1VSCA

Vcam-1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
196
structure length
196
Chain Sequence
FKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion protein
molecule keywords VASCULAR CELL ADHESION MOLECULE-1
publication title The crystal structure of an N-terminal two-domain fragment of vascular cell adhesion molecule 1 (VCAM-1): a cyclic peptide based on the domain 1 C-D loop can inhibit VCAM-1-alpha 4 integrin interaction.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1vscA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1vscA01
2ZJSH 5C0BD 2F9BT 1LP9B 1RUQL 4RX4D 5DEZA 4OB5H 4ODVL 5DHVH 1WK0A 4P2OD 1MELA 2X4SA 3DBXA 4NN6C 4P5KA 4PJBF 4UAOC 5EB9A 3IYLW 4AENB 4J3OC 4ELMF 4HWEH 4RA3A 1GGUA 3O6KH 3BW9B 4MDIB 3QUML 5F6HJ 1MFBH 3HI1B 2P5WE 3N1GC 1CGSH 4N8VG 3MA7A 5F9OL 1RK1B 4WI8A 4GG8A 3C6LC 4U2YA 4BFIB 3FB6B 1BQHB 2GTZB 1BIIB 1WIUA 5EZIL 3V7MA 1WEJH 4XNXL 2CLZA 4G6FD 2L7UA 4CMHC 1CIUA 3GSVA 4AEIL 3EO1A 1IAII 1WGOA 3U4EB 4GG6B 1QRNB 3GI8H 3TPUB 1FC1A 2ZUQB 3PL6B 3DO7B 5FO9B 4OIBA 4CVZB 4PJGB 4PP1C 2NW3B 3GBMH 4JN2A 3EW3B 3LS4H 1FZOB 1RJZA 1UJTA 4OZFG 4OLWH 5LJYH 1ZT7B 5HGHB 4NBYB 5BOPA 3HAEA 2AV7A 1MPAL 1VEOA 2ITDA 5BJTB 5BVJB 1MWAA 2F74B 1IC7H 2D7OA 2J88H 1KTDB 2NX5E 2W9EL 1ZVHA 1F58L 1PSKH 4NO5A 3EYQD 5EC1A 1G1YA 1W72L 1A8JH 1RU9H 1YNTB 3MRBA 5T5FH 1UJ3B 2R1WB 1T7VA 5DYOB 4U0RC 4YIQB 2HKHL 4ZOBA 4JDZA 3RZWA 2DLIA 3TH3T 1NUGA 1AGBA 1NGZB 1S7UB 4WFGD 3IKKA 5ITBH 2NY7H 3TBYA 1NCAH 4TTGA 2HT3D 1QHPA 3SN6N 1S3KL 1S9XA 5EBLB 2GTWA 5B3JF 5IB1B 5E9DD 3O2WL 2BVUA 2ED8A 4U7KA 5IVNA 1EEZB 4OZGF 1B2WH 5K93A 4MAYD 5I8OL 2E7HA 2MQCA 3MOAH 1I4FA 5I16A 1QSEE 5DVLA 4WRLA 3RX5A 1MFNA 1EAPA 3I85A 4HBQA 3G5ZB 4OQTL 4WUUB 4P46D 4NKDA 1QBML 1RY7B 4LLQA 2V2TB 1J1PL 3QQ4A 3MNVB 1ACYH 4U6YA 4NP4L 4KDVA 5DQ9B 4Y1AA 1P5VA 5T5NG 3NABH 4PJIE 4P2OB 3P9MA 3Q3GB 3VI3F 5AD0A 5IIEB 3LKOB 1CD1B 1A0QL 3TWCH 5DS8A 3MV11 4TVPH 5ETUA 3MJ9L 1P4BH 2EZ0C 1A7RL 1SY6H 2Z91B 1AO7A 1SJHA 5I1IL 1W2KT 4NHCL 1YEJL 4PJEB 4X5XA 3MV9B 4I77L 5E00A 4U1HA 4HIHA 3MBEB 4FG6D 3BMVA 3VRLF 5K59F 2YUZA 1S7TB 3C09B 1GC1L 4OGYH 4NJ9L 3ZSSA 1H0DB 1P9MC 1XR9B 2LU7A 3BESR 1T1WB 3EO0A 5BZWA 1S7WB 1LEKA 3IJYB 1B90A 1DQDL 1DLFL 1QFWL 4DUXA 1NDMA 2PR4L 5DEGA 1T3FA 1JHLH 2CRYA 3MRJA 4J23A 4HF5L 1VGEH 4RGMC 4WFFD 4LCCC 4X5WA 5HHOD 4JZOA 3HZMA 3OR7B 3RBGA 5GS1A 4LVHC 1H5BB 3GFUA 1OAKL 3MLUH 4YDKH 5IW3A 3P9WB 3NFNB 4XHQA 5D1QA 5D7JC 3N06B 1HYSC 1U58B 2R2BA 4LASH 3UEZA 2KBGA 4TNWK 4U1SB 4K55A 4CVXA 5T1KD 3ECBB 1KBGH 1J87A 1U41A 1NAKL 4MWFB 2OR9L 1KYOK 5ISZD 3Q5OA 4Y2DD 5HPOA 4RAVA 4QOKE 1FG9C 3MRRB 3WS3B 1F8TH 4P49A 3A6BL 1UXWA 3X3FH 4ZTOL 4OGAD 4R90L 5TE7H 3EJJX 2R0WH 2CK0L 2O5YH 5F1KC 3NCJL 2GJ6E 5HYQA 3MACH 4XMPL 5DD1L 2BVQA 4ZS7L 1EGJL 3NZHL 1CQKA 1MJ8L 2V9RA 4F7TA 2FX8L 3BEWA 1C5CH 4LCUB 3HMXH 5CHNB 4QRPE 1TVHA 2BRRH 1B4RA 3B5HA 3ULUC 4JFHD 4NNYA 2DJUA 2OXHA 4UT6H 5BRZB 3SKOB 3SGJC 2WBJC 5AAMA 2H9GA 3TBSB 3AREA 1T66D 4KDTA 5I1HH 2YEZA 1EZVY 2EDWA 1T7YA 5FAAA 2OXGA 2APWA 2CKBB 3QZWB 4M7JL 5CS7A 4CU8A 3QBTB 2EDDA 4FQLL 1P7KA 1VERA 3QJHB 2V5YA 3WFBH 3L3KA 1S78C 2ED7A 4O02L 2F15A 4RFOH 3QIWC 4C83A 5T3ZD 5BW7C 3ULSB 1CXFA 3QXWA 3VXNA 5C0ND 5HHPA 3VFTB 3CDFA 3QISA 3RWJB 3B9KA 2NX5A 1PDKA 2VR9A 4OSUH 3UJJH 2VDRL 4MNQE 5EIVA 4PJAF 1LO4H 3BAEL 3ELAT 2MKLC 4XC1H 1LD9A 4DZ8A 1LNUB 1ZVYA 4PJFB 3P0GB 4JQXA 1FFQA 4X6CF 3MOBH 1OM3L 4QXTB 2NY0C 2NXYC 2VAAA 1QPXA 2QR0A 3S88L 2HTLC 4S0TD 1HQ4A 3TP4A 5DR5H 5C0JB 4OZIB 3N1MC 4OLZL 2GAZA 2ORBL 1RUKH 3AC0A 4KK9C 2AV1B 1JIBA 1UWXK 2W0LA 1RZIB 3KYNA 3S35H 5EUOF 8CGTA 3RDTC 3A6CH 1LWRA 3AB0C 3M45A 5C6PB 2J6EL 3FKUS 5MHSE 3CFCH 3ARXA 2BSED 4Z7OE 3RKDD 4HWBL 1QSEA 4AQ1B 4YK4B 1SYVB 3U0PB 1CF8H 3ROOB 1MCWW 3TV3H 4AK1A 1A4JA 4JRYB 1CG9B 2W65A 5I1JH 4FS0A 3RKPA 3VFMB 1CK0L 3VFWA 2EYTB 3BKYH 3SQOL 5HHNB 1T4KA 4GXVL 1SJEB 2C1OA 2JIXD 4MA8H 1LHZA 5JLZB 3G6JF 2P48B 4LCIL 2IH3B 3KPRE 4KI1A 4N1HB 2GIYA 1U8IA 4NGHL 4F15B 4HFWA 5E8OB 1J8HD 4QTHA 3QNXA 3OB0K 3T65A 5LCVH 1WFNA 5C9JB 4N8VB 1NCCH 3ARFB 2X70B 3DX6A 1LO3H 1RIUH 4JANA 4C56D 3KPSA 3K4AA 3TNNA 2VISA 1G9MH 1MSPA 5IEHA 3MRPA 2G75A 5F21B 3TVMB 4IIQA 3GSRB 4LLMA 4P3CL 4Z77B 2QSCH 1L7IL 1QQDA 4I3GA 1QTYT 5FM4A 4DN4H 5BV7H 4ISVA 2XV6B 2VXUH 4JB9H 5JIPA 4GBXC 3PHSA 5KANI 1IAOA 3BSZH 3L6FB 3PJSA 4Z7UF 1DQLL 1I8KB 4C57C 2Z93A 5IQ7H 5JHDE 4LSRL 4TOYH 4WFED 1R3HA 3BH9A 2VDNL 1KPRB 4YDVA 3GUTB 1D5XA 1U93A 1ED3B 4EI5D 2XOTA 5DEFB 2FNBA 3LS5H 3QO0A 5EN2A 4RISH 4YEFA 1CICB 4PJBB 4U7MA 5H94B 5DJDB 3MJGX 3UTTB 4ELMB 5E2UL 4OCWL 3WN5C 1FIEA 4TUKH 2YC1B 1NGXB 2R1YA 1AHWA 1HDMB 1PLGH 1VSCA 5T3ZH 1ITBB 3C5JB 2EC9U 3U9UA 3A6OA 3DO3A 4PJ8B 2D7QA 4XNYH 5DF0A 2ICWJ 3ULUE 3W9DB 2P7TB 2F53E 5I15L 3BWAB 1M05A 1NCWH 43CAA 3BW9A 1HOCB 2AK1L 3N50A 5C07B 2VERN 2P1YA 2Z0BA 4JFXA 3OL2A 1RK1A 4RZCA 4YBLC 4POUB 5CINH 4BFIA 3L5HA 5F6IC 3J7HA 3FB6A 1BQHA 2GTZA 1BIIA 1V3JA 1FLRL 4JKPL 4MXWL 4S1DD 4NRZB 1DBBH 1NL0L 2YPKB 1TTGA 3WFCH 4MA7L 3PGCB 3U4EA 4GG6A 3TPUA 3PL6A 4KRPC 3T0EC 3DO7A 5FO9A 5BS0B 4CVZA 3MLWH 4PLKC 4PJGA 2NW3A 4NO3B 