3H2QA

Human sod1 h80r variant, p21 crystal form
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
153
structure length
136
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPRRVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEENAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Structures of Pathogenic SOD1 Mutants H80R and D124V: Disrupted Zinc-binding and Compromised Post-translational Modification by the Copper Chaperone CCS
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 32
structure length 136
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3h2qA00
4OJAA 1Z9NA 1IBDA 2WZ0A 3KM1A 1E9PB 1SXBA 1IBBA 1B4TA 2E46A 3GTVA 1E9OB 4N3UA 1F1DA 2GBVA 1FUNA 3PU7A 3ECUA 1Q0EA 2ZKXA 3SODB 1L3NA 1EQWA 4A7QA 2C9VA 2ZKYA 1IBFA 2V0AA 2Q2LA 4OH2A 1E9QB 3L9EA 3QQDB 2WKOF 3KH4A 1CBJA 2Z7YA 2NNXA 2LU5A 2AQPA 1SXCA 3CQPA 3MKGA 3RE0A 3F7LA 3HOGA 4FF9A 2WWOA 1SDAB 1AZVA 2WYZA 1JK9B 1TO4A 1SXZA 2VR8A 1UXLA 1JCVA 1COBA 2C9SA 3KM2A 1SPDA 4A7SA 3GQFA 3H2PA 4U4IA 4MCMA 1B4LA 1U3NA 1OALA 1TO5A 4A7VA 2AQTA 3HW7A 3CQQA 2WKOA 2SODB 1UXMA 1YSOA 2E47A 2XJKA 2JLPA 1YAZA 1PU0A 2XJLA 3GTTA 4A7GF 1PTZA 2ZKWA 3GZOA 4N3TA 3L9YA 1MFMA 2GBTA 1OZTG 2WYTA 4B3EA 1E9OA 3GZQA 1F1GA 1BZOA 1EJ8A 1PZSA 1HL5A 3S0PA 2AEOA 5KBKA 2WZ5A 1SXNA 1F1AA 3HFFA 1HL4A 2C9UA 2VR7A 2R27A 4MCNA 1E9QA 1OEZW 3GZPA 1N19A 1CB4A 3QQDA 1XTLA 1QUPA 1SXSA 1OZUA 1RK7A 1SDYA 1SXAA 3LTVA 5CU9A 2APSA 4BCZA 5KBMA 3F7KA 4L05A 4A7GA 4BD4A 3T5WA 2ZOWA 3H2QA 1S4IA 3KH3A 1BA9A 2AF2A 1DSWA 1E9PA 2VR6A 1IBHA 2Z7WA 1JK9A 3MNDA 2AQSA 4A7UA 3ECWA 4A7TA 3CE1A 3KBFA 1F18A 1OAJA 2WZ6A 2AQNA 5KBLA 1Z9PA 1SOSA 1XSOA 3ECVA 1YAIA 1ESOA 2WWNA 2AQQA 3KBEA 2Z7UA 1DO5A 2JCWA 3K91A 2AQRA 2Z7ZA 1KMGA 1P1VA 1IB5A 1XTMA 1N18A 4BCYA 2GBUA 1SRDA 2K4WA
chains in the Genus database with same CATH superfamily
2OMNA 2ARJA 3P2TA 2AJXH 3ARZA 4X5WB 1WZLA 2X1XR 3F65A 5D71L 4YXLL 1FSKC 2H0JA 3G6AA 3PWLA 4J2QA 5I8KH 3GZKA 4U7KA 3V5HB 3UTZA 1XT5A 3HG3A 1GIGH 4AMWA 5JDSB 3QYNA 4GT7A 4FN0A 3VXUD 1QI3A 1QLEL 4MB5A 5DMKA 3G04B 1AYRA 3PHQB 1FCGA 1TZOA 5E9NA 5ITFA 3KWUA 1G7LA 1H3GA 4PVNA 3OMZA 2VNCA 3UCQA 1FN4B 2HAZA 3HAEH 1J5CA 2IC2A 4IDJH 1S9WA 1RP8A 4D3CL 4B9JA 4JRLA 1BMWA 1BLIA 1KTDB 3LMJH 1MJ8H 4HCFA 1CPUA 4GKOA 1YEEH 4PGZA 4F15B 3MCLL 1Q9LA 4P07A 3D2UB 3RB7A 5T1JA 3Q6FA 1AO7A 4OUUB 5IMLB 2GYSA 5KVEE 2AQ2A 3BIKA 2BS8A 1M7IB 4Z7QF 3RL1B 2EKJA 1FV1B 2V3FA 3P0YL 5E8NB 2C9SA 3NJFA 1R3LB 2WTOA 1S7SA 1TG8A 3CVHL 4MZRA 3V4LA 4ZUWA 4OCYH 3V0IA 4WW2F 3L81A 1OCCB 3L7FA 5D4IA 4MNQB 4EI6A 2Y7MA 2BP5M 4ZO6A 3HZVB 3WIHL 4KKRA 4LKCA 3M1CA 4E41A 4P2RE 43CAA 4ENED 3SDXB 5G5DB 1N26A 3OKMB 3F7VA 1LLAA 3FSVA 4MD4A 3LQAL 5KOVC 3CZLA 1KCSH 2TRYA 1T5KA 3QFJD 2I07A 4HFWA 3K1KC 4MJIE 3VXNA 1CFVL 3AABA 1REIA 5AWNL 4S11A 4GG6B 1WCBA 2COQA 1QABA 1LWRA 5I0YA 1M7DB 2DLEA 1RHHB 2IADA 3L48A 3C8KB 3IKCA 4EDWL 1XMEB 3BEWA 1UXSA 2JKSA 4LCWE 1J0IA 1OARL 5LAXA 4LSQL 2UY7B 1LO5B 4DZBA 2C3VA 1F6AA 1OZUA 4GBXA 4Z7AA 2WN2A 3U6XS 1JXGA 1MQKH 1XR9A 1ZXQA 3OB8A 1I8LC 2FO4A 4MMXB 5ID0B 5A43C 3KPMB 3QNYB 3F7QA 2A74A 5GS2H 3A67H 3OXRB 5BO1H 3LRMA 4UT9A 3KHQA 3HC0B 5D9SA 3VYOA 1U58A 4Z5RB 1I31A 1AZRA 4MB4A 4QEGA 4Y16B 1Z6JT 3TVMC 3FTXA 4KOCA 4OUOA 4I5BA 3BYYA 4WUKL 4C83A 4JDEB 2A0LC 4JEGB 2FEDC 1D7FA 3NSXA 3LDBC 4KO6A 4M7KH 2AEQH 2YD0A 2ENQA 2ZQKA 3PWVB 5C0EA 3DYMA 1A9BB 4KHTL 4X6EB 5D7JD 3NZUA 2HRPH 1A6ZA 4HT1H 1AQ8A 1I8MB 2EICA 3VG9B 1XB6A 3SKNA 4W9CC 4FYSA 4RA0C 1DQLL 5F88A 2F68X 3QEHB 4NI6A 4QRAA 2GSGB 3VNZA 5JQ6H 2CMRH 3CXHK 12E8H 3U36A 2P5EE 5HVHB 5IREA 3FOLA 4J6RH 2CQVA 1VCBC 2NNXA 1L0QA 4HOZA 5L8KB 1GL4B 4MWFA 4FQQB 5K9JL 5A6LA 1BAGA 3FH8A 2MNUA 3CN0A 3M46A 3WJLA 1G7HB 4PUBH 1TFPA 1I75A 1KNOB 3X2QB 3S9DB 2CBTA 1P0SE 2Z93B 1OAQH 3GI8H 4YZFF 1XCQB 4P2RB 2ZSVA 5IGXH 4IJ3B 5D96B 4M8UA 3V6OA 3QDGD 5B3JF 2GJ6A 3KWWB 2CIKA 1ZIBA 2H3NB 3PXJA 4O4YL 4OLZL 1OK0A 4MJIB 2FCBA 2DLIA 3OWEA 1A7PH 3SO3B 3S3DB 2FJHB 3M1BB 1ZJBA 5LNDA 4LCWB 1JVLA 2AK1H 1MRCH 2GIXA 5IKCB 3TIEB 3OF6D 1MFAL 2ZX9A 4Q7DA 3WXVL 4F7TB 4M62L 1WD8A 1HCVA 2WXPA 2XZAH 4N26A 5JHLH 3CSYB 1DLFL 2EDOA 3QPQC 3P4MB 2UZIH 4KROC 3KLDA 1BZDA 4KKAD 1NINA 3Q01A 3O9WB 3QUMB 4LARL 4M7LH 1MRFL 2XKSA 1SY6H 3NFPA 2ZOWA 2WXHA 3MZGB 5EO1A 4ZMWA 1KGYE 1CU4H 4YOKA 1OAZH 3U46B 1BIIB 4DH2A 4DP2X 2M8XA 2VDLB 1ED3B 4R8WL 4FLQA 4Y5YC 1YZZA 2UUDH 4K73A 4WCYL 3V7MA 3WO4B 1KB5H 3Q48A 1UH2A 2ZKHH 4OFYD 1VFBB 3AY4C 3IU4H 3EGSB 3RWCA 3TCTA 4FERA 4MJ4A 1GGIL 4D8PA 4YHPA 4RDBA 3QK0A 5B21A 4V2BA 2CUMA 1XGTA 3FZUD 3ULAB 1CFSA 4ONFH 2Q5BA 2UV3A 3CDYA 2YD4A 3BUIA 1IAKA 4YFEA 2F7PA 4YHYB 1A3QA 1S9VA 4MHHG 3N40F 4N2GA 3ZVVA 4JN1L 2CR6A 2ENYA 4XVJL 5BRQA 1LEIB 2J6EH 2P5EB 3EH1A 2KC0A 5DHYB 1DEEB 1NCIA 1J5OH 1A14H 5I1CL 1JZIA 2ZG1A 3P3TA 3RA7H 5BRZA 5ADPH 1KFAL 1EDYA 1G0XA 5CBEB 2H6UA 3MGAA 5JPMA 2HKHH 2P5WE 3IVKB 4UAHA 4BWUA 1KB3A 4NAQA 4TNWK 2VDQL 3RGVB 3GK8L 3UEQA 4KJYA 1RZ7H 1ZSDB 2JQAA 3UYRH 5HJBA 4NOFA 1L6ZA 3WS3A 2YMXH 2X6AA 3NJHA 3OAZH 2OJZH 3HIZA 3ZX1A 3S36H 1E4HA 3NJVA 3T08A 4IOSA 1NFDE 1Q9WA 1WEJH 4K71B 4ANWA 1CLYH 1MWAB 3KS0J 3ESPA 3C6LA 