3IEAA

Structure of reduced m98l mutant of amicyanin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
b'DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFLRGKVVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title Defining the role of the axial ligand of the type 1 copper site in amicyanin by replacement of methionine with leucine.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 25
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ieaA00
5B3SB 4HZ1A 1A4BA 2Q9OA 2QT6A 4K9JA 2XV3A 1PMYA 2IWKA 3NSYA 4KO5A 3NJIA 1M9WA 1E30A 1TU2A 3EH5B 2VMJA 2AANA 5I6NA 1FFTB 3SBPA 1ET5A 1JOIA 1OCCB 2ZONA 1B3IA 4DP2X 1W8EA 1GYCA 2VM4A 2HZHA 3FSVA 4A2DA 2HLEB 2UXFA 5B7FA 2DWSA 1IC0A 1ILUA 1BEXA 3IE9A 1W6LA 1RZPA 2W88A 2Y69B 3IEAA 5I28A 4G7QB 4A67A 3X1BA 1J9TA 3SBQA 1KCBA 1IBYA 3FU9A 4E9XA 3JTBA 2EILB 3PCYA 5I5JA 2CJ3A 2FWLB 1AG0A 2PP9A 1NPNA 2WO2B 2B08A 1TEGA 2JXMA 3NJKA 1OV8A 1XMEB 4BWTA 3FT0A 2BP0A 2YAPA 1PZCA 2TSAA 7PAZA 5I5MA 1E5YA 3FS9A 2WO3B 3CG8A 1A4AA 2GSMB 3EH3B 2X88A 1V55B 9PCYA 3NJMA 1WA1X 3EF4A 1IBZA 4DPAX 3NJNA 2GHZA 1GSKA 1GY2A 4DP6X 4DPBX 1NIEA 2IAAC 4HIPA 4A66A 1NICA 1J9QA 2FT8A 2J56A 2B3IA 4DP0X 2AVFA 1PZAA 1RCYA 3QPKA 4G7RB 1BXAA 4KO9A 1W6WA 1L9QA 3AW5A 4HHGA 2YAMA 1SDDB 1AACA 2ZWNA 1BYOA 2HX9A 2QDVA 3T6WA 4G72B 1AQ8A 4KNSA 3X1EA 2VW7A 1AR1B 4A2EA 3KW7A 2W8CA 3ERXA 2EIMB 1CURA 4YSSA 1SF5A 5I6OA 2NRDA 2DV6A 2XX1A 4P5RA 1A4CA 1NIAA 1ZPUA 2VN3A 1PY0A 2QPEB 4YVUA 3X1FA 5I6KA 4AKPA 2FJSA 2GI0A 1QHQA 2H5UA 4AZUA 1ZIBA 4BDVB 7PCYA 3X2QB 6PCYA 1JXDA 1XB8A 2PLTA 3TU6A 1AS7A 1KV7A 4YSTA 3AZUA 1X9UA 3BQVA 3N55A 2AFNA 2UXGA 4YSAA 2P80A 1V10A 4E9SA 1M57B 4ZK8A 3ZBMA 1JVLA 4BXSV 3FQ1A 3QJRB 1AANA 2FQDA 1ASOA 2FQGA 2PP8A 1CYWA 1VLXA 2OV0A 3JT2A 2DYRB 3FSWA 4CSPA 2H47C 1PF3A 1BXUA 3IBOA 2I7SA 3L45A 2BO0A 3NYKA 3OMAB 1HAWA 1ET8A 3NSDA 1ZDSA 1NPJA 2EIKB 3NT0A 3EHBB 3S8FB 