4NQTA 4PJXF 1FZOA 2UVFA 1BLNA 2A9ML 1MCNA 1ZT7A 5HGHA 3PP3H 1FAIH 1AXTL 1CDUA 1JGDA 1J8HB 3H9SB 5GGVY 5TF0A 4L8CA 1VFUA 4IS6B 5BJTA 5ADPH 5BVJA 4RBPH 3RVUC 2F74A 3TIEB 4UT9H 1TIUA 2YSSB 3FL7A 3QUXC 4WWKD 4APQB 1VEMA 2EIBA 4HC1H 2VLME 1BVKA 1JHKH 3VGFA 1YNTA 5IKCB 1UJ3A 2R1WA 2CDEB 5DYOA 4YIQA 1C16A 1EHNA 3FRPA 1LDSA 4YXHL 3S37X 2WIMA 2E8ZA 4OCLC 5JR1H 5DJ0B 3RVTC 3SDCD 4OZGB 1I9IH 4OZHF 3QHFL 3L5WB 4CKVX 4YFDB 4JM2C 2Y4SA 2I07B 4QHKJ 2GUOB 3NIFF 5FHBL 1S7UA 1QEWB 3UDWC 2PYEB 4KTEL 1A7OL 4RNRB 1KB5B 5F72S 4JM4H 5EWIH 4FNLH 4YHZH 2GKIA 1FGVH 3HCVA 2C4FT 4PGEA 3KNBB 3TEUA 4Z0BH 3DSFH 2R56H 1EEZA 3SDDC 5C3TA 2OZ4H 2VO5A 3ZO0A 1KSRA 3P11H 1KB5H 2CDGA 2D03H 3OXSB 4L9DA 4ONGL 3U7YL 4WUUA 1DTUA 1X5GA 2V2TA 2W59A 3MNVA 4NOBA 5GHWL 3K7UA 4E42B 3Q3GA 5IIEA 3LKOA 1KT2B 1CD1A 2XXMB 5C2UB 1YJDC 2VDOL 2NY2C 4ZFGL 2FHFA 2AK4D 3C2AL 3L3GB 2Z91A 3EBAA 3OAYK 5DJ6B 1NKRA 5GGSB 3BN3B 2MSPA 3SY0B 4YFLF 3IJSB 3MV9A 4M1GL 2A2QT 4M00A 1A6WL 3SGKA 4OV5B 3MBEA 1S7TA 1QOKA 1NFIB 2PW1B 2OBGA 4WFHE 1XR9A 4WV1B 3LH2L 2D2OA 3IJYA 2NY4D 4G6JH 1DDHA 4DGIH 3QI9C 4UTAH 4MA3B 4JPWL 2Q3AA 4QXUL 4UINL 5DJYB 3AXLB 2E27L 5B21A 4CDGC 3O2VL 1P53A 1KJVB 4HKXB 5GXBB 1EXUB 3D0VB 3MLXH 4EIGB 1KULA 1MQ8A 1U91B 4J6RL 4JO2H 3EO9H 4P4KC 1OP3H 2Y6SD 2FEDC 5D7LE 3E2HB 1U58A 1KC5H 1KENH 2Y7QB 2QBWA 1CLYL 3QUZD 1I1AD 2P49B 4U1SA 3G6DL 3GSOB 4N90D 1UVQA 4IBLT 4JHBA 3ECBA 5E8PA 4MWFA 1C5DB 1NH6A 1UZ6E 5J6HB 1U8PB 1CL7I 2F53A 2WBJA 4ODWB 3WE6B 3MRRA 4Q6IC 5ESAB 3MUZ1 1RZFL 5HYSG 2WBWB 1E4JA 3IDYB 1FSKC 1D5IL 3DXAD 3BKCH 4JCLA 2DD8L 4NUJA 5BVPL 4NFCA 3M17B 2CIIB 1S9VB 2BP3A 1H3UA 4U1GB 5D93C 4R3SB 5JW4Q 2OL3B 5HDBE 3D3VB 3KDMB 3CDYA 4LCUA 5E0QA 1HN1A 1L7TL 5CHNA 2X1QA 1OARH 3SE4A 3T3PE 4GAFB 5GPRA 4OD3L 2ARJA 1GPOH 2BK8A 3LN5B 5BRZA 2BVOB 3BPOB 3PE9A 3SGDI 5D7IB 3SKOA 3T0EE 3TBSA 1A6ZB 1MRDH 3EJYC 5T1LD 2G9HB 4HUWB 5SX4H 5C7XH 4IRJD 3VXUD 4HKJB 3E0GA 3RNKB 1Z9MA 2P47B 5CJBA 1KCRH 2BOBB 4FMKA 3ZDYE 4WEBL 2CKBA 1YY9D 4GJTB 2B7DT 5AZ2L 4IDJH 4PJAB 3MUGB 1KJ2H 5SWSB 5EU7C 1EPFA 4Q7DA 5J1AB 3ARBB 3ZDZE 5CJ5A 4UNTA 2DM4A 1DSFH 1NGQH 1I7RB 1WV7T 4P3WA 3NZ8B 4UT7L 2PTTB 3ULSA 4ZO8A 5TDPB 4AYFA 1MAML 4GQPH 3G5VB 4OCXH 3VFTA 5HGDB 4C54A 2DBLL 4HIIB 3RWJA 4AG4H 4FQHA 3QIUD 1OAQL 1J11A 4Y4FB 3WIHH 2ZNWA 4F58L 2HTKD 2XTLA 1RSFA 1F90H 1LNUA 4GXUN 2YKLL 3VFUB 2KPNA 4QXTA 2EXYD 1RUQH 5IK3A 1E4XI 4ODVH 5C0JA 4OZIA 5IHBA 1ZLUK 2VQ1B 4I2XE 1CFNB 2BDNL 4G8IB 5F7NC 4PG2A 2AV1A 1H3PH 2FR4A 1RZIA 4S1QL 1V7NH 1C5BL 3VXOB 3QIBD 2AVGA 4WTWA 4L29B 5CZKA 3MLVL 4PJHF 2MPAL 3FQTB 1EV2E 5TJWK 1IM3B 5D2LE 5EZIH 1SYVA 3U0PA 4U1NB 3ROOA 5AAWA 3QUZB 3GM0A 1LE9A 2QADC 5JQ6H 2EXWD 2QHRH 2VQTA 2Z31B 1ORQB 3VFMA 4FFVC 5T33L 1E6JL 2EYTA 1I1CA 5HHNA 3NFPB 1SJEA 2IAMB 4G3YL 4P2RE 3AS0A 1F97A 3LDBC 5CD5C 4GS7C 1KFAL 5IBLC 5C0IB 2DM2A 5E8OA 3OTTA 3SOBL 1I1FB 1QYGL 3NA9H 5MEND 5C9JA 2WINB 4N8VA 3ARFA 4KVNL 2X70A 4GAGL 3W5NA 2DRUA 4UILL 5BXFB 1P1ZB 1TVBA 1FYTB 4KKCD 1N64H 3TVMA 1MI5E 3GSRA 3MRNB 4ZQKA 3BT2L 3BX7C 3LAFA 1TPXC 3RIFF 5JOPE 3EZ8A 2W9EH 4HWZB 3PG2A 1F58H 2A38A 2JJSA 4MJ4A 1NKOA 3UC0L 5I73C 3BUTA 1QFOA 1W72H 4DGVL 4C55A 5J7CC 3IFOB 3L5XH 3QFDB 2Y5EA 1U8OB 3O9WC 2DTMH 1L9NA 3X17A 3KAAA 4GW5B 4RWHA 4KKAD 3L6FA 5HI3D 1TZIB 4OZFA 1JFQL 4P9HC 3KLDA 1I8KA 2R4RH 5C3LD 2X09A 1UM6L 5JOFB 3K8KA 4OGXL 4W4OA 4P5MB 3ZDXF 3T0DA 1KPRA 1TJIL 3T3ME 1BFVL 3GUTA 3WFEL 1K2DB 4JFOB 3UP1A 1QSFB 1X3DA 4XB8A 5DEFA 5ADOH 1CICA 4PJBA 5FGCE 2FBOJ 2HFTA 4O00A 3UTTA 1GGCL 2ESVD 3VRJA 2YC1A 1NGXA 5I8OH 1DN0B 1HDMA 3C5JA 5FYJE 5D1ZC 4PJ8A 2PETA 3NIGE 3PHOB 5GGTA 5DFWH 4OQTH 3W9DA 1F3DJ 3CU7A 5FM5M 1J1PH 4JFZH 3BWAA 4TRPL 1P4IH 2FB4H 4D8PA 1M7IA 1N6QH 3ES6B 2GJZB 3WS6C 5KJRH 2EDLA 5IB4B 4Y5VB 1UCTA 2NXZD 1DQML 5I1IH 5EU7E 3VA6A 3CFDB 3FZUC 4NHCH 3BGFC 1IGTA 1F6AB 3B5GA 2ZCKL 1HXMB 2P43B 1CTNA 2B5IC 3GB7B 4Z7NF 4NRZA 2YPKA 4NJ9H 4AMKH 2Q7NA 2FCBA 1NFDE 4PV8B 3V79C 2P8PB 2LU4A 2J8UB 1DQDH 3QPXL 5IFJB 5CGYD 3MJ8A 3OAUL 2GFBA 3EYUL 3O6MH 4LHQB 4ZXBC 5I8CA 3I2CH 5FV2A 5CWSB 3UTPE 5BS0A 1RHFA 3WXWL 4NO3A 5JUEL 2A1WL 4R97C 3SQBA 5A2LH 1MFEH 3ZTJG 3H9SA 5HYJE 2APXA 2Z9TA 4IS6A 1UCBL 4HIXL 5MENB 4I1NB 5C08D 4QRRB 3VCLB 3TIEA 4LDEB 1AP2A 1NAKH 3HLAB 4KTDL 5C8JA 2R2EB 1F00I 4OZHB 1T6WA 1QR1B 1FNGB 4I2XA 4XBGB 3TBVB 4DQOH 1I3VA 1B6UA 3CLEH 4LGPB 1MJJB 2R15A 5C0GB 3A6BH 4H25B 4AT6A 3GHEL 5IKCA 4XCYB 2CK0H 1LO0H 1ZAGA 2YD4A 2JF1A 5I8KH 4XMPH 3EYVA 5CIPA 1A6PA 4HX1B 1EGJH 4OI8A 2BSSB 2FX8H 2I07A 1J5OH 1YMME 1QEWA 4K3DL 1JK8B 1JZ2A 3RBSA 2RGSA 2PYEA 4LLVB 3W11D 4X9FA 1XMWA 4RNRA 4PRID 4AJ0A 3C8HA 3QCVH 1XEDA 2YN3A 3CIQA 4P2RA 1BX2B 1ZLSH 3WMSA 3LB6D 2XG5A 4P5TD 3SGEI 5I1AB 5I1GL 2VABA 4M7JH 3PWLB 3VFSB 3CVHL 4ZAKD 2DIBA 2ESVB 3EUUA 5CUSH 4X6FB 2LAGB 3UBXG 3ULVL 3LKRB 4O02H 3FAWA 4X7EC 2WUCL 4QNPF 4N1EA 1RZJC 1IILE 1E4KC 2P44B 4QEGA 1MCQA 1MI5A 1T0NB 1T5WB 2AJZB 4E42A 4KKBC 5B38G 4TSCL 3LOWA 1KT2A 4FQXC 3OAZK 4ZDHB 2BY2A 3BH8B 4K7FB 1A7QH 4R7NB 3L3GA 2W0KA 3QCUH 2GY7B 12E8L 3SY0A 5DMIL 3OPZH 3TIDA 1AGEB 2NXZB 4X9HA 2H8PA 4OV5A 1N26A 2XZCH 3IFNH 5DD3L 1YEFL 4Y5YA 