5FUOL 2BP8B 5DHEA 5CLWA 5DI8A 1QBAA 3ZRFC 1II4E 3NABH 4PJ5E 5GHWH 2W94A 3DARA 4QYAA 3BD3A 2VM9A 4M6MH 5C0AA 4ELKB 2IOMA 4NN7C 2YFOA 4KUCF 4WI4A 4ZMYA 3PWPE 1OPGL 3KWVA 3MRKA 4OZ4A 2VLRD 1PTZA 1H3UA 2DJMA 2Q9OA 4U2YA 5CP3H 2W65B 1NGQH 2ADFH 1MAML 1MF2H 4GYBA 4OZHA 1PBYA 1K5NA 2VQ4A 1Y1DA 3IDJB 5FK9B 1GZHC 3D4CA 1FDLL 3DMMB 1SXNA 5F7EL 1A02N 4TUOB 2R27A 3DECA 5D7IF 4Z78A 1CLZL 4F3FA 4JRXE 5EIIB 5LG1A 5IF0A 4TUJA 3QAQA 3T09A 4AY0A 5E4OA 5GIRA 5DHXB 1M6OA 1IC5H 1NH6A 1OSZB 2R7EA 4DPRA 4HUXA 2ZOUA 1I9IL 2OJEB 1GZPB 1R33A 3C5JB 1G7PA 1GPOH 4RH4A 1NSNH 1SOXA 5LBSH 4ACPA 2AAAA 4B5EA 2PW2A 2MTPA 1URZA 4LAJH 1UD8A 2EABA 4R7NA 1FBIH 3U2SB 4HUNB 3MLWL 1R3IH 3D7PA 2NT1A 3ZT6A 3FRPA 3EGXB 3UACA 4JO2H 2DJ4A 4HWUA 1OAXH 1YY9D 4DGVH 5LCVA 1U8MA 2MJWA 3V0HA 5KVGH 4J7RA 4KUZL 2YSSA 1HYSC 5IHZA 1MIMH 2FT7A 2F7QA 1IM9A 5CGMA 3NFNB 3MREB 2IANA 1KB5A 3PGCB 1F4HA 3GM0A 2ZUVA 1F97A 3QSKB 2CJSA 4FFZL 5T5FH 1WAEA 1SNRA 2P5WB 4ABWA 3NSDA 4NWUH 1IEBA 4RQQA 4PJXF 3RKDC 3AXHA 2MKLC 1XGRA 4UAOB 4G72B 3T0AA 1MLBB 4DUWA 2E5EA 4ZMLA 1MPAL 2WB7A 3PUCA 2HX7A 4TPRL 4LF3B 1EXUB 4MJ5A 5A2CA 5IW1A 3STZB 1TTBA 2NY7H 2ENJA 4PRID 1NFDB 3RTLA 1C8QA 4P59L 5SWSB 3HC4L 3VXQA 5A2BA 3IRZA 1NBQA 4CC4C 4XPAL 3VJ6A 5IBTH 2QDWA 2EXSA 4PGBB 2CJTA 3UXFA 3VQLA 1ZXKA 2YPLE 1NOFA 3PWPB 1LL1A 2B16A 4PLKC 4KI5D 1BXXA 1KBGL 4NNPL 2L04A 4UWQB 5L88L 1DCEA 3A4EA 3NN8B 3UAJD 3VD5A 2WLLB 4KVPA 2FX9L 1BJ1J 2PW1A 4LLMB 4P2OA 5EEVA 2BNQA 1F90H 1VGEH 5DT1L 4QR7A 5C2UB 1Q4NX 2EADA 5C0ND 2BNRA 1NGYA 4JRXB 2XTJD 1KYDA 4OT1L 3LSOA 1D5ZB 4JUTA 1P7KB 3BO8A 4G80A 1NLBL 5BZXA 1KXHA 2PYFB 2Y1ZA 3MKKA 4XODA 5CEXB 2CHZA 4ANVA 2NW2A 2XC8A 3EBAA 5CEZL 3BSGA 3VU1A 1WS8A 3MACL 2WP3T 4UQDA 5E94A 4IHOB 4PY8J 5FKPB 4GRLD 4KZDL 4PJFE 4BD4A 3LN5A 4OV5B 3RVWD 2GUOB 5CGTA 2P47B 1HI6A 1WE5A 2VAAA 3BZFB 4HKZB 4B96A 3ECWA 4WV1C 4UTBH 5BS0D 5EEWA 2WQRA 2F54D 1WHOA 2VSKB 1R3KB 2XA3A 1WG3A 4QRRA 2CO6B 1AGBA 4JZJA 2C3XA 1DO5A 4AIXA 5A1AA 5F7AA 1JAEA 1OAKH 4ZAKD 1N5AA 4L5FH 3SDCB 4XP4L 2H1PH 1BVZA 5F71A 2OCJA 3ARGA 3I3BA 4XRCB 3FQ1A 4OKDA 3L4UA 4NUGH 3A6BH 5C0DB 3O4OC 2GJJA 4LAQL 1INQA 4EZMA 1BOGA 4LVEA 4ODXB 1JF1B 1I1AA 5FW8A 1ID5I 4NHCH 2AEIT 4CDHA 1NBYA 4EZJA 2VXTH 2K8MA 4ESKA 1PZAA 5T3XH 4NSKA 3TFBA 4X6CA 2FBOJ 1Q94B 3MRGB 4FNLL 3OAUH 1RURL 3CHXA 4ZOEA 5TE7H 2VUYA 2V5YA 2YPLB 4XB8A 2QLVB 4RFNC 43C9B 2DD8H 5T5FA 4X4XB 3APDA 1S7XB 1I9EA 5JHAA 5BW7C 3TLRA 3OKDB 1NCAL 3MJGX 3ZE2B 5FYLH 2CKBB 4ZXBD 4KZEL 3MBXH 2AMUA 4M5YL 3H9ZA 2GEEA 4OJEH 1CDUA 2H6OA 3ATEA 1K6QL 4ZMAT 3G08A 4M5ZH 3UL4A 5BPPA 5KYWB 4MASA 1KBWA 5K9KA 5MHSD 2K7QA 2JELH 2RQ8A 4PB9L 1OTSD 2NRDA 3EOYG 2UXVA 3JYCA 3LZPA 3N5AA 3ULVL 4KO5A 4N8VG 3MRBB 1J87A 3ZTCC 3DDFA 1FG2A 3K0WA 4YDVB 1AHKA 1X4YA 3B5HA 2OMXB 2D7QA 3CHPA 25C8L 2QSCL 1KLFA 4TQ8A 4OCXL 1JFQL 3R4RA 1PZBA 2O5ZL 1KC5H 1DQDH 4OZGF 5CWSB 4WU7B 2DDQH 3OKEB 2E75C 4DZ8B 1XSIA 4YGVA 2DLGA 4G1MA 4YEFA 2I9LA 3DVGB 4NKDA 2VABB 5F1SA 2V6HA 4HK0A 4LHUB 3VI3A 1SLVA 1DSYA 3CVHA 3N9GH 3BQUD 1HAUA 5MP6L 1WITA 4NAJA 2XNAB 1WFNA 1FVDA 2VKXA 1IGIL 5MI0C 2YO3A 2VDML 2JKRM 3DV4A 4PEEA 2UWEB 4EI5B 2PETA 3BDBA 2A3TA 2JF1A 4PY8I 4OCSH 5SWZA 2AHIA 3NGBC 2BDNH 1THAA 2XOTA 1D7DA 1K2DA 2V9QA 1MW3A 3AWEA 4XAWL 4AM0A 3P3SA 4A7TA 1YNTA 1ZT4A 4KKCC 4IKNA 2CDFB 5KUMA 4AVIA 1BWWA 5FYKD 2KDGA 5L9DL 2P52A 3HR5B 4HH9A 1UM4H 1XR8B 4OGYH 1E5CA 1A6AB 2BOLA 4K8RH 5IFAL 3DURB 4TUKL 2O6DA 2BC4B 3CBRA 2XTSA 3SYCA 4AENB 1Z1WA 3FO0L 2FH8A 3NBNA 1ZD6A 4NNYB 1NEPA 5IQNA 1AKJB 3BC9A 4Y88A 4PJCA 3A4AA 3RNKA 1LE5A 1AZCA 2GHZA 2NXZD 1QHQA 5LNEA 3R18A 2UYLA 5DFAA 2X4NB 2J71A 2F58L 5MEQB 3QEUB 2I9TA 1N5YL 3VU2A 4N2MA 4DP8X 1JIBA 2KBGA 3KYNA 2B5IC 2CRZA 1S7VA 1AP2A 4IOIB 2JCCA 2W9DH 2JB5L 5DFVD 1XQ4A 3A6OA 4EE2A 3EOAA 3W81A 3AREB 1U8LB 1GYCA 3RL2B 1KXTB 1UEMA 5HYSA 2O5XH 4HJJH 5DHVA 4Y19A 3FO9B 3DI2B 3T1FA 3MGOA 2V2WA 1EJFA 3CDZA 3I75A 1SHSA 5GRUH 3ET9F 1ETZA 3MNZB 2PR4L 3B2UC 1L9MA 2XWDA 5DS8B 3SE3C 4L4JA 5DR5L 3DX0A 5IFHH 2XXFA 4OFVA 2VWEE 4RGMB 4UTAA 5DUBA 3FQUB 5FFGA 4C4KO 1IRAY 1UQSB 3O2VH 3TPUB 1NDGB 4UQIM 4AMKH 1ZEAL 3C9NA 2DBLH 3FUMA 1UJ3C 1C5BH 2VDQB 5TGBB 4RBPH 2XKNB 3V9EA 4GAJH 3S5YA 2V7HA 1XHHA 4BZ1L 4EPSA 3L54A 4XVUD 4YUEL 2WBJA 4U1NB 3S0PA 2QPFA 4IEFB 4XE5B 3HBZA 2VC2B 2NQ3A 3B3IB 5CZXD 4HV8A 3QQDA 3QUHA 4I18A 3VFGH 4BEIA 1SDYA 2DRUA 4BKSC 3MRMA 4FFYH 4NRXA 5AOIA 5TF0A 2R9HD 5CSBA 7FABL 4I3RL 4XCFH 2R4RH 3RWDB 2ZUWA 3RX7A 1IAOB 4FXGC 1NGWA 4Z1PA 2BH0A 4KQ4L 1GOFA 3MPCA 3TJEL 2B7DT 1WTLA 2CAKA 2WUCH 5I71C 3QH3A 3L16A 3AG2B 4NBXB 4ONHA 2PTTB 4O58H 1LP9E 2OQJB 3WUWB 1MUJA 3VFNB 3CQFA 5AG9A 3HC3H 2J20A 2UZXB 2ZP0T 4X5XB 4LLAA 3PABB 4F91B 1R5IA 1NC4A 1AXIB 1GOHA 1P69B 1Q9OA 2NY6C 3QNXA 1F4XH 4ZO9A 1T22B 3IDIA 3CX2A 2AK4A 1DVXA 2OCCB 2XWTA 5CFHA 1BDYA 1NCBL 2EDDA 2DQMA 3BUYA 3BKML 2N4IA 4OJAA 2UXGA 3BZEA 2B59B 1T2JA 4B0MB 1F4WL 2D03H 2DQFB 4G7YH 2YBRA 1QFWM 1VB9A 3DDGA 1WAAA 3F6LA 2QQKH 3MA7A 1CL7H 2A38A 3QUYA 2IQAB 1JF6A 1YEKL 2Y9RT 5JNYA 3CSFA 1OGTB 1A4CA 3PWUA 5T1KD 3U4EA 4WNJA 4AEIH 3NZ8A 3X1BA 1T0OA 3GS4A 1FH5H 5ISZE 1NLDL 4X7SH 4N8UA 4XNXL 2WN3A 2OLDA 