3S4SA 2HMID 2B1HH 4PLNC 3OAYK 3ZE0F 1CBVL 1P69B 3UPRB 3ULUF 3OAZK 4Y16C 2Z31C 3TIDA 2NXYC 3QEUB 1EXUA 2CR3A 3VXSB 1J5OL 5I19H 4WO4C 4P9MH 1YEHL 4JN1H 4XRCB 3TN0C 2P8PA 3U9PH 3X13B 4PP1C 3LDBC 4KHTL 4OLYL 4XCNB 3EIFA 3KS0H 3I75A 1UWGH 2V7NB 7FABL 3DUSA 1KTRL 3BQUC 3I6KB 3MRNA 5FA3B 3FOLA 1DQDH 3UTPD 3H9HB 2EDXA 4AJ0A 1UGNA 4HHAA 5CBEB 5BXFB 4IOIA 1I85C 4TSBL 2B1AH 4YHLL 2R23A 3MV8A 1HCVA 2R4RL 5DRZA 1YMMA 2DIBA 2QR0B 5IB1A 3STLB 1P7KB 1L0XA 2CDEA 1WZ1H 3E6FB 1MCFA 4K3DL 4Q6YA 5C0AB 1MFAL 3GMLA 5EO1A 3VXMA 1UJTA 1DUZA 1UB5A 4NBXB 3GM8A 4FQCL 1FQ9C 3SO5A 2PYEE 3QDJB 1BZQK 3MRHB 1TPXB 3LRSB 3VGAC 4Y2DD 3DV6B 3GMNB 3N9GL 4JR9H 3OL2A 3V6OA 4GT7A 2AXFB 2MQ3A 3OKLA 4EXPX 1QKZL 1L4IA 1NCTA 4RFNC 5GJTL 1EO8L 5EPMB 3PJSB 4RAVA 2KKQA 3QI9A 1D5BA 1HHGB 5E1AA 3FTGB 4OB5H 2WUCL 1LEKA 3V4PH 4Z7OE 3LD8B 1FYTE 1QSEA 4PTTA 1DL7H 1SVZA 5DGQA 3B3IA 1UA6L 5DJYA 1KJMB 2IADA 2PCPB 3ALPA 3S5LG 3FOMA 5C0AE 5IW6A 1DJSA 1SEBA 1S9KC 4FFWD 3WJLA 1JF1B 5C09E 3MA7A 1FG2A 2XZZA 4FZEH 1T2JA 3UTOA 3DSNA 3JTTB 4UQ2B 2N4IA 3O11A 2UV3A 2OK0L 1F6AB 3GO1L 2ADJA 4J2XA 4HPYH 1AR1C 3ROLA 1UH4A 1NCUA 5JIHA 4XAWL 1BMGA 4BK5A 2ZUQC 1VFUA 5AAMA 3U0TB 1ZXQA 3ESUF 3MRPA 5FB8A 2JCCF 1PKOA 2J8HA 1QPXA 3HB3C 3NAAL 5SWZA 1U8JA 3C5ZD 4YH6A 3KYNB 3PQYB 5E5RB 1FN4B 2JJUA 4MXVE 5T3ZE 1WBZA 1ZLVK 2ZSWB 1CE1L 5I0ZA 1ZGLB 1P6FA 4L8SC 4OF7A 4WI5A 5IJVA 3TBTB 1BFVL 1MCEA 3HUJF 4NBZB 5FUCC 5ICXA 2R1YB 3SQOH 3KYKL 4ZSOB 1A3RH 4M5YH 2C26A 3DVNB 2PO6C 1PEWA 2YN5A 2V9QA 3IDIA 4PJIB 3V5HA 4DVRH 2NW3A 4EUPA 4BYHA 3SO3B 4MCZB 1KB5A 3VFMB 4XXDA 5MEPA 2IWGA 1GGIH 2BXYA 4XX1G 4PR5A 5ITFB 4PLJD 2B2XL 4U1KA 2QTEA 5KVDL 4A6YH 1KNOA 3N50A 5I1AB 3QXAA 5HHQB 4WFGE 2NY7L 1ZKAA 4P4KA 1MUJA 1EVTC 2P4AB 3EHBD 1UVQA 3IETB 3VXQB 5TDNB 2ZJSL 4M9OA 4IIQA 4YK4B 4QRRE 1HZHH 2G9HB 4HAGA 4OF6A 4ZFZB 3QNXA 1I8MB 5KAQG 1JYXA 4PJIE 5TDOA 2VITB 4EKXA 2HJKA 4M8QA 1K85A 4M7LL 3B6SB 4GKZB 4NYLA 2HA1A 1G7PA 2X40A 3EJYD 1WC7B 5MHSE 5FYKU 1C7TA 4JPIB 1CF8L 4KRMB 1XCQA 5CGTA 1XGUA 3A0OA 4FQ1H 4Y7MA 1P7QA 4PJBE 1F6FB 4KC3B 4MD0A 1A47A 1PQZB 4BFBD 4HQQH 2Y07H 4WIQA 5BJTA 4YHPB 2VAAA 1V5JA 4X5WB 5JXEC 2B39A 4GLRI 3VGHA 2H2SC 4JN2B 5EA0L 1Q72L 1QZ1A 2GTZB 1QSFD 4NWUH 3VI4F 3SJVB 2DWEA 4HX1B 3RJDA 1KJ2L 5IUSA 4ZXBC 2CMRL 5D71L 5SWSD 4R8WL 1IILE 4YQXL 1U58B 4NRYB 3QQ4B 2ZUYA 1XGTB 3HI6H 3VH8G 2ITCA 4EN3A 1GGYA 2IANA 1RZGA 2X4TB 3RGVA 3MLRH 4LPUA 5F1IB 3PWVB 4L3EE 3EJZD 3T77A 2NW2B 2IMMA 2XFXB 2VE6A 4LGRB 1MAML 3V4VL 3OXRB 4S1QL 3WS6A 1OVZA 1WEJL 4HUWB 4LVOB 4P23A 5A2LH 4Z5RB 4JPKH 3MOAL 2DQIH 1GHFH 2B5IB 3FN9A 1A6TA 3E2HC 3R06A 4GAJH 4DW2H 2ICWA 1A1MA 3QXDB 1WCBA 1I3GL 5HYJA 5IVNA 1Y0LA 4EZMA 1NFIA 3L1OL 3MYZA 5B38G 2IAMA 2FJHB 3FQWA 3O2WL 4EI6B 4IS6A 1LDPL 3CFCL 3DJ9A 5ICYB 4UINH 4GRWH 4JFFE 5B21A 3EOYG 1J0ZA 3V2AR 5BO1H 3S35L 4XNYL 1S7UB 2X70B 1NMBH 3LS4L 3RJQB 5MEOB 2P7TA 3BUYA 1RK0A 4QWWC 3CDGB 5IROC 4GG6B 4R4NC 2FLBT 2VWEE 4QF1A 3THML 3P9LA 