3H2QA

Human sod1 h80r variant, p21 crystal form
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
153
structure length
136
Chain Sequence
b'ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPRRVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEENAGSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Structures of Pathogenic SOD1 Mutants H80R and D124V: Disrupted Zinc-binding and Compromised Post-translational Modification by the Copper Chaperone CCS
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 32
structure length 136
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3h2qA00
5CU9A 1HL4A 4A7UA 1E9QA 1JCVA 3KM2A 1MFMA 1RK7A 2C9SA 3GTVA 1OZTG 1BZOA 3F7KA 1CB4A 1SXNA 2WWNA 1IBBA 1DO5A 1SDYA 3SODB 2WZ0A 4N3UA 3K91A 2WZ5A 1EJ8A 1IBFA 2GBTA 1FUNA 2R27A 1B4TA 1F1AA 1IBDA 1BA9A 2Z7WA 1TO5A 1YAIA 4OJAA 2AQTA 2XJKA 3F7LA 3KBFA 2E47A 1QUPA 4MCNA 4A7TA 1SXSA 3ECWA 1B4LA 1CBJA 3PU7A 2WYZA 4A7GF 4A7VA 1XSOA 1OALA 3MKGA 3KH4A 4B3EA 3GZPA 2AF2A 1P1VA 2K4WA 4FF9A 1Z9PA 3HW7A 3S0PA 1PTZA 2JLPA 4MCMA 3KBEA 5KBLA 1F1DA 1U3NA 1F18A 1E9QB 2ZKYA 3GTTA 4BD4A 4A7SA 2AQRA 3HOGA 1UXMA 2WKOA 2Q2LA 3ECUA 2GBUA 2LU5A 2E46A 1OZUA 2VR8A 1XTLA 1E9PA 2AQNA 3H2PA 2WWOA 5KBMA 1Z9NA 1AZVA 2APSA 3L9YA 1SRDA 1ESOA 1SXCA 1SXZA 2SODB 2Z7YA 2AQSA 2JCWA 1EQWA 1OEZW 2WZ6A 1SDAB 1IBHA 3QQDA 3CE1A 2C9VA 1SXAA 3CQQA 1N19A 2WYTA 2VR7A 5KBKA 4N3TA 2AEOA 4L05A 1DSWA 3H2QA 1PZSA 2AQQA 1S4IA 3T5WA 3GZOA 3KH3A 2VR6A 2NNXA 1SXBA 2GBVA 4OH2A 1YSOA 1YAZA 2ZKXA 4BCZA 1TO4A 1E9PB 3GZQA 1PU0A 1UXLA 3KM1A 1JK9A 1N18A 2ZKWA 3GQFA 3LTVA 2Z7ZA 1F1GA 3CQPA 1SOSA 1KMGA 3MNDA 1SPDA 1E9OA 4BCYA 1JK9B 3RE0A 2V0AA 2ZOWA 4U4IA 2AQPA 4A7GA 1HL5A 3QQDB 1E9OB 1IB5A 2WKOF 3ECVA 2Z7UA 1OAJA 3L9EA 4A7QA 3HFFA 2XJLA 1L3NA 1XTMA 1COBA 1Q0EA 2C9UA
chains in the Genus database with same CATH superfamily
2EUVA 3HLAA 3VGAB 1MAMH 4JO2L 4KI5D 4JRLA 2O5YL 1S5IL 4Q6IC 2XFXA 3CFKB 4PRHB 1X7QA 4X6CF 1RP8A 2D3JA 3MRHA 4K3EL 3NQIA 2CLVB 4PJXE 4AG4H 3P4NB 5IJBC 1FL6B 2YZ1A 5E08H 1U3HA 2P5EB 5AW2B 4W6XB 5AW6B 2BVEA 3CX2A 4G9FD 4E2OA 1J8RA 1ZE3C 4DEPC 3VXUD 3ULUD 3WS6C 2Q7NA 5AOLA 4GUQA 1OV8A 5I1HH 5L6YH 3HUJE 1FGVL 4FQIH 4KKLD 5FKPB 1VZGA 4ZPTB 3V2AR 5J57B 5LGHL 2ITEA 5EOCJ 1Y18B 1CFSA 1BHGA 4NUMA 4C59B 2ZG3A 2AK4B 3R06B 4HCRA 2AMGA 3EYFA 4EI5C 1Z9OA 1NCNA 3FO2A 5HHMB 1F4YH 3K8LA 4QRRD 3C9NA 1MCSA 3MRDB 2GY7B 4XAWL 4ALAL 3VCLA 5DSCA 3MFFA 3EHBB 3DJZA 4DGYH 7CGTA 3GIZL 2E5EA 1IX2A 1PCXA 2IANB 5FA4A 3S8GB 3QXWA 4Y4FD 1D7BA 4RFEB 5EC2B 2PXYD 2O6EA 3MUGB 4B0MB 4NRXB 2FH8A 2YKLL 4WRLA 2AANA 1QWHA 3F7PC 2IDQA 4U1HB 1RIHL 4O02H 3UBXG 1HSBA 2CRYA 3LQMA 2HX7A 3DPDA 4ADJA 3JTTB 5D70H 3V95A 4QT5B 3ZDXE 1RUAL 2W60B 2Y7OA 4JJOA 1W6WA 4PJ9C 4X9BA 1FNHA 5B1JC 2Y07H 4NM4H 3U2IA 4LB8A 4Y5XB 3RA7L 3MV7B 4RCAA 1YYML 2A6JA 1NAKL 2CO1A 2EDHA 2P8MA 3RURA 4U1SA 3JSSA 1PZSA 1G9MH 4AJWA 5JQHC 2RAMA 3VFVB 2JELH 1PNCA 3GZOA 1X9RA 5BCAA 4CGUB 2AJVL 5LBVA 4NYLA 4P5RA 3CZEA 3HE7D 3LH9A 3QFJA 4M8QB 4AVIA 2E6QA 3VH8B 4K3JL 2L7UA 4H8QA 2DLFH 4RWHA 3UPRB 1KJ3H 4AJ0A 3EOBA 3O9WD 4BSVA 3VD4A 1OSPH 5JIPA 4AOFA 4QJ5B 2BY3A 3BD3A 3S88H 5DI8A 1QVOA 4Z7NF 4NAJA 4GQ9L 3CXHK 1MPAH 2JXMA 1ZLWK 4TRPH 2KQNA 3IDIB 4L48A 3S3JA 1AIZA 1MWOA 1JWMB 2CR6A 5D4JA 3QIWA 2K1MA 4N20A 4NBYB 4Z0XB 1Q0YL 4MLSA 4OZ4B 1TZIA 3WXWH 3TL5A 4IOFD 5HSFA 5AAWA 4WHDA 3GTVA 5DTFA 1UENA 3FTGA 2DQIH 4NKOA 4N4YB 2I07A 1SXNA 4PJXB 3GI9H 4WI0A 4PS7A 4XVJH 2ITDA 2LLGA 2ZXGA 1B0WA 5IROC 2EE0A 5GRVK 3MRCA 5KS9F 1IM3D 3E0GA 5F9OH 1YAIA 2X4NA 3HC4H 3I84A 3R4RA 3BDYH 2GITB 1K2DB 4LSVL 2C4XA 4GUPB 3DO7A 1JCKA 1BEXA 1NIBA 4TLUA 3EYQC 3LQZA 3GRWL 3TLRA 1H8OA 2KL6A 5LN8A 2AJ3A 3UIYA 4QGTA 2R39A 3VXUE 5FUCE 4YLCA 3ULUE 1ED3A 1EPFA 3L2NA 4X6EB 3PUUA 5J6GB 4UM8A 3WTUA 1EWHA 5G55A 1OPOA 2ALWA 5MEPB 3G6DH 5KAQG 2VL5B 2G9HA 4CSTA 4EKXA 4NERA 5F7DB 5BVJB 5IIEB 1I7RA 2YAFA 4QTFA 2Z8WC 4AYEC 3MGTB 4LLVA 4CW1A 2GBUA 3RY5A 1UJ3B 2WLLB 2VXVH 1SQMA 1UWGH 3GMMA 1T1YA 2GTQA 3L3OC 1HOCB 4QRRE 4BRJA 3WHE1 3HMXA 3IMTA 1R3JB 4PIRF 5F89B 3VSTA 5EBLA 5EUOE 2FBJH 3QDGB 3QFGA 4NP4L 4H88L 3ZDXB 43CAA 4E5XB 3SDAB 3GXMA 3TT3L 2DOCA 2QADC 2YSTA 4CVZB 2CDEB 5I1JL 2UZXA 1DJWA 2GK2A 3FQXA 2FWOB 4L8DA 2NDGA 3RDTB 5AZEH 4UZUA 2RQEA 1T03H 1ZV2A 3RTQA 3QXDB 4N3TA 4NJAH 4IGBA 1LE5B 2ZP9A 3OPUA 4RMSA 3RNKA 4I0PB 5CIPB 4NZTH 1MJ8H 2X4PA 5CNHA 3BSZL 2YFNA 2I25N 1B88A 1NCCL 2O4EA 3NIFF 4JO5A 4OGYH 4QRUB 2OAAA 4MBOA 1BZ8A 3BD4A 4KZDH 3CK0H 4DUVA 2NY6D 2BWDA 2B9BA 2DS4A 4G9DB 1Z1WA 3NH7H 4J23A 1GCFA 4KJYB 3BQUD 4F8NA 4XGZB 1IC4L 5KW9H 4JFXA 2IAAC 2QPSA 4Q6IA 4WK0B 2VQTA 4BWUA 4M48L 4FI8A 1EHLL 2BSED 4H1LG 2WVTA 1NMAH 4KY2A 1MEXL 3MOAL 3LVTA 1HEHC 3ML8A 1MCIA 5EU4A 3T1FB 3VTTA 1MVYA 2XETA 1CFQB 1D5BA 3QEUB 3PP4H 3ZVVA 5AW5B 2BVYA 4UTBL 2R69A 1EO8H 1PW3A 1RJZB 4DO6A 3IGFA 3GHPA 4RIRA 3ARED 1UM6H 2V2WA 1AKPA 3WS6A 4FA8A 1GZHA 1P4IH 3KLQA 2Z31A 4NUQA 2IH3B 4X5QA 3V5HB 3EF4A 1FGNL 3MFGB 4UI2A 5D1QB 2HKFH 4EI5A 2X12A 3L1OL 3IE4A 2CAKA 1QSFD 3PQYA 3ZDZE 4OCRL 2HMID 5J0BA 5DHVH 3HG0A 3KR3L 3NPSC 3T9WA 3D5OF 4OM0H 3S96B 1QNZL 5E7BA 4OKDA 