1VSCA

Vcam-1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
196
structure length
196
Chain Sequence
FKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VASCULAR CELL ADHESION MOLECULE-1
publication title The crystal structure of an N-terminal two-domain fragment of vascular cell adhesion molecule 1 (VCAM-1): a cyclic peptide based on the domain 1 C-D loop can inhibit VCAM-1-alpha 4 integrin interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion protein
total genus 34
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1vscA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1vscA01
2MFNA 3QNYA 4BH8A 3MLUH 1FORL 3WEXA 3QCVH 1SJEB 4LF3A 1BP3B 4QHNB 4XRCA 4ODWB 4FQ1H 4P9MH 4L8BB 3VFMA 2CO6B 2HAZA 1T2JA 2EDYA 2Z8SA 1P53A 1FFPB 3ARFC 5IMKB 1DLFH 2NY6B 15C8H 2B20A 4NCC1 3W5NA 4E41D 1U8NB 1J0HA 1PY4A 2NY5C 1EEYA 5SX4H 4WTXA 5DK2B 1LE5B 2VAJA 1BEYL 4RAUB 4RAHA 3QXVA 2J8UF 3D85A 3ROOB 5A2KH 3VWKD 4TSBH 4KJYB 2ATPB 3K8KA 2BVUA 5E6ZA 3B8YA 1L7IH 4NQEB 1YC7A 3WL9B 4Z7OF 1HEZA 5FIEA 1NMCB 4OM0H 4GOSA 3ARSA 1F2QA 3SDCD 1KFAH 4NGHL 5HY9B 5IV2A 3VW3H 4Z0XB 1MWAL 6FABH 1QRNA 3VXOB 12E8H 2B5IC 3C60D 1ZA6B 4K71B 4G6FD 1KB9K 4D2NA 3VFRB 2FWOA 4C56A 1F3RB 2VLRA 1C1EL 2H26A 1HINL 2PCPA 1TJGH 5D7SH 3BUYA 3QNXB 4X6BB 3CNKA 2VLKE 3IKCA 4XHQA 1EJOH 1EZVX 3QDGA 4EI6A 1V5JA 1S7UA 2D7TH 3V8CA 5SV3A 2AABH 2I27N 3IXTB 5EZOH 1ZHKA 4E5XB 2VZOA 4KRLB 4JAMA 2EYTB 3DROB 3QEUA 2EZ0D 3PABB 2CGRL 2WBKA 3QPXH 1XF4B 3X3GL 3SKMB 5BQ7A 2GJ6E 1QHOA 1NUDA 1WVZA 4MS8C 4JZNA 3G5XB 4KDVA 4OZGF 5C2BH 4JFOA 1A8JH 5E5MB 4XPGL 1A9BB 1N8ZA 4MCYA 3LMJL 1GGIL 2EICA 5IW1A 4K9EC 1EEQA 3JBG7 4CU7A 4KTDL 3INUL 1IC4H 3FRUA 2JCCE 2VLME 3L7EA 4R97B 3ZSSA 3LVEA 1EBAA 4MYWB 3L9RA 1J87A 3MV9D 3LN4B 2EDDA 4OFPA 4ODBD 2OJEA 3RWCA 1H3WM 4C4KO 1M7DB 4HC1A 5D9SA 3T65B 5I30H 5IEKB 4YQXL 1ND0A 3G5VA 2ICEB 5BS0D 4YDVA 4JG0H 4UNVA 2IQAB 4WHTB 5DDHA 4OQTL 1OAYL 4KI1A 4NOBA 4LDOB 4ZUUB 4WI2A 4AT6A 1HYSC 4OCMC 3IAGC 3QDMB 2OBGA 1UCBH 1XCTB 1G84A 1BFOB 2KQMA 4MCZA 4XHJD 4LSQH 4XP4L 5DC9B 2D3VA 4HJJL 4ISVB 5DMIH 5IM7B 4F7PA 1MCJA 1JHLL 3B3IB 2H3NB 5CWSB 4FG6D 3WD5L 4H5SB 3TA3D 3KPRE 1MJ7L 3I75B 2YD8A 3VFTA 5EWIH 5KSVB 5D5MF 5MP6H 2MQ0A 2GY7B 5F7YC 5E08L 2JK5A 3D3VD 3LN5A 3QFJD 3VD7A 1EGJA 5C07B 1OW0A 4JM4H 5IB1B 3W11C 3STZA 4QCIA 4LP5A 4HIEB 3WFBH 4KJPD 3O4LA 2D31B 3KJ4B 3RWGA 3QUXC 2X1XR 5J0BA 1T6VN 4YHNA 5LXGL 5FF6B 3MBEA 4HF5H 5JR1H 1A0QH 5GPRA 2PXYD 1F6AB 4CJ0A 4PRID 1VEOA 4I0PD 3GMLA 4KGLA 3AU1A 4D0CA 3RWFB 1FORH 4LAQL 1I8KA 2A74B 2OSLB 1DQJB 4UIMB 1P7QB 4X99A 5B38G 4ZXBA 4KDTC 5C09D 2N56A 3DI2B 3LV3B 2Y07L 4D0DA 3X14B 4PLJD 2EDQA 3SGDI 4X8JB 2RFXA 8CGTA 4ZFZB 3B9VA 4NQCB 1DTUA 3GMOA 1V3LA 4GMSL 4H0HB 1CLYL 4HMDA 1GC1L 2PNDA 3UDWA 4J7RA 4BQ6A 1NJ9A 4PJGA 5EBLB 3QO0A 1WJ3A 2AXFA 4H1LA 1QPXA 2F54B 4MX7A 1UZ6F 3BQUA 4HGMA 5I1LB 5GRXG 5IMLA 4CNIB 4OZHE 1T1YA 3SGEI 4RMWA 5GGQL 4NGHH 2FATL 3HE7A 1RK1A 1MWAH 3DTXB 3NTCL 2PW1B 4P2RE 2GAZB 2C4FU 2BCKA 4QOKD 5CJOL 8FABB 1C1EH 4HWNA 1HINH 4DVBA 3R4DA 5K9QI 4KROC 3NIGE 2IG2L 1FN4A 2QSVA 3QDGE 1KPUB 3S3SA 4RX4D 1GGUA 3PQYB 5EN2A 3QUYA 1EEUA 2B1HL 1HIML 3HUJB 3F7VB 1G6RA 1Z6JT 2PO6D 4X5XA 1RUKL 5ENWB 3HKFA 3UO1L 3B6SA 3IDYC 1CR9L 4KKBD 4CUCA 3MMEB 4KJQD 3DO7A 3FN3A 3MRMA 1NGYA 5ETUA 1F4HA 2H8PA 1KT2B 2CGRH 4EUPH 3L7FA 4PLOB 1I7TB 4PJHB 1EIBA 4Y2DA 4TVPD 4PJIE 3WNKA 2Z91A 2I07A 2V2TB 3L3KA 3T0ED 5HYJD 3FONB 1KTLA 2PR4L 4MJID 4PB9L 4XPGH 3V7MA 4NUJB 3LMJH 1GGIH 3D69A 4TTDC 1K6QL 3PHOB 3QUMB 3ES6B 4KTDH 1C08A 3INUH 3F7PC 3TH2T 2P5EB 1S7VA 1A7RL 2UWEA 4ELME 1T7VA 3WBDA 6CGTA 2XXMB 2HJFA 1QSVA 4Z9KB 3HC3L 4YQXH 4JFYA 4PRHD 4M8VA 5ID1B 4PJBF 1S5HB 1JGEA 1KJ2B 4OQTH 4IDJL 5FCSH 5BMFL 4OCWL 2D9CA 3MLSL 4XVUC 3REVB 3C87A 1I9JL 3OKOB 2AK4B 4NHUA 3DLQR 2VQTA 4XNXL 2NTFA 3IU4L 4XP4H 4HJJH 1JHLH 3RGVB 5FECB 1S9VB 4N9OB 3LB6C 3WD5H 3VWJC 5D7KE 5DJXB 5E9DE 5EOQL 4ZQKA 1MJ7H 2XWBA 5EFIA 4HS8L 3MJ9L 3Q5YA 4YNYB 1L6ZA 4FQPA 5E08H 2AERT 3DURA 5JXAL 5HGBB 3ILQC 2QADC 1JTPA 4YFLI 3FB6B 3SJVD 5GGSB 3PGDA 1J05A 3DPBA 1E4XL 4NZTL 2HN7B 1XGUA 1MCPL 2V9RA 1MVFA 4PGEB 5D8JL 5LXGH 4OZIA 5ITFB 2AQ1A 1T7ZA 1KIRA 1ZHLB 1KPRB 1JJUA 5I18L 3T3PF 2WMPA 3C6LA 1KB5L 2BNQE 5HI3D 3NZHL 4LAQH 4OFDA 4AZ8A 3KLHD 4PJCA 5BJTB 5TDNB 2NYYC 2ZWLT 35C8L 2A6KA 5MEPA 2WBWB 2Y07H 2E7LC 1D7FA 3MLTA 2Q1EA 1IKNA 1S7TA 1YEDA 1KTDB 3DARA 3RZCC 3VG9C 3B5GA 4YLQT 5IF0A 1WK0A 4HKZB 3KYOA 1MI5A 2VH5L 4GMSH 1F58L 1NBQA 1CLYH 2H32H 4PRAA 1GC1H 3TWCH 1MEXL 3RIAK 4F7MA 4Y19D 5D2LB 2CLZA 2HTKC 3TT3H 5FDWA 1T0MB 4GJTB 4O4YL 4XWGH 2VDQH 3C6SB 4BZ2H 3QEHA 3MRDB 5J6GB 4NRYA 2OXGA 4G9DA 2H2SD 5GGQH 2FATH 1KJVA 2WP3O 4FZEL 3JTSA 5I16B 5C0CB 3ULUE 3NTCH 1Q72L 2VQ1A 1SM3H 2VABA 1OQXA 5L2KD 5MENB 3CSYB 1ZGLA 5CJOH 2QSCL 1L0XA 2XPGA 3I6LD 4OV5B 2NW3B 1EO5A 2FX7L 4G7VL 5FCUL 2HT4D 3E8UL 3GSWB 4RNRA 4B7IA 5FO7A 2B1HH 2OLDA 1HIMH 3IDXL 3N1GC 5KS9F 3V7AG 2E8YA 1RUKH 1YUHB 2EYSA 5T1LD 3CCHA 1ZLVK 3NCYP 1CR9H 4YR6B 1B88A 3HMWL 4OCRL 3MUGB 3NFNA 5IG7B 4EVNA 4OAWA 5L8JB 1NQBA 1FJ1B 3RNQA 4EUPA 3OAUL 1BVLB 3DV6A 2YS4A 3RVXD 4KZEL 