1JVOA 2MRYA 4P5SA 2DWTA 3QJQB 1J5CA 2DYSB 2YQBA 5EHFA 4JHVA 5IY5B 5I6LA 3QQXA 3WNJA 5I6MA 4YSCA 2HX7A 2GB2A 1JXFA 3S3BB 2IDTA 2VW4A 2BP8B 3DTUB 3GXUB 4F7KA 2IWFA 2YAQA 1XB6A 4YSRA 1L9SA 3FU7B 4WKXA 5FC9A 2A3TA 1DZ0A 1IKOP 1RKRA 3UAAA 2XWZA 3C75A 3CDZB 3H56A 2DY2A 1TEFA 3QJSB 1JZIA 4KOBA 5I6PA 1ADWA 2CAKA 1JZFA 4Q8BA 1T5KA 2PPAA 4BWUA 5E9NA 3TA4D 2XVBA 1PLBA 2FTAA 3ABGA 3ASNB 3SQRA 2PP7A 4E9RA 1QLEB 1JXGA 3NSCA 4JKNA 5TK4A 3DKHA 1SFHA 1BAWA 1OCZB 2FQFA 1L9RA 1AOZA 3AG2B 2XYBA 1BXVA 2XV0A 4YL4A 4DPCX 1KDIA 2I85A 3T6XA 2XLLA 1I53A 3MX0B 1TKWA 2BZ7A 2HRGA 1A3ZA 5I26A 1AS6A 1ET7A 1BYPA 3ABMB 2XUWA 2JKWA 1YLBB 3FYEB 4G7SB 1E5ZA 1ASPA 4AI7A 2GC7C 4FAAB 2J55A 1CC3A 2IDFA 3FQYA 1NIFA 2FQEA 2BWDA 3NP4A 1NINA 1AZBA 2BP0B 1KGYE 1PZBA 1SF3A 3D12B 3T6ZA 3NJJA 1JERA 4GP4B 2TSBA 2VSMB 3X1NA 1OE1A 4W1TA 1A65A 4YVNA 4BWWA 5B1BB 5D4HA 4KNUA 3T9WA 4DP9X 3S3CB 2R7EA 5F7AA 2YARA 3H4HA 2VW6A 2IH9A 4UF7C 1NTDA 3TBCA 4YSOA 2UXVA 4DP5X 3N2JA 3S8GB 1JZHA 2IH8A 4TXVB 4FA7B 5AKRA 4GY4A 2QPDB 3ASOB 3GDCA 3PAZA 1AAJA 3WIAA 1ASQA 4PCYA 3AG3B 4KOCA 5PAZA 2YAEA 2FT7A 2BZCA 4UAHA 4E9WA 1JZEA 4CSZA 1ILSA 3FQ2A 4AX3A 3WG7B 1MZZA 3WKQA 3OM3B 3OQRA 3IN2A 3T71A 2JFCA 3UAEA 2LLNA 3IN0A 2ZXWB 1A8ZA 1URIA 3OD3A 2UX7A 3QJVB 2XU9A 1DYZA 4AKOA 1KBVA 4F2FA 3UGEA 2UX6A 4BXVA 4EF3A 2Q5BA 4AKQA 1PNDA 3RYMA 4G70B 5LDUA 1NZRA 1J5DA 2Y1AA 1HFUA 2IDUA 3CVCA 2VSKB 3U25A 3ZX1A 2P80D 2GBAA 4MFHA 2PCYA 2XX0A 4GP5B 5TK2A 3OMIB 6PAZA 3S3DB 4PAZA 1J9RA 4NERA 5B1KA 2IWEA 1M56B 5A7EA 4DP7X 1EHKB 1X9RA 1GS6X 3DIVA 1V54B 3AG1B 2YAFA 2PPCA 4Q89A 5AFAA 1AG6A 4M3HA 1CYXA 1IUZA 8PAZA 4F2EA 4NB7A 1ZDQA 1NDTA 3X1GA 2X87A 4E9VA 2YXWA 4DP4X 3AY2A 4A2GA 4E9YA 2PPEA 4G71B 4A2FA 5PCYA 4ENZA 3ZDWA 2HRHA 2PCFA 4BK5C 1J9SA 4A2HA 1OF0A 3CZUB 3FYIB 1L9TA 3PPSA 1OCOB 3GYRA 3FSAA 3HB3B 5I5IA 1AZUA 3FPXA 1E67A 5B1JA 1OOWA 2H3XC 2FNWA 2RACA 5B1AB 1PNCA 