3VB9A 4ORZC 2OMTA 3FC8A 4PJ9A 4RSVA 4ZS7L 1Z5LA 4OZFA 4WNQA 5CP7A 3VD7A 1N4XH 1FHNA 1GGCH 4CKVX 4MX7B 2IFFL 4KKZA 5HPMA 1UVQB 4U1LB 3ARBD 2JKLA 1QNZL 4N0FB 3KLSA 1ET7A 2XHNA 3ZDXF 3B9KC 4R5VA 3WE1A 5JHDA 5AVSB 4MAUH 5MENE 2D7OA 2WLIB 4OI9A 4PJEF 3II2A 1J1OH 1ZHBB 5CJQH 3H7LA 4FYQA 4RGOH 1BQRA 5E4EC 3TN0B 3A6CL 4XMPL 2ZNWA 2C4FT 1TTCA 2D7TH 4JKMA 4EZKA 2E7MA 1IQWH 3PREA 4NM4L 4KPHH 1D5MB 3W39A 3QRGL 2FGZA 1QW8A 4Y4KA 2JTYA 1CMOA 3O6KL 3VFVB 1Q0XH 3GNML 1HH6A 2QLYA 3ZDYE 4FQXB 1GJWA 2GJPA 2FD6H 4NO5A 2MOQA 1IGCH 2A9NH 4U05A 4ZYKB 1F1AA 2AI0H 2A9MH 3C60C 3LKNB 2VDOB 5E8DL 3TO4B 1JPFA 1ZS8A 5F6HI 3IF1A 1BF5A 3E9TA 5EO9A 5AUMA 1LP9B 4TVSa 3OZKA 4J4PA 4HUWB 4OU3A 4WJG3 1TJGH 5LXVA 1HQ4B 1CYWA 4RMSA 3QDMD 2CNZA 4I3SL 3C5ZB 1AS7A 3PWJB 3GXDA 1NMAH 3BPLB 4OKVB 3ZN6A 5F3BA 2CGYA 3QI9D 1WYJA 4M48H 1Q72H 1A7OH 1ADQH 3BP7B 3I50H 5ES4B 2APTA 4WEUD 1RVFH 4M8QA 1CT8A 2X4RB 3NESA 4XO3A 3ULVE 3I2CL 4PLJD 5ENWB 4KXAA 5CILL 3GM8A 4YR6B 2YWYA 5DJXA 3AY2A 4B6ZA 3SYPA 4MS6A 2EJ1A 2R2BA 3BKCL 3H6AA 3VO0A 3L4VA 4IRZA 5D8JL 3KGRA 3GJEA 3LKRB 5F7BA 2ZUQC 5C0RH 4LNRB 4F24A 3NOIA 1CZ8L 1E2WA 2N1TE 3QUZB 3WLBB 1MI5A 1RZGA 3EJRA 2CBOA 3KPNA 3BYTA 1C1EL 2LTQC 1AY1L 2CGRL 1HDMB 1QSED 2YIHA 2XWXA 3K2UL 5EU6D 2NW3A 3RZCC 5E99H 3RUGE 1G87A 5DK2A 1AQKL 1T83A 3BVNB 2P8MB 1G7JB 4JPKH 3UZVB 2OXHB 1F0LA 2UUDK 3L3DB 1D5XB 2W91A 2HH0H 5D72L 5I6XC 3WS6C 4LIQH 5I8OH 5MENB 1CXFA 2BHYA 1DBAH 4GI8A 2J8OA 4F8TA 1E7UA 4PJAF 4QRPE 4JZOB 1R5WA 1T6BX 1U3YA 2ZP9A 1Q0YL 1H8OA 4FE9A 4J3TA 1CDYA 5ICUA 4S2SB 4C4UA 1Z66A 3H9HB 1IFGA 2NSQA 4G11A 5CIPH 1TDQA 1NJ9A 1UASA 4NS0A 2RAMA 2JIXD 1HILB 1KJ3L 4Q89A 2FX8H 4ZFOA 3LNFA 3VXSD 3Q8BA 4AKPA 4DK3A 1CD1A 1HX0A 3ZDYB 3F12A 1ACXA 3OHXB 1F11A 4Q2ZA 5E5UB 2DMKA 2H3KA 4ONOA 5GS0C 2OMZB 2BVQA 3ARPA 5I8KL 3N43B 2BINA 3AT0A 1ACZA 4TTDC 3LNIA 3FJTA 1U3HC 5IBUB 5F0LB 1GIGL 5FLVA 1GTNA 2PXYA 3OKLB 5B39A 1IZJA 4M7LT 1O7DE 3UBGA 3D25B 4GXFA 2HFEA 3O6MH 4DAGH 1NAKH 2GK0B 2AEOA 3Q2NA 3S3SA 3ZK0A 3TZVC 2XFXA 5JXEC 4OLUH 1DBKH 1EAQA 3QJXA 3EFOB 2BFGA 4IDJL 4J12A 1HHHB 4HZAA 4CKQA 4GKZB 1MJ8L 2XN0A 2B3RA 3MLUH 1YEEL 4OQTH 2WWKT 1FZMA 1BEYH 3P54A 1P5UC 3WEOA 2RQEA 4NQEE 4DK6A 2EXTA 3QIWD 4RLDA 2E7LA 1DLHB 4XMUA 3M07A 3EHBC 2VRKA 4LCCC 2WLMA 5HHOA 1JZEA 3KPSB 2DQHH 5F0JB 2F15A 1AGCB 4UQ3B 2H1LM 3U9WA 3LNDA 3MRLB 4PGCA 2X4QB 4XMKH 3FFCD 4PMFA 3CFEA 3O4LE 4GINA 5F3FA 5ABDE 4DP5X 2HJLA 1PKOA 1OHZA 1L9TA 3RI5K 1E8XA 1IILE 1P53A 2AV7B 1ASQA 4WFHE 5AAWA 1IAMA 5DXWA 4ZDHB 1S9KC 3W5NA 4LE8A 1PZCA 2ESVD 5A2FA 3GSNB 5E8OA 3QDJE 3ETSA 3L4CA 1UZGA 3QIUB 3ZKMC 2B3IA 1CGXA 4LQ1A 2A77H 3KYMA 3ZUCA 1SYVA 4FDWA 5C9KA 1EGJL 2IQ9H 1V7NL 2HTKC 2NX5A 3PV6B 2VL5A 4KTDH 4QRPB 2X05A 3HZKA 1KCWA 1MQKL 4TNVF 5FGRA 1WC7A 3DKHA 1XMWA 4WWNA 2DI9A 4F7MA 4IKIA 1N68A 3QUXB 3A67L 3OKOB 1KPRA 1DVYA 4GW5B 4NC1C 5BO1L 1IVTA 5HYQA 3HNVH 4KQ3L 3MKGA 3DGGA 3L45A 3D69B 5CZRA 4WI7A 1X5AA 1K8DB 4IIQA 4HW6A 5EEZA 2BY1A 1NC2A 3DETC 3HS0A 4WTXA 5JQHC 2NDFA 3Q8CA 4Z7NE 2G9HA 1ADWA 4HUCA 2PNDA 3SY0A 1SPDA 4S1SL 2ODIA 3GSRA 4JO5A 3FRUB 1YEDB 3QJVB 3W37A 2QBWA 1J5HA 2N1KA 3L4WA 2AEQL 4M7KL 5DVMA 2Q8BH 3TF4A 1UXMA 3CMGA 4XN8A 2DICA 3E0GA 2HRPL 4HT1L 3T0VA 4UM9D 1E2VA 1OGPA 2Y0SA 3HS9A 1PLCA 4PRHE 2HFTA 3IFPB 2ZJSH 4BSWB 2FR4B 1UJTA 1EHKB 3UIYA 3V79C 1M3IA 5I30L 1XIWB 1U8KB 4ZS6D 4NQEB 4Y5XB 4NCDA 2QR0B 2CMRL 4HUVB 12E8L 1TQVA 2D9CA 1ZAGA 2V3DA 3K6IA 3BVUA 3UERA 4J6RL 4A2MA 3LXUX 4JFFD 2WQWA 5FO7A 1XO8A 3GXIA 5LNGA 2V2XA 1E5BA 5E6YA 1GGTA 3SY6A 4X80H 4XAKE 3S4SA 4R7XA 1QA9A 3O4LB 3RVVD 5DEJA 4PJIA 1OAQL 1JNHA 2VDNB 3MV01 4OF3A 4X6DA 3U1QA 2KQMA 3MTRA 4HWBA 4DUXA 5IGXL 4DP1X 3OTTA 1XH0A 4ZUTA 4Y5VB 4LSVH 3RWJB 2NR6A 2OSLA 3QQ4B 4OCRH 3QJFA 1C5CH 4AQOA 1A7PL 2NY0C 1E90A 2B15A 3D85D 5IJBC 1DVSA 4E5XG 4OLEA 1B0WA 5IR1B 1CTOA 1TNMA 4DFIA 1X5FA 2AK1L 4QRFA 1MRCL 2WJ7A 4IRJB 5D1ZA 4WFED 2J3SA 1P7QA 1AO7E 4XE0A 5FGBA 3FSOA 1JZ5A 2Z31A 2VRAA 2YD1A 1DCLA 2JJUA 2XZAL 5JHLL 4YMPA 3FMGH 4N2DA 4JRYA 3GTNA 5HJ3B 4F37K 2UZIL 5D1QE 1NBCA 1JNJA 3STLA 1ZVYA 4R4BA 4KK6D 4YPGA 1JYXA 3FTYA 4FL4C 4MMZC 1RK0A 3T1WA 3FT3B 1NIBA 1SY6L 2XA8H 4E41E 4I3GA 4L4VD 3DO7B 1SFHA 2ATPB 1KACB 1CU4L 3OVUB 1KG0B 3ELAT 1OAZL 4Z7NB 1UT1A 4Y2DB 1VADA 2YUXA 4IOFC 2Z7YA 3OGCB 4KJQD 2UZYB 2LVCA 3RHWK 2OMBA 3RJDA 3TWYA 3FB6A 1BV8A 2L8AA 2ZICA 3F00A 2J56A 2ZKHL 3VGEA 4ZX3A 1UT2A 1ZA6A 5HGHA 3VXUA 3IU4L 2GAZB 4HUUA 4N0YL 1JYWA 4WO4B 4M1CD 2FQEA 3ASWA 1BGXH 4PRHB 4ONFL 2P8PB 4E9VA 4IKJA 2Z1PA 4XXWC 2B2XL 3CFNA 4F15C 1I3VA 4FJ6A 3C6SA 3JV5A 3T0WA 3N41F 1A1NB 4W6WB 1UWYA 5IM7B 1B2YA 2WAHA 3LNGA 2J6EL 1U2YA 2NY4B 2N59A 4AYID 3BPNC 4ZW6A 3D87B 1S7UA 3RWIB 2VMJA 1A14L 2LFGA 3ROOB 1RIHH 2JFCA 3SYOA 2I27N 2ARJB 1USZA 2P8LA 3RA7L 4OFIA 1K72A 3ZDWA 5DJZA 2VQ1B 5ADPL 5C71A 3DVNA 1NOLA 3PWLB 4U1SA 3S5LG 3QYCA 1PVHA 1KY7A 1LHZA 3L08A 2BIIA 2HKHL 4MQXC 3UTZB 3C5XA 3ULUC 4POYA 1VENA 4EQ2A 3RX9A 3UYRL 5ITFB 1CD8A 4E0RA 1G7LB 1NFDF 9CGTA 3V52H 1PZ2A 3QFJA 1KWGA 2OJZL 1EANA 5FYKL 3II1A 3TFKD 1WEJL 2WGNB 5KBNC 3IJ9A 1CLYL 1L9RA 5DD6A 4UQ9A 4X0KA 4XPGH 1Q9LB 3OJDA 3Q6FB 4BZ1A 1CIUA 