3H2QA

Human sod1 h80r variant, p21 crystal form
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
153
structure length
136
Chain Sequence
b'ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPRRVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEENAGSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Structures of Pathogenic SOD1 Mutants H80R and D124V: Disrupted Zinc-binding and Compromised Post-translational Modification by the Copper Chaperone CCS
rcsb
total genus 32
structure length 136
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3h2qA00
4U4IA 1JCVA 1B4LA 1F18A 1SXBA 4N3UA 1SXSA 1PU0A 1YSOA 2WYTA 2WZ5A 2VR7A 2C9UA 2E47A 1FUNA 4BCZA 2V0AA 1N19A 2SODB 1SDAB 2LU5A 1OZUA 4B3EA 1OEZW 2Z7ZA 2AQRA 1CBJA 1IBFA 1PTZA 1E9QB 1Z9PA 2WWNA 3ECUA 4OH2A 2APSA 4A7GA 2GBUA 4A7GF 4BD4A 1DSWA 2ZKXA 2WYZA 5KBKA 2Z7UA 1P1VA 3KH4A 1B4TA 3KBFA 1U3NA 1OZTG 3CE1A 1XTMA 2GBVA 1PZSA 1XSOA 1SDYA 1XTLA 3MNDA 3RE0A 2VR8A 1CB4A 2C9SA 3GTTA 3KM1A 1E9OA 3GTVA 3K91A 3HW7A 1SRDA 1BA9A 1F1AA 1SOSA 2AQNA 2JCWA 2Q2LA 3H2PA 3LTVA 1SPDA 3L9EA 5KBLA 1MFMA 1EJ8A 2WZ0A 4N3TA 1COBA 1BZOA 1SXNA 2E46A 2ZOWA 5CU9A 4A7QA 1E9PB 4A7SA 1E9OB 1UXLA 1L3NA 3F7KA 1IBBA 1YAIA 3HFFA 2WKOF 2XJLA 3L9YA 3KH3A 1SXAA 4L05A 2WWOA 1IBHA 3QQDB 1AZVA 3SODB 2AQTA 4BCYA 4A7VA 2ZKWA 1UXMA 2K4WA 1EQWA 3ECWA 4A7TA 3GZOA 3GZPA 3CQPA 3T5WA 1OALA 3HOGA 3PU7A 1SXCA 1RK7A 4MCMA 1JK9A 3MKGA 1DO5A 3CQQA 1E9QA 2AEOA 3F7LA 1HL5A 4FF9A 1Z9NA 1IB5A 3GZQA 2XJKA 2WKOA 1F1GA 1TO4A 2NNXA 3KBEA 1E9PA 4MCNA 1N18A 2VR6A 2ZKYA 1S4IA 3S0PA 2Z7YA 1TO5A 1HL4A 3ECVA 3GQFA 2C9VA 1IBDA 1YAZA 3H2QA 3QQDA 2AQSA 4OJAA 2GBTA 1QUPA 5KBMA 1F1DA 2Z7WA 4A7UA 1OAJA 1ESOA 1JK9B 2AQQA 2R27A 2WZ6A 2AF2A 1SXZA 2JLPA 3KM2A 1Q0EA 2AQPA 1KMGA
chains in the Genus database with same CATH superfamily
3WTSA 1KTDB 1E5CA 4YQXL 1T7YA 3V4UL 2XRAL 3MJ9A 1BQSA 2EZ0C 3T6WA 5EO0B 1JZ4A 4GG8B 2VDQB 3K2KA 1JXFA 3NCYP 2WAHA 2ZXBA 4AQ1C 4OH2A 1IAOB 4PLOB 3S37X 1H6EA 4MA7H 5IKCB 3VW3H 3R8BB 4JFOA 2HPTA 1HT6A 4LT7A 3G08A 1WDAA 4R0LA 4HJIA 2DMKA 4GI9A 4JFEA 1HYSD 3APCA 2LU7A 2HJFA 2BVTA 3KCWA 1O5PA 1YQVH 3LZQA 3U46A 2A38A 2BHYA 1KGWA 1SLUA 1PG7X 4NKIL 4H88L 1FORH 3QORC 3UO8B 4ETYA 1ZEAL 3FCUB 4XNMB 4WK4B 5FHAL 2WYHA 5JR1L 1NLDL 1DLHB 5K39A 4PJIA 1N6QL 1L7TH 4KK9D 1Z5HA 4YC2C 4QRBA 3MRNB 4TSAH 4ZMQA 1DQVA 3MNZB 4DEUA 5AYTA 5IP4A 2NY2B 1G7IA 3QO1A 3VFMB 1EJ8A 2W80C 2YPLD 2QFRA 3FU9A 3UZVB 1KXTB 4JDZA 4JS7A 4AE1A 5F7FA 4ECNA 4QXVA 1F4HA 3CVDA 4QXGL 3SBQA 3FL7A 1FRGH 4ZAKD 1DL7H 4WFGD 4PWJA 1L6XA 3L4UA 1XZ0A 4CSTA 4X4ME 3CZJA 4FQLH 1NJ9B 2D0GA 4I77L 4PW3A 3T4AB 3NZUA 2A74B 3H9SE 1ZXQA 1SJMA 2OSLB 4WTQA 1KTLB 1YNKH 1OCWL 3FU7A 4HKBA 4WNQA 4BINA 1E28B 1RK7A 2BP8B 5KVEL 2IAMB 3B2DC 1URIA 5GS1A 2VR3A 3O3AB 4WENB 4FF9A 1TVBA 1M7IB 1NTDA 4G6FD 2D73A 5TFSL 3TA4D 1IM3B 2X2JA 1DVYA 3X1EA 3OX8A 1Q9WA 3BWUF 3LEYH 5J6HB 2CLVB 3IFLL 5IJKC 4Y1SA 5MI0C 4PJ5A 5TFSH 5MHSE 4JPVH 3WNMA 1QBML 2V9QA 2EEDA 1FYHB 2YO3A 1QSFD 4KMLB 4PLKD 4G43A 1JRHL 5T1DL 1T03L 2V37A 3GSUB 2CH8A 1YEIH 3ABMB 1CL7I 3ARFA 3KXFA 4G6AC 4JFYA 3BKML 1JWUA 1YNKL 3QWRD 4QKTA 1MCKA 5AEAA 3QG6A 2VERA 1F86A 5F3HA 4TV3A 4MNQE 1F18A 4R4ND 3GD1C 4S0SD 1QFPA 1YC7A 2JQZA 2WZ5A 2NNAA 4PJGA 3HE6B 4RETB 4GW5A 3AG3B 1M9WA 1D5RA 1CMOA 2P5WB 1JSYA 1L9NA 3L08A 4F8TA 1SDAB 1V3JA 2AERT 1YNTF 2BIQA 3BUTA 1JXJA 5HDWA 3R0NA 2I85A 2YKLL 5J6SA 5C9KA 1KIUA 5JHDA 3MTXA 4E42B 5B7MA 1WBZA 2G9HA 4XOEA 1JF1B 5IR1A 4KRPD 4LU5L 5KVFL 2X1XR 3S5LB 3P30H 2OLDA 1MH5B 1XIWB 1IMHC 3MRJA 4YHOL 1CG9A 1Q94B 2A6DB 1AE6H 1MREH 1MCPL 1T1ZB 1S9KC 1YEWA 4PJ8A 2DPKA 1I8UA 4IQHA 4WWPA 4AOFA 5EZJA 3L3HB 2YC1B 1ET7A 1QBMH 4X9YA 3VXQA 3FO2A 4WHTA 3BZFA 4E68A 1PFOA 4FRWA 2K70A 3OVUB 4NZUL 3H9HB 2QVFB 3L3GB 3QNYB 4YSEA 4G1EA 2FWOA 5EIVA 1NPJA 3SHSA 4P2QA 3UPAA 3U7AA 1LMKA 4XT1C 1I3VA 3C5JB 2X4TA 1BM7A 3PV6A 2WKOF 3ULUD 1N26A 1PY9A 1G1OA 2K45A 2VITB 5F7KC 2XX0A 3MRHB 4I77H 4N20A 5H94B 4PGCA 3FO0L 4IBQA 5BMFH 2OMZB 4DVRL 1WFIA 3DO3A 1FN4B 4ZPVB 1LMIA 3FTGB 1MRDH 3GSXA 5GGQH 1MLCB 3WY1A 1ZLEA 4XVJL 4F1SA 3HOGA 1AACA 4MCMA 5KAQG 1NEUA 4JQIL 4NT6B 1IKNA 1P4LB 2V6HA 2VR5A 2YRZA 3L5JA 3WN5A 3T0EA 2CKBL 1IGIL 1EEZA 1ZT1B 3CN0A 3QDGB 2XWJA 4D9QD 3D06A 3OZLA 1OTUC 3IMVA 4KI5F 2BXYA 5EEYA 3IPBA 2BJML 3TV3L 4FQCL 2X6UA 1E7VA 3HMWL 4NC1E 4OCSH 3S5LG 3SDAD 1TUPA 3OKNA 4TUKL 1NKOA 4Q4IA 3VXNA 3FOMA 3SYQA 3MBEB 4RRPA 1U8CB 4KMQA 1OLLA 3IWUA 1IE5A 5I1KL 3GMRB 3TYFA 4NC1C 2E8ZA 2XKUA 4AT6B 1GKEA 1TT6A 4D0BA 4Y2OB 2MPVA 1F58H 1XGYL 4K8RL 1S7RB 3DSNA 1MVUA 2Q8AH 2OK0L 1Q0EA 2AQPA 2XBTA 3MV01 3VFRA 1Z7JA 4HIJB 4EKJA 2P49B 3GTNA 5F7EL 1P5VA 2CQVA 1XD1A 1KZQA 4ZUVA 3ZR5A 1Q8MA 3QPKA 2WM0A 4UM9A 2K78A 2X1PA 2MFNA 5J3HC 2LABA 3UP6A 3FB7A 3UO1H 4Z9KB 4L4VA 1AO7E 1VA9A 1FQ9C 4XZUB 4AYFB 3IXAB 3QFJB 3IDGB 4WEEA 5IW6A 2VSDA 1FPTH 3QUXB 3GYRA 3QISA 3B2MA 3E6FA 4I5BB 3EYUL 1XH2A 4GPVA 2O5ZH 3PWVA 3DDFA 2AFNA 1NBYB 1TNNA 5I73B 2UV3A 3AXIA 5IK3A 2ZG2A 2DL2A 5JPMA 2BW5A 2QQLH 4QRRA 4QNPE 1ZT7B 4XODA 2IWKA 2VAAA 4UQEA 3FYEB 1Q4NX 3IDYC 2VMDA 1IC7L 5ERWB 3MBEC 3N50A 1UUNA 