4HK3J 5EO0A 1F3DH 2EYRA 3A22A 1LWRA 3QO1B 5I8KH 5ALCH 3VQLA 5JZ7D 1ZS8B 4UZSA 4Z7WE 1XSJA 2IH8A 3CN1A 3LB6D 4LMQE 3RPKA 4NC0B 9CGTA 5TQ0H 2BSTA 4D0CB 5GJTL 1IKNC 2X09A 1NGPH 3T0WA 3LS5H 4Y9FA 6PAZA 1E7VA 3INOA 4QRTA 4PJ9A 5IUSA 4ZMNA 4JKPH 4PYGA 3JV4B 3QUKA 4YBLB 1PFOA 5HGGS 2BMKB 5AL8A 4JHZA 1E9PA 3DV6A 1BM7A 4E9VA 5EOQL 4ZDHA 2JJWA 5KYXB 2I69A 5DO2D 4O02B 1WEJL 1U3HD 4AEFA 5KVGL 1A3QA 1J18A 4LLQB 5EUOB 3IXTA 4ZW6A 5FO8B 3VG0L 1JAEA 5D8JL 5DGRA 3TT1L 5EZIH 3NG5A 2WLNA 3GXNA 3IDGB 4KRPD 2HFGL 3VGHA 1V54B 3JXAA 1S7UB 4UT9L 4BELD 3WKNA 3ULSB 2WGXA 1LDSA 1QR4A 3KBPA 4OZGE 3VXRA 5MEQB 3CCHA 4PBVC 3TONA 1BOGB 5GGSA 1ODUA 1F56A 3GMOA 2YEZB 5EOCH 2BINA 2C3WA 4XNXL 3VXQA 2GUYA 5EWIH 1OSPL 1P5UC 3BH9B 2NOYA 1ECZA 4R9HA 4HFUL 5JDSB 1EEZA 2XVBA 5FOBA 3EGSB 3IT8D 4TRPL 4RDBA 4FFZA 5ISZD 5IROA 3ARGC 3D25A 3G6JE 4U6YB 3RIFF 3GSVB 3U0TB 4AQOA 2A6KB 3VNZA 1ETZA 2VZUA 1M1XA 1T66D 3CVIH 4LLMA 4V1DB 3C5XA 3LSOA 5ADOH 1T7WA 5I73B 1IMHC 4G6JL 2VLRD 4MVBC 3U7WH 1YQVL 4CNIA 3DROB 3WXWL 2NY0C 1HU8A 1I9IL 4N0UB 3QZLA 1E4KA 1NDTA 3LIZH 2B1AL 1GOGA 2OX5B 2UY6A 5DJDB 2NY2D 3GI9L 4ELKA 1KSRA 4DUWA 5CILL 1U8PA 3ZRCC 5L8JB 4HIEB 3ZDZB 2WAQA 4MA3A 2CR0A 1YNTA 2GAZB 5JOEA 3QXTA 3P30H 4K23H 2VLKB 3V4UH 2XZZA 3FUDA 4H8PA 4KVPA 4X4ZA 3T65A 7PAZA 2BM3A 2H1XA 5D2NE 1RK0A 5FF6A 3L3OA 2GB2A 3FCSB 1CDCA 1NM4A 3UJIL 3PUCA 2DQHL 4Z7WB 2GTWB 5JUEH 1YQ2A 1ZANL 3QNZA 3RX9A 3MNZA 4BD4A 3OX8B 5LNGA 3ZGIA 3G6DL 1WAAE 2D9CA 2NQCA 1X5AA 4BK4A 4O2CB 2P43B 2IBZY 4JDTH 4ZQKA 1BXAA 5IHBA 1MJ7L 4Q56A 1XHHA 1IGCL 4HBCL 3HZYB 4W9HC 4G59C 3MRJB 5CR8A 2AVGA 1MCKA 2FWSA 5SX4I 4CMMB 2PYFB 4UAHA 3SYOA 3WEBA 1L9NA 3FUKA 1OM3L 3BZ4A 2RA1A 1M7IA 4HZ1A 1ZV9A 4G72B 4JFPA 4WFHD 2EC9T 4NC2B 4PWKA 2EXTA 3WDIA 4AL8H 4JEGB 1LILA 4MQXC 3BPCA 3V0FA 4ODSL 3X1NA 4JN1L 1PD6A 5B39A 5JXAL 1E65A 5EZLB 2OK0H 5D2LE 3KG5A 1NAMH 2YPLB 3PDOA 1FG2A 1OTSC 3B34A 4PFEA 1VHPA 3OAUL 2Q8BH 2DPKA 4OCLC 2ARWA 3VMOA 3QPQC 4OH2A 3UCRA 4X6DF 1KFAL 5AZUA 4XR8C 4MQ7A 1NDMB 3UJJH 4Z77A 3B2PA 3V6OC 4LQFH 4X6CE 2NUTA 2QPUA 5KYUA 2QLVB 1RMFH 2BVUA 3NN8A 4ZTEA 4XH2A 4BFIB 2R8SL 1HIML 3WLBB 4ONGL 4FRWA 1L7IH 3MBEC 3BRFA 1VACA 3GO1L 2G75A 4LSTL 1BBJA 1HHGB 2IGLA 1OCCB 3L3IA 5I1EH 3LZNA 1BXXA 5CEYA 1TQBC 2C7UB 2AJXL 5L8LB 3VU2A 4F5CA 3FT9A 3VFWA 1RV6X 3U4BH 2E6JA 1GRWA 1CL7I 2JI2A 1IRAY 2ZONA 3NJVA 2IOOA 1BQLH 5IEHA 2WWMC 3TBCA 3LZOA 2NPLX 2Q9OA 3QH3B 2EICA 4WW2A 3L4UA 2HT3C 1E6JL 5ISZE 4IMLA 2QKIA 1HH6B 1P4IL 4YLBA 4M5ZH 1U3YA 5C0JB 1DEEB 3RTQD 2FUQA 2PWFA 2VMCA 1JTOA 4RSVA 3MHZA 2IV8A 2VLRE 3VGAC 2W59A 1AOHA 2W9DH 5AYUH 2HKFL 2UVFA 3ECBB 3HC0B 5ALBH 4ZBJA 1IKNA 4AIZA 1L0PA 2FEDD 3GNML 1AIFB 2J4WL 3Q9PA 3QR0A 5FGSA 1ET8A 5CBAA 3GSRB 3DWTA 4C4UA 2B0SH 4BZ2H 5IQLA 2AXWA 5D2NB 3VWKB 4XMKH 3O3EB 4KKPA 4PBWD 4JPVL 1URLA 2QPDB 1QQDB 4OLXL 1J5DA 2VWEC 3SJVA 1HE8A 5GS0H 3W38A 5B8CB 2C9PA 3ZXAC 4BGLA 4MYPA 4MQTB 1S9WA 1VFMA 2NT0A 3RWCA 2FO8A 4MCZA 1F11B 5DA0B 3DSNA 4U1JB 3CH8A 5IG7B 3OTTA 1HSAA 1KOAA 1S7VA 1JNNH 2HRPH 2CD0A 4ALAC 1IM9D 4JM4L 5CHNB 5GZNC 2VN5A 5HHVH 2R2EB 3IFPB 1GH7A 1CG9B 1KYUA 3KYNB 4H8WH 4NKIH 4X7DC 3EYOA 2XV2A 1SRDA 3EHBC 1HCYA 2P3YA 1DN2A 4I48B 5I1GL 1EQWA 4EUPH 2FJGB 1OAQH 4JDZB 3EO1A 3MI6A 1RERA 3ZTEA 1OAKL 1JPFA 1RFDH 1TETH 2C9VA 2PYEB 4IYKA 5FK9B 4Z7NE 4B27A 5CLWA 1EGJL 1CLZL 4M1GH 1FYTA 2YGVA 1J8KA 1TEGA 3EXLA 4MASA 4NNYA 2NTFB 1BG1A 1TNNA 1VZHA 5D2LB 3S35X 1LK3L 2ZCKL 4IOSA 4WFHE 4XNYL 4Y5XC 1KPVA 4K8RD 4EI0A 2P46B 1WCBB 1OGTA 1PSKL 4EDWL 4JKLA 3B3IB 4YX2L 2NY4D 2VZ1A 5G2NA 1JPST 3FT2B 3RL2A 5I17A 4XBPB 4X6CB 2QTEA 3U30B 1F1GA 1PYWB 4OJDH 5EWIL 5KS9E 1REIA 4OCYL 5DJZA 4ZX6A 2XWXA 2RGSA 4PREB 1IB5A 5JPMB 2KT6A 3RVVD 4ADGA 1J1OH 5HI5C 3UXFA 4N0RA 4XCFL 2PWDA 1F8TL 3CVIL 4DN3H 1S46A 4LOEA 1BLNB 1NCOA 5IHLB 5J9PB 3QHZL 4KKBC 4HLJA 1OQOA 4I2XE 5L4JA 2XC8A 3L95A 3WOVA 4OAWA 2JTDA 1WZLA 3L5XH 2MEJB 4PJFF 1A4JA 2YN5A 5GZOC 5TDPB 5I2IB 3O6FD 2JKJA 2VLRB 1KCRL 5EU7E 1I9EA 1NBCA 3H53A 1ZT7A 1HZLA 4M6ML 4AMXA 1RP9A 4YMPA 5HHQA 1GYAA 1YHPA 4NQCA 1T1ZA 3WAJA 3LXCA 1F4WL 3FQYA 3OB8A 4PV8B 4NQSA 4U3SB 3UJTH 1IGYA 4M5TA 4NDMA 4PEEA 2WLZA 5CEXA 3TBVB 1MF2H 3MZGB 3JWDL 4P57A 1J0KA 1SDDB 2DV6A 3DETD 3TM6A 2R9HD 3MA7B 1L5GA 2DY2A 3C8KB 1P1ZA 1K9TA 1JPGB 3D9AL 4N28A 1RUML 2LFGA 5FS5A 4BKLB 3L4TA 2NNRA 3FSVA 4X80L 2EKJA 3ILQD 4GBXA 3GSOA 3OZLA 3PV6A 1HVXA 1GJUA 4HXAL 5JQ6H 5DK0B 1QKZH 3MNWB 4WKZB 1S2EA 4LVOB 5HDQH 2Y1ZA 4MJIA 1JE6A 5DRZB 5EO9B 1AZBA 4DK5A 3N41F 1SN5A 4KVCL 3VXOB 3FBQA 3GI8H 5F97E 1UJ3C 4QIRA 2BSBA 2C9QA 2E59A 4PP1C 3NJGA 4KNSA 5D71L 1N0XH 2MOVA 3IFLL 3V6OA 4Z7NB 1KB5B 3L4XA 3QG6B 4Q4IA 5C0AE 4GIOA 4UQ2B 3QZNA 1CD9B 1KB5L 4XPGH 4HOMA 3SCMA 3MBEA 1NAMB 3SDAC 4KGJA 2Q87A 1MFDL 5FECB 3BW9A 1ZT4A 1B2WH 4PRIA 3RDTC 4M7LT 1WRFA 4AH2A 1P7KB 5FYKD 4Y1SA 4D9QE 1I53A 1M1SA 4TUOB 3FF7A 1PY9A 5K39A 4Z7VA 2WSKA 1NA8A 4I0PC 3W0WB 3MREB 2QPEB 1JNLH 4LQFL 4ZNEE 2CJ3A 4KXZH 1GA2A 3VNYA 4KO9A 3TF7C 1PG7H 1R3IH 2XFGB 1RKRA 5IVZB 1BFOB 5KS9B 2AQPA 4YN3A 3U2SA 4DPAX 1SY6L 1LE9A 3DK0A 3MUY1 4YFLF 1OF0A 3W11C 1MHHB 5EC1B 3VJ6A 3ZKSD 5KBDA 1ZAGA 3BPOB 