1AO7B 1OF2A 2X9YA 3ECBA 4XBPA 3BIKB 5GHWL 4MMXC 4MNHA 4M6ML 1MHEB 4YDIH 3FONA 4I1PA 4PGEA 2ENSA 2ZCLH 3WHE0 1S7SB 8PAZA 1AIZA 4ZUWB 1GRWA 1FZJB 4RRPM 1UB5A 3EFFA 4M00A 5INCB 3RVXC 3O41B 4AKOA 2ZXWB 1N6QL 1FNFA 2QVIA 3CFQA 3L7FB 3NACH 5LBVA 1NGQL 2ADFL 1IGYA 1KDJA 1MF2L 4X9IA 4BZ2A 4EI6B 4E68A 2GITA 4Y16C 4E41B 2QPEB 43CAB 4ODUA 2QQLH 4LLQB 3EKCA 4OGZA 2IALA 1R17A 2DN7A 4MD4B 3MXWL 4BE6A 1IBBA 4NGHH 4FG0A 3GIZL 3GTVA 1JPSL 1E5AA 2XPGA 2I07B 1UWXK 5I1EH 3ATBA 3VXNB 4PJHF 1WCBB 1IC5L 1DVFD 3NCMA 3IKCB 4R90H 1UXSB 4WEBH 4ACTA 5LBSL 1WS7A 5LAXB 4QLWA 1GPOL 5BV7L 1NSNL 3CAFA 1CFNA 1F6AB 1UC6A 4GBXB 1CBJA 4MXQD 3MLSH 4RMUA 3HLAA 2DYRB 5D7JA 2Q8AH 1U42A 1XR9B 4Q58C 2AXJA 2IDFA 1TJIH 2FO4B 1I7RA 4DVBA 1FBIL 3LIZA 1JPTH 3GXMA 4V11A 4JO2L 4TVPH 2VSMB 2CCVA 3O3BA 2OZNA 1OAXL 3PPSA 5HVHC 5IOPA 2AV1A 4ZUSA 1PDKA 1U58B 3E80A 4MJ2A 3VWJD 5KVGL 5DVKA 4G70B 5H35B 1MIML 4GW1A 4QDGA 5FO9B 1ECYA 1FL5A 2W0PA 1FAIH 1YCSA 2V33A 2L4OA 3FQYA 5K33A 4HULB 2B8OT 4I5BB 2WXRA 1AZUA 4C83B 3BJLA 4UQ2B 2W5PA 4NWUL 5C07E 4IJ3C 4Y0GA 3T8XA 4NWTL 2DM3A 4HXAH 2YZ1A 4D9RE 5C0EB 3B2VL 2R0WH 3HE6A 3QDGA 1A6ZB 1JHLL 2ZYIA 3PLYA 4JM2C 5F2FA 5AVRB 3LVEA 3B9DA 1G0YR 4M4RA 5AEAA 4XBMA 1EEQA 4F9LA 3QXTA 1KLGA 2X88A 3SO3C 3SKNB 4N1EA 1YO4A 3CDGA 3B9EA 5ESVA 4M02A 5F70A 3GSQA 4Z23A 5IBTL 3UTPE 5F1NB 5C0CE 3LCYA 4ZPTA 3FOLB 1YN6A 4ZFGL 3OF6A 2JLLA 4JPVH 3KXFD 2C1PA 4MWFB 3RWGA 5H4ZA 2VR6A 3AT9A 2L7EA 5BRZE 3K6FA 3INUL 3O9WC 1CXIA 3DSNB 4PW9A 1CLOH 2C9AA 4Y2OA 5JPNC 4HJTA 1QBLH 1FFQA 1SUHA 2LOEA 3U2IA 2ZSVB 4JRFA 1A66A 1MCSA 3I84A 4NERA 1RI8A 2J8HA 3RFRA 2OULB 1VGEL 5EEXA 1CFMA 1MFUA 2GJ6B 1SBSL 2WY3B 4JHAH 4TRPL 3WO4C 5GGSA 1U33A 2NY2C 3MDJA 4G7SB 4LOEA 1M9WA 3EH4B 1WK0A 5CO1A 2YAHA 5C1MB 1JZHA 1RD6A 2AKRA 4M8RA 3BLBA 1ZY9A 3T0BA 1H5BC 5LQBH 3HJEA 4YFLI 5L8LB 4OFYA 5IOKA 3HC2A 4G7RB 3ZW3A 1OWRM 1DJHA 4PJFF 3W9DA 5JTWA 4ERSH 3T65A 4CUCA 4FA8A 1FJ1A 1QBMH 1X9UA 1T89C 3CPUA 3OKYA 4NO3B 1OOAA 5E7BA 3H9SD 4AGMA 1SMOA 2R1YB 3FHEA 3LXAA 2Y07H 3II3A 3OSKA 3CFTA 4OZHE 1B4RA 1PY0A 4X6FB 4QGYA 2IH3A 3RTQB 3NFPB 2K9UA 3K2IA 5HDQH 5EO1B 2P42B 4IBVA 5TE6H 2XWRA 1RL1A 5B8CA 1R3HA 5CCKH 2GJZB 3UIZA 4YSRA 5C07B 1OAKL 4L5FL 4LRIA 3RGVC 2H1PL 1G7IA 4KFMA 3UBXG 5ANMA 4HCIA 3T0XA 1GXEA 5JOFB 3T9WA 3RWCB 1MCHA 3A6BL 4D8PB 3H0TA 2N7AA 4YHPB 4TQEH 1XGTB 1Y6NR 1BECA 1CFSB 2YK1H 4FCAA 3S97C 4NHCL 2F8OA 3T3ME 4F57H 1X5HA 1XZ0B 2BZ7A 4NPYA 4UDTA 5ESAA 5T3XL 4NQDA 4BHUI 5C0CB 3O0RH 3VWKD 2CO7A 3OAUL 1SJHA 4K3GA 1YN7A 5TE7L 3P4NA 1F8TH 1DBJH 2H9GB 5TE4H 2CK0H 5ITBH 2DD8L 3DUHA 1NZRA 3ZL1A 3FYEB 3GZPA 5BRZB 1RLWA 1UWEH 3ILPB 1W8NA 5H37A 2VLRA 2BHZA 4ZRGA 5FYLL 3BAYA 2VOTA 3MBXL 4MAYD 2X4OB 3DMMC 2GBAA 3FSZA 2JKJA 2EACA 4TOYH 2EIKB 3D0LA 3E1ZA 1MAJA 3LEVH 4KJYB 5DEFA 3SGJA 2W38A 3IMWA 4IBQA 4CW1A 4M5ZL 1K4DB 1R24A 3WS3B 5IK3A 2JELL 2XIDA 3EGDA 1H3TA 3ERXA 4RFOL 4HVBA 3VD0A 1Q9WB 4ELDA 2LV4A 1DVTA 3ZTJG 5CBAA 4K7FA 5AZEH 3VG0H 1JPEA 5DI8B 4EI0A 4HLEA 1KC5L 1DQDL 2C9XA 2Q7AA 4JGUA 4OLXH 1TQBB 5DZ9A 2DDQL 4YDMA 3EXJA 2C9PA 2ITCA 1YNKH 4FQIH 4YBQD 4OZHB 4N2CA 3ARTA 1K5NB 4ETYA 1PZUB 2ZOTA 3ZTJH 1DBBH 2VN7A 1O0VA 2HXAA 4D9QE 4X7FC 3QB7C 4LLYA 2BNRE 3LKOA 4F3FB 4R7DB 4R4FH 5IF0B 1I1YB 3HHSA 5GIRB 5D7KE 5DQJA 1M6OB 4M6OL 4LPTA 3JV6A 4UAOC 2R7EB 1HHGA 3O3DA 3WAKA 5D6DC 4QOKE 3L2NA 2YR3A 4I77H 3R06A 4ISVA 1G7PB 1ZDSA 1IARB 1UM4L 4AI7A 2DQJH 1D5IH 2WXGA 3CH8A 3QHFH 2H1XA 3SDDB 3IXAB 3WFZA 4BQBA 2PW2B 3QCTH 5KYUA 1IE5A 1BF2A 2E6QA 4XO5A 4R7NB 3T3MB 2GKIA 3N6YA 1L9NA 3MV7D 4N2KA 3G5VA 4JKWA 4PRIA 1U3NA 5IG7A 4J3OD 1TMQA 2BS9A 4EDXA 2NY1C 2BP3A 2ZUTA 1U8MB 2YEZB 3W1ZA 5CCGE 4WGKA 5D7EA 4FEMA 2YSSB 5DUJA 5IHZB 3RPBA 2E9WA 1IM9B 3OAWA 3OJ2C 2XBTA 1NANI 1QI5A 1KB5B 3GLAA 2YUVA 1XXFC 4QRRE 3UJJL 2GI7A 1AVAA 2EYRB 2H32A 4JQXC 1H9DA 2G30A 3DRQB 1NEUA 3JTTB 3GSOA 3QAZB 4AE0A 5AAMA 3UAJA 2BSSA 5DVNA 2HFFA 5F7UA 3MUGA 3TA4D 4MJ5B 5KG9A 4B60A 5IW1B 1E4XH 2MQ0A 1AR1D 1BYPA 2O5XL 1J5DA 1V05A 4ICXA 4AC4A 5GRUL 3VXQB 3H3PH 3BSZA 5L2JA 3V4PL 5C2BH 3VJ6B 4XNUL 4X6CE 1QSFD 3K5RA 4HS3A 3RU8H 5IFHL 3GLZA 4DTGH 2VMCA 4GXVH 3KBFA 4XBGA 2XU9A 4OFPA 2CXGA 1NCNA 2P9RA 2Z4QB 3FAWA 1CS6A 1I3GH 3ZT5A 3O2VL 4P46C 4AMKL 1OTUD 2OJ1A 4CC0A 4GRLA 2DBLL 2KYIA 1F3JA 1C5BL 3DIDA 3N04A 4Z7WE 1XTMA 3TS8A 3FULA 2B14A 2MQ3A 3L2MA 4GAJL 1JHTB 3CZSA 3F8UB 2XQBH 1NCJA 2BNQB 2WIIA 2XV6B 4BH7A 5BS0A 1M4KA 4KXBA 2F54A 4OLWH 2BNRB 1NGYB 1IGFL 1Z9SA 1ZHKA 4PG2C 3SDCC 3L8QA 4HG4J 5GISL 3BO8B 3VFGL 4PVBA 5C6WH 5JQIB 4JFZH 4ZSOE 4G80B 4R26H 1BZ7A 2PMZA 4ZAKA 1JTOA 4UMGA 2A6JA 2R4RL 4PU2A 3MV9E 4HEPG 3P9LB 4XCFL 2OYLA 5IT2H 3H55A 4Y9EA 1QR1B 1TU2B 2JB6A 4YHOH 4OY9A 2ZYRA 3QULB 2J1KA 2WUCL 2BW4A 4Y4HD 1SLXA 1KBPA 2BJMH 2PO6B 4LFHG 3HN3A 3QXVA 3SKMA 5CD3A 1EFQA 3MMEA 3O81A 4NQVA 3F85A 1QO3A 1W72H 2WLNA 3LN5B 4P9HH 1TQWA 1HFUA 3SE6A 1EMTL 3HC3L 1FNLA 5GGRA 4K3HA 4N8CH 1YQVH 1R9FA 5I17A 3HUJF 2VAAB 1UM6H 5AVYB 4MDRA 3L1FA 3U1SH 2RCSL 3BZ4A 3FKUS 3D07A 1KZQA 1E40A 2IAMD 3ESNA 1ZOXA 3QXDA 4QRRB 5EPMB 1AGBB 3HVDA 3F7YA 4JZJB 5K39A 5IQOA 3QIBB 3EAKA 4LEBA 5SWZE 1FNSL 3FCTB 2G60H 3RVUC 