1XGRA 2R39A 3FHEA 3L45A 3KPOA 2Z64C 3H9SB 1E8XA 1PD0A 3NIDF 1YEHL 1D7FA 3BAJA 4PRBB 3Q2LA 3PDDA 1MREL 2J72A 5A16B 1UH2A 2CPUA 2Z4QA 4NOBA 4Y5XB 5EOTA 5CINH 5ID0B 4PB0L 4IBTA 2NNAB 1T2QL 1U8QB 1Q72L 2NNRA 2HT3C 3HRPA 2MQ3A 2N4IA 2OMUA 1UGKA 5FKPB 3FF8A 2BWQA 4KKRA 1FBIL 3QEQB 4Z8FH 3LAFA 2OULB 4WTXA 5J1AA 3KLAA 3LYRA 4XMLH 3ZKSD 2F5AH 2NX5D 2QHRL 5AVSB 1BBDL 5I1DA 4CL7A 2G2NA 4LSTH 3BKJL 5ACZA 3EGDB 5LN8A 4PJ5B 4DT2A 3CDGA 2MSPA 2HA1A 1Q1JH 2CALA 1JRHH 2HB0A 1E4XH 1IB5A 4POUB 5DD1L 3MYZA 4F7EB 2H26B 4LLVA 3D34A 5KVGL 3EOBA 1CLOH 2J88H 4NQDB 2AKRA 3UDWA 3R18A 2I5YL 2HVJA 1QKZH 2Q76A 4WU7B 1XH0A 2IBZX 2OMYB 4WY7L 5T33H 2P9RA 2WQVA 4OD1H 1OSPH 2VUKA 3FTUA 1KPRA 4KUZH 3X13A 4BFFA 1USQA 5I1GL 4X83A 2VXQH 2AXJA 5I1AB 2JLPA 3R7QA 1TKWA 1QHQA 5JIIA 2IWFA 1J1XL 2Y6SD 2ZQKA 4E42A 2X2HA 3KL0A 4ZFGL 5C3LD 4GRLB 1QO3B 2VLKD 3BFQG 5DGRA 4XPGL 4P23D 3P0VL 5LG6A 1V27A 5ANME 1XL6A 5AVVB 4R4FH 3AU1B 3CFEA 4M6AA 3TZVA 1YN7A 4A39A 1ZGLM 4J3SA 2ZOLB 3ZOAA 3O3BB 3ETBF 3SE8H 3MNZA 4JDVB 1VCBC 4L3EA 4IBZA 5GJTL 5AW7B 3GJEA 3JWDH 3APMA 4K07A 1E8ZA 4LCYA 4S11A 5C0FB 1PZSA 1B2WH 3QUXC 4AEIL 2CA4A 2CSPA 2X88A 2Z0BA 4ODUB 5L4MA 2MMXA 5IMMB 5A7EA 3L81A 5JXAL 5I82A 5FGRA 3ASOB 3MRQA 4XP4L 3T1FB 2PXYB 4XXCA 4AX3A 5ITBL 2PPDA 7FABH 5D7IE 4BHUA 1MFVA 2ZCKH 1A7RL 4LLQB 3RVUC 3ZTJH 1TCMA 3EGXB 1UKQA 3GNMH 3BPCA 5HP5A 3O3AA 3TESA 4N25A 1E3FA 2VNCA 4FLHA 4KXZI 4Y1AA 3DX7B 2ZOKA 5DJZA 4CN6A 5IREA 2HJLA 3MUJA 1FZJA 3ARGB 3FU6A 4HULB 5JXAH 2ADYA 1OAXL 1SYSB 4M8UA 4PAZA 1J8SA 2CK0L 2QKIB 1TCRA 1V7MH 3EDKA 1F4XL 2WQUA 1KNOB 2E74C 2IH1B 2RQ8A 4XPBH 2Q87A 4HJGA 1LO0L 4KO9A 4F91B 1UM6L 1PEZA 2N1TE 1AKJB 1EEQA 2V17L 1GHFH 1N8ZB 4NHCL 5T1LA 4PREA 1G7JB 4H1LH 3GK8L 4BCYA 1E30A 3F85A 1HIML 2P4AB 5IHLB 4IJ3B 4JREB 4QWWC 3OLIA 2CKNA 1BV8A 1OALA 3D85A 4FZEH 3AT8A 3FO0H 3P73A 3EO9H 1N0LA 3CNKA 3FQRB 3UERA 2R29L 4JPSA 3MRIA 2A99A 2KC0A 2GY7B 3WTUA 2NY5H 4CUCA 2WKOA 3L54A 1T4KA 5C09E 4NAJA 2VR6A 1CDCA 1W16A 4Z0BH 5ETUA 3GXNA 3S0PA 3OF6D 5IFAL 3NSCA 3EDFA 3QJHB 4DCQB 3ORJA 5MI0B 5DQJA 1DVZA 4HIHB 2W07A 3IFOA 3M8OH 4P5KB 4U1GC 3CFNA 4LCIL 3SO3C 4GYBA 4ADJA 2W88A 2DTML 1UD2A 2LQRA 2NY6D 5EZLA 1JK9B 1KYFA 2GBAA 4HPOL 5IVXA 2WZ6A 4B53A 4LHUA 4D94A 3WN5B 2GEEA 2H6OA 3JWNH 3DROA 5CNHA 1FG2B 3D25B 5GRWA 2XZCH 3MRJB 1GGYA 3K1DA 1CYWA 1A6WH 5C07E 2ZJSH 5EUOA 1S9YA 1FL3B 2V4LA 4LSUL 3ZMRA 5J0BA 2FD6H 3LIZA 3HHMA 3LXAA 4HZAA 3TT1H 4HUVB 2DWDB 2EDRA 4PJAB 4YE0A 5IB5A 1MWAL 1P4BH 2GTWB 4I1RA 3U2SA 2G9HB 5DFWH 4F20A 3BE1H 3NH7L 5CGMA 2DB8A 1J87A 3FDWA 5ALBH 4AWJC 1DQIA 1CD9B 3NFSL 4F7TA 2Z65C 2WINA 5DFVD 3FQUA 3VFOB 1J9CT 5C8JB 1H3UA 1F3DJ 4KQ4L 1YDPA 4W9DC 2LTQB 1BZ7A 2XPGA 5E23A 4E0RA 1R5IB 4UAOB 4J3OC 2O5NA 4UNVA 7CGTA 1MY7A 3NCXA 1NCBH 3W9DB 1BZDA 3FB7B 3HE6D 3FCSA 4HC1H 5FGSA 1AR1B 1ZGLA 2GFBB 3JQOB 3VDBA 5EC1A 4O2EB 4X99B 1HHJB 3HZVB 1N6UA 3ZL4L 2JI3A 4GG6B 4XVTH 5HHMB 3VXTB 3KL3A 4BJLA 1MWAA 4DQAA 5ITFA 5BV7B 2EO9A 3TASA 3DUHA 3B37A 4PJ5E 1C8PA 1AD0A 4G5AA 1NM4A 4PJDB 1IGCL 2WGXA 5JPMB 1EHLH 5D7IA 4XZ4A 1O0VA 1WAAF 4Z0XB 2F7QA 1CZ8L 1OT1A 1T0MA 3AG1B 3NDZE 3L9YA 1KIUB 1XR8A 5FGCB 3ESOA 3JT0A 4PJEA 3ZSSA 3ZIMA 4NZTH 2WQSA 1AP2A 1WITA 2WB7A 1MRCL 3QBTB 4JRFA 1IBHA 2P5EB 3QUZA 2NSQA 1E7UA 3VXUA 4N0FA 4M00A 3U9UA 3VQMA 2WBJB 3N9GL 4GB9A 1DZBA 2AV7B 3VJ6B 2VDLB 4U0RC 3IDNB 1S7TB 3GSQA 1AG6A 4WI6A 2Q7YB 3RWCB 1H9VA 5GXBB 4LF3B 4APXA 2RR3A 2OX5B 4UM9B 2PXYC 4RAVA 4ZUUA 5LBVA 1XIWD 5DJYA 1LEIA 3L3KB 4KROB 1NC2B 2WN3A 4OVUA 1HESA 1OSZA 4RA3A 3G6JF 4LVEA 4AL8C 5C71A 4E2OA 4FKKA 3DO7B 1N59A 4HUMB 2L4OA 4HLZG 3PHQB 4NZRH 3VXOA 1CLCA 5AWNH 3CBRA 4KKZA 4YX2L 4JDEA 1C5CH 1U3ZA 3GLDA 5TDOB 2C3VA 5DJ2B 5JPMC 2COQA 4OJAA 1DEDA 1FDLL 4OKVB 1OAJA 2G2RB 4NRYB 3C5SB 3AROA 3IBOA 4PJDF 1CIDA 2K7QA 3GLEA 2GK0B 4ZSOA 4N2BA 5KSAC 2OXHB 4YWGL 4R4BA 1PU0A 2Y6TE 1QZNA 2GUOA 4AENB 2VRKA 5FYKL 3BZFB 4ACTA 1PLGH 5AUMB 5EN3A 2CUIA 5J13B 1MZZA 3C12A 4D8PA 5CLTA 4JL2A 1MF2H 2YLKA 3TBWB 2B15A 1ORSA 1OSPL 5T5FL 3TH3T 1I1AB 2BCKB 2ZYRA 3DGGB 1IKOP 3RGVB 5T33L 3WTXA 1M7XA 4X98A 1UYWH 5LGHH 1KCSH 2ADIA 4XMZA 1B88A 1C5DA 1WLHA 1PY0A 2MNUA 5IB1A 1RZKH 2VR8A 5AYQA 1HXYB 1EK3A 5CFHA 4RBPH 2YD5A 3GTVA 4U2ZA 1V55B 2PCPA 3DTXB 5ACMA 5C2BL 2CO6A 3F58H 3EBHA 4LPWA 3TZVB 4HJ0D 1GMIA 4PJIF 4EN3C 5C9JA 3LMJH 4H0LC 5F8QC 5KVDE 5L4IA 2X4SB 4FQ2H 3HFML 4ZAKB 4AV4A 4O2FA 3T0EC 2I9TB 4YPGB 4OCNC 5FX3A 3L3DA 4UM8A 3NFSH 4URKA 2O5YH 2VLLA 2YGQA 2YOAA 4J27A 3KGUA 3TA3D 3EZJB 4XMVA 3BE1L 3BPOC 2Y1YA 3VG9B 4EAEA 2YGPA 4QRAA 1OVZA 4L0ZA 4Z77B 2UVEA 3FFCE 5EBWA 2K6YA 3OAZK 1NGZB 2JKLA 4L8DB 2ZOTA 5LQBH 2FEJA 4DGIL 4OD3L 4Z7QE 2I27N 3GBEA 4HK0B 2HWZH 5INDA 3DSFL 4BSJA 1G1KA 2Q76B 5C6WH 3JV5A 2AXFA 2VOTA 3FUKA 1M56B 4M6NH 5A3IC 3WMSA 5J9PB 4CC0A 4XXWC 2XXMB 3ULSB 4YGAB 3HAEG 3VD4A 1CI3M 2BOBB 3VGAC 5DD3H 4DCQA 3IVKA 2YPKB 3N42B 1FVEA 1F3RB 5EG6C 5E4IA 1MW3A 3POHA 2Z92A 1UD8A 4A2MA 1UQSB 2B14A 3QNFA 3C08H 1U8NB 2VDPH 5D2NA 5T1DH 1NKGA 3PP3H 1H0DA 5JIMA 2FJHA 1XQ4A 2A9NH 4KY2A 3DKHA 1TU2A 5EIIA 1BFVL 3LZNA 4IMLA 2YN5A 5KZCB 3OJVC 4LMQI 3MV7A 3W39A 4F7CA 1ESOA 5AVRB 