4OBSA 5CN3A 3X13B 1GTNA 3CFKA 1NEZB 2KZBA 4MJ5A 1C9SA 2DD8H 2CLVA 1IV8A 3O45B 1JCVA 3P4NA 1UWFA 4G6FD 1IARB 4MD0B 5E95B 2BRRH 2P5EA 3PWLB 4JRXD 5HYFA 1JDDA 4I2XB 3JVGC 4GRLB 4CJ0A 2QSQA 3BJ91 3D39D 3L3DB 2HVKB 5HI4C 2XG5B 3HMWH 3BUDA 5FHBH 3QQ3B 3P40A 3REVA 1ZDSA 1RZ7L 2OI9B 3VWJA 2BCKB 3FZUC 3HAEA 3PWNB 4HCIA 4KTEH 4PLOB 1ETB1 5FKPA 2C1PA 4ZPTA 4A7TA 4GSDH 3K72A 3SGKC 3Q2WA 1BVZA 4Y9EA 4I3RH 5D1QC 3FCUB 3R06A 4PSRA 3S3CB 4NWUH 4PB9L 5F70A 5C9KA 4NUGH 4WW1B 3SQBB 2AQ1A 5GZNA 5IVOA 3MRDA 3DOSB 3FU8A 4JO3H 3O2VH 4IIZA 5HGAA 4H0GA 4HD9A 4WJKB 4Z3IA 2CGZA 1KELL 3ORJA 2XIDA 1FN4B 4OJEH 3FQUA 5F7UA 1R24B 3SPCA 2IANA 1WT5C 5JLZB 3AY4A 3C12A 4RFEA 5EC2A 3MUGA 5F7WC 4NRXA 1PDKB 5KTEL 4NP9A 3FFCB 2EILB 5FUCC 4U1HA 3QQNA 1HXKA 1QRND 3HPJB 4NQDA 3TCXA 4IU3B 3NBNA 1JNNL 3NIFB 4QT5A 2W60A 4XMUA 2K7QA 1EBAA 4NZUH 4YBLC 5HYIA 3AU1B 4NB7A 2R29H 5AOMA 5C08E 2NZ9C 5D1XD 3RWEB 1OK8A 4N1CA 5FOJA 1LO5B 2YZ8A 3MTXA 5CLYA 1DBBH 1LVEA 3KW7A 4W4NA 3IETB 1TETL 3AXLB 2JKNA 5C0AB 3VFVA 4EQ2A 2RQ8A 3ZK0A 1SOKA 4WWNA 4Z23A 1QX1A 2L04A 4M8QA 4TLKA 5EU3B 4Y4FC 1GW6A 2XZQL 3VH8A 1X5KA 1NCIA 2VNCA 3UTZB 1KCUH 3BVTA 4HJ0C 4MMZB 1NCDH 1IAOB 1UACL 3UPRA 3OBAA 4JFQB 1N0LB 3CBKB 3HIZA 1FYHB 2YWZA 2H3XC 4JKKA 4P5TA 5B39G 3VI3F 3WD5H 1AC0A 3KVDD 2W94A 3LN4B 3STBA 3QVAA 4QRPB 3IDIA 3CQPA 4HX1B 2A9DA 1XEDA 2GSGA 2H9GB 3CHQA 4S1RL 5FYKE 1FFPB 1JWMA 5IHZB 2MWCA 3NJLA 4JPWL 1I1FB 5FPIA 5IMMB 4Z0XA 3HE6B 4AI7A 5GZOA 3MLSL 3DPBB 1F3RB 4RDQG 1XBRA 4OVVA 2VYRE 1P4LA 2K70A 5KN5B 1BZ9B 3RIAK 2XQBL 1MXGA 4HFWA 5B7FA 4OLWH 3TP4A 3UEZA 1K5WA 3QIUD 1JYXA 5TF1H 4NKQB 3QZBA 4CSZA 1XV8A 4WI7A 1PF3A 3TA4D 3GXIA 1WF5A 3O9WC 1KN2L 1DO5A 5F9JB 1WA2X 2CDFA 2CM6A 1TQTA 5I73C 2GITA 1QD0A 1K2DA 1BA9A 2Q0ZX 4GUPA 1DJYA 4IOSD 4JRXE 4KRLB 5DRWB 4GI8A 4AMKL 3R7RA 5HYQA 1KG0B 2WYZA 3D39E 4BKTC 2J12B 1KYAA 1JRHH 3ZR5A 1R75A 1DQQB 2LAGB 2A73B 4C83B 1DFXA 3H7BB 5J6GA 1KXHA 4BFRA 2WVVB 1AXTH 2V7HA 5MEPA 1JGLL 3MPCA 5CP3A 2D7MA 1H3UA 1LDPL 2CU9A 5BVJA 3E7JA 1MF2L 2APFA 5IIEA 1DL7H 4MZRA 4FNQA 1CDBA 1UJ3A 2WLLA 4ZMAT 2WKOA 3C60B 2VJXA 3TBSA 2A83A 4RESB 3U0WH 3BKMH 3EBGA 5B1BB 4LDEB 1OWWA 2D4DA 3NAAL 4WJG3 1DSFH 3UAEA 3POCA 2AHIA 25C8L 1W72A 2CK0H 4K3GA 4LIQE 5F89A 4UTAL 5EN3A 4A6YH 3QDGA 1E2VA 2OMZB 4E5XA 2EKSB 3QRLA 5C0FA 1D5MB 4X6DE 4CVZA 2CDEA 1MJJB 2WVUA 3CC1A 3VM5A 4JM2F 1O9WA 1JPTH 1FL5B 2FWOA 3RDTA 4HUWB 1SNRA 4NN6B 5C08B 1LGVA 4G6MH 2WZPA 1QRNE 2ZX6A 3PJNA 1LE5A 3BSZA 4Y16D 2HG5B 1TYRA 4I0PA 5CIPA 5GS2H 1MQ8A 1UB5B 4MB5A 4WJ5B 2UXGA 3EJJX 1WTGT 4NQCD 4QRUA 3RY6A 3SQRA 4KNUA 2BS9A 2HLEB 3QJHB 5D7IF 4HJEA 3FB5A 2MQ3A 1WE5A 1BIIB 4AIXA 2GIYA 3PHQB 4LVNB 3C87A 2CJUH 4KJYA 5FM5O 5GJSL 3LPOA 4WI2A 3R4DA 1CPUA 1M6OA 1MAKA 1FH5L 1RXLA 4D3CH 1YC8A 3QCUH 4PRPB 4KDTC 4JRYB 3BAJA 3UC2A 4DH2A 4G8FA 3CWGA 3T0ED 4GBXD 5DJAB 3QEUA 1PG7L 1B0IA 3B9KB 4QTIL 1R6VA 1YEGL 2DH2A 3TEXA 3ISYA 3LZFH 1GHFL 3L5HA 4AVJA 2EUXA 5FO7B 1KEGH 3B1TA 3QEHB 2VDKB 3MR9A 3TA3D 2VDKL 2QSCH 5CU5A 2IH3A 4TKWA 3C08H 4BXVA 1YC7A 4YDVB 2CPUA 4DP5X 5D1QA 4HPOH 5HYSA 3Q8EA 4NHUB 4DJMA 3OKNB 3SEPA 4YZWA 3ARQA 4GPVA 3SCMD 3QO0B 2BXZA 4HF5H 4LNVA 4Z8FH 3KZ8A 5IB1B 2FVNA 2J55A 3ILPB 5F6HJ 5MEOB 2XBZA 5FXCH 2XY1A 3IDMA 2HT2C 4KY1L 3VSQA 3NYKA 4I0CC 4XMLH 3QO1A 4XWGH 1WT5A 1PKQB 3O6MH 4M1CC 4UQDA 5I0VA 1UG9A 4NHCH 5CZVH 4I3RL 5ACLA 3Q1EA 4D0CA 1UURA 3L17A 1T22B 1URZA 1YEEL 2B4CL 3FO1B 8FABB 4BK5C 3RI5K 2IMMA 3S34L 4Q9RL 3GTTA 4A7SA 3DJRA 1BEYH 4IRZH 5D2NC 2BMKA 3VWKC 3F5WA 4GRLA 5EIIA 1XF3B 3QDMD 4OF0A 4OGAD 2HMIC 1VFAB 3FN9A 4PLJD 3TBYB 3BN9D 1UFUA 1UZ6F 5B8CC 1NANI 4O02A 5AVSB 3JVFC 3PHOB 1G0YR 5JW5B 3JV6B 1CDHA 4LLQA 2KS0A 2MCMA 5FO8A 4JY5L 4LIQL 2HJLA 4X6DB 1JXGA 2AQSA 2COQA 4JREB 5DD3H 3TPUB 4XZUB 3BP7B 5CEZH 1QW9A 4EZMA 3IDGA 3P11L 4LBAA 3RWIB 3VFRB 3WFHB 1S7UA 2EECA 1WGVA 4YDLB 3ULSA 2CO3A 5MEQA 1WBXB 1FBIL 1BOGA 1BM3H 4RX4A 4P2OB 4XNBA 1AD0A 2YEZA 3NFPB 3VDAA 1KCUL 3EJZD 4Y1TA 3N44F 4NM8L 4E9XA 1NOFA 5BZZA 2K45A 3BH9A 1BAWA 3KLHD 2X89A 2FQEA 1E67A 3IBEA 3APMA 5SWZE 5JDSA 4XRCB 5GGRA 2X1PA 1BXUA 2EC8A 3VDBA 2ROXA 4PJFE 5KYYB 1HESA 3EH4B 4AX3A 3U0TA 4U6YA 2NY3B 1NIEA 3WUZA 4KOBA 4NQDD 3P2BA 4V1DA 3TFKD 3ZE0F 1ZMYA 1L9TA 3U30C 1FNAA 2E4FA 3BT2L 3OR7B 2JB5L 4XXDB 2R59A 5DUPL 3NSFA 2ZZUT 3DROA 3WIHL 1TJMA 2LLLA 2NYYD 3BZEB 3C6LB 3T0EE 4N0UA 1LTXA 3VAEA 4OLWL 5MP6H 4J39A 3QYNA 5DJDA 3MRIA 1TR7A 5JPMC 2WYHA 3VW3L 5DHXB 1M71B 4J7RA 2UXFA 4XVSH 1C12B 1DVUA 2BFVH 3NESA 4O9HL 5C0IB 3SKOA 1KJMB 4X9HA 5E1QA 2JJTA 2VLKA 3K4DA 3E38A 3W57A 4MCNA 1UD3A 4YBQC 2Q2EB 2AJSL 4TNWF 1V5JA 1AJ7H 1ANUA 4HWZA 4R5XA 1U93B 2V4LA 1DBAL 3GZPA 2OMUB 1PEWA 4J6RH 5AW0B 2Y06L 2NY1D 2V8LA 3F7YB 3FCSA 4KROD 2R0ZH 4Z7WA 2GTWA 3FT1A 3HAEG 1JRHL 3D87B 2X1OA 4YSPA 3UTSB 4L0ZA 4GT0A 2VUOA 3X11B 5DK3A 3CSYB 3UAAA 4AT6B 1EK3A 4O2CA 3FPXA 3DIDA 1DL7L 1F90H 2QSVA 2XWCA 1LO3L 4D0DB 2WIMA 3BAKA 3JWDC 4PU2A 4QNPE 1JFHA 1MFAL 1XGQA 1BMZA 3N1PC 2IG2L 4ECNA 3HZYA 3V7MA 3DV4B 3MRJA 4LSQH 2XICA 4G71B 1G5GA 3X1GA 1V8HA 4MAYD 4A6YB 2D7PA 1NIAA 1J05B 1GPOH 2FZ3B 3ATDA 4A6YL 5IKCB 1E6OL 2JB6B 3K46A 2ZOTA 1F4AA 