1DUZA 2CO2A 4YBHA 5ILTH 2MFNA 1N5AB 1WO2A 2D03L 1G5AA 4ZXBA 3Q9PA 2QQKL 1CL7L 5CGYD 1DSFH 4GH7B 3ARGB 4ZMPA 3VVWA 2H2PD 4F20A 4GRWE 1GC1H 2HLEB 4PS4H 4AEIL 3GZQA 1INQB 2J5LB 1FH5L 3UGEA 5LKNA 3UDWA 2BY3A 4X7SL 4UUJB 1E6OL 4I48B 3EJCA 4A39A 4X6CB 5KSVB 1N4XL 4JFHE 2RFXB 1GGCL 2XDHA 3QJHA 4I1NB 3PDOA 3ZJAA 4PJCE 4XN4A 4NO0D 3PL6D 3QDHA 4AQEA 4LVOC 1ASPA 1ES0A 2K0RA 4YFLF 4MAUL 5I75B 3L3JB 3S3JA 4AT6A 2X9XA 1UYWH 1QLFA 4WF7A 4Q0XL 4RGOL 2DWEA 4Z7WB 4L1LA 3D08A 3K81A 2JCCE 1OWWA 3LQMA 3IB4A 3BQUA 2OR7A 3CSPA 1IQWL 7TAAA 4KPHL 1I8UA 1HXKA 3G08B 3J07A 3MRNA 1EAPA 4N6QA 2IDSA 3ZDYF 3V4VA 1MW0A 1RZJC 5K9KB 1Q0XL 3I6LD 4B0MM 3C6EA 1V7MH 4ZSOB 2IJ0C 2IDQA 4HGMA 4NQQA 5BZDB 2F8XC 1NFIA 2C7FA 3HG5A 4N0CC 1FG2B 1TMCB 2A9NL 1IBDA 3CNKA 2SEBA 5IIEA 5DRXA 2BSED 1KLFB 4A2FA 3HPLA 3CVIH 1U8JA 5AW3B 4NQCD 1OT4A 4P23D 5FYLE 5IQ9A 2A6DA 3X3FH 1EWHA 3X13A 1TJGL 2AEPH 4YGVB 4G1MB 2I9LB 2ZT9C 5F7DB 1QFWH 2ICCA 3SDAD 4PP1C 3VI3B 4TL5A 2EVJA 1ZTXH 4F7CA 1NMAL 1CYXA 2FE0A 3APMA 3TA3D 5CFAA 1NM9A 1SXCA 4M48L 1Q72L 2VXUH 2Y7QB 1FVDB 1Q8MA 1E4WH 3ULVF 1A7OL 1ADQL 2ZX6A 3I50L 2VB5A 3DV4B 1RVFL 2VDKB 5SWZB 1U92B 1MXDA 3R1GH 1K2DB 1V3LA 5H2BA 4KWUA 4AM0B 1COBA 1ZT4B 4OGAC 5GS0H 2FWSA 1SYSA 2APBA 1O7SA 4GRWB 3CTTA 5BCAA 4Z7VA 2RA1A 35C8H 5IHUH 5C0RL 4JKLA 4X7TB 3GMLA 3RUGF 3IAPA 1AH1A 4KUCD 1IEAA 1D9KB 5E99L 4RGMC 1L7IH 3PHSA 1XGUA 1OB0A 1L6XA 3I9GH 4PD4J 4PJCB 3RNKB 4JPKL 3T77A 4TV3A 3JWOC 2HH0L 5HI3C 4LIQL 1CXLA 5EU4A 2AQ1A 1DBAL 1WFTA 5DA0B 2F0CA 1NPUA 2OL3H 1RZKH 3AW5A 3NH7L 2O26U 1S7VB 4GW4A 3BRFA 4AEEA 1AP2B 2JCCB 3GYRA 4XP6H 5F21B 1WAAE 3EOAB 4BQCA 5D1XC 4N90D 3C8HA 4IRSD 4UBDC 1EA9C 5ICXA 5DHVB 4KXZH 2FX8L 4YC2C 5FAAA 5B1AB 3T1FB 2V2WB 2BRQA 2YBGA 2CDGB 3CDZB 3I75B 3TASA 5TF1H 3VACA 3K4DA 5DMJB 1MFCH 3D5OF 2C3HA 2MH4A 2NT0A 3LQZA 1XSOA 3I9PA 3JZ7A 4XC1H 2BY2A 5DD1L 1S7WB 1MJ7H 5M95B 3K4AA 3HE7C 5E2WH 1KMGA 5FV2A 5DUBB 4DT2A 4ZO7A 2OCFD 3TL5A 4O2EA 2CR0A 2VXQA 3H4HA 5JHDE 4F5CE 3ESMA 1J1XH 4DAGL 3C9NB 4J8RA 4OF0A 2RBLA 3MV8D 4OLUL 4ZMNA 1DBKL 1OB1B 2XQ0A 3NVQA 5HVWA 1NEZG 3VAEA 1BBJA 1KF9B 2ZG3A 3MLUL 2WBJB 4OQTL 1BEYL 1HL9A 3MFFA 4GP8B 1NGXA 1AGFB 5HI5C 4L3CA 2AABH 3TIDA 4KK8D 3CZJA 2ED8A 2AZUA 3QQDB 4HV8B 1KJ2L 4CJ0A 1SHXA 2DQHL 3NCXA 1A65A 1L9PA 3V0FA 1J0ZA 4GSRA 4N9OB 1NPNA 4XMKL 4LEXL 1MCDA 1NGWB 2XG4A 4GAGH 2AP2A 5T1KA 3KG5A 3QH3B 4HX1A 4LLVA 3MRRA 4ONHB 1BG9A 1HH9A 4YSPA 4G43A 3DTXA 1MUJB 3MBEB 4LOUD 4ZK8A 1FH2A 3V9FA 3ZO9A 3FN3A 2VWEC 2VGLM 4MA3A 2R69H 5GJSH 4L23A 5DO8A 1IAIM 1R5IB 1RZ8B 1NC4B 2BOBA 1Q9OB 3MRHA 4HLZG 3EBGA 2XWTB 1ORSA 3ARBA 3WO3B 2A77L 5HHME 3FXIC 4ZW8A 5D6CA 3QW9A 3UTSD 2IQ9L 4DN3H 3Q1SH 3BUYB 3EYFA 4FQ1L 3GXTA 5E1AB 3BZEB 1UXWA 4PRNA 2VZ3A 4X42A 2V8MA 2ZXDA 3FDWA 2XBZA 1NCCH 4MBOA 1CGUA 3PGDA 5KS9E 5JNYB 3HG0A 1E4JA 3OKNA 4P5MA 3PWUB 4JFDD 4U49A 5DSCA 2WINA 3E2HB 3NZ8B 2Y7LA 4I9WE 3ZHNA 4DERA 5GZOD 5KZCB 2EUWA 4NQXA 4BUGA 4AZUA 4EKJA 3OB0H 2OMTB 1MI5E 5E23A 4HLZH 2WNWA 4MNGA 1Z5LB 3B2MA 4WNQB 1T4WA 3WNKA 4IS6B 2A7BA 1CLVA 3TO4C 2PYED 3D52A 1A21A 1UGNA 5KW9H 4XMZA 5HPMB 3GJFH 1RJLA 2EE9A 3FH7A 1HS6A 3MOAL 2Q8BL 4QXVA 5JHDB 1BXVA 4HOMA 2FHCA 1J8HE 5FR3A 4RMRA 4U1HA 2G75B 3C5ZC 1NBVH 2Z7UA 1S78C 1P9MA 2Z0BA 2BFVL 4UU9A 3BPLC 5MERA 2ARWA 5EUKA 1NAMH 4JKPH 4LP4A 3WTXA 3UCRA 3SB3A 3O45A 4K94C 5AALA 3RWEA 3QI9A 3W39B 3FU7A 1Z9MA 2AANA 4Y4KB 2OMVA 3T4AA 3H3BC 2Y4SA 3ME0B 4QKXB 1HH6B 3LB6D 4UB0H 3RY4A 2J1XA 3EJYD 4GKNB 1DJSA 3AMLA 4M56A 3BLKA 4BCXA 1I7TA 1YMHB 4CU6A 3HB3C 4X80L 4PV8A 3GO1H 3IMBA 5A2KH 4YHIA 3EJZD 1JPFB 3QUZC 4P2QD 1SHWA 5KAQG 4YXKH 4ZTOL 3IF1B 2BIQA 5EO9B 3MJ8B 2E0PA 3WTYA 4LSVL 4ZUUA 4HZ1A 1RJYB 4ZFZA 2YD7A 5DTFA 4TTGA 1XBRA 1LM8V 2X3BA 4OCRL 3KCPB 1QSEA 4W9GC 5EU6A 4RX4D 3SYQA 3L3OA 3LS4H 2C5DC 3EJJX 3HS8A 2V2TA 5GRYA 1OGAD 3QEQD 4LPVA 4JFVA 5HHMB 2RIKA 4HWEH 2Q6WA 5BVJA 1CT8B 4MTMA 3HW7A 1B3JA 3TH4T 1BD2D 3HG1D 4POZC 4KDTA 2WM0A 4XGZA 1EBPA 5C0IA 5DJXB 2EEFA 4FQ2H 3FMGL 4OTXH 3GT6A 2R2BB 1QEWA 3KEHA 4KRNA 2OXGA 4BQ8A 4OD2A 4ZNEE 3EYSH 4HJEA 1EJOH 3GJEB 3ULUH 1AS8A 1F42A 3N55A 1B9KA 1U8PB 2VW7A 4J2XA 1MFVA 3QZBA 1O5PA 2IDUA 2JIXA 2L7JA 2XA8L 5L0QB 3OHXC 1G9MC 4FFVD 1MI5B 3VXSA 3NCJH 3X1EA 4AITA 1JDAA 4K7PY 1DE4A 1I9RH 3MLZH 4EN3D 4F7EB 2HLFC 3BWAA 4XVSH 2NW3B 5IESH 5E2VH 1E9QA 5IQ7H 1BVNP 1BF8A 1S3KH 2DJUA 4P3DA 4Y9GA 3GSWA 2QVTA 4XWOC 4OFDA 3KZ8A 3EBIA 5H8DA 1QSZA 2IWEA 3ELQA 1J8HB 4MHHI 4WDIA 2E59A 1R5WB 3R0NA 3NEEA 4WO0A 4L1TA 1A6WL 1UFGA 2ICWB 4PJGF 3G6DH 4PRBA 4PW4A 5T3ZH 3S35H 3IGKA 1NJ9B 1RUML 4G8IA 1O6TA 3QIWA 4ZFOB 2AJYH 5B4MC 1KTRL 1G6RA 1CD1B 1RIHL 4FMKA 4PM1A 2IOOA 2PTUA 1F11B 5IHHA 1BVNT 4KJPC 1KWKA 1XCTA 4XTRC 5FM5O 4WZ9A 4DEPB 5JXED 4AYMC 2Y7OA 3FFCA 4LIQE 3ABZA 3ZQWA 5IVZA 2MNJB 2PXYB 4AYGA 5J56B 4RZKA 3SCMB 4PRDA 2BZDA 4WTZG 1MEXH 3ARSA 3GSVA 3OJMB 4XX1G 2HFEB 2FL5A 2GJRA 1VZGA 2XFXB 1XSJA 4AYSA 5CJOL 2K7PA 1SEBA 4YK4B 4CU7A 3V52L 1OE3A 2V9RA 3QIUC 4JY5H 1TLMA 2YLKA 4M1GH 5AKVA 1N0XH 3GB7B 5KVEH 1YEHL 2ESVA 2OTWB 3CHOA 3Q8AA 2PPAA 3P0GB 2BXYA 3JT0A 4HIIA 1MCLA 2F5BH 4XPGL 5DLMH 5DJ6B 4PLOB 5I5IA 1IUZA 1ZA3A 