4J4PC 5L2KB 1DE4A 2YWYA 4HKZA 1PVHA 4NN7B 1J8KA 3MC0A 1AP2A 4HUVB 4L5FL 3IU4L 3U7AA 4LU5H 2PYED 4BUHA 1OQXA 3SDCB 2EKSA 4IOFC 3GGWA 4LCWE 5B8CC 3MBEC 1YJDC 1A7RH 2YK1H 4Q2ZB 3VRJB 5IW3A 3ARXA 2FH8A 1MPAH 3U46A 1OPGL 4PGJA 3QEGL 3C60A 2OM5A 4MDIA 3ESVF 5DUBA 2AGJH 1JUFB 4NGHH 3QUZD 1FYTD 3DROB 4HMDA 1MY5A 1T5XB 5GJSL 4WWKA 5DO2C 1NAKL 5IOPB 1S7RB 1HKLH 4CADA 2EE3A 5C09D 1UG9A 3IGAB 1B0RA 2CO6B 2DDQL 2DICA 3ZYOA 3STZA 4HC1H 3EOTL 4NQSB 2VZ3A 2B8OT 5IEHA 4K94H 1D6EA 1AFVH 1TQBC 5ERWA 3EYSH 3QEQB 3VWJA 4LNRB 3QNYB 4AL8L 3MRQB 1JGLH 1BECA 2A6KA 4NQEA 4CU6A 3R1GL 5A1AA 4ZPTA 3MUHL 3RWCB 3QZWA 5T1LA 1UJ3C 3CSBA 3UJJH 4F7MA 1XF5B 4WW1A 4N0YL 1TITA 3N1GC 1FL5A 2VDQH 5GGQH 4K9EC 1HQRB 1NC2A 5J7CC 2JJVA 3GMRB 1TXKA 1U3HB 2NY5L 2XKNA 1P4LA 2MPAH 2DQJH 5C2BH 4M62L 5MI0B 4WW2B 2FO4A 3WUZA 5FO9B 2RIKA 1LD9A 1S9VA 1XAUA 4JRXA 4NBYB 2XZCH 5E5MA 3TM6A 5IG7A 1V05A 4UIKH 2XG5A 3OGCB 1MFEL 2BVUA 1BWWA 4PRNA 4MAUH 1CR9H 1OP9A 4WFGD 2A6JB 4OQTA 4ESKA 2R0KL 1XEDA 2Q7YA 4K3EL 5HYEA 4S1SH 3ZDYE 2VZOA 2UZIH 3BZFA 3I75B 1GH7A 4DKEL 5SWQB 3DUSB 4QRRD 1K9TA 1QNZL 4HF5L 2ZSVA 1EIBA 2GJ6B 5AUMB 5T1DH 4IOIB 3UTTD 1UCTA 1DVFD 4YZFF 4YEEA 1P9MC 4OCRH 5JOPE 2VABA 1Z2KA 2XTJB 5C86A 2E8YA 5MHSD 5IB1B 1IKNC 2GSGB 3NPSB 5IMKA 2A2QT 4IRJC 2J4WH 1NAMA 4IRSA 2VDLH 3GMLB 3RUGB 3WNPA 1SM3H 4XPGL 1CDBA 1N3NA 1DUZB 4POYA 3WFDH 4N0FA 5EB9A 2MNUA 3QUXC 2ED9A 2NY2C 4NZTH 4KTDH 2J5LB 1DCLA 3REVA 2BOCB 1RUMH 3L5HA 4XC3H 5EU4A 3OKLB 4OCWL 5E2VH 4UAOB 1M7XA 2ICES 1W72B 3MRIB 3QI9B 5E1AB 3S35X 1LEKB 4J3SA 3MV8E 3MOBH 1WZMA 1QSEB 1CLZH 4XVUD 1KGCE 5I1CH 3BKYL 4PTTB 2I9LA 4XGZB 4ZUUB 4K2UH 1YMME 3DBXB 5F89B 3B3IB 2R15A 2EDQA 1ZE3C 4UU9A 4ZFOA 2YUXA 5DJYB 4L3ED 5I1GH 3FOMB 3UJIH 4Y5VA 3VXME 1R3IH 1A6WH 3HI1B 3EUUA 2BSSA 1E4XI 5HBBA 3MA7B 1FG2B 1MCCA 3QDGB 3D85A 4W6XB 3RZWA 3V6OE 1BX2B 5L2JA 3GSOB 3OJVC 3U6RA 4PRHA 3QULA 1V7ML 3BSZH 4WI7A 2ADJB 5D2LA 5JPMB 1H3UA 1R3KB 4NKIL 1XIWC 4LMQI 4NKMB 2VXSL 3VGDA 4HPOL 5BZWA 1LEGA 1QSEE 5FGCB 1MWAH 4JFFD 3MRPB 2Z8WC 4JY4A 3K2UL 1U8JB 4U2ZA 3VDAA 1F00I 4CRPA 5J11B 1FGNL 2H1PH 1EMTH 1T83C 3QIBC 3VCLA 5CGYC 4RQQB 3MV7A 3TZVD 5I0DA 5IJVB 5DEGA 3FL7A 3L7FA 5CMAB 5I16B 3WHXA 3ZDZE 3OKMA 1QVOA 4LCWD 4F7EA 2IC2A 3TC9A 2HLAA 3H9SD 4I3SH 1GGBL 5FGCE 3DVIA 4XCEA 5F6HJ 5M94B 3V5HB 4EUPB 3H3PH 4KAQL 1I9IH 5SWZE 2I60L 1KB5B 2R29L 4XXDB 1KEGL 5MEPB 2E7LA 5GSRA 4PR5B 1U92A 5JIIA 1CFSA 3CVIL 1RZFL 3MV9D 3TEUA 4KROD 5IVZA 2GCYA 4Y5XA 1JZ4A 4P4KB 1U3JA 5F9OH 3UJTH 1YEEL 1OAYH 3KPQA 1MJ7H 4LASL 3SGJC 4IIQB 4PJIF 4PRDB 2RJMA 1EGJL 1I75A 4NO0D 3ARGA 4LIQE 4OV6F 3C6LB 5TDOB 1KLGB 4M8QB 1S5HB 1Z6JT 5F9WB 4RMWA 5KOMC 1IEBA 3B9KC 1E4KC 1BJMA 5GZOD 4PRID 1XF1A 1EAPA 4M61B 5D1ZD 5C9JA 4H1LG 3KPSB 3NABH 4QHKJ 3J7HA 4UOJA 3SEPA 2NPLX 1F2QA 2ZUXA 4KK5D 5DWUL 3T3ME 4PGBA 4YDLC 3HRZA 2UZXB 5ALBH 1LO4L 2R2BB 4OZ4B 4FS0A 5ABDE 4G8FA 5CSZB 3GMQB 3DUUA 1Q9WB 1WIOA 2Y36L 3HKFA 2BSTB 3VW3L 2FJGA 4M1GL 