3MLTB 3C2AL 4BRVA 1R34A 1RZGB 2AF2A 2RGSA 3BLKA 2W0FA 4FZEL 4LQFL 3SGJA 1R3JB 1O5DT 4FFYL 2IPTH 4E5XB 4JM2B 4QHUB 1PAMA 1EH9A 2P1YA 4P2RB 3G5ZA 2OMVB 4HQQH 1PQZA 4X4XB 4XWGH 3BXNB 2FIKB 3AADB 1CDUA 1AY1L 5CP7A 1S7QB 1W0VA 3RUGF 3VI3E 1M2OA 4YHKH 1JWMA 4L8BA 1YNTA 3RDTB 1PDKA 2H2SC 1NCWH 3C6LB 4IDJL 4PRBA 1F6AB 2WWNA 2QKIA 4LIQH 4JHAL 4NKMB 2LFEA 4DPAX 3DI3B 4G71B 5D93C 3FUIA 1CBVL 2JJVA 3WKNA 3NJKA 4KPHH 4NJ9L 4RFEA 2Z31D 4M4PA 5AYUL 4YBLC 4XO4A 1K2DA 1TZGH 4G5ZH 3RB5A 1BQLL 3GNML 4U05A 3BKCH 3HMWH 4WU5B 2ZICA 3MV7E 3OR6A 4DPBX 4M1GH 4HIEA 1UM4L 4JM4H 4M62L 4JDEB 5GRVL 4AMXA 4PJ9D 1SRDA 1W6WA 1GGBL 4DNLA 3VXSE 5E5MB 2LAGB 3ALXA 3MKKA 2MJWA 4QYAA 4DGWC 1G9MC 2WZ0A 1TMCB 4PWHA 2ITDB 1DUYA 1RK1A 2ZCHH 4PJIB 4LGPB 2HXAA 3L16A 1AOHA 3D85B 4OZHA 4MXQC 3IBEA 1KGIA 1I9RL 3ENEA 4IOSA 2YUXA 3KXFE 5KW9H 4LDCA 4B50A 4H20H 1SBBA 2JI1A 4JFTA 5T3ZL 4OZIB 1CTOA 1ZD6A 2I24N 2FR4A 4IBUA 2P8LA 3ALPA 2YEZB 4F57L 3BFOA 5HJGA 2ZUQC 1LEIB 4Z23A 3QHZL 4DZBA 1FZMB 3ZIYA 4KRMB 3QULB 4NN7C 2Q9OA 4QRSB 4PRDA 5B4MC 5AG8A 2LR4A 1INDH 1H3PH 1NZRA 4X7EC 3X13B 2FO4A 3CCHA 3ME0A 4R97C 3WYRA 1G9NL 4DKAA 1IGYA 3RTQB 2FX8H 4NAMA 1HHKB 4ZS6D 3SQRA 2DMBA 3ULVH 1T20B 4LDOB 4LBAA 2NR6D 1URZA 4KMTH 4XVTL 1K4DB 1HEHC 1QYGL 2VDMB 3EYSL 4DN4L 2R7EB 4N2DA 1FIEA 4MCNA 3WMQA 3SOBL 3V0FA 3UZEC 2WVUA 1IEBB 4N85A 4M7ZB 5LO7A 3BH8A 3C5SA 1EFXB 4A2GA 5MHSD 1P9MC 2HFFB 2W65A 4U3SB 4BUHA 2ZOLA 4PCYA 4GXUM 1KBBA 3SO5A 2WSPA 3JWDC 1TZIB 4JY5L 4YHIA 4PLNC 1Y6NR 4P3CL 2FRGP 3S36X 5HI5D 1U8HB 4J8RB 2RIKA 4F7TB 2QHRH 1JGLL 2LLNA 5BZZA 1AZZC 1YMHB 2QMJA 3BHBA 3G6JB 2PTTA 3QFJD 4YO0B 1BZ7B 4BQCA 2MCG1 3LDBC 3V6OE 3D2UA 5E5LA 1DN0B 1QLEH 2DWDA 4EIGB 1L7IH 1HCFX 3AUVA 3RJOA 5IQ7H 3U6XS 5B39B 2X2UA 3H6AA 2L7EA 1V10A 5C0BA 1OY3B 2WTRB 1S5IH 3TBVB 1CD0A 5EOCJ 1WGVA 1KFAL 3CZFB 2X4QA 4L8CA 3EJYD 2I25N 1XR8B 3WFDL 1DQQA 3E6HB 3RJDA 4PS3A 5IJBC 2W5PA 3UL4A 3U79A 4AZ8B 4EDWH 4F9LC 4NZJA 4YE4H 3IDJA 4LCVA 1XF2B 2AXGB 3RU8L 5I76B 4YDLC 5I6XB 3HAEA 4GT7A 3D30A 3VGBA 4FCAA 1KYOJ 4YPGA 2F68X 3B2VH 4JO3H 4LHUB 4M5YL 5GRJL 1OB1B 5B3SB 3ATDA 4PSPA 4G7RB 4Z5RA 4BH7B 1MAMH 4MQXD 1T21B 3UH8A 4JKPL 4JANA 4NKOA 3FT2B 2GJ6B 3EO0A 1KB5H 1NDMA 1GS8A 4N2NA 5J57B 3HFFA 3E38A 1KY7A 2EEAA 2Z8WC 3WS6C 1E4WL 4CNIB 2DIAA 5IROD 4L4JA 2MCAA 4XO8A 4G7YL 3TIDA 1DQKA 5L6YL 3WL9B 3WJJC 4KKQA 2B59B 2QZ5A 1A7NL 2WQWA 3DOHA 3DIFB 1XMWA 2VW7A 5DZNA 1BEXA 3B43A 3KYKL 1N12A 3SBWC 4IRJB 2QTEA 4L9DA 2YA1A 3QZWB 4PLKC 2IWGA 3II3A 4ADGA 4XPAH 5DHVB 3PV7A 1LWHA 2JJUA 3TA3A 3TWYA 4E5XG 4YHPB 4LCWD 4PBXA 1NMBH 2J6WA 4EI5D 3T0EB 5FOBB 4FQXB 3W81A 1YLBB 2EDJA 3NCFB 2RA1A 4OR1A 4FQCH 4J28A 2FEEL 2YMXL 4HSAC 4N8PA 4OCSL 5D7JA 4EI5C 5HVWA 4OKVA 5IGXH 4D3CH 3RJQB 1SBSH 5HDQH 4NN5B 5KTEL 3BGAA 2NNCA 5CD5C 3F6JA 4JZJC 1IFGA 3ZTCC 3S3DB 3BSGA 2GTZA 5DJ0B 1IGML 43CAB 3NCBB 3J8F7 2P5WE 2DF3A 3QFDB 4B96A 4RNRB 3D05A 5C0GA 2Y72A 3PWPD 4XP5L 4W9FC 5SWSD 4JFVA 3PV6B 2NUTB 1MVUB 2WLLB 3RKDD 3UFIA 4WO4C 3ROLB 3VWKC 4IRSC 3SOTA 3U4AA 2DQIL 4FMFA 4ZZFA 3K2UL 5BZDA 1ND0B 1AIFA 1YJDH 4JZNA 4KHXL 2WXNA 5HTSA 1ES0B 2O5XH 2JB6A 4P2OD 1BMWA 3BCDA 3EH5B 3I2CH 3K2MC 3P40A 4JLRA 2Z7UA 3EJCA 3DECA 3HG2A 1YYLL 2UXGA 1FLRH 3NIFE 3UG5A 3A6BH 3OHMB 5CS7A 4TN9A 1MJJB 4P5TA 4AG4L 3UPCA 2R51A 5HYIA 1V8HA 1RZ7L 4OZIE 4P4KA 4NZUH 1KYOK 4WI9A 5K33A 1MHCA 4QRTA 5I16B 5C08D 4XGZB 1I9RH 3KPSB 5KW9L 5JW3H 3ZX1A 1F8TH 4AYID 3P4NB 2QSCL 3OKNB 4WFFD 1YNTB 3RDTA 3WNLA 1YEFL 5KVGH 4OI7A 4PLJC 4TUOA 2ZX6A 1ZT4B 1A0QL 3C6LC 5ADPL 1LK3H 1E4XL 1OPOA 4QRUB 4WTWA 3T8MA 3RWGB 1TZHA 3KWXA 4YHOH 5DUBB 2LTQC 5HI5C 1QSED 3GLZA 3OC5A 2Z31C 4L1LA 2IXQB 5KJ7E 3CXHJ 2EABA 4MQ7B 2D0HA 2IAMD 4GG8A 2NOYA 3OB8A 1OM3L 1OGAE 1C08A 4HJJL 3LD8C 1ZTMA 4UZSA 3UBXB 3JV4A 5IG7A 5FYLH 3UAFA 1HJCA 3QDHA 4IMLB 4B0MM 6PAZA 3BPNC 5BVJB 4MJHA 2K1MA 4ENED 1TMQA 1B0IA 3GFUA 5MEND 3UJJL 3RL2B 1I75A 1YYML 1N6VA 1NCGA 3QG6B 3K5RA 4K55A 3UBFA 3D3VE 1KB5B 3NIGE 1WWAX 3UMTA 3CFCH 5IBLD 2WHVA 2ZP8A 3HE7C 2JNZA 2R69A 4EE2A 3H4FA 1MIMH 2FWOB 5M94B 1ZV9A 3NCYS 1HOEA 4TRPL 1JPSH 2AEPL 1TZIA 3NJVA 5DHEA 5DEZA 1Q9LA 4LZKA 5CXPA 1DVFD 1FYTA 2XN0A 3GZQA 1I1CA 4K3JL 4U3SA 4XBMA 5IB2A 4JPVL 5I76A 2J8UB 5JQ6H 1XF3A 3C6LA 1FZOA 3NIDE 3SPHA 1DSFH 3GEWB 3RVXD 5IJVA 1IAKB 4FKHA 3UTSE 3WDJA 3MRKA 4PFEA 4KWUA 4I2XE 5CP7B 5C0JA 2EAEA 1KUMA 5CJQL 4PWIA 2YUVA 5AKRA 5IQMA 3Q2VA 2GBTA 1FNHA 2PYEB 2ZUUA 1UASA 1Q94A 2Z7WA 4O4YH 5LBGA 3WXWH 4KJWD 2YAOA 35C8H 3C6SA 4P99A 4MVBC 4XOAA 1NJ9A 4JFHE 1NDGB 4GNKB 2BVQA 5D96C 3EOBB 4Z7WF 1INQB 1XX9C 5IEKA 3F6LA 3DX9B 3PPSA 3D33A 3GSNL 1JMXA 3GKZA 1OD9A 3LHPL 2ATPA 3QFJE 4MZIA 4OF8A 5DD3L 4C59B 2J5WA 1OOAA 3GSRA 3T09A 1ZK9A 5L2KE 5KANI 1OKEA 4CSZA 1X5ZA 3VNYA 3S3BB 1IC0A 4HCGA 4I5BA 2V8LA 4DEPB 2XV2A 1QUNA 4HP5A 2C1PA 2E3VA 2YPKA 1UXWB 1JNLH 3LPPA 5EV7A 4H8WL 3VDAA 2BVYA 1XH3A 1DUYB 1RK1B 3MV8D 1A65A 2ZXQA 2DM7A 3NEXA 3O6LH 1XXDC 4NUQA 3TN0A 5IBTH 3WO4B 1IJ9A 4WW2B 5E8EB 4A6YL 3HJEA 3REWB 1F02I 5D7JC 3KPOB 3SE9L 3R06B 2GIXA 2VJ8A 2WP3T 1S78D 1HH6A 1TEFA 3H54A 3VD2A 1FH5L 2XSKA 1L9MA 4U7MA 1DQJA 2IV9A 2J2ZB 3QWNA 1HOCB 