2YWZA 4A6YH 3CZKA 3OC8A 3HI1A 4YDIL 3O8XD 1MZYA 3K2MC 4LSTL 1U2CA 4FG4A 4W9ZA 5D4QA 1MHCB 5HHOB 5AW0B 3BGFB 4FA6A 4ODVH 2AXGB 3JUYA 1G6VK 4YL4A 4PGCB 1P4BL 3HMXA 3CFEB 3SGKC 2JE8A 3FT0A 3QO0A 1FO0A 1JGLH 2HJLB 2DQUH 5DD3H 5DLLA 2AJVH 1JVOA 1WF5A 2QQLL 4X6DE 5CHNA 1G1YA 4R2GD 4CA4A 1KJVA 5EOCH 4NGHL 4Z9KB 1QFOA 4Z95L 3FTVA 2B20A 1CFBA 5I1EL 4QO1B 3SJVD 3LNHA 3MJ7B 5E8OB 3MBWA 4BFBD 4WEBL 1JXFA 3KYMB 4KTEH 1SYVB 4CU8A 4UT6A 4HKBA 1WUZA 1CBVH 1BVKA 4JW3A 3MLSL 2VL5B 4EQ3A 5I1LB 1D7BA 2O6CA 2DQDH 3JWDC 2WLHA 4UM9A 1WC7B 1TJIL 2VZOA 1DZ0A 1XIWC 5K69A 3QUMH 1EBAA 1KB9K 3B43A 5GRVL 1JPTL 4MDIA 4JRYE 4QHNA 4Y5XC 4F7MB 1M53A 1KCBA 4H26A 4YXHH 1KPRB 4TVPL 2QEJA 3TCLA 5HYQB 3ML8A 5DJAB 4M03A 1TTGA 1NBZB 3DGGB 1TEGA 4HMDA 1BLNA 1FAIL 2H2SD 2VDLH 4JFFA 5C08D 3FU3A 1LE9A 3HS0B 4OJDH 2C8NA 2D31A 4ZOBA 2JJTA 3QEGH 4CGUB 3ZYJA 3DBXA 4TLKA 3SY0B 4AUYA 4DVRH 3KMDA 3QO1A 1QOKA 1IMHC 3APNA 2DQCH 2FK9A 3F5WA 1A4JA 2Z6FA 2BVOB 5E8PA 4Y89A 3VTMA 1VFAA 1SQMA 2R0WL 3T6WA 1SLWA 1UKQA 4QRBA 3MX0A 1MQ8A 4U6VH 3K3QA 1K3ZA 5I6LA 4OGXH 4HSCX 4FNQA 1M2OA 3A47A 5F6IB 4IRJC 3D85A 4WI8A 1G0DA 4YNYA 4RAVA 1KBVA 4NZDA 4PJ7F 1AIFA 3PP3H 3TBTB 4MVBC 3DBSA 3NCEB 3QARA 4JPVL 5FO7B 4QJ4B 2XN1A 1LO3H 2V2XB 2W60A 4JKKA 4X7CC 5LLIC 4DP7X 4UNTA 4QRSA 3S4SB 1QA9B 2AXWA 2BX5A 4PAZA 5JW4N 3V7AE 1CLOL 3EG9A 4PJIB 3HRZA 1HXMA 1QBLL 4G8FA 1JNHB 1H3XA 1SDDA 2CUAA 4ZQKA 4X6DB 4FQJL 4QRUA 5PCYA 1TJXA 1UZ6E 4H1LA 4KKBD 1JZ3A 2GC4C 4WTWA 3RFZA 4Y2DC 3SE8H 4JZNA 4CC1A 4CL7A 2APFA 4L4VA 2HLAA 4QXGL 2OSLB 1MWAH 4ZMZA 3QJFB 5EBMA 4IGBC 3QFJE 1N6VA 2VO8A 5EIIG 4JQIH 4GXUN 5LQBL 5EC1A 3L4XA 4H7VA 4WO4C 5D1ZB 2G3ZA 2NYYC 3E1F1 2Z31B 3QXWA 4Z3FA 2MPAH 4DGIH 3M86A 4QRTA 2VUKA 3LDBB 1BZQK 1FFPB 4GSUA 4JRYB 5E2JA 3STLB 5KOMC 1MREH 2NY4C 3N3EA 4R4BB 4YPGB 1J05A 3ZU8A 1A9EA 1RK0B 1JD9A 2GT9A 2HRHA 3BE1H 5HDQL 4QTFA 5TE6L 5ECGA 5EN2B 4X9BA 3DSFH 5AW7B 4DGUA 2Y7NA 5DWUH 1A2YA 2KS0A 3T8MA 4NKIH 3FB6B 1RLBA 3Q1EA 2VXVH 5BNXD 3HPJA 4TLSA 5DJ0A 3K8KA 5T1LD 5HGHB 1TJHH 4LCUA 4HUUB 4OJFH 3UYPA 5BRPA 4HHAA 2KZBA 4TQEL 4YSCA 5LGJA 5DZOA 3K5SA 5SX5H 4FJZA 4KDVA 2YK1L 1PQZA 1ZANH 1IKFH 2XWBA 4F57L 3V0WH 4HOXA 4I0CC 2VDPL 1UOLA 3C6SB 2K8QA 3WNMA 3TTSA 5KTEH 1NMCB 2NY3D 4N1HB 5KJRL 1QATA 3GBNH 3Q5OA 4L29A 3ZPDA 5FW6A 3DRTB 3CUPB 1F8TL 1DBJL 4NLHA 2CK0L 5ITBL 1S7UB 4NFCA 3D3VD 3DX1A 2P8LB 5F1IA 5DJZB 2APWA 3FUDA 1UWEL 2YMOA 3DVNB 4G8EA 5FO2A 3FB7A 4L0ZA 2CBPA 2MRYA 2W9LA 2WXNA 4N68A 4QAMB 4HPYH 1IZKA 2CRYA 4FG2A 1CURA 4L4TD 2EDKA 2VERA 3LEVL 3UZEA 1URIA 2X6BA 4I2XA 2OKMA 5AVZB 4NKQB 4E0RB 3QDGE 1XV8A 1CGWA 2D3JA 1K4CA 4G8GE 3QFJB 5FHAH 5GS1A 1EHLH 5EZIL 3UH8A 4BFIA 4DEUA 1AI1H 5DD6B 1DVFA 5AZEL 3VG0L 1ZV2A 2F53D 4X0KB 3QZNA 4O02A 3S34L 1QWNA 3GUFA 4GBXC 4YVNA 5FYJD 5E9DE 4WWKA 2FIKA 1OF2B 4GJTB 5LDUA 4KBPA 3ECBB 4XBPB 1JN6A 1KIQA 4MNHB 1B4LA 1FNEA 1OALA 2HUEA 2V5MA 4OLXL 1R5VA 4XX5A 4X2UA 5E8EA 3FONB 3QQNA 4Y5YB 4AYBA 4PGEB 2A74C 5TDNB 2SODB 5D7HA 1JZ6A 2JLPA 3EFFB 1OTTC 1YNKL 4FQIL 4N2BA 1KJ2A 1GAFH 1OSEA 1IGYB 1IGMH 2GITB 4UV7H 4AW4A 3ES6A 4ODUB 3VWJA 1NIAA 2IALB 3GMPA 4DSYA 1DBBL 4EAEA 3O6FD 2XPGB 4JQIA 3ILEA 1DEDA 4R4FL 1NMBH 3WTSA 5DZNA 3CFJA 5IHBA 1GMIA 2DQGH 5BOJA 2AZAA 4RZCA 4YSSA 2WLKA 3V10A 3EDJA 1VIWA 4I77L 4LPYA 1CFNB 1X4ZA 2DQJL 3QHFL 1NCDH 3HLAB 5JUEH 3FAXA 3SBWA 1XH1A 1Y6KR 3RI5F 1CICD 3Q8EA 4NRZA 3WEMA 5K9OA 4DVBB 1OV8A 1MCWW 1MFBH 4BE5A 5I15H 5DC2A 4XOCA 2Z92B 2GCYB 1AQMA 3O6LH 3ZDZE 5IOPB 1I8IA 5A7EA 2AV1B 4ZUSB 1PDKB 4P2RD 4HJGA 4I0KA 4GW1B 4RWYH 1FL5B 3RWIA 3OAYH 4S0HA 4A66A 4A67A 4GLRH 3WJLC 4LVNB 3P77A 1RPQA 3KXFA 3ARQA 1FZOA 3FT2B 4HGKC 2K4WA 3V6OC 4GIPD 3FH5A 5E2UL 4YQXH 3T8XB 5GGUA 3IFOA 1X9LA 3N0PB 5ANME 1NTDA 3MRFA 5DFTA 3ETBJ 3BVVA 3HE6B 4W9KC 1E4XL 3QDGB 1BM7A 2V8LA 4BFOA 4Y1SA 4G8GB 4WHDA 1KXVA 1KLGB 1IBFA 4JDZA 1XF2A 4J3OG 2V0AA 3HA0A 1M05B 4HC1L 2VMEA 2YD3A 3H3PL 3DHMA 4XCYA 4FC3E 2BWIA 3CDGB 3N2JA 4GB9A 4NQDE 3GSQB 4HP5A 3MJ9H 5DWPA 5ESVB 4EMZA 5JR1H 1IGJB 4G2AA 3FW6A 2HUHA 1JZ7A 4DTGL 4ZPTB 1J8KA 4GXVL 3ZMEA 3DX6B 1ZV9A 1YN6B 3ZLQC 2BHFA 4TSCH 2P80D 1I3GL 1X5XA 2C1PB 5AYUH 4DP0X 2CKBH 2I24N 4YO0A 3WDHA 4Z7WF 2YXFA 4JHWH 3KM2A 2VLRE 2NZ9D 3H9SA 4NZRH 5D2NA 3W3BA 4F9PA 1LXMA 4U4IA 4BFRA 3P3RA 3WKNA 4A2LA 4LHUG 4J3OH 2WKOA 2XQBL 3PHOA 2CM5A 2VUOA 2DM7A 4JGJA 5F7FA 4OLWL 3E3QE 5AVVB 5LWYL 4PV1C 1RH8A 1MLCA 1WZMA 2JK5A 3UFIA 2WXQA 3D18A 4WW1B 4P04A 2VE6A 2XBDA 3IU3A 4JFZL 3OR7A 1RMFH 2D0HA 2FUTA 3OJVC 4FGMA 3V5KB 1CL7I 4XHQA 5IT2L 3MLPA 2P5ED 1Z3RA 4YHOL 4DOHE 1PG7X 5KANI 3QQ3A 3MXVL 3W9DB 2ICWI 1P4UA 2BJML 3PJSB 1FJ1B 2F8VA 1W72L 1UCTA 4ZI8A 2CIIB 3VFTA 4LDOB 3I6GA 4YHZH 1MCQA 5K59E 3HNTH 2EIJB 5GGQH 2J44A 3MRQA 5C70A 3VWKA 1UM6L 2IH3B 3PYCA 5I6OA 5IB3A 3MNDA 3U79A 2JXMA 3QZMA 4WWID 4L9LA 3QS2A 4Z6AT 5B3SB 5B8CB 1RZJH 2OMWA 1R3HB 1UFUA 2R23A 4G6AC 1JUFB 1SUJA 1T21A 1CR9H 2IH9A 4NUPA 2G60L 5ILTL 1XB3A 1OCWH 4U6YA 2JCWA 1TENA 1LQSR 1G7IB 4MAYA 1DSFL 5ANMB 2IPKB 1FP5A 4AOFA 3FHAA 4GIAA 3VNYA 4GQZA 2DTMH 4PJDF 3H0TB 1KSRA 3U6XA 3VH8A 4FD0A 5T1MB 2A6KA 3WU1A 2BSRA 1ECZA 4UDTB 4ALAC 5ESAB 1BZ9A 