4NFCA 3RZCC 5ELIA 3QPXL 1Q9LA 3FO9B 4FQPA 1SEQL 3H0TA 2IANB 1OM3H 4EN3B 2HFFB 4MNHA 3RGVB 4M7KL 3AFLA 2NNAA 3HNSL 5IMOA 4J3UA 3NPZB 3WDIA 3ZL4H 1HSBB 2IJ0C 3QDMB 4G9FB 3ETBF 2XPGA 3MNVB 2AERT 3EYVA 5DJ2A 1FO0H 2AJXL 3IDJB 2HWZH 3T0BA 5IT2L 4WV1C 1TQCC 2PNDA 5HYJB 4KUZH 1Y0LB 1NFIB 1NL0L 3SKNB 4ENED 2IAMB 3JWOL 5DLMH 3KPMB 4CU7A 3FO0H 2IQ9H 3FQWB 1K3IA 1YY9C 2OL3A 4YPJA 1L7TL 2IANE 4P9HH 1EAJA 1B90A 2P24B 4G6KL 5LKNA 3BVNB 2ZPKL 2CIIB 3BUYB 1YEJH 4KMQA 2C7UA 4XI5D 4HDIA 4OD1L 3MQIA 1IGFL 2CDFB 1IGJB 3P9LB 4QF1B 5AYQA 1S78D 4HKZB 4O5LL 1MI5A 2X4NA 1AP2B 2D31B 1G7QA 1GGCL 3OAYH 4M5ZH 2X4QB 3E0GA 4X6DA 3FZUD 3WEXA 3D3VB 1KT2A 2EKSB 4OLXH 3NBNA 2X05A 2R2CA 4QXUH 5T5FL 1WGOA 5D1XD 1A0QL 3TPUB 1CFVH 5JO5B 3SQBA 3C60B 2PETA 4MDIB 2XTLA 4LL9A 4PB9H 1JGDB 4ODSH 3MRMA 4GG6F 3MV8D 5I8OH 3ARED 1KGCD 3MR9B 1YMMD 3CNKA 1TDQA 5FOJA 3EYQD 2YPKA 4GAGH 4N0RA 3VXMD 2A6DB 4LDOB 5DD6B 4NWTH 1DBBL 4M1CC 5BRZA 1DBKL 5D9SA 4CADB 2FGWH 4GRLC 5J1TC 3RIAF 5IIEB 1FFOA 4CMHB 3UCRA 1H8NA 3WUWG 4NM8L 4TTDC 4F37K 1B0RB 5F1KC 1FH5L 3STZB 3QIWC 3GUTA 2GW5A 1H3PH 1L7IH 1RJYA 1MJ8H 5IEHB 1LO2H 4U7MA 2EYRA 5C0CA 4JQIL 4KZEH 1XCTB 2B1HL 3RBGA 1OW0C 4GW4B 4LBEB 1OL0A 3HAEG 3GJFB 2A6KB 3FO2A 4NQEB 5I19L 2R1WB 4P9ML 4JN1L 2EXYC 5GRJH 5HHXL 3HMXA 3U9PL 4Y0GA 4UB0L 4ZPTB 3QR2A 4LLUB 5KANI 1XGYH 5T1LB 3DVFA 2RFXA 1UWGL 1W8OA 3U7WH 1FL5B 5ISZD 3RY6C 1OGTA 1QRKA 1U8HB 3TJHD 4MJIA 4I8DA 1MHEA 1NC2B 1OD7A 1S7QA 1LEIA 1VGEH 5BMFH 1U8OA 3GK8H 1F6LL 3TA3A 4O2CB 3JV6B 2B1AL 2VIRB 4ZPVB 4GRMB 1DR9A 5FOBA 1P4LB 5DZLA 3CFBA 4JHBA 4YHYB 3ALXA 5J13C 3ARFB 4NQEE 4CMMA 5SWZD 1MELA 1WZ1L 1BJ1H 5D7IA 5KSAA 1AY1H 4PB0H 3CLEH 1U8NA 1WICA 3CJJA 5D7JA 1KCVH 2UVFA 4FABH 1QLFA 4ZD3H 3PV6B 5CJ8A 1P53A 2LVEA 3IFLH 5CAYB 4JR9L 1RURL 2YXMA 2SEBA 2ZKHH 2Y5TB 4Q6IA 3FQNB 2OTWA 4FN0A 4HJ0C 4MNGB 1HHKB 1WWCA 2BDNL 3BZFB 4WW2F 5ESVB 4OB5L 5D1QC 2NTSP 5CIPB 4TPRH 4BKLB 3VE0A 2WP3T 2Z93B 3V8OA 2ZSVB 1DL7L 2VJXA 1FV1A 4LHJB 1JGUH 2YEZA 4KDTC 2MKWA 4JKPH 2FYYB 3EYFA 4GMTH 1X5LA 4JRXE 4LLQA 3OKOB 4GXVL 2AJZB 5GS0C 4AIOA 1BFOA 5I17B 5IMKB 3RY5A 1NAMB 2DWDB 4HK3J 3DMMB 1KC5H 2JELH 4PJGB 4S1RH 2Z4QA 1XZ0A 4Z7UA 3HC0B 4HPYL 3RWJA 3VXUD 3REVB 3NA9L 2JJWA 4JZOA 2VLKD 3BIAX 2H2PD 1HILA 2APTA 3E3QC 1G7IA 5AZEH 2DOCA 2W9LA 3CU1A 2AEWA 2HLFD 2AQ3A 5B3JE 1FFRA 1NDMB 5J6GA 3IDNB 2M1KA 1WVZA 4NPYA 4QTHA 4ZO6A 3RUGF 3JXAA 4ODUB 2I9LB 3PWNB 5GGUA 2Q86B 3VG9B 4KKLC 2C3WA 3ARQA 4ZFOB 2KUTA 4KRLB 1NGWB 5JNYA 5HYSA 4R2GC 1JJUA 2MOVA 4U7SA 3AB0B 8CGTA 1P7QD 3U79A 3O3EA 3GSUA 4Q0XH 3DX9A 2DJ4A 2FEEL 4Y4HA 5DK0A 2R1XA 1M7DA 4HV8A 5HHMD 4PREA 3D85B 3SQOL 5L8JB 2GI7A 4RCAA 1A3RL 4M5YL 1F11B 4MZ3A 3KXFA 4B5EA 5HYFA 5L2JB 2CXGA 4PRHB 7CGTA 2O61B 4UBDC 15C8H 2ADIB 2I26N 5D2LB 5T1KB 4DVRL 1WUNT 3BGFB 4CUCA 1GGIL 2K3TA 3IRZA 3ULSB 2OCFD 1LEGB 5DRNA 2DQFB 1YECH 2Q76A 3QA3B 4U0RC 4WO4D 4JY4B 3TN0D 1CDYA 1WFOA 3FN3A 5E6IA 4P5TB 3WLWD 1CIDA 3VCLB 4QRTB 