1G9EA 1NFIA 2PW1A 5EOQL 3MV8B 4MQ7B 4WV1A 5TQ2H 3CVIL 2MWCA 3JWDC 1BF8A 2VZ3A 4MA3A 4Z76B 5F7DB 1U8LA 3WJLC 1QR4A 3QWRD 1I3RB 5DJYA 1NUFA 2X44D 2PUQT 1OW0A 3IETB 3C6SB 1OP9A 1KJVA 1NMCC 4HKXA 1SVCP 1EXUA 2WQ8A 4ZOCA 3MJ6A 3D0VA 2HWZH 2O93L 3U0WL 1INDH 3VH8G 2DQTL 2VZTA 3TN0D 1SQ2N 4Q0XL 1ES0B 1PZ5B 3OKMB 5DC9B 2EH7L 2RHEA 2HRLA 4CL7A 3TA3B 2FBJL 3V6FA 2Y7QA 2YD2A 4L4TE 4HWBH 5ANMB 3DROB 3GSOA 4HEME 5BOZG 3WUWG 4OF8A 5A2KH 1C5DA 1N7MH 1HI6B 4KROB 1U8PA 5F97E 4A2MA 3NIDE 1CK0H 4M9OA 3WE6A 2VLJD 3SQOH 5ESAA 4GXVH 4ORZC 3KXFD 3UTQB 5FGBC 5MEOB 4MSWB 1UM5H 4HCRL 3HE7A 1URLA 1IGIH 1HK6A 1BBJA 1KLUA 1IFHL 3RWHB 3ZL4L 1G0YR 1WBYA 4HGMA 2CIIA 1NAML 4XMLH 4TULH 1HHJB 1S9VA 3W0WD 5DRWA 3U9PL 1KACB 2OL3A 2C26A 3CXHK 4I13B 1I3GL 1EHXA 4OFIA 4U6HB 3D3VA 3KDMA 4J12A 4Y5XC 1F4XH 4G8GE 4WHTB 4YEEA 3JSSA 3E1F1 5D2NC 4XHJC 3LN5A 2BVOA 5D7IA 4P3CH 4D0DB 2G9HA 3MGTB 4HUWA 3VXRD 4MLIA 5J13B 4DZBA 3QDMD 2HFEB 2P8MB 2R1XB 4MQSB 4GRLC 2HFGH 4MA1B 4D0CB 4TN9A 1YYLH 4LCWD 4PJAA 3UTSB 4MJ6B 1NPUA 3NVQA 5SWSA 4MJ5B 1PG7H 3O6FC 5J1AA 1YEEL 3FFCE 2PNDA 4U1JB 3ARBA 3GMRB 4OI9A 4DJMA 3S4SB 5HYJA 1I7RA 4H0GA 3NZ8A 2PTTA 4MYWB 1JBJA 3S7GA 2VDNH 4AL8L 3GBLA 4IMLB 4JPKL 5HGDA 1T89C 4HIIA 2VC2H 4JPVH 3ULUL 1A47A 1MCRA 3TCXA 2Q7YB 4Y4FA 2V9QA 1IAMA 3FN3A 1U9KA 3BO8B 2Y06L 3UO1L 4G9FD 2XTJB 4KZEL 5ID1B 5E2UH 1JWMB 5FA4B 4E0RA 5CEYB 2EC8A 4JFEE 1UENA 3VFUA 5HDQL 4KJYB 3QULA 2IC2A 2IAND 4HS8L 4KRNA 3LD8C 3HC3L 4OM1L 3RWFA 5L6YH 1OTTD 1YMMA 1KXTB 3IU4H 4QWWD 2VQ1A 1UB6B 4XXCC 1FVCB 2EDYA 4YXKL 1CFNA 4FQ2L 2JKXA 4HIJB 4G8IA 3MRFB 5DWUL 4PJCF 2JCCE 5T3XE 5ILTH 3MROB 3MCLH 3VXME 5E8EB 4JRXB 4G8EB 3PABA 3VXOA 4X9IA 5B4MC 4L29A 4L4VD 5HXMA 3X11B 5FUCC 3FQTA 2V2XA 1AI1H 5FYKE 2P4AB 1FYHB 3FQWA 1SM3L 3KS0J 4JKPH 4MXWH 1CBVH 1FLRH 4O2EA 4GKNB 3V9FA 3DV6B 4GRWF 4K2UL 5A3IC 4LARL 3GGWB 4U1MB 4HXAL 1FNEB 1FG2B 2Z31A 4XVUC 4NZTL 2L7JA 1WVZA 3MRQB 3PQYE 3NFPA 1LK2B 3KPQA 4J1UB 1V3LA 8FABB 1T83C 4E41D 3THML 5C0IA 1LO2H 3QEQD 1W8OA 1I1FA 4LAJH 1G7JB 4ENED 1AXTH 5IW6A 5KAQF 1RJLA 5IVXE 4KI5C 2XNAB 4M5YL 4JR9L 5SV4A 2FGWH 5BXFA 4Y89A 1P1ZA 1D5BA 1R6VA 5IJVB 1FYTA 1UEMA 3SDXF 1BJ8A 2HKFH 5I1LB 5K9OB 2X9YA 4HWZA 5GGQL 4GAJH 3RVVD 1XGYH 5ALBL 4GO6B 1X7QA 3IFOA 4DUVA 4WTXA 3QFDA 4P2OC 4WJ5B 1U8OA 1R3IH 5IBUG 1JWUB 3TFKD 1BBDL 1HKLH 2FATH 5JPMA 1TZIA 3U4BL 5CP3H 4POYA 1Z9SA 1WT5C 4L4TA 3QHFH 1AY1L 4XWGH 2X10A 3EHBD 3SDAA 3ZKXB 4RDQF 4ZYKB 4QGYA 4P5MA 4PBVC 1FO0B 3PDOB 4RRPG 4NQEB 2NY6B 2BC4A 4GMSH 1A7OH 1QSFA 2AI0L 2Z8SA 3MREA 2H32B 5EA0L 5D5MF 1QFUH 4HJ0D 3LRSB 5T1DL 1S5HB 5C09E 1HEZB 1U8MB 4BSVA 1A6UL 3HRZB 1DN0A 1OTSD 1FO0H 3VU2A 1H5BC 3QUYB 3QXAB 4JFFE 5EU6D 5LWYH 5DK0B 1F4WL 3PHOA 3FO2A 4ONGH 5D2NE 3ULVF 2D7PA 4G8GA 2YMXH 1FLTX 1AC0A 4H88H 4LL9A 5JZ7D 1XF4B 4DTGL 1MLBB 5GHWH 4J3VA 5HHMB 1KTKE 2CLVA 4EN3D 5K9QG 3OKOB 3JTTB 1MRCH 4NKQB 5IB4A 4UI2A 4Y5VA 4G8FB 5EZJB 4L1DA 4XPBH 3FOMA 1A6VH 5I30H 3CFDA 3QH3B 1CLOL 3EYQC 1HSBB 2E6PA 4JPIB 3RFZC 5F7FA 3DUUA 4OJFH 1HXMA 4X8JA 5D71H 2ATPB 3IDJB 5DFVD 3FFCA 5ABDE 3C60D 3HI6L 2XN9D 5J11B 3UBXB 5E94B 4PV8A 5I9QB 2P8PA 1WAAE 2J8UA 2X4UB 4XPGL 5IFJA 1HINH 4J4PD 5C2BH 3ETBF 2KZWA 1ZA6A 1DBAL 3ARDA 5CWSA 2E27H 4KXZI 1NMAL 1O0VA 2BY0A 4WO4B 2YD8A 1SEQL 2HT3C 3TO2B 3T2QA 3C8DA 2VXTL 1CN4A 4J6RH 3P73B 2CGRH 3PUCA 3HI5L 5IHZB 5JXED 4XVTL 5JXAL 1HHHB 3VXPA 4FQQB 3VE0B 4QRSB 4QRRA 2Z35A 4MAYC 4PFEA 3VCLA 2LU3A 3HLAA 2R2EA 4HZAA 3IGAA 2FL5B 3QDGB 1U3HA 4EVNB 4XBGA 3TBVA 4MQTB 3WHE0 1MJJA 5FO8B 3H8NA 2XZZA 2JCCA 2Y72A 4HJGA 5DD6B 1OGAB 3VXMA 4P46C 1XZ0B 2HLFD 2NY3B 5FUCE 2WM0A 2DD8H 4D2NA 2RIKA 3MLYH 2WIIA 3DGGB 1XT5A 3PWUB 3VG9C 4HHAB 1ZHBB 2AXHA 4HX1A 2I9TB 2BSSA 2CH8A 1WSST 4JVUA 1JTPA 1JK8A 3VFOB 1T2JA 4LLVA 2IMMA 4N9OB 2UUDH 4FG6C 4KHTL 3PQYA 4IRSB 2EKSB 1BX2A 5I66B 2CRMA 1LQSR 1T1ZB 4A6YL 4P0DA 5BMFH 5F9DC 3PWLA 3NFSH 3VFSA 3QXVA 5AZ2H 4CRPA 2YD6A 2YHGA 4X6FA 4IDLA 3ARTA 1I75A 4KI5E 5AYQA 4QTIH 1ZGLM 2BHYA 1MLCA 2Y25A 4TVPE 2PO6D 1TZHB 1JPGA 4UT7H 2ADGB 3GIZH 4JN1L 3S98A 5C0BE 4YK4C 5INDB 1T0NA 4JHZA 2DBLH 2AJZA 3NCYS 2EIZB 1F45A 4KV5E 2GT9B 5HD8D 1OAQH 2OP4H 4BJLA 1JF1B 5C9KA 1PBYA 4ZDHA 2WMPA 3BH8A 4K7FA 3S36H 4F58H 3V8CA 4EN3B 1NUDA 4HPYL 4XAKE 4Y2DC 3JWOH 1G9MC 1ZGLB 1OPGL 4PREA 4CVWA 3QG7L 4OGAC 5E1AB 1T03H 5ICXB 4EUPG 4MQ7A 5CLWA 2QSTA 3C60B 1KF9B 5BV7C 2VZ1A 1S7XB 4Z76A 5F7DA 5JO5B 4ZMAT 1UEYA 1I3RA 4IOIB 1ZEAH 2BDNH 3VXTB 1G7LB 3IETA 4MHHI 3GHBH 2ZSVB 4LSQH 2VKWA 4JO4L 2AJYH 3FO0L 4HH9B 5C09A 4CAGA 3PWPB 1RUAH 4Y19B 3OKMA 2X6MA 1T66C 4NQVA 3BPLC 5F7UA 3AM8A 3TA3A 4J8RB 5GRXG 3SJVD 4C59B 1VKXA 3VDAA 5ANMA 5TGBB 5GZND 2J5LC 3QP3A 1T1XB 2DLHA 2ADFL 4OF5A 4P9MH 4OF6A 1HI6A 4F9LA 1E6JH 1FGNH 1MHCB 2LV4A 3U30C 3UTQA 4GKSB 1U8NB 4MSWA 5MEOA 4EQ3A 2NZ9D 4FXKB 1V5JA 3H3BC 1KFAH 3RWHA 5C0NC 3BDBA 3ORJA 5HYEA 1E6OL 1UWEL 3SOBH 3SHSA 2HVJA 3DHJA 1PJ9A 1ADQA 3BE1L 2YZ8A 5EO1B 2YOCA 1G7MB 1S5IH 5JMRA 3O6LL 3P4OB 4MAUH 1QBLL 3QHZL 4I0KA 4RWYL 1NC4D 1WAAA 4DOHE 3GM8A 3MV7B 3MGTA 3TO4D 4HUKB 2ZOKA 2HFEA 4DGVH 1R24B 4OUUA 4WFGE 2R1XA 4JY4B 4MS8D 5DURB 1RZ7L 