3IEAA

Structure of reduced m98l mutant of amicyanin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFLRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Amicyanin
publication title Defining the role of the axial ligand of the type 1 copper site in amicyanin by replacement of methionine with leucine.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 25
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ieaA00
2XV2A 3OM3B 2XX1A 2BZCA 2CAKA 3NJLA 2YAOA 2HRGA 4JHVA 2VW7A 1TU2A 1ZDQA 4QKTA 4GY4A 2I85A 4CSZA 3CVCA 4DPCX 2QDWA 1NWPA 1W8EA 3WKPA 3EHBB 1OE2A 3FYIB 3GXUB 3NSYA 3ABLB 1MG2C 2J5WA 2GC4C 1F56A 4A2FA 1NIFA 1HAUA 2IDUA 3FQ1A 4CSPA 1J9TA 1SFHA 3UAEA 3ASOB 4UAHA 1SF5A 2XXGA 1X9RA 1WS7A 1PCSA 3KW7A 1AG6A 2UX7A 1J5CA 1AAJA 1AG0A 4DP6X 4F2FA 1OE1A 2DWTA 2GC7C 3OMNB 2BW4A 3C75A 4BXSV 4F2EA 1YLBB 2PPDA 1JZIA 2FWLB 4E9XA 4YSQA 2IDFA 1OV8A 4G70B 4X4KA 2YAMA 3AG4B 2PPEA 1E5ZA 2FJSA 1ASQA 2BWDA 3FYEB 1DYZA 1E67A 1GY2A 2J57A 2VM4A 3UGEA 3SQRA 2QPEB 3FU9A 1CC3A 4W9ZA 5I5JA 1JXFA 1GSKA 4Q89A 3DKHA 1BYPA 2IAAC 2CUAA 3NJNA 3AZUA 2AZAA 2XYBA 4E9QA 3EF4A 2HRHA 2EINB 2VN3A 3NP3A 3PAZA 3T9WA 1TKWA 3GDCA 2YAPA 1BQ5A 4BK5C 4YSDA 1JZHA 3V9CA 3HB3B 4GP5B 4ZK8A 1KCWA 1FWXA 3DTUB 4ENZA 2BP8B 4P5RA 1ET5A 4M3HA 2GI0A 2MRYA 4KNSA 1ET8A 4DP5X 3QJVB 4DPBX 5EHFA 2P80A 1J9RA 2CBPA 5B7FA 1AS8A 3H4HA 1BQKA 3QJQB 3X1FA 3T6ZA 1W6LA 1PNCA 2XV0A 4F7KA 2J55A 3SBPA 4G71B 1AANA 1V55B 4RH4A 5ANHA 4BWTA 4KNTA 3FU7B 7PCYA 1QNIA 1PZAA 4P5SA 1NIDA 3ZIYA 4E9YA 1I53A 2XU9A 4HCGA 7PAZA 4BDVA 2W8CA 4AKOA 5I26A 4NB7A 4A2DA 3X1NA 2P80D 2EIKB 5FC9A 2BP8A 5I6OA 5I6MA 1NWOA 5I28A 9PCYA 1SNRA 1AZNA 3UAAA 1PY0A 3TBCA 5D4JA 1JERA 1TEFA 2BZ7A 2I7SA 3AW5A 1M57B 3EH4B 1AS7A 1AOZA 4DPAX 2PPFA 4TXVB 1AQ8A 5TK2A 3ABKB 3N55A 4KO9A 1CYXA 5IY5B 4DP4X 3X1GA 4HAKA 6PCYA 2GIMA 2FTAA 4M4RB 1PZCA 5I6NA 4GXFA 1KBVA 1KBWA 1GW0A 5B7EA 1WS8A 1ILUA 3FU7A 1AZUA 1XMEB 2QT6A 4MFHA 5PCYA 1OCOB 8PAZA 1DZ0A 2QDVA 1RZPA 2WO2B 3TASA 4A66A 1KDJA 1NDTA 1NTDA 2EILB 2IDSA 2XV3A 4L0PB 1A3ZA 4JHUA 2AVFA 4HCFA 1SHWA 3PAVA 2YAEA 2N0MA 2W88A 5D4IA 2VSKB 3S3CB 1NINA 1BAWA 3X1EA 3PXLA 1V54B 3WIAA 1JZGA 3PCYA 1VLXA 5I5IA 3BQVA 1ASOA 3FQ2A 6PAZA 2PP7A 3SBRA 4A68A 2CCWA 1PAZA 2YXVA 2QPDB 3CZUB 3GYRA 1ZV2A 1E5YA 2IDQA 3OQRA 3IBOA 2DWSA 3NJKA 2UXFA 5AZUA 4DP0X 3QJUB 1XB3A 3SBQA 3OMAB 1NIBA 1RZQA 2IH8A 1ZPUA 1PF3A 4KNUA 1OE3A 2PCYA 3NYKA 4DP8X 1QLEB 4WKXA 2YARA 4K9JA 1JVLA 4YSTA 1A65A 3FU8A 2XUWA 1J9SA 1L9TA 4YSRA 2H5UA 2OJ1A 1PZBA 2UXVA 4QLWA 1SFDA 1SHXA 3ZDWA 4BDVB 5AFAA 1KCBA 3QJRB 3FSWA 4YSEA 1PLBA 3S8FB 1ZIAA 4HHGA 4AZUA 1IUZA 1AACA 3PAUA 5I6KA 2VW4A 4Q8BA 3OMIB 1SDDB 2FT8A 1T5KA 1WA2X 1ETJA 3FPYA 4HHWA 3HEIB 1IC0A 3FSAA 5B1JC 4NAJA 4A2EA 3PPSA 2HZHA 3NP4A 2IWKA 3T71A 2PP9A 4GP4B 2AANA 5A7EA 4BWWA 5B7MA 4AKQA 2VMJA 3MX0B 1PLAA 1OCCB 1A4AA 5F7BA 2B3IA 3U25A 2A3TA 1NPJA 2PCFA 4G7QB 3FT0A 1NPNA 5B1BB 1GS7A 3N2JA 1GS6X 2I7OA 2YAHA 3NSDA 4YVNA 3ABGA 2XWZA 4G7RB 2Q5BA 2DV6A 1L9SA 1EZLA 3QJSB 3NJGA 1AIZA 1RKRA 4DP1X 1WAEA 2IH9A 2FT7A 1KV7A 1L9OA 2FT6A 1BYOA 3KW8A 3T6XA 1JZEA 3NJHA 1M9WA 1XB8A 1NZRA 2B08A 3ERXA 1SF3A 2BO0A 1SDDA 5I6PA 3FPXA 4EF3A 3QJTB 3X2QB 2IWFA 2YAQA 4AKPA 4AI7A 3FSVA 3QPKA 4DP9X 3WI9A 4E9SA 4GP8B 4DP7X 2PLTA 5I5MA 1BXVA 4KOBA 2VW6A 1ILSA 4AX3A 1OCZB 3G5WA 1GS8A 4YSCA 1IKOP 3FQYA 2JKWA 1OOWA 2DY2A 4YSPA 1BQRA 4HCIA 1PMYA 3V9EA 1IBZA 1IBYA 1GR7A 2AFNA 2WO3B 1ID2A 3CVDA 1URIA 1L9QA 3JTBA 2FQFA 2YQBA 1KGYE 3ABMB 4W1TA 2HXAA 2Y1AA 3NJIA 2OCCB 2VSMB 3NSCA 1R1CA 2BW5A 1AR1B 4JKNA 3EH5B 1CUOA 3TBBA 4KOCA 2LLNA 2HX8A 3ZX1A 1AS6A 1WA0X 1M56B 4WTQA 3IN2A 3RYMA 2FQGA 3FSZA 3WNJA 1RCYA 4YL4A 5TK4A 1OF0A 1WA1X 3S3BB 2PP8A 1JXDA 3JT2A 3AG1B 3WG7B 1TEGA 2FNWA 4UF7C 4KO5A 2GSMB 1L9PA 1JXGA 3MBWB 4PCYA 5B1KA 4HZ1A 4N4YB 4NERA 5LDUA 2BP0B 1QHQA 2ZWNA 3NJFA 1J5DA 4E9RA 1ADWA 2BWIA 2XXFA 2TSAA 1ET7A 3IEAA 3EH3B 3T6VA 1NIAA 1JOIA 5E9NA 2XVBA 2Q9OA 2UXTA 2GB2A 5B1JA 1ZDSA 1HAWA 1HFUA 2Y69B 1AZBA 2AZUA 2PPAA 1MZZA 2ZOOA 4HIPA 2ZONA 5B1AB 3L45A 3CDZB 2HX9A 4KO7A 3PLYA 5B3SB 3IE9A 2MTAA 2GBAA 2UXGA 3NSFA 3NJMA 3UACA 3S8GB 2FQEA 1ZIBA 1X9UA 5I6LA 2IWEA 1FA4A 4KO6A 1EHKB 3NT0A 2J56A 2YXWA 4PAZA 2EIJB 4FAAB 2BP0A 2H3XC 2GHZA 2VM3A 1A4CA 1BXAA 2H47C 4E9WA 4A2HA 2X88A 4BWUA 1A4BA 1JZFA 1MDAA 2YAFA 3AG3B 4YSOA 2OV0A 3BVDB 2PPCA 3OD3A 4G7SB 5F7AA 1J9QA 1PNDA 3UABA 2HLEB 5D4HA 1PLCA 1MG3C 2CJ3A 2NRDA 2RACA 3DIVA 1AZCA 2FQDA 1N70A 3QQXA 1JVOA 4FA7B 2HX7A 3CDZA 2E86A 2IDTA 2X87A 2DYSB 1MZYA 2EIMB 3IN0A 3WKQA 4HALA 1CURA 4A67A 2R7EB 1BXUA 1GY1A 4E9VA 2XLLA 3CVBA 2CALA 2DYRB 1BEXA 4A2GA 5PAZA 3FS9A 3H56A 4UANA 3X1BA 3ASNB 1UATA 2JFCA 3TA4D 1CYWA 1XB6A 1SJMA 3WNIA 1E65A 1OCRB 3T6WA 1AZRA 1E30A 2UX6A 3UADA 4G72B 4N8UA 4DP2X 1V10A 1A8ZA 1JZJA 3AY2A 4GYBA 1NIEA 1GYCA 4E9TA 3CG8A 1ASPA 1KDIA 4YSUA 4YVUA 3H4FA 4BXVA 1NICA 3ZBMA 4YSSA 2TSBA 1KYAA 1L9RA 2JXMA 1FFTB 4YSAA 3AG2B 1B3IA 2XX0A 3TU6A 2R7EA 1W6WA 2WSDA 2ZXWB 3NJJA 3S3DB 5AKRA 1N68A 3D12B 2BHFA
chains in the Genus database with same CATH superfamily