4QY8A 2DKSA 3PGCA 1ITCA 2W91A 4MD4A 3TESA 2PXYB 3CZJA 1DBJH 3MRLA 5EO0A 5CEZE 2CUIA 3ULVF 3UP1A 1HNFA 1HZHL 2BJMH 3D2UB 4PRHE 5EULV 1JWUA 3HNTH 3WIHL 5D2LE 3WHXB 4AIZB 4KJYB 1OTTC 2CGRL 4R4BB 4QLRA 1CU4L 1QEWB 2X1OA 4MD5A 1FNSH 4ACPA 1FZMB 5HHPB 4Z18A 4C54A 1BOGA 4OZFA 1IFHH 2X4PB 3KPOA 1TCRA 3DX6A 4FQ1L 3O3BA 1CFSB 2VXVH 3TVMA 4HQQL 3U30B 2VH5H 4PJ8B 3RX8A 4F8QA 4R90H 4OV5B 2Y07L 3O3DA 4U1IB 1A4JA 3CPLB 3C2AH 4P46A 5IVZB 4X0KB 1A1NB 3MV7E 4XWGL 1EBPA 1JWSA 1UXWA 2VDRH 3AM8A 3ZKMD 1FCCA 4NWUL 3MACH 1PY4A 3EO0A 1OAZH 2XN9A 3RP1A 1MIEL 3LN4A 3O8XD 1DLHB 5F93C 1S8DA 3HI6L 4YAQA 4D0DB 3MRKA 43C9A 3MLRL 3BXNB 3L3JA 1D3CA 2DIAA 4DGVH 1JNNH 3VI3E 1CLYH 4QXTA 1PLGH 2QL1A 1S7TB 3BT2H 4KRPC 1EAPB 4JPKL 4WWKD 1GHFL 3JUYA 5HGAA 4PV9B 1I9EA 4DW2L 1ZHBB 3MGAA 4M93B 4H5SB 3WN5A 3T09A 4WHCA 2VNCA 3HRZB 2MJWA 1MJUH 4UINL 3DUUB 2VLJA 3PXJA 5BO1L 3VWJD 4F7TB 5C70A 1HXMA 1NMBL 3IRPX 3VRLE 1IM3B 5KG9A 1JI2A 1JP5A 3QDAA 4MNHB 3L3KA 4I0PA 1J87A 1XFPA 5IMOB 2WQRA 3PXHA 4LU5L 5D96B 4TVPE 5HDOA 4HXBH 2XPGB 1QRND 3HS0A 5FO8A 2PO6D 3WE6A 5DMIH 1UT9A 3O3AB 3RX5A 1A7RL 2YK1L 3SGEI 4L29A 5EORH 2HRLA 1MPAL 4JZNA 4K3JH 1YEGH 3DUHA 4GH7B 5H94A 3LV3B 4ZFGH 2AGJL 3MBXH 2X10A 1ZTXH 2RAMA 4EBQH 4NGHL 1NANI 1OLLA 2OL3B 3RTQB 1I1AA 1S3KL 3MOQA 1W0VA 3HR6A 4G8IB 1J05A 4UIMA 2DIJA 3SCMA 1JE6A 1Z9SA 4KJQD 4JRXD 1QLRA 1KCKA 1YEDB 5DQDH 1HKLL 3VXRB 4PJEA 2C7UB 1INDH 2YUZA 4HDIB 1B0GA 1O7VA 3ARWA 4LLYB 4QO1A 2E7CA 1LILA 1VEMA 1G7QB 1S9WB 1IQDA 2NY6D 3MXWH 4LVNB 4FOMA 3WO4B 5EZJA 3VWKB 1KELH 4K94L 5CBAB 1AFVL 1KT2B 1ZGLM 1WFNA 1RJZB 4RMQA 3TIEB 1JGLL 1G7LA 1U8KA 3MMEA 3O3UN 3OPZH 4PP2B 3RIFK 4ZYKA 1AGDA 1ZLUK 5CZVL 3F8UB 4OFYD 3UJJL 1T89C 4IRSD 4OQTH 2DQDH 2VDQL 1MI5E 4G43A 5GGQL 3BWAB 5DTFA 4X6DE 2XA8H 2E6PA 4KKCD 4XNQB 3EO1A 3RQ3A 2MPAL 5EDXA 4P2RB 1A7NL 2DQJL 1RJYB 5C2BL 4JY6B 4JGMA 4H25A 3KLAB 4JPVH 5J4MA 1CL7I 2EYRB 5C0CB 3QUMA 2N7AA 3I2CH 3S9DB 4GW5B 2XZCL 4K7FA 4J3VA 2MCPH 2H32A 2V9RA 2P45B 1H15B 5BRZE 3MLZH 4RMVA 4DJMA 4MJ4A 4LNVA 1FC2D 4Z9KB 4D8PA 4N0CD 2NYYC 3HZYB 2UZIL 1ONQB 3RDTB 1JF5A 5CEZD 2AK4B 1JGEA 1OGTB 3CXDH 1JZ3A 4MJIB 1MHEB 1QP1A 1S7QB 2DLIA 2GY7B 3ALWA 2P47B 1KIRB 3IJYA 5T1DL 1GOGA 2YD6A 2VOTA 5C0CE 1MQKH 2PTVA 3BKCH 3MRFA 2ZG1A 5CS7A 4WU5B 2YD5A 4OCRL 4YBHA 1I8LA 3P11H 4OKDA 2EDYA 5D7IB 1FC1A 3V4UH 1HHJB 2J4WL 5F7FA 5KSAB 1J88A 1QBBA 2VDLL 4XXCC 1SM3L 1A14H 3CCHB 3LCYA 2OI9B 2V5YA 4OF8A 3WFDL 2MKLC 3L5WB 4NQUA 4KTDL 4NZTL 4IOFD 2EYSA 5CEZH 4GW1A 4EOWH 1IAIM 1RUML 4ETQB 4X6FB 4GBXA 4XC3L 1VERA 2SEBB 3TGXA 3ARDA 2HJLA 2OTWB 4MJIE 4PJFA 2VR4A 5E2VL 5BW7A 4FA8A 5E8PA 1FNGB 4ZUSA 2NZ9C 3VE0B 3MOBL 3IXAA 4K2UL 1FV1B 4XP6H 2YEZB 3KPRD 5D7IE 2FECI 3UJIL 1R3JA 5DHVB 4R7DA 1GGTA 4LEOA 1R3IL 1ZWIB 4LLQB 1A6WL 3RY4A 3ARBA 2CKNA 2BVQA 1ORQB 2L4OA 3MRRA 4M6AA 2QADC 3KPNB 5GIRA 1JNLH 5F9DC 2BK8A 2XWJB 1U8MA 2O5YH 3BSZL 2Z4QB 4V2CB 4Z7UB 1UXSB 3W0WD 4WUUD 1K4DA 5B3JF 1Z9LA 3A6CH 