3D2UD 4Y16D 4QRSA 5FM5M 4GO6B 1CPUA 4LOVA 4RZKA 1G0DA 4YUEH 5JW4R 2CLZB 2D7MA 5J89A 2OI9C 3CCHB 3ME0B 2PXYA 3ZT5A 3UGUA 2G3XA 2QPDB 1WD9A 5FO8B 4PCTA 3FOMB 3IJHA 4LO9A 3ELQA 5AB9A 5H8DA 3ZDXF 3CSYB 2Z91A 5BW7A 5F1SA 3N0PB 1DJWA 2BNUB 2FBOJ 2FNBA 5F1KC 4N2FA 4PJEF 4AYSA 1OAUH 4X7DC 2KYIA 4OGYL 4Y9EA 2DYPB 4E9YA 4HKXA 4KDTA 4LVOC 5TDNB 2J56A 2P24A 3CN3A 3IXTB 5AAMA 5DVKA 5JDSB 2DWEB 3RY5A 2IBZY 1GGUA 5DDHA 3VXME 2FJGB 4JDVA 4B9KC 3NPSB 1PJWA 2BVUA 4OGXL 5EULV 3VRJB 4U1JB 3WMPA 3X3FH 1KJ3H 4PJ7F 1A1NB 3DX4A 4J6RH 2QJDA 3MV7D 3BJLA 4N6RA 1W0WA 1WF5A 3CC5B 1DVUA 1B90A 1TKWB 5D6CB 1MFDL 1NGWB 4JPKL 4K4KA 4HWEL 2VMCA 4AEEA 5FCUH 1ZCRA 3MUZ1 2PO6C 1H3GA 2QSTA 3D39A 4M6OH 4BV1A 5EFIB 5E1AA 4FAAB 1S46A 4WI0B 2J3SA 1VRSA 1HAWA 3WIHH 1GGIL 1KB3A 3NIFB 2F18A 4IMKC 1X5HA 3V4PL 3OQ3B 1UJ3C 5DFVC 4E41D 1XVSA 4TVUA 3T2PA 1I7TB 4AUUA 1HFUA 4HWNA 4MMXB 4NP4L 4TULH 2DV6A 3L6FB 3F7VB 5E7FA 4G42B 5CSBA 5D4QA 4X6CB 3PNRB 1IEHA 5E5UB 2VN7A 4M7LT 5CJOH 3FMGH 3KDMB 1QNZH 4M4RA 2VZSA 1NANH 3SQOH 5JYLA 3NOIA 5C1MB 4G80B 3L17A 4ZO6A 3MRBB 1ADWA 4HPYL 2HMID 3KLAB 1JMZA 4WK0B 3DHMA 4UCFA 5F70A 4LNRA 4GIOA 5I5RA 3BSZL 2G5RA 2CBQA 1FCGA 3BC9A 4TNGA 2F7RA 3HCVA 1IE4A 2M8XA 4HAGA 2DLFL 3PL6B 3S37H 4O02B 3UZEA 1RIUL 2HVBA 4M1DH 2VRAA 1O6SA 1J0JA 4N68A 3KLLA 4FFVC 2WANA 3B9DA 4LLUB 5EU6D 5I66B 5KUKA 1WYJA 1HE7A 4AM0A 2MCMA 2DMGA 2N7BA 1RL1A 3MUGA 5GGVH 1DVSA 2GC4C 3I50H 2VW6A 1A3LL 2ED9A 1KYAA 2A4ZA 3QUYA 4YVUA 4NP9A 2MOVA 3ARDD 1VADA 1ZHBB 2OMXB 1HKLL 1UZ8A 3HI1A 4WUKH 4WWKD 4NM8H 1LDPH 4PB9L 5EU3B 4ZTOH 5BW7C 1I8MB 1DEEA 4M9OA 4ZFOB 2CHWA 1BAFH 2Y2TA 3AABA 2OR9L 1FO0B 4WW2C 3HB3B 2VXSH 3F12B 1X5LA 5C09B 3UBHA 3C9NA 1FNSH 2VLMD 1DZ0A 4MRBA 3TV8A 5EBMB 4JFQB 4KKBC 2VIRB 4GP8B 5DGQA 4HXBH 4OQTL 4AXWA 4LAQL 2A4CA 4X6DA 3VCLB 4G2AA 5FM8A 3QGVA 4KNUA 4JFFB 2X3BA 3EOAA 1FLTX 2NNXA 5LXVA 3ELAT 4A67A 2VC2L 3GO1H 1BOGA 1BD2B 3VX0A 3U83A 1NLDH 2BSTA 5BV7L 5DU7A 4ENZA 1KGYE 4JPQA 4F8QA 5D5MB 1YAZA 1OSZB 3GMLA 5FW8A 5LN4A 1ZA6B 5JUEL 2EEFA 4Z7OB 2AABL 4U1HA 4QXTB 4RH4A 4ZXBB 1E4JA 1MQ8A 5DJYB 3D9AH 3V9CA 1SYVA 3SGKC 1WA1X 4G7VL 5GGUB 5I8KH 1QMUA 4PY8I 3S3SA 2Z1KA 3HBGA 4YBQC 3T8XA 4Z76A 4G9FA 2EIKB 3BOVA 3FRPG 2QKIC 5LUMA 5IBUB 5DEGA 1FZJB 4DKEH 4Z7OF 1N3NB 1W15A 5K9JL 4NQED 5EOQH 2ZUWA 1R5WB 3WHE0 1SYSA 5IQ7L 3DV4B 3G04A 2PWEA 4PG2C 4JO8A 4RGNE 4J3OD 2JB6B 5DA0B 1QNZL 2EIBA 2HG5B 2XPYA 4HIXH 5I8CA 3ZW3A 2TSBA 1IT9L 4RGNC 4HLJA 5HDBE 3TN0B 3I6GB 4Q6IA 4NS0A 5GZND 3B2PA 3ZK0A 1AC6A 1H3XA 4KVNH 5SWQA 4A2FA 5A2CA 4XPBL 4R26L 1P6WA 5HGAB 4ZK8A 3CJJA 1NGXA 4WAFA 4LSSL 3L3KA 1IIIA 1RUMH 3C60B 2VCOA 1P7QA 3FRPA 4BFGA 1OO2A 3CH8A 5E2WH 3ISWA 4KVNL 1AFVH 4BWTA 1TYEB 2IGFH 4AQEA 3L4XA 5DMYA 1ETZB 5BOPA 2YPLA 3QQ9D 3PAZA 1R47A 4KKBD 4URTB 1AIZA 1DVXA 3AU1A 1I1AC 4FG4A 3RGVC 5KJRL 4UOW1 5LNEA 3VFGL 3ARGA 3D12B 5CGYD 5DD0L 1W72A 2YIHA 5AW5B 4LSRH 3P02A 2W0PA 3WD5H 5D9SB 4G7QB 2CJSA 3O3DB 5DK3A 4UILL 5EC2A 4OGXH 4UUJB 3TJHD 1QWUA 5EN2A 3GBMH 3APDA 3HC3L 3GXTA 4AYEC 4POZD 2ZSWB 1HHIA 1NICA 3QEUA 4LBEB 3V0GA 3QQ4B 1BECA 5EBWB 2K3TA 2QADD 5I1HL 3DURB 5AVXB 6FABH 5J56B 2ZXEB 3HC4L 1RLWA 3NRQA 2E9WA 3WE6B 4JM0A 4HZ1A 2R2BA 5TDPA 4XBEL 4Q52A 2ZYIA 4P5TD 3VG0H 4QLWA 1H15B 4GT0A 3A47A 3EH3B 1DJXA 2J8UA 3RGHA 1FP5A 5HVFB 1RUAH 4XPTH 4L37B 2WINB 3OKDB 3LS5L 1M4KA 2XV6B 4XMPH 1JV2B 3UEQA 5GS0C 1H8LA 2X40A 5HGBB 1U2CA 2ARWA 3FCTA 1RJLA 4HKJA 4Y2DA 4LSDA 1SJVA 2X12A 2WUBH 5FYJD 2UX6A 3OXSA 3Q9QA 3VGFA 1U93B 3Q5YA 2WTOA 3CLEL 4UT9A 1WJ3A 5CJBA 1CQKA 2VABA 1UD3A 2V9UA 4Y9FA 3L6FA 1ZRUA 3PXJA 1G7JA 4O02H 5EUOB 4ZTPH 4QYOA 2M2DA 4H2AA 1RUKH 4MS6A 1R3IH 1KZYA 1RSFA 3VRIB 3FRUB 3V0WH 2B2XL 4RRPG 1RIVL 3BT2L 1Q0XH 1PVHA 3QG7L 5T1LD 3VXUD 2JF1A 5E1AB 2ZXAA 1OB0A 1TZHB 4UU9A 4DUVA 3AQDA 5EUKA 3T3PF 1J18A 1UGNA 2G60H 2WSDA 1R3LB 3CK0L 3KBFA 4UQAA 4ADIA 1F2QA 1N0XH 3VU1A 4GP5B 3ARBD 4XC1L 3DJRA 1IX2A 1O9WA 2MOQA 3LS5H 3QS3A 4KK8C 1U3HC 5I17B 5I73C 3RE0A 4RESB 1O9ZA 2G5BB 2GSMB 4R2GC 1UVQB 1GZQB 4KX9A 3QPXH 1P0SE 4NIYE 3UP1A 4XNQB 4O2FB 1GJIA 3NIGF 4K71C 1TYRA 2A73A 1BA9A 1YEHH 1BFOA 2WO3B 2HTLD 3WKQA 3ZDXB 3VXMD 5H2BB 3RHWF 4OJFH 4Z95H 1NUGA 2DMHA 2J20A 5JDSA 5H35B 4A7QA 1EFQA 4Q0XH 2VL5A 3BAEL 3MLRL 4ZMOA 2V2XB 2XVBA 5DRZB 5AVYB 4AC4A 1J5OL 1RLBA 3WLBB 4OCRH 1A9EA 4UOQA 3L4VA 2AK4A 2DQTL 5FS5A 4HG4J 1MNUH 1V3MA 3LZPA 4F7PA 2E5EA 4PBWD 2X9XA 4ZFOA 2VXVL 5KYUA 3HN3A 1BIIB 4KJYB 3SGDI 4LRNL 1HHGA 2DJMA 2FBJH 3IJ8A 4KY1L 5GGRB 3O2VL 1SMAA 1CXFA 1U8CA 2FH8A 2RALA 3RWFB 3DBSA 3P9LB 3VFNB 3VD7A 3R1GL 2P5EE 3GSVA 4EN3D 3Q13A 2AZUA 5I24A 4F5CA 4CADA 3T71A 5FUCC 2P80A 3GMLB 1ZVSA 3QWQB 1JL8A 3IE9A 5GRUL 3WLWC 2VZ3A 2WXFA 2H9GB 3E1ZA 4GSDL 3B3IA 2H41A 1H8OA 4IRJC 4G6ML 3KCPA 5C86A 2WUCH 5E4OA 4FG6D 3ZYIA 5SX5K 4N2IA 2DWSA 2Z35B 3N43F 1FV1B 3VXOB 5KYWA 2C1PB 3ZO0A 2C4FU 3KPLA 4DGUA 1JZ6A 3HB3C 5KEZA 4M5ZH 5ANMA 1X5AA 3SKNA 3DUSB 3NCMA 3KWWB 1ZLVK 2WZPA 1DDTA 4WW1A 4EIZC 3TCLA 3MCYA 4OZGE 3V0VA 3DK2A 5JOPD 1R19A 4U4IA 5JNYA 3N1GC 4HD5A 1NPNA 3A4AA 4B6ZA 5IIEB 2HG5A 3KHQA 3C5JA 4XAKD 4AQZA 4KX7A 1EERB 2WBJA 3SDCA 1CUOA 2YAFA 