35C8L 5A2IH 3OM3B 2KI6A 4NUGL 4Z3HA 5AVSB 4XI5C 5T1LD 3NZHH 3MV8E 2N0KA 2HJKA 4CSSA 3WNNA 2VZTA 2WHVA 2QDWA 4MJ6B 3SD2A 4AH2A 5EDXA 1ZE3H 4EZLA 1D3CA 4AGLA 2WZAA 3SDCA 1NIFA 4FDWA 4D0BA 4MMZB 3NRFA 5DF0A 4YXKL 4O4YH 2DN7A 4XPFL 5D70H 4FFVC 4MMYA 1XZ0B 1MY7A 3RVUD 2OMBA 1CLOH 2FDBP 4YFDB 1MCIA 3GMQA 3L54A 4Z0BL 2FJGA 3U1SH 1XEDA 2J8UA 4F8NA 3UG4A 2HLFD 1ZY9A 2J12B 4I2XE 3SYOA 4L5FH 3OMNB 2FWOA 1MH5A 3SZKC 4BXSV 4JDVA 2VC2B 5DGQA 2HP4A 1GKEA 4F8QA 1ORSA 3F8UB 3B7UX 4NQSA 2Y5EA 1JBJA 4JKPL 3N41B 4IEFA 2D31A 1K8DB 5I74B 5TE4L 1LMIA 4Z5RB 3V4LA 4OV5A 2XKSA 3O4LD 4C57C 4JFDE 3TLRA 5FYJU 3FU9A 1NKRA 1YCSA 1JXFA 4A2LA 2KC0A 3D25A 5FECA 2CUAA 2AZAA 3T77A 2X0VA 3LN4A 1KSRA 1BOGB 1UURA 3BISA 1UXSB 4XAWL 2VLJB 3FT2B 1IAIM 2HRHA 5T5NF 2OS7A 3JYCA 1N8ZA 5HPMA 2P5EE 5L7XH 1SQ2N 1DQVA 3IF1A 3P11L 4FG6D 4N8VG 4X5WA 3IXTA 4WO4C 5M7QA 2BP3A 2P8MB 1DFBH 2VUKA 1BHGA 4RCAA 4RGND 5KEZA 2F61A 2Y9RT 1KCWA 1QVOA 4UQBA 3G6JE 1LJMA 1HE7A 2QGEA 2FEDC 2BOCA 4C4KO 1T7ZA 3AC0A 1U3ZA 4TSCL 4PHXA 1HL5A 1RUKL 3KYAA 5JOEA 1ED3A 1M7DB 1A7OH 5IG7B 1JPFA 2P80A 3ZR6A 5I23A 2W9LA 3DGGA 4F57L 3D34A 3QXDA 4AEIL 1U8LA 3C2AH 1WD9A 5DFVC 3QPXH 2YOCA 2OSWA 1TYJA 4GSXA 5J06A 3BKMH 1MHEB 5EO1A 1OQXA 5C0BE 2IALB 2ZWZA 4RDQF 4KKLC 1BQHB 3IFNL 3Q5YA 3UBHA 4QRRE 1JZ5A 4KZDH 4UTAL 5KYYB 5IB1A 2YEQA 3VGHA 2CPCA 1RPUA 2R29A 3ZDXB 2XICA 1JYNA 3BZ4A 4U1GC 5IJDC 2V17H 4F92B 4DZ8A 4P5SA 3HZKA 3O6FB 3AU1B 4HIXH 4CBPA 3DVFA 2J21A 1ZT7B 5H4ZA 1EEYA 1GL4B 1GPOL 3KLKA 1UUSA 2I5YL 4N9OB 2D7TL 4NPYB 2PO6C 1A6VH 4L1TA 1QACA 4W9FC 3UO1L 3KWXA 2VO5A 4P4KA 5I6OA 2B20A 1MVFA 1I1YA 1HQ4A 2WBJB 1JF6A 4FD0A 4LNVA 4WUUE 3M45A 5I9QC 3KHOA 2BZ7A 2I7SA 2YGQA 1U36A 3D4CA 3MRFA 3FT3A 5DEGB 1HL9A 1XCTA 5C07D 3BD4A 4EI0A 4JN1H 4R4BA 4TXVB 5K9QG 3QQ9D 5J6SA 5AB0A 4UT9H 1G9ML 2AMGA 2Z91A 3BVUA 2LQRA 4GMTL 4Y9EA 5ICYB 3RB5A 3WDIA 4RMSA 3SO5A 2NNXA 3IDGB 3KWWB 5L4JA 2ZOKB 3IJ8A 3MLTB 3WJJA 1Z5LB 1SJHB 1LP9E 1NCJA 5GRZA 1PZ2A 3QWQB 1KDJA 1AGDA 3WFHB 1CIDA 2ZX5A 4PJIE 5AL0A 1T1ZA 1F1GA 3KPPA 4HPYH 3TIDA 4ATTA 3BVTA 3NFPB 5EU3B 1ACYH 3HFFA 4K3JL 5J6HB 1RZIB 1NJ9A 1SHWA 2N0MA 1QTSA 5LXVA 2VSKB 4KY1H 5F3BA 2XG5B 2NY4C 3MLWL 3KPOA 4HS3B 5EC2A 2Q8BH 1XD1A 1Q0YL 2ZYSA 3JYBA 1H3GA 3HZMA 3F00A 5F88B 4PREB 4X99B 3HI5L 1I1RA 5I5IA 4ZUUB 4WIQA 3EBAA 3BT2H 1G6RB 3ISRA 3UJJH 5DZPA 2ZAHA 4JDZB 3WFBL 5E9DE 3WHE0 3DBXA 2DJMA 2D2CC 5F7NC 5DXWA 3TV3H 3PF2A 4OCYH 1ZV2A 3PABB 1YSOA 3JWOL 3D2UB 4M6MH 3W2DL 2J1KA 1U92A 2JCCE 4LSTH 1MI5D 1NAKL 4XP9H 4PH8A 1BIHA 2R2HB 4FLHA 4M3KB 5DD1L 3MYZA 4OCSL 3BGMA 3PQYD 1A21A 3DV6A 3R1GH 1RULH 3BDXA 4QTIH 1HCVA 4RFEB 3RGVC 2LOEA 1EO8H 3EDJA 2VDOH 1FG2B 4HEMA 3R19A 4DP8X 4R26H 1QLEB 3QDJA 2V2TA 2OXHA 5D7JA 3T3PE 5D7SH 2HWZH 4UNUA 4ZG1A 3WEMA 1UYWL 1CL7L 2IPTH 4LT7A 5HDBB 1QUPA 5SWZD 4TTGA 3V5DB 1MJUL 1INDH 2IAMB 3K4ZA 1A64A 4AENA 1E4XI 1YEKL 3G6JF 3BWSA 1DJHA 2VB5A 2VW4A 4C83A 4EPSA 3P30H 1T5XB 1MLBB 4MVBD 1A3LL 1L7TL 3WFDH 4BKTC 3VDBA 4U6HB 2F5AL 2ADYA 1LK2B 2ITDB 5KW9L 3IDMA 4CDHA 5IR1B 3KJ6L 3T71A 2AANA 2Z8RA 3Q43A 2E9IA 4RAVB 5I1IH 3B2VH 4DAGH 2VT0A 1LO3L 4OGAD 1MFCH 3BSZL 3LX9A 4DQOH 3R4DA 2PCFA 2ZX6A 5C0ND 2OMTA 4BELD 3CFCH 4XHJD 5B22A 1GA2A 3KNBA 1GS6X 5E2TH 5IROC 3O41B 4GQZA 1ECZA 1F18A 3TX4A 3JSSA 1P5UB 3KYNB 3U0WL 2WKOA 4GRMB 2V5YA 5JHLA 3C60B 4X4MA 4R0LA 1S9WB 1FFNA 1DL7H 4WKZA 4EI6A 4GKSB 2O6DA 4ODUB 1JV5A 5FGCE 1BX2A 5HDRA 5D5MB 5CEYB 4N86A 5EEXA 1NC4D 3TS8A 3A22A 2W9DH 2IC2A 3FMGH 5ICUA 4BQ8A 4LLDB 5AVQB 4AI7A 3DDGA 4IMKA 1UJ3A 4JRXA 3VXUD 3EZJB 2DBJA 3QI9D 1REIA 3QORB 4U0RB 3V4VL 4DTGL 3L4ZA 5IW1B 2IMMA 1S9VA 2OR8A 4LLYB 3QUYA 2XTJE 2NCEA 1MCOH 2QPSA 1FQ9C 5C0GA 2VDQL 1OOWA 5F7EH 1MHPL 3ES6B 2C3WA 2X3BA 3FTGA 3KPNB 2ERJB 3M07A 2VDPL 2EACA 4HETA 1NLBL 1IBZA 1SZNA 2R4RL 3A4DA 1EMTH 3E0GA 4JPVH 4UM8A 2WO3B 5BRZE 3H9SA 1GTNA 3MODL 4BFNA 1G7QB 5TDNA 1ZA3B 1LP9F 4QJ5B 3KXFE 2HXAA 3D7PA 3IRPX 4PJIF 2Z0BA 5GRJH 1VENA 1CTOA 2NXZB 5EUKB 4J28A 1I8LA 3H42L 4JKNA 2J71A 3FF8A 1R5IA 2HT4D 2WWKO 4Z6AT 4ZAKD 1T7XA 3FFCA 1WA0X 3ZRFC 4TQHA 3IT8D 1HHKA 2NUPB 3QEQB 2MCAA 2JB5H 2DEWX 5GGRA 3S3BB 1WHPA 3BXNA 4ODHL 4HA1A 5C6PB 5KS9A 3AG1B 3RIFK 2XWTB 4H26B 5EEVA 1ZTXL 1E4JA 1KBGH 3VFVB 1DN0A 3P9LA 5HYJE 4PG9A 2K7PA 1TZOA 3A3YB 4L37B 3HI1A 4B5EA 5I73B 4P2AA 4IBVA 2AJSL 3IJSB 2ZQKA 2YRBA 3HS0B 1OP3K 2V2WA 3OLGA 4PJCE 3NOIA 3SE8L 3FFOA 1KB5H 3MRJA 3KYOB 1G0XA 1E4XH 4GMSL 4YHLL 2WQAA 2A73A 4K8RC 2NTFA 1OO2A 5I19H 1AQKH 4Y2DA 2WVVB 3P77B 2F53B 4RMRA 4PI2A 4DZBB 3T3PF 4I0PB 5FDWB 4F7TA 1GJWA 5SV4A 5EF0A 5B39A 1P1VA 1C5BL 1WEJH 3CLFH 4Z18A 1IGJB 1ZHBB 5GJTH 2I9LA 4HUWB 1BLNB 3CDZB 1JZ8A 2Z31A 3K72A 5DMGC 2A1WH 2CQVA 1HTYA 4Y5XB 3D30A 4FZ8H 4NKOA 4YUEH 3R7QA 3TF4A 4YN3A 4E5XA 3CQPA 2EZ0D 2NYYC 3GRBA 3UTZB 1IFHH 1IARB 5C08B 5EEWA 2RALA 3REWB 2EICA 4CMMA 1K5NB 1RUQH 3CXDL 4ZFOA 3DPDA 3P4OA 1UWGL 1IGIL 2YC1A 3ARBC 3F58L 1DQLL 1GVIA 4OSUL 4G8EB 2XCMC 3NGBB 2H47C 2AAAA 3QULB 5H2BA 2X4QA 1AMYA 5DS2A 3HA0A 4X6BA 5ESQA 2YWZA 3QAQA 3T0XA 3VXRD 3IMUA 2XPGB 1NGZB 1MG3C 4KVNH 1A4JA 1NKOA 5BS0A 4WI0B 4TRPL 2N01B 1AR1C 3RA7L 1CFMA 1SRDA 1WWCA 