1EO7A 2ICWB 1WJ3A 1RI8A 4D0CA 5JA9A 5C0RL 2KL6A 4M6MH 2OSLA 2XFXA 3UTSA 4JDVB 1H15B 5E9DE 4U1JA 3MSPA 3GMRA 1MJ7L 4PJDE 5E5MB 4O58L 4G9DB 3QNZB 1UM6H 1JCKA 4OGXH 1ZXQA 2BNRD 3ULVD 4EOWL 1TJIH 4DKFL 1BFVH 1I1RA 2BCKB 4OF7A 3WFEH 3RKDC 3P0VL 4NT6B 4S1RL 2Q7YA 2VLRB 2C3XA 3EYSL 3GSUA 3MFFB 3BO8A 4PJCB 1L6ZA 4QF1A 1JWMA 4Y16D 1KG0B 5F89B 4XI5D 3CXHJ 4FQ1L 4KJYA 1FCGA 4QO1A 4NQDD 4KY1L 3L7FB 5FV1L 5KVMC 1CWVA 1I9EA 2GHWB 1G84A 1UB6A 1FVCA 5AUMB 1BAFL 4HIJA 1WWAX 5DT1L 1P7HL 2BXZA 1JYXA 5L2JB 1UB5B 4TTDD 3UAJD 2WANA 3MROA 3O4LB 1MCPL 2WBKA 1ORSB 3DMMB 4JRXA 4G8EA 4ODTL 5GSVB 5KG9B 2I5YL 5CEZL 3MLSL 4U1IB 3X11A 3BP7B 3STLB 3IDNB 4U3HA 4XTRD 3PV6B 5I19H 3LIZL 4WFFE 5HHOE 2F54B 1ZT1B 1NDGB 3A67L 3DGCR 1IGJB 1IAIM 1UG9A 5JIIA 4GRWH 3VFGH 3S96B 5DK3A 3DI3B 1MF2H 5AYUL 5EOCL 3I9GH 4GKNA 3DV6A 1QFHA 3UJIL 2W60A 1JWSB 1E4XL 1YNLL 3DOSA 4U1MA 5D9SB 1FNEA 5DUPH 3SCMB 3H0TB 1FP5A 1IVLA 3MV01 3MRQA 4BQ9A 4ONFH 4WI6A 2J8OA 1CVSC 5EZLA 1LE5B 1WLHA 3SDXB 5GQBA 3WXWH 3I3BA 3S5LG 8FABA 5ISZE 5JUEH 2VDPH 1A6AB 4J2XA 1MQKH 2XA8L 3K2UH 2HG5B 4EI5C 1G7JA 4L9LB 4BQCA 4U49A 5D4QA 5ICYB 4ZS6D 2AJXL 3ZKMD 4HIXH 3CDCA 3S37L 4GLRH 5FHAH 4HW6A 4PRPB 1GOGA 3O8XD 1D6EB 5I1LA 1IAIH 5J1TC 4X7TA 4HPOL 4XX1G 1F42A 3TH2T 3VMPA 2I60L 3WLBB 3GHEH 4JFHE 4DVRL 5L2KB 4WJ5A 5SWZE 1JWUA 4NUGH 1TETL 3H9HB 3U82B 4MNGE 5D5MB 5GSRA 3M8OL 4X6DB 3EDEA 4NN5B 2NY5L 1PYWA 3FQRB 1MVFA 4ZYKA 1K8DB 3GK8H 2Q3ZA 5HPMB 4XCNB 4N5ED 3PDOA 3ZLQC 3FMGL 4NQEA 1JYVA 2G60L 3WL9B 1QBAA 4S1DC 5T3ZE 3LRSA 4CNIB 1HEZA 4MD4B 1U8MA 3HB3D 3MRMA 4WCYH 2IG2H 4OFKA 3P9LB 4F33B 3U6RA 3CVHH 1VENA 3QUYA 4Y16B 5DK0A 3ULVH 4P9HL 4Z7WB 4FQJH 4CGTA 1YA5A 4X99A 3T09A 3HG1D 5F7EH 2H2PD 4KQ4L 4TSCH 3LQMA 5F8RC 2MCG1 3OKOA 1KB9K 1N8ZB 4YHLH 3UJTL 1ZVSB 1LILA 2ICEB 4G8FA 5CZXD 5EZJA 4WWKC 3QH3A 1HSBA 3LMJL 4JPIA 3RTQD 1YDPB 2ATPA 3ALXA 3CFJB 3IDJA 4DEPB 4BUHA 1ETZB 2XG4A 3QQ3B 2B39A 5F88B 3UBXA 2DQFB 1WUNT 5E94A 1TZGL 3CXDL 2IWGA 1M1SA 2X4UA 4M5ZL 4HG4K 1E28B 3SDCC 3DHMA 4LSVL 5T1MA 5IWLC 2NNAB 1QLEL 4GFTB 3BPOC 2FHCA 2VUYA 3GJEB 1A1MB 4WO4A 5B38A 5E7FA 1I7UB 2DQIH 1H3WM 4YX2L 1HWGB 1FRGL 3TO2A 3JTSB 2DQTH 3P73A 3T0BA 1OAZL 2ZSWB 4I18C 3BZ4B 5TH2A 1M71B 3CC5B 5IHZA 2AJSL 4MD5B 2BNQD 3O2DH 1HHIB 3LRHA 1CE1L 2EDTA 5IVOA 1S9KC 5IB3A 3VE0A 1RULH 1IQWL 1RUPH 3HNSL 4EUPB 3HNVH 2XWTB 4EVNA 1JPSL 1ZLVK 4C56E 5FO8A 4FP8L 5IESH 3WFZA 3BMWA 1OGAA 3MX0A 3OXRB 1XZ0A 4HCRH 1KEML 1Y0LB 3MMEB 2B4CH 3ZL4H 1HZHH 4NRXB 3UYRH 4UIMB 3DGGA 4H1LH 3T4AA 2DLFH 3PWUA 3OQ3B 2I9TA 4BQ8A 5C0CD 4I4WB 2EYRB 1F6LL 1YEHL 4WGVB 3H3PL 4NKMB 3ROLB 3K4ZA 3VFOA 3R1GL 4IRSA 3D2UD 4WFEE 5T1KA 1K5NB 1DQJA 3TT3L 2R2CA 1T1ZA 2NY4C 4NC0B 5FUOH 5I74C 5JW3L 2M2DA 3VI3E 1WZ1L 3MTRA 4YWGH 1YEEH 3MXWL 4AM0B 5JTWA 1QSZA 1JRHI 2NZIA 4PGDB 3QO1B 1TZHA 4LDLB 4MJID 5LAXB 2Y6SC 2ADGA 4JJHA 4H20H 3ARRA 5CBAB 4ODXB 4MCYB 2EIZA 3QUZC 1I1AC 2GT9A 3VRLE 2PN5A 3MRIB 1WCQA 3HG1B 1JF1A 4ZPTB 3ZTNL 35C8L 2VDML 1FH5L 5SWZA 4Z5RB 5KSUB 2VLLB 5IJKC 4I0PA 3IJHA 4XP5L 5CP7B 4HXBH 3HC0B 5KSBB 1LDPH 4OD2A 1D9KB 1FC2D 5E1AA 4R2GB 1T80A 3CFIC 4HS8H 5ICXA 1VGKB 2CR3A 4YHNB 1OWRM 1BD2B 1RZJL 1S7XA 4YXLL 5JO5A 1C1EH 2IPKB 4FQ2H 4O9HL 1YPZB 1AFVH 3VXTA 1G7LA 4IOSD 1FE8L 4NPYB 2COQA 1MCEA 3S34L 2ZSVA 3BKJL 5ERWB 1RVFH 3K8LA 4JJ5B 1UT9A 3L3DA 1IM9B 2X4OB 1TCRB 4HH9A 3PWPA 2C4XA 1B6DA 2JJVA 3DETD 3CFBB 4Y19A 2X05A 1QNZL 4IRJC 4J8RA 4YLQT 1SM3H 5MP6L 1PQZB 2O26U 2DMBA 5TGBA 2WUBL 1T1XA 4X80L 1YY9C 2DKUA 4K2UH 4O51B 4NQCD 3WO4C 3GSNL 1YYML 3BPNB 3JWDL 3INUL 4NZTH 1MHCA 4NWTL 3BFOA 2ZZUT 2R0LL 4PYGA 1N0XL 3THMH 3DRQA 4TNVF 1FNHA 4NM4L 3AVEA 1FORL 2PXYB 5D96C 2K7PA 3QIUC 2OK0H 3WEXB 1IE5A 4Z0XB 1G7MA 2GSGA 2HTKC 4BH7B 5CLTA 4TVSa 1G6VK 3N9GL 3RHWF 4OIAA 4I3RL 5KOVC 3MV7A 4Y4HD 2EXYC 5GGQH 3OF6D 3QWQB 1R5IA 3V0WL 4JY4A 4XCCL 2ICWA 5H8DA 2Y5TB 1UKQA 3OB0H 3OX8B 3WHE1 5J6GB 1UZ8B 2JIXA 4OB5L 5IMLB 1N5YL 1H15A 5E5MA 3VFPB 4Y4KB 4JZJC 3QIBC 4G9DA 2BVYA 3QNZA 4HWEL 2QL1A 3PWNB 3O6KL 1FBIH 1MCWM 2BCKA 4JHAL 4P23B 4X6CE 1MFBL 4PRNB 4ZNCD 4PRHD 4KZDH 4NT6A 2VLRA 4G80B 4DGYL 1CGSL 5EG6C 3TZVA 3DJ9A 3RGVD 2EXWC 1ONQB 2HJFB 1A6UH 1KG0A 1PFCA 2IQAA 2VR5A 5DMYA 5KBNC 3H7BB 2AK4E 2WWKO 5EUOE 1CD9B 1XGTB 4XP4L 3L7FA 1KUMA 3GI8L 5FDYA 4LLUA 5FCUH 3T0AA 3IAQA 5CJQL 5AUMA 3GBML 3C5ZB 3LS4L 4JCMA 3ARGD 4PTUB 4DN3H 1NEZG 3PIQA 1UB5A 4RRPA 3O4LA 4X9BA 3DMMA 1ORSA 5GSVA 2VIRB 3STZB 4LMQI 4KKCC 3JV6B 4U1IA 3STLA 3IDNA 2V17H 5D1XB 5E70A 3PV6A 2O61B 1DQQB 2X1PA 2F54A 1ZT1A 3G6JE 1DZBA 1IGJA 1IC7L 4PJ7B 2J88L 4I48A 4ETYA 3HI6H 4OKVB 1H3XA 1JWSA 4BELD 1PZUB 3DV4B 3WFHB 4KKAC 1G9NL 1RU9L 5HI3C 3PXHA 3H0TA 1NCBH 1BP3B 3EZJB 4XBEH 2OM5A 2ID5A 4LKXB 5T5FL 4IMKC 5E6ID 1YC8A 4N90E 1LE5A 2DJSA 1NMAH 5HDLA 3D25B 4B53A 1A6AA 1BJMA 4M93B 1QO3B 1GZQA 1TCMA 3HI5H 3DXAE 4L9LA 5DA4A 5ICYA 5TQ0H 3FJTA 2NY7L 1NCAL 4YHKH 5GJTH 3LSOB 1CFSA 1IEBA 4PRPA 2V5TA 2DQCH 1D6EA 1HH6B 5C6TH 4M9PA 4F57H 4Z7UE 4JFDE 4FTVB 2NYYD 2YRPA 4G5ZH 1BIHA 3WV0A 1B2WL 3WLBA 3MOAL 5KZCB 3D39D 4YHOL 4NO0B 1WCBB 5KSAD 1QA9B 4M3JA 1A6TB 2GEEA 2AS5M 3H9HA 3VXUE 3VD3A 