4JHUA 1WA2X 1KCWA 2YXVA 1GS8A 1SNRA 3V9CA 3EH4B 4HCFA 1AS8A 2GIMA 2XV2A 1FA4A 1SFDA 4E9TA 1SHWA 3NJFA 3CVBA 3ZIYA 3KW8A 4E9QA 1PCSA 4KO7A 4GP8B 1CUOA 3PAUA 1MDAA 1KDJA 1XB3A 2CALA 1AZCA 4WTQA 1GY1A 2XXFA 1E65A 2MTAA 4YSUA 4GXFA 1PLAA 1KBWA 2BW4A 1SDDA 2HX8A 3PXLA 4HCGA 3TBBA 2OJ1A 1WS7A 1BQKA 4M4RB 4YSEA 2J5WA 1JZGA 4L0PB 4YSPA 2BW5A 2OCCB 4W9ZA 3WKPA 1UATA 5AZUA 1SJMA 2GC4C 1HAUA 2N0MA 1MG2C 2VM3A 3MBWB 4A68A 3FSZA 3QJTB 3PAVA 3QJUB 4HAKA 3PLYA 4KO6A 4N8UA 5D4IA 2CCWA 2PPFA 1NIBA 5F7BA 1NWPA 2UXTA 1GR7A 1WS8A 3UADA 1FWXA 3FU8A 2CBPA 5B7EA 5B1JC 1L9PA 3FPYA 1OE2A 3G5WA 4QKTA 1GS7A 1F56A 4BDVA 2QDWA 2BWIA 4NAJA 1MZYA 3WNIA 1N70A 2IDQA 4X4KA 2EIJB 1MG3C 2AZUA 3ABKB 2R7EB 1AZNA 1ID2A 4N4YB 4GYBA 2E86A 1OE3A 1ZV2A 5D4JA 1GW0A 2I7OA 3ABLB 4KNTA 3UACA 3NP3A 3TASA 1EZLA 5ANHA 4QLWA 1BQRA 4HHWA 3SBRA 3NJGA 4YSQA 2EINB 1NIDA 2AZAA 3CVDA 2XXGA 4DP8X 1BQ5A 2IDSA 2ZOOA 4RH4A 2FT6A 3T6VA 2J57A 3OMNB 3V9EA 1NWOA 2CUAA 1ZIAA 2PPDA 2BHFA 1SHXA 4UANA 3NJLA 3NJHA 2HXAA 1AIZA 3AG4B 1L9OA 1JZJA 1AZRA 1KYAA 1RZQA 3H4FA 1OCRB 5B7MA 3WI9A 2BP8A 2YAOA 1PAZA 1WAEA 2WSDA 1QNIA 1R1CA 1WA0X 3FU7A 3NSFA 3HEIB 4HCIA 4HALA 1PLCA 4DP1X 2YAHA 3UABA 3BVDB 1ETJA 3CDZA 1N68A 4YSDA
chains in the Genus database with same CATH superfamily
1KGIA 4GMSH 2YQ3A 4JZOB 4LCWA 1KXVC 1M42A 2Q9OA 5CGYD 3VWJA 3GJFB 1L0YA 1OQXA 4NQEB 2HYMA 2Q7AA 3KHOA 1T0OA 3OAWA 1YYML 5TDPA 1O6SA 4IRJB 4NJ9H 4OD2A 2R1XA 2DQJH 4L3CB 3G3LA 5EUKB 1HH6A 4PGDB 4NC0B 4PV8A 4OZFB 1ZVSB 3WNLA 3B5HA 4R26H 2UXFA 4UNVA 2C8NA 5AW5B 4NQQA 3M1OA 3SYQA 1MN4A 2JJUA 5IESH 1CGSH 4NAQA 3QEHB 2FIRT 1IGFH 3LRSA 3QJHB 3APMA 2EYTA 3D4YA 5AWNL 3POCA 4NO5A 1VCAA 1Q1JH 2FO4A 4KY2A 1RVFH 3FOMA 4KRPB 4DJMA 3QHZH 2OXGB 3F62A 4NZFA 4EBQL 1CICB 4NYLA 4LEXH 4YUEL 2NY4C 1NAMA 3QZWB 4APXA 4I77L 1A8JH 2FUTA 4OLZL 1KOAA 4XN8A 2WO4A 3EOBB 4Y2DD 1K3IA 4KHTH 2D8KA 2XWEA 