2FAUA 2CO1A 3Q2LA 2AK4D 2JXMB 2QSVA 3PL6C 3G5VA 4NGHH 1NCNA 2DYSB 1IM3D 3MHZA 5E2UL 1EFQA 2DI9A 4IW4C 1UZ8B 4LMQE 3W56A 5IBLD 1MRDH 2F8OA 3T0ED 3TO4C 4XPHL 3C9NA 4TKWA 4XPGL 5DUBA 4M5SA 5BO0D 1T03H 1CFBA 4UANA 1Z9NA 2WB7A 3V6BR 1EEQA 4DEPC 5LNEA 4H7VA 4F7PA 2UZXB 5DCCA 2R1XA 5E8DL 5AAPA 2CBQA 2VLRE 1J12A 3IDUA 4JRYB 2C5DC 4MQXD 4DP2X 4AXWA 4A6YH 4FHJA 2V4LA 1FGVH 3CDCA 4L3ED 4N6QA 4QRTA 5JHAA 2C4FT 3AY2A 3G6DH 2OP4H 5DSCB 5BVPH 2PF6A 3ML8A 1QSFA 3H0TA 15C8L 1OOAA 1RIUH 1NEPA 1SLWA 5DR5L 1UTDA 4NQCA 2VAAA 5D7HA 2JJTC 4NZDA 5KYNA 3D39D 1RJYA 3VFNB 3O6LL 5SX5K 3WD5L 5IBUG 1J1PL 3HMXH 4LEOA 4X7EC 3N0AA 4YSAA 4MHHG 2WP3T 4O9HH 3MV8A 3TU6A 4RA0C 1J87A 3D85B 1RFDL 4XX1G 2WSDA 3QWOB 5K59F 5E99H 1QZ1A 4JFQB 3R8QA 4N90D 4KDTA 4NZTL 1OCWH 5DHVB 3T8XA 5D6CA 2F1BA 3VFTB 3O0LA 2J1ZA 2OZNA 3OTTA 4JPWL 4CGUB 4P2QD 5IEHA 4HIJA 3IDIA 2VW7A 3SGJA 4F2ME 2AGJL 2DWEA 2IAND 4HCRH 3L7FA 5IW3A 2BPBA 5HYFA 1T20A 2FHFA 3ILPB 3S5YA 2XI9A 1FNGB 1IBHA 2P26A 5IFHL 3MNZA 4YOKA 5F72S 3GHPA 4I2XA 4KKPA 4H5SA 3CFEA 3E6HA 3NUKA 4XMLL 1QLFA 5CZXC 3ASOB 1WLHA 5CP3A 1C5CH 2BOBB 1WS7A 5ESAA 4YK4C 5A2KH 4K3DL 4KITB 2N7AA 2X05A 3GGWB 4R96A 4DSYA 1ZCRA 4NJAH 4LLUA 4R3SB 3BKYH 4HDIA 3MVSA 1ZHKA 4JFDA 2D03H 2G3NA 3OR7A 3SKOB 1E8ZA 4P48A 5J6GB 2P42B 4BSWA 3AU0A 3QYNA 2OAAA 1SEQL 1OV8A 3QSKB 4HJ0D 3ULSB 4A1RA 2ZD0A 2NX5B 3KYMA 2WOYA 5FOBA 3CH1A 3MJ8A 2A77L 1QFWI 1R0AL 1FFQA 1P4BL 5DD3H 2DQUL 1T0MA 4YWGL 3TPUB 4JZJA 2P5EA 3QHZH 5F9OH 1UADC 2Y7MA 3MUGB 4HMEA 2VERA 2X38A 2XPZA 3PV6A 1PQZA 4KFZC 4E41D 5C71A 2PCPB 4G6AD 3TYFB 3IDYB 3WFZA 4CJ1A 2BVOA 5CILH 3UYPA 3G6JA 3BQUC 3FC8A 1M7IB 2EC9T 3NP3A 4FNUA 4GFTB 4X8JB 1TQTA 2BJML 3MFFA 4W4NA 5CSBA 3TBTA 3T8MA 2VMCA 5IVZA 4X2UA 4FKHA 3BESR 4XC3L 3HCVB 1BBJA 3K81A 3AB0C 3UAJD 4JZNA 4RESB 4DEWA 2CM6A 3QQ3B 5E2WL 6FABL 2CO3A 5DJXB 1XBDA 5C0BA 2HMID 3UIYA 2MFNA 1J9RA 5BZZA 4LHUG 5E08H 1A14H 4QRRA 1G7LA 4G6MH 1DQQA 1BQKA 4R83A 4TQEL 1A8JH 1T5WA 3GBNL 4Y4HD 3MA7A 1DVFB 1Q9KB 3IAQA 2R1YA 2MCG1 4KKAD 1SXZA 4FJ6A 3QQ4B 2EE2A 4XWOC 5GHWH 4HK0B 1QNIA 1YY8A 3SDYH 5ENWA 3NA9H 1RHHA 2WNGA 1MQKL 4PJ7B 3U9WA 1NDMA 3ME0A 1U3HA 3P0YH 3SQBA 1I53A 2OMZA 4AGOA 5L2KE 1AMXA 5EIIG 4WUUA 3A23A 3QWNA 4WGWB 4HUUB 1WF5A 1Z1WA 5HYSG 2E4FA 4NNXA 3T4YB 3RWFA 1ZWIA 4PBXA 1EFXD 2F68X 1CDYA 2X4OA 2EXYD 3LTVA 4K7FB 5FHAH 4HJGB 3TBCA 1IRAY 3EYUH 1F45A 1PJ9A 3NTCH 3AW5A 1NM4A 3RHWF 3V4VB 4I4WA 4LCCC 3QIBD 3SBWC 3UGUA 4KHXL 1JXJA 4APXA 1B0GB 2D7PA 3BYYA 1E4KA 3SJVE 1E4WL 4KK5D 3VX0A 3B83A 1J1OL 4FQHA 1HKLH 2WLNA 1LP9A 4FG2A 1TNNA 4R90L 5K9KB 3MUJA 2VDQB 3I6LD 4O58H 4PJIA 1WAPA 3BEWB 2VDPB 3HLAA 1YEDA 5M95B 3X3GL 4Y4FD 4IOIB 1XMEB 4JFOB 3C6SA 4BSVA 3VUAA 3QEUB 3TOPA 5JW4R 5DJAA 3N9GH 8PAZA 2QDVA 3HNSH 2YFNA 4JY5H 4HC1L 5T33H 1VADB 3IFOB 1E7UA 2GJPA 4PJ9B 1YYLL 3S7GA 3UROR 5D4IA 2G9KA 4MXVE 2F74A 5DT1L 4MXWH 1R75A 4AYFA 4OR1A 5IMMB 5E9DA 3JVFC 4U33A 5E6YA 1M05A 1V54B 2M1KA 1QFWH 3B8YA 3CHOA 3AQDA 4KKCD 2K9UA 3PCYA 3ZE0F 4L8CA 2MPAH 1MRCH 5D5ME 2JCCA 3BDYL 2CLZA 2QSCL 3KPQB 3ZN6A 4KZEL 7CGTA 1I4FB 1HXMA 3CZUB 3DK0A 3SDAB 3UCRA 1KIUA 1JZ4A 1R3IL 3AFLA 3WKYA 1VFAB 2H0PA 3ZDYE 2E8ZA 3HE6D 5HVWA 3NPSB 3RGBA 5MEQB 4DP0X 4JRWA 2XVKA 1GGBL 3QJUB 4XN5A 1E3FA 3KWUA 1DVTA 1KTJA 2VQUA 2JVUA 3OAUL 5ISZB 1IVTA 3G9AB 4KNUA 2LU4A 5KN5A 3NAAL 5EIVA 4X83A 2UZYA 2H3NB 3QH3A 2EDFA 4PJHB 3Q2WA 4YHML 3ZYIA 4K94H 4JB9L 3B6SA 4MD0B 2HVKB 2AHIA 3BZ5A 5MP6H 4KK9C 1CGYA 2GJ6D 5FW6A 4BRVA 4BDVB 5GGSB 1W0WB 5C09E 1F4YH 2AC0A 5EEUA 2B5IC 5E8PB 1NCGA 2JKXA 1V27A 2F54E 4AZ8B 1O0VA 1OAXH 5I66B 4MB4A 1DJSA 2FT8A 3QXAA 5I6XC 1GW6A 1MW2A 2GITA 4GQPH 2IBGA 4U2ZA 4LFHD 4XPAL 5DFTA 4AG4H 3FULA 1YEWA 5AOJA 4UQ3A 5F6HJ 2ITFA 3CZJA 5LGHH 1QR1B 5CUSH 1DQML 2B0SH 2WXRA 1XF2A 2DKUA 4NQVB 4HD9A 2R8SH 1CLZL 4HCRA 4F15C 1UKSA 2VLKD 1HOEA 3EYSL 2XRAL 5GGQL 4OFYD 2H1PH 2GQHA 1P4LA 4JO2L 1S7WB 3GSQB 3QUXA 3FTVA 3C08L 3MR9B 4P9MH 4ZOCA 4NNYA 5LBSA 1RH8A 5CJXC 1J18A 4MA1C 2IPKB 1BYOA 2YK1H 1MREH 1NBYB 4QR7A 2FECL 3W0WB 5J3HC 3GEWB 1DJYA 3BH8B 3P4LA 1SUJA 4S11A 1LDPL 1FYTB 4NC1E 3L1OH 3EJQA 3KH4A 4HU2A 3BUYB 2CGZA 3OV6A 2O5ZH 5TF1H 4GKOA 3FSVA 3L5XH 5GRXG 3C5JA 4GP8B 4HFWB 1S3KL 3IFLH 2MCMA 1KIPA 3HFMH 1HSAB 2X4PA 4YAQA 3AXLA 1XGTB 5LO7A 1UM5L 1OCZB 5BRZA 3T0BA 3N0PB 4NYLB 5JXED 2JJUA 1KGWA 1F4AA 4YDVA 3KXFA 5SV3A 4M7LH 1RY7B 1BAGA 4YSPA 3LKSA 4KROC 4OLZH 4WO4B 3PWPB 4QAWA 1T22B 1T6VN 1TUPA 4BH7A 1ZANL 4TL4A 2X53A 1D5ZA 4F1ZA 1UCBH 1URIA 4ZUSB 3E9UA 3CQQA 4YO0A 1GC1H 3QYCA 4J3TA 4XVSL 4F7EA 4JPIA 5KSVA 4MNHB 2B8OT 2HG5B 2KUTA 5AD0B 3CX2A 3C6LD 5ITBH 5HHQB 4Z7WE 4LPWA 5FHBH 4W68A 4KOCA 3US9A 3NACH 5J1AB 1GKOA 2YPLB 3V0WL 4AWJC 5HYJA 3ZTJG 4AL8H 3PGDB 3IN2A 4BQCA 1CXIA 1UD5A 5ETUB 1S7VA 5LNGA 5C0DA 3EG9A 3PS6A 1OT1A 3WSQL 1XR8B 4I48A 1OZTG 1YEFH 4PJCA 2FNWA 1VFBA 5E1AB 4B27A 4XAKD 3OJDA 1L9PA 1M1XA 1MQ8A 4U1GB 2LLLA 3MBWB 1VDGA 4XVJL 1RK1B 1ZT4A 3BN9D 4GO9A 4AC2A 3EJSA 3ZUCA 4PVLA 3ZDYF 1BM3H 2BK8A 2OXGA 4GSQA 2PO6B 2WLKA 4HUKB 5ITFA 2TSAA 3RX5A 2RGSA 4GSUA 3L7EA 3RG1C 3HR5B 1K4DA 3STZA 5FF6B 5FKPA 1OAZL 1QPPA 