1X4YA 1PBYA 3MYZA 4ZO7A 2O93L 5EO9A 3TBSA 2X9XA 5AWNL 3GMQB 3QQ9D 2H1PL 3SDXA 3U48A 2PR4H 5AG8A 4PB9H 1I7ZA 1NFIA 4FQQA 4JFEB 1L0YA 3BZ4A 2XFXB 4JDVB 5C2UB 3MJGX 3PL6C 4P2OB 5F7DB 1K6QH 1RI8A 4GBXC 3MNZA 5F9OL 4QGTA 5K9JL 1TENA 5A40E 5E2WH 4TNVF 3OKNA 1PX4A 1ETZB 3VI4E 2YZ1A 1A7RH 2DLTA 2WAHA 1F11B 2VLJB 4X6EB 1YECL 1XR8A 4X7DC 2D7NA 5K9QG 3H9ZA 4Y4KA 5D1QD 3HC3H 1UXWA 1OP3H 1DUYA 5CKAA 1MFAL 3U0WL 4L4VE 4ORZC 3BZEB 4QRUB 3RVUD 2DQDL 4JZJC 2NXZD 1VFBB 1A4JB 3RTQA 3MJ6A 4IDJH 4H8WL 5JOFB 5EH1A 3UTTB 5BMFH 3HR5A 3DUHA 4OCWH 2R0WL 3MLSH 1AD9A 4M61B 1I9JH 2JB5L 3D39D 4ODWA 7CGTA 4XNXH 3IU4H 1D5BB 4MZ3A 4NDMB 5EBWB 5A2FA 4HS6B 4JHZA 4TSCL 5IBLC 4PS4L 1FFPA 4JFZL 4Y4FC 5D96C 5EOQH 4JDZB 3HNTH 5IMKA 2AKRB 4HS8H 3MJ9H 2HTLC 3PV6B 1SJVA 3SE4A 3UBXB 1ZWIA 4JFXB 3KWWA 2FR4B 5JXAH 1A3RL 4DKAA 3MLPA 5T5NG 5FGSA 3BDBA 4OCXL 4X9FA 4RAUA 1NDGA 2DJUA 3UDWC 3SN6N 3ROOA 3NFPB 1T80A 1E4XH 4NZTH 1MFCL 1FZOB 3TBVB 4S1DC 3ULSB 3LKQB 1MCPH 3OV6A 1L9NA 1XEDA 5DTFA 1QSEE 5D8JH 1U93A 1PX3A 3O9WB 2YPLE 1DANU 1TVDA 1BFTA 4R8WL 1G7LB 4NQTA 3H8NA 3FQUB 1KB5H 5IHBA 3NZHH 1DVFB 3BP5A 4JFDD 4LQFL 5ESQB 2OMNA 35C8H 1HXYB 1G9EA 2KPNA 3OL2A 3QNXA 1CFNB 4X6BA 5DD1L 4PRPE 2VN7A 1UT9A 4Y88A 3QUYC 4V1DE 1E4WL 1A9EA 1IM3A 3E2HB 3VE0A 1U8HB 4M3KB 2XOTA 2VH5H 1F58H 5HYQB 2JB6A 1MHCB 1MEXH 3KPPA 4A6YL 3C5ZC 4LIQE 3DVFA 1FVCA 3LKNB 3TNMB 1OWRM 4M1DH 1ZK9A 4K94C 3UTZB 4EN3A 4O4YH 1BAFH 3C8DA 3QQNA 2E3VA 1AHWB 1S7XB 5JHDB 1NFDF 2O61B 3SKMA 3TBYB 4Z7WE 4FZEH 4Y2DC 3DVGA 4U6XA 3G5XA 1Q72H 1EXUB 3PWLB 1DN2A 3VFGL 3I02B 5AUMA 3E6FB 1G7IB 1LEIA 4DVRL 3ZTJG 1AC0A 5BOPA 1LNUB 4G7VH 2FX7H 4DKDC 3V95A 5FCUH 5FA4B 3E8UH 5JUEL 3DSFL 2COQA 1RMFL 5FFLA 3L5WA 4H88L 4NKOB 4WU7A 1SEBB 2C1PB 4JHAL 3CH8A 1D9KD 2DTSA 4L4TD 2FLRT 3CVHB 4HSQA 5IEKA 2DS4A 4HDIB 4OCRH 3O3AB 2ICEA 2IQAA 1FYHB 1KENL 2BY2A 2PW2B 3OAUH 1KBGL 1U36A 1WQVT 4KZEH 4ODXB 3FJTA 3FO1B 3HLAA 2EDWA 2Y1VA 1ACYL 2EC9U 1FL6A 2IANA 3QI9A 5SX4I 1GZQB 4YPGA 4ZSOE 1PEZA 5AWNH 5JORA 3SCMD 4JB9L 2H1PH 4LCWE 1YN6A 5CEZH 5INCB 4P5TC 4GRWF 3QEQA 3B3IA 2Q7YA 5C0EA 3PNWB 3T08A 1W0WB 3RQ3A 3BVNB 2Z4QA 5F9OH 5JPNB 3IJYB 5K9JH 3RWEA 4XXDB 4GG8A 5E5UB 43CAA 4M6NL 1QSFB 4XP9H 5INDB 3V0AC 2OQJB 1R3KA 1OARL 1YPZB 2P44B 5LQBL 3S37X 2ESVD 3NCEB 2Y23A 2CH8A 1YECH 3HRZB 4PG9A 5BZWB 3BKYL 3CPLA 1IRAY 5DD6B 1UKTA 5IB1A 4Q97A 4OZFA 2VZ3A 5DJZB 4HIEA 1K2DA 3O8XA 2VDKH 1MFAH 4MDJB 3UJIL 3VRLF 3U0WH 2DQDH 5GRZA 5FF6A 5FKPA 2ENYA 2NTSP 5E5RB 3BPLB 4H8WH 3D2UB 3KPOB 5HJ3B 1OD9A 2H41A 5KN5B 2Q3ZA 5ANMB 3PWJA 3QXTA 2A74A 3RWIA 1DQJA 4JPWL 4UIMA 4CGTA 4PJDE 3F8UB 2AVGA 5HPMA 3BPOC 4TSCH 5KSUA 5IW6B 1JNHB 3LV3A 4PS4H 4Q9QL 1EUUA 4JFZH 3FO9A 3X14A 5HD8D 1EMTL 1QP1A 5JOEA 3BZFA 4NQCA 1A3RH 2PTUA 1OGAB 4NQEE 5B3NA 1MFCH 3WXWH 3O41A 3UBXG 5F1IB 2DF3A 4OLVL 3QBTB 3DX9A 3CUPA 4M1CC 3V5KB 1MCLA 4NQDB 3K81A 5E94B 5I1LA 4GAGL 1KB5A 1HILB 3QCUL 4R8WH 3DTXA 3LY6A 4Q9BA 4G8FB 4GH7B 4LQFH 2V5SA 3QXWA 3TZVA 4XNUL 2FBJH 4M8QB 8FABA 3AS2A 5MI0C 2NW2B 1KCRL 3K4DA 2B7DT 3VXRB 5DD1H 4KKCC 4M6OL 3BRFA 3VFWB 5IWLA 1TPXC 1DBAH 5I1AA 1E4WH 1BBDL 4MB3A 3FN9A 1KYOK 5HDLA 3RDTB 3F7VA 2BHZA 4A6YH 4ZTPL 5I9QB 1K85A 4N8VA 3MMEA 1R3HA 4NO0B 4MB4A 4ODSL 3SDCB 3GJFB 1WIPA 4H26A 2HYMA 3TFKD 1XGRA 3A67L 1HH9A 1Z0NA 4PJHA 4XPTL 1NCUA 3EZ8A 5C0IB 4G6FB 4OFVA 3S4SB 4WHYG 4BSWB 4N9GA 4FFYL 4U6HB 5HVFB 4KV5F 3VFGH 2J88L 2HFFA 4FQXA 3BW9B 4NUJA 4CVZA 2ZCKL 5IOPB 5F9AC 5FDYA 2RJMA 4DVRH 4P99A 2ADIB 3PHOA 3G6AB 3ES6A 3MR9B 4W6WB 4IMKA 1FIGL 3G6JB 2Y25A 2R1XB 5JQ6L 1U3YA 1UG9A 1B0RA 5HVHB 3OGCA 2NMSA 2OTWB 2P5EA 3HG1D 4XWOC 4AJ0A 3DSFH 1RMFH 4C57C 3GSVA 3WDIA 2HLAB 2H6PA 1K4CA 3MJ8B 3UYPA 4PJAE 5D1ZD 3T0DA 3H9HB 3CD4A 2ILLA 1RVFL 1FAIL 3QDME 1CFTB 5EUKB 5ID1A 1KENH 1S5HA 4X6CE 3W0WB 3BMWA 2RAMA 3CX5K 4OZHF 3ZE0E 3HPLA 1KBGH 3U4EB 3JV6B 1ACYH 3SGJA 25C8L 1BJ8A 2V7NA 1XFPA 3OKOA 3ZE2F 3BISA 4D0BA 4JB9H 3KYNA 4ERSL 4AL8L 4BZYA 4UV7L 1L0QA 5CILL 5FYKE 4CRPA 1S9VA 3A6OA 3DBXA 1OAQL 5DJXA 3R0MA 2NY6C 3ARGD 5HHQB 4X80L 2NY7L 4NO3B 4M6NH 5C07E 3D18B 1OARH 4WUUA 3BWUC 5EC2B 1J10A 4AM0B 5LQBH 3RBGA 4ZOEA 3Q5OA 3FB6A 5GGSA 3LHPL 3BKYH 3MTRA 3IRPX 3BT2H 2ITCB 5T1MB 2DMBA 4M43L 5HI5C 1CBVH 1UB5B 1JIBA 3BFOA 3UJIH 4PGEA 2FCBA 1HSAA 5IVXF 1NMCC 3MLZL 3QFDB 3GJEB 4OZ4B 1BVZA 3FO2A 1ZT1A 3LKPB 1JWSB 1EHLL 3LEYL 4PJIF 1QO3B 4NQVA 4Z7VA 5DHXB 1H0DB 3B9EA 3GSNB 4KPHL 4LASL 4GRLA 4JPWH 4K71C 4XBGB 5KG9A 4JRWA 1MFBL 4Q9QH 4JY5L 3V6ZB 5IB3B 2AXGB 5F9DC 3D3VB 4LLMB 1RHFA 4RIRA 1JN6A 1EMTH 4NO2B 3X13A 2FHFA 1EJ6A 2LFGA 3RL2B 1LO2L 3L5XL 5I73B 3DETC 5CSZA 4HKZA 3U79A 4ELMF 3DRQB 1PKQE 3PDOB 3LD8B 1RY7B 2F54E 1I8MB 1NEUA 2D7PA 1D6VL 4LVEA 3ULVF 4R96B 4OLVH 2DLHA 3BD4A 1A6TB 3N9GL 3IF1B 1T0MA 2OM5A 1U91B 3C6SA 5DJ2B 1OGTA 4QXWA 3VA2C 4GAGH 3MUY1 3MRDA 5HHPB 5I74B 3QCUH 4JR9L 5I16A 1OTSC 2YXMA 5HHOD 4HQQL 3V7AE 4X7FC 1UYWL 2VL5B 3PQYE 2B4CC 1KCRH 5FYJE 5CEXB 5MHSE 1HHKB 4M6OH 3HUJE 1AKJD 4TNWK 4Y1AE 1CD1B 3VA6A 3ZT6A 1BBDH 4R97C 3R06B 4RFEB 4LSPL 1MH5B 3SDYL 1YUHA 5F3BB 3W82A 1JV5B 4YR6A 1N0XL 1P5UA 3FMGL 3MV8D 4WI8A 4ODSH 3U36A 