3MPCA 4HWEH 3ARGD 1MWAL 2GSIB 4JPWH 2HT4D 5GGRA 3INUH 1MVUB 4PPTA 1DN0B 4RISH 5J6GB 2C1OB 2F5BL 4QTHB 2VRAA 4PJ9A 2X4UA 3KPPA 2H1PL 2FGZA 1EMTL 1EHLL 3RI5K 1A5FH 2J6EL 2RHEA 3O6FA 4PJGF 5JNYB 1T04A 2NY0B 5IB3B 1EHNA 1WZKA 5IGXH 2QSVA 3GSUB 4YC2B 1KFAH 2AV7B 4Y4HB 3PWLA 4NKOA 1M7DB 2EE9A 4HV8B 4JDTL 4PREB 4HIXH 4X7TB 4LKCB 4Z7UE 2FSEA 3N1PC 2VQ1B 4I3SL 3D69A 4HUMB 5I1JH 2P8LB 2NY1C 3H3PL 2DJUA 2HRPH 1I9IL 2OJZH 4L8BA 1KSRA 3ZHDA 2XZQH 4H88H 5I74C 3QXVA 3U0WH 4Z0XA 5IWLC 2BX5A 2Q3AA 1KACB 3NCYS 4RBPK 5IBTH 3MYJB 4MA7H 4OSUH 5JHDA 2GFBA 4FXKB 2NZIA 5C0IA 3HCVB 3NCBB 5GGTA 3NFPA 2IPKB 3OHXB 5F9OL 1AI1H 3UJTL 1OAYL 4PG2A 4YFDB 4LAQH 4MD4B 5D2LF 4PGEA 2MHAB 3KXFE 3PWPA 2P8MB 1MCOH 2RB8A 2ZZUT 4G8GA 2QEJA 4AENA 5MEQB 5KN5B 4YPGB 3FONA 1JWUB 1KLUB 2QQNH 3S5LA 5I71C 5B39G 5IQ9B 3IAQA 1NMCB 4X4MA 2DN7A 2J3SA 1LP9A 3V6FB 1OARH 4MD5B 1NFDE 3BDYH 5EOQH 1TCRB 3DX6B 4OGYH 5INCA 5TJWK 3NABL 2R2EB 4ZUVA 3BIKA 4QEGA 3O3DB 2DM3A 3LAFA 2CD0A 1A4JB 4NRZB 4P46B 1F8TH 4FQXC 4U1JA 5BQ7A 1RHFA 4JFZH 3DETC 5IR1A 3VD9A 3C9NA 3MCKB 1JPFA 3DSFH 5F70A 1MI5D 1T80A 5ALBL 4JB9H 4M7ZC 4P5MB 5E00B 5FM8A 4RDQG 5F3HB 1FFQA 3EO0B 2XN9B 1BM3H 4WHYG 3H42H 4X98B 1QFUH 3WJJC 3M17B 4M6NH 1S8DB 4YAQB 2A9MH 1OM3L 43C9B 5C0ND 2EDKA 1I4FB 2FB4H 4Y4KA 3O41A 1N5AA 1YN7B 4C56B 3OV6A 2VLME 3KYMB 3ZL4L 4WRLA 5CJBA 3UYRH 5HGAB 5E56A 5C0JA 1E27A 5KZCD 2IEPA 1FO0L 4JZJC 5BRZD 1ZS8B 3E1F1 5IFJA 1WTGT 2BNRB 4KUZL 1EPFA 4AEIL 1XIWD 3SKOA 3UAJC 5DLML 1ITBB 3BW9B 1NCAL 1U91B 2XN9E 3NIFF 3FO0L 2LABA 4Q74A 3X3FH 1S7XA 3SHSA 5EUOB 2OR7A 3VRLF 1OAUH 5KSBA 3W11C 2VLJB 2HP4A 4KTEH 2AEQH 4V1DA 1LDSA 3VDBA 1HXMB 5ACZA 3QIBD 4LDEB 5CGYD 1U95A 3MODL 1YEJL 2UY6A 3L3KB 4BSWA 3QCVH 3P0GB 4CJ1A 3TCLA 4LCYB 2P5EB 4UZGA 4M5ZL 3QPQD 4CVZA 4EEEA 5KOVC 4WFFE 4OLXL 1NJ9B 2WLYA 1EO7A 3EO9H 1NUFA 2FBOJ 4QXUL 4E9LA 1KG0A 2D0FA 4PJDA 1KTDB 4JRWA 4LK4A 3VFNB 1T7VA 4JZNB 3T3PE 5GS1A 3T1WA 4PRAB 5IBUB 2VLJE 3TA3D 2EDJA 5JDSB 4ODSL 5I8OL 5TE4H 1I1AB 4LHUA 5FDWB 2XWTA 4XWOC 1DQMH 2GTWA 2OQJB 4PBXA 1MIMH 2UY7A 2C1PB 3LKQB 4UIMB 3RVUD 1W2KT 3SCMB 5T5NF 4X8XA 4JLRB 4NWTL 2FGWL 1OAKH 5D7JD 4HBQA 4PJEB 2H6PA 1GRWA 2X1QA 3WNOA 4OCYH 3QJFA 3QCTH 1H3TA 5FDYA 1NLDH 2YRZA 4HUXB 1FORH 3HE6B 3P0VH 1H3PL 2ESVB 1VB9A 5DQ9A 1MJ8L 4L9LC 4MQXD 1LO2L 3T0EC 1LHZA 4APQA 4KZEL 1LE5B 2ITDA 5JPNB 1TJHH 3BEVA 4HAFA 1UWXK 1M05A 1MRFL 2ZOKA 2OJEA 1A6AA 5GRJL 4OFDA 5I1DB 5CJ5A 3SE8H 4ZYKB 1AGDB 1R24B 3UC0H 5EC2B 1BIIA 1XGYL 5B38A 4PJEE 3G6JA 1RK1A 5DHYA 5IW1B 1KEMH 3BP4A 1I3RA 5FKAA 5I8CA 1VGEL 5BMFL 4AH2A 3GK8L 1G6RA 1WV7T 2QHLA 5JXEA 3EO1B 3BN9C 4XMPH 3RNKB 1P4IL 3RNQB 1WWBX 1BBDH 1R3LB 2E27H 4CVXA 2YRPA 4J8RB 5DDHA 4DCQA 3QUMB 3PDGA 4QXWA 1HQ4B 2FD6H 1IGYA 3CFJB 3IF1B 1AY1L 1TVBA 5K59E 3IVKA 4PB0L 3CLEL 3GZKA 3G5XB 1SHMA 4I5BA 1KCVL 4OIIH 3PL6B 2WBJB 2H32B 4FABL 4ZD3L 3JWDC 3IFLL 1AXTL 5KVGH 3EYUL 43CAB 4ALAH 2ZKHL 4FFYH 1VDGA 4U6XB 3W5MA 3CFKA 1IGCH 5IB5A 