4XMPL 2UXTA 3MUZ1 5GISH 5I9QB 3L3KB 4FP8L 4YNYA 5LLIC 2KYIA 5A2CA 1AXTH 1KXVC 2PPAA 3ESPA 5K69A 4ISVA 3ESNA 1P1ZB 1QATA 4P57A 2BOLA 1WP6A 2JB6B 4PJ5D 2DQGL 2NSXA 4FNQA 1P5VB 1JNNL 1GAFH 1I9JH 5HDOA 5A3ID 3IE9A 4W70A 5HTSA 1D7FA 2WQVA 4KGJA 4P5KA 5I17A 5JPMB 4RDBA 4L48A 4Y5VC 4FN0A 4E36A 2RH0A 1INEL 3G08B 4HX1B 2H26B 4YZWA 1JHLH 1SOQA 4E42B 5I30L 4S1DC 1LWJA 2OQJB 2WTRA 2BNQE 1NEUA 3ROOA 4OLVH 1MDAA 5B3JE 4PGEA 1R24B 2ZCLH 1FNLA 1MFEL 4YEFA 1CLYH 4YDIL 1DLHA 5F7AA 1BMWA 2DTSA 2HLEB 4W9HC 4NO3B 5JIMA 1ZJAA 4OZFG 4ZS7H 3GSRA 1A7RH 1QO3A 4MRCA 4Z7UB 4Z5RA 4X6CF 1LD9A 2C7UA 3SDDD 1HILB 1ADQL 2AEIT 2J43A 3CFDA 3GIVB 3RTLA 4HALA 5DLMH 4XN1A 2DQIL 4LK4A 1FV1B 2VLRA 1R3HB 3VRJB 2MIZA 4I0CC 1UXSA 2EEXA 2QSTA 4OCXH 3C12A 4DGYL 3FO9B 4OI8A 2WLLB 1MVUB 2I60H 3KPRB 3VXQA 2XNAB 4GG6B 4PSRA 4WNQB 5FB8B 2YKKA 4X50A 5FW8A 4UZSA 25C8H 1T1XB 1JWSB 3MBEC 5DJCB 4L2YA 2AAVA 3I75B 4R2GD 4H25B 4FQQB 2OR9L 3IM1A 2ZUTA 2XWCA 5I16B 3MGOB 4KZ0A 4WTZG 1NQBA 1R17A 2VABA 5GZNA 3LB6D 3LKNB 4LARL 2I26N 4NQDB 5IF0B 2DD8L 1ORQA 4G5ZL 5E1GA 4P3DB 4I3RH 4JZOB 3N1FC 4YSSA 1AY1H 4MA7H 5L0QC 3HC4L 2VZ3A 3V5HA 3N06B 4FNLH 3UIZA 1I31A 2X4UB 4UI2A 4L4VD 1UD6A 3TZVA 3P9MA 4F2MA 3QEHB 1EJOH 2IALA 3RWCB 2A9MH 4AK1A 2FIRT 1BQHA 1KT2A 4M6OH 4WSGA 2X2HA 3IDXH 4XC1L 2CIKB 3OR6B 5KYYA 4KRMB 4JANB 2QKIC 5EC1A 1E27B 4JHVA 3ARDD 1UXWB 4CSZA 3AU1A 4WWID 4OKDA 3TJHC 1JWMA 3CSPA 4PGZA 3L3JB 2XV6B 4TUUA 3RP1A 1AYOA 1F56A 2WJ7A 1J0YA 3ROLB 2HTLD 2WLYA 1A1OB 2FIKA 1F8TL 3UP6A 1G7PA 2WBJA 3O4LE 1QNZL 3AAZB 1AG6A 1UZGA 3LVTA 4PV8A 3ELQA 4Y5YC 1AKJD 1UT1A 1KIRB 3KPMA 3FQWB 1N0XH 1VFMA 1X5IA 3WS3B 3LQAH 1IAII 2DF3A 1XGUB 2WWNA 4ICXA 5C0EA 5ICYA 2VR6A 2H6PA 4I3SH 4MNGE 4I1PA 3KWWA 2IOMA 2BIQA 3V6OC 2UYLB 3DHMA 5EOQL 4ZXBC 2ZOKA 3MLTA 1S9XB 1Z5LA 3ZDZE 3INOA 2V9UA 1KCRH 2C9PA 2JKNA 3GSNH 4NWTL 5TGBA 3VXNB 4JAMA 5B4MC 1BYPA 4QWWC 4RGNE 1NUNB 1FRGL 3WFHA 3OF6D 3OB0K 4HZLA 2CCVA 4HUVB 2EDNA 1DJWA 4IOSD 5EU3A 4E9QA 2BVQB 5J6HA 2KLTA 3OXSB 2VN3A 3FZUC 1A7NL 4PLJC 4AYSA 1NSNH 2XG5A 4PS4H 1HEZB 2QQKH 4CNIB 1FO0L 1QA9A 4HQQH 4NI6A 1PY9A 4JG9A 4ORZC 3EFOB 5B3JF 4UV4H 4KMLB 5F88A 2HTKD 1YEIH 2BMKB 5A16B 2Z8WC 3T2LA 3LV3A 3L5WB 3G04B 5CHNA 2PR4L 4DP5X 4XN4A 3QJVB 4DVRH 1DE4A 4RMTA 3VH8B 1JTPA 1ZRUA 4D0CB 3ETBJ 5JXAH 3GRWH 4E68A 4GW4A 4M4PA 5DJDB 4S1SH 5MERB 1P7QD 5CFAA 4L0YA 1U30A 3X1FA 5LJYH 3TT1L 1ZTXE 4D0DB 4MMXC 5IMLB 3HG0A 3K2UL 3LNHA 2W95A 1IGMH 4X7CC 5JO5A 5CWSB 1UXMA 4JM2C 4OCNC 4PJFB 5AYUL 4RFEA 5CD3B 5L2KA 2YLKA 1VB9A 5FA4A 1FG2A 5GRUL 1YMHB 5EOCJ 1Y6NR 2P8LA 1K85A 3PP3H 1SVZA 4L4JA 4GI8A 3S3SA 3DOIA 4TV3A 4RWYL 3HC3H 3RDTD 4PJGF 1IBGH 2O5NA 1O7DE 3BGFB 1PY4A 3AREB 3ENEA 4P07A 4U3CA 5JZ7C 1QX1A 2WWMD 3L1GA 5ALCH 4PJHE 5IHZB 1I1CA 1XH0A 3HPLA 4NT6B 3FU0A 1LM8V 3D06A 2ZKMX 3SJVA 5J1TC 1I7RB 1MLBA 1CTMA 3DTXA 4U6HA 2VXTH 2EUVA 2ITDA 2O30A 4LASH 2VRQA 5ICZB 5E6ID 2HRLA 1CU4H 1F6FB 1D9KD 1NGXA 4K2UL 3VNZA 2D4FA 5TK2A 3N42B 2JKJA 2JIXD 3LZFL 3N55A 4QCIA 5G5DB 4FYRA 4I3GA 4LAQH 5HVHC 4HKBA 2VZVA 3I9GL 1G7IB 1WITA 3IJ7A 3S37X 1NCIA 3ARBB 3QIWD 3KLDA 4C4UA 4K7PH 5IQ9B 4BFOA 3O41A 3LMJH 3HB3D 1PG7L 2L7JA 4W9GC 5F71A 1CXKA 1P5UA 2H0EA 1U0QA 5PCYA 1MWOA 2A9DA 4NQEB 1DZ0A 4GB9A 4BYHA 3FRPB 5I1GH 4ODTH 2HAZA 4M9PA 4KKBC 4FKKA 1TFPA 1IAIH 4GKSA 4LSQL 4ODUA 1O9WA 4HEPG 4PD4J 1NEZA 1TVHB 4OJYA 5D5MA 4WW2F 4QXTA 1NINA 2NR6A 4UWQB 3MJ9A 3PL6B 4HLJA 3S2CA 2WLIA 4LLDA 1XSOA 2VRAA 2Q76B 1OD7A 4KI5C 1WVZA 3N1QC 1MI5E 3US1A 2B15A 3TO4B 1OSEA 5GS1B 4U1JB 3HG1B 4N28A 3A4FA 3GSXA 3EOBB 3TVMD 3VWKC 3HVNA 3PQYE 3HE7C 3MOBH 4P9HH 5JYLA 3JZ7A 3MLZL 4DEPB 3I50L 4UYPA 2HFEB 5CJQL 4B9YA 2CCWA 3HBZA 3UO8B 2Z9TA 1J05B 1C1EL 1LDSA 4R5TA 3LZLA 5A40E 3NJKA 4JG1H 5SWZE 4ZNCD 3VXOA 3ATAA 3B5TA 4RMWA 1NIBA 4X7FC 3RNKB 3ATEA 2VXSH 2WUCL 4O5LH 3BAEH 3HN8A 4NM4H 5C09A 3CSFA 3RU8L 2X6MA 5EUKA 3VGEA 4WW1B 4ZNEE 4JJOA 2HT3C 2VDLL 2F54A 1GYAA 1F4HA 1A6ZB 2L7EA 1J9SA 2EH7H 4Q6IC 5FM8A 1SFDA 4ONHB 1KCBA 2VUOA 4H4NA 2YMXH 2WAQA 3CCHA 4LSPL 4U1SB 3CPUA 2XKNB 1EZVY 4Q8BA 2HKFL 4H26A 4MS8D 3VFVA 3N44B 2A7BA 3DI2B 1Z0MA 1XIWD 2PWFA 2Y5TA 4UOJA 2EDMA 2PMZA 3IJSA 1FDLH 3M8OL 4NENB 2X4TA 3D8MA 4J4PA 3V6ZB 4BWWA 5B39G 3MX0B 1EERB 4N2IA 3ZKND 1OCCB 5JIPA 1KMGA 4YXHL 3VFUA 5T5NG 3N1GC 4NPJA 4R4NC 3N2JA 4YK4B 3QEGL 1CE1H 3O8XC 3SGDI 2F8VA 2WVVA 4E5XG 1YMMB 2CDEA 3M1CA 1S5HA 1MFUA 2XWDA 3VXUE 3S88H 1ZGLP 1OM9A 4OVVA 2PWEA 1AIZA 1IGJA 1RKRA 2QGDA 4GI9A 2IH9A 2LVEA 2ZJSL 1BLNA 3SE9H 5JMOC 1KV7A 5F7FA 4NZ8A 2CDGB 3OPZL 4LCWD 3MCYA 1FHNA 1S78C 1XB8A 1N59B 1ZGLM 5K1NA 2BO0A 2VDMH 3UTZA 2AEPH 5DVOA 1QQDA 5EBWB 3FCUB 3REWA 4MZ3A 3S34L 2O5YL 2YZ1A 1Y07A 1KB3A 4V1DE 4ZMQA 4UILH 5EZPA 3ULVD 4KRLB 4Z76B 1IAKA 3I3BA 4RDQG 3D4ZA 4LQFH 1KC5L 4ZFQA 5I15H 1N5YH 4ETQA 5FYKL 2LU3A 4PGJA 1MF2H 5FYLH 4XBPB 3BQUB 2D3NA 4TVPL 3GSNA 1FZKA 4NO0A 1N26A 5JW3L 3II3A 3MLRH 4MJHA 4BA8A 5BUAA 4YE4H 2NY0C 3GTVA 3LPFA 1JYWA 1NGZA 3V9EA 1CJYA 4ODSL 3FB6B 4O2FB 5CIPH 4P23A 2RCSH 3AB0B 3CVDA 4WI0A 4Z7WA 5FW7A 1BZ7A 1A2YB 3VGAC 2D0GA 2AJZA 2LR4A 4PW9A 4OF6A 4W1TA 4P4RA 2GK0B 4HMCA 