1BVLA 3QZWB 3A67H 3EYOB 1ZV5A 4XPTH 5I8OL 5J8OA 4HIJA 4N8CL 1ZANL 1U8JA 3GMQA 3CMGA 4QOKB 3L3IB 1YC8A 4FFYH 1XGPA 1K8DB 4FFZL 5J1TC 2J88H 3IJSB 2IPUG 2ZCKH 3IDMA 1MHHB 2R1YB 2BOBB 2JKXA 1VSCA 3S4SG 2AJ3B 1MLBA 4PG2C 1FIGH 3D0LB 2DWDA 5JQ6H 4OFIA 3ARFD 3UPCA 1M05B 1ETZA 5BV7B 1KLUA 5C08D 5EBMA 4D3CL 3QIBB 4XNMA 4X6EA 3KPSA 5DFTA 5DK0B 2FSEB 1S7RB 2DYPD 3LQMA 1JBJA 1OT1A 2F53A 4WUKL 3EGSB 3JWDL 3KJ4C 1FAIH 1YYML 4JFQA 1UM4L 4QRUA 5C1MB 1J5OL 3IETB 2V2XB 1VFBA 1A4JA 2P5WD 2Y7QB 3DX8B 3CK0L 2AK4E 3K8LA 4JRYD 3UTTA 1FGVL 1MCIA 1VACB 2X41A 4MJIB 25C8H 3K1DA 4HZLA 3ULUF 4FMFA 3PIQB 4M61A 2W9EL 2EDJA 5IK3A 3BKJL 3D87B 1D5BA 4NDMA 2VOTA 5EBWA 4AL8H 4UV7H 5CILH 3EAKA 5H35B 3VFOB 1OAQH 3BP4A 1I3GL 2EDKA 2XY1A 5FOJA 1RJLB 2XTLA 1WWCA 3W81A 3SDDB 4PLNC 1DN0A 1ZVHA 3OB8A 4X80H 3HC4L 3PV6A 2NY7H 4N0UB 3UBXA 4JFXA 2FR4A 1UXSB 5SWZB 3R8QA 3T0BA 3V8OA 3SDAA 2GCYA 1FC2D 1S5IL 3LHPH 3NFPA 3BWAB 5EUOF 4UNUA 3X11A 4KAQL 1JZ3A 2JJSA 1ACZA 3MLZH 4CW1B 4AY0A 1EHLH 3ILPA 1G7LA 3LEYH 3FQUA 1E4JA 1B6DA 1LEKB 1TZGL 3TO2B 4KPHH 2IBZX 3QWQB 1DVFA 4LASH 5EORL 3FRPG 2UY6A 1L7TL 2H32B 4MS8D 3P9LA 4MMZC 2E8ZA 3RX5A 1DQLL 1MFBH 5LG1A 3U4AA 4PJFA 3MLXL 1T5WB 4JY5H 4A2LA 1ZLWK 4DZ8B 1CFNA 2CKBL 3BD5A 1KIQB 1G9MC 1M1SA 1QTYT 1NGZA 3DXAB 1LO2H 5ECJE 1C7TA 5CP7A 5D2LE 4Z76A 3SE3C 2DKMA 5EC1B 3MRJB 4KQ4L 2HFTA 4XCFL 2DWEB 1D6VH 5CHNB 3TNMA 5J6HB 4WWKB 4U1IB 3N9GH 3MV11 2EIEA 4LKXA 4JM2F 5C0CE 2JF1A 5D6DA 1S7XA 2OK0H 2YPVL 3LQAH 4JR9H 2AV1B 3GSRB 3LZFL 4POZC 4AMKL 1HYSD 4UTAL 5MENE 3TC9A 1EXUA 3PWLA 1U8PB 2FZ3B 3OPZL 3R1GL 4HQQH 4YHOL 1VADA 4QRPB 3E6FA 5EPMA 1UYWH 4HCRL 4YBQC 1T4KA 3EOAB 3V4VL 3TVMB 5DEGB 3CSPA 2PYEA 1CL7L 4OUUB 5M7QA 5EIQA 3RKPA 2XQYG 1RAMA 4IMKC 4RCAA 1YY8B 5CP3H 3OB0K 3QRFM 3OSKA 1DBKH 4PJEB 4L9DA 1T89C 4LSPH 3SDYH 3TIDB 1NCAL 4V2CB 1N0XH 2AI0L 1W0YT 5D1XB 1GXEA 3W11D 4PJXB 4UIKL 3T2PA 4M7ZB 3UTSB 1ZSDB 3HA0A 1HHJB 2BVPA 3QUXD 4ODXA 3OQ3B 1FFNA 5I8OH 3SGJC 3QWOA 4N8CH 4JFEE 4J3VA 4LRIC 4RBPK 3N1QC 1TFHA 4CAGA 5A3IC 1GZPA 3QZWG 4FFZH 4ONOA 4UQ3A 1LO5A 5GRUL 1E4XI 5L0QB 5GS0C 3RGVC 3DGGA 5C6WH 1FYTE 2X70A 5FXCH 4NCC2 5TH2A 4X4XB 5IFHL 1W0WA 5KSBF 3IJYA 2GJZB 4UDTB 3T1FB 1TJHH 2VLJE 3BYTA 2XT1B 2OQJA 1ONQB 1YPZA 4D3CH 2OTUB 3C8KB 3HRZA 5DD6A 2F58L 4U1MB 5DJZA 4L8SB 2VLKD 4WUKH 1I85A 2NY4B 3JWDH 1VB9A 2YA2A 3OG6B 1YYMH 1UM4H 4PGJA 5JTWA 1DZBA 1J5OH 3UTTE 4P46B 2GKIA 3CK0H 1WAAF 2X10A 1AD0A 4NZJA 4YK4B 1GGCL 5HJ3A 1ZGLP 3E3QC 3P4MB 3SKUD 4CN1A 4WTZG 2W9EH 4MAYD 2R56L 3BKJH 2VMFA 4NJ9L 5DZOA 4X6FB 3ETBF 1U58B 3MZTA 1FP5A 2FL5B 2GJ6D 1LO4L 1I3GH 4LGRB 5E2UL 3VFPB 4N5EC 3VCLA 1CXKA 3I6KA 3DRTB 3HC4H 4H25A 2BSSA 1FBIL 4UNTA 4KROD 5JLZB 1JGVL 4NC1E 3STLB 1KIUA 5I8CB 4MD5B 1DDHA 1S5IH 4OD3L 2V2WA 5F7NC 1MRFL 3W9EB 1GH7A 4KAQH 3V5KA 2VLMD 4NQDA 2QHRL 3QQ4B 1RUQL 1AGCB 4OCSL 2A9MH 1W2KT 1JTOA 2FO1A 3G04A 4WJ5A 1JGUL 3M17A 1NCWL 4QYOA 1DSFL 1TZGH 1SYVB 5ALBL 2GITB 3D25B 5EORH 4G8FA 5A2LH 1L7TH 2QSQA 1RZKH 4AEEA 1ZVSB 1DQLH 1BVKB 4E41A 2NW2A 5F70A 1CFQB 4JG1H 1PKOA 3MLXH 4XNQB 1RFDL 2HFEA 2CKBH 2FIRT 5JNYA 4KUCF 4TTDD 2EC9T 2VITB 5DD0L 1QQDB 5AD0A 3ZHKA 2G60L 5TDOA 1OSZA 2ICWJ 3VWKA 2GSIB 4X7CC 3RL1A 4KQ4H 3SY0B 3KPRD 4XCFH 3H2WA 43C9B 1TCRA 4DGVH 5HHVL 3C08L 4BJLA 5JHDE 4UILH 5B8CB 5GZNC 3SDCA 1A21A 2Z8VC 3GJFA 4JRXB 4I3SH 1CI5A 1DJSA 5TQ0L 2YPVH 4N0CC 4HJGA 3P9MB 4HS3B 2R15A 1PD6A 3LZFH 4XCCL 4AMKH 3MGOB 3WHE0 4GAYB 4UTAH 4PJDF 3QG6A 4AQOA 1BD2E 4YHOH 3MXVL 4XVUD 4J8RB 4P2OC 4I8DA 3G6AA 4HPOL 1N3NB 3ULVL 1CL7H 1ES0A 3BP7B 2VERN 3MR9A 3ZKXB 2G5BB 3GFUA 3LB6D 4JJHA 4ZAKB 3NA9L 4RFOL 3VWJD 2NY3B 2OTWA 4S0TD 1IGFL 2OR9L 4W6YB 3WLWD 2EDRA 2R2BB 3U0PB 2FRGP 2VKWA 3MJ8A 3ILQD 2QADD 1NCAH 2BNUB 3H9HA 1JZ2A 2AI0H 1GGBL 2BSTB 3D85D 1CFTA 4NO5B 4AIZB 4EBQL 1FL3B 1I3RB 3W0WA 3BUTA 4UIKH 2ICCA 3JTTB 1HI6A 4UU9B 4YO0B 3U4EA 1KN4L 4LCCB 2OP4L 4YZFE 4WDIA 2FJGA 3PGFL 3TYFB 1E27B 5DQ9A 1NAML 5GRUH 2VXUL 2DM3A 1P69B 4DN4H 3AUVA 5IFHH 1HHHA 4N1CA 4OZGB 1FVEB 1QSFE 4X0KB 3WSQL 2NYYD 3BD3A 1YPZE 4NO3A 4P2RD 4NNPL 3MV9A 1OPGH 4ZUTB 1YMMB 3NCCB 5EC2A 1F02I 2E9IA 5IMOB 3RZCD 1T04A 3FQWB 3MO1B 3EJYD 5DQJB 3EDKA 1Q94A 4ZODA 1CDYA 3QDGD 2VO5A 5BS0A 4NC1C 2DM2A 4NNYB 2ITCA 3RUGE 3MYJB 4GKNA 4IBLT 4XPFL 3T0WA 3HAEB 3AAZB 4F9LC 3EYSL 3O9WC 3FRPA 3QFDA 3GJEA 2NXYB 2LU3A 2OYPA 3IS1X 3PWUB 4EQ3A 2HTKD 4QRRB 1CXIA 5ANME 1JWSA 1GGCH 4G5ZL 2EDXA 1YEJL 3E6HA 2AJUL 3OWEA 3GSNA 4TUKH 2R56H 1DVFC 1BJ1J 1RZJL 4KTEL 1URLA 4XBGA 4XPBL 1KG0B 4NJ9H 4C58B 3TA3A 4NJAL 3THML 1LO4H 3WMSA 5E2UH 1LHZA 3QQ3A 1EK3A 4XC1L 4IRSB 3WE6A 3V6ZA 5IB3A 3D3VA 4PGDA 5CIPH 2P7TB 4CVUA 3QFJA 1FBIH 2LTQB 3TPKA 4U49A 1FV1B 3E2HC 1I8IB 1OGAE 5GJSL 3D1MC 1HN1A 1JGVH 4N0RA 4PV8A 3BPCB 2X7LB 5DUBB 4X98B 1RJCA 4K2UL 2AV7B 5D5MB 4NQDE 4PJAF 1MRFH 3CXHK 4R96A 4MXWL 2PXYA 1MAKA 4RWYH 2QHRH 1RUQH 4PRIA 4X6CF 4I0PA 4IOIA 3TO4D 1U91A 4QHMB 4NSKB 1HNFA 3CFJA 4OCSH 5LBSL 5HHPA 2XWTB 1AHWC 4LNRB 1N5AA 1R3LB 4PJ8D 1PSKH 2LVEA 1JGUH 5L9DL 1NCWH 4Y16B 1KCSL 1DSFH 2J6EL 1IAOB 5ALBH 4M7LL 1LMKA 1U2HA 5C0GB 3EOTL 1Y0LA 4A6YB 3VXRE 2VL5A 4D9QE 5GHWH 