4NQDB 2D3VA 4Z7UF 3EO9H 2P24B 3FB5A 3OB0K 2DIJA 3RHWF 3VRLE 1QAWA 1SF3A 2CO7B 4IM8A 3R8BB 2KLTA 1NA8A 1SJHB 1TQBC 1YN7B 3P4NB 1CVRA 1MN4A 1XF1A 4P06A 3K74B 3C8DA 4GS7C 5C0BD 6CGTA 5ERWA 1L5GA 1UYWL 4NLAA 5I1AA 2VLRB 4LESA 4FLOA 4NBYB 4X4KA 3U6RA 4V1DD 1LNUA 3RVTC 4L2YA 1NWPA 2CM6A 2N01B 3D0LB 3QJTB 4DKFH 2AEWA 4XB7A 4PHXA 1R24B 5BVPH 4HALA 3EGDB 1A47A 2XTJE 1V7ML 1YRKA 4GT0A 5CBAB 1Z0MA 5C6TH 4K7FB 2BZCA 1E30A 2ZYHA 5ANHA 3WUZA 1WZAA 2Y72A 3VTTA 4P5KA 2NSMA 2P48B 3JWOH 4N3TA 3REVB 4CMMA 3DVFA 4EEEA 3WNIA 4UINL 5DMGD 4X4YA 1YJDH 3X3FL 1TCMA 2YRLA 3F64A 3GEFA 5IV2B 2AEPL 4Z0BL 3MV7A 2ITCB 3V0EA 5AAPA 2BHUA 6TAAA 4ZPVB 1AR2A 1VLXA 5D7SL 1QFWL 1Y07A 1AFVH 4YE4H 1Q9KA 4M9OA 1VEMA 1HWHB 4WGWB 1E67A 4WW2A 1ZGLP 1GGUA 4HCGA 5L4JA 2VXUL 3DHJA 2VC2H 1E4WL 1XGPA 4LCYA 2Z1KA 3E6HA 5BS0E 1WA1X 5IVXF 2OK0L 4UNVA 4U1MA 4LLYB 1VGKB 3AT8A 3LKOB 1BOYA 4APXA 1CI3M 2EZ0D 3QAZC 3QXAA 2ETWA 3HHSB 3R1GL 5DQJB 2ZIDA 4BK8A 3JV6B 5EC2A 3T0ED 4P9ML 1HHGB 3O3DB 5GS0L 4TN9A 3ARDD 4RFNB 4OCMC 3R06B 4JFSA 4PJ5D 4JJOA 1CLCA 3AQZA 1L7TH 3FUEA 4KX8A 4FKEA 3QDAA 4UOJA 1T2XA 4KX9A 5I76A 3KPQA 4MA7H 2Q20A 5HHNA 3TBSA 1UD6A 35C8L 2IXQA 2J88H 3MNVA 2CWRA 5IHUL 1CDJA 1T1XB 3RILA 5KYUB 1FYTE 3TWCH 3PWPD 1LO4H 2DMHA 2WXLA 3G5VB 4PRIB 4ZD3H 4ELMF 2ITEA 1JHKH 3T6XA 1N18A 3LIUA 4EDXB 4YE0A 4RETB 1L7IL 1KGWA 1QSFA 3I9GL 4FQLH 3SKUD 4K5PA 2DAVA 5AZUA 3AXIA 1T0PB 2H5UA 4Y9FA 1FL6A 3HBQA 5I6KA 2CBQA 4X7EC 3OQ3B 4Q9RH 1Y7VA 2OL3L 1WAAF 3VE0B 4RMQA 1P6WA 3NJLA 15C8H 2ZKXA 2EUZA 3BCDA 4JAMA 4P2OC 5KSAD 2PP7A 2HFFB 2K9FB 2F8IA 2ZG2A 3GMNB 4HBCH 5I0DA 3BGMB 3AM8A 2DBJA 5F96H 1C7SA 1AC0A 3VXPA 2XTJB 4KRPC 5C7ZA 5TF1L 2X4UB 1MFCL 5MHSE 2K4AA 2V3EA 3E6FA 4XC1L 4AGNA 3ZKQD 4U0RB 3OLGA 3SBPA 2VIRA 3VW3H 1MJ7L 4AYEC 1K9TA 5E2WL 2DOCA 1KFGA 5ABAA 5C8JA 2DF3A 3MLVH 2Q7YA 2A9AA 4MCMA 5DUPL 1I3RA 4Y4HA 1I3UA 4OSUL 3VFSA 1J1XL 4GRLB 4X8JA 1GYWA 1F3JB 3NP4A 3PDGA 3NRPA 3F3HA 3T2QA 3B8SA 2GY7B 4OLYH 4D0BA 5J3HC 2ZKWA 4JE0A 5ICZA 1H0DA 2ZCZA 2C9QA 4BH7B 1BM3H 4JZJC 5BS0B 1Z5HA 2XG5A 3UJIH 4U1KA 5AW6B 2IAMA 2AABL 4R5TA 5DQDH 5F9JA 3JTSA 1F4YH 4WI2A 4RWHA 2WCGA 3JV4A 1BZ7B 2HT4D 3ARGC 3OPUA 2JJSA 2A6JB 4GIOA 4ABQA 4PCSA 3EADA 2J5LC 2YPLD 3H53A 3UMTA 4J3BA 1I1AC 4FA7B 2X40A 1FYTB 1VEPA 4L8SA 5J57B 5CD3B 3SKMB 1RUAH 2VN4A 3WG7B 3MMEB 4NQVB 1QO3B 1FC2D 4JPIA 1DUYA 3G3LA 3CXFA 4YDLB 2JV6A 5I0WA 1FI8C 4WEEA 2R69L 1PY9A 5GJSL 2E9BA 3FOMA 2YPKA 5IJCC 3CK0H 2EXWD 3T2PA 3U0WH 1HC1A 2H6PA 5I75C 2YXMA 4K94H 3OLDA 3BZ4B 2J1YA 2E6JA 1KGUA 1NICA 2XWJA 3UABA 4JVPA 2ZYSA 2CXKA 4NO0A 3PL6A 4U6HA 5F7LB 3QXDB 3S37H 3Q1SL 3IETB 2H0PA 1TSRA 5KS9F 1DUZB 1TQCB 3K8MA 4TSBL 4NBZB 5DJCB 1C8PA 1ITCA 1NCCL 4CN4A 4X4ZA 1ZHNA 5LBGA 3UC2A 3UG3A 5IEKA 3ISYA 1T1WA 2YPVH 5HPOA 5CMAA 4Z7VE 4TSAH 4DKEL 4F27A 4ZMQA 4YVUA 5IW6B 3U7YH 1UM5H 5IB4A 3LH2H 5DJYA 3F58H 5BOPA 1RUPH 2Q76A 1NCTA 2QPUA 1FE8H 1XF4B 1OF0A 1PLBA 5KW9L 2JQZA 5JIHA 2BSEA 3V0JA 2UVEA 3PDOB 4FHJA 4BWTA 4AQEB 4NQCA 1E2ZA 2GSIA 1ES0B 4EI5D 1QPXA 4UOW0 3TPKA 5FC9A 1KN2H 1MCBA 4P23A 1ZLSH 4AT6B 4BINA 1NBVL 3IS1X 1A3LH 3BP4B 4FXGB 1SEQH 5FW7A 3SDAA 2FJFA 4OJCA 3PAYA 1NAML 4HS8H 4JKPL 1IKOP 4EUPG 4JQVA 4RSYA 3TA3A 3VD9A 5JIPA 5DEZA 4JFEE 5F0MB 4ZODA 2W0LA 2WSDA 3TEUA 4AIZB 2VERN 5HBBA 5ACZB 5GGTA 3I3DA 1G9MH 5EHFA 4NDMA 3PP3K 3BCFA 1WRFA 3FFOA 4JFXA 4MKTA 1NFIB 4Z3TA 1U8OA 1IAIH 1OP9A 4HQQH 4JFOA 4LP5A 5KEZA 2W9EH 5DRXB 3VFPB 5IIEB 3MRCB 1R34A 4AG4H 1T0NA 4FQCH 3AS3A 3CH1A 3HPLB 5EUOE 3U30B 2J72A 1R19A 1U8JB 4YXKL 5BZWA 4MCNA 5IQ9B 2OZ4H 1EH9A 4EUPH 3X13B 2FDBP 4MB3A 4N85A 1RK7A 4QCIB 2K78A 3ILQC 4XNQA 1VA9A 5AG8A 4HF5H 4F7CB 3LS4L 2FT8A 4JO1H 1WISA 3ARED 1ZVSA 4NUJA 2WANA 2VTFA 3OKKA 4HWEL 3EH2A 2EDFA 4ZW3A 2JKTM 2WZ6A 5F7YC 4P49A 5CNHA 5JO5A 5H2BB 4M93C 4AL8H 4A68A 2H7WA 4FQ2L 4OTXL 3K72A 4AMXA 3B9KB 1GKEA 4OIIH 3EYSL 1EJOL 4ODSL 4IRSA 5TFSH 2J4WH 3ULUL 5FA3B 3DYPA 4Z7VB 3MRDB 5JZ7C 5J6GA 3QXUA 1SVCP 4BKTC 2E7CA 2EINB 1CD9B 4L8DA 3GMLB 2Q3AA 1U91A 4RAUA 3NCJL 5JW3H 2HA1A 4Q6IA 1C9SA 4N5ED 1I9RL 3MLZL 5E6IB 1ZTXE 1IEAB 7CGTA 1T6WA 1TNNA 3GSNH 5E2VL 5IQ7L 3T0DA 1XGUB 5EZJB 3ARVA 2GBVA 5DYFA 1SVZA 2X0VA 2VN6A 3T77B 3L2LA 3DJRA 4HDIA 2Y6SC 1IT9H 4AKQA 4KKLC 1G7QB 2FX7H 3MLTA 3AS1A 2UZPA 3AU1A 4KO7A 4TXVB 4U1JB 4GW4B 4JREC 2EIBA 3MV8A 3VQ2C 1UB6A 5SX5K 2WBJC 5I82A 1HKLH 1KCRH 1BSIA 3KEDA 4Z7OE 1WH0A 5T3ZL 4JFEB 1PIFA 1XD1A 3S35L 3BJ91 1YUHA 2NNAA 5A7BA 5ICXB 1W2KT 4XCCH 1BMZA 4I18C 3RB5A 2VCOA 3AXLA 2AJYL 2Q86A 3H3KA 3OHMB 1EEUA 1XGQA 3LQZB 2WAQA 1XAUA 4XHJD 4MNGE 4OAWB 3D39D 4H0GA 4HC1A 3RZWA 5EUOB 4Z3IA 4NXKA 4HEME 1I53A 4N6RB 3UADA 4AGQA 3AITA 3MBEC 1ZCRA 4O2EB 5A3IC 2EKSB 4MLIA 4XI5C 5GZND 1A25A 5CJBA 5ALCL 4J8RB 5FFLA 2DLFH 4WI3A 3NCYP 4BFNA 3EXLA 3JWDH 4LHJB 2PP9A 3O3AA 3GS0A 3NSFA 4OW6A 4GFTB 2ZUQB 4M1GL 4R4ND 1N0XL 1YMME 4YHKH 4Q6YA 4O9HH 5DU7A 5KVEL 1RUKH 2E76C 1E5UI 2F5BL 2QV4A 5DLML 2EDQA 3CFMA 3MFFB 5IJDC 1P4LA 2X53A 3X3GH 1NGXB 2LTQB 5AOMA 4A6YL 5GPRA 4L3CB 3SPHA 2WXJA 4WWPA 3UTSA 1CWVA 1N2RA 2EDEA 1MCOH 4XPTH 3IWVA 3QUYC 2OW7A 4AEFA 2Q1EA 3C2AH 5K1VA 4UDUA 5LN4A 1EVTC 