1MHHB 5DC2A 1Z9LA 1KEMH 1EXGA 5IQLA 1UZ8A 4PTUA 4BIKA 2HG0A 2VDNH 5T1MB 4OQTA 3VI4E 2XT1B 1Y0LB 2YD1A 2Z6FA 5I1EL 1WZKA 5KBLA 1FNEB 1FN4A 4PY8J 3DMMB 2ZUSA 4JNXA 4S1RL 1VCBC 2CXKA 4AQ1C 4XCCL 1HHJB 4DESA 1JDDA 4PRIB 3FQNB 3V8CA 3WG7B 4MNQB 1TEGA 4UF7C 4YHOL 3GXNA 4BJLA 1OAUH 4WWOA 5J7CC 4HJJL 4MAYD 4NJ9L 3MFGB 5F0PB 1CF8H 1X5MA 3KPRE 3V6FB 4RISL 1P2CA 5B38B 3BAYA 3G6AA 4QHUB 1ZHNB 1UZ6E 3NN8B 4B0MB 4GG6E 5T3XD 3I9IA 3VVWA 4OLYL 3MI6A 5AKVA 3QZBA 2E9BA 2VE6A 4KKQA 1OGTB 3EYQC 4PS3A 5KSUB 2ZUQC 1K8IA 1KGIA 3MXWL 4HS8L 2E7LA 4S1QH 4QUOA 3V4PL 2ESVD 3D18A 2WLHA 1JD7A 1JWUB 3OG4B 2WLJA 4LCCB 3QWOA 4JFFB 5E6ZA 4QT5B 4U1MA 1S9KC 3ESVF 1PTZA 1AHWA 2C3HA 1DJGA 3B2UC 2CG9X 5DHVA 1RMFH 3GMNB 5B1AB 4OJDH 4KO7A 2J1XA 4N22A 3F6IA 5AZEL 8FABB 4PGDB 2B77A 3ILPA 3H2WA 2RIKA 4D8OA 3NSFA 5DJ6A 1H9VA 1ESOA 5F7YC 3VXRE 2BNQA 3VSVA 3RTQC 3SGDH 4PBWD 2IWEA 3WE1A 3X14B 4URKA 3CFBB 2YXWA 3HKFA 2XBDA 3LEXA 1S8DA 2WUBL 4WWKD 1BXAA 2APVA 1FO0B 4XPBH 3VQ1C 2AK4E 4N2FA 4GAYA 4HJSA 1TLKA 4OT1H 3DGCR 1KN4L 4BCXA 4R3SA 3T0EE 3OKOB 5KVGE 3IDJB 4KJQD 4CW1A 2AXGB 3FUHA 1I8IB 4I87A 4IMLA 1HL8A 1O7SA 1U8KB 3VB9A 2LU5A 3INUL 2AMUA 5EFIB 4BD4A 5EORL 1AXIB 2EUWA 3UCQA 2DAVA 4AYID 1SQMA 4HUXB 4BE6A 3NZUA 2WO4A 1IC5L 3C8KA 1HH9B 5KUMA 1KNOB 4Y2OB 3QB7C 3KPSB 4A67A 4DKFL 2WTPA 2FR4B 2PCPA 2ATKB 1M71B 2MH4A 3HAEH 3U4KA 4A2GA 1E2WA 2PXYA 1CI3M 4WI5A 1XBRA 5T1KD 1F90L 4A38A 4I77L 2G60L 1QP1A 4OM1L 4X8JA 4CC4A 1RURL 3D39E 3W9EB 1F02I 2AEQH 4M1DL 3RVWC 1C8PA 3S36L 3GSOB 3QFGA 2XFXB 3TBSB 1CFSA 1V3LA 5CLZA 4J6RL 4UT7L 4NEHB 3MLXH 3D50A 3EO0B 1S7TB 3MV9B 2MQ0A 2GTZB 3PRZA 4IU2A 4OD3H 5DJXA 2UWEB 2QADD 4XP5L 4XCYA 4P2QE 3ZBMA 3QFDA 5KTEL 4QHKJ 2BCMA 1FZOA 2H32A 3SODB 3ZRSA 1OP4A 4GEIA 4UQ9A 4F9LC 3RWJA 3U2SA 4IS6A 3TJEL 2BXZA 5EU5B 3BSZA 4OBSA 5GGTH 1Q9KA 1WUZA 3VI4F 1TZHA 4BA0A 5C92A 1E9OA 3QHFL 4MKTA 4G80B 5FO2A 1AO7D 1KGXA 1DBAL 1L3NA 1S46A 2OX5B 3NJLA 3O0RL 3TYGH 3VE0A 4ZMOA 2EUXA 4WW2A 2QZQA 2AJYH 4F15B 1F13A 2C7FA 1U42A 4ZOEA 3O4LA 1W8EA 4ADIA 3I2CL 3LN5B 2J5WA 2KQNA 1OQOA 1X5KA 4ZD3L 3T4AB 3T4YA 4JHWL 1NBCA 1UZ6F 2B2XL 1TIUA 1TDQA 3EO1B 1X9RA 4FFZH 1CYGA 4K7FA 4MA1B 1JV2B 4XMUA 5H37H 3V0IA 4FLQA 3AS1A 4MNGA 1KYUA 4F2FA 4NUPA 2ADIB 2GC7C 3QJZA 2BW4A 2ZUWA 1KTCA 2QQLL 2OKMA 4HWBH 1YC8A 1TF4A 3G5YB 2GUOB 2F18A 4ODWB 3Q6FA 3OVUB 5DEZA 3QDGD 5K39B 2H3KA 3ZQXA 3PHQB 3KLSA 4XNBA 1PU0A 3BEWA 3HJ0A 2W0FB 4DUXA 4IOIA 4JFOA 4P49A 4O02L 4KTDH 2EYTB 5I8EA 3DKHA 1A9EB 5EA0L 3JVGC 4KROB 1IV8A 1SOSA 1KN2L 4R4FL 4MA8H 2WXMA 4PJ9A 3VWJD 1UACL 1HCZA 2VDLB 5TDPA 4FFYL 1TKWA 2N4IA 1PZUB 3MCLH 3QDMD 3FH5A 1W8NA 1Q4NX 3SGEI 3V9CA 1NAMH 3ZU8A 1NMAH 2DM7A 4Y4KC 2Y7QA 4ENZA 2RBLA 1I9IH 1V3MA 1ZS8A 3SZ6A 1CFQA 2KDGA 3MRNA 4S0TD 1E3ZA 1Q72L 3COOA 2ZNXA 3KPQA 1L6PA 1I4FA 5L6YH 1PFCA 1RUAL 3BO8B 5JHDD 1KLFB 1FSKB 5IMKA 5BOJA 1CFTB 2L0DA 4AE1A 5KZCD 4IYKA 5KG9B 3ZVVA 1TTBA 4MD4A 4PYGA 3RPBA 3L5HA 5I82A 5JNYA 3BI9X 4FQLH 1J1XH 2XFGB 1WZ1L 2GSIA 4F7KA 5AVVB 4HWEH 3FU5A 3EYFB 3PWLB 2O61B 1VKXB 3QUHA 4PJHA 3OQ3B 4U1KB 1B2WH 1U8CB 2NPLX 1S9YA 3BZFB 4MD0A 2HVKA 3BWZA 3ZT5A 3UAFA 4AYMC 3I9PA 4X9IA 1MJJA 4BDVA 4JFEB 1W0WA 5E03A 3JWNE 4ODVL 4AQAB 2QKSA 4V2BA 4U1HB 3NSXA 2BP8A 3FTZA 2A74C 5DC0A 3FQ4A 5BO1L 3DOSB 1IGTB 1HNYA 4M8VA 4B9FA 3B37A 5GS0C 1U8MA 1ZMYA 2P43B 3B3IA 3EH4B 2VO8A 3E3QE 3EOTH 5JPNA 1MWAH 3J27A 4JVWA 3ABKB 1YNKH 2UVFA 1MIEH 4R6UA 3EUDA 4BFIA 1K3IA 5EIQA 4DP4X 4Y5VB 1N2RA 3RBSA 5ERWA 3V52L 5I6NA 4KJYA 5KVGH 4N8VB 5CEXB 1UEYA 1H6TA 4AEHH 1BG1A 2NMSA 4R7LA 4FXLA 5C0AD 4JY4A 3CZGA 1ILUA 1AZUA 3MYJA 3Q7JA 1AGBB 2QELA 1CDCA 3OZKA 1NKGA 2E59A 2NY4D 3PGCA 2RFXB 3IGLA 3ZMNA 2Y07H 4S0SD 2FX8L 1MI5A 2W65B 2XV3A 2YKLH 4XTRD 3OGOE 2AJXH 5IB4B 3GZKA 1KFAH 1RUMH 1UWXH 2IOIA 5EN3A 5F2FA 5I18L 4LCVA 3PQYA 3PIQB 5ID1B 4PJXF 2LTQC 3BUYA 4POYA 3VSUA 1OANA 2EIZB 5D1QC 5E5LA 5I0XA 2L04A 5MI0C 5A2LH 3H7BA 3UERA 5E0QA 3G9VA 3LDBC 4G43A 1HSAA 1KV3A 5ECJE 3RIKA 4NI3A 1DUYB 3EGDB 2WXPA 1ND0B 5SWZA 5J8OA 4FXKC 4NYLA 1G87A 1LNUB 1U3JA 4X4XB 4CADA 1ULVA 3AXHA 5AAWA 3IKCA 1PAZA 2YGVA 3RGVD 3ARFD 4FQXC 4N20A 3K5SA 5H35B 1T22A 3I6GA 3Q5TA 4J3VA 3MBEB 2GJ6E 5AZUA 2LT9A 4ZNEA 5ADPH 1DBJL 3SGEH 4UIMA 4IDJL 5KVMC 4IRSD 1RZQA 4GSRA 1TNMA 1M6UA 1JK9A 4GG8A 2HG5A 4LLVB 5GIRB 3V4PB 3GHEL 5JOPD 2R0ZH 4J3BA 2X4RB 3MV7D 2YZ8A 3GIZL 4FCHA 5HHQA 2V5MA 1MAJA 5L0QB 1DO5A 3SDCC 3FU8A 4BUQA 2OMXB 4OIIL 3GMPB 4XH2A 4ATWA 5GJSL 2Z4QB 4KXZH 4QAMB 3QJRB 3T8VA 2FBJH 5D7KD 4DERA 3DGDA 1BEYL 2QV2A 3CJJA 5EULV 2DIJA 2K78A 4LSVL 1EO5A 1FZMB 2FWSA 2QKIB 4UCFA 3Q1SH 2VLKE 4WUKH 5GS2D 3VFSA 2MCPH 3RWEB 1BFSA 4KQ3H 2E76C 3ILDA 3LEVH 4HWZA 3C5ZD 4N2LA 3MRLA 3A0OA 4LLMB 1KTDB 3CDYA 4MNQE 3THMH 4AQOA 5BV7B 5AVUB 3VXUA 1IM9B 4W9KC 5H94B 5E8EB 4JO3L 3CGTA 3FT0A 2DQDH 1MCQA 4JREC 4GO6B 3OLEA 5DU7A 4Y5YB 3AT9A 2JKRM 3QUML 3HHRB 5IREA 1J0ZA 1MW0A 1LO4L 4MQ7B 2BS8A 4U7KA 3P02A 2OJZH 3VXPB 5DUPH 2FT7A 3FONB 1L9OA 3OLDA 2OMYA 3OJ2C 2JB6A 3MRQA 4H20H 4J3UA 4NN6C 5D1ZD 3VD5A 2G0LA 1C8QA 5C0JB 1RZKC 4HPOL 1D5XB 3HI6L 4LVOC 4ZXBB 4JHAL 3JTTB 3TT3H 4JM4L 5JPMA 