4YC2B 4W68A 3RZCD 1Z2KA 2YPLD 1RJCA 2VDLL 4X6DA 4LU5H 4N0UE 5F9AC 2A6KB 4XNQB 1IKNC 3NABL 4QRQB 2NXZC 1K8DA 1PG7W 3GRWA 2VLKD 2ERJB 5HPMA 4XCNA 3TWCL 3WL9A 1P4BL 2YRZA 4KHTH 1SY6L 3BUYB 4N9GA 3I6GB 4PRHB 1IKFH 1IT9L 2APTA 4M7ZB 3ILQD 4MD4A 4A6YH 5HGGS 1J0KA 5CGYC 1NC2A 2GW5A 3P9LA 3BRGC 1GSMA 3IXAB 4B41A 5BQ7B 3DUSA 1MH5B 4Z7WA 4BM7A 2DL9A 4KU1A 3QEGH 1BFOA 1VGEL 4Y7MA 4GW4B 3NGBB 3TBTB 3MLUL 5DLML 4JREC 3T4YB 4PJ5B 4ZO9A 1A1NB 5E2TL 3ARGB 1N8ZA 4ZUSB 1GZPB 3QJFA 1ZVSA 2ICEA 4LASL 1GIGH 2IBZY 2R69H 4I18A 5ICZB 5CEZD 1DBMH 1RK0B 1S7RB 3CFJA 3HZKA 4PJXE 5DZLA 5F88A 1NCNA 2IFFL 3VWKB 3ILPB 4HUMB 4UDUA 4OCNC 1A22B 1GGIH 1P6FA 4HV8B 5F9JB 1QVOA 2NQCA 1E28A 2IF7A 5TE7L 2R0WL 2CRIA 1JMZA 2O5YL 3GMNA 2NNAA 4ZO6A 1MCIA 3T77B 3GJEA 1A1MA 3MACL 3OAYH 2CDFB 1I7UA 4JO4H 3W11C 1ZANH 1CDJA 1W0WB 4H26B 1MJUL 5K9KB 4MA1C 2ZSWA 3IVKB 1C5CL 3BZ4A 1M71A 4L8SB 3HMXL 3CC5A 5CJXA 3F62A 1FFPA 2BRRL 2AK4A 4MD5A 1HHIA 5GISL 4HAGA 1GCFA 4TSAH 3LB6C 4UT6L 4P5TC 4Y8AA 3T0XA 3RI5K 1SMOA 3QUMA 1VHPA 2ADFH 1BQUA 5FUZL 5I1HL 4ZAKC 4EUPA 5DQJA 2XWTA 4L3EB 2X1OA 3W82A 4V1DB 5F6HI 3QFJB 5M7QA 4F9PA 3JZ7A 5GRJH 4TUOA 4K7PH 4LKCB 4XX1E 4PR5B 3OXRA 3PGDB 3NIFE 5I71B 2QQLL 3WFBL 2E7LC 5HVFB 3MMEA 3R06B 5TE6H 1VDGA 2IPUG 3D39B 1UWEH 3QDJD 1KCUH 4RGND 2P5EB 3IS0X 2XPGB 5FB8B 3S8WA 2CMRL 1N59A 2CKBL 3V4PH 4BZYA 3GO1L 4XCEA 3O6LH 4I4WA 2EYRA 3UJJL 3ROLA 1M6OB 1LO4L 4RWYH 1CL7H 3QUKB 4XC1L 3VG0H 4ETQB 4RQQB 1GGTA 1K5NA 5EU4B 1RZ7H 5IJKA 3VD5A 2FRGP 4YNYB 3WJJC 3NCYP 2DS4A 4M1DH 4TSBH 1FFRA 4Y1AD 5DR5L 4AM0A 4JQIH 1MJ7H 3GSXA 5FA3B 1RZKL 3S36X 2AEQL 4O58H 1MCHA 1Y6NR 3TN0C 5LAXA 1AKJB 1RUKL 1T0MA 4I0CC 4YHMH 5EOCJ 5CBAA 3S35L 4ODXA 1AO7D 4MCYA 3A6CL 4JFDA 2X1XR 3QA3B 4S1RH 2X1WL 4BZ2H 4Q97A 3MRIA 4ZPTA 3WUZA 3PWVB 1G7IB 1R0AL 4ZUWB 3EYSH 3CFCL 4Y88A 1YEKH 3MFGB 2VLLA 1MFDH 3IDMB 4Y0GA 2A73B 3HC0A 5KSBA 2MQ3A 3OGCB 5ELIA 5H37G 1VPOH 1D9KA 3GSVB 1O5DT 2IBBA 3EO1B 5I1JL 4LLWA 1VGKA 3BKYL 4YHNA 5HVWA 1DEDA 1BD2A 2IPKA 3HMWH 1QUNA 5B3NA 3PWJB 1YPZA 5DT1H 1CGTA 5H2BB 3DYMA 4PUBH 5D1QD 1A7PL 3HE6B 4NPYA 1HCFX 1DN2A 1OGTB 4JJ5A 5LCVL 2X4OA 3RUGB 5CEZH 2DQHH 3MLSH 2JJUA 1NCCL 3S6CA 1D3CA 3CFBA 3QIUA 1B3JA 3LIZH 4GG6F 1MWAB 4YDLB 1PQZA 3W2DH 1XR8A 4PJGF 3UJIH 4NO5B 1XGUA 3ARVA 4XWOD 5E8DH 5EC1B 3HAEH 3MJ9A 3D18B 2QQKL 3ZKXC 4YZFE 2X4NB 1OD9A 1T7WA 3MRBB 3T08A 5C08E 5BV7L 1MWAH 3BI9X 2V7HB 3ARPA 2CUHA 5L7XH 4YE4H 1G6RB 3WDHA 4ZOEA 5I8EA 3TESA 2PXYA 2ARWA 2YR3A 5IQ7L 3WEXA 4Z0XA 3S3SA 4TOYL 2H1PH 2VL5B 3ARED 1CXIA 4BH7A 5HTSA 3WLWD 2X89A 3OKKB 5JDSB 1KEGL 4R0LB 1TQBC 3OHXB 4HULB 1S9XB 3KPOB 3FB8B 4HPOH 4PJ9B 4GKZA 1A5FH 4Z7OF 3NCEB 3FCTA 1I4FB 3LEYH 1LO5A 4DVRH 1OTTC 4QWWC 4PRIE 3OX8A 3D48R 1TETH 4YPGB 2VL4A 3S5LA 4XNYL 4QYOB 3T1FA 1GXEA 1UZ8A 1EAPB 4M61B 3WD5H 1CU4H 3M8OH 3B9KD 3QB7C 2NX5D 4Y4KA 3VFPA 3QAZB 2NY5H 3LHPL 1CQYA 1U8KB 3WYRA 1MIMH 4RA0C 3PWNA 1A3RL 4RIRA 4XVJH 1A3LL 4NM8H 2VN7A 4P23A 3FMGH 4PRNA 4Q9RH 1P5UA 3HA0A 5ETUB 3SE3A 1CYGA 5L8KB 3UBXI 4G80A 1AO7B 2A6DB 1U6AH 1XF3B 3ARQA 1WQVT 3DSNA 5CINL 2K1MA 1UYWL 5E00B 1ONQA 4U1HB 1X9QA 3PGFH 5J3HD 1X6NA 1R3LB 5IF0B 1DBBL 3H7BA 3VWJA 3CX2A 5LGHH 5C86A 3EO0B 1XGTA 3WFCL 1X5KA 4PJHE 5CFHA 4HBCH 4EXKA 1NDMB 5DEGB 1VB9A 1JNHB 1OAYL 3LEVH 5HI5D 4JFPA 3MLWL 4ENEC 3O3UN 5FF6B 4JZOB 3ZE2F 4IRZL 4KQ4H 5L8JB 3E8UH 3STZA 1FAIL 3JV6A 1JZ7A 1AR1D 1EFXB 5I0DA 3GMPA 5D1XA 5HHXL 5ADPL 1F5WA 2O61A 1DQQA 2UY6A 1EJ6A 3ME0A 3RVVC 4UT9L 4PJ7A 5KOMC 1OQXA 4OKVA 3BJ91 3TFKC 3MODH 3ZYIA 3DV4A 5GGVL 3WFHA 4NQUA 1HXYB 5DMGD 2AW2A 2B1AH 2CK2A 4M5ZH 5J9PB 4QY8B 2L0DA 4PYHA 3EHBC 3CZFB 2P5WB 5HYQB 3AY4C 3D25A 3IT8D 5JR1L 4LRIC 2VZSA 3KPSD 4YX2H 2N56A 4RMQA 1QO3A 2VLJE 1I9IL 2BVQB 3V6ZB 3KXFE 1NANI 3GSWB 1KLGB 2Q76A 4HJ0C 1CE1H 2W9LA 1IKNA 4NNYB 2CO6B 4HZLB 3RY6A 3LSOA 5EWIL 4FNLL 3AREB 1Z5LB 3W0WE 1HH6A 1OTSC 4YHZL 3RA7H 4NN7C 3HNSH 4K07A 2J6EA 4FTVA 5D8JH 3ZYZA 4Z0BL 2V6HA 3DSFL 4HMCA 2R56L 1H3VA 3HN3A 4FP8H 4KJPD 4S2SB 5L88L 1ZTXH 4NO0A 1WCBA 1KEMH 1QA9A 1A6TA 5JZ7C 3P11L 1KB5L 3VXRE 1KPUA 1TQCC 3QDME 3T2OA 5B8CB 4EN3C 4XP1H 3ZMRA 5HSFA 5IHLB 1MCFA 4C83B 1D7FA 4XBPB 1GYAA 2JJTA 4I3SH 1V3MA 1K4CB 4LCWE 1GGBH 2NX5B 1I85C 3H3PH 4AZ8A 25C8H 4XB7A 1DVFB 3R1GH 5DFVC 4DZ8B 3CNKA 4LVNB 3C60C 3BUYA 3I6GA 1NCTA 2WW8A 4WTZG 5E95B 1I8LC 2EDHA 5GRYA 4J4PC 1WBXB 5JW3H 2VAAB 5DJ8A 5E24E 3IXAA 4OLXH 2XYCA 5BQ7A 1FNFA 1WZ1H 5D70L 5FEBA 4G6JL 3MXWH 4G9FE 4DGIL 1T2QH 5EUKA 5A43C 4MB3A 1JL8A 3P0YH 1BFTA 4Z8FH 1C8PA 1HQRB 3QCTH 4UQ2B 5AG8A 1NQBA 5JXEC 2IANE 4GW4A 3V6OA 4MXVE 3TBTA 3MLXL 5IEKB 4HS3B 3EO9L 1RQ5A 1UKTA 3DVFA 1A1NA 4UUJB 35C8H 4ZUSA 1KC5L 3SGEH 4OZIF 1QSEB 4XP5H 4HDIB 3HHRB 1RK0A 4HWNA 4L4VE 3PL6D 2ZUSA 3ZYOA 4BYHA 2HLFC 1A14H 3VWKA 3ILPA 4PJIB 4HV8A 2AQ1A 2FX7H 4KMTH 4RFNC 4MCZB 2ITCB 3BKCL 1J7VR 5C1MB 2CQVA 3OAZH 1UACL 3LZFH 3AMKA 4HGWB 3S34H 3QNXB 2CDFA 3BKJH 1MCKA 3T65B 5J12B 2B0SH 1W0WA 3DX6B 3MZGB 4H26A 1MCOH 2X41A 3IVKA 1XIWB 3PP3K 4L8SA 15C8L 1OARL 1YMHB 3MRPB 4E41E 2ICWI 4H0IA 5MP6H 3R4DA 3TPKA 3QEQE 1DBKH 1PEWA 2DBJA 2MQ0A 1WTLA 1MRDL 4X80H 4RBPK 