2AK4D 4PRPE 4BFNA 5GGVY 2GSMB 5AL0A 4FQXB 3X17A 4X5XA 1YEKH 4RQQB 4S1QH 4WI5A 4GS7C 2NY3B 4JG0L 3MV7D 5FYLH 1H6EA 3CLWA 2XVLA 5E8PB 2E7DA 3VFGH 1Q94A 3T2NL 3OAZK 4HIPA 4HLJA 1UXWB 1Q9KB 2WKOF 4TUUA 3X3GH 1KSRA 2B3IA 2FBJL 3N40P 3LKNB 3SGJC 4AXWA 5EDSA 1ZGLB 1U3YA 1UACL 4HKBA 3U2SB 1FZJA 2R2CA 4K5OA 1QSFE 1A7NH 1NCAH 4MX7A 1DSYA 4YDJB 4TUOA 4CC0A 1AQ8A 2YIHA 4F2MA 2VW7A 5DZ9A 3DYPA 2C3GA 2R56H 3GI8H 2XQYA 3TFKC 5K93A 3A24A 5KVGE 2DQFA 2ZX7A 2NY2D 3IDJB 4HIEA 1JZ4A 4EOWL 5DHEA 7TAAA 5JOEA 2AV7B 4PWJA 3MYJA 1MFCH 3QUXB 3G5YB 5KBNC 4X80L 4WV1B 1RUAL 4BKLB 2VDNH 4D94A 2FYYB 1FZOA 2H6PA 4AV0A 4LFHD 1QUPA 1X7SA 2FJSA 3MN8A 3LNDA 4YHOH 4U0RC 2WBJD 4I13B 4XNMB 2KLSA 2XFXB 4PJXA 5KG9B 1OGAE 1RUPL 4WFHE 5IGXL 3D39D 3TOPA 1KV7A 5IHHA 5C8JA 3V0VA 4QTIH 5TDOA 4PSRA 3UYOD 1ZLDA 1BCIA 5F3HA 2DIAA 3LN9A 5ETUB 2LFGA 3LRKA 1BLNA 3P77A 1KC5L 4YDNA 2DYRB 3FSWA 3KPRE 4CGTA 4Z76A 5DUBA 2PTTA 1FNGA 1C1EL 2LVCA 2ZAHA 3DTDA 4NGHL 3HVNA 3G6DL 4PJBE 5SWZD 1K4DB 1KT2A 3MR9A 4FYQA 3NA4A 3IE4A 3ARVA 5I71B 4BSVA 1JFQH 2C4XA 5IMOA 5KYXB 1PX8A 2K8QA 3MFGB 4MA1C 4NFBA 1YEFL 2L8AA 2Z31C 3IYLW 3FNKA 2BDNH 4G6FD 4FP8H 3HZYB 3SDXF 3A5VA 1QMUA 1QPKA 2ZOKA 2V2TB 1OL0A 3BGMB 2XICA 3CFIC 4JRWA 2C1OB 1BF5A 4QAWA 1ZS8B 1M71A 3TH2T 1ROWA 1EXUA 1T89C 3QUYB 3PGCB 4R6UA 2Z1KA 1AY1H 1L9SA 5DURB 2EVHA 3LCYA 3ZQWA 1ECZA 3ZL4H 1GZQB 3UP1A 4FLSA 1G7QB 2CBTA 2WKLA 3EKCA 4MNQA 3H56A 4QY8A 4FFZA 3L3KB 4WNQB 4HPHA 1U3HD 2RBLA 3M6DA 1TEFA 1G94A 1PAMA 1KN2H 4V1DA 4FXGC 3BESR 2PPAA 2VABB 4FJ6A 1J8HB 4LCWD 5CEZD 4DEPC 3VWJD 5IK3B 1DO5A 2A83B 5KVDL 4RGOL 4LPUA 5TK4A 4WVRA 5JHDA 1F4XH 5E8EB 1QSZA 1ZRUA 5CZRA 3KD4A 4XNBA 3UBGA 1SOXA 3QFJA 4NQCE 3A67H 4LLYB 4G8GA 1HIMH 1UXSA 3PGDA 1KDIA 4XNXH 2PMZA 5EZPA 4N9GB 4G9FA 1B2WL 5JOPD 3ABMB 5I0VA 4OLYH 4JG1L 1YLBB 4N0RA 4PJIE 4GSDH 2COVD 1JYWA 3WOVA 1MWOA 3HMWL 3LMJH 4YDZA 4G7YH 3UDWC 5I6XB 