5E1HB 3DROB 1I3GH 3ML9A 3LQMA 1OAJA 3NCYP 5C0CD 2AVGA 3JTSB 4HX1A 4UOQA 4U2YA 3O3AA 2P52A 2C1PA 5IJVA 3IJ9A 3QRGH 4F7CB 1NUFA 2AV7B 2A6IA 2TRHA 4HSAC 5D8JL 1B4JH 3CMOH 2IQAB 2VXQH 5KVEL 1OGSA 3DA0A 3BAWA 3F04A 4ELMF 1YNTB 3IMVA 2IBZX 4X0KB 2O5XH 2XKUA 3VI4A 3RWDA 3KHQA 4PWIA 3H7LA 1HILA 1SMAA 2VDKH 4MJJA 4M5ZH 1I7ZB 3GIVA 5F8QC 2VH5L 4XAKE 2ED7A 2JQMA 4TSBH 1FV1A 3VRJA 1QI5A 3UEZA 2YEZB 3W3BA 2LLNA 2WGXA 1U2CA 1XCQA 5LUMA 4P4KC 2FH6A 2CU9A 2C4FU 2VZUA 3N85L 3Q06A 5IMMA 1CDUA 2DQEL 4HZAA 3KPRA 5IBTL 1HX0A 2V9TA 2ZKWA 3OAZK 3KPSE 3QFJB 4YL4A 3WNJA 4GG6A 4KTYA 1F4XL 3JT2A 3K4DA 4GKLA 5FCSH 4ELKB 3UTPD 1NGQH 4MLIA 4HF5H 5E4AA 2GSMB 5IV2B 1CLVA 2C3XA 3I75A 5AB1A 3LXUX 3CZLA 4H25A 4FQQA 3LZPA 3DSNB 4N4YB 3QPQC 4K8RD 5IHUH 2VISB 2VR9A 2OMUB 3I6KA 1LE9B 3MGOA 4I5BA 5DA0B 1NCOA 1Z3GL 2GY7B 1H3PL 3EH1A 5IF0A 4GAAA 3OL2A 1YN7B 3WJJC 2DH2A 4WO0A 4UT6H 1ET7A 3CLEH 4PJ5E 2DICA 2X4UA 3PHOB 4X8XA 3MV9E 1IQWH 2BC4A 1J8HD 2A6JA 2GCYA 2AABH 3A6CL 5AB2A 5IHWA 3RWCA 4YIQA 2NYYD 5E7FA 3E6FB 1VGKA 3OR6A 3VXRA 3IU4L 2ZOOA 5FKAB 1QSEB 3PY9A 1F11B 2OL3A 4JANA 4O02B 4YDKH 1E27A 4GBXD 1XF1A 1B9KA 2HX9A 4F58H 5HVHB 3QCVL 2CK2A 2BZDA 4XNYL 4QRSA 1QASA 1KYOK 4QLRA 2MTAA 2AK4A 3HTLX 4C47A 3WEBA 5LNDA 3L3JA 4Z0XB 1A4KA 1IM3A 3WIFA 3ROLA 1MRFL 1YEGH 5EU6B 3T0EA 3GMRB 1MCDA 1NL0L 4XP6H 1A1OA 3D5OF 1QBLL 4BK4A 3AAZA 5I8KL 4HXAL 2BHUA 1AR1D 1KIRA 1Z66A 1Q0EA 2FO4B 3DI3B 3FKUS 2DLEA 3DV4B 4JL2A 4YSOA 2C34A 1UFUA 2PPCA 3BE1L 4J3WA 3WS3A 4QRPB 4HBCH 4RETB 2P5WB 1UA6L 2WAHA 3L4CA 4PW3A 1TZAA 4PRDB 5FK9B 4OTXH 2J2ZB 4ZFGH 4D3CH 2UYLA 3WFCH 4Y9FA 3VMOA 5D7JC 2YBGA 3HE7B 5I8CB 5IEKB 4WFED 3KDPB 4M7JH 3O45B 4NRYA 2EC9U 2X2IA 3DK2A 1CURA 1G7JB 2NY2C 3VXNA 3QCUL 3D39A 4JGJA 5DURB 4BM7A 3DIFB 4ZPVA 1BEXA 4WI2A 1F4WL 2WIIA 3X1BA 3TA4D 4N2AA 1UD2A 1C08B 1RZ7L 5KOMC 1FFOA 1N3NA 4P2CG 4V1DA 2QLYA 3WIHA 3WNIA 1RZJH 3LQZB 3VACA 1AZRA 4CNIA 4P3CL 1TZIB 2H2SC 4L4VE 1TETH 4P2QA 3EFOA 4NQQA 2FX9H 2KS0A 4WDIB 4GYBA 2E9WA 3EFDL 5F9WC 3FQXA 2JE8A 3L5WA 4FCAA 1BPLB 3CG8A 1KDIA 2F1EA 4M29A 1FH2A 1IJ9A 5TJWK 2YXFA 4K5NA 3VH8A 5F93C 1L7IL 1ZE3C 2OSLA 2NY3D 3CE1A 2CGRH 4FXGB 3GXMA 4XO5A 3EH2A 4P06A 3OLIA 4D0DA 1SY6H 3EGSA 1JD9A 5D2LB 2GUYA 4R0LC 5HHOD 3TA3D 5I8OL 4UMSA 1W6WA 2IG2H 2VUYA 3FO2A 3CTTA 1UCTA 2LVCA 4MCZB 5KAQF 5CKGA 3NJNA 4G8AC 1ZLVK 1YMHA 2F7OA 4P5TD 3BPNC 2JJWA 2CWRA 4XVTH 2VWEC 3VXMD 1EXUB 4IMKC 1UJ3C 5TDOB 5HD8D 1BQLH 2K0RA 5DJ8A 4DCQB 4P2YA 3TURA 2CNZA 3GINA 1FP5A 3O8XB 3AREA 3E8VA 4LEXL 2GBVA 3UTSD 4ZZFA 5IOPB 3FQ1A 3QUYC 2XN9D 2Y36H 4IKKA 5TQ2L 3UAEA 1I7RA 2XXGA 1C5DB 2BSED 3TCLA 3TTSA 3ZE2F 5DEFB 3VD7A 1I7TB 2R69L 4RMBA 3SOBL 4DP6X 2QZ5A 1U91A 3LKRA 2RR3A 5E2JA 1D6EA 2Q87A 1YEHL 1OGAB 2QHRL 5G5DA 3SPVB 4F1SA 1EZSA 4M8QB 1CD8A 1AYRA 2QVTA 1UA3A 3QJHB 5FYJD 2NY1D 1RXLA 2YAMA 3RAJH 1OPGL 1I8UA 5DS1A 1U4EA 1VZIA 2FJSA 1NEZG 2IGTA 3O2VH 2Q6WB 2EDOA 2J57A 2J3SA 5FYKE 3ULUD 1NGPH 4W9ZA 4EDXB 4P2RD 2IH1A 1I8MA 1BFOB 1LEIB 2Z0UA 2NY0B 4U1NB 1A6AA 2P3YA 4O51B 2WNXA 3B9DA 4JHZA 3L08A 4LEEA 1AD9B 3CFIC 2F7IA 1MXGA 1WPCA 1GTFA 3VGAB 3WXWH 4Y4HA 1UM6H 5EBLA 4E0RB 1YN6B 2VXQA 3O2DL 3GI8L 3MRGB 3P4MA 3SDXB 2F2HA 2BIPA 2Q76A 1ZVNA 4FMVA 3KG5A 4IU3B 4X6DE 3ZKMC 5JUEH 5TE7H 3DETC 1JZ3A 2AXWA 3BPLC 5GS1A 1BZOA 4DN3L 3ZUNC 5DRXA 1G43A 3SQOL 2V7HA 4ZMXA 2Z1PA 2IQ9L 2AKRA 5KANI 2ICWB 3BIAX 3GXIA 4RMVA 5JR1H 3VA2C 3KLAA 4Y2DC 1T7YA 5ANMB 1R5VB 4EOWH 4RAUB 1GMEA 4G5AA 1EFXA 5J89A 2J8HA 1OXYA 2ZCHH 1W6LA 4QJ3B 3VW3H 3K6SB 1K9TA 2ROXA 2Z31C 2HT2C 4PB0L 3QIBA 2J55A 3MACH 3H9HB 1BAFL 3OZ9L 3WXVL 1QMUA 1MCWW 3K8LA 2DQCL 4HH9A 4WW1A 3QUMB 5CR1A 5E6SB 1BVLA 4I9WD 1ETZB 3LXAA 2ZUQB 1OEZW 4PB9L 2E27H 1S5IH 1SYSB 4ONHA 2KT6A 1B0WA 1ZKAA 4Y4FA 4CU7A 3EBHA 3T5WA 2V5RA 5LWYH 4MJID 2EVGA 4LU5H 4HLEA 1WCQA 9PCYA 3D48R 4DGUA 5DDHB 4KDWA 2YO3A 1U8QB 3KYKH 1EVUA 3U4EA 2OBGA 2IADB 1AS7A 3U7WL 3FTYA 3V6ZA 3HBPA 1WDAA 1TT6A 3MX0A 2XA8H 4KO9A 3RTQB 3UZVB 3NH7L 4JG0H 2C3VA 2G2PA 4LPXA 4M4RB 2E74C 4JR9L 1KBWA 5AEAA 4B9IA 4NKDA 4JO8A 4FHBD 3VJ6B 3LH9A 5ESVB 1VERA 2V3EA 4U4BA 5INCB 3TN0D 3U0TA 1DSFL 2GJJA 3GO1L 4B96A 4URTB 3WHXA 3ZQ9A 3S9DB 1HEJC 4XP1L 1ADQA 4LP8A 5DJYA 1E43A 4R7NB 3BUPA 3HE6A 1QLEH 2VLMD 1BVNP 4AT6A 2HJLA 2VXVL 2X5PA 3IPEA 4LHUB 4NHUB 4OZGB 4BQ9A 4ELDA 1N59A 3F64A 3IJHB 5BOZG 2YAEA 1WHOA 2W88A 4QXUL 2DWXA 1Q0XL 2E5EA 3G5XB 5DHYB 3UZEA 5EBWA 5IVXF 1BZ9B 4W9JC 1HXYA 1IZKA 1JPTH 3PXHA 1V8HA 2XN1A 4IK7A 4Z76A 4PGCB 2IVFC 3Q6GH 5DZ9A 3V6OE 3VRLE 4FTVB 1HZHH 3ZW3A 2YRLA 3BQVA 3LKQB 2GJ6A 1NFIB 3FB8A 3T3MF 2APFA 3TFKC 5DYOA 5EWIL 5EIIB 2YHGA 1DTUA 1F58H 2CLRB 2N1TE 4O2FA 5ID0A 4KDTC 2NYZA 2WQUA 5HYSB 4HU8A 2K6WA 3IVKA 3S4SA 2EYSB 3LJ3A 1A2YA 4GUOA 4KK9D 2MKLC 5T1DL 3SGJC 1RLWA 2GK0A 3EBIA 1F6LL 2E4TA 1GIGH 2JKIS 5IM7B 1TQWA 5J5EA 5DTFB 1UWEH 1UENA 3A47A 3W11C 2B1HH 2R4SH 3QXVA 4YSRA 2VLKA 4K73A 1PZBA 5AFAA 4X6DF 3EYOA 4OFYA 3B9VA 3M46A 3DMMA 3BRDA 1XGRA 1ZEAH 4F8TA 4LOUC 5F9AC 4X6FB 5L2JB 1SDDB 3FQNA 1NCAL 4MNQA 2R2EB 1FJ1A 1EO7A 1I7UA 3DX1A 2YA1A 3GB7B 1V05A 1FZJB 3ECQA 2ZICA 4ETYA 1NFDB 3V6FA 1U8IB 