3FONA 3ZR6A 2WP3O 1AVAA 1JZFA 3GBEA 3SE8L 3RHWF 1BAFH 2OSXA 3N0AA 4G6ML 4LVOC 4U1MB 2R0WH 3EG9B 5EZLA 2YPLA 4GSQA 2VOTA 2FD6H 3KJ6H 4XVUC 1NCWL 2BK8A 4LLYB 2OMNA 1YZZA 3DHMA 1PAMA 3N1MC 2BHZA 3EUUA 3LRKA 4U0RC 3PWVA 1NDMA 2J1YA 4ONHB 4GO8A 1Q4NX 1T2QL 2CLRB 5J1SC 4BFIA 3WLBA 2VDOH 4RGOH 4JFTA 2P8LA 3VRLF 4D2NA 4BKSC 5SWZB 1A3LH 1IGTA 3VH8G 1HHGA 4FFWD 4D3CL 2BZDA 2ADGB 2C7UA 3KL0A 4AGNA 4PJFB 4FHBD 3WS3B 4EXKA 2AJYL 1YVLA 5GPRA 3T6ZA 4FZEL 3SGJA 1PZ5B 1N7MH 1MLBB 2OTUB 3TVMB 2Y7NA 4YDMA 3RB7A 3LZFL 1CLOH 4UIMB 1T3FA 3S8FB 1FCCA 3AT0A 3KE0A 1Q0EA 4TTDC 5E2TH 3U4AA 3BCFA 4UNTA 3D0VB 5A2FA 4YE4H 5AAPA 1SHMA 3UTQB 1DEEA 3L7FB 3VFNB 4A2FA 3AADB 4D0BA 2ZXEB 2A9BA 1J87A 3SDYH 3BPOC 3ECBA 4GW5B 1IAIH 2VITB 3QHTC 2XG4B 3BZDA 1AIFA 4JX0A 4RSYA 2TRYA 1LO4L 3J07A 3RBSA 4Z8FL 3BIBX 3GSRA 4LPCA 4GRLC 2QEJA 4E36A 1HKFA 3TNMB 1QSEB 3H4FA 2IDFA 1TSRA 5D2NA 3VWKA 3O3EA 4XMLL 2OI9C 1QQDA 2ADFL 4DQOH 4GG6B 2BHYA 5B8CA 3CAFA 2Q3AA 3EOTH 4MSWB 4X9YA 3N41B 3RVXD 4KX7A 1BMGA 3Q01A 1UYWH 1F11A 1B0RB 5E1AB 3V4PH 1EFXD 5DD5H 2BWQA 4U1JA 3QYMA 1U4FA 1FF5A 5IG7A 1U8OB 2D2OA 4OF3A 3OKOA 2APTA 2FEDC 2R2EA 1F2QA 2H6OA 3IFPA 3F64A 4X4MA 2Y6SC 4MD5A 3AJ7A 1PZUB 5GISH 4GUOA 5IW1B 4I48A 4MAUH 5EIQA 2FJGA 3ESNA 4JDZA 3V6FA 3EYSH 4J6IA 4FKKA 4PTUA 1EGJA 3VI3E 2PYEA 5FK9A 1KXVC 5JO5B 2JCCE 1RQ5A 3MXWH 5DD3L 3UPCA 1WISA 5DZ9A 2WO2B 3KWTA 3C2SA 4BEIA 2NTFA 3LHPL 1BJ8A 3QI9B 5D2LA 4DW2L 4E5XG 4AENB 4UM9D 1CICB 5EUKB 1V10A 2QDWA 3L45A 3MRKB 1BQUA 3DMMD 1WCBA 4EOWH 4FQQB 3B3IA 3FT2A 2RTTA 1T83C 1K6QL 3L3JB 2YD8A 1BVLB 1B9KA 1E3ZA 5D72H 4XBPA 4X6CA 5DWPA 3TESA 1E4XL 4N2DA 3UYPB 5A6MA 4PVMA 5KOMC 3FQRA 4ZFGL 1IGJB 2DLGA 3VFSA 5EZPA 4ODTH 3ZL2A 3KYKL 4MMZC 3VQMA 4HAFA 4PREA 4ACTA 4CVXB 4C4KT 5JPMA 4WEBL 1HE7A 3IM1A 4PB0H 4YXLH 2NLJB 2PWGA 3FTUA 1J0JA 1N8ZB 1BLNA 1OW0C 5HVWA 5J9PA 4H44C 3SPVB 2IGTA 2VJ8A 3HN8A 3EKCA 3JWNH 3LIZA 2OYKA 3DUSA 4WHTB 3HE6C 4J3TA 5FWRA 3RGVD 4HWNA 1VFOA 1WHPA 5I2IA 5DJ6B 2YSSB 4OLZL 5TDPA 1JI2A 1QASA 1K72A 5I1AB 3DYPA 4OGXH 3BFQG 5A16A 2ICES 4XVSL 3RKPA 4BUHA 1NKGA 1XT5A 2AV1B 3DIFB 5L9DH 2NQDA 3DRQB 3CV5A 4NQXB 2TSBA 3P0VH 4ZAKD 4NUJA 4KK9D 2CIKA 4PV8A 4LASH 5ANME 4DAGH 5TPWL 4U3SA 5HYSG 4W9CC 4BBWA 1YPZF 2VW4A 5M95B 3GMNB 4JFZH 3MV9E 3TBVA 2X89D 5D7SH 2OMTB 3IE9A 2ZPKL 3EZJB 5AEAA 1U91A 2ICCA 4RMWA 3MA7A 3GMQB 3GZKA 3C8KA 2DMCA 4XN2A 3IFNH 1FPTL 2YUWA 1FO0B 1JPGA 1G1CA 2DLTA 2BC4A 4O58H 5FHAH 1NQBA 4BKLA 3D08A 1FO0L 5EZJB 1UEYA 4UTCA 5CLTA 2I32A 4AV4A 2EVGA 5DK0A 3MNWA 4WKZA 1DVQA 1I3GH 2ZCLH 3MZTA 3TBWB 3WNLA 4RAVB 1GMIA 1U9KA 4L4VB 3VMNA 5KVDE 3GEWB 4OQTH 5FLUA 5D7IE 3VXMD 5M7QA 4LSQL 5T1DH 4OLEA 5KOVC 3QRBA 4PR5B 3C60C 1WZ1H 1OCRB 5EIIG 1U8HB 3GLDA 1HYSD 1MN4A 2OL3B 3VI3B 4K9EL 3DGGA 1KB5A 4JANB 2IALB 1S7WB 4F33B 2OL3L 4UQ2A 3DETC 3NACH 1NGXB 2R9HC 3FULA 4HC1L 4QD2E 1NAMA 2DLHA 4Y9GA 4YXHH 4APQD 5FECA 1CGXA 5D7HA 1P7KA 3EXJA 4NN6C 4DK3A 3IAQA 3CLWA 2WUBL 3BUYA 1ZJBA 2WMPB 4PGZA 3NSYA 3W0WA 4F1SA 1F00I 2MHAB 3BT0A 3SDDD 3OC8A 5E2UH 4GAGL 2GI0A 1XCTB 4M7ZB 3U83A 2J44A 1RVFL 1JFQH 5IVZA 4LVNC 5C0RH 4J28A 1E5UI 4HU8A 1MHHA 4XPTH 1CD1B 3MUHL 4XWOC 3X13A 2FHCA 1S5HB 1Z0MA 1NEZA 1ZVHA 1GC1L 3O45A 4MD0A 1BPVA 3PWLA 3K5RA 4I2XA 1JPSH 1I9RL 1CLOL 1AXIB 3ET9F 1NCTA 3GD1C 2NRDA 3IFOB 3KBHE 1KUMA 3B9KC 3QQXA 2CUAA 3L3DA 4FQ2H 2HVKA 3DKHA 3GGWB 4FJ6A 2Y1AA 4U6TA 4EI6B 4PVBA 3NCWA 3QQ3A 1NGZB 2BCKA 4F7MB 1UH3A 4FP8L 2MTAA 4BH7B 3B2XA 3IJEA 3N6YA 1R0AH 5EEUA 1H8NA 1PD1A 2BJMH 3GXPA 5HGBB 3KYMA 1MCWM 5FGRA 3INUL 5JTWA 4WW1A 2CNYA 1GGUA 3VACA 1EBPA 1I1AB 3CBJB 3CVBA 4QHLB 3MV9B 3DOSA 3QXVA 3M88A 1H5BB 1W0WB 5C09E 2A99A 5SWQB 1YNKL 4FN0A 1FN4A 3N85H 2MSPA 1CF8H 3ZE2F 4Y5VB 4GT7A 1R24A 4JM2B 4Q9QH 5JLZA 3TJEH 1UYWL 2B4CC 2ESVA 3FFCA 1T5XA 1JK8B 4L3EA 4X4YA 4KJQD 1G6RL 3HPJA 1U42A 2DN7A 4IU3A 4L9LB 3BHBB 3ZQXA 5DJXB 1GYUA 3V0DA 3UO8B 2GC4C 2MMXA 5T33H 2O30A 5D7IB 1NJ9B 3AU1A 4EUPA 4PPTA 3OWRA 2YGOA 5KVDL 3RWEA 1SXZA 1UGNA 1ZHKB 2WIIB 1VADA 4MD4A 5JMRA 1LO5A 4RZCB 4GW4B 2PO6B 4BRVA 5C0AA 2RMNA 5IFAL 4W9KC 1ZK5A 4X42A 4NXSA 1XDTT 1E8YA 4IDJL 2B1HH 3WMSA 2H2PD 5EU3A 1QUNB 3HR5B 3UTZA 2J5WA 1FLTX 1IAOA 1CR9H 1R5IB 4JFQA 2G4EA 1N0LA 4OT1H 4EOWL 4N8VB 3ALXA 4F93B 4WFED 3ULVF 3LN4A 1A6TB 4QRPA 1TVDA 4QRBA 3V55A 4OM1H 4YDLC 5C7XH 1OW0A 4HX1A 2DEWX 4JB9H 5ERWB 5EPMA 3LRMA 4ZNEA 1XFPA 1FFPA 4Z95L 5IHZA 2JIXB 4FADA 4TS6A 1MFCL 1MUJB 1I1FA 4KXCA 1JXFA 5IMMA 1ZGLP 2VDQB 3DPBA 1TJGH 4JR9H 1HZKA 4OV5B 2FGZA 2F8XC 2VDQL 4DOHB 2KH2B 3FYIB 2DJMA 2WB1A 4JQVC 4YXLL 1DJGA 3BO8B 4JUSA 1OGPA 1TTAA 4HUVB 3W39B 1ROCA 3N9GH 4K5MA 2AXFB 3TO4B 1XIWD 2AEQL 4NCC2 3U1SH 2EUWA 2Z0BA 3MLRH 2NY3C 1CZ8L 2ZX5A 2IWGA 5F9JA 4D94A 1GGCH 1MFMA 1P6FA 1DQKA 2PW1B 3AG4B 1OP5K 3AWFA 4JW3A 3MQIA 3N55A 5DRWA 5L2KE 2F53E 3C6LC 3SGEI 1NSNL 3NOIA 4AYBA 2PLTA 1KG0A 4ODWB 3ZOAA 1CFVL 2IXQB 4QHMB 1NFDF 1QLEH 1U8IB 4U33A 4PJ8A 2DTMH 1DQQA 4PVLA 4EEEA 1NLDH 4C83A 4LASL 3H7BA 4I77H 4FQ1H 3Q5TA 2MKWA 2WVVA 3OLEA 1OSEA 3QIUC 2X88A 2VE6B 3VRJB 5C09B 1LHZA 2R1WB 2XX0A 3IDXH 4UMSA 1ZSDB 4JG0H 3MRBB 1OQXA 1XH1A 4LPVA 3X3FH 2ENSA 