1RFDH 1MJ8L 1KXQE 4K07A 5CEXA 4OGYL 3HB3C 3PL6D 4LCIL 5DD0H 4OM1L 3NPZB 1CD1A 4GBXD 4RFEA 2ZSWA 5D7KD 1MH5A 5E9DD 1IGML 3P77A 2XA8L 1YEGL 5B4MC 1JV5A 4NNXB 5HGHB 1D5XB 5CINL 5HHVH 3C08H 5IMMB 2VDRL 2XN9B 3VU2A 3LKRB 3O4LD 5TQ0H 1JPTL 1F3JB 2KDGA 5CEYB 4G6JH 3QXAB 4XCCH 4Y2OA 4DTGL 4QOKA 3OXSB 4HUNB 1K8DA 2NCMA 2ATKB 4HCRA 3F6LA 4K8RL 3MXVH 5FO9B 1MHHA 3G6JE 2R1YA 1IILE 1ADQA 3S9DB 5HHNB 4HPOH 2AJ3A 3ULVH 5ISZB 5C71A 2VAAA 2BNQD 1U42A 3D0LA 1UQSA 3UPRA 3NA9H 2NNAB 4RFOH 5E95B 4Y4FD 2VLLA 2FLBT 3MLVL 1M05A 2PO6A 4XVJL 1IGFH 2OR9H 4MJ5A 3QIBA 2HTLD 5DK0A 2FSEA 1M71B 3EYFA 1S7RA 5KOMC 3VMNA 3TM6A 4Z5RA 3IYLW 5JO5B 4TPRL 1AR2A 3W0WE 1MVUA 2JE8A 3EGSA 1FIEA 1GGBH 3UMTA 4H0IA 3DMMB 4EBQH 2CLRB 3OGOE 2V2XA 4S1DD 2QQQA 2V17L 1P4BH 1YEFL 3ZKMC 3HNSL 3BPLC 4C83B 4F9PC 3AREB 3T0EA 5HYJA 1BX2B 3QHTC 1H9VA 1KN4H 4DK3A 2OP4H 4MJIA 3PGFH 1OAXL 3QIWB 5GS3A 1MFNA 5I8EB 1JNLL 1NAMH 5CJXA 4N68A 1HHIB 2DLEA 4YJZL 1NGWB 5H35A 3VFOA 4FQLL 4X7SL 2FECL 4P23B 4NZDA 3WSQH 1RJLA 3ULUD 4RA0C 5EU4B 3HE6B 2B1AH 1FE8L 3MGAA 4N0UA 4NNPH 1KELL 4I4WA 4I18B 5J9PB 2N7AA 4K7PL 5SWZA 1BJ1H 1HQRA 3QSKB 3QUYD 1NCCL 4FTVE 3QWRA 1ZTXL 1RJYB 4XPFH 3C5ZD 4GUPB 1KCLA 4HMCA 4ORGA 1I3VA 1NC4B 1YDPB 1FL5A 4S1SL 4PR5B 1YEJH 4PJBB 2AJUH 2GUOA 3L3HB 1FO0B 1NBZB 3TO2A 1XR9A 2GQHA 2E9JA 1RZJH 3BN9C 1FNSL 4KTEH 4URTB 4XPBH 4Y2DD 2APTA 3MRCB 4FZ8L 4NJAH 3THMH 3OKEA 2VZVA 4OLXL 4JVUA 5C70A 4XC1H 1F6FB 5SX5H 5IQ9A 3SJVA 1VGEH 3CDGA 3RZWA 2AGJH 5GJSH 5A1AA 3V6FB 5JHLL 4N1EA 3PHSA 3RDTC 4K2UH 4NWTL 5EC1A 5J11B 3MRJA 4DQOL 3TN0B 2DWEA 5I9QC 1BGXH 5C0NC 5J6HA 2DMCA 4CMMB 3IFPB 4GW5B 4MXWH 1RSFA 3SDCC 4MWFB 4M03A 1T1WB 1T3FB 1RUPH 5LBSH 3WDJA 1HDMB 4PJ7F 2NY1B 1C12A 1BBJB 5DJYA 3CMOL 1O7VA 1CLOL 1G1CA 5L9DH 4L4VD 1KCSH 2J6EH 1ZS8A 4M7LH 1E6JL 1U8PA 3JWNC 1RIVL 3PV7A 4U1LA 4YFDB 1E28B 3EOTH 4JM2D 1NFKA 1LP9F 1QFWL 3DX7B 3TVMA 4OUUA 4P5TD 1KNOB 1MJ8H 4P9HL 3RY6A 4OGYH 1NCNA 4ZFFA 5DMYA 3OJDB 4B50A 4LCIH 4QHUA 5HVHC 3RI5K 1L9MA 4OM1H 1A6AB 3WS3B 4PJEA 5FAAA 1C16A 3TCLB 4IJ3B 1IGMH 2XA8H 2VDML 2A6JA 1YEGH 5CINH 3VD9A 3UP1A 3MJ7B 2VDRH 4I2XB 2YWYA 2IBGA 4TQEL 1GRWA 4CDGC 3U0TB 3UTSA 3AFLA 4NZRL 1HHJA 1JPTH 5FV1L 1JYNA 3I9GL 3UROR 1IEHA 4LSVL 1QSED 1FZMB 2D0FA 5F7KC 5LGJA 4NFDA 4K8RH 2YPLD 2EIZA 1FSKB 3PJSB 3WUWA 3GI9L 4X4XA 5D7IA 3KHQA 5LWYL 3O3BA 1HE7A 3LIZH 1TQBB 1TXKA 4UT7L 5H2BB 3RAJL 3WFDL 2GJZA 4UDTA 3T1FA 2O5YL 5CBAB 3DYOA 3PWVB 4H0GA 4YFLF 3MLVH 2APVA 4O00A 1ZLSL 1UWXH 5T1LA 3QUKA 2OTUA 4QTIL 4LSSL 1K5NB 4Z77A 4U1MA 4TPRH 5BVJB 2A83A 4PRPD 4V1DD 1YY9C 5KS9B 5DJ8A 1IZJA 1YEFH 2V17H 3FCTB 4P46A 5K9KB 3HNSH 4M1CD 1I4FB 4WNQB 5ICZA 3OZ9H 1NDMB 1OAXH 2BY1A 3MNVA 4ZYKA 1JNLH 1IGCL 2BOCB 3FFDA 1YA5A 1BWWA 1JGDB 2Y5EA 3VXTA 1U58A 3U7YL 3WS6A 2FL5A 4FQLH 4X7SH 3TLRA 4HBCL 3ELAT 5SWZE 1FE8H 1LVEA 1A4KB 1QEWA 3GMNA 3KPQB 4WU5B 5F97E 4OD1L 5I73C 4K7PH 3Q6FA 4KH2A 2DYPB 3STLA 1A6ZA 3LD8C 4MD5A 2MHAB 5EZJA 2E9WA 2WLYA 1OAZL 5I1GH 1U92A 3FT3B 4BFIA 1NCCH 5ADPL 2F9BT 3W9EA 2EDEA 4PP2B 4X5WB 1CDHA 2D2OA 1ZTXH 5CLTA 1DQQB 1AGCA 4JO1L 1T0NB 1JUFB 3PG2A 1RZ8A 5MEOA 1NSNL 5I74C 2CKNA 3MRGB 3D39A 4JN2B 3PHQB 4S1SH 2HWZL 3MUZ1 3UZQA 3RWDB 3KPMA 1PW3A 2YC1B 1SYVA 1HQ4B 3D25A 4PBWD 1BQHB 4HBQA 2FGZA 1XGYL 4N0FB 4PRBA 1FNSH 1ZAGA 3HCVB 2DM4A 4FZ8H 2ZCLL 1BVKA 1NGQL 4OLXH 3DXAE 4JPKL 1DBML 2FD6L 1DL7L 2NY0B 1LE9A 1WUNT 4LCWD 1HOCB 1M6OB 1QQDA 3Q48A 1TITA 2GSIA 5JHLH 4NWTH 3GHBL 2NX5B 4DQOH 4XWOD 3V2AR 5JMRA 2YD7A 1BLNA 1G9NL 2DLIA 5B8CA 2J8UA 2G9HB 3ECBB 4JRXA 4ZUSA 1G7JB 4YE4L 4H20L 2OCFD 1TNMA 3P9MA 4HS3A 4ACPA 4B5EA 4BKLA 5JIPA 3CMOH 4RMTA 5AZEH 1CLOH 3MGOA 4QRPE 5IJKA 1CVSC 3FTGB 2Z92A 4GAYA 4HD9A 1J8HB 1E6JH 2M26A 4PJ5B 1FNFA 1RIVH 4WEBL 5BRZB 4NZUL 4LKCB 1MQ8A 1QFWH 3EDJA 2IFGA 1MCHA 3L1OL 4XH2B 3OBAA 5DJAB 4LGPB 2R8SH 4Z7NE 2A2QT 4JKKA 4P9HH 5HSFA 3U1SH 3OMZA 1V3KA 3KYMB 1FNGB 5TE6L 2NY6D 4ZO8A 5BV7C 3F58L 3QIBC 2C4XA 3U2SA 1QFUL 2P43B 1G6VK 2VDMH 1HXMB 1IL1B 4PJXE 3ZDZE 3UTSE 2BNUA 5L88L 1JWMB 1EFXB 3ESUF 4GG6A 4BSVA 5KZCB 3RJQB 3GDBA 3EO1B 3JTTA 3RIAF 5HI5D 1N59B 1A22B 4YO0A 1TZIA 5SV4A 1WFTA 4NQED 3NAAL 5T33L 3TYFA 5D6CB 3I9GH 2R2EA 3F7YB 2DLFL 2UYLA 2DQEL 1NFDB 4BELD 1P7HL 3MA7A 2XICA 3OHXA 3QIUB 1AGFB 5DRNB 3G08B 3GI9H 3NN8B 5LWYH 1P9MC 3NVQA 4KQ3L 2XZAL 1FVEA 4OZGA 4DFIA 1BF2A 4UT7H 3SDDC 3RAJH 3WFDH 2O5YH 4I3RL 1GHFL 1JPFB 4Q0XL 4BZ1L 1ZT7B 1ZLSH 1YMMA 2NY5L 3FQWA 1QZ1A 4MJ2A 4QTIH 5DQJA 5JDSB 1MCNA 4LSSH 5FM4A 5JOPE 3DETD 5IT2L 4BYHA 1IC7L 1T7YA 1CK0L 4OFKA 4XMPL 2F5BL 2X4RB 3HAEA 4KRPB 3ZKQD 5ICXA 1ITCA 5EZLB 3SCMA 1QBML 4Y8DC 5JIKA 4M7JL 5ILTL 1NCTA 4L8DB 4R0LB 3W39B 1QFWM 1VCAA 3BGMB 1OTSD 3U7YH 5T1DL 2VISB 4XCYB 1N6VA 1HYRC 4HWZB 4HBCH 4GRWB 2P7TA 2ESVA 3UEZA 1PVHA 3N1MC 1ZT4B 4OD1H 1I8IA 2X7LA 3GGWA 5DUBA 3IDGB 4HWEL 4CL7A 1KB9J 2VLKB 7FABL 1OAZH 4U1NB 4K3JH 4PRNB 1RUAL 5ADPH 4WWKC 1YMHA 2ORBL 1BZ9B 4J3TA 4TUJA 4U1HB 3NCYS 1A1OB 2VXQL 2F19L 5J7CC 3STBA 1CL7I 3MRPA 3PP3K 1WC7A 1ORQB 2BDNL 5IVZB 3T77A 4HX1B 1UVQB 2LE9A 1NSNH 4G8EB 2CKBB 4MAYB 5KVEH 2HWZH 5I66B 1RU9L 4JPIB 3CSGA 4F7TB 1T1XA 3QDMD 