1NGWB 1QQDB 2BSTB 3KGRA 4CBPA 1YYMH 1KCRL 2OL3L 4L3EA 1WWBX 4V1DA 3QFJA 4ISVB 1KTLB 3D6GA 4M7KL 5JOEA 3DWTA 2C1PB 4LKCA 4PR5A 3PGDA 1J0JA 2PO6C 1S8DB 5IROA 2R4SL 1KJ2L 2R0LH 1N0XH 1BZ7A 3R06A 3QWRA 4NM4H 4UV4H 2ENYA 1NGQL 2BVEA 2P5EA 5HD8C 2XPGA 1ZHLB 2AEWA 1FL5B 1R3HB 3BH9B 4NN6B 4NJAH 5IFAL 4OCXL 1WZKA 2YZ1A 4KRMB 4UAOB 4YDVB 4AG4L 2EEAA 1U93B 2FEEI 3FO1A 1DFBH 3JVGC 1N6UA 1T22A 4QOKB 3LN4A 4OD1H 1M6OA 5EN2B 3WIHL 2RAMA 4N68A 4ETQA 4RQQA 1F90L 3RL1A 4QNPE 1B88A 5EU4A 2GJ6B 1U8QB 1IEHA 4R96B 4MB5A 5ACLA 43C9B 3EDFA 4WUUD 3U9UB 1PVHA 1UZ6F 2RBLA 1I7ZA 1A7NL 4RMRA 3AU1B 4J3UA 1ZS8A 1N5YH 3UXFA 4QRPB 1EO8L 5FA3A 5JPNB 2EDBA 4HS6A 3P40A 4JQVA 3VGAB 1IC5H 4KMLB 3SBWC 1AKJA 4NSKB 1IQDB 1M05B 3ZYJA 5A2IH 1H3PL 5KANG 3W0WA 43CAB 5EU6E 3N1QC 4PP2B 4XNMB 1V7NL 4JHAH 3QA3A 1YQ2A 4XXDB 3MV9D 3PWVA 5GZNC 1G7IA 4JFXB 1DBJL 4ZUWA 4U6VL 4DGYH 5HDBF 3MBED 4RZCB 1RUML 3NBNA 2NY1D 2R0ZH 1FVEB 3IDMA 3VXRA 2A73A 5D7SH 4GLRI 3OGCA 4QHKI 2NZ9C 5K9QI 2JK5B 5JQ6L 2QHRL 4XP4H 4Q6YA 4XT1C 5E6YA 3VMNA 3FN0H 5F44A 4MNQB 2R0KH 5CJQH 3X14B 5E1HB 1ULVA 3PWJA 1J88A 5H2BA 2XN9E 4U0RB 1KELH 1BLNB 3HE6A 1OGTA 2A83A 4WDIA 5EULV 3NA9L 4ELKB 4FFYH 1JGDB 3RUGA 4L8CB 2EDJA 3TO4C 2DQGH 1MCCA 1HHGB 4HLZH 5JHLH 5AZEH 2B20A 3BD5A 1N64L 4MS8C 3NACH 5J0BA 4M7LT 1DL7H 2R29L 4BKLB 1G9NH 4MZ2A 1BVKB 1FJ1B 2VN4A 3D18A 5EBMB 2I25N 3L5XL 2X4NA 4OAWA 4HJJH 1B4JH 5AEAA 2DTML 1C16B 1XCQB 4QHLA 2V7HA 1K6QH 1JYNA 3WKMH 3ULVC 4YO0B 1G6RA 3HS0A 4X5LA 2XI9A 1EHLL 1QRKA 2GITB 2R4RL 3OKDB 1FQ9C 4R4FH 5BRZD 3EAKA 3BZFB 5ESVB 2VL5A 3D85A 5JDSA 1RPQA 3OKKA 3RAJL 1JV5B 4Y16C 1QFPA 4R0LA 3OHXA 5ADOL 4XI5C 3KPOA 3HCVB 4PGEB 3FB8A 4PJ9A 3LEXB 3KPRB 4TQEL 3H7LA 4OLYL 1AGCB 4YHOH 4N8CL 3DURB 5L0QC 5E08L 3F58H 2XY1A 4WVRA 5F7MC 2CDGB 4YPGA 4QYOA 1JNLL 1PAMA 4M61A 4TTDC 3UAJC 2DB8A 4JO1H 2VDLH 4Z95H 1YEIH 4JFZL 1U8KA 4NNPH 2DI7A 1IL1B 1U2HA 1P4IL 2FB4L 5HI4D 4MQXD 4XTRC 3BEVB 4N0FB 1N6QL 3B5TA 4LCCB 4PG9B 4LVHB 5KJRL 3SE9H 1V7ML 2Y9RT 2A6DA 1XF3A 2IADB 1IT9H 5D7JB 3RL2A 3VMOA 2OLDA 5C0EB 1EUTA 2ZUYA 5HY9B 2ZNXA 1R3LA 2XWBB 3TCLB 5IF0A 3V4UH 4X4YA 2NY1B 1NBVL 4AMKL 5JHDB 1GVIA 2YK1H 1KCSH 3MA9H 1DDHB 2BSRB 3O6ML 2ZP0T 3I2CL 4PB9H 2Q8AL 2Z4QB 5TF1L 1EERB 1JNHA 2AQ3A 1Q72H 2C3WA 2B4CC 5FF6A 4ZS6C 3ZKMC 2EO1A 2APFA 2DI8A 3LY6A 4H5SB 3DNKA 4O4YL 5DLMH 4DFIA 3BQUA 5E2TH 4GRWE 4LRIA 3O8XC 3NAAH 1MFEL 4G6ML 5IFHH 1EFXA 1KTRL 1E0OB 2WQRA 2VTFA 1X5LA 3TM6A 3DRTA 4JRYD 5JW4M 3EDDA 4F7CB 4M7LH 1UVQB 5DUBB 5E8PB 5FXCH 5LGJB 1MHPL 2A77L 2F53B 2WBJB 4DQOL 2IFFH 3CLEL 1HXYA 3LKNA 3SJVE 4KGLA 2PW2B 4DAGL 3F5WB 5J9PA 4QY8A 1RIHH 1LO0L 1PY4A 1DANU 2J12B 4NUJB 3CZFA 2P5WA 3ARFD 3TC9A 5I8KL 3HUJE 3N0PB 4N5EC 4D94A 3LKSA 3V6ZA 3QIWB 3TVMD 5I1CL 1MJUH 1KLGA 3GSWA 1J18A 1J5OL 3U46A 1FL3B 4LNVA 5GISH 5EU3A 2ARJB 4HZLA 1LEIB 3AS1A 3HB3C 1Z5LA 3AROA 4LHUG 3QCVL 4RSVA 5FUZH 3KPMB 5HVHC 3KYAA 1ZLSL 2EDKA 1QLRB 5C0AE 4PPTA 4S2SA 5FGRA 3L7EA 4HIEA 4KXZH 2C9AA 4TPRH 5E99H 5DJCB 4X4ZA 3OKNB 3K3QA 2QQLH 5CUSL 5ALCL 5CSZB 2I9LB 1I7TB 2NY0B 2NXYB 5B8CA 1EA9C 5D7IF 1OF2B 2H2PC 3EFFB 4XBPA 3EOAB 5EORH 2MCPL 2CMRH 2UZIL 1K4CA 2BERA 1U3JA 2CKBH 1A2YA 5CZXC 3GO1H 1CICD 4YDIL 4UQ3B 4FQHB 1U95A 3UTTD 1S7VB 3RDTB 3RTQC 1DVFA 3AB0B 1A7QL 1AGFB 2FJFB 5B39G 3QCUL 4L8BB 2BNRE 3ULVE 1SYSB 1H8SA 4PJ8D 3OPZL 4Z6AT 2XZCL 3IFNL 1Q0YL 1WBXA 2ICCA 4FZEH 1N0LA 5IK3B 2A74A 1TNNA 2P46B 4WWID 5TQ2L 2YUVA 4DCQA 3GJFA 1RZKH 2XT1B 3L1OL 4B5EA 2DIJA 2AEQH 5C07D 1MRFH 1HQRA 2FR4B 3QQ9D 4UQ2A 3SO3C 4NQDE 2HWZL 1U8JB 1MY5A 5I6XC 1INDL 5IEKA 4HS3A 1R0AH 4UUJA 5K9JH 5DD0L 1TLKA 1ZA3B 2Z8RA 1OB1B 3QYCA 4X0KB 1A9BB 4HDIA 5JW4N 2ZUWA 2R9HD 1N7ML 1CE6B 1LE9B 4U2ZA 5BS0D 3NN8A 2KQMA 5HJ3A 4EDWH 4UNVA 3JXAA 4YHYC 4PJIA 3DX8A 4HQQL 3LVEA 3KYMB 1UM5L 1QFWI 4MCZA 2RFXA 2ITCA 4EKXA 1IGIL 5IOPB 1Y18B 5DRZB 3CK0L 2MMXA 4GBXB 5KVGL 1A7PH 3H9SD 5IUSA 1Z9LA 1KN2H 4HGWA 5E4EB 5EIQA 4XMLL 4Z7QE 1MFAH 4TULL 5L9DH 3S97C 2VDKL 1XIWA 1F4XL 5DVNA 1YMHA 4FA8A 4G7YH 1TVBB 3E3QC 1Z3GH 4APQD 2BMKB 4ZQKB 2H45A 2WAHA 1E27B 1NGWA 2BSTA 1ADQL 4G42B 2LVEA 4YDJB 2QQKH 1ZK9A 1IBGH 2HFGL 4Y8DC 1KTLA 3WN5B 3ZSTA 2C1PA 2FD6L 5GRVL 4OF3A 2FLRT 1YYLL 2F19H 1S8DA 4OZFB 1PG7L 4FN0A 1B0WA 2E9WA 5D7LB 1MNUH 5E5UB 1ZHLA 3O41A 4L1HA 2PYED 3HFMH 1FL5A 3F6IA 3LPGA 5DQDH 2VC2L 3SBWA 1W0YT 4JPVL 3NMEA 1KEGH 4HMDA 3CPLB 4OZFH 4QOKA 3UPCA 5TFSH 4EXPX 1CXLA 3OV6A 1FIGH 3B2UD 4OBSA 2Y36H 2UVEA 3VRJB 2IEPA 3VJ6B 1BMGA 2GJ6A 5JIKA 3ZE0E 1U8QA 3C6LA 4R96A 3N1FC 43C9A 5F6IB 5GGRB 3DVNB 4F2MB 5GGRY 2DM3A 3AU1A 3B3IB 3IFPA 5L6YL 3IU4L 5D7KD 4QRPA 1LVEA 5JPNA 1X5IA 3LHPH 4D8PB 3T0EB 3DETC 4NSKA 1IQDA 1A3RH 1M7IB 4M43H 5ILTL 2EEBA 4ESKA 1A3LH 2W38A 3MCLL 4PP2A 4XNMA 3IKCB 3IF1B 3GBNL 1M7XA 2XY2A 4XXDA 5C0AA 2H3NB 4OCSL 4XP6H 5GGTH 1AI1L 3RRQA 1FNAA 1IGTB 4LIQL 1UYWH 2WZPD 4P4RA 1FVEA 1CBVL 3EJZC 1JGLH 1BFSA 4BFBD 2VE6B 4NNXA 1X4ZA 2JK5A 3ZE1F 1HNGA 3MJ8B 2GFBB 3QUXB 5I8CB 2VZVA 1Q0XH 1K3ZA 1OAYH 4K9EH 4MNQA 3X14A 5F3HA 3ZHLA 1JUFA 3CVHA 2V2WA 1LO2L 1NGPL 4IRZH 1WZMA 3EKCA 4ELKA 1JPTL 4K71B 1L0XA 5DRXB 2F5AH 2J8UF 3H3KA 