3MZGB 4AIZB 3NN8A 3EJZD 1BZEA 2HSIA 5DK0B 4Y16D 1CWVA 2FYYA 2YSSB 3LY6A 1ZV9A 4GIAA 4Z1PA 3FNKA 1EWHA 1JHTA 1HC1A 3GXFA 1CQKA 3MV01 4G7QB 3AS0A 1FLRL 4JZJC 3DXAD 3L95B 4APQD 1U6AL 4GKZB 5DD5L 4PUBL 3LH8A 4LCCA 5JXEA 3UPCA 2DQTL 2AQ3A 1IQDA 4LGRB 4OCWH 3ULVE 4WI6A 2WZ6A 5D7IE 5EOCH 1P9MA 3GMNA 4G6FB 3MXVL 5E4EC 2H8PA 4PQXA 2RB8A 4PGDA 5CJOL 2XG4B 3R0NA 3HN3A 4PBVC 2PW2B 2AV1B 3U2JA 4EF3A 2WYHA 4HKJA 3PDGA 4H13C 1N7ML 4G9DA 2V8MA 3C8HA 3RVXC 3WI9A 1QBML 2GEEA 5KSAD 5EG6C 2PNDA 3GJEA 3L3HB 3UFIA 4XPTL 4JUSA 2NY5C 4BCZA 3V95A 4YXKH 1OTSD 2YGNA 2VN5A 1GZHA 4DKAA 1MNUL 1KXQE 3OKOA 5EU6E 3LYRA 3IDJA 1B4LA 3O3DB 1W72H 1I8IA 1PMYA 3FB7A 5HVFB 1U8KA 1XXDC 4Y4KB 1DVUA 2G5BB 3SYPA 3NFNB 4G8FB 4X7SL 1LO2L 2Y22A 4GW5B 4QRPE 3K1KC 2FX7L 3IETB 1RJZB 1KGCE 1U3HC 3CHPA 2J1WA 3BP4B 4CN4A 4Y2OA 3TEYA 3KPSA 1NC2B 3AROA 3DX6A 1KWKA 5JQ6H 4DHLA 5T1JA 4FZEL 2FR4A 2NY7L 4UBDC 4HJUA 5T3XE 2B7DT 2KZKA 3QNFA 1U58B 1R19A 3DVNB 3LS4H 2W60B 2ARJB 3OZLA 1W16A 3T1WA 3W9EA 1WA1X 4WLCA 1WZAA 2PP8A 1Z3RA 2CPUA 2QMKA 3EGXB 2DLGA 1RIHL 3BPOC 4ZMAT 1E4KC 2ZX8A 3RBGA 2XFXA 3MBXL 1A9VA 3BW9B 4PJ5A 4F7MB 2ETWA 4X9HA 5IB5A 1XGQB 3EO0A 3EO9H 3MV9A 3PJNA 2GTZA 4KH2A 1CPUA 4LRNL 1J5DA 3HKZA 1EEUA 3LN9A 1EANA 3KWTA 4WV1A 2A74B 4PJDE 4PY8I 3T6VA 3NZHL 2C9RA 1C16B 1NIAA 2NDGA 1SPDA 2IPUK 2R0KL 4GOSA 4TSCH 4PVNA 3S5LG 1JGEB 2SEBB 4BHUI 4N0RA 3NCCB 1ZDSA 5FM4A 4TUJB 1HFUA 4MYWB 5HHMD 1AZBA 3LRLA 3MRKA 2EKSA 4O4YL 1KCVH 5BMFH 5D70L 3QA3B 2VR8A 4XBGB 1A7PH 1BVKA 1CLOL 3ARSA 5AG9A 2OX5A 3U1SL 5L8KB 4OZIB 2AJ3A 4QRQA 2XYCA 4X80L 3HBQA 1HZKA 3U46B 4L5FL 3DURB 3SDDA 4Z3IA 5LKNA 3NJMA 3PPEA 2IDCA 2ITCA 4MDJB 2GT9B 2B16A 43C9A 4CKVX 3W39A 5DYFA 1KCKA 4IGBC 2XVGA 3T4AA 1HI6A 4GKNB 3W57A 2HFTA 2E6JA 2X0UA 2VM3A 3MUHL 4U6TA 4JFYA 1CK0H 4A2HA 1B6UA 4Z7OF 2OV0A 3BVDB 4X5XB 4QY8B 4J3OC 4ZUWA 3TO2A 3BP7A 1PLCA 2GUOA 2PTVA 2V9QA 5DRZA 4B3EA 3PHQA 4HJIA 4J8RB 3OKNB 4P59L 5GGVY 1JVOA 1G9MH 5D7IF 4XE5B 3RPIB 5L7XL 4FXKB 1NBVL 5GZOC 2DWDB 2EIMB 3AGWA 3W1ZA 4Q6YA 1JNHB 1HHIB 4BK8A 3ZTCC 1BXUA 4FQXB 4QF1B 2R9HD 5GQBA 1A5FL 2XWJA 4L4VA 3MROB 3GPEA 4DT2A 3VI3E 5B8CA 1W0VB 2XJKA 1FE8H 1UT2A 4PYHA 3TV8A 1MSPA 1A7OL 1UFGA 3T6WA 2HJKB 4N1CA 4D9LH 1YNLH 1H3WM 2Z35B 5IKCA 3M86A 4G72B 3C2AL 1D6VH 1PYWA 2A99A 4AH2B 4CAGA 3HUJE 4C4KT 3QPXL 2CBOA 3SDCB 3SE3A 3QUZA 5ACLA 4MMYB 2HVJA 4R97C 3SDXE 3GMQB 4KZDL 5F7LB 1AO7E 2IO5A 2ZUYA 3JUYA 1KLFA 4KRNA 2C4XA 3Q8EA 4LSSL 1I1AD 4XNXH 6CGTA 2IGLA 1MH5B 5E8NB 1EVTC 2V17L 3ECUA 3QUXC 5ALBL 1FFTB 4KWUA 4HIXL 4JKLA 3IGKA 3N43F 2B1AL 4NQSB 1IX2A 4H8QA 1B88A 3LCYA 4IEFB 2D31B 3S3DB 2LFEA 4PJ7F 1A6VL 1N68A 4K0OA 4OV5B 2OSYA 1D7CA 3G5ZA 2VQ4A 2CAKA 5DD1H 3H53A 1JZDC 3LXBA 3VDAA 1MAKA 3D25B 4B5ZA 5FECB 4X4YA 2FRGP 1NWPA 4JREB 4PD4K 4OZFB 3T77B 3GXUB 4MTMA 4U1HA 1XAUA 4UT9L 5A2AA 1J9TA 1HOCB 4M43L 1QG3A 1UYWH 1N8ZB 2DDQH 3S37L 3ZOAA 4IBSA 3OF6A 5AW6B 3ALXA 3IF1B 1CICC 4X5WB 4PJ8B 5I1JL 1PSKL 3GSVA 1EX0A 4NN6B 1YEKH 1AG0A 1VJSA 3B2PA 1XT5A 4LVOB 4WJ5B 4HGWB 1QWHA 5C7XH 2QJDA 5BXFB 1L7TH 2BOCB 5K9JL 1Z0NA 4ZMYA 5KW9H 4F91B 4KXCA 4HPYL 5JMRA 1WK0A 1UH3A 1ED3B 1XTMA 1ACYL 2XA3A 1JPFB 4ZTOH 3DGGB 4PLOB 3FCTB 3QXDB 1LO3H 1U8LB 4KY1L 4F27A 4PLJD 1QTPA 2NXYB 2WXIA 3OJMB 1P7QA 2G3ZA 2FUQA 4X6DA 1CDGA 7TAAA 3BT2L 5IB1B 3FCSA 4NC0B 3BZ4B 3PAZA 3RFZA 4Y7OC 4DZ8B 3TV3L 4OUUB 3HZKB 3IFPA 4H0GA 1NOFA 4OCYL 5T3XH 5ID1A 2ITEA 1W72A 2EIZA 1YO4A 2AEWA 4XP9L 3HAEG 3WJLA 2PW1A 3H3PL 3EFFB 4PBDA 4P4KB 3RDTA 3FK3A 4POZC 5LCVA 3BFQG 3R1GL 1D7BA 1I1YB 1EGJA 1RULL 3B56A 4OFQA 4KV5E 1LNUA 4QTIL 3S0PA 1T4WA 4DZBA 5ABZA 2EXTA 2VDOL 3LH2H 2XQ0A 4JM2D 4DTGH 2CBPA 1FL6A 4R26L 3FT3B 3EHBD 5CEZD 1N6QH 4L8BB 2HWZL 4LIQE 5D7SL 4R4BB 5E00A 3ZYOA 1LHZA 5E6IA 2VDQH 1INDL 2Z91B 4M9OA 4Z3TA 3TONA 1QHOA 2DPKA 2VDPH 2X9XA 4RH4A 5GIRA 4I7ZC 3V4PA 5FWRA 4Q9RL 2HRPH 3E7JA 3MODH 4Y2LA 3P30L 1CE6A 2PETA 4MBOA 3VI3F 7PCYA 1XF5A 3WFDL 2Y0SA 3DX2A 2EVHA 3GXPA 3QNZB 1N0LB 4AEEA 3QIWA 4NO5A 2EKJA 1T1ZB 1T4KB 2BVTA 3KPPB 4EKJA 1XF3B 3B2VL 3HUJF 4DAGL 2Z92A 1MFCL 3KPLA 4DQOL 1FZMA 1NWOA 1B2YA 1EHLH 1AXSA 3DYOA 5F3BB 5J11C 3QG7H 3CFCL 5CCKH 3KPOB 4BZ2H 5C0AE 5E2TL 4F80A 1JERA 3EJPA 1P6AB 1TEFA 5EC2B 2QQQA 4LDOB 3RWEA 3QQDA 4ODHH 5I74C 1AOZA 1LE5B 3CFTA 2CHDA 4AW7A 5LXGH 1KTDA 1VFUA 2CZNA 3MOAH 2MOQA 5KJRH 3CBJB 3QR0A 5H94A 2AJSH 1DL7L 2FTAA 2VL4A 5H37G 3DBXB 4GXFA 2R0WH 1PS3A 3TVMA 3WGUB 5F0LB 5JTWA 2OJEA 2QT6A 1RPKA 2W9DL 3FMGL 3BLKA 2FWUA 3FH8A 4Q7DA 3HG4A 1B0IA 3UBGA 1MN4A 2WO2B 4MQ7A 2MQGA 2V2XA 3BGMB 5F9DC 3DV6B 4AYBA 3FOLA 1Z5YD 3FUIA 1KTLB 3S35X 4HISA 4XT1C 2ZWYA 3V6OA 3PAVA 5BZWB 3VWKD 1MCOL 1EXHA 4H88H 4XWGL 2ZXDA 3BJLA 5F7EL 3DROA 3BVWA 3IDNA 2NY2B 3KD4A 2AK1H 4JPVL 4TQPA 3RJQB 5GZNC 3JTSA 5DFAA 4L1BA 4KX7A 1C12A 2AQTA 4UTBA 4C83B 1N8OE 2Q86B 5JOPE 3FQ2A 1WQVT 5GRJL 3RKPA 4AV0A 4NFCA 1MCHA 3B5GA 3TZVC 1FGNL 1UWGH 3DDFA 3IDMB 1DQLH 4H0IA 5HPOA 1YNTA 2HFFA 2HT3D 1VACA 3WKNA 4X0KA 1SYVA 2UXFA 4KJPC 1PIGA 2XWRA 1XIWA 5D7EA 5D7KE 2X6BA 5F9WB 1YQ2A 5I1LA 1I7ZA 2OMTB 3BX7C 4TRPH 1KBGL 2WWKT 5HJ3B 3F85A 1SJEB 2MNJB 4HH8A 