3C09C 3C60A 3IFNL 4L4TB 5HVHB 5DD1H 2FX9L 4ZS7H 2VC2L 3AABA 1N6QH 1LP9E 3HFML 4XI5C 3BGAA 4Z7OF 3L54A 4ONOA 2OMZA 4KV5F 2EKSA 1NBVH 4P46D 3WKMH 2YGNA 3SDXF 4K71B 2ZP8A 4JG1H 1MJJA 3IRPX 5GRUL 2FSEB 1FL5A 3C2AH 3DX4A 3FQ2A 4HUWA 5C08A 4FDWA 4B97A 4R0LB 3N44B 2DQUH 4L3AA 1WZ1L 3US0A 2NY5L 4EZLA 1OAUH 1UB5A 3MVSA 4WJ5A 5HDRA 4AYDC 1KBBA 3VFUB 2ZXBA 4OB5L 4WFFD 4JFYB 4XE0A 4ZO9A 4JGNA 1S9VB 2VR7A 1MFNA 2ZUUA 4NGHH 3QJHA 4YXHL 3UYOD 1BIIA 1XAUA 4FYRA 5IOKA 2DQ6A 1FFRA 1INDH 1HAUA 1L0YA 1RU9H 5AZ2H 3ZE0B 1PBYA 2Y36H 2IC2A 5TJWK 4JE4B 1LO0H 1K5NA 5EDXA 4E41D 1YAZA 2MQGA 3P69A 2DI9A 4PRPA 3U1PA 3ZIYA 1HWHB 4JRYA 2G2PA 2CO4A 3T0AA 5ESAA 1CT8A 3JT2A 5F7EL 4X9FA 3WNOA 1RLBA 3B9KA 3UYRL 3F58H 1JPEA 1V27A 2NW3B 1GL4B 4NN7B 4PVNA 5FO7A 2FJFB 3QEHA 4KJWC 3RIFK 4UIKH 5K1NA 2YXWA 4BDVB 1MFBH 1IVLA 4LRNL 2OZ4H 1ZGLB 3LN5B 3IMSA 2R7EB 2EVHA 3CPLA 2C3VB 1PPIA 3FRUB 1CN4A 3MOBH 1FZOB 5L0QB 3NJJA 4YDVA 5EFIB 3V8OA 2HCZX 3ARVA 4AITA 3CFJB 1QTSA 2LU5A 2ZUVA 4S1SL 4HOZA 5I66B 4NHUA 1SEQL 1JPSL 3ZDYF 3OKNA 1HWWA 4FQ2L 2F7PA 2G3NA 1OE1A 1ZT1B 3CSGA 3GKWL 3QO0A 3GJFB 4PS3A 3TVMC 4Z3EA 1G1OA 2LAAA 1M2OA 1NGQL 3ILPA 5MEOA 3V8CA 5L2KB 3I75B 4P9HL 3IWVA 1E5CA 2BY1A 2F53B 3K3QA 3P4MB 3NA4A 3T0EC 3D4CA 4JFED 1PKQA 1MI5A 4XBGA 4N2IA 4CC0A 3TEWA 1B4LA 1R46A 2Z8VC 1AYRA 3P4OB 4WUUD 5ILTL 3TA3C 1A1MB 1T22A 3FO1A 3Q2CA 8FABA 1DUYA 2BNQD 1U6AL 4P5SA 1IEBA 3CH1B 2YKKA 5I6NA 4YSUA 4IRJD 2BS71 1Z5YD 1BVKA 1P84J 3STZB 4ODXB 2R4SL 5E94B 5DQJB 1VFAA 4FNSA 3TBYA 4HKXB 5HYJB 5HHXH 1TZAA 3WFDL 5KVEH 3PHOA 1JTPA 4YXKL 3N1FC 3JV6A 2V9UA 5HTSA 1MCFA 1Y6KR 4OLYH 4I89A 4QHUB 4KVNH 4X6DA 2XKUA 3BVWA 3LZLA 4H8HA 1G87A 2R29A 3RWJB 3TPUA 5T33L 4MJ4A 4XZUA 3BP7A 4HKJA 3FS9A 3FB7B 3J8F7 4UNUA 4R90H 3RWIA 1BGXL 4Q6YA 3T0BA 3WFHA 5IB5A 1QFWH 5TK4A 5C3LD 1MRCH 4NZJA 4X7CC 4N0YH 2ZP0T 1WBXA 2N59A 3B9AA 2ZNWA 4JFDD 2MCPH 1UZ8A 4P2OA 1P4BL 1G1KA 3NFPA 1KTRL 1OT4A 4PLJC 2K8QA 2VISA 5J13B 1TOXA 3BWZA 3PWUB 3E6HB 1AO7B 2OS7A 3VSUA 2L7JA 3IJ7A 5GS0D 3G08B 5BNXD 3QI9C 3HEIB 3BAEH 3SQOL 1GGTA 1UCTA 3ESMA 1WIPA 1CICC 1DLHB 1W8EA 4N25A 6FABH 2X4SB 5EF0A 1TZHB 2ESVD 3FH8A 3LTVA 2QPFA 1LNUB 1VPOH 4L3ED 4Y2DB 5T1LD 3ZTNL 1DBJH 1J1PH 4M4RA 1ERNA 2R1YB 3TV3L 2O5ZH 4NBZB 3G3LA 3KWWA 4JO8A 1GGIL 4MX7A 3WFBH 3WIHA 4XXDA 4L1HA 1E9OB 2JKRM 5KSBA 3IPFA 1Z66A 3C6LA 2IQAB 1JF5A 1MCBA 3BQVA 4UT7H 1HCFX 5CWSA 3W1ZA 1E27B 3M1BB 3U1QA 1JDAA 1V3MA 5D96B 4A7QA 4M7LL 1WA0X 1E42A 3D8MA 3LMJL 3HNVL 2HTLC 2Y7QB 3QCTH 1M71A 4FKHA 4OZFB 2I60H 1TTUA 1GGCL 1C12A 2R2HA 2Y7MA 2BVPB 2YXFA 5JOPD 3CXDL 1KJMA 5CM1A 2WLJA 2JWYA 4NT6B 2VKXA 4BQBA 1QHOA 5BS0B 1XIWB 1DP0A 4LLAA 4ZOAA 1U93A 1GW0A 1UM4L 2C26A 4GINA 3VRIB 4XNDA 2OMUA 2NNAB 1NEUA 3TFKC 3F7YA 2X4RB 1IVTA 3EJYD 2DTML 5IGXH 1NLDL 3UTSA 4AW4A 4WFGD 3X11A 2WXLA 3CSYA 1TJIL 2VDPH 3I3DA 4AT6A 4XNQB 3QWRA 4WUUE 2YGPA 4TUKH 4W4OC 1NTDA 4F9LA 4D0DA 5IOPB 4OZIA 3AGWA 1CDJA 2BNQE 2Z1PA 1XMWA 3J7HA 5H94B 5DD1L 3DV4A 1N6QL 1KGYE 4OCWL 3N5AA 1MJUH 3P9LB 4A6YA 3KL5A 2VW7A 1J05A 2FZ3A 3BWAB 1OT1A 3DXAD 5F0LB 1P6WA 2JB6A 2ZG2A 5GGVL 2NY1C 3PRZA 3ULVH 4TUJB 2RCSH 4KQ4L 3CHSA 1RURH 4KK6D 3WJJA 2H5UA 3QUML 4U1MA 2K6WA 1THAA 2NCEA 3FTWA 4NO3B 2AGJH 4WO0A 1KCBA 4LLYA 1PZ3A 3EDFA 5AB1A 2HT4D 1WFOA 4EUPG 3S3DB 2YLKA 4PJ8D 4QXGL 3SE9H 5HY9B 2FGWH 3H2QA 4K9EC 1U95B 1ZVNA 2AABH 2ZE0A 1M3JA 3KPSB 4RGNB 3A6CH 4ONHA 1J9CT 5GRZA 3T3MB 1YMHA 3LRLA 1DVFD 1INQB 1RU9L 2EC9U 3HI5L 4ZS6D 2DMBA 5INCB 4F7CB 1RUQL 2AKRB 4JFDE 3GZQA 2ADGA 1WG3A 1YJDL 4P3DB 4PJFA 3OV6A 4L5FH 3WS3A 3KPRE 3NEEA 3S37H 5D6DC 2VXUL 2YD6A 4IOIB 3ES6B 2PCFB 4HUMB 3RILA 1PZ5A 2OTUA 2DWEB 3JZ7A 2C8NA 4FA7B 3TVMA 3AFLA 4OZHF 1WVZA 4UIMA 1OP3H 3F84A 4M7ZC 3HR6A 2P7TA 4Y7MA 1MFBL 2Q7YB 4X7SH 4WI9A 1H0DB 2XQ0A 3IJ9A 3UTQA 2Z92B 1XF1A 3L7FA 3VFNA 1YPZB 3NGBB 1JHKH 2ZX9A 3MN8A 1H15B 1OHZA 2YK1H 3QC6X 4GW5A 2VITA 1DE4B 4R8WH 2XG4A 3B5TA 4NQEB 3L08A 3WFCH 3IF1B 2CXGA 1IAKB 3KXFA 4KMLB 1DQTA 1R5VB 5DUMH 4KK8C 4MJ2A 4AE1A 5GRXG 3UTPD 5B1KA 3TNMA 1QSEA 2XZCH 3NCEB 4NSKB 1D9KB 1R1CA 3P0YH 1Z9SB 1SJMA 3LEVH 4JY6B 1X5ZA 3BUBA 2W80C 2C3HA 4GG6A 5K59F 1E4WL 2HJKA 4FF9A 4GRWH 4MSWA 1SF3A 3DARA 3T04D 4F24A 4S1DD 5I1CL 4MGXA 1B0RA 1T0NB 2V6HA 5E1AA 3KNBB 3FB6B 3GS0A 4NO0D 5T1KD 3QUZA 1U8OA 3C6SB 3P3RA 4QHNB 5AKRA 3T08A 4TULH 1I1AC 3V4LA 4ZFOL 4YFLI 1H5BC 3ME0B 4WFGE 5BRZD 3GTNA 3LEYH 2FTAA 4P4KA 1XGYH 1E4XI 1P5VB 4Y5VC 5HHXL 4JM2C 4G70B 2OW6A 4TQIA 5HVGB 1SVZA 2CLZB 2DQTL 4PG9B 3PNWB 2HTKD 3QCVL 1H6EA 4LKCB 5EBMA 3D3VB 5E6ID 2ZJSH 3MBXL 2YPVH 4WNQB 1IE5A 4L9LC 4TOYH 3RVXC 3QI9A 2V8MA 4WGVB 2WVSA 3W9DB 4AENA 3DXAE 1ILUA 3GDBA 1MI5D 5EUKA 5I1DB 3MRKA 5E5MB 4Y5YB 2GJ6D 1DQLH 5E2VH 2VRQA 1KGCD 3DGDA 4FHKA 1MFEL 4I8DA 2PPAA 3L3JA 2VZVA 2PO6C 1P0SE 3LEXB 3ZHLA 5I9QC 3O41B 3UYPA 5KYWB 3GUTB 2QV2A 2FQDA 1T6VN 3V7AE 1ZA3B 2WAHA 3MLVL 3BAEL 3D2TA 3C5ZD 2NX5B 4ZMVA 4MS8C 1TDQA 1U30A 3KPNA 2L4OA 4PJGA 4CVXA 2WBKA 3KPRB 1J86A 1XXFC 3SDCD 4JFFD 3B2UC 4EE2A 3C6EA 3HJEA 1N8ZA 5DMIH 1A9EB 3NJMA 1FNGB 2JQAA 5BRPA 3U9PH 1J8HE 4FXGB 1A4AA 4CU8A 1NFDE 4MA7H 2VH5H 3SPVA 5IJCC 3KDPB 3RKDD 3HZVA 