1ZV5A 4WSJA 1AQKH 4E9WA 1B0GA 1I7RB 3II1A 3U1PA 1NFIB 3IDNA 1ILSA 3CXDL 5FYKH 4GKZA 5FXCH 3H9HA 3QNYA 1MRDL 1SF5A 2WBWB 4RWYH 1P1ZA 2BY2A 1ADQA 2UZPA 4DAGH 4HSQA 4HK0A 2ODHA 4PSRA 4X9FA 4Y0GA 5A16A 3ARFC 5C0RH 1NGZA 5BO1H 3Q8BA 2LAAA 3SE9H 5HD8D 4J39A 4WCYH 5FGBA 4IHOB 4PN6A 3CHXA 1Z3RA 4Z7UA 5BQDA 4JG9A 4W9JC 1BDYA 4NNYB 1FN4A 1OSEA 3OR7B 1PF3A 4EN2A 2XY2A 4ZSOE 4H0HB 4XXDA 4ZTEA 2JCWA 1BXXA 4IBYA 3W82A 4XC1H 1PY4A 1RI8A 3IWVA 1RK0B 4QCIB 2QQKL 1FFPA 1DBBL 1R3HA 3ZE0F 3LDBB 1LDPL 4PVBA 4YHIB 5I30L 4LP4A 4C8XA 4PCKA 2A1WH 3G5YA 2VT0A 3GSUA 5TDPB 5LHDA 1KJ2B 3EFFA 4WEMB 4XN1A 1UZ8B 4PV1C 5J11C 2AJSL 4QAWA 3AREB 3QNXA 4QMEA 3QRLA 1OCRB 3APNA 3VXQB 5HYSA 1KC5L 1I9JL 3KYMB 35C8L 5D7LE 3QK0A 4WI0A 2F54A 1DHKA 5IFHH 2WXQA 5DWUH 3LH8A 2HPOA 3SE6A 3NJHA 1C5BL 3L4WA 1N2RA 2MTPA 3CFBA 2OCCB 1U8KA 3D8MA 4IOFC 3OAUL 1QLFA 4PV9B 4RMQA 1N70A 2OJZH 4HS3B 4DKFL 4GQPH 3TNNB 4Z1PA 4HF5L 4CKVX 2H0PA 2OSLA 5E8DH 5J7CC 3WKYA 3KJ4C 3JV6A 4XOBA 3QUXA 3RIFF 1TQBB 4OZ4A 5GS2H 4IEFA 2R15A 1GXEA 4JKLA 1HL8A 5KSBA 5AALA 2IALB 3CN1A 3PS6A 2IOMA 4KH9A 4PEEA 1HYSC 1OTSD 2C9XA 2WQAA 3BQVA 4FLSA 1MCBA 4GFXA 4NI6A 5E5MA 5L2KA 1OAZH 2OP4L 2C34A 2ESVB 4P2RE 4PUBH 4PJBE 3QRBA 5EF0A 2CLVA 2IOIA 2V0AA 3H0TB 1N19A 4FQJL 4JO1H 2DBJA 1NC4B 3N41F 2J4WH 3I3EA 2JI2A 2NY6C 1T7WA 3QFDA 1TVHB 4AXWB 1H6FA 5C07A 1CICC 2X4UA 2X6BA 1IAII 5E9DD 1TJXA 4MMYA 4NWUL 4P5MA 1TLMA 2ZXCA 1CYGA 2CHNA 4PMEA 3V6BR 4LKXA 4PP1C 5D2NE 3SGJC 2C4XA 2Y25A 4OFIA 3R19A 1CDJA 1MHPL 3OSVA 4F8NA 3FNKA 1CLZH 2W9DL 4RSYA 5ELIA 1X3DA 4IOIB 4FNQA 3P11H 2FLMA 3TX4A 4L23A 4MB5A 3MUUA 3IEAA 2EDOA 4U6TA 4WFEE 4KZDL 1QFUH 2IH8A 2W38A 1FFOA 2WCGA 3G9AB 3PCYA 3KXFD 1T04A 1JOIA 3ASNB 3K6IA 2K6WA 2ZYSA 3CFJB 1OF2A 1GR7A 1AGBB 3L4CA 2RFXB 4K5LA 3S7GA 3VXSB 1FNLA 3WDHA 1NWPA 1K8IA 1DO6A 4KHXH 3A22A 2FSEB 2GHWB 2DS4A 1EAJA 4D7BA 4DPCX 2KZBA 4UTBL 3R7RA 1TYJA 1WPCA 3SN6N 2FDBP 4K8RC 1MJUH 2CO4A 1FFNB 4X7TB 3ZGIA 4M3HA 4R7DB 2XN2A 3AY4C 2AZAA 4OM0L 4WWNA 3BDXA 4Z3EA 4U1NA 3L7EB 4G9FD 1CE6B 1S3KH 2Q86A 3Q6FA 4GKLA 2EADA 1JHTB 5LGJB 1Y0LA 4DFHA 2K4WA 4KGLA 1YN7B 1YEJH 2OMWB 4G1EB 4MLSA 1U8JA 1S3KL 3JV4B 5I71B 2XQ0A 1JPGB 4NQSB 5BJTB 2RB8A 4KITB 1DJGA 4P5RA 5DEFB 1EO5A 2P7TA 3E7JA 4A38A 2J43A 3F7QA 4BA8A 2XWTA 5FC9A 1NMCB 4WWID 2X44D 3OTTA 3JTTA 4PTTA 4FERA 1F00I 3H3PH 3LVTA 3HPLA 4DW2H 1EEUA 5BRZA 4OLVH 3TBVA 3JTSA 1CF1A 3MZGB 1WC7A 1AS8A 8FABA 1J10A 3B4NA 4HUCA 5DZLA 5C0CE 5L8JB 4P4KC 1JZ2A 5E95B 4LAQH 4NQEA 1FYTB 3QI9B 3OMNB 1CGWA 5J11B 4M62H 3AACA 2ZOUA 3SDCB 1Y18B 2JELH 4GRWE 5EO9A 2VXSL 4ZMZA 3LY6A 1NFIA 1W2KT 1I3GL 2FT8A 3Q8AA 4I3SL 4ETQB 1FZKA 4YXLL 3UOAB 4ZXBC 5D7SL 5D93B 3ZVVA 1FUNA 2PTTB 2FQGA 5GJSL 1ZDSA 4MNGB 4JFDB 4LDLB 4JHAH 3AT0A 5BVJA 2PTVA 3RAJH 5BO0D 3X1GA 1IBYA 2NY4D 4IGBA 2EYRB 3NAAL 4F7MA 2NY7H 1AS7A 1QPXA 4ZRGA 3CX5K 4PRAA 4YHKL 3EDEA 4AQ8A 1I1YA 4PJGE 4D9QE 3PDOA 3F84A 2VDNH 1G7PB 2BY3A 1LP9A 5JOFB 3IU4L 3NQIA 4YFLF 1DSFL 3K0WA 3AB0B 3BH8B 3EH1A 3WXVL 4ZMLA 1HXMB 1CB4A 3AFLA 3MV9A 3E2HC 4U1IA 2R59A 3HR5B 4FP8L 4MQ7A 4QRUA 4EI5A 2BVPA 2HKFH 2IDQA 3ZUNC 5JHLA 2PW1B 1HHIB 3GRGA 4EQ3A 2VW4A 1PKOA 4B95C 1PLBA 1ZVSB 4ERSL 5DFTA 3NCJL 1A6VL 3OGOE 4PS8A 1QRND 1QI5A 4LPUA 1XWVA 4HHGA 5DVLA 4KNSA 1SXNA 3O2DA 2RCSH 5FK9A 4RMBA 3EYOA 1HH9A 4GAYA 1SHSA 1HOCA 1NDTA 2VJXA 3Q43A 3CK0H 1PZAA 4OFDA 4F7PB 2BRRH 3CHOA 3PHSA 4R97B 3HC0A 4X7SL 4OJEH 4KJYA 4XI5D 3IU4H 1TSRA 3VI4B 2IJ0C 2P28B 3IFPA 2VDNL 3TS8A 2IH3B 1KB9J 4P57B 3QXTA 4U4BA 4QIRA 3QXUA 4P2QE 5C07B 4CDHA 1HWHB 2HKHH 2WLLA 4ZPTB 4ICXA 1I9JH 1RU9L 5DJ2A 4XMKH 1XB3A 4PJAE 1AGDB 4LAJH 1MI5E 5ILTH 3P0YH 4MD5B 1ZAGA 1R0AL 2YZ8A 1SN2A 3HZMB 4I3SH 3NN8A 4LESA 4Z5RB 1CDGA 2NQCA 4EZKA 3N85H 3T6XA 1NWOA 4QRRE 4HV8B 5E2UH 4QEGA 4R7NB 5I30H 3BWZA 1D6EB 1JV5A 3RUGB 5FDWB 2EH8L 4U3CA 5GSRA 1TJIH 3GIZH 4ZW7A 4OZ4B 5CEYA 1ASPA 2EVJA 2N59A 4QRTB 2ZWSA 4L3FA 1S78C 3HMXH 5EUKB 3UTTB 4E9SA 1P84J 3DYMA 3ZO9A 5KVMC 3PUUA 3GMQB 3QUKB 4NXSA 3PLYA 4LLAA 5HGDB 3WOVA 3SZKC 5DK2A 4E41A 2UVFA 5DK0A 4PGZA 3MOAH 3O4LA 1H8NA 25C8H 1WZ1L 3WUWG 2H26A 1FHNA 2CDFB 1SXBA 3GBNL 4N3UA 2HRPL 4PJ9A 4CU8A 4HJ0C 2AKRB 4ZYKA 4UQ2B 5HDRA 4UTCA 4XNUL 4PJDE 1DBJL 3BSHA 5ECGA 2AJUH 3ROLA 1VEOA 2P8PB 4FTVA 1IQDB 4NO3A 3D48R 3UABA 2YPVA 5IHZA 1XH3B 1JGVH 5FGCE 2R4SH 3CFEB 3PFUA 5EIIG 4EVNB 4LP5A 1G7QB 2AV1A 5IGXL 2X42A 1CD8A 5LXGH 4W81A 4AYMC 3K6SA 1MFEL 2XN9B 1JHLH 4ODTH 4HK3N 3V0HA 3OL2A 2E7DA 2XWZA 4BQ9A 1XF5A 1TQSA 4K8RH 1IC5L 3B5GA 4GXFA 1XB6A 2LT9A 4DVBB 4PI0A 1HQ4B 2BS71 4BIKA 4UQBA 5D7JB 3VVWA 3OG4B 2IGFL 2Y5EA 3LN4B 3VXRA 4HHAB 5K9KB 3KPSE 2R0KH 4PRIB 3WDIA 4HKZA 5DTFB 4Z78B 3MUHL 2ITCB 2V9RA 5DI8A 3ZHNA 4AY0A 1O6TA 1TNMA 4OBSA 5DZ9A 1HNYA 4G8IB 4X8JB 1GC1C 4PLJD 2BSCA 3LCYA 2IXQA 4PRNB 5C0CA 3JWOH 2FATH 2XZQL 1NGQL 5D70L 3DROB 5DUBA 3GMPB 1XF3B 5F7HA 1KIQA 1VENA 4F1ZA 4J3UA 4EZJA 3F5WB 5FO2A 2AK4E 4LK4A 1UG9A 1IAKA 1NOAA 1CLVA 4LLUA 1A5FL 4GO8A 3WIAA 2FTAA 3U4BL 4XWGL 4CMMA 1NFDA 3UPRB 1DANU 2NQDA 3DMMB 1A14L 5E4EC 5E2JA 3V5KA 5T3XE 4N9GA 4KTDL 3D25A 3BW9A 4R9HA 1I1FB 1U8JB 4XVSH 2OZ4H 1QRKA 3QR1A 9PCYA 