3QXWA 2YEZA 2XUWA 4NHCH 1WBZA 1UEMA 2AXFB 1FPTL 4R0LB 2DQ6A 1FFNB 4EI6B 2CO4A 4XPHH 2VMDA 3O9WC 5EUOB 1KB5L 1JV5B 4M1GL 4XPGH 1BX2B 4PRPD 3JWDC 3BP5A 4UOW1 1D5BA 4KV5F 3VG0H 4R4ND 4CU8A 4EN3B 3C09C 1AQKL 1UJ3B 4JRXB 3FSAA 5I19L 4NAJA 3DSNA 2OMUA 3VFGH 4BINA 3AVEA 3R18A 1WEJL 4H8HA 1J5IA 5GJTL 5EU4A 4RX4D 4ZO9A 3QUYB 1TFHA 2B3IA 3U25A 3OKLB 2A1WL 5C0GB 3GNMH 5D7IA 5AVTB 5DR5H 3WEAA 1AFVL 3NCJH 2OZ4A 4FQJH 1N9PA 4UM8B 2CDFA 3ZGIA 2P7TA 4G11A 2XTLA 3H9SB 4G7YL 1RUQL 3UMNA 2BS71 3E6FA 1WZMA 4ACPA 3APNA 2ZPKL 2QQNH 3EKCA 2A0LD 3TCTA 5I1HL 5CP7A 5CZVH 3HNTH 4PJBF 1R5IB 4RWHA 1FC2D 5IT2H 1GC1C 3X2QB 4Z0XA 4OFPA 2CRYA 3FFCB 4XE0A 2BCKA 4DP9X 1KXQA 4KVNL 5EU6A 1HHKB 4DP7X 4F24A 2JSFA 4ABUA 2KMWA 3HZVB 5GGRB 1UB6A 2WCGA 3BXNB 3HC2A 4H1LA 5KS9B 4ZO7A 4IRJD 2GFBA 4NGHL 1DN0B 3P9LB 4BQ6A 5H4YA 3GS0A 3RNQA 4PG9B 2OK0H 3QS3A 4Y1AB 3UJIH 4Z7UF 3HI1B 1MRDL 4G8GD 4LLQA 4QRPA 4JFVA 1QKZH 4A7GA 2V2WB 4PRDA 3BPLB 5E5RB 1T03L 2J2ZA 1YC7A 2X42A 4MAYA 4ZOAA 1BP3B 4JDTH 3MRJB 1KGYE 4R5VA 4OI7A 4LIQH 1PX3A 3D87B 3NEEA 4A39A 4TYUA 4PV1C 5IEKA 4TNWF 1QTYT 3U79A 3O45A 3Q9PA 4XGZA 3UTPE 1ROWA 1G7JA 1SLUA 1TTFA 4Y2DB 2AQ1A 4FFTA 3CPLA 2M83A 1ZXKA 3KR3H 2BINA 2CO7A 3DIFA 1OL0A 4F7TB 3G6DL 4QHNB 5B39B 2NOYA 5T3ZE 1R0AH 1Y1UA 2DQUH 5A6LA 1P0SE 5DFWH 4V11A 2X10A 1RIUL 2Z31B 3K72B 3K0YA 3BUQA 5DHDA 3IGUA 2CJTA 2CR0A 3H6JA 3LHPL 4JPKH 5D1ZI 4E5XB 2PYED 2X89D 3A67L 4AV5A 4Z7QE 1J8HE 4KTEH 1L5GB 2WV3A 4AIXA 4PJDA 4WDIA 5HGGS 4IBTA 3P4OB 4GRLB 4HK3N 1GCYA 5E99L 2YC1B 5SWSD 3U48A 1AZVA 1OCWL 1KGJA 2K8QA 2IBBA 1D2PA 5H2BB 2X4QB 1P5UC 4FXGA 5C86A 3B2UD 6FABH 2RTTA 4MB3A 4JKKA 4HCRL 5ESQB 1RUPH 4WWKA 3MTRA 1MAMH 4LPCA 4B50A 5IQMA 1O6TA 1UM4H 1JXKA 1A4JB 2AQ2A 4LRIA 3V55A 3L6FB 5BS0B 2VM9A 1VRSA 4KRPB 1C5CL 1BZ8A 2NR6C 2Y6SC 3K3QA 4HIQA 5DJZA 5LBSL 3G5VB 4BZ2A 4MS6A 5F8RC 3DSFL 3A5VA 5CZRA 5G4MA 4QOKE 4NJAL 3WNKA 3C9NB 5DZNA 4YBQC 4JLRA 2FEEL 2NYKA 5A2JH 3QJXA 1FA4A 3NT0A 1MQKH 4W4OA 1CG9B 1N12A 1A22B 4F7PB 2BP0A 4GT0A 5JORB 2X6VA 4XMXA 1UOLA 2ERJC 5HHNB 1CMOA 2X88A 5E5UB 3OWRA 1T21A 4AXWB 4U6XB 3BWAA 4XNZC 4HIHA 3QHZL 5F9OL 3KGRA 1J9QA 1QSFB 3H0TB 4M8QA 4IQHA 5D4HA 1FNAA 3W5MA 4WU7A 3U4BH 2VDOB 4QHMA 4QRAA 5CZKA 2NXZC 3SO3C 3BP6B 5CO1A 1RJYB 3KGSA 1BJ8A 1E4WH 3ARTA 4HHAA 1J1OH 3JBG7 1BZDA 4LEOB 5AYQA 3VI3A 3NRQA 2OSXA 1BFOA 4FQPA 1LQSR 3MV8B 5EF3A 1WIOA 2XLLA 4NN5C 3X3GH 3QDAA 1XSKA 3FS9A 3HUJA 4JVUA 4XNAA 5D6CB 3ASNB 5IEHB 5GS2H 4PR5A 4HIJB 2Z7WA 2BY0A 3IDIB 1A1MA 4CMHC 1OCRB 4HC1H 2DWEB 2V5TA 2BSRA 5E08L 3SDXA 1T20B 4ZODA 1A14L 4IU3A 1LEGA 4ZT1A 4J4PC 1AO7A 3MNZB 3H3KA 4OIFA 4A55A 1ONQA 7FABH 3RZCC 5HBBA 4H5SB 3CFEB 3M1OA 5HHOE 3E6HB 1QLFB 5C7ZA 4N5UA 4JJ5B 5IGXL 1F5WA 4G8IA 5ESAB 4Q4EA 2A6KA 2J72A 2W07A 4MZIA 5GHWL 2CJUH 3JWNG 3Q05A 3O3EA 1R5VA 3L4VA 3SDYL 3VXME 4RAUA 5CN3A 2ODIA 1D5RA 3NA9L 2YMOA 4LLUB 3LRGA 4HDIB 4G42B 4PJFF 1ZHKB 4JFDB 4KZEH 3P0YL 3OR7B 4NC1C 2NW2A 4K5MA 3UTSE 4XVUC 1R3IH 4RFNC 1U4FA 3CH1B 3MJ8B 2W1NA 3QZOA 3OAUH 4CBZA 5FO9A 1ETZA 3NA4A 1T0MB 3FT4A 3NTCL 5CS7A 4JZJB 1MFBH 1J8SA 3VSTA 1ZAGA 4N2KA 4PMEA 1I75A 1TYEB 3PV6B 4Z7QF 3ESMA 1KG0B 3ZZQA 4UDUA 4QNPF 4JB9H 4KUCD 2BVOB 1HKLL 3H1ZA 4MQSB 4PWHA 4MGXA 2ENJA 1CR9L 3G6JB 5FCUL 4LP5A 2G5RA 5FYJE 3MFFB 4HXBL 3GSUB 3TBTB 4O58L 5E4EB 4UV7L 3IPBA 2WZPD 1SJVA 4XN9A 1U8QA 4QTHA 1BJ1J 3VWJA 3ULUE 4P23C 4Y19B 2R39A 2IADA 4CVXA 2YWYA 3B9KD 3N9GL 1YLBB 3MMEB 2PPDA 4ZMLA 3HNSL 5T33L 2I07A 3KVDD 1RSFA 1N6UA 2IGFH 4QRRB 5INCA 1YPZE 4JQXA 5E4OA 4BCYA 1T5WB 1X5FA 4JMNA 4S2SA 5MEND 2X9WA 2CKBH 1QFWL 12E8H 1DUZA 3EYSH 2XRAH 5GGQH 2UVEA 3IAGC 3MA7B 5IIEA 2MPAL 4ENED 2R1YB 3WFEL 2WZ5A 4ORGA 4LHUA 5DO2D 3IJHA 3C08H 4N3UA 1YY8B 1EIBA 5ENWB 4K8RH 1RHHB 2DB8A 2IH3A 5AW0B 2BIHA 2OM5A 1NDMB 3ME0B 1BQ5A 1U3HB 1ZLDA 3R0MA 2OMZB 3SQBB 1JZHA 2G3MA 4GP5B 4WFGD 3L48A 1KENH 4JX0A 3KM1A 1KB5B 3IRZA 1S7XA 3VX1A 3S4SG 1ZWIB 1NFIA 2GI0A 2OW6A 4LFHG 4UB0H 3WIIH 3T6QC 3HN5A 2NSQA 1H3TA 4JQVA 4M1CC 5CD5C 3ZPDA 2Q0ZX 1AZZC 4I9WE 4G6KL 1JYVA 4K94L 3BPOB 4APXB 5FM5M 4RBPH 1JYXA 4MAZA 3PNWA 1AHWC 1AD0A 1B6DA 1KBPA 2MPVA 3CN0A 4FQHB 3FUNA 1H9DA 1F4YL 1LP9B 1OT4A 3FHAA 3T09A 1Z7JA 4MJIE 4NN7B 4PJIB 1OAXL 1QFPA 5IM7A 1PGRB 3HLAB 2C9AA 4BSVB 3C6SB 5DJAB 1WBXA 4GPVA 4E9YA 5GS0D 4AG4L 3VGDA 5C0AA 2DQJH 3KEDA 5KBNC 3IMWA 3MPCA 5LGHL 4QRBA 5CUSL 2B0SL 1H8NA 1PLGH 5G55A 5DQDL 2X3AA 3V0WH 1EJFA 2Q1EA 4X6FA 2F74B 1KIQA 4AV4A 2L7UA 3KL3A 1PG7X 4FFWC 4WU5A 1TCMA 1SNRA 1T2XA 3GB7A 4LSUL 3SPIA 1UH4A 3ZQWA 4AYFB 4F8OA 5E9DB 1M05B 2F9BT 1U8IA 5EUOE 2H1PL 3ZZ1A 2MOVA 3ZKQD 3JWDL 2ATPB 4L5FE 1JPSH 5HGBA 3JWOC 3GMMA 5CBEA 1ZA6A 2YSSA 2JCCB 5IFJA 4IBLT 2CM5A 4P9ML 4XBMA 2ALAA 4IGBB 2JK5B 4OF5A 4XVJH 3K91A 3MU3A 1MREL 3GKZA 4ZO8A 4ZW6A 2JJSA 1KEGH 2NNFA 3EJYD 1WCBA 1LVEA 3L1OL 5C2BH 4P9HC 2O5ZL 2F8IA 3T3PB 2PXYC 3L5XL 4AMKL 1M4KA 5CINL 3TF7C 1OAZH 3QNYB 5D1QD 3ARFA 3IFLL 3V4UH 4CC4C 5JW5A 4ZX3A 1HQRA 1ZHLB 5KN5B 3QZNA 4AE0A 1BD2D 3VFWA 2UZYB 3QH3B 2XG4A 3GM0A 3ZHNA 4IRSA 1H8SA 1BJMA 3RDJA 5INDA 4EIBA 4M7LL 1G7MB 3TTYA 5LN8A 4OLZL 3V0VB 3RIAF 3ULUF 1JNNH