3VFMB 3TASA 3WO3B 2IADB 4UOZA 3W9EA 4WHTA 3VVWA 1E28A 3BWUF 2XN9E 5DJ6A 2YSSA 4B9ZA 5AALA 3WN5B 5C9JB 3FN0H 4HZAA 5KBNC 3WL9B 1RCYA 5I1AA 2VM3A 4XCYB 1XEUA 2WBJA 4U3HA 1FFOB 3MUZ1 5AAMC 1FRGH 3ZE2B 1XH2A 1N6VA 2AV1A 3DIFA 4POZD 3DRQA 4YLQT 3TO4C 4NQXA 3WSQL 1AAJA 2M8XA 5F3BB 3DDGA 1T4KB 4W4OA 3DTXB 4BFEA 3GMNA 3GXFA 3I02B 4A2LA 3RUGE 3MKGA 3QS3A 4KV5E 4UT6H 4Y4KB 4WSJA 3SDXE 1YUHB 5DK2A 3UC0L 4KAQH 2FECL 1J5OH 3UTPE 1IIKA 5A2IH 4JVPA 5HDWA 1X5IA 1NCBL 3TPKA 3T2NH 1MRFH 1R34A 4Y7OC 3BLBA 1CI3M 4NENB 3HN5A 4P2RD 5EZJA 3X17A 3G7TA 4YSCA 1FAIL 2N4IA 3OJDB 4NWTL 3TBWA 4FA6A 4RAVA 5DQDL 1L4IA 3H55A 4L4VA 5JHAA 4ZAKC 4P5MB 4I1RA 3RX8A 1MJUL 4PR5A 1C8QA 5HVHC 4TTGA 2WWOA 2ROYA 4Y4HA 4QYOA 1CDIA 2AITA 3HG1E 1S3RA 1DFBL 4NO2B 5BRZE 2IALA 1S7WA 1UB6B 4F33A 3ULVL 1QP1A 1NGXA 4R2GD 4N0FB 5DEFA 4K71C 5CFAA 2F8OA 2EH7H 5LVEA 2AGJL 4RETB 5I26A 5AVUB 2NY5C 1WLHA 3RVUD 5AW8B 4R0LC 2WMPA 5K9QG 2CKBB 4IRSD 3KHQA 1VKXA 2MHAA 2CKBL 1HDMA 4IMKC 3CFEB 1E8ZA 4LSPH 2DEXX 4JS7A 1SN0A 1UH4A 4FNLL 4BUGA 2IH1B 2GJ6E 1KGCE 3TS8A 3OG6B 4TSBL 3DBSA 3ARRA 4EDXB 4NJ9L 4JDVB 3ZW3A 4KQ3H 5AYTA 5C07B 1PGRB 3LZQA 1CD1A 2ZUWA 4GLRI 1T6WA 2RB8A 1OTTD 4GI9A 1S5HA 2ZSVB 1DCLA 3IS0X 3QORB 3D4ZA 2DIEA 4P48A 1J8HB 3K74B 3DRTB 1NFDB 3HC3H 3NFSL 1KIUB 3KGUA 5EN2A 5GGUA 3WTXA 4QAMB 2R2CA 3GGWA 4JFFE 1QSVA 4X83A 1VGKA 1OGSA 4X7SL 4EI6A 5IEKB 4NN7C 2XN9B 1W6LA 1NGZA 4G42B 1EX0A 5GS2D 1U21A 1UM5L 1XF4A 3FW6A 1U8KB 2DQGL 2GUOB 4BH7A 5GGVY 1RSYA 5IUCA 4UDUB 5ACMA 3ARFB 3MRQA 5L0QC 3RWDB 4HW6A 2IEPA 4XP6L 5IWLC 1HCVA 4IBWA 5CGBA 4JPIB 5DUML 2V5MA 1JZ8A 5AOKA 3WTYA 1I1AA 4Z7OB 4NLAA 4QHLA 5E9NA 4P9HC 4MJ6B 1W0WA 3TJHC 4OCSH 5FGCB 3LEVL 5SWQA 2WNGA 3SDXB 3CZUB 2F15A 4Y5VA 1CE6B 4JM2A 4P2QD 1A0QL 3QJSB 3E3QE 1Q0XH 3GLAA 3V4PA 1T21B 2HB0A 4AEHL 2KZ1B 3MODH 1JK8A 4FJZA 3MLYH 3D05A 1B4JL 2BZ7A 4L9LA 4TQEL 4D8OA 2Y7SA 2WCSA 2YGQA 4W68A 1IFHL 4WEEA 5SWSB 4OTXL 5DJXA 4ENEC 5D9SA 3UAJC 4Q0XH 1A5FL 1FZMA 3LEYL 5D7IA 1NJ9A 5BVPL 4ZUSA 2J73A 1XCQB 2QV4A 4LSSH 3NZHH 1VENA 1ZHKA 2A9ML 2WIIA 3B6SB 3OKEB 1XGTB 3U36B 4F7PB 3NTCL 4RZCA 3HG1B 1A9VA 2PO6A 3RZCB 2Z7YA 1CK0H 3KXFD 3CX5J 3EFDL 2P5WD 4AGQA 3O0RL 2MNJB 4RISL 3WKQA 2X4OB 1QUNA 3HR5A 1R5IA 3OG4B 3PV7A 2D8KA 3WIIH 1WQVT 4N85A 1G0DA 1TQUA 2EXYD 1M4KA 4N8VA 3TZVB 2X6AA 1CGTA 1A6TA 3EJCA 3KJ4B 4XX1E 1T0OA 1PX8A 2GG1A 3LPPA 1FDLL 2A4ZA 3TCLB 2NT1A 3BVXA 5ERWA 1XZ0A 2MH4A 5EZOH 5AUMB 1LK2A 2J88L 3K7UA 3O8XB 2JIXA 5C6TH 3I6LD 3OXRB 3QUZD 1MUJA 4BZ1H 3ZDYB 3V0HA 2LTQB 5A7BA 1HWGB 2EDWA 1SM3H 5J13C 4OGZA 4MTMA 4LVEA 4L3CA 4X5XB 5JHDA 3S5ZA 2BPBA 3MNDA 3CG8A 3OSKA 4MA8H 4OLVL 4P4KD 5IVNA 1JL8A 4BFBD 3NFNA 5AAMA 1ACYH 3BO8A 5E9DD 3TWCH 2OJZL 4Q74A 4HUVA 1CF1A 4PW9A 3TO4A 5IVXF 2VH5L 4LNRB 4Y2DC 1EV2E 1U8LB 3D85B 4QXVA 1COBA 2PW1A 2MFNA 5CEZD 3L6FA 4NNPH 5AWNH 1AKJD 1BQKA 1SGKA 4CBPA 4R7DB 4XOCA 3BKCH 2BP8B 1J11A 1FLRL 2OR7A 1MCQA 4L3FA 4ODWA 1SYVB 5D96C 3T3PE 4QHMA 4DEUA 1XXDC 2VGLM 5GSRB 2A1WH 4M5YH 3VGEA 1U8IA 4CU6A 1DCEA 4I1NB 2J20A 5B4MD 4JK0D 3KBFA 3DX2A 2FX8H 4HH9B 3BP4B 5L8KB 2VE6A 3ZE1F 1IIIA 5C09A 2Q86B 3VRJA 5E8NB 5JHBA 2R1WA 1XIWC 5FFOA 2ENQA 4FS0A 4G1MB 3VD1A 4E42B 1ZSDA 1HL8A 3O3BB 2DLEA 4J3VA 4YL4A 2P48B 3ZZ1A 4L4TA 1J5OL 1MCLA 3B83A 1FFQA 1D6EB 3OMNB 3P2DA 4LCWB 3T2NL 1OAZL 5ID1B 1JGDA 1IGIL 4PGJA 1KPRB 2FEJA 3OKLB 1JUFB 1WC7B 3OZKA 4P2QE 4IS6A 3ZPDA 2JSFA 2VUKA 5CJOH 3OKMB 5DJYB 5TFSL 4OQTA 1ZLWH 3VXSB 5D7LE 1JV5B 2FSEA 4L37B 2BWIA 5EU6D 3FK3A 1CU4H 1MWAH 2C5DC 2D2CC 1M7XA 2WBJD 2WXIA 4UBDD 1PY4A 4HOWA 4IMKA 2ZOKB 3VFUA 3H0TA 2PETA 5CZRA 4JFYA 1BF2A 3SOTA 4CADB 1A66A 2WXMA 1BD2B 3MLXH 1CI5A 2F9BT 1KPUB 4HSCX 2PWHA 2O5XL 4N8CL 4LCCB 2QDVA 4R2GB 4PRAB 4P46C 1DJHA 2OYMA 5ECJE 5D6CB 5JPNB 3BYTA 5DGQA 3HZMB 4RGNC 4B50A 1ORQA 5TQ2H 2D7TL 2NW3A 4OFIA 2GIXA 3EH1A 3HHRB 1UHVA 2W91A 3C5JB 3WEMA 1SOSA 2FJFA 3MA9L 4IBQA 1ONQB 4BDVA 5LGKA 5GRYA 4LAQL 4PHXA 4HWEH 2HYMA 3LN5A 1ZGLA 1QNIA 1EANA 2R7EA 2YD7A 3HBZA 1E3FA 2C3VA 2DYPD 1YJDC 4MFHA 3GUFA 4E9LA 3LZRA 1S7RA 4MMXA 4Y4HD 5EFIA 1IQWH 5IWLA 3CFJA 5I66A 1QEXA 2WLKA 4FTVA 1R9FA 3ZKMC 2VR3A 1NGWA 1ZT1A 2X42A 2Y3NA 3KVPA 3GJFA 3LV3B 3RPIB 3VFGL 5E9DE 4NX0A 3BI9X 1WPCA 3IDYB 5FX3A 4OIIL 3MNVA 3M7OA 3PXLA 4FLQA 2F53A 5GRWA 3T8MA 2AAVA 3FQ4A 4AE0A 2YC1B 3UL4A 4LKXB 4G6AC 1GVIA 3F00A 3NGBC 2CO6B 1ZVYA 3FTYA 3P4OA 2OQJA 3F04A 4LHUD 2FR4A 1A1MA 5I1KL 4EBQL 2YRLA 4KK5C 5D5MF 4QHKJ 4R6UA 1RH8A 4CBZA 1AGEB 3CH1A 4YNYB 3UAJA 4O5LL 3IGLA 2EDOA 2FWUA 3GJFK 3OMAB 4L1DA 4IBSA 4RAUA 3K0WA 2CO7B 4XN9A 3I50H 3KW8A 1D9KC 4XMVA 3STZA 2NUPB 4ODXA 3WIFB 5E94A 1I8LA 1KB9K 5DQJA 1CXKA 3ZMRA 4HKXA 5HYJA 3FU5A 3MODL 4F2ME 5DHDA 1ZS2A 1ITBB 2A74B 4QTHB 4OLUH 2Z34A 5KVMC 3NJIA 3O6LH 1OGAD 3LKOB 1IBYA 3QDJE 4QHUA 1ZGLM 4N68A 5D7LB 4Q0XL 2WNXA 4HPYL 1LMKA 1Z2KA 1Z9NA 5I1IL 1AZVA 4K4KA 1CC3A 1O5PA 4LSSL 2KZWA 3FB7A 3HNSL 3NZHL 5LBSH 2X4QA 5F9AC 2DF3A 3CIAA 5E4EB 2YS4A 2MCG1 1AZZC 5IJVB 3RHWK 1ES0B 3UTTD 1QLRA 3RVTD 2XBDA 4QOKD 5EU6E 2DIJA 4IRJC 5EDSA 4GP5B 4APXB 2UZIH 2L7QA 4ZJ9A 4J4PD 32C2B 4S0SD 4XCCH 4J3BA 2ZF8A 2VXQH 4CN1A 1GTFA 4YS4A 