4Y4HC 4JM2B 1HHGA 5DJZA 1CZ8H 1U8HB 4ZFOB 5HHXH 2FGWL 5BZDB 1AP2B 5C8JB 2B2XL 4S1SL 4WI3A 2HKFL 3BP4A 2P45B 4I2XB 4YR6B 3RPKA 4BSWB 4BKLA 5GGVH 4GAJL 1XGYL 1WWCA 4EI6B 1FJ1A 2BNQE 5EBMA 4AT6B 4NQDA 2KDGA 3RWIB 1R3IL 5J1SC 3SDDB 2BNUB 1XCQA 1HKLL 4KKLD 2FATL 3DVGB 4YO0A 3D3VD 1CDBA 2GITA 3EYVB 5CIPB 4CADB 3OKDA 4XWGL 5D2LB 4X7SH 3UTZB 1T21B 1D5MB 1UH4A 4PGBA 1QZ1A 3BZFA 1AQKH 5ESVA 4RAHA 2JCCF 3FOLB 2VB5A 3RGVC 4OM0H 4GMSL 1JV5A 4XMKL 3GKWH 2ZG3A 1QFUL 2NY2B 4P2RB 1OP5H 1QLFA 3LEXA 5C0CE 3KPRA 3O3BB 4GH7B 5SWSD 2VABB 5L88H 5HHVH 4DKDC 1AGCA 3ARBD 1FO0L 3DURA 4YHIA 1OSZB 5HYJD 3MRHB 5LWYL 3I84A 4IEFB 4OCRH 1JN6B 3ARGC 3TT1L 4QCIA 1P9MA 3E3QE 2FWOB 4D9RD 2G5BB 2EYSB 5GJSL 1WIPA 2YMXL 4H88L 4UIKH 3B2VH 2AXFA 3QI9B 4Y4FD 1IL1A 1MI5B 2HFFA 2WWMD 1HSAA 3BEVA 4N0FA 4LCCA 4PG9A 4N0YH 1MRCL 1N4XH 3T0VA 3KLHD 1NAMA 1Y6KR 3KPNA 2EE9A 4MJIE 4P4KB 1HILA 4XPBL 1A6VL 5I30L 4NHUB 2IADA 3K2MC 3O8XA 5D7JA 5DC4B 4JRWA 5C0EA 3TIDB 4OJFL 5HY9A 5D71L 4U0QB 2H8PB 2UY7A 5E6IC 4Y5YB 3Q1SL 2XWBA 1T6VN 2FIKB 4XP9H 3TCLA 1YEGH 5D70H 5JHDA 3O3EA 5CMAB 4ZUUA 1HINL 5C2BL 1CR9H 2BSRA 1BVZA 1U8LB 3EYOB 1NUNB 3ZHKA 4P2QE 5DSCB 4Q6IB 2Z4QA 2ENSA 1G7PA 4KGJA 1FSKB 3NCBB 4ERSL 3HR5B 5FGCB 4PTTB 4H5SA 2RQ8A 4LFHD 2CGRL 3RVWD 2AXJA 3SKMB 5D93B 3ARSA 1EAJA 3C87A 3V6FB 4WTZA 4M8VA 5I71C 2NYYC 2Y1VA 2FH6A 2E3VA 4F7CA 5DUBA 2Z31D 2IQ9H 1HH9A 5LGJA 3Q6GH 5KSAC 2EIDA 3SGJA 2IAMD 4HKZB 5IG7B 4DVBB 3RZCC 1NSNH 1OHQA 2C7UB 2PW2A 3F5WA 3HE7B 1BBJB 1KLUB 2X7LB 5D6DC 1P84J 1UACH 4Q9BA 1WBYB 3MLYL 4KVCH 4NQCE 5GGUA 1CDCA 1RAMA 5DRWB 5DVOA 3ET9F 4GUPB 1FYTD 1KCVH 3QIWA 2D4DA 5BW7A 3CSPA 15C8H 4PRAB 1FL3A 4HSQA 2E8YA 3O11B 1NFDB 3ILQC 1LEIA 5SV3A 4JAMB 2ARJQ 4DZBB 3KPMA 3RTQA 4LPUA 2OI9C 2P24B 4FZ8L 2OL3H 4ZODA 1QLRA 3MOQA 4M7KH 1DJSA 5BMFL 3NFSL 5DJCA 5DMKB 2FJHB 5IV2B 3OKNA 1DUYA 1I8IB 2R4SH 5F7YC 5CSZA 2I9LA 3SDAD 1I7TA 3G08B 4QTIL 5KS9E 1WAAF 5HYJB 1OF2A 5FKAB 3EFFA 5F1NA 2GI7A 3V0AC 5I17B 2XQBH 3EOAA 1QSFD 3GIZL 4OKDA 1BHGA 4WUKL 5IFAH 1Q1JL 4YBQD 4OLUL 1XGQB 4UQ3A 5FK9B 5HGAB 3RI5F 4UU9B 2OP4L 4NDMB 2MFNA 4JO3H 4KRLB 1S7VA 1ZLVH 3RDTA 4LHJB 4Z7VE 1QPPA 2BNQA 3S36L 1CXEA 6FABH 1AGFA 2FJFA 5CZVH 5F96H 4JG0L 4X4XB 3LRGA 4L8BA 4Q9CA 3JWOL 3LKPA 4OFYA 4E0RB 1SYSA 2LVCA 1AE6L 3RWCB 1TTUA 1QHOA 4ZSOE 5IQ9B 2AJVL 3QULB 1T03L 1A7NH 1YNKL 1FN4A 1AXSA 3RWFB 1E4WL 1OLZA 1P7QB 1YMMB 2QADB 1EO8H 2X4PB 4B0MM 3SDYH 4JFQA 5A16B 4PD4K 1ZEAL 1U92B 1KIRB 1F6FB 3MXVH 5F9WC 3D5OF 3GHBL 3LDBB 1GRWA 4GS7B 4LSQL 3PABB 5IB2B 1U8JA 3DIFA 2AJYL 1EFQA 1RUAL 1DBJH 2V2XB 4U6VH 4V2BA 4WHDA 1EVTC 1C7SA 2GSIA 3FFCD 2VMFA 4YUEH 3NCCB 3GMQA 3V7AG 5M94B 1ZA3A 3DECA 1OB1A 3FQWB 1RUMH 4K3GA 1G7HA 2B1HL 1VADB 3FHQA 4X0KA 4ONHB 1FVDB 1A9BA 5F3BB 3D2UA 4O2EB 3B8SA 2W1NA 2EH8H 2EE6A 2Q20A 2X42A 4P9ML 3ARDD 1CE6A 1LK3H 1TPXB 4AEHL 1JRHH 2I27N 3JUZA 1FGNL 1OLLA 2DQEH 4RGNC 3KPQB 3KYMA 4HLZG 5JDJA 2AJUH 5IOPA 1Y18A 5DRZA 3O9WB 4BQBA 4GBXA 1OL0A 3ZKQD 4XZUB 1ROWA 2NY5C 4IJ3C 3O4OC 5IW6B 1RJLB 4QRRD 1A9EA 3OWEA 1S5IL 3UZVB 3VI4F 1U3HD 3DVIA 1D5BB 4MAUL 2OJEA 1G1CA 5DJ2A 2BMKA 5T3XD 1EEQA 4CW1A 1E27A 3VXMD 4CMMB 4P2QA 3QG6B 2R29H 1LMKA 1PGRB 3T8XB 4G42A 2MOVA 5FDWB 4YDJA 1X7QB 1V05A 4PLJD 1ZLWK 5CKGA 4YH6A 3WN5A 1H3TA 4M6ML 2ZCLH 1D5ZA 3FRPG 5KN5B 5JPMB 1IGCH 3VXSE 5D7LA 5D1ZB 1EHLH 3IDIB 4LPTA 3RJDA 3TYGL 4L4TB 2CPCA 4XH2B 3SDAB 3KR3H 2OQJB 2LTQC 4YFEA 1BQLH 4LPWA 4HD9A 3E6HB 2BC4B 3RAJH 2WLZA 2NCMA 1N5AB 5FOBB 3MREB 3CPLA 2YPLE 4FQCL 3BKMH 2QEJA 4G7VH 5E5RB 4LVOC 2H26B 4BSVB 2AAVA 3VJ6A 2VLKE 4G6AD 4HGKC 4TQEH 3BGFB 4OLYH 4QHUA 4NQCA 4N8CH 5GS1C 5E08H 4W81A 5GGRA 3DVNA 4F2MA 2B5IB 4MJ2A 2EEDA 1JNLH 5DRNB 3MO1B 5ECJE 3FO2B 5D1QC 4JVWA 1I9RH 3B3IA 4FMFA 4G8GB 2AABL 3MNZA 4ZXBB 3T0EA 3F7YB 1X44A 2CLVB 2IJ0C 3HPJA 3IKCA 2FX9L 5EIIB 3IF1A 4R97B 2C3HA 1N3NB 3EGSB 1V7MH 2H3NA 3KLAB 4H8WL 1S7QA 2CRZA 3FOMB 2DOCA 4S0SD 5I19L 2Q6WB 4XWOC 5DI8B 3DUUB 4X8JB 4WHCA 3MV8D 3FFCB 3SO5A 4QXWA 3VFGL 5FFLA 1MF2L 2OTWB 5KS9A 3I9GL 2VE6A 1NBVH 5CSBA 5FECB 5DUPL 4X7CC 5H35B 3QUXA 2X4RB 1ZA6B 4BK4A 3ARDB 4ONFL 5KVEH 2Q8AH 3MGAA 5CEZE 5TF1H 2ZUUA 4CDHA 4X98B 5C0FB 1DUZB 4Z7VA 2VDPL 1RHHB 3BIBX 3AREC 4NKIL 3OJMB 4O4YH 3WLWC 1MQKL 4KDTC 1JPFB 5DHYA 3TA3D 5BO1H 3K2UL 2ADIB 1FFOA 2UYLA 4G6MH 4JFEB 1Q9LB 3K4DA 5FYLL 3WJLA 3OJVC 5DRXA 5B22A 2R39A 4JM2A 4ZFOA 1U8HA 3VXPB 4KROD 5BZDA 2BY1A 5FHAL 5C6WH 1DP0A 2Z35B 4K23H 3UDWA 3QQNA 3VRIB 2OJZH 3IDXH 3C5SB 3RGVA 1MHPH 3IGAB 1U3HB 1IAIL 2A77H 4YR6A 4BZ1H 4BSWA 2DQDH 2JCCB 4EI6A 4HJGB 5FOJA 4DAGH 3LCYA 3VXMB 3B9KC 3RWIA 2GK2A 4NUGL 3SDDA 2BNUA 3U0TA 4LF3A 4NBZB 5I1EH 2WIIB 1C7TA 3DVGA 3H42L 4LVNC 1RMFL 4CADA 4JQXC 5D2LA 5T3XH 3UTZA 5I1CH 1T21A 1D5MA 3GK8L 5DDHA 4WW2C 1PKQB 3FOLA 1CD8A 2AXGB 2UZYB 1SBSL 3QDJE 3U1SH 1UA6H 4RGNE 5J3HC 4M62H 4OI7A 3PQYB 2M1KA 4L8DB 2QSVA 1CD0A 2IPUK 3UTSD 2FHBA 4V2CB 4WW1A 3O3BA 3ZT7A 5HYSB 3GJFK 1AGDB 4JG1L 4WCYL 2XZAL 2IG2L 3S9DB 3QZWG 1NBZA 4HK0A 5EDXA 3G6AB 5CD3A 1OSZA 3MRHA 3H9YA 5ALCH 5HI5C 1IEAB 1JN6A 5IVXB 4FQJL 2A0LD 3CH8A 2FWOA 2BOCB 2G5BA 1MLCB 3GSNB 2EYSA 3NH7L 