1YZZA 5A2JH 2R4SL 3KXFD 4TPRL 5FUOH 3HC3L 1U0QA 1T1YA 1OB1A 4DQOH 3GSRA 3S96A 3LPWA 4JKPL 4GMTL 5J06A 3HNVH 4QRPA 1FNLA 4FQJH 5E6ID 1X7QB 3BIBX 3LB6C 1D9KC 2EDWA 2V2XB 1KC5L 4ODWA 2JELL 3GSVB 2CLVA 4S1RL 2CO7B 5IQ7H 2A74A 2PR4H 2EEAA 2VDKH 5ADPH 4QRSA 4XNZB 1WBYA 4GBXB 4XAKD 3ARDB 2HJLB 4XCCH 3U48A 4J7RA 4W4NA 1ADQH 2PW2A 1CFQB 3QNZA 5E8PB 4ZUSB 5D7IF 3VXNB 3B43A 4QTIH 4KY1H 4DTGH 1J10A 4XCYA 3W9DA 1T7YA 3X3GH 2NXZB 3L3HA 1N6VA 2X6MA 3Q5OA 1JCKA 1R3JB 2A83A 1SMAA 4UV4H 4HGKC 4R7DB 3VXPA 5MERA 3UZQA 4MLSA 3TVMD 4Q0XL 3ARBB 4FFVC 2VLMD 4YHNA 4TTDD 1EX0A 3MRRB 2NLJA 3VG0H 3FHAA 5HD8D 3S97C 4IDLA 4TUKH 15C8L 4PJFE 3IFNH 4FFZH 4YX2H 1II4E 4RFEA 5FF6A 3PP3H 1YECL 3RPIA 2B7DT 5GGRB 4OZFH 3HR5A 3W2DH 3W39A 3BESR 3WL9A 3MLTB 5DVNA 2IALB 5A3IC 2X4UB 2VMFA 3FJTA 3KPPB 5EZIH 1AKJA 1VKXA 5D6DC 1CG9B 3O6FB 5F9JA 1DBJL 1T04B 2UUDK 3GSNH 4NCC2 4Z7UF 3WSQL 1R5WB 2Y7QB 3PWLB 2CLZA 3OR7A 4WFFD 3GEWB 3HNTL 4EI5C 5JA8B 1QA9A 3QAZB 2R69H 2CLRA 2X9YA 2M8XA 2VXUH 3MROA 4X4ZA 4G80A 4LFHG 4KJPD 1FNSL 4ZOEA 2AXJA 4L8BB 1T66D 3BRGC 5DURB 1IFHL 4G3YH 1RU9H 1YUHA 4Y4FC 1UB6A 3NZHH 4Z0XB 4F7PB 3SDAC 5A16A 2AS5M 3CX2A 2VXVL 5JOFB 4EXKA 2VH5L 4R90L 4Q58C 1IGMH 1VACA 3HFMH 5C0IB 3O9WC 3C2AL 4I0PD 4RGNB 3BPOC 2APFA 2VDRL 1B6UA 4Y16B 1AR2A 2Z31B 5C2UB 2NXYB 3A67H 3MACL 1F58H 1HXYB 4PGEB 1PG7W 1G9EA 2KBGA 3GI9H 3PWPB 3QFDA 1ZHNB 3LDBB 4NN6C 3FONB 2AEPH 3S5LB 4YLQT 5GGSB 1NGPH 4DGVL 5EBMB 1JNNL 4N5EC 3U9UA 1CLYL 1PLGL 3BQUB 1DBMH 1LP9B 5IHZB 5GS0D 2GAZA 3JWOC 5EUKA 3BT2L 3RVTC 2LTQC 5JHDE 4O02H 5IESH 3UZEA 4JREC 4RGNE 2E3VA 4OT1H 4JAMA 5EOTA 3MJGX 5HI5C 2EXWD 4KQ3H 4ZUVB 1SJXA 5JW4M 3Q3GB 3RWDA 3QQ9D 1M6OA 5BQ7B 3DXAA 1JPFB 1OTSC 5DD0H 4LCCC 1MJUL 4G8GE 4MWFA 1JL8A 4B50A 4DUVA 4XNUL 4F9LC 2P42B 2JTDA 4X4ME 5C0EB 3FQRA 4NO3A 2AJ3B 2R2HA 4W6WB 1PW3A 1ACZA 1Q8MA 4RFNB 4S1DD 4RMSA 4Y4KB 5FKPA 3DNKA 4E41B 2FIKA 1MHHB 3LEYH 5ANMB 4HXBL 5MP6H 5GGSY 5DMIL 4H0HB 5F3BA 3R8BB 4UBDD 3IKCB 1OY3B 5EORL 2JJSC 4K3JL 1G7JA 1YEGL 3UBXI 2QQQA 5DF0A 2QQKH 3MBXL 4EBQL 4PBVC 4J3TA 5C0FA 2EC9U 4ZG1A 5CEYA 5KSBB 3UDWA 2YRLA 3WFBH 3JTSA 4PJXB 2BOBB 5GXBB 1J1XH 4ODHH 1QFWM 2IG2H 5ACZB 2ZUQB 5DQDL 4PJHA 4XBPA 1D5ZA 1INDL 2HT2C 3AC0A 3GSWB 3VA2C 3D39A 3TCLB 1DQJB 4JFXA 4JKWA 3LS5H 3MXWL 4CVZB 3QWOB 3PHOA 3LRHA 5EUOF 1HI6B 1CGUA 5ECJE 1AJ7H 1KELL 2DYPA 4GLRH 3T3PF 3V7AE 1CXKA 5J3HC 3UTSA 4PJDB 4XTRD 4L8SB 3FT2A 5KSBE 1KCLA 3I6GA 2OXHA 2E6QA 2Y5EA 3OPZL 2ARJQ 4V1DE 1AGFA 4LMQE 2AW2A 1YN6B 2PO6B 2HMIC 4P48A 4F58L 4P5KA 2H32H 2GTWB 4YDJB 4Y2OA 3L5XH 3KVQA 3MJ8A 3MNWA 4OQTL 4NRXA 2DQDL 1MAKA 4PRPA 3AAZB 1FZKB 2EIBA 4XHJC 3B9EA 3SKMB 5DEFB 1U8IA 2XA8L 2CJUH 4PJ5B 4YGVB 4RNRA 3QJFB 4HK0A 4TULH 4PJDE 3VMOA 2VO5A 5DQ9B 4ELMB 2Q7NA 4JPVL 4I2XB 3JVGC 3SGKA 5IJKC 4BSVA 3QEHA 4PV8A 3I2CL 3FRPG 1UZ6E 2A6IB 4ODVH 3RWIB 3BP6A 5HVFB 1ZT1B 3C5JB 2ZOKB 2MCPL 4PJEF 3NFNA 1A6AB 2HG5A 4W81A 3NH7H 2V5MA 1F97A 2BFVH 3H6JA 3IKKA 