2NPLX 1XGYH 2QJDA 4XI5C 1QG3A 3EDFA 1UA6L 4M9PA 1KTKE 4PJ9B 4PBVC 2ZCLH 1T7XA 1P6FA 3ZKSD 5D7LB 4CN6A 3TVMC 2XI9A 1DBMH 3BH8B 2FD6H 3IFNH 1DL7H 4WV1B 1BQHG 4EI5B 1U8QA 4QNPE 2EIDA 3BXNB 4K9EL 4GW1A 1T66C 5EU6B 4MA3B 5FYKD 3AS1A 1R3JB 3MOAL 1JYXA 1JMXA 3BN3B 3U82B 2YD2A 1J12A 3GHBH 1I1RA 3C5SA 5C0FB 4JEGB 3RUGF 4JRXE 4NNXA 5DMGC 1AXTL 1G9NH 1REIA 2G75B 5D1XC 5C07D 4NQXB 4ZNEE 4AEFA 4OTXL 1OB1B 2IEPA 4M7ZC 3LKRA 2DQJL 5DA0B 3U6RA 4YUEL 4YE4H 4LVNB 5ESVA 5GRWA 2OL3B 4P2QE 5JPMA 4WW1A 2Q3AA 2YD5A 3QXAA 2MKLC 3OXSA 4PJGF 2W60B 2ATKA 4WEBH 1DQDL 5L0QC 1T20A 4UTBL 1WBXA 4YAQB 3S96B 3GB7A 3L1OH 5I8KL 1P7QD 2R29H 4ZFOB 2NR6C 3LS4L 5JA8B 3PWNB 4NQSB 5TE6H 2UZIL 4LGSB 4QWWC 4KGJA 3KPRB 5E8DH 1C5CH 4GAJL 5CEZE 3OKLA 2O5ZL 4JKPL 2EXWC 4GKZB 4AH2B 4GMTH 4U6YA 1QACA 5HYSG 5ID0B 1QFUH 2V5RA 3WIHA 4L8SC 3OAZH 4IHOA 5L88H 2NY4C 3VXPB 5HI4C 4MB5A 2CLRA 5TFSH 1HWGB 2XIDA 3TPUB 4P46C 2XKNB 3VD4A 2F54D 1T03L 3EHBC 3NAAH 1SY6L 4YK4C 5T33H 1C8PA 2DLFH 2DQEH 4G6ML 4CVXA 5DEFA 4JO2L 2IBZY 4OZGE 1W0VA 1GGTA 9CGTA 4XMKL 4Q2ZB 5I2IB 1I1FA 1AQDB 2XZAH 4LLVA 5F9JA 1A7PL 3WKML 2GK2A 2YMXL 4OIAA 1CG9B 1YMME 1N2RA 3FQRA 4I3RH 1G0DA 1GHFH 4Q0XH 2ICWI 5C0JB 4BZ1H 1Q38A 2YD9A 5F88A 3IB4A 3H9YA 1RK0B 4Y5XA 3ZO0A 3PQYD 5FYJD 2QQLL 3PWPB 5IT2H 1IC7H 1SBSL 3RVUC 3B5TA 5MHSD 1AIFA 3WNMA 1CK0H 4XMPH 3FO0L 4Y1AD 2F5BH 4QRRE 1RJYA 1MPAL 2MQCA 3D0VA 3BSZL 5TF0A 2WWKO 5E8EA 3V5HB 4OBRA 1NC2D 3IFLH 1QBMH 1R5WA 5ERWB 3RNKB 3T8XB 5FHBH 1T21B 4M7JH 1IGJB 5ILTH 2UWEF 1FO0A 4LVHB 3OKMA 3MCKB 4OZHB 2W1NA 3I6GB 1NH6A 4QXGL 4QRQB 3ARGA 4R3SB 1B0WA 4HK0A 5KANI 4NBYB 1T6WA 1ZVYA 2CMRL 4YBQD 5IB5B 3CDFA 5D5ME 1R24A 1RZ7L 2ICWB 2GT9A 3V6FA 4HWEH 2AJYL 5SX5K 1CT8B 3DYPA 4F3FB 7FABH 1AGEB 5ICYB 4Q6IA 3AVEA 1VFAB 3MNWB 4GW5A 5D2NB 2ORBH 3KPLA 4LLQA 5B8CC 2VXQH 2F19H 3DVNA 3VFUB 3KJ6L 2GIYA 1T3FA 4XAKE 1TZHA 2BDNH 1HDMA 2FEDD 2VSDA 3GK8L 1WITA 1RU9H 5C9JA 5IVXB 3F65A 1AXSB 4LSUL 2E7MA 4PJIB 1UA6H 4GXVL 2IADA 2AK4D 2Q6WB 1FCGA 5E7BA 5A3ID 4U1KA 1Q9KB 3GHEL 2XRAL 3ZKXC 3LRSA 1KNOA 5GS0D 3RGVD 3DHJA 4QXUH 1QBAA 4ZAKC 3ZHDA 2NY3C 4WW2A 4U1JB 4HWBL 1OVZA 3WS3A 4YHZL 3WNLA 1BM3L 4EXKA 1K3ZA 3BO8A 3MRRA 3SO3B 2XN9E 4PJCF 4HGWA 2ZNWA 2IALA 4MD4B 3TO4B 1AXTH 4ELMB 4PGBB 1KCUL 4HHAA 2P8PA 4LRNL 5DHVH 2VDPH 4IOFC 4PJ8B 4OTXH 3U0TA 5J3HD 2DQJH 4WCYL 1IAKA 4YUEH 2P42B 5LJYH 2Q86A 4M00A 4LCCC 5HHOA 3SHSA 2I9LA 4P57B 3WCYA 1KIPB 3MBXL 5E00B 5FKAA 2GTZB 5ISZE 1DQDH 4W4OC 5TF1L 4UTBH 1KCVH 5MERB 5DQDL 4NBXB 5I8KH 1AKJA 3UXFA 3LS4H 4TN9A 5CBAA 3MZGB 1IE5A 2DQIL 2UZIH 4N5ED 4H8WC 4GAJH 2O5ZH 5HGAB 3OKKB 4JKPH 5T3XE 1RIUL 2DD8L 3HZKB 1UWXK 4GW4B 3ARXA 4PP1C 3CFKA 3KLAB 4LPVA 3C9NB 5E1AA 3RIFK 3FCTA 2NXYC 1J0ZA 2FHCA 4I13B 1QLFA 4X9GA 1T03H 2Q8BL 4JHBA 1SY6H 1I4FA 3ZYZA 4S2SB 1NDMA 2PTTA 1F3DJ 4NFCA 1PDKA 1UZ8B 2YRPA 1VGKB 3UJJL 2CLVB 2FO4B 4JO2H 2JJUA 3ARDB 4HXBH 4KKLC 5C0CD 2WINB 4LSRL 4XMKH 4S10A 2P8LB 1A7PH 3WKMH 4IRSC 4OCNC 3P11L 5MEND 3MLRL 1YN7A 5C08A 5E8NA 1A4KA 2LTQC 3BDYL 4LEXL 2DYPA 5HYEA 5F93C 2A73A 4U3XA 4IMLB 2X4QA 2QQLH 4EKXA 4MDIA 1SBSH 2QQNL 3QJHB 1R5VA 2P5WA 3HR6A 3HFML 4X5WA 3FO0H 1B4JL 1MPAH 2B39A 2V6HA 1CD8A 3BSZH 1T0NA 1JUFA 1WZKA 3GMRB 2WW8A 3H9SB 3GRWA 4PJBE 4Z78B 5IIEB 3OJ2C 3I50L 2MPAL 3QAZB 4F58L 1BZ7B 1UWEL 5HXMA 4Y16C 4N0CD 4FMKA 1HQ4A 3RWHB 3SKJH 1JRHL 4ETQB 5FUCE 4FHBD 3NCJL 4JZOA 4WENB 4QRTB 1U8KB 1LO0L 3QNZB 2X9WA 4NRZB 5D7JB 4JFED 2FIKA 3FFCB 1RV6X 2CMRH 3NA4A 4P2OD 4JFFB 2BNRB 3L3JB 1FYTD 1RZ7H 4APQB 2B2XL 3N0PB 3O2DA 5HVGB 2AJYH 1CDBA 1MCKA 1FVDA 1M4KA 4M48H 1X7QA 2AXJA 4RQQB 2AJSL 3CC5A 2MTPA 2VLJD 1NMAL 1BQLH 2EXYC 3ECBA 4HC1L 3KJ6H 3VG0L 1G7JA 5EUOB 5K33A 1JHTB 1CDJA 1NANH 2GK0A 2Q87A 1OCWL 3ABZA 1CIDA 3GK8H 4HKJB 2CDEB 3T3PE 2VDNL 2UVEA 3FTGA 3WYRA 1RZFL 4PREA 5I75B 4ZUVB 4UT9L 5FYLE 3UTTD 4LKCA 4GXVH 3MFFB 4XH2A 3GHEH 5GS1B 3NFSL 2XRAH 1S7WB 3MQIA 2CUHA 3KYMA 1XGQB 3MXWL 1MHEA 3O2VL 2HVKA 4HWBH 3TBWA 4YHZH 3PGCB 3DV4A 1BM3H 3KPTA 1ULVA 4KMQA 5HHMB 1BF8A 4I2XE 1MAML 4R4NC 1EGJL 2FJFA 3JV5A 1IL1A 4M6ML 2I9TB 4O2EA 2JJVA 2EECA 2FECI 4I1NB 3DMMC 4LRNH 4PV9A 4TVSa 4BFGA 3QH3A 2VZ1A 2I60L 4WCYH 5E03A 3D48R 3AREC 2JIXB 4L4VB 3SBWA 4F8QA 4L8CB 4NIKB 3LOWA 3O9WD 3QIWC 1I1YB 1CU4L 1QR4A 4FQJL 4JM2B 4L9LB 1QPPA 5D70L 3MBXH 2BVQB 2F5AL 3O4OB 2XG5A 4QF1B 3QIUA 3BDXA 5TF1H 1I1CA 1DVFD 4IRJB 5DQDH 1IGYB 4P23C 1QFHA 3FOLA 3HE6C 2DQIH 4RDQF 1F3DH 1XIWB 4I18C 1P1ZB 3VD3A 1S9KC 3SQOL 1RIUH 5JDSA 1RUMH 2DD8H 4QY8B 4XCEA 5KS9E 2OX5A 4NT6A 4RGMB 4TNWF 2WLZA 4DUVA 1SJHA 3B9AA 1CDIA 3VXNB 1U8LB 3QUXA 3HMXA 1XGTA 5C92A 5EZLA 5CZVL 2XACC 3TT1L 1QSEB 3WHXA 1CDCA 3U46B 5JHDD 5BOZG 3UJJH 4XVSL 5EIIA 3W39A 4EDXB 1P4LA 3BGMA 4JKMA 3MUHL 3O6ML 4DGIL 4LSRH 2C3VB 1YNTB 2VISA 1YNKL 3EZJB 3NZ8B 2W91A 2AJZB 1ZHNB 2ARJB 5CGTA 3MLRH 3UZEA 3GZKA 2EDNA 4QRSA 1BD2D 3BDYH 4U3CA 5J13B 5KSBB 5C0DA 4LEXH 4OLYL 3HB3D 2R23B 2ERJB 5GGUA 2AJXH 2VLKA 2ZSVA 5J11C 2LAGB 3SKOA 1F4XL 3TN0C 4U1NA 4MQ7B 4BSJA 1D5ZB 4G43B 3PDDA 1A7QL 1G6RL 1QFWI 1LDPL 1UENA 1BZ9A 2ZOKA 1MJJB 4U1HA 5K9OB 1B4JH 5B4MD 2BX5A 4K94L 5IVZA 4NYLB 3V4PL 