3DSFH 4YSEA 3PWUA 3E6HA 1AO7A 3G9AB 4JGMA 3G08A 4OZHB 1HILA 4PJHE 4S1QL 3AVEA 2R4RL 5DMGD 1YN7A 1DLHA 4UYPA 5KEZA 1QBLH 3U6RB 1EHKB 2GBVA 2X4SA 4Y5YC 1I82A 1F41A 2R69H 1ZPLA 5FYJH 1LNUA 3I6SA 2VERA 1ZE3H 4ANUA 4Y2DA 4QCIB 1NLBH 3CFDB 4KRNA 2XQYG 4ZUVB 2R1YA 5H35B 2OCCB 1AE6L 2Z7ZA 4PY7B 3P3SA 4Z3GA 4DK6A 1G94A 4LFHD 1E9OA 2BIMA 1KYFA 3M17B 5GGTH 5T5NF 2IQAA 1M6UA 2VQ4A 1E27A 3M1BA 2CXKA 3CZSA 2H3NB 5TE6L 4H0IA 5D1ZA 1KCSL 1UEMA 5CCJA 1RUPL 5IM7B 4OUUA 2Y7QA 4JGUA 2X1WL 2EDEA 3I3EA 1NC2D 4OZFA 1PMYA 2AQ3A 3WNPA 1E8WA 3Q8FA 4KBPA 2BVPA 3OHMB 2EYSB 4KPHH 4LSUH 4TVPH 3SKJL 5JHLH 5BS0A 3VRIA 4HS8H 2JKWA 1F1AA 2NNAA 5IFHH 4C54A 2A4EA 1GIGL 3MLZH 3S37X 2XN0A 1TO5A 4YHOH 3WN5C 2A1WL 4Z7UF 5JW3L 5A6IA 2A38A 4OFYD 3IN0A 3CLFL 3HS0B 3AB0B 1J0IA 3DHPA 5HD8D 1IC7L 3WTVA 4C47A 2X38A 2QZ5A 4CVWA 2R0KH 5EEYA 3DO4A 3LIUA 1Z9PA 4GS7B 4XNQA 2I27N 1BWMA 2ENYA 3R7QA 4MXWH 5JHDD 5HGDB 3V4VH 5IOPA 1IC1A 2V5RA 2HP4A 4HJSA 3B4NA 2GT9A 4G80B 4Y4KC 4YSDA 1T1XB 2JJVA 3B1UA 2NQ3A 4DTGH 1DQDL 2ZCZA 2XXCB 3UMNA 4PCSA 2K4AA 5AL0A 3TJPA 3BWAA 4PJDE 5JXEA 1KDIA 3CLEH 3QDJB 1P7QB 3PGDA 5CJOL 4KQ0A 1OM9A 4ODHH 4TUJA 3ZO0A 1MWAB 2PR4L 3IKCB 1A3RH 3NIDE 4JGJA 1DQJB 4MNQD 2ARJB 2F54D 1XBDA 4FQCL 5DWUL 5AOIA 5CP7B 5I16B 4QRFA 4NO3A 2KPNA 4FQXD 3X2QB 4FOMA 1HINL 1OGAE 4PS8A 3WFEH 1GYVA 3G04B 3IK2A 1WFIA 2F6AA 1EDYA 3UDWA 4Y1AE 4J3OF 5HY9A 3BP5B 4I9XA 4P23A 4W6WB 1U95A 5AW7B 3ROOB 3KPSA 5DURB 4FQJL 1CFNB 4X6BB 5B1AB 4M1DH 1OO2A 4FCAA 3B8SA 4Y19A 2E27L 2YN3A 3ULVC 2Y25A 1DSWA 1YA5A 2VXSH 4OJFL 4YHZH 4Z18A 2EDKA 5EG6C 3UTTE 4TNEA 1I1YB 1TF4A 2Z35A 1INQA 3MV8E 3A4EA 4U6HB 1V7NH 3FUMA 4QOKE 4F58L 3X3GH 5ES4B 1QA9B 2Y3AA 5EA0H 5F1OB 4F7CA 2J6EL 2AKRA 3ARBB 3K6FA 3UP1A 3M6DA 3OXSB 4P3DA 1JYWA 2Y72A 4DKFH 1PX4A 2Y1VA 1ADQL 4IOIA 4N8VG 3KD4A 3DX6B 1YMMD 2AXGB 3FOMB 4LPXA 2AFNA 3CVHB 1Q72H 2F1BA 3GIVB 2Y5QA 1XMEB 1JNHA 2QR0B 3S5LA 3SE3C 3CVHL 4OIBA 2OZ4A 4PMEA 5GHWL 5FO2A 4ZD3H 3II3A 4KXBA 2Q7YA 4ODUB 5FV2A 5BZWB 3M8OL 4N9OB 1LO2H 1H0DA 5IBLC 5I30H 1WICA 1YPZA 3ABMB 4TQPA 3GSNB 1IQWL 5C2UB 1H15A 3GSNL 3BVDB 4JDEB 4HUCA 3SBRA 3TIEA 1DE4A 1E9QA 1VRSA 2C34A 3QORC 3Q44A 4NQEA 2Y6TE 3HB3B 4PG2A 3A47A 1SBSH 5FUZH 1R5VA 2DIAA 1JS4A 1JSYA 3JWNG 2EDXA 1S9KC 3CFMA 2G5BB 4BYHA 2Y2YA 5IQ7H 1D9KA 2DBJA 2X5PA 4LARL 1GJWA 3MLWH 2HFFB 1X4YA 5CD5C 1IKFH 4DVRL 1CGWA 1FI8C 5HHOD 3ARFC 4N2BA 3RNQB 1ODAA 1P6AB 2DM4A 1T0NA 5I23A 3KNBA 3FB6A 3EJUA 4PH8A 4LLWA 4J1UB 5KVFL 4OW6A 4LHUB 5IJKC 3DTDA 4QHNA 1QABA 3BAXA 5SV4A 1OB1B 3FMGH 3I50L 2VO5A 4TMPA 1N9PA 3ME0A 5IBTH 1YO4A 1ID5I 5F0PB 1P5VA 2CCLA 2FLBT 5F9WB 4FTVD 1TVHB 2XRAH 3PNWA 2DBLL 3BVVA 4LKCA 3O6LL 3D3VA 4DIXA 3FQ1A 5KBMA 4HUUB 4KNTA 4WNQA 1BVOA 2EUZA 2E9WA 3GBNL 4XBEH 5FYLH 2NMSA 2E8ZA 4NNXB 4S1DC 2ATPB 3W9DA 3K2KA 2X0VA 3H9HB 5LBSL 3WEOA 1YEHH 2XXFA 4F3FB 2YMOA 5SX4H 1QTYT 5E5MA 4Y5YA 1X6LA 5K9JH 2WOBA 4Y1AB 5L88H 4EXPX 4MNQE 4G8IB 2F54E 5E24E 3LEXA 2AEOA 3MRRB 3RZCC 4FLSA 2R2BB 4XCCL 3UADA 5E99H 3O41A 5KYWA 1JVLA 3UTTB 3GUTA 2WUCH 3A67L 1F3JB 3MV8B 2E9GA 2VDRB 4XXWA 2WXNA 1ZA3A 3DJSA 2VDRL 2NX5A 4AYID 5F44A 4MNHB 2GEQA 2FBRA 3TNNB 3EH5B 3KPRA 1I9JL 1DBKL 5LCVL 3RAJH 3BE1L 3TZVC 4HJJH 1KNOB 3EJQA 5MHSD 4UCFA 3KJ4C 1A9EA 1FNGA 3DYMA 4FXGA 3WFZA 1WCQA 5E1GA 1NBQA 3O8XC 1U2HA 4XNMB 3IKKA 3B2VL 4JHVA 4WGKA 2FECI 2LTQC 2OSLB 4JO1H 4GP4B 3UX9B 5I18H 1YMME 4R84A 1F5WA 3WN5A 5C9JA 3HFFA 4WVRA 4QY8B 1AFVH 4XCYA 3ZYIA 5L2JA 2YHGA 4ZSOA 3T2QA 1CL7H 4PSPA 1KTDB 2QQKH 4KUCF 4UINL 2OR9H 1NOLA 2AW2A 5C0BE 1IUZA 5IT2H 1QYGL 2J8OA 1T4KA 4YK4B 1BPLB 3DTXA 1J0ZA 4K07A 2VDNH 4LSRH 4G7VL 3ZYZA 1Y0LB 2K6YA 4Y4KA 4F2FA 1YUHA 1PY0A 2UV3A 3HUJF 4A7VA 1SLUA 5DJ0B 2AF2A 4N9GA 4MZ2A 4TVUA 1CDUA 4NENA 4JQIH 3GHBH 3V4VB 5F7NC 2ZCHL 3V10A 4MXWL 1H3PH 5HHOE 1ZEAH 5IESL 1SHXA 3K1DA 4CDHA 4LP8A 4P5MA 2J8HA 3ETBF 1CIUA 3HOGA 4X8GA 4WWKB 1T7YA 1ITCA 3I9IA 3MCLL 4BJLA 4H20H 3T2LA 1RZJL 4G8EA 3B56A 1AQDB 2EP6A 4UANA 4AV5A 1RZIA 1YY8A 4NO2A 4NKMA 1UB6A 1SEBA 3GBML 4ODHL 3WJLC 1T7ZA 1QEWB 3EYUL 4AQ8C 1C5DB 3SBQA 4WENB 5C0CD 3E8UH 3BAYA 2W0PA 5IHUL 4DGWC 1X5FA 3IDJB 2XZAH 2AZUA 2BS8A 1HI6B 5FLVA 4ZUUB 4OI7A 1AP2B 3JUZA 3WFEL 1SVCP 3ETBJ 4XHJC 1AY1H 1HHKB 4MNQB 4M6OH 1MSPA 4EZJA 1AC6A 3L3KB 1SUHA 4HCFA 5F96H 2HVBA 4H4NA 1JGIA 1S4IA 4GKNA 3HI1B 1CLYH 2NXYB 2GY5A 3I3BA 5IVXB 4P3CH 4F37F 3JWOL 4PJ5D 4EDXA 3DBXB 1IC5L 4JO4L 5C07A 3MBWB 1SVBA 2R23B 5MEND 1CDGA 1DJXA 4R2GC 4WI5A 3RU8L 1X7SA 3CDGB 4ZFZB 4DKFL 3D34A 5JXED 5LWYH 5JPNC 3D7PA 4KHTL 2IF7A 1UQSA 5DR5H 3S9DB 3AUVA 4PRNB 4ZD3L 1JGUH 3K1KC 5IEKA 5HGHB 4NRYB 2XN9A 4FQHB 4G42A 4HGWB 1N4XL 1XGPA 2DQDL 2IAMD 2O6PA 5D5ME 3DVGB 1RHHA 3ZE1B 1U8KA 4HK3N 2C3GA 4FL4B 5BRQA 4BK8A 4UDUA 3ARFA 1TTCA 3KPOB 3RWDA 3IAPA 5GSVB 2CALA 3NUKA 2WWNA 5FUZL 1XVSA 4Y19D 4N2OA 5C0BB 4N8PA 4JPIA 2PF6A 3CN4A 4OZFG 1A14H 1FORL 3U46B 5IJKA 3L4VA 3QRFM 4KI5F 4NI3A 4OJAA 4MJ6A 3IDYC 1BFVH 2YAEA 3MROB 1TQWA 2VJ0A 1QUPA 3GSQB 5T3XH 1NKOA 4P59L 1CE6A 4N2EA 4KRMB 4ORGA 1O9VA 3S48A 4XC1L 4YHLH 3RYMA 2XXGA 1KJVB 4NZ8A 3H8NA 2QQLL 2DKSA 3GRBA 3ZQWA 4M6NH 5JIMA 3ULUF 3HLKA 1QMUA 