3MLXH 1PKQA 1BIIB 4HWUA 4KPHH 5B38B 1T7ZA 1E4KA 4YHIA 3MLZL 5J8OA 1FE8H 4XPAH 1RK1B 5DD3H 3U1SH 4M00A 2CSPA 3RIFF 3BP4B 1I3RB 3CXDL 4JY5H 4R3SA 3FFCB 4Y2DC 4TUJA 5F6IB 2VDPL 1YDPA 4KHXH 3UEZA 4P2QE 4AH2B 1G6RB 1MQKL 3NCEB 5DUMH 1W0WA 2VSCA 5TQ2H 1X5GA 2C4FT 1E6JH 5FV2A 3V4UL 5DDHB 2HVKB 2IH3A 4ZXBB 4DCQB 1IGYB 1H5BC 1TVBB 1A14L 3F7VA 4PJ9D 4XNMB 3V9FA 4L4TA 3IVKB 1WTLA 5DYOB 3BE1H 3G6JE 5E2UL 2P5WA 4XP5H 4EOWL 1M71B 4DN4H 1CGVA 1I7ZA 1WFTA 1J0KA 3BO8B 4KQ4H 3K74B 3D6GA 3ILPA 2D7QA 3E2HB 2D03H 2D9CA 5E94B 3N85L 3CMGA 3IU3A 5ENWB 4WV1A 4ORGB 3BZ4A 3OXSA 1KIUA 1OT1A 3VFTA 2N1KA 2R0ZH 3C5ZC 3WUWA 5EWIH 5JHDD 2IH1B 3WIIH 2XT1B 4TVSa 5CINH 4IHOB 5TPWL 4BQ8A 4X6CA 1JYNA 5IB4A 2O5YL 1FIGL 2E9IA 2F54D 1T6WA 3PWUB 2A74B 3OG4B 3ZE2F 5J9PB 5CZKA 3DO7A 3HAEA 1WBYB 3A6CL 4G8GD 5BOPA 4MJ6A 5D2NC 1MJJA 1NCCH 1HWGB 2DL9A 4JPWL 4MHHI 3INUL 4K07A 1I1FA 4RISL 4M6OH 3SE9H 4N0UE 5B8CB 1HE7A 1OSPH 3MBEB 2Y25A 3P0YH 1DBAH 3LEXB 1B3JA 4JQXC 4XCYB 4QRPE 1A5FL 2IPUG 5FM4A 3WXWH 1T21B 3L3HB 3T8XA 4O58H 4PLJC 5GGTH 2JB6B 2HT3D 5MERB 5IGXL 3TO4A 4NN5C 1KFAL 2GJZB 3KGRA 5ETUA 4HIXL 2NLJB 2K7QA 2ZNXA 3EHBC 4DKFH 2LV4A 1SQ2N 2DJSA 4HZLA 5I1JL 2OLDA 3FQXA 8FABA 2HRPL 3MRDA 3SDXE 5H35B 1CYGA 3X12A 2XZQL 4H88L 3WMSA 5GRYA 3OKNB 3U0WL 4HWBL 4RFEB 1A7OH 1AO7A 4PLKD 3DTXA 3CVHL 4OI7A 5IBTL 4MA7L 4OSUL 3VFUA 4RMUA 1TQBB 4JGJA 3W39B 1MRCH 3EJYC 4KK6D 4TN9A 1ZT4A 3RL1B 1AKJB 1FDLH 4NCDA 1I7UA 4Y1AA 5CSGA 1YY8A 5FO7B 5FV1L 1C7SA 4LAQL 2NYYD 4NJ9H 5FAAA 1J0YA 4IMKA 3RI5F 2CXKA 2BERA 1MCOL 1YC7A 4LRNH 5F8QC 2CLZB 1AD0A 3OR7B 3ME0A 1EEYA 2QQNL 1OP5H 1O7SA 3HUJA 1UJ3B 2C3VA 5HI3C 1DLFH 1NMAH 2CLRB 1XT5A 3ZYZA 5GSVA 3U2SA 1IT9H 1JHLH 3RY6A 4G80B 3T1FA 3BDYL 3U4AA 4DGIH 1UC6A 3WS3B 4V1DD 5KSVA 4OGYL 5A16B 4OFVA 3T2OA 5ITBH 3MFFA 2BY3A 2HFEB 5GGVL 3EJZC 4YXHL 1NLBH 1VACB 2YD9A 3LN5B 2ZCHH 1F8TL 1QBLH 4JFZL 4CN1A 3DSFL 4M48H 1TZGH 2ZCKL 1QO3B 3BD3A 2CRMA 1E4XH 1YYLH 4JB9L 4NZRH 5I9QC 4PY7A 3LZFL 1BM3L 3EDFA 2NZ9D 1CQKA 3VD7A 3H42L 1QFUL 2E7MA 4M6NL 3K7UA 4XP9H 1QFPA 4OCSH 3B2VH 4MAYA 3U9UB 1T2XA 2FB4L 4PBWD 4KKAC 4ZOAA 1UM4L 5D1QA 2GAZB 1NUDA 4LHUD 5IM7B 5C0GA 5INDA 4U1NA 4YE4H 4HFUL 5H2BB 1PBYA 2HTLD 3UYRL 3OTTA 1K5NB 1ZV5A 4KZDH 2I07B 1ODAA 4I3RH 5F96L 5J1AA 5HGDA 3RWDB 1QHOA 3DXAB 4N1EA 1F3DJ 4IRJB 2E7BA 5DC4B 4AIXA 1OD9A 3X3FL 2NX5A 5I1HH 4YO0A 4FQQA 3G6DH 3QUXB 1LP9F 2NY2B 1OAUL 4NT6A 4P2QD 2FBJH 4APQD 3ARVA 3D18A 5L0QC 2OSLB 4K94C 3FQRB 3HE7A 1LO3H 1KCUH 2DLFH 2X9XA 4HJGB 1S9XA 2C3HA 1X5IA 2VZTA 3C5SB 4UTBH 1NC4D 2BVOA 2DQTH 1YNTA 4GJTB 3CXHJ 5ALCH 3VFVA 4EIZC 3QCVL 5FKPB 2YN3A 4I48A 2AQ1A 5C7XL 4UOW1 3OKKA 4LSPL 1RIUH 3KNBB 3DXAE 4R0LA 2J88H 5GGVY 3EO9L 3IDMA 5F3BB 1OGAD 3SDDA 2ZCLH 1G7JB 1RJLA 4CNIB 5DJZA 3OB8A 3H7BA 4KUCF 4RSVA 5TE4L 4Z7QE 3OZ9H 2PF6A 3OKEA 4N9GA 2H3NA 3R8QA 4YXLH 4JKLA 4NQDA 3JTSB 1MIML 4QHNA 4RZCB 1WIPA 1AXSA 1W0YT 3O4LB 1A2YB 4XBPB 1OAKL 1E4WH 3W81A 2F5AH 1MH5A 