1UVQA 2NY1C 2X4OB 4G8EA 4MAYA 3BPNB 3I50H 1Y6KR 2MPAH 4F58H 4JPIA 1K4DA 3W9DB 5CGMA 3O2WL 5FOBB 2WQRA 1UWEH 5BXFA 5F1NB 5KSAB 2VIRA 2GJ6A 4Y5VB 3NCJH 4MNQB 5M95B 3VGGA 4OF5A 1DUZB 5ACZB 1LO0H 1KJMA 3LKSA 4AYFA 3MFGB 4XNZB 1Z5LB 4HLZG 2W0LA 3BH8A 5FUOH 2X6MA 4EI5A 3O6LL 3QG7L 4K23L 3BXNA 4YEEA 5EU6A 2NX5E 2H9GB 1R3JA 1ZLVH 3VJ6B 3AROA 2B2XH 4IJ3C 1DE4B 1QSFD 2NLJB 4JDTL 4LPWA 2JCCA 2PTVA 2X1WL 2GTWA 1XZ0B 2DICA 3RPKA 3S6CA 5KBNC 1B4RA 3T1WA 1NMAH 4NQXA 1T2XA 1PJ9A 4HC1H 3KLSA 1OB1A 3VG0H 2WZPD 1A2YA 2C3GA 5J1AB 4PLKC 5DT1L 2OL3A 2ZJSL 1OCWH 1J8HE 3V0WL 4UB0L 4PJ5E 5J12B 2BVOA 2VDNH 3QT2A 4QT5B 5EO0B 3ZKMD 5BRZE 4OI8A 2GYSA 4RAVB 4IDLA 4P2CG 4YXHL 1RZFH 3D2UD 4UT9H 4HKBB 1QNZL 4U1SB 1FSKC 4O5LL 4B7LA 1NKOA 1IQDB 4X4ZA 3NFSH 1TQBC 1G7QB 4RMVA 2ADJA 5DMKA 1CE6B 2P8MA 3MXWH 4NQSA 1I3UA 3O2VH 3KPRA 4WFFE 5F96L 3VGHA 4K7FB 2G2RA 1ZOXA 2Z31B 4AH2A 2Y4SA 5ID0A 1H15B 1MAMH 1EGJH 3NCFB 3VXPA 4OIIL 1OGAD 4U31A 1NCBL 2I26N 3IVKA 2I60H 2Z35A 2UV3A 3FOMA 5B38B 3F7QA 4PY8I 4NQDD 2YD6A 1NFDE 5DYOB 1CU4H 4FQJH 4N8PA 5D70H 4JY4B 1IEBB 4F80A 2A77L 1X44A 4I48B 2F5AH 1TLKA 3QXDB 4UI2A 4LMQI 5D71L 3OJMB 2EO9A 4OGZA 3QHFL 2LVCA 3BN9D 4PJDB 4XTRC 3VWJA 1RHHB 2R4SL 4M5ZL 3BP6A 4QNPF 3SPVB 3RHWK 3P9WB 2XNAB 1U3HB 3QDJB 3VXRD 4A2MA 4P5MB 4D9QD 3X17A 1AGBA 3OTTA 1N26A 3L5HA 2EYRB 4QXTB 3LQZB 1S7QB 3RDTD 1QBBA 3RJDA 5C0ND 2IF7A 4H1LH 3TF7C 1JK8A 4NO0D 1XH3B 2WWMD 4GO6B 3TT1H 4ZNCD 5GIRB 3RNKA 3L95A 1UB6B 3P4OB 2C7UB 4D9LL 4NM4L 4OZHA 4KMTL 4XVSH 5C0BB 1U95B 3HNVL 3IXAB 5I1DA 4R3SA 3OR6A 2VUOA 3O6MH 4DGIH 4GRWE 2IAMB 4LSDA 5IHZB 5T3ZL 1IVLA 4P2RA 2E7LA 2YSSB 4PD4K 3HI5L 2NY0C 1PQZA 4Q9CA 4U6TA 2QV2A 3RZCA 2E6QA 4K3HA 1YEHH 1A1MA 3TBTA 4OLYH 5IR1B 3LQAC 3FT4B 3BEWA 3O0RL 1JF6A 1AO7B 4PGCA 1Z9LA 3X3FL 4OD2A 1CT8A 1F4XH 1ZEAH 4UOJA 1NLDL 1VFAA 3JXAA 1DBJH 1A7QH 1G6RH 5D2NA 1LDPH 4LLYB 2PYFB 3UTQB 4GQ9L 1RZIB 3HPJB 3VRLE 4K94H 1Z3GL 4HIIA 2GEEA 3V4PH 1PGRB 2BJML 2CIKB 1X5XA 5DD3L 3VRJB 4J2XA 4ZG1A 1KYOJ 3W0WD 4HK3J 2YEZA 3O2WH 3NIDE 3ZMRA 3S3PA 3RWJA 2LU4A 5IQ7L 2VN4A 5D7LE 1CICB 2K7PA 4L3EB 3P73A 5FKPB 4LLDB 5IB2B 2BMKB 1J0KA 3BH9B 4PJIA 3CJJA 1ORSB 2FEEL 3EO0A 4Z8FL 2Q6WA 4KKAC 1Q9KA 5EU6E 1C5DB 4P48A 3O6LH 3QG7H 4K23H 4NRXA 4U1JA 4XGZA 1RZGB 3MLYL 4KHTL 4Y89A 4PRDB 2E9BA 1GPOL 2R0ZH 4JDTH 4ZOBA 4JY6B 2P24B 4R4FL 2IWGA 2XWJB 4MD4A 3TO4A 1F42A 4ELMA 3O45B 1PZ5B 5F7FA 4PJ8A 4PJAB 5IBUB 1X5GA 1Q1JL 3FL7A 5IROC 5DT1H 4HUKB 4E0RB 2ZJSH 1YY9D 4RFNB 1WGOA 3SBWC 3V0WH 4UB0H 4FTVD 4X6CB 4P57A 4ALAL 2KUTA 4XZUB 4YXHH 2BY0A 5E00A 4W81A 3B43A 1QNZH 5GRVK 2V5YA 3S5LB 1Q9OA 3QIUC 2IPKA 4O5LH 1LD9B 1QA9B 3PL6A 3CX5J 4ONHB 3Q3GB 4GBXA 1P84K 5E9DA 5SWSB 5EG6C 5F96H 1IM9D 3SE9L 1BZQK 1XMWA 3OKKA 4IOSD 1O5DT 1XT5A 1GJIA 5CD3B 1OTUC 1UADC 4N0YL 4X7EC 4LAJH 5EULV 1PG7L 3BIAX 1G7HB 3OF6D 1FDLL 4OIIH 1S9WB 1QLEH 1NCBH 3MRBB 4KI5F 2Q8AL 4JZJA 4PFEA 4KRPC 3TJHC 4JFPB 2UZXB 3FN0L 2HJKB 4L3CA 3ROLB 5TE4L 1CFBA 5IEHB 3QEGL 1U8IB 1VGKA 2CLVA 4LDEB 1CXHA 2FO4A 4R0LC 1WBYB 2A77H 1JPST 2Y9RT 4E42B 4PTUB 4KV5E 2EE2A 5I0ZA 1JYWA 1I7RB 2BNQA 5D71H 5C0RL 1AP2A 5L7XL 1KCKA 3QHFH 4Y4FA 1FG9C 4G8GB 2R4SH 2BC4B 3G9AB 4M5ZH 1U0QA 4G8IA 3WFCL 3VGEA 4S0SD 1R5IB 5F3HB 3PWPE 1CXFA 4O58L 2VXTL 1BEYH 4IMLA 3M1BB 1QR1B 1I8LA 1PKQB 4YHPA 1UH3A 5GGSY 2BSRA 3K4AA 1G7PB 2ZCHL 1RZKC 3H7BA 3OJVC 5BO1L 2YWZA 4P59L 1VERA 3H9SA 2YA1A 3U4BL 1VEPA 5FO8B 5IIEA 4MAYC 3GIVA 4YHIB 4DEPB 2DIBA 2CSPA 2MNUA 5F89A 1BZ7A 3WO3B 3DUSA 4NM4H 3QULB 2YUWA 3RWHA 4ETQA 3MRQB 3ZE2E 2RR3A 3HNVH 1VESA 4PJ9C 4Y0GA 5FK9B 2MSPA 5EU3B 5F1OB 4X8XA 5T3ZH 3ZYJA 2HG5A 5J4MA 5H8DA 3HI5H 3FB7A 4WV1C 3LDBB 3IRZA 4EI5C 2WP3T 5IJVA 1CGYA 4MNGB 3UYRL 3AC0A 5FA3B 2HVJA 3O0RH 2R39A 1DFBL 4XCNB 5D2NE 2PUQT 3X3FH 1XF3A 3E1F1 4Y1AB 1FNEB 2AK1L 1NLDH 3C5ZA 4G42A 3QIBD 2R0KL 2X4TA 1NC2B 4GQ9H 1Q0XL 1INDL 2PETA 5EUOA 1JHTA 1Z3GH 5IVXE 4LVNC 3K8MA 2BJMH 4MA7L 3EYVA 3X3GH 5DD3H 1WTGT 4HKJA 5FUZL 4YX2L 4F33B 5JXEC 2IH1A 4R4BB 2BSED 2IC2A 1OL0A 5IQ7H 4LLWA 4ZUVA 2VZTA 4HUWB 3FHQA 4Z0BL 3F12B 4MD0B 1FFOB 4Z8FH 4O02L 4ONGL 1G7MB 3MRKA 1S7WA 5EU7E 3C2AL 4DKFL 5FYKL 4QKXB 1VHPA 4WFEE 4GT7A 1TVBB 3B8SA 3MLYH 3SDDD 4KHTH 2DTML 2YPKB 2X4PB 3HC0A 3HZMB 1GPOH 4NC0B 4JQVC 4R4FH 1F00I 2FYYA 5I1CL 5SWZD 3I6LE 2ZUYA 2CQVA 3ULVE 2A9NL 4BH7B 5HPOA 1IGIL 4PJFF 4R7DB 3H3PL 3QWRD 1Q1JH 5EU5B 1OAYH 1T83A 2DQFB 3B2UC 4Q9RL 4L4VA 5E0QA 3SGKC 3QJFB 4ALAH 4JM2A 1FZJB 5IBUG 4PJ7B 3T2QA 1IC5L 1VFUA 4P5TA 4HUMB 4HH9A 3WFEL 1ZGLM 4IRJA 4OF8A 3JSSA 2VR9A 4MHHI 1Q9LB 3VXSB 4JANA 5F6HI 3WLWC 3S5LG 1LP9B 4CJ1A 2V9TA 2N1KA 3SE9H 3QP3A 3MOQA 2YK1L 3DXAD 3HN3A 3OX8A 1Q8MA 4FXGB 3QUZB 4N0YH 1PG7H 1S9YB 2B8OT 4JQIL 3WLBB 1FDLH 3VMOA 3GIZL 4MQSB 1FNAA 4QTHB 1MLCA 2R0LL 2Q8AH 3FAXA 3JV0A 4WFGE 4WWKD 1CYGA 3FN0H 1KEML 2CJUL 5TE4H 1QSEA 1WZLA 3U46A 4XPHL 1JF5A 1TJIL 4LVHC 2YPLA 4RMRA 3CZFB 2OR8A 3OAYH 1A1NB 3MREB 2X44D 5EO1B 4LVOB 3MRFB 1BWMA 3P4NB 5DJ0B 4P5KA 3V0VA 3NACL 5C0RH 2C3VA 5L7XH 2GSGB 1RJZB 4J3SA 4XI5D 4QRPD 4UT6L 4YDJB 4ZMAT 2VJXA 1NANI 3WFCH 1X5JA 3TVMD 1NEZB 3EJYC 4KFZC 4WIQA 1K3IA 1G9ML 