4BQBA 4WJ5A 2LVCA 1NBCA 4N6RB 2GUYA 2WKLA 2IQ9L 2W9LA 4S2SB 4WW1B 5DZPA 3AQYA 1XL4A 3MKGA 4FQQB 1DN2A 4Z7VF 5F7YC 3OKEA 1BCIA 1RJYB 1TQUA 1EANA 1L5GB 1MNUL 3VWKB 1GSMA 4Y5YC 5EZPA 1BX2A 3GIVA 3QXAB 2F9BT 5CJQH 2E7LC 5F1NA 3QP3A 3EYVA 4L29A 4LFHG 4QUOA 1MQKL 2IANB 3OKMB 3QRGL 3MO1B 4Y4FD 1OWRM 4JPWL 2IFFH 3NRPA 3TBWA 3ZT7A 3QORA 5KBMA 1TQBC 2NY7L 4KJQD 2XACC 3K72A 3RAJL 4R83A 1V54B 1J9QA 3MA7A 1D6VH 4GAFB 1NCBL 4FQHA 3LRLA 4FC3E 4C83B 1ANUA 1VEMA 4AVHA 4MCYB 1JHKL 2OR9H 4F92B 5K9QI 4PY7B 4NRXA 4KU1A 3DK0A 4JFXA 3QZLA 4M8QB 1U8IA 5I1EH 1TITA 3TEYA 4WO4B 4UBDD 5ALBL 2JELL 5CCGE 2UY6A 4UT9L 4BFIA 2IDSA 1ZJAA 3FFCB 4ZUWB 1KDJA 2VDPB 5TTRA 3MV9B 4KVPA 1XDTT 3GXDA 4OSUL 1D9KB 1BWMA 4P5MB 3OJMB 4JGJA 1AGCB 1NBZA 3P9WB 1TTRA 4GAGH 2X6CA 1P1VA 2VXUH 2YKKA 4M61B 1JZFA 1SHWA 5IESH 5DO8A 4ODHH 4C56D 4LLDB 1RULL 1A6WL 1S2EA 2WLIA 1ZHLA 1NCAL 3EBAA 2EQDA 4A37A 3BJ91 1I8LC 3VCLA 1I4FA 4LDEB 4QOKB 4PRPB 1CFTB 4JFDA 3TPUB 4GRWF 4AYDC 5I75C 1NM9A 1YPZE 2Q8BL 1DQDH 1E3XA 3CFUA 4EKXA 4LCIH 1JZEA 3QC6X 3VI4A 5JO5A 3N43B 4GW1B 5DC9B 1LQSR 4QHPA 2APFA 2XVKA 5D71H 5HHOA 2RQEA 4PJ6A 2V5YA 4LEXL 3HI1B 4X5WB 2XBZA 4XHJC 1MI5B 1DEEB 3GPEA 4MJJA 4XNMA 3D0AA 3HHSA 1RIHL 4NPKA 3GM0A 1SNRA 3SQOL 3BQUD 3UG3A 4B0MB 4ODSH 5EZOL 4H1LB 1A6AA 4YFDB 1G9ML 3E2HB 3WUZA 2X28A 4NKQB 2EDQA 2KKQA 4XBEH 2D4FA 3U4EA 4UANA 5DT1H 3S5LA 4P23C 2X1WL 1HE8A 4RRPM 3NQKA 4NNPL 4RWYL 3ZQ9A 1S3RA 4F7CB 1WUZA 2BSTB 1NBVH 2C3WA 1KGCD 2XWBB 3SPCA 4OV5B 3EOAB 3MZTA 4N0YH 2PCFB 2A9AA 4PG9B 1G1YA 3WS3B 3C5ZD 4X4XA 1TLKA 3TBBA 3V0AC 1HX0A 1RFDH 2PW2A 4J4PA 5J6GB 1FJ1B 1KBWA 4HFUH 1F42A 1G9NC 4H26B 4G5ZL 4YO0A 5AVWB 3L3GA 3OBAA 1L9PA 3ZE1B 1QEXA 4X9IA 1CBVH 1D3CA 3PL6C 4XNYL 3QA3B 5EU3A 2BFVL 3NJNA 3AQZA 3MRBA 3FU3A 5T5FA 2E7MA 3OLDA 4LIQL 1BM3L 3LZOA 1H15A 1QR1A 1M71B 1MFAH 3K81A 2H32B 4NYLA 5GHWL 4QJ5B 2UXVA 3QDJE 5DYOA 5F0MB 2XN9E 3OKDA 3QIWA 4FQJH 3KM2A 3IETA 4XBGA 4FXGA 4M29A 5CP3A 3RZCA 4HCRL 1HL9A 3T77A 1XF2A 2EO1A 4S10A 3ARYA 3KW7A 4IRZL 5F2FA 3LNHA 4AEFA 4ELKB 2WWMC 5AUMA 5BZWB 3OHXB 4J3OF 2KHAA 4KDVA 1PZCA 1CBJA 4AIZA 2ZAGA 3IFNL 3V4VB 2R0ZL 3W0WE 2QT6A 3QUKA 5HGDA 3VFVB 4LHJB 1SFDA 5IVXF 1INEL 4R4NC 2BNRB 4N2MA 1P53A 2FGWL 3IDMA 1IIKA 3MLTA 4BSWA 4GMSH 2ZF9A 1MEXH 2BZ7A 3IDXH 1JYNA 4DWHA 4KGJA 5EZIH 4ZMVA 3U7YH 1W8OA 3UIYA 3RURA 2FB4L 3ZRFC 5I1JL 1JBJA 3VWJD 1ZS2A 2AV1B 2W65B 2Q2LA 4K9EH 5C9JB 3PJNA 3L9EA 4MMXA 1ACYL 3K71B 3S96B 1Q9KB 3U30C 1F3JB 2JQMA 5D7KD 3VQ1C 2F8VA 4PGDB 1RJZA 4MQSB 5HXMA 4OD3H 2AJSH 1AZCA 4PV8A 2HFTA 3RX8A 3N42F 3WEOA 3JZ7A 2P8MA 4RAUB 5FUCE 5CUSL 1YAIA 2H6PB 3WIHA 1F13A 3BP7B 4J3WA 3GRWA 3T3MF 5F9WC 4RCAA 1IM9B 3SKJL 2BOLA 1TG8A 1VADB 1ZHBA 2OMXA 5DEGB 4XO3A 2K0RA 5E2VL 2X9ZA 4AT6A 1PS3A 2VZ1A 1MCWM 4CBPA 4ZTOL 2QTVA 1GYAA 3MJ6A 4M03A 4P3CH 4V1DA 1YEKH 5IT2L 3PWLA 4XCYA 4P0DA 1F6AA 4P46A 1IKFH 1WAPA 3OLEA 4S0TD 3WEXA 1GZPB 1CR9L 1W72L 4ODVH 1OE3A 3B9KD 3ESUF 2R29H 4IYKA 5HHOD 5IQOA 3FT4A 1BD2A 2WO4A 3ZRCC 1GKOA 2H4EA 2MRYA 1A6TA 1SJEB 5F72S 4JG5A 4MNQB 3M07A 1MCLA 2A73B 1ZY9A 3CDCA 3GMOA 1I1YB 3QZNA 3DMMC 4K5NA 5EUOE 4NZDA 3W39B 4UWQB 1J7VR 4B7LA 5T1KA 4YSCA 3WUWB 4JRXA 2GSIB 5F0PB 4X5PA 1PG7W 3DX1A 1CICA 1LTXA 4ZUWA 3VQ2C 3GMRA 4WLCA 5JA9A 5EBGA 2ZUSA 1A7QL 4ILDA 5DUJA 3NGBC 4P9MH 1DFBL 3SJVD 1C12B 3KYAA 1BG9A 5GGSA 3V6FB 5TQ2L 4NEHB 3GMPA 5CFAA 1YNLH 4FG2A 3AVEA 2YK1L 4WFGE 4ZO8A 4FJYA 4HJJH 1RSYA 3HC2A 4I48A 5ESAB 1OZTG 3N40P 4WKXA 1FNGA 5HDBB 3VM7A 1UWXK 3HI5L 2HVJB 1G7HB 3BXNA 4P2AA 4GKZB 1JPST 2NT1A 4W93A 4NDMB 2QBWA 1VFOA 1BPVA 3QFGA 1EPFA 1IVLA 5B8CA 4KKCD 5HHXL 3RVVD 4YDKH 2MKWA 1VACA 3VXPA 1FSKC 1AYOA 3QQ9C 3NABL 1E6OH 3ZSTA 4OJYA 3B8SA 2V7HB 2DLTA 5TH2B 4QDGA 3SDXF 5HDLA 5MEPB 3VH8A 1T3FB 3DUSA 5G4MA 1KPVA 4D9LL 3A6BL 1WCBA 4ONFH 5ALCL 4DP8X 2VXVH 4NM4H 2JJSC 3B1UA 4PW9A 1OGAA 1BVNT 2EYSA 5IW1B 2XA3A 3FZUC 2PCFA 2YGVA 2Z4QB 4Q2ZB 1K6QL 2WWMD 4OGQC 4Y5XA 4JQIH 5HVGB 1KGCE 3P4MA 1WISA 3GGWA 4F2MB 4AUYA 3MRKB 5I19L 4YSQA 5AOIA 5I1GH 4LBEA 1DLFH 2Z6FA 4FHBD 5DQDL 1IAIM 1SEQL 3GZPA 5DJDB 1A66A 2DRUA 5DK0B 3MRPA 2HX8A 4IRSB 1OAUL 3Q8EA 4FULA 4NQXB 4O9HL 3QZPA 4QHKI 1KCUH 4WV1B 4I3RL 2R69H 3WNNA 2ZOKB 4NYLB 1A8ZA 1F1GA 3ILQD 5JTWA 4YHZL 2VGLM 1M42A 3BAWA 4FFWC 2R8SL 3RIAF 2X7LA 3LN5A 5IFJA 2NSMA 2NYZA 4G7VH 4G11A 3EBGA 1NMCC 3O4LD 4HUKB 4JCLA 2F19L 3VGDA 3WTTA 4WFHE 3SDYH 4JVUA 1AHMA 3QIUD 5FEBA 5C6PB 3W0WB 5F9OL 3HEIB 2P80D 2E9GA 3Q3GB 3SQBA 3WKML 3LRKA 3L4YA 1DCEA 4X4MA 5C0FA 3HJ0A 3N44F 4AUJA 1V7NH 1IVTA 2WBKA 2AS5M 1ZHLB 1BZ9A 2E7HA 2HT3D 3BLBA 1NAKH 4ZDHA 4Q9CA 5F9JB 3B9VA 1Z9SA 4Q89A 4EOWH 1K3IA 4NCC1 3QUGA 4BH8A 4G1MA 4DGIH 5LGYA 3CDYA 1E4KC 1ZT4A 3MLYL 4G7YH 4LASH 1WZAA 2FEEI 5IHUL 4N9OB 5KSBB 3KYNB 3HG1A 5BS0A 4OI9A 4U0RB 1ACCA 2K9UA 4M1CD 2QGBA 2NYYD 1B4TA 2PYFB 2R1WB 3OG6B 2EXWD 3BRFA 4JN1H 1QBLH 5CCKL 2WOYA 4NQCB 5DHVA 2A77H 4QRQA 2D9QB 4UTAA 1UM5L 1N10A 1U8KB 2XIBA 2X4UB 4M8VA 4Z3FA 2GI0A 5T3XD 2AEQH 3GWJA 4AITA 1QG3A 2JKWA 3MA7B 2NDFA 1AIFB 3NIDB 4QWWD 1P4LA 1BXVA 3SD2A 3RU8H 4RISL 5I8EB 2H1LM 4CJ0A 1RURL 1WZMA 1ZHKA 4FEMA 1ZE3H 2N56A 3CLFH 5T5FH 