1JPGB 4N5UA 4NC1C 3NCFB 3V4VH 2MCPH 5DTFB 3QI9A 4W6YB 2UZIH 5F7EL 1AR1C 1B0GB 5I1KH 4YDIH 3RY4A 1Q9WB 1JGVH 2X4TB 1NMCB 2XTJD 2FJGB 4Y1AE 4O5LL 5F1IB 3MYZA 4YHLL 4LHUA 4P4KA 4NHUA 5HYIA 2HA1A 1ODAA 1OD7A 4PREB 5DMGC 3VXSA 3UYOD 2I24N 1Q0YH 4POZD 2HLAA 2OYPA 2FIKA 1JNNL 1Z6JT 3IXTB 2DMCA 5CMAA 5KSAA 2VAJA 2R2HB 2ZWLT 4DFHA 3FB7B 3L1OH 2DKSA 3EYOA 4D9QD 4JRXD 5DSCA 4NC2B 3FT4B 4LAQH 4Q6IA 2DYPB 4IIQC 4HFUH 3HR5A 2IBGA 2DQIL 3V0VA 4PTTA 1IC4L 5C09B 4S10A 4WU7B 5DHVB 2R8SL 4NQVB 2J8HA 5DD0H 3SKMA 4MXQD 3O2DL 4JFFB 5I75C 1SBBA 3I50L 1VKXB 1EJOH 2VQUA 1OWWA 4R4BB 4Y5XB 4KJPC 3RVXD 3WNOA 1RULL 5LQBH 5D2NB 2X9XA 2VXQL 1RUPL 4XVSL 3HNVL 4HKZA 1CTOA 5IG7A 4DVBA 3L5JA 5IESL 1X4YA 2W0PA 4X8XA 3MBXL 2ZG2A 1IGFH 2C7UA 3L95B 4HQQH 3LPWA 1BPVA 4GRLB 1MEXH 4NIKB 4XAKD 5EO9B 4YPJA 5J89A 3CK0H 2B4CL 2X7LA 5KVGH 3TBWA 1HZHL 4JLRB 3UYRL 3MCKB 2HVJB 2DLFL 3O6FB 4E9LA 4KKNA 2V7NA 3O0RL 5DGQA 2VH5L 1ITCA 3I6KB 4GUPA 3EIFA 2VDKH 2AGJL 1AHWC 2UWEE 4ZFFA 1V8HA 3PHQA 5IMKB 4PRAA 4F7PB 3MUJA 4MHHG 5CCKL 3O11A 1NFDA 3BIKA 4LLDB 3REVA 4JAMA 4KHXH 3W5MA 4XGZB 5KVDH 2ZOKB 1JZ8A 1ADQH 2P24A 1EZVX 4OUUB 3VGAC 4D9LL 5FUOL 2FD6H 4XPFL 2OSLB 2CO7B 2XFXB 5DMKA 2FJHA 5HHQB 5IV2A 1I8IA 2O5XH 2D7TH 1NBQA 4YWGL 3G08A 1MFCL 3WFDH 5FKAA 3LD8B 5CILL 5I17A 4NQED 2NY6D 5DD5L 3FT3B 2WP3O 1Z0NA 3PV7A 4FQPA 4H20L 1T2XA 4AIXA 1XGQA 1FFNB 1UXSB 5FK9A 5HGAA 3FRUB 4UU9A 4NDMA 4R8WL 5F71A 5GRUH 1OVZA 3GSUB 2QTEA 2BJMH 4KUZH 2ZUQC 3PL6C 4UV7L 4P3DB 4X4XA 3QUYD 4QF1B 4HXBL 4KH2A 1IGMH 1LDPL 1W8NA 1ZHKB 3RWCA 3S35X 5IQ9A 5TDOB 1FV1B 5MEPA 4EDXA 1G9NC 1P7QA 3BISA 2ZUTA 2X4PA 5HHMD 5DZNA 3AAZA 1C1EL 5A16A 2HVKB 3QDJA 1XF5B 1AFVL 1X6LA 4ALAL 1U92A 1KIRA 2MHAB 5IB2A 1RVFL 2XXCB 3GBNH 3MRLB 3ZKND 3EDJA 3CZJA 4U1LB 4OCSH 1F11B 1QD0A 2ILLA 2WV3A 4CU7A 1UJ3C 5JW5B 4LIQH 1VADA 2NPLX 4ONHA 3K8MA 1FVDA 1CIDA 5F3BA 4NC1E 3GSQB 2W60B 1PKQE 1YECH 2Q86B 5ACZA 1JZ3A 4U1KA 5C0BB 3K74B 4P59H 4WO4D 5SWQB 2YD5A 5EZLB 2H6PA 4F8QA 3O9WA 1NGPH 2CXGA 3DUHA 5SX5K 2XIDA 2OK0L 4QHMB 5GS0D 4XZUA 4K3JH 1JPTH 2X5PA 2G2RA 2MTPA 2X4QA 3QDGD 3B43A 2J1KA 1MCSA 4PD4J 3KPSE 2B2XH 4S1SH 4F3FB 2CJUH 2WLYA 1OGAD 4X7TB 2BFVH 1YN7A 4CMMA 3QG6A 2NY3D 3T8XA 3E6FB 1I1YB 3QXDB 5FDWA 4G6FB 2XA3A 3F7VA 1ZSDB 5IR1B 1X5AA 5KN5A 1U0QA 2R23A 5GSRB 5D1ZA 1KNOB 3GMOA 3IDIA 3L5IA 1S9YB 2KQNA 1PYWB 4XH2A 4U7SA 1BGXL 2OQJA 2GK0B 2NTSP 1Q8MA 4IHOB 3BP5B 1FBIL 3SGKC 4Q9QH 3MBEC 2DAVA 3C09C 4KZDL 4IRSD 3E6HA 2NY1C 1N5AA 5FOBA 3QHTC 5F7HA 4XMKH 1NLBH 2XICA 4GQ9H 2H26A 3WS6A 1GJIA 3ZTJH 3MRDB 2D0GA 4X6DF 3V5DB 3MRMB 4XPAH 4L3CB 2ZCHH 4KUCF 3U6RB 2JB5H 3VD7A 3G5XB 1K4DA 3CLFL 4HUUB 5DRNA 3TT1H 3MO1A 2H32H 1LP9E 2UWEA 1OTUD 4WI7A 5GJSH 1IGYB 4X99B 2ZOLB 5FCUL 1RZGB 1YEDA 3WSQH 4ZXBA 2VSCA 4DOHB 4DN3L 3F7YA 3C8KB 1GHFL 3F6LA 5SWZD 1UGNA 1SEBB 4Z9KB 5EIIA 4I0PD 1J10A 1N3NA 3EGSA 2NMSA 1BM3L 2AJ3B 3KLAA 2V17L 3V5HA 4Z7WF 3Q6FA 2JTDA 2Q6WA 1NCDH 3KHQA 1H3GA 3CCHB 4QT5A 5DI8A 3V7AE 2IPTL 5E9DB 1TMCB 3OKLB 5M95B 1VFBA 4PJDB 1JZ6A 3Q1SH 2OTWA 4Y2OA 4MAYB 3U2SB 1BREA 5DGRA 5FECA 5H35A 1NCBL 4XBEL 4NZUH 2X4RA 3P4MB 3SE4C 5IT2L 5T1MB 3IRPX 4GG6E 1QRNE 3FQXB 4P46B 4X98A 1DUZA 3PWPD 4LOUD 4ERSH 5C0FA 4Y19D 5B38B 1RHHA 4GMTH 3OZ9H 1F2XK 1JPFA 4PJGE 2AEPH 1I8MB 2ADIA 2APBA 4NWUH 1EIBA 3D9AL 4TUJB 3VG9B 3C08H 3CMOH 4LRNH 5TH2B 4JFEA 1Q9LA 5TQ0L 1TTFA 1UC6A 1VESA 4YHKL 1GOHA 5IB3B 3CGTA 5GJTL 3SKJH 2DQCL 3RX8A 2X9WA 4WW2A 4F57L 5C6TL 3VRIA 4FABH 3C5SA 2Z8VC 4YGVA 4G5ZL 3LQAL 3EOTL 1NGYB 5KSVA 3QT2A 2LE9A 3LPFA 2IGFL 5GS0H 1CLZH 4UTBH 4JVPA 1MY7A 4KJWD 4MQXC 5HI4C 3T4AB 2QQNH 3VH8B 1RZKC 5EU5B 4LU5L 5A2FA 5HHOB 3CD4A 4TNWF 1E4KA 4U6XA 4K8RD 3MV7D 3ARYA 2PF6A 1SHMA 1PKQA 2AXGA 3WUWB 2NLJB 2YS4A 5DURD 2E9IA 1D6VH 2VJXA 4FQXA 5DFTA 5T1KB 1DQJB 1IKFL 4L8DA 4FZ8H 1OCWH 3FTGA 5ISZB 4PG2C 5HYSA 1AGDA 4Y2DB 3S3JA 1SJXA 3G6AA 3CH1B 4RMSA 1IEAA 5IVXA 1NANH 4PY8J 1QKZH 2BOCA 3GSNA 1JYWA 3QEGL 3UCRA 5BV7B 5DTFA 4L5FH 2EIEA 2VLRD 32C2B 1Q1JH 1B0GA 4WUKH 2D3VA 4OLUH 4WUUE 2OR8A 3U36B 4ZTPL 5FCSH 1Q9WA 3TZVD 2AQ2A 2X4TA 4PLOB 2FJGA 5F1IA 3U7WL 5F7LB 5SWZB 4ODHH 4JG0H 1GIGL 5DK2B 4I0PB 2R69L 3IJHB 3L9RB 1EHAA 3BPLB 2VDQL 3C9NB 4MNGB 1AE6H 1T04A 4M6AA 3I75B 4OD2B 1DBML 3Q0HA 4F15C 4F37K 5I18L 1FZJB 4R7DA 3F12A 4RGOH 4PJEE 5E4EC 3MV9E 2AJVH 2J5LB 3ZE2E 4M48H 1PKOA 4X6BB 2FYYB 3IXTA 2GQHA 4UOJA 1YNKH 3MUY1 3PNWB 1GGIL 3T2NH 5E2WH 3DTXA 3ARFC 1E4WH 2R2HA 3FB7A 3O4LD 3DMMD 1TJGH 2DICA 3FT4A 1X5HA 2DYPA 3U30B 5FGBA 3TVMC 5IB5A 4BFEA 4F7EA 5KSBF 4QHNB 2JJSC 3L3DB 1ZANL 4L4JA 1N2RA 2F54D 4WU7A 3V52L 3QSKB 5DHVA 1NMBH 1T1YB 2CXKA 4LFHG 4JFFA 2B1HH 4TSAL 2JJWA 4R4BA 4Y5XA 3SCMD 2JELH 1FHGA 1LP9A 1YPZF 3D69B 5D2NA 5FYLD 1ERNA 3HPLB 3T0WA 2VSDA 1BZ9B 1S9WB 4AEHH 4W4OC 1L6XA 5GRJL 3MRCB 4K7PL 5DC0A 1QBBA 3L95A 4GRLA 4OF0A 4AENA 5EO9A 3CX5J 4LSTL 4U33A 1PW3A 3ZT6A 1PX4A 5TE6L 3DRQB 4MDIA 3RP1A 4JLRA 3GMLB 1CICC 3MCKA 3HI1A 1KCUL 5GS2D 4M4RA 2Y07H 3O6FA 1ND0B 5GS3A 1KPVB 2VZOA 3BOVA 5EFIB 3I6KA 4PRPD 4F7MB 1JTTA 4NO2B 2GSGB 3V4PL 3VW3H 5IMKA 4F7PA 3RWEB 1QP1A 4PJ8C 1T89A 4LLDA 1CL7L 3N85H