3CFDB 3NCMA 4O58H 1KLGB 1INQB 4WHDA 5FYJL 3RY5A 3U7WL 2VXTH 4GRMB 4PRPA 1T66D 4V1DA 1NL0L 2C5DC 4G43A 1Q9WA 3ZSTA 1FQ9C 5LAXA 3H9SE 5D2NC 1RQ5A 3JV4B 2ZG3A 2ZCHH 5K9OA 1F45A 5BO1H 3SOBL 2CR3A 4P59H 5DMGD 3AB0B 2X4OA 5D1XD 3U4BH 1FG2B 2EO1A 3CFBA 3PE9A 4LQ1A 3UTSD 5FOBA 1A6WL 5KSAA 1LK2B 2EDLA 2DQGL 4Z7WA 1U3ZA 4Y5VA 1DQML 3F7RA 4HFUL 2CRZA 1WZ1L 1P7KB 3FFCE 3L3OA 1KXTB 4JFFE 2BNRE 4YPJA 3GSQB 5IGXL 4D94A 2IG2H 3OR7B 3W5MA 3QUML 5GQBA 5JW5B 2H9GA 3AXLA 5EU7C 5GGRB 3MRHB 3BX7C 2NR6D 3UYRH 3SO3C 1DFBH 2C1OA 2NLJA 4QWWD 4YGVA 2AK1H 4YHLL 1MY7A 3TO4C 3UO1H 5EUOE 2EXWD 5HTSA 2R0KH 4MQXC 4X7TB 1IJ9A 3QA3B 3FB8A 1Q0XH 3ZYIA 1INDH 1XF5A 4PJ8C 2OMBA 2CO7B 5IB4B 5J1AA 1H5BB 1WBZB 3ULVC 3VFVB 2NY4D 3HRPA 4MA7H 5HI4D 2JLLA 1KJ2L 5BVPL 5FUZH 4YX2H 5I17B 3GSXB 3REWA 5EO0A 4P46D 1AGDB 2ITDA 3EHBD 5DI8A 4HKBA 4KDWA 4ZSOA 4Z0BH 3DUUA 4O02H 4LCWA 3CFEB 4ONGH 4RMSA 5GS0L 1D3CA 4XVTL 1CE6A 1FYTB 4DKFH 4FXLA 2DQTL 4HJ0C 5HHME 4CADB 3S36L 4K7FA 4TSAL 2DTMH 3L3DB 3GSUB 3BHBB 3EJJX 1H15A 4CU6A 2CR6A 4L4JA 5I1CH 3QNYB 1EFQA 2DL9A 1A7NL 2WIIA 3WEXB 2A9NH 1CXEA 4XRCB 1IGIH 4OZFH 3BGFB 1K9TA 1V3MA 1BOYA 3H3PH 3VFMB 3MRIB 1MCCA 4Z7QF 5H37H 3AY4C 5B38A 4Q9RH 1F4WL 1N64L 1RIHL 1UFUA 4P49A 5DYOA 1H3TA 2Y5TB 3UC0L 1SJEA 4QHNA 4PBXA 1PAMA 3MX0A 5T5FL 3ARDC 4AEHL 1IC5H 5TJWK 4YIQB 4L8BA 1H3XA 1JYVA 1OLZA 4JQXA 1KXVC 5FGBC 3WFEH 4PJDA 2C26A 1RHHA 3VDCA 2FGWL 1IAMA 4FQ2L 5ITBL 1U8NA 4M4PA 3S35X 3T0AA 1HEZB 4XXCA 5DK2A 4YXLL 1LE5A 2YK1H 1JRHI 5IV2B 1I8LC 1RZJC 4KJYA 2ATPA 4X6DE 4JQIH 1QRNB 3T0VA 3GIZH 4J12A 1MREL 4NQEA 3WL9A 3DX6B 2R0LH 2FWOB 4C56B 4WRLA 5I18H 1VFOA 1KEMH 2CJUH 2VLRB 4JRXD 5GIRA 5HY9A 4XPHH 3J8F7 3QAZC 1TJIH 3BUYB 2C7UA 4LHUB 4OLEA 4Z0XA 4KRMB 3AMLA 2EE9A 2RB8A 3QRGL 3VXOA 3IKCB 1U95A 1ZA6A 3IXAA 4EI6B 3VFRA 3ULUC 1ZLWH 2QTEA 5D7JC 2YSSA 4UT6H 5KSBE 1ZHKB 4JAMB 3QEUB 1IQWL 3MRLB 1G9MH 4WO4B 4ZAKD 4APQC 5FYJH 3U7WH 2LU7A 2NY3D 5BQ7B 1A6VL 1NL0H 4MHHG 3IXTA 1NEZG 4JZNB 4E5XA 4RWHA 2CDFB 4LLYA 2EYTA 3DROA 1J9CT 4JFOB 5GS2H 2HH0L 3HPJA 2XZQL 4BQ9A 5CEZD 3SOBH 2CK0L 3PABA 1CVRA 1XF4A 2AJVL 4IOFD 5IW1B 1WAAE 4FXKB 4MNQE 1CLZL 5E6IB 3EBAA 3CFCL 1A6WH 3LRHA 5I75C 5E5MA 5IB2A 3L3GB 4X4ME 3BMVA 1WZ1H 1A9BA 3L7EB 1ORSA 5DF0A 3NPSB 4PYGA 4BFEA 4DCQB 1DBBL 1X3DA 2QSCH 1BD2B 5GS1C 1C5DA 2OJEB 3RWCB 5IGXH 1AC6A 1EDQA 3OB0H 1J0YA 1CDUA 4DOHB 3QUMH 4O9HL 2A38A 3G5VB 5CKGA 5DDHB 3D6GA 4PRDA 3IDXH 1HWHB 2XTJE 3KS0J 3LN4A 4JY6A 4HMEA 1P2CB 4F8TA 1YMMD 4YHLH 5E8PB 5FB8B 3O45A 1M7DA 5EOCL 4KK8C 3T65A 1AQKL 4PUBL 3HMWH 1W72B 4PJAA 4PP1D 4WHTA 1SVZA 4F7PB 1BIIB 4ETYA 1T83C 4ZUUA 4E0RA 4YEFA 4RBPH 3QDMA 1KJ2H 5GGTA 1XCTA 1IBGL 5BVPH 1BFOA 4X6CA 5IKCB 2NXYD 3VFTB 4XZUA 3KG5A 4JM2C 4L9LC 4QRRD 3VI3F 1L6XA 2C3HA 3EIFA 3BESR 3O4OC 4ISVA 1NBYB 5IM7A 4IEFB 2EKJA 1J7VR 2D7MA 1LD9A 2H3NA 3NABL 4IRJC 5CWSA 5F71A 5EOCJ 4H5SA 1JTTA 2J7LA 3GMMB 3ORJA 5GS0H 4KKLD 3Q3GA 3I75A 4XVTH 3STZB 4PG2A 5KSVA 1MOEA 3VDAA 2DQTH 3RWGB 4NKIL 1XIWC 5HHXL 2E7BA 4YHNB 3S36H 4IRSD 4YHKL 4BUGA 4TSAH 3MBEB 2D7QA 1B2WL 3GO1L 1CIUA 3GMLB 5C07A 3AU1B 4D0CB 4RGMC 1A7NH 3ET9F 5DO2D 5IHUL 2D31A 3NGBB 4NWUL 3KXFE 4X99B 4ZXBB 2FDBP 3RUGB 2HFGL 2SEBB 32C2B 1F6AA 5B3JF 1F4WH 1N64H 1CGUA 1UC6A 4D0DB 3NIDF 4YHYB 5JZ7C 2YRZA 5IEHA 3RWFA 2R0WH 5DJ6B 4I77L 3UC0H 2RFXB 4J4PC 2JB5H 2OSLA 4BQCA 4XAKD 1P7QA 5T5FH 4AEHH 3GMOB 5E4EB 2W0PA 4Y16D 4L1HA 2VYRE 4R7NB 1B90A 4PJGB 2EDTA 2FGWH 3QDJE 4FQ2H 5F72S 5ITBH 4X8JA 3AGVA 2WM0A 4H1LB 4ZFZA 5J13C 1T5XB 4MX7B 4LPUA 2OZ4L 1WIOA 3BQUB 2ERJC 4YXLH 1I1AD 4OCXH 1T1YB 3M1BA 5FYKU 3HE7B 2EEBA 5EBLA 1PKQA 1UM6L 3UYOD 4MLSA 2HT2C 1G7PA 2F54A 1MREH 5DVNA 2K3TA 1J0JA 4CNIA 2XN9D 3MCLL 5ELIA 3M45A 2EXYD 3BPNC 4YHIA 2R2CA 2QL1A 1QFOA 5C0BE 3ZE1E 3WNNA 1FN4B 5KSAC 2PW1A 3QRGH 2OR7A 4LMQE 4Y5VC 3CXHJ 2GAZA 2H2PC 2I24N 2VXSL 5FK9A 1ZKAA 2A1WL 4MVBC 4R9HA 4XNZC 4LHUG 1NUFA 1G6RB 4X5XB 4HKXB 2X42A 4U05A 3NIFE 2YRLA 1KPUA 4G80B 1AO7E 3PQYA 2IGFL 5TE7L 5ISZD 1IQWH 3MRMB 1EHNA 5FM5M 1NGYB 2P46B 2H8PB 3HUJA 1R3IL 1NCDL 3SE3A 3L7FB 1X5KA 4Y1AA 1FNEA 2HJLB 1A6VH 5ENWA 1GYAA 2Z91B 2I07B 2M1KA 3L3KB 1NC2A 2NQCA 3CX2A 2HH0H 3A0OA 2XZQH 3CVHL 4R4ND 3Q1SL 4LOUD 5T3XD 2CK0H 1KT2A 1OAUL 1I7TA 3DMMD 1TETL 2AJVH 2E6PA 4L3EE 4P3CL 5J12C 4F33A 1HH6B 4NPYB 1MIEL 1CLZH 4HGKC 1C08B 3CFCH 3KS0H 2V2TA 3ARED 2ZUQB 3FONA 2FBOJ 3QIWD 1S7VB 3EOYG 4MD0A 1FFOA 2UWEB 1DBBH 3QUMA 5E8OB 2VTFA 2HJFB 3KDMB 3EFFB 4O9HH 4P23D 3UX9B 5JUEH 2D7OA 4HV8B 4GLRH 4FNLL 4JFYB 5CGYC 3HE6D 1EBPA 1JGEB 2Z31C 1KN2L 2X4PA 3EOBB 3HZMA 3X12B 4H88H 1T89A 1Q0YL 4JHAH 3U9UB 5EOCH 2P45B 3O11B 1AQKH 4PUBH 5FYJU 4NHUB 2DKSA 4R7DA 4OGAC 1NMBL 4FQ1L 1TIUA 1KJ2A 2HMID 4YXKL 5CCKL 1MF2L 3DGCR 1CN4A 1IBGH 2Q76B 2ZG2A 3QJFA 4ZQKB 5SWQB 3ARTA 4LRIA 1NC4D 5EFIB 3REVA 1FZJA 2AK4A 4RGOL 4KWUA 1X4ZA 3GKZA 1QFPA 4JQXC 3RGVA 5FECA 3NABH 1HCFX 5J06A 5SWSE 1J05B 1XGUB 4JLRB 4TSBL 1PFCA 4K3DL 4YNYA 2APBA 4NKIH 5HHXH 1U3HC 3MV7B 1WFOA 4XXCC 1CS6A 4YHKH 5HGBA 4OM0L 4OZIB 4E9LA 1KIRB 3B83A 1B2WH 1NBVL 4FXGA 3GO1H 1TTFA 3C6LB 3RU8L 2HN7A 3WLBA 5IHUH 4RZCB 3TN0D 4QTHA 4NWUH 