3VD3A 1LNUB 2R83A 5HHQB 4KKAC 3ZTDC 3RVVC 5HJDA 3T6QC 4EBQH 1VDGA 2GTZB 3K2IA 3MLPA 1DJIA 4YHYC 2OTUA 1ADQH 1M57B 4Y5VA 4DKTA 2R2HB 5IEHA 3B7UX 2C3XA 1KCBA 3LQAC 3QXVA 1A2YB 4N8UA 3NEEA 1OAQH 2DI9A 4HS8H 3TO2A 4Q8BA 3LRMA 1QLFB 1TCRB 3POCA 3QJOA 4FQIH 4FQLL 2HVKB 1ZANH 4N0UB 2OMYA 4Q74A 3RPIB 5DWPA 5EOCL 4PV9A 2VN4A 4TUJB 1PAZA 1AZNA 3AU0A 3QUMA 1C16A 1U33A 15C8L 4HEMA 2XYBA 3L7FB 2TSAA 4KUCD 4HAKA 4QXGH 4LP8A 5FUOL 5TD4A 1BVNP 4LSSH 1D5MA 5FF6A 2D7TL 1KYUA 2BNQD 2I60H 3IDIB 3RZCB 3WCYA 3QWOA 3Q8CA 1HTYA 3INUH 4PD4K 4BZ1L 5SWZB 4NQSA 5BJTA 3FHQA 3PPEA 5HYSB 1QR1B 2OQJB 2X10A 3RX5A 3EH4B 4BCXA 5ADPH 1JN6A 2VXQA 2FYYB 3TN0C 1SUJA 5IK3B 4EUPH 3MRCB 4NNPH 4CU6A 3CPLB 1ZTXH 1KBGH 4I4WA 4R5VA 3RWEA 3V0EA 4CC4C 5AAPA 1FNFA 1ZPLA 5FOJA 1EDQA 3ML9A 3VUAA 5HGHA 3D0LA 5EOQL 2JV6A 2FUTA 1KJ3L 5L8KB 4LLYA 1P2CB 4K71B 4K9JA 1MRCH 4HGMA 1KTCA 3QYMA 4IGBD 5EU7C 1FLRL 4M7JL 5GIRA 1OM9A 4DH2A 5EA0L 4KNTA 4NWTL 3QDMA 2Z7ZA 1VSCA 4XRCB 2O4EA 3D9AL 5D1ZC 2LFGA 3C09C 4DP0X 3P73B 3MLWH 3K2UH 5C0CD 3VMPA 3CE1A 5I8OL 1MCOL 1QPKA 1XHHA 2CXGA 3KR3L 4Q4EA 5TGBB 1OF2B 1KBGL 4ALAL 4CGTA 1S7XB 1BAWA 1RMFL 4Y8DC 3NESA 3AWGA 4P4KB 3U4EB 3FOLB 4YZFE 3QIUA 5HD8C 1D5BA 3IJEA 1TVBB 4I0CC 1KNOA 3IFOB 3KJ6H 4WEBH 4QF1B 1IBGL 4MJ4A 1UOLA 3N3EA 5E7BA 3H2PA 1CGSH 3SJVA 1L9SA 3RILA 5SX4H 4ZSOB 2OKMA 4GKSA 3VB9A 3T0WA 1P6AB 4Y4HD 2VM4A 2WVVA 4FXKA 1TPXB 1A6UL 4RMTA 4TOYL 1MCRA 2ZUXA 1JZGA 2Q20A 1L9OA 2QV2A 5D1ZB 1X5KA 3ZMNA 5CZVL 1KELL 1JZ3A 1KTRL 3GMOB 3EGSA 3MRIB 4LEOA 3KW8A 1A47A 3AY4A 3BMWA 5I74B 4WO0A 4R5XA 5IMLA 4HWBH 4M02A 3BVUA 2IALA 4A7TA 3DGDA 4LCCB 4PJ7B 3Q8FA 5E6SB 3ARGC 3H3KA 3TOPA 4AYGA 2QPUA 3L1EA 1DBBH 4LQFH 2AEOA 3G6AB 5I0ZA 2X7LB 3LN5B 2IH3A 3G5VB 1GOFA 2O1AA 1ITCA 1E6JL 2OXGB 2QQLL 3VMNA 1G6VK 1UB5B 4PRID 5D1QC 5I26A 2CDGA 5ECJE 4J8QA 5D6DC 5IHBA 4C57C 2UYLB 3DV4A 3G04B 1NH6A 3LKRB 3GS7A 3Q6GH 3BP5B 3TTYA 3MGAA 3MR9B 4BFBD 2JK5A 2CR6A 1G6RA 3L3HA 4R7NA 5DJDA 1RD6A 1T5KA 4ZZKA 1O7SA 1KG0B 1QW9A 2J6EH 2IQ9H 2WY3B 1U8LA 1XIWC 3L5WA 2AJYL 4I0PC 1ERNA 4OU3A 2H6PA 1ITBB 3FYIB 3BISA 4OF5A 3TONA 1OE2A 1IC4L 2HLEB 3ILQC 4ANWA 3FSZA 3KLDA 4NP4H 1PQZB 3K1KC 3P1VA 4KXZH 4OZGA 3W1ZA 3QNZA 3DO4A 4K3JH 3BWAA 2A2QT 1FGNL 1A14H 3KYMA 2J57A 2D3LA 2UY7A 4KO5A 5GS0D 2V2WB 4ESKA 3HKFA 2FX7H 3ZKNC 1YEDB 2AI0L 4WJG3 3EHBC 2Q8AL 2P5WA 5MEPA 4ZMTA 1JZ7A 4ODXB 1TDQA 4ZX4A 1B0RB 1SHMA 3OF6A 3A0OA 1DSWA 2H47C 2Z34A 3CZLA 5KBPA 2IWEA 2OX5A 3HG0A 5TH2A 1L0XA 3FZUD 1AHWB 4OJDH 2KUTA 4N2EA 3JV6B 3ZKXC 5D2NB 3ZHLA 4MVBD 4OZFG 1A7RH 3GSRB 4GG6E 1F4YH 3F7YA 3KBPA 4V1DE 1JGLH 4Z7QB 4XHQA 5ISZD 3BWSA 4OIBA 3MODL 1TTCA 2H5UA 1JYWA 3HNSH 4NO0A 5E6ZA 2NCEA 2WUCL 4IHBA 2YA0A 3HS8A 3MLXL 3S8WA 3BT0A 2R8SH 2OFQA 4PJHA 2ZKMX 1I85A 4AEIH 1BIHA 1EDHA 4FNRA 4PS4H 4EMZA 5J9PA 3LH2L 2E4FA 1COBA 1RMFH 12E8L 4TS6A 5D5ME 3BIBX 1T83A 1G9EA 3GB7B 4KKLC 4NERA 4X0KB 2XWDA 1G7PA 1JS4A 4V2CB 1R3KA 3VTTA 4AH2B 4YEFA 5C7XH 1JF1A 4TTDD 5IR1B 4M6ML 2WVSA 5FHBL 5MERA 2W07B 3GBNH 2VO5A 4ATTA 1XGPB 1M1XA 4AW7A 3GSWB 4K7PL 4L05A 4TUJA 5H94A 4ZAKA 3D3VD 5E94A 4MAYA 3TVMB 4DZ8A 1Y0LB 1EZVX 4XH2A 5HGBA 1K6QH 2Q86B 1ECZA 3EAKA 3HZMA 4OCRL 3QCTL 3UXFA 4JG0L 4L18A 2HH0L 3IRCA 2GC7C 2YBRA 1TJIL 4NKDA 3RWIB 2DM2A 3TC9A 4OFPA 3EFDL 1KIPB 4H5SB 2Q6WB 2GSGB 3DV6A 1QBAA 3MRCA 2NY0C 2AITA 1PKQA 2ENYA 1HI6A 1HZHL 3PIQA 4UIMB 2ZIDA 4N1EA 5F88B 3P0YL 3GQFA 3IFPB 2I07B 4BFNA 1OAYL 1X5JA 5BRZB 2I60L 4HJEA 4H8WH 1JNLL 5E24E 4BA0A 2B39A 2V5SA 2XQYA 2H1PL 1JXGA 3DC0A 5FUOH 2BVOA 2WZPD 3SSGA 3I6GA 4Q6IB 4EI6B 4IKNA 5AOZA 2UZYA 3D51A 3IB4A 4OCYL 3QUHA 4WFFE 3X11B 4EDXA 3GM8A 4LSTL 1CFVH 1F4YL 2DYRB 3S4SG 1JPTH 1LJMA 3NN8B 2WYTA 2YK1H 5D9SA 1FBIH 3RYMA 3LZLA 2XUWA 1LQBC 1BBJA 4MD0A 3BO8A 3P2BA 2IEPA 1CU4L 1GY1A 3DJZA 4M5SA 3P9MB 3BKMH 3DPBB 4RWHA 5FLVA 1Z6JT 1MCQA 3SDCC 4AMKH 2RCSL 5I1IL 2FIKA 3GJFK 1MFCL 4EBQL 3PWNB 3QFJA 3C8HA 5C0BE 3LNEA 2B0SH 3QI9D 4TVSa 3PDOB 4AK1A 2QEJA 5AW3B 2HG0A 4P4RA 1PBYA 1O9VA 2HLFD 1X5XA 1R1CA 5JQ6L 2CE6A 1FA4A 5J8OA 4XC3H 2WLIB 3M7FB 1LILA 2FJHB 1IUZA 1OP5H 2ZXDA 1XO8A 2YD9A 4L5FL 2B0SL 4WRLA 1KCVL 1OP3H 2K9FB 4D8PB 1TF4A 4XVUC 3GXMA 2Z4TA 8CGTA 4APXB 1D5ZA 2X6AA 4CAGA 5J3HD 5I8CB 1AMYA 3CMOL 1UEMA 3E3QC 3EYOB 5T5NG 1JGEA 1BZOA 2FLRT 5GGTH 1T0NA 3VYOA 3S2AA 2ED6A 3MLZL 4OM1L 4CADB 3L2MA 3IKCB 3DX0A 3PXLA 1CYXA 3ZDZE 4FQHB 3QJUB 4HAFA 3NH7H 5I1HH 2CHZA 3WFEL 3DXAD 3LKSB 5HSFA 1D5BB 3D7PA 3T3ME 3GHBL 3HVDA 1IILE 3WO4C 1OM3H 4XI5C 5E8NB 3ETBJ 2F54D 2DH2A 3OSKA 2EDMA 4Q97A 2CJTA 2WIIA 4HK3J 3DGCR 5AZEL 4M48H 2KDYA 3D87B 4Y4HC 1JGUL 4BWUA 4LIQE 4R3SB 3KYOB 1BX2B 1CVSC 2XZCL 1WBZB 3CV5A 3F8UB 3GIVB 5CBAA 1N6QH 2B5IB 1T83C 3EGDA 3G6DL 3UC0L 4YN3A 4U6VH 1UQSA 4HUNB 4PGCB 3WG7B 1MW0A 3ESMA 2L3BA 5FHAH 4KZEL 1T1WA 1D5XA 4H88H 2DQJH 5DMGC 1AD9B 5D1ZI 2ZG3A 3M8OL 3VXRD 2NT0A 2F19H 3JZYA 4MKMA 2VAJA 2EVHA 1GZQA 1I8MA 3AG4B 2JJTC 1LEGB 4Z0BL 2G9KA 1FO0A 2NY3B 2OCFD 4I1PA 3VA2C 2QQQA 4KKCC 4OAWB 1QX1A 2CIKB 1UJTA 3TBTB 1DTUA 4L1HA 4O9HH 3FU5A 4OIAA 3U7WL 4AH2A 3UJTH 3EO9L 4Y16A 5B38A 5IBLC 5E9DB 4AQ8C 5FLUA 3NSDA 3O0RH 1P5UC 