1NC4D 1WP6A 1IILE 2G30A 4F1ZA 4N2FA 5CFHA 1Q1JH 4BGDA 3EGXB 2BSSA 3CN0A 5SWSA 3FMGL 3CFCH 1G7LB 4GH7B 4OIAA 2BHUA 4GAJH 3V52L 3OF6D 3ALPA 4WQOA 1DDTA 4DP4X 3B6SA 2YLHA 1RZFH 2ZWSA 1XGTA 1AR1D 3BFOA 5TD4A 3U36A 4F7PA 3ARDB 3RZCA 2YPVA 1ND0A 3H4HA 1MVFA 1HXMA 3VD9A 3BDBA 4K3DH 3WE1A 1PX3A 3EGDB 1BG9A 2BVTA 4L9DA 3E1ZA 1IQDA 4AQ1B 2X4OA 3VQ2C 1IGMH 4ES8A 1Y6NR 3B7TA 2UX6A 4PUBL 3TZVA 1I7TB 2PP7A 1QBML 2WV3A 2YD1A 3BESR 5C0CE 5E4EC 1KLFB 3TIDB 1B3IA 4UOQA 3TCLA 3KDMB 4QRSB 4U1LB 1A8ZA 3O0LA 1YLBB 5AUMA 2FE0A 3OXRA 2O5YH 1S5IH 2OLDA 1SHSA 4MMYB 5KJRL 1V7ML 4K3EH 4D9LL 1EDHA 4CJ1A 1WGOA 1FP5A 5KAQF 2EDFA 4X5XA 3NSJA 4EKJA 2F5BL 4UILL 1UXLA 4MNGE 1EO7A 5F7YC 4HIXL 4LHQB 4Q2ZA 3ROLB 1U8QB 3DX9B 1JK9B 4PJ5E 1CXEA 1W2KT 5EULV 3TTSA 4FABL 4LNRA 5MENE 1YEKL 1E4JA 2Q3ZA 1U8LA 1FGVH 1KLGB 1Q9WB 3D85A 4HHAB 4G7QB 5LGHH 3OZ9L 2KLTA 3O4LB 4X5WA 5DMJB 1XAKA 4TL5A 1ZPUA 2DB8A 1ZOXA 4K5NA 4R7DA 1F4HA 4CC4C 4YHKL 4RRPA 5D5MB 3S5LG 3IRZA 1AFVL 2DLIA 2YJQA 2C9SA 1SYVA 4V2BA 1KXQA 1A7BA 1QAWA 3APCA 1RK1B 4ELMF 3NJXA 4OU3A 4XAWH 5E2JA 5FW8A 1P84K 4NIKB 5DUBB 4YHIB 4DZBB 3TYFB 4BHUI 1JZ4A 5IT2L 4ZMQA 3GIZH 4HPHA 5D7JA 2G3XA 4HH9A 3BP4A 3Q2VA 1G7IB 4XTRD 4P8QA 1NUGA 2YKLH 3OQRA 3PDGA 5E8NA 1R47A 5IMKA 2YRZA 2DMGA 3PLYA 4G1MA 3O3BA 1CYWA 2HLFC 2JKTM 3VB9A 4OD3L 1WS8A 4PCTA 2F18A 2IDCA 2FJHB 1KLUB 1D6EA 4LCWA 1RUAH 3LYRA 1IGFL 5ID1A 5EO1B 1F13A 4HG4J 1KPRA 3HS0C 5KBLA 3AB0C 1JUFA 1INEL 5IHWA 1WC7A 3RA7H 4MQSB 1FSKB 1YYMH 2G2RB 1NAKH 1X3DA 7PCYA 3VXSA 3OKMA 5DJYA 1DJZA 1TCRB 4BHUA 4W9FC 5C6WH 2BIPA 4GS7C 3P77B 4L37A 4YHML 5DMYA 5B4MC 1J5IA 2F5AL 2AJVH 1ZY9A 3F6JA 2G0KA 2OXHB 2OM5A 3U7YL 5J1AB 4MLIA 4K3JH 2AXJA 2VR4A 4MB1A 1CXIA 1A4KB 2A77L 3VO0A 4PJIE 2AK1L 2H2SD 5DC4B 1VF5C 2HRHA 3HBPA 1C7TA 4RRPM 4CADA 4YIQB 1P2CB 3BVNA 1BD2A 4AJVA 3EBHA 4GQ9H 4YSTA 1TLKA 3PIQA 4YGAB 2YWYA 5PCYA 1KPUA 2XZAL 4PJAE 4HWBL 2D73A 1BW8A 4LCCA 3T77B 1O6VA 1AY1L 3P2TA 3Q6FB 5C0CB 4PRAA 1EHLH 3IU4L 2OJ1A 2L0DA 3G5YB 3QA3B 3WCYA 2X4TB 3S4SB 5D6CA 5FYJU 4LQ1A 1Q0YH 1USQA 4DP7X 2NNXA 3HZMA 3DYOA 5IMOB 3HKZA 5LB1A 2VN6A 2VZTA 2C3XA 2IPUK 4WV1B 4XC3L 3VD3A 4Y8DC 5CSGA 3C5JA 3X1BA 2FLMA 4ELDA 2V7NA 2UZPA 4JL1A 4KHXL 1H3GA 2J56A 1U92B 4GXUM 1WWBX 2ZAGA 1OXYA 1XB8A 3ARBC 1T20B 3Q5OA 2ZWKA 5LNEA 3KWUA 3BWUC 1ZXKA 3QQ4B 1MLCB 4LSVH 3QNYB 3G6JF 3MOQA 1HH9B 1LQBC 3VYOA 4Z7UB 4BINA 3DVFA 2PPFA 3LV3A 1N2RB 2V2TB 3RPIA 5F0JB 3GRWH 7TAAA 2DDQL 5TGBB 2Y4SA 2COVD 3D2UB 2Z4TA 2ED6A 2G3MA 4ZOBA 5D7KD 2YC1A 3US9A 2F8IA 4LKXA 4UV7L 1A6WL 2B3RA 1JV2B 2CO6A 3NJFA 5LG6A 4X50A 5F7LB 3K91A 2IAMB 1OP9A 3FO0H 5I24A 3VI4F 1NGYB 2NY7L 5ITBL 1CQKA 3HB3C 1UA3A 1AGEA 3PREA 2WXFA 4WK4B 4ZMZA 2XPYA 4WWPA 2EXWC 3ZT7A 3RIKA 2ED9A 2CO7A 5T3XL 3VE0B 3HHSB 4BH8A 3QIBA 2Z91B 1RULL 3CVDA 3WIFA 4NP4H 4H88H 1G7PA 1EVUA 1U33A 2W07B 3EIFA 4ZXBB 4YHLL 5I1JH 2YD5A 2ZG1A 5I0DA 5I0YA 1UUNA 3OM3B 2A74A 4QTHA 5C8JA 5J4MA 3LKOA 2ICEB 2EDBA 1MZZA 1WAAF 3VD5A 3CFCL 3L8QA 3I6KB 3BSZH 3F8UB 2MNWA 5CIPH 3AMKA 1NCCH 4FLOA 2IBBA 4WO4B 1NCAL 4JN2B 3E6FA 3NK4A 3VGBA 3OAYH 4XMPL 1YY9D 1JERA 2DH3A 2FK9A 2B20A 4M3KB 4PQXA 1ES0A 5FWQA 1J9QA 1Z5LB 5I71B 5I8OL 5CJXC 4W9IC 5F9WC 2QELA 3KPTA 1TQBB 5H4YA 1XSIA 1GY2A 5IBUG 2YQBA 4G5AA 3IJHA 4APXA 1UCBL 32C2A 5A3ID 3MC0A 1NCJA 1ZKAA 3QUYD 3AM8C 3R1GL 4M48H 5K93A 4AKPA 1MEXH 3OJMB 3MOAH 3QEQD 3FQTB 1SXAA 4OZHA 4DVBB 5F1IB 1GS6X 1KCVL 3TH3T 5FIEA 5ITFB 4UTBH 4S0TD 4E9RA 3U6RA 4WTQA 5IB2B 5EORL 4EN3D 3AROA 3UIZA 4J5VA 2EO1A 4FC3E 1WFUA 4LOFA 2GTZA 2RACA 4P49A 5BUAA 4AZ8B 4XNUL 5TTRA 3II1A 4ZUVA 1J88A 3K6NA 2CH8A 3KGSA 1T0MA 5H35A 4H2AA 4CC4A 4UB0L 1FGNH 3LVEA 4A2DA 4MYWB 3M17A 1QLFB 5GIRA 4KKAD 4IHOB 3KLAB 3D51A 4WWID 3L1OH 2H3NA 5E00B 4J4PC 4OCRH 3NZ8B 3KR3H 3PL6B 5BW7A 5IM7A 2WJ7A 1QNZH 1S3KL 3FF8A 2Z1KA 2P5PA 1EZUA 2K7PA 5C0NC 3CHXA 4X7EC 1CFMA 3HG5A 3QAQA 4MCYA 5HHNB 1EIBA 5DMGC 2EVJA 2EYSA 4UZGA 3SKMB 5SX5K 4F80A 3IJYB 5B38B 1FV1B 1GOHA 5FO9B 2EDTA 1BVNT 1OARH 4FULA 5GJTH 1NIFA 3ULUH 1OKEA 2KUTA 2FO1A 3X14B 1F45A 2D7QA 1ZHBB 2AEPL 2C7FA 4NLHA 1GZPB 4EQ3A 3HS0A 4HAGA 1HC1A 2FT8A 3GXDA 4X7FC 3CZGA 5D7KE 4E9QA 1M05B 5C97A 2EO9A 3B7UX 2JNZA 3PXHA 4ORZC 3PWPE 4Y9CA 5EOQH 1FZJB 5E5RB 3KH4A 4K2UH 4YK4C 4OF5A 5E1HB 1W8OA 1WEJH 4OFQA 2VLJE 2ZXAA 3GHEL 5KVGH 4X98B 5K9KB 4LU5L 4WIQA 5DEZA 4BA8A 1NBZB 1DLFL 2OULB 3FOLB 4G80A 3VG0H 4CMHB 3BXNB 3MKKA 1QI4A 4RFOH 5D8JH 1UOLA 1O6TA 3TT1H 5BO0D 1MCNA 3QJFB 4M29A 4R97B 3PGFL 2HFGH 4FI7A 1P7QA 5H37A 2J43A 2MPAL 1K4CA 4UT9H 1MWAA 2NXZB 3IKCA 5KZCD 2E46A 1DQJA 4EO5A 4QXUL 5DUJA 5CP7A 5I16A 5LQBL 1NANH 3G04A 1RZJC 4WWKC 4XNXH 5IB4A 4C57C 1JP5A 3ROOA 3QUXD 2K0RA 5KSAD 3QW9A 3SPIA 1CFNA 4X6BA 5C70A 3BP6B 4HFUH 2ED8A 5D7JD 5LGJB 1L9MA 1XL6A 4PCYA 1RZPA 4UDTB 5DFAA 4U6HA 2H6UA 2VZOA 2UXVA 1JWSB 1QA9A 1BREA 4ICWA 3ARBA 5I5IA 1S7QA 2AI0L 4LEEA 3OXSA 4G6JH 3LOWA 1UJTA 5J11B 2GFBB 1YQVH 3QEQE 2VT0A 1I3UA 3LKSB 4P04A 4BXSV 4AYGA 5JDJA 1I9IH 2IPTL 4GRWE 3FRPB 2B14A 5LXGL 3PNRB 3FOMA 2B1AH 3AZUA 1F6AB 1RUKL 3K8MA 4M8VA 2NXYC 3JWOC 3I2CH 4JL2A 4ODVH 5CILH 5BZWA 4PHZA 4NEHB 4FG4A 1MIEL 3QUGA 1AI1H