5BJTB 5HHQA 4ODVL 2JVUA 4BA8A 2VDNH 2Y1AA 2EXYC 1N12A 3GHBH 3E2HC 4K8RC 2HMID 2WWMD 2XG4B 1BAFH 2WQXA 4X9YA 3T2LA 3WFBH 1EO7A 4ZNCD 1YVLA 1UA7A 2X7LB 1JGLL 5C0GA 2DQUL 2G2NA 4JFDA 5DD3L 5T1KB 4LLVB 3MRRB 3U4BH 4WJ5A 5GZOA 3P69A 4PJ9C 5HI4D 3EF7A 1HH9B 4GEJA 5C92A 1M42A 2Z9TA 3DTXB 3KBPA 5EOCL 5B38G 5MEPB 3TN0D 5KYYA 5I8CA 4M43H 4MA3B 2UY6A 1QSEE 4EO5A 5EU6E 3ETTA 2BOBB 2PYEA 4L3ED 3MRHB 4HGWA 2CLVA 1UUSA 4R7VA 2R2HA 4LOVA 3I6KA 4PJ8D 1RZQA 1EEYA 5BO0D 3GKWH 4I0PD 3MOBH 5D6CB 1LEKA 1Y1UA 1CBVL 5GGSY 3PGFH 2YRBA 3EYFB 1G1OA 2N3JA 4YFDB 3FCSA 4PRNB 1E3FA 5DC9B 4FQXD 1U3HB 1Q0EA 5LO7A 4Z7OB 3QUML 1J8SA 1KYUA 3PGDB 3VDBA 1CK0H 4YXHL 1IJNA 4OD3H 2ZTBA 3OKNB 4Y4KC 4ZX5A 2X3AA 1MCIA 2WINB 1FIGH 1RZFH 4PVMA 2CK2A 4ZOCA 3TZVB 2R0ZL 4QT5A 4NQXB 1JMXA 5CKAA 5DMIH 3RE0A 4IMKA 5KN5B 2VDLL 1C7TA 3IAGC 3OAYK 4FF9A 4NKOA 4MNGB 4PBWD 5ELIA 1QVOA 4QKTA 3QEGL 4LKXA 1HEZA 1P5UB 1IE4A 2HT3C 3K4ZA 4KJWC 3CSTA 4XN5A 3GHEL 1VKXA 1RJLB 4J4PC 2DQCL 1A4BA 1OM3H 3RDJA 2OL3B 3RY6A 2G5BA 4P2QA 4LCCB 3CPLA 3VXMD 4LRNL 4GP5B 5E6SB 5B7FA 4U1HB 2A99A 4UU9B 5MERB 4OGXL 5CEZD 1NOAA 1YMMB 4RX4A 4FFTA 4A7GF 2BLFA 3CMOH 5J06A 1FF5A 4RMWA 1MJJB 5B1CA 1OGAA 3RWEB 3QI9B 3QEQA 2X09A 2COVD 3FU7B 1FYHB 5ISZD 3DX3A 2EYTA 4W93A 2OMVB 3T4AB 1AC6A 4UV4H 2YKLL 5AOKA 1TETH 2G0KA 1WZKA 3E38A 1ML0A 5I1JH 3IJYA 2ATAA 1BD2A 3HG1A 2V37A 4E9TA 1LO3L 3JVGA 5DD0H 2R4SH 4CSPA 5KSUA 4PV8B 4YHIB 3U25A 2XUWA 3FFCE 5L0QC 2XZZA 2X6MA 3IDUA 3NIDE 4CN6A 1D3CA 2EDWA 4U1IA 1KT2B 3SE8L 2WBWB 3BDXA 4OZGA 2XQYA 3V6FA 5DTFB 3FL7A 5CS7A 3LYRA 4EN3A 3H6JA 1MWAL 1T83C 1QSEB 3DOHA 5EU6B 5FCSH 3L3OB 4PWFA 2VW6A 4GAFB 1E6JH 4PREA 5KBLA 1MH5A 2V2TB 1UOVA 3AVEA 3QC6X 3MZTA 2BRRL 4HIXH 4X9GA 3NAAH 3MNWA 2Q6WB 1T4KB 5BVJB 3MYJB 4N86A 2DH2A 5CINH 1TEYA 1MCPL 5EA0H 1BFTA 2BOCA 2MPAL 3ZT7A 5C0IB 1HN1A 1L4IA 4KHXL 5DHMC 5KYXA 1B0RA 4WHYG 1SGKA 1NEZB 4OD2B 1MREL 4NPJA 5GSVB 4CVZA 3QCUH 2DS4A 4JX0A 4MJ6B 3SBRA 1LVEA 1DFBH 2E4TA 1KCUL 2JIXB 3ARFD 4YWGH 1PKQE 3BE1L 3VXSB 4UQCA 5I1DA 1DE4B 1FL3B 3UBXI 2D2OA 3DSFL 3BWAB 3W11D 5AOZA 1E9QB 1AXTH 1DANT 3CX5K 4AH2A 3KS0H 2PXYC 5JXEA 5F44A 2VXVL 1XF3B 2CZNA 4W9LC 4F80A 3B37A 4JANA 4CAGA 4ZQTA 1UD3A 4LNVA 4OJFL 4MRBA 4WHYH 4YK4C 4WDIB 3ULVD 4ZG1A 4DIXA 3CFKA 1LDPL 3G5WA 4QY8A 4MNQE 3V2AR 4BFEA 3S8WA 2CA3A 4Q74A 4JCLA 4H4NA 1RXLA 4UT9H 4Y4FD 3WY4A 2EIEA 3IGAA 2AJZA 4PRBB 2E7LC 3AAZA 4ONGH 1I7ZA 5AVTB 4P4RA 3GBNL 1LMKA 4Q8BA 5IMKB 1T0MA 4DO5A 5EORH 3QIWB 3VSQA 4Y7MA 4U3SA 4GG6E 1BQ5A 3BGFC 2CO3A 1G6RB 3O8XA 3QWOA 2RB8A 4P4KD 4CDGC 1XCTB 1DN2A 5C0FA 1IKNC 5FPIA 4B3EA 4N2EA 4AQZA 2V5TA 3FFCB 5ICYA 5E0FA 4N2LA 4H0HB 5IVZB 3NIDB 5DF0A 3H9YA 2D4FA 4MB1A 1USQA 2D0FA 1A7QH 3GMQB 5L6YH 1PL3A 4PBXA 4PRDB 4HIEB 2FL5B 5AAWC 4QRPD 4GUQA 1ACYH 1N19A 4NO2A 1SEBB 3IMRA 4TQPA 4FL4B 3A21A 3CN3A 1GJIA 1EHLL 4J1UA 3SJVA 1ZK9A 4LDEB 5EZLA 3T5WA 2VZUA 2N0MA 4FI8A 3FUHA 3QUXD 4JDVA 4YEEA 1JWSA 3Q2WA 1DN0A 4WK0B 3WLWC 1N10A 5DK0A 1ZSHA 1ZA3B 4RFEA 1OSPH 3TBBA 1UOKA 5I0ZA 1OKEA 3HI1B 3GMOA 3MVSA 5HYFA 2GFBA 2J1WA 3KDPB 2FH6A 4HISA 1QASA 2AQNA 3AUWB 4NQSA 1HOCA 3WFEH 5CXPA 3ZQ9A 2AXHA 3K6SB 2R2EA 1SFDA 4MD0A 3CFIC 1IGML 1FO0B 4IIQC 1VJSA 3BAJA 4UV7L 2J73A 5CHNB 1W9XA 1PKQB 3HS0C 4FFWC 4PTTB 2VLJE 3DWTA 3Q2LA 1KJVB 4F92B 5C08A 3F04A 2YRPA 3DO3A 4L4VE 1JRHL 4DFHA 1NMBL 1WICA 1BQUA 2DYSB 1AGEA 2DQGL 1Z3GL 4HS6A 2H4EA 1QKZH 1DDTA 2WBKA 2R29A 1J88A 3BPNB 3VQMA 1HSAA 3DIFA 3DOIA 1XH3A 3BW9A 3T4YA 4KK9D 1WVZA 2EYSA 1JV2A 4HKBB 1NCDL 1G9HA 3L3KA 3O3EA 1E4XI 5JUEL 3ARYA 4UOZA 5GRJL 4JFQA 3L9RA 4XX1E 3TU6A 5F6IC 3WMQA 3ZDZF 1NDMB 1CD0A 4Y9BA 4MDIB 4AZ8A 5I15L 1B2WL 3O4LD 3VXRD 1BXAA 1JWMA 1ETJA 1AE6H 3BUDA 2EE0A 1BJ1H 1DQJA 1EZSA 2EO7A 3UOAB 1TF4A 4RWYL 4BRJA 4F8OA 5LHDA 1JCVA 3RIFK 5HGBA 1BLNB 5FYJH 4JFFB 1LE9B 4WFHD 1ZHLA 3HNSH 5GGRY 2D31B 5IP4A 1EO5A 3CQQA 3DBXB 4GOSA 3QDJD 3RGBA 3O0LA 2E7HA 3QO1B 4FX5A 3GINA 1HJBC 4P5TD 1W8EA 2YD5A 1YDPA 2R0KH 4ICWA 3UJTH 5E8PB 3IGLA 4IRJD 3BD5A 3V6ZA 1H9VA 1U95B 3UX9B 2NR6C 3QQ9C 2I5YH 4G1EA 3MX0B 4YSUA 3BN9D 3ZZQA 4AGLA 3N40P 4MSWA 3ZXAC 4PJEA 3TX4A 3IWUA 3IKKA 4S1QH 3WHE1 5D1ZC 5I19H 4YNYB 2DQIH 4RAVB 3MJ9L 2Z8SA 5FGBC 1OP5H 2Z31C 5DEGA 5BMFL 1AIFB 5I2IA 2FGWH 1FLTX 3RX5A 4ENZA 3HBGA 1I1FA 4EBQH 2KERA 3I02A 4L1DA 2B77A 4TSCL 4N2AA 2CKBL 2W60B 1M1SA 3Q06A 4HMEA 3DUUA 4QRSB 4KVNH 4J6IA 1OANA 5C3IA 3SPCA 3IEAA 3HRZB 4NPKA 4NZRL 1JERA 4G8FB 5DCCA 1SDDB 4ZQKB 3DV6A 4QRUB 5LJYH 4H1LB 1JJUA 3GBML 2VLJB 3RFZB 4QGTA 2MCPH 4LHQB 4L4VB 3QR1A 2WNKA 4I2XE 4PRHD 2HLAB 3D2TA 3QZWA 1KBBA 5EBMB 1NPJA 4KVCH 4ALAH 1QHPA 4JG0H 3U9PH 4PJBF 4A6YB 1RMFL 3U0PA 1W6WA 3FTSA 1A6UH 1MWOA 4I9XA 3AGVA 4C4KT 5T1LA 4F2MA 4WRLA 4M4PA 3V0GA 5IMLA 5FCUH 3RL1A 1FV1A 3DX7A 4K7PH 1F00I 4UT7H 1DR9A 4B9IA 2BSBA 3VMPA 3BISA 4JHVA 1F1DA 4FABH 1NMCC 3ABGA 3JXAA 3DTUB 3LKQA 4YHZL 1J05B 3HNTL 1G9EA 1T66D 2F2HA 3FRPG 4JM2B 5EN3A 5I1IH 2GT9B 1EUTA 1GZQA 3T6ZA 1TTRA 1ZMYA 2M1KA 4KH2A 3D3VA 5E08H 1RZJL 4HCRA 4NN6B 4BYHA 4IU2B 1A2YB 4S1DD 4C55A 1CR9L 4AUUA 4MYWB 5CR1A 1NUDA 1OCWL 4M6AA 1IVLA 4K55A 4Z8FH 1AG0A 4ENEC 1X9RA 3HPJB