4WQOA 1VZHA 4HIXL 1R24B 1QYGH 5SV4A 2EICA 2V5RA 1UYWL 3RIKA 4S1DC 4XE5B 3GK8H 3M1BA 4D7PA 4LOFA 4J7RA 4X8JA 1CG9B 1LE5B 4J4PD 4FADA 2EP6A 3FAXA 3MGTB 3VFPA 4B3EA 4ZBJA 2PCXA 1Z9PA 2Y5TA 1INDL 2WAQA 3PRZA 1SBSL 2MCPL 1BF2A 1TJGH 3BCFA 5HDQL 1DN0A 2AVFA 3SPGA 4TKWA 4UDTA 5C08E 2W0FB 1PLGL 2YD8A 5ISZE 2IMMA 3DPDA 3OKLA 1P4UA 3ARTA 1WH0A 2YRPA 4KZDH 3WSQH 3W0WD 1KPUB 2YRBA 1NIEA 2FJSA 3PGCB 4OF0A 4JO2L 3Q06A 4U33A 1MFAL 5KG9B 5GRYA 1QBBA 2PWGA 4Y5VB 3UAJC 4H25B 1FE8L 5IEHB 3X14B 2BFVH 3IRPX 3BLPX 2ZX9A 4F58L 5IVZB 1S7VB 4NZ8A 2NZ1A 3EG9A 3Q9PA 1M7DB 4OBRA 5FKPA 3WO3B 2ERJB 1F1AA 5DS2A 1CXHA 4GKNA 2FHCA 3RWGA 2Z35A 5KWYC 4CGUB 1MCPH 1EAOA 2ZWYA 4UOJA 2N1KA 3OB0H 4EO5A 1ZHNA 1RFDL 1XGZA 3KPLB 3QCVL 5D96B 1IQDA 4FNLL 1E9PB 4P3DA 3N5AA 4ZUSB 2D7TH 4ATWA 4U6HB 3DYPA 3NA4A 3GHBH 2YGOA 2F53B 4E9XA 5IVXB 1TTUA 3I02B 3EJJX 2N7AA 3MJWA 1J5CA 3GUTB 3P9MA 1MJJA 4X8XA 5CGTA 4LPYA 2B08A 3SO3B 4XNBA 3QDMD 4Y5YB 4GS7B 5DURD 2F5BH 3BGMB 4UV7H 5TF1L 3RVWC 3ARBA 3MMEB 4IU2A 1OQXA 2CDEA 2QSQA 1G6RB 4WHCA 1O75A 1CT8A 3JSSA 5F6IC 3BIKA 3KG5A 2DQFA 2OZNA 3MLUH 1TZAA 4X5WA 4U6XB 3ZE1E 3VSTA 5F96H 1FH2A 4LKCA 3IYLW 3O11B 3CLWA 4I89A 3U0WH 3UEZA 4OLWL 1IGCH 1PD1A 1SVZA 3A23A 2B59A 2BHZA 4MJ5A 5BQ7B 5E8PA 3IFLH 4Z7VB 1LO4H 3MAWA 1IZJA 4JZNB 3S35L 3QDJB 3C2AH 1AGCA 1NBZB 1U4EA 5T1MA 3CU1A 4RQQA 1ZS8A 4ODVL 3PP4H 5G4OA 2WZAA 5DHXB 3RNKA 2ORBL 3S34L 4AMKL 3C08L 4JANB 1BFOB 2VQTA 2ADGA 2NLJB 1HEJC 3EGSB 1CU4H 1YEKL 3CD4A 5IT2H 4DP9X 5F0JB 1BBDH 3MRGA 2CCVA 4BZ2L 4WJ5B 5MENE 3SYOA 2JIXB 3C5ZC 3MRLA 1AJ7H 4JNXA 4AIZB 1A6ZA 1HU8A 3X1FA 3T1FA 1NANI 4KVCL 3ZKQD 4APQC 1ID5I 3RVUD 5IOPB 2DQMA 5L2JB 1O7DC 2TRYA 4WI4A 4I9WE 1E43A 4MZ2A 4APQD 1U0QA 2BS8A 3O6KH 5DSCB 1ZOXA 3MTRA 4GAJH 1FAKT 1OARL 5EZLB 3D39E 3AW5A 4AGQA 1X5GA 4E0RB 4FXGB 5DXWA 3GI9H 5DLLA 2BZCA 1MXDA 3O3BA 2AJXL 4NCDA 3UCQA 1JFHA 4NN6C 3K91A 1ZEAH 2ZKHL 3EIFA 2W0KA 4RMUA 3D3VB 3QWRA 4JG0H 1T22B 3BEVB 4H26A 4O2EA 4X99A 4PGBB 2Z3FA 4WJKB 2HRGA 3GRWH 4PVLA 1MCNA 1VACB 1IEAA 1GA2A 3D1MC 3QA3A 4HA1A 1QA9A 1X6NA 5J06A 2VLJB 3BVDB 2DWTA 1EHNA 1BGXL 1K8DA 4KAQL 3T0DA 4H8PA 1U42A 3GKWH 5AKVA 4CJ1A 1PZDA 2LHAA 3Q1SL 3QJSB 1IM9D 3IJSA 4ELMA 4IHOA 2CBMA 4HG4K 2IC2A 2IG2L 3VFPB 4U0QB 3FT1A 3UBGA 1AC0A 2XVLA 1EQWA 3D52A 3FQXB 4KAQH 1R5VB 4NQDA 4PJFF 5CKGA 2AXHA 5I9QB 1QWNA 4XBGB 4ELKA 4F7EA 3L95B 5DRXA 1GGBH 5ESVA 1JK9A 3KPRD 3MLXH 2VDML 3GRWL 2DI7A 4MA3A 4YUEL 3MODH 2HJKA 3K8KA 5D70H 3FN0H 3T9WA 1YY9D 4GG6A 4W1TA 4PU2A 5HDOA 4Q9QH 1KWGA 5ALCH 5FB8B 1YYCA 3FH5A 4KKAD 5T1KB 2CM6A 3NZHH 2AEWA 5LDUA 2CIKA 2ZNXA 3H9ZA 2XTJE 5IVNA 4R96A 4ISVB 5FAAA 1FC1A 3MROA 4GAJL 1MKFA 4Y4HB 1MCSA 3MA9H 2F61A 3H4HA 2EIZA 3NMEA 4HSCX 4HKXB 5D1XD 2IMNA 4MX7A 2AI0H 5ETUB 2FUQA 1AY1H 1MY5A 1Y6MR 3LNFA 2XWBA 3FT9A 1QFOA 2OTWB 2FSDA 1U4FA 4UTBA 2DIJA 4JFPB 2NCMA 1U8OB 2XTSA 5DT1L 4ZFQA 2EE0A 4WHYG 5BMFL 3VI3A 1UACL 5CILL 1TZOA 1SVBA 2KZ1B 1ACZA 1VCAA 5EWIH 4LEEA 2BW4A 4L2LA 4RBPK 5GZOC 1G5GA 1RZIA 4EQ2A 2JKNA 1X4XA 2RBLA 3DVFA 4IMKA 3ZTJG 1MHCB 4M93C 5I16A 2BP0B 1U92A 3U1SL 1AZRA 1JJUA 1U30A 5CEZD 4ZFOL 3BPCB 2BNRE 3H9YA 3B9AA 3T65B 2HMIC 3U30B 2F53E 2HFGH 4OB5H 3E8VA 4ABQA 1QLRA 3DVGB 4KK9C 1UA6L 4L9LB 1P9MA 4U6HA 4GSUA 4H8QA 2R1WA 1YECH 2WKGA 2OZ4A 1TENA 4H8HA 1PLCA 4IRJA 5DJAB 3RY4A 4OD1L 1GW0A 4A66A 4C4KT 4W9KC 1Q38A 5F96L 1J8HD 4WVRA 4YXKL 3FUFA 4HC1L 1Q9KA 1XH1A 1Y1UA 2DQHH 4ELME 3NPSC 3BPLB 4JRXD 43C9A 1KGXA 1GTNA 3KS0J 5HHNA 3ZZ1A 4RAVB 4ZUUB 2ZXGA 3CFDA 5SWZD 1G0YR 4NGHL 2E9JA 4U1LB 4Z3JA 5TF1H 1BZ9B 4BSVA 4KX8A 3ZDYE 4LEBA 3DIVA 2X9YA 4AIXA 4TQIA 2VM9A 3EJPA 4N22A 5I6MA 5DJ0A 1DQLH 2AQ2A 3W9EA 3VFWA 3KWTA 3U9PH 4X6BA 4X7SH 5KUMA 3RVTC 4QPEA 4MDJB 4NAQA 1XCXA 2B1AH 2XV3A 3BZDA 4ICWA 3HR6A 1MI5D 3IKKA 5CZXC 3KJ6L 4WEBL 1T0MB 1A1MA 4LSUH 3K3QA 4P9HC 4Z7QF 3KVDD 4O58L 1RV6X 4KFMA 3QIWD 1WVZA 3OZ9H 3BGFC 3SKMB 4BKLA 3BX7C 1M7UA 4MGXA 3TCXA 1K9TA 1NCOA 4F8LA 5CINL 5E5RB 2VSCA 4FQXC 3QAQA 3NEOA 4R2GD 5D5MA 2BVPB 4JM2C 3ZDWA 4BWWA 3BPLC 2LW3A 4GW4A 2EYRA 4F7MB 4Z77A 3ILDA 4BE5A 3Q2CA 5DQDH 1TU2B 4JFWA 3WXVH 1KCKA 1PZ5A 2FB4H 4FCHA 5I19H 4YDIH 5EEUA 4DUXA 4HWBA 1PFCA 5EA0H 4WUUD 4PWGA 3QXDA 4ZX6A 3MLUL 3QCTH 4LNRB 2VMFA 1OTTC 1UA3A 3F7PC 3ZTNH 2EO7A 4DO6A 3V4LA 2O5XL 4NCC2 3SPJA 4DF9A 4MJIA 2VR4A 1BQRA 2CU9A 3P4OA 1J48A 1DVFA 1UHVA 3KYOA 4YHML 1TJHH 3B2UC 4PR5B 1CGYA 3JXAA 1ZSDA 4XPFH 4A7GA 1KN4H 2UUDH 3FQWB 2BVQB 4XNDA 3KPPB 1C5CL 3JT2A 4YDVA 3CC1A 4GBXD 5BOZG 3LKPA 4U1SA 3HKZA 1FAIL 3L13A 5HHVL 1T1XA 3WV0A 1BLIA 4WDIA 2XT1B 2CUMA 1AQDB 3I9AA 4ANKA 2FH6A 3QW9A 3AS3A 1LD9A 4RFOL 5D2NC 1TQCC 2OW7A 1N3NA 3HCVB 4MMYB 3OC8A 1EZVY 1M6OA 5F9WB 3MGOB 4XP4H 4M43H 4KXAA 3V6FA 1KPVB 2ZWKA 4MD5A 3OQRA 5A3ID 2CGRL 5BRQA 3QZBA 1T1WB 4NZTL 3TV3H 1CIUA 4GQ9L 1IGJB 1I7ZA 2F74A 4YPJA 3ETTA 3U36B 3X1NA 3VA6A 9CGTA 3BWUC 2FX7L 5JIKA 2BVEA 4I9XA 3CLFL 4W4OA 5AD0B 4XVJH 1RURH 3HUJE 4XNUH 5I8KL 2PF6A 1YQ2A 1KB5L 3HUJA 4F2EA 1SHXA 5HVHC 1XBDA 2HRPH 3T5WA 1AGFB 1DJSA 4NNXB 4FXKC 1I7UA 4XNXL 4YBQD 4N5EC 4L0YA 3MLZH 3QQNA 5BZXA 2D2CC 3TO4D 1PNDA 1I1AA 3RGVA 2X2IA 3CMOH 3HG1D