5CZVH 4PGCB 2R0ZH 2EH8H 1LO4L 3F01A 1J1XL 2FQEA 3N1GC 2OK0L 3GSUB 3TVMA 2NY6C 3QZLA 2J3SA 5I1HL 3IS1X 2YPLD 2VLKE 2K9FB 2Z7ZA 1EFQA 1MCWW 1U8OB 4HIIA 2BRQA 4ZD3L 2QGDA 4FZ8L 3GGWB 4N0YL 2DLFL 2LT9A 3T04D 3VXSB 4Y9GA 4KNUA 5FR3A 1RZKC 5F6IB 1Q9LA 4PYHA 2YBRB 3S4SB 1MJ7L 3KXFA 4DH2A 5LGJA 4JQXC 4HS8H 3STBA 2EEFA 4EI6B 4S1RH 2CDFB 3RWFB 2F53E 2JKTM 3STLB 1QZ1A 2HCZX 2VLRB 4KKRA 3RGVA 3TCXA 3D48R 1RURL 2ZOLA 4P04A 3KH4A 3QRGL 4ODBD 2PW1B 2QVKA 5CD5D 1Q38A 5GJTL 4XODA 3HAEB 15C8L 3VQMA 1UB5A 3BWAB 5DJZB 5PAZA 5D4QA 4IJ3C 4ZPVB 5ERWA 2KT6A 5I19H 4G80A 3KPMA 4LF3B 5CBAB 4AX3A 1KYOJ 4L3EA 3QCUL 3AWFA 1P53A 2JFCA 2W94A 3OGCA 4OJFH 1WBZB 1NCJA 4GW5A 3B8SA 3VWKA 2BC4B 4JQIA 5T5NG 1GCFA 4BKSC 1H8OA 3FXIC 2BY0A 3BPOB 3U48A 5BZWB 1CU4H 3EADA 3MNZB 5G4OA 4KHXH 3L9YA 5FYLD 2HN7B 3O4LE 5K59F 4UDTB 2E0PA 2Y6SD 3SKNB 3KGUA 5CLTA 3QHFH 2APXA 4HHAB 2ZOWA 4OLEA 4HH9B 1S7QA 3SE4A 1KEGH 4YR6B 1WCBA 3DUSB 3TWYA 2D73A 1YDPB 3G04B 5EF0A 3RJOA 3GXTA 4XB3A 3WDHA 2A74B 1CFQA 1EHKB 1S7RA 1FNEB 4X4ME 5DJ6B 1OAUL 4TUJA 4KK9D 5I66A 3H9SB 1BF2A 1QG3A 1XQ4A 3H6AA 1LO3L 4NWTL 3L3HB 2VSDA 3HC3H 2WD0A 3ARGA 4N2MA 4M9PA 3OHMB 3WJJA 4PTUB 2FATL 3E6FB 5DZPA 4BFKA 1H8LA 3AROA 3IETB 4QHUB 2OR8A 1BG9A 1IMHC 3F58L 3H7LA 1LP9B 5C2BL 3WFDL 1WEJH 4IOFC 3VH8A 2E74C 2YEVB 3MLWH 4PJHB 3TT3H 1KLFB 5KVGH 2VMDA 2P8MA 2E27L 3BXNA 1LWRA 1UYWL 2NXYC 4NNXA 1YQVL 3D18B 5CJOL 4J3XA 1H3XA 2B4CL 1PKOA 4PRPA 2O5ZH 1I31A 5CEYB 1FLRL 1ZV9A 3ZR6A 2C9PA 1OPGH 4WU7B 4PP2A 2R2EB 5I15L 2BSTA 5GGUA 1EBPA 4S1DC 2RD0A 5I76B 4YDLC 5L2KB 2BP3A 3FQUB 2AK1L 4J5VA 5B38B 2HFGH 3MV8E 4X4YA 1GJWA 4U4IA 4ANWA 1N4XH 3NZUA 4XC3H 4X7TB 3VJ6A 1L7TL 3RL1A 4TQEL 4QT5A 3ROLA 1RP8A 4V1DD 4F20A 1DANT 4LCIH 1YEEL 3IMSA 4HSCX 1G1OA 1NCCH 3K6FA 4QUOA 4ZSOB 4JPVL 5F1KC 1QSFA 2ZKHL 2FX7H 2XZAH 1T7ZA 4JDVA 3U9PH 5JHDD 1J8SA 1EIBA 3PFQA 1KPRA 3PXLA 4LSPL 3VG9B 1SJEB 