4W68A 4NN5B 4PJCB 3BRDA 4IRZL 4FTVB 2HFGH 5ITFA 1ZHLA 1KPRA 2VR4A 2X89A 2A6KB 4UBDD 1S7TB 1YEDB 2YBRB 4N5UA 1YZZA 2NY1D 2ZUSA 1A1NA 3MREA 4LP4A 5IF0B 5BJTA 5DJ0A 4G8GE 5TDNA 1MIML 3KYOB 1MI5B 2IAMC 3OAYK 2GSGA 4Z95L 4PIRF 3ZZ1A 1F6LL 1A64A 4F7MB 1KTDA 1IM9B 5FYLD 1DQTA 2CLZB 1NEZA 5FDWB 4ODTL 2DI9A 2HLFC 1UM5L 2JJTA 4HG4K 1FPTL 4ONFL 2YD3A 4NRYB 2EDOA 1MWAB 4G9DB 1H8NA 4OGXL 3ZDYE 4DK6A 4H1LG 2FEEI 1UM6H 2HKHL 2Y6SC 5D2LA 5D7IF 4MJ4A 1JI2A 2VQ1B 1WSST 4KVCL 5CMAB 2VABB 3UTPE 3RY4A 1ZLUK 5J6GA 3MCLH 5J57B 4WHYH 1ZGLB 1FG2A 2A6IB 5JW4N 3WFHB 2YD1A 5DC4B 2XPGB 4CVWA 4PLKD 5C0CA 1LK2A 1CICC 2UVFA 5FO7B 3UPAA 2VL4A 4LU5L 2WQ8A 5FEBA 5MENA 2VXSH 3CSYA 4XNUH 2A1WH 5FGCB 2CUIA 1PEWA 4MNGE 4OV5A 3CCHB 3IDIB 2NW3A 2IBBA 2BRQA 5JW5A 3GSWA 4WVRA 2IGFH 5TE7H 4XNYL 3MRHA 2X4UB 3O3DB 4JG0L 4EUPB 3UTOA 3DV6B 1BQSA 1R3IH 2DL2A 1NCDH 4J23A 4EXPX 5DZLA 4ZTPH 3TBSB 1U41A 1OOAA 1MHPL 2W92A 3MUGA 3QA3A 5DFVC 5IG7A 1FJ1A 3CVHH 1BECA 1I7ZB 1NFIB 2ZUUA 3Q1SH 4FQQB 1OWWA 4NOFA 1WBZA 4RFNC 1TETH 4P3CH 5DVKA 1MIEH 3DECA 3GEWB 2IPTL 3MNZB 1N6QL 3MGTB 4Y4HB 4JFEA 2XFXA 4JDVA 4KZDL 1H3UA 3VXUB 4DUXA 4P2OA 5F7DA 3QISA 1XR8B 4Y4KB 4QEGA 2UUDH 4JM4L 1FYTA 3ARZA 1UXWB 4XTRD 5B22A 4NQUA 4LNVA 4TOYL 4FNLH 3VXMB 4J3UA 1KN2H 5KVDL 3RTQB 1F11A 5F44A 2VLJA 3GSUA 1JPGB 1Q0YH 3HR5B 3HHRB 2FHBA 1SJXA 1J1OL 1AD9B 2CUMA 1RVFH 3BZEA 1NMBH 2DJ4A 4YXKH 5CCKH 1MF2H 3MRIA 1BFVL 3Q5TA 1MRCL 2XYCA 1JZ6A 5JOFA 4PJ7E 5C6TL 2Y5TA 4OUOA 1MNUL 1WWBX 2BHUA 5DA4A 4RGOH 1ZWIB 3KWWB 3GSNL 4ERSH 4YIQA 4HS6A 4MQTB 1INEL 3VXSE 4I5BB 2ARJQ 1LP9E 1NDGB 5I1JL 2XA3A 3LN9A 4JDZA 2MJWA 4K3DH 2AKRA 3H0TB 4WGWB 5DTFB 1OT2A 1U93B 2NY0D 3ARYA 3BJLA 1EZVY 1T22B 1MCDA 1EO8L 2F8XC 2DMKA 3N06B 1KUMA 4ZPVB 1NBVH 1I9IL 3TBVA 3RU8H 3ULSA 1FZOA 3LKQA 2CPCA 4M43H 1VENA 2NX5D 4AIXA 3BP5B 1S7SB 1EAPB 3CFIC 3DX6A 3O6KL 4F9LA 4Q7DA 4IRZH 3O9WA 3JUZA 3DYMA 2CD0A 5GZOC 1N7ML 3RP1A 1TQCB 4DEPC 2W65B 4LHUA 4OKDA 4ELKA 2CDGB 2R1WB 2VDOL 1I9EA 2JJWA 1A9EB 1IM3B 3VE0B 1KEGL 5ESQA 1MIMH 5IUSA 1J8HD 4GG6F 2MWCA 2JB6B 2HA1A 1HXYA 4Z95H 4PJ5D 3KPPB 5BRZD 1FVCB 3LDBC 5KVFL 4KKAD 2OZ4A 3AS3A 1JF1B 4UQ2B 3IDJB 3MROB 3L5XH 4ODTH 4EN3B 3MRLA 1U8HA 4WO4A 2KQNA 1UM5H 3S97C 4X4YB 5HYQA 1FPTH 4ONFH 4KXZH 1MHCA 2Z0BA 2CXGA 3LKNA 4OGXH 3DVGB 4U6XB 1WF5A 2HKHH 2CDFA 3N85L 5E24E 4WFFD 3UTZA 4KVCH 4DFHA 5AUMB 3B5HA 1U6AL 1EFXD 4U3HA 1LEIB 1AHWA 3ZYOA 5JHDA 3GJFH 3G9VA 2O61A 5KZCD 3TBYA 1BMGA 4FXKA 1WFUA 4KJWC 3RIFF 3I3BA 5E6IA 3MOBL 3L3GA 3I02A 4LU5H 3S3JA 5ACLA 2A6DB 1G7IA 5CZKA 3L5WB 4DCQA 4WU7B 4KK9C 1BD2A 1KC5L 5E99L 3QIUD 1LNUA 1ADQL 2X4NB 3O6FB 5FA4A 1KF9B 1WCBB 1UWGL 4XNYH 4EDWL 1G0XA 4JN1L 4LL9A 4MA8L 4XT1C 4NKOA 1GCFA 1SEBA 4LLUB 5BV7L 1GOGA 3HLAB 2C1PA 1P2CA 2GI7A 1FL6B 2IANB 3QI9B 4X6DF 5E8PA 4YPGB 5FB8A 1MHPH 5JORB 3CVHA 2XQBL 5F9WB 1OAKL 4HDIA 4EUPG 3FMGH 2FEDC 3O3AA 1YN6B 4FP8L 3F6IA 1W72A 1OTUD 4U2ZA 4KTYA 2PW2A 1BIIA 2IMMA 2AEIT 3QEQB 1TVHB 3O3EB 2Q7YB 1PG7W 5C0EB 3IAPA 3FO1A 4FFVC 3LPGA 3BJ91 4TVPL 5IKCA 4KRPD 3TJHD 1GZQA 2DJSA 2Z4QB 1ZANH 5F7MC 2IPTH 1CFSB 2KBGA 1N6QH 3RWEB 4GG8B 43CAB 1TMCB 4GS7B 5INCA 1AJ7L 1NBYA 1X5ZA 1R3KB 4KZDH 3WJJC 4UOW1 3PNWA 3GMMA 4PG9B 5CAYB 3CPLB 2ZUWA 3BVNA 5K59F 4OZFB 5JPNA 3S8WA 1K2DB 3O8XB 4XXDA 3KYAA 4ZUWB 1QSFA 5INDA 3I3DA 4TOYH 3O81A 5DR5L 2AAVA 5KVDH 5BZWA 3QUZC 2CRYA 1J1OH 5J3HC 3PWJB 1V7NL 4MDJA 4U2YA 3RWIB 5DURB 5HPMB 1YYLL 3RUGA 5E2JA 5KSUB 1BFVH 2SEBA 1MRCH 3TH4T 2VQUA 32C2A 4F9PA 3D2UA 3KPOA 3FO9B 1A3QA 1FGVH 4B53A 5C6TH 5KN5A 1MNUH 3RPIB 5I1KL 5DJ6A 3KPNB 2LQRA 5ANMA 2QHLA 2O26U 3BZFB 2EH7L 4LVOC 3GSNH 5LCVL 1INEH 5IVOA 1P6AB 1S78C 2V5MA 5IW6A 1JNHA 3TWCL 4R7NA 4WY7L 1GAFL 5I1JH 1QYGL 1GIGL 4GFTB 4PJ9D 5KTEL 3O41B 4MGXA 2W0FB 5D7LD 1OP9A 3TT3L 3DX9B 3CUPB 2AEPL 5E1HB 5DRWB 1T5XA 4XWGL 2VDQL 4XP5L 2JJTC 4BZ2L 4EI5D 1EO8H 1YEKL 1QRNE 1KB5B 5EU6D 4NN6B 1SMOA 4K55A 4XP1L 3T09A 1I9IH 1OGAA 2WK2A 2E7CA 5F1IA 4ODHL 4C56E 3VGAB 4HK3N 2VLRE 4LLAA 3PDGA 1A47A 1SM3L 3O6KH 3IKKA 3D9AL 4IM8A 5E94A 3TZVB 5I19L 3AB0C 1N7MH 3QXUA 2Q20A 1HILA 3LH2L 5GJTL 1R6VA 2VDOH 3GKWL 5I1AB 5JXED 1KEGH 1JE6A 1HSBB 4TTGA 1A7BA 4M8QA 4HKXA 4G80A 3VXRA 4RGNB 4N8VB 3V6BR 5KVFH 1R3HB 3VFWA 1J1XL 4I9WE 2Z9TA 4ZTOL 1CXLA 4H26B 1XGRB 3RDTA 1HH9B 2HJLA 2BXZA 5DS8B 1NGXB 4NO0A 3N85H 4N9GB 1W8NA 1MY5A 2HFFB 4FQXB 3ZDXF 1H5BC 4CVZB 1U6AH 4F15B 4RDQG 4G6KL 3PXJA 1IC1A 1HH6A 1JWUB 4NPYA 5C0IA 3S4SA 3B2UD 1YJDL 4P2QB 4BSWA 1ZHBB 1B0RB 1CTNA 3MOBH 3OPZH 3R1GH 3OGCB 4K7PX 4U6HA 5E2WL 3BW9A 5IOPA 3ZTNL 1JZ7A 1OSPL 2VC2L 3GSVB 1MCWW 1RD6A 4HCRH 4DOHE 5KAQF 2ADIA 3V4VH 4NFBA 1KC5H 1QKZL 2H6PB 1K4CB 3E0GA 3L6FB 5E8OA 5E99H 3KDMA 1ADQH 3EFFA 4M6AA 3G6JA 2R1XA 5I76B 1UWGH 4HV8A 1Z2KA 2O5XL 4EDWH 5TQ2L 4DGYL 3TYGL 4JN1H 4MA8H 1MRDL 3EOBA 1OTTC 3X12A 3HPLB 2HLAA 5BV7H 2A0LC 3U9UA 1JZ5A 2V7NB 2XQBH 3O11A 3V79C 1OAKH 4KC3B 3U9PL 4D0BB 3KYNB 2UY7A 4FP8H 3PWPD 5I6XB 2QKIB 5EUKA 3BGFC 4Y8AA 1BOGB 3DBXB 3JV6A 2Q76A 4TVPH 3ZE1F 3HNTL 4HUVB 4P4KD 5SWQA 3MSPA 3BKML 4XBEL 3KHOA 1AJ7H 4WUUB 3TV3L 3DIFB 3O4LE 4UAOB 1MCEA 3NIFF 1J0IA 5HHQA 4JLRA