2FO1A 3L95A 2XZAL 4GFTB 1B88A 3ZO0A 4OCYL 3QCTL 3QIUA 4OAWB 4Z76A 4GQ9H 1NLDL 4G6MH 3PHOB 3P0VL 4W70A 2EEBA 2BNUA 1DANT 2DYPB 4K8RD 1JHTB 5DS8A 5KSBF 4ZUTB 4PJXF 3UTSB 1TJHL 2EE2A 3REWA 3QUYD 3ZT7A 4NQXA 1MCSA 4KXZI 1C16A 1T0MA 1CXIA 1WK0A 1VGKA 3QQNA 4YIQA 5FUZH 3TWCH 3IDYC 4H1LB 2AKRB 2OP4H 5KVEL 4FG6D 5CEXB 2GKIA 3PHQA 3UC0L 2MSPA 4PJHE 4P5KB 4QRPD 1FNEB 5GISL 5KAQF 4NO5A 5DJAB 1NFKA 1F13A 3CH1A 4I9WD 1UM5H 3MFGB 3MNWB 3D39E 2H26A 5C0BB 4NRXB 1B6DA 3FAXA 3MA9L 5TE6H 1HSAA 4PJDF 4U4BA 2BSRA 3B4NA 3PGDB 4K8RH 1V3KA 5BVJA 1YEKH 4RNRB 5ILTH 2PYFA 3UTSE 2F53B 4XMPL 3O6LH 4L8DA 1UZ6F 4FXLA 2E27L 3WXVH 4RAHA 3VGGA 4BSVB 1S7WB 4FQHA 1MFCH 3QEHB 3M1BA 5H8DA 4JRYA 1FZOA 3BRDA 3IDXL 2EO9A 5EBLA 2WWKO 2FRGP 3NFNB 2KDGA 1XR9A 5HGHA 5LAXA 1L6ZA 4G42B 2X89A 1QFWI 4TUOA 1PKQB 4U0QB 3B9KB 4PRPE 4QOKA 2J1KA 5D7LA 4OLWH 4WI2A 2XI9A 1QG3A 2APXA 4NC0B 4ELMF 1IGCL 2GUOA 2YSSA 1JTOA 4U1MB 4WJ5A 5E08H 4B41A 5FUOL 5CJQL 1YDPB 4LSUH 4J1UB 5DMJB 4L8CA 4YDVB 1CD9B 3RWEB 3WBDA 1W0WB 1FVDA 1FNFA 1MVFA 4XC1H 4YDLB 3HNVL 1TLKA 4F57L 3QRGH 3LSOA 4FQJL 1NSNH 4JJ5B 2IH3B 4XVUC 5C92A 4JFEA 5JUEH 5BS0A 4M1DH 1N8ZA 3Q6GH 3QG6A 2H8PB 5IFAH 4JHAH 5KS9A 3RZCB 3VFWB 1AH1A 3ZTNH 4Z8FH 5ADPL 2RCSL 2D2OA 4RA3A 3C8DA 2DAVA 2C9AA 1RULH 4XCCL 1HK6A 4ZDHA 1NGXA 1ADQL 3OF6A 1PYWA 3BZDA 4D9LH 4ZTPH 3AS1A 5I1KH 4QTIL 1NKOA 4KY1L 2W38A 1T1XB 3UPRA 4WV1B 1TQCB 1VFAB 1TVDA 4HS3A 3BZ4B 3KLHD 4L3CB 4OD3L 1DQQA 3VXSA 3OXSB 4UV4L 3VFOB 4XRCA 3ZE0E 1N6QL 4L4TE 3ULUE 5CLWA 3VFTB 3T4AA 3WUWB 3X13A 4AG4H 5EIIB 2C5DC 1MCBA 4L9DA 2IPTH 4WTZA 2P5WE 4DOHB 5TF1H 1PZ5A 2ATKB 4X6CB 4TRPH 1NUGA 2V7NA 5IB4B 2VWEC 4TUKL 3O6KH 5FGRA 3TZVC 1X5JA 4XB7A 3IFNL 3DO7B 4FFZL 3H9HA 3HAEB 4YX2L 5BXFA 4JFOB 4S0TD 3HLAA 3BH9A 3LVEA 4MJ6B 3ZDXE 1SMOA 4X9BA 3W2DL 3STLA 2QR0A 1P7KA 2OMBA 2XA3A 3GI8H 3E6FA 1FVEA 3V6ZA 5KW9H 5EZIL 1XF3B 4C4KT 4FTVB 5K9QG 1JIBA 3ZYJA 1OAQH 3QDJA 3GSNL 4LSQH 3LRSA 3DV6A 3GMNA 3BWUC 4X6CE 4WHTA 5DQJA 4P0DA 2VQUA 1EEUA 2R69L 3PJSA 2VXUL 3GMMA 1BQHA 3VFGH 1HHGA 5LQBH 1N0LA 4GRLB 4NP4H 1RZKC 1JFQH 3ABZA 1QBMH 3MRDB 5C07E 4G3YL 3IDGB 5JQ6H 1RU9L 3FO1B 1X4ZA 3GIVB 5LGHH 2PCPA 3DTXB 3QIWB 2I24N 1UCBH 1XF4A 3NACH 1IGIH 1WQVT 3HFML 1A64A 2ZNWA 5GZOC 5DD1H 4NQVB 4F7CB 1ZT4B 4TSCH 1MREL 1W8NA 1M7IB 2VZ1A 1YY8B 4UQ2A 1GL4B 3A67L 3RAJL 1BVKB 5D1ZC 4DAGH 1F58L 5EBGA 5BVPH 3V52H 3GI9L 2VQTA 3HZKA 4KK5C 1AD0B 1TTFA 2AEPL 1EEYB 1KN4L 4P3DB 3BYTA 2O5XH 1NGPL 1NGYA 1YNLH 4TNWF 1BREA 5FCUH 5CZXD 3PQYA 4U1LB 1AO7E 1FN4A 5KJRH 3P4OB 3JWDH 2DLGA 1D9KD 2JCCE 3B5HA 4NFDA 4O02L 5IESL 4OT1L 5KSVB 1I7TB 3MFFB 4KQ3L 4P9HC 2NY3D 4Y1AE 2XQYG 4HS6B 1IC5L 1BD2D 4CJ0A 3D39D 2DF3A 1F42A 1DEEA 5DD0L 1JN6A 2AJUL 2R1YA 1IC1A 4XXCA 4UDUA 3PABB 4ZSOA 3DHJA 2LVCA 5DUPH 3ES6B 3D48R 3DVNA 3HUJE 4G6JH 2COQA 1CE6B 5F6HI 2Q3ZA 2YBRB 1TTGA 1IKFL 5CSBA 4MCZA 4ENEC 5GS0L 1BZ9A 1J9CT 1LO5B 4L1DA 5ITFA 5HSFA 2BY0A 3AS2A 3S37L 3S6CA 5I1AA 1PY9A 3N1FC