5FV2A 3FTGB 2J88L 4OF6A 1RZ7H 3MOAL 1MCHA 2EADA 4G8GD 4HK3J 4X6BA 3JWNC 4H8WH 1TKWB 3L3OC 2YK1H 1K4CA 2FGZA 2ZXQA 3N5AA 4JR9H 1F4YL 5E1AB 1E5AA 5EO1A 5C86A 1NC2B 2VL5B 4N8UA 1VADA 2IBBA 1HXMB 1S7SA 4OLVL 2CCWA 3OZ9L 3MLXL 3VCLB 4EJ1C 1CD0A 2MPAL 4O51A 4NQVA 1L9PA 1OGAA 2AQ2A 3EFDH 3WFEH 2DKSA 4QKTA 3WUWG 2XRAL 4LE8A 3NZHH 3TVMD 1E9PB 1NOAA 2JCWA 1XO8A 2HFTA 1NDGB 5CEXB 4JE4B 3KPTA 1VZIA 3ABKB 4OLXL 5D1XB 3DHUA 1B9ZA 1OAZH 1QTSA 1IBBA 2V7HA 4IKIA 3U0WL 4G6JH 3MUY1 4ZX5A 5KSUA 3KPRA 3VXQA 1MI5B 1YUKB 3ARBA 1T2QH 5J9PA 3DV6B 2OMTA 3P4NA 1ZGLP 4RETB 1ND0A 4R0LC 4KQ3L 3FFCE 5JA8B 4PJBA 1VFMA 2A6JA 3RGVD 3WXVH 3PL6A 5GPRA 3Q13A 4KZEH 4JE0A 1UM4H 4DP8X 1T83C 4QJ3B 4RH4A 2KDGA 4PJ7E 3SPHA 3JTSA 5KAQF 4FKHA 2YR3A 5D93B 4FTDA 2B2XH 3ATFA 3FU5A 3IF1B 3NRFA 1A6WH 2WP3O 4UT9L 3P54A 4Q6KA 3S9DB 1AIZA 1RZJH 4L3ED 1JF1A 5C0EB 4ZXBA 3O3DA 1OD9A 4N8CH 4UOW1 5ID1B 1A14H 3FTVA 1KTLA 1OCRB 3DX7A 2RQEA 2VN5A 5BRZB 2WXGA 3VWKD 2E6QA 1OAQH 2G4GA 5IVZB 1AQKL 2L4OA 2ZUTA 4OBRA 3V6BR 4NP4H 5DQJB 3WJMB 4BBWA 3W9EB 2VTFA 1KJVB 2YFOA 3TBSA 4JB9H 3TBTA 1N68A 4LEBA 2UUDH 1ZKAA 4ISVA 4GQ9L 4H20L 4WEBL 1DVUA 4HZ1A 3BW9B 2QV4A 1U8LB 4PCKA 2WIMA 5EUOF 5B8CC 2OSLB 1WFOA 3OJDB 3GMMB 1A1MB 4ZNEE 5E8NA 4U1KB 2NNAA 4HUWB 1ETA1 2R29L 3C6SB 3BDYL 3LKSA 4NQCA 1C5CL 4N8VG 4XNUH 1U4FA 1JGLH 1RUQL 4OFKA 3PNWB 4NNYA 3NMEA 3VXOA 4DQOL 2NTSP 2WQXA 2MOVA 4KC3B 1CE1H 1NFDB 4HGWB 1HKFA 3L5WB 1OB1B 2OZNA 4P59H 1AGDA 4G7QB 3ARGD 4PJIA 4LDOB 1FAKT 2YXFA 3N06B 4OTXL 3A6BH 3WIHL 3JTBA 4FQHB 3ZW3A 4A55A 3T3PF 4Y2DB 4MXWL 3CH8A 4NFDA 2AK4B 2WO2B 5BQ7B 2VLKA 1T66D 4ODWA 4AEIH 4AJ0A 5LWYH 4M43H 5DDHB 3HR6A 4PRPD 2X88A 4Q0XH 4N8PA 1MRDL 2OMVA 4CKQA 1FORL 3MFFB 4M6OL 4L9LB 2YQGA 1T80A 4ZYKA 1QBMH 1OK0A 1F45A 1OCWH 1GSKA 2F53A 2J4WH 1SYSB 1D7CA 3V7MA 1Q0EA 1MJUL 2F7IA 3IDMB 3PGFL 5EN2A 3S37X 2ZXCA 4YZFF 1JWMB 2DM7A 3M8OL 2HKFL 5EZIH 2ATKB 4A66A 4OGAD 1CT8A 2FT8A 4QPEA 5FEBA 1L7IL 2AVFA 4N22A 4UOQA 4XXDA 3LH2H 3F5WB 5CJBA 4KUCF 5HDQL 3VRJA 4WWKA 3NGBC 2ZKYA 1AC0A 4HHGA 4OLUL 2OA9A 4UV7H 3VGGA 1BYOA 1DQVA 1G9NH 1QSFD 4ZS7L 2RAMA 2NY2B 2O6DA 2EIDA 5GGTL 3RVWC 1A1OB 2DI7A 2I07A 4LASL 1A47A 4WGVB 3GI9L 2NQ3A 5E08L 3FO2B 5C9JB 2ADYA 4KKLD 3RWHA 1P4BL 1P84J 3K2IA 3M1BB 4M5ZL 3AUVA 5KVEL 3W57A 2CPCA 3FN0L 3JWDH 5CGMA 5C0FA 4HIHA 2OP4L 2ZPKL 2H32H 3C08L 5I6KA 1O9ZA 4M93B 4GKOA 2IFFH 4AUJA 1YNTF 1NBVL 4FOMA 3D39B 1EGJL 3GTTA 3O4LA 3UEZA 3WTYA 5AD0A 1DVTA 3FONA 4PWGA 5F0JB 3VMNA 1YNLL 3PXJA 4F33B 1JNHA 2H8PB 4WFHD 1JNLH 1HH9B 1QYGL 4E9SA 4FQ2L 3ZBMA 4XHJC 1XIWA 2VXVL 1EX0A 4U1LA 5CF3A 3TEWA 2FQGA 4LEOA 1CYWA 5IQMA 3H3BC 3EJCA 3MRGA 4MJ2A 1WZLA 5SWZB 3U4EB 3ARBD 1LDSA 4QHLB 4X4MA 3VI3B 3US0A 2O61A 2G9HA 4HPYL 2R4SL 3C6LC 4FN0A 3B37A 4D0DA 5LXGH 4EZLA 3PL6D 5D7HA 4G6FB 4G8IA 1AGCB 4B97A 5GGSA 3RB5A 1O5PA 1X6LA 4YO0A 2JQAA 4L37A 2H32A 2ICEB 3EDDA 5DLML 4DZBA 3OXSB 3CFEB 5I6MA 2DWEA 3BPNC 4NQXA 3ZKXB 3P11L 3KWVA 2AERT 4F37F 5GSVB 3B1TA 3KR3H 4R4FL 1WC7B 3BP5A 4WI2A 2JTYA 4ZXBD 5HI4D 3VSUA 2V3FA 4OAWA 3L7EB 4EIBA 1DZ0A 1U3HB 5F8QC 2CR3A 2F1AA 3UAAA 3KLQA 5DJYA 4PRAB 4J8QA 1GIGH 3CDZB 3UPRA 3MV8A 4YX2L 4TTGA 4LCWB 3KDPB 5IHLB 3WNPA 3HW7A 3VWJB 2RH0A 2CAKA 2ZUWA 5E2WH 5ADOH 4OZ4A 3EYOA 3BJ91 3N85H 4XPHH 5DYOA 3QNXA 4CJ0A 4Y1AE 3VG0L 3CH1A 5TDPB 1ODUA 1O6SB 3P02A 2UZXA 3P69A 1VESA 4OD2B 4OVUA 2R1XB 4AMXA 5K9KA 4MQXC 1HH6B 1NDMA 4PV8B 1U8MA 3QJFA 2R59A 4YZWA 4TL5A 4I18A 5M94B 1X9QA 3KG5A 1UOKA 1TF4A 4BUHA 2I85A 3CU1A 3LRSB 4M4RA 2EYTB 1HZHH 2WYTA 4XCCH 1I7RA 3FCTA 4NO5B 1AO7E 3DHJA 1I9RH 3GJEA 4PLJC 1LO2H 2FO4B 2Y6TE 2JKWA 3FOMB 5DT1L 5GRXG 4B7IA 5KYNA 1P4IH 4WI4A 1GXEA 4NYLB 5LBVA 5I0WA 2IDFA 1NAMB 4N1HB 4APXB 2OI9B 5CJ8A 1VF5C 4PV9A 3HE6C 5CR8A 3DSFL 3T6ZA 1QFUH 3ZIMA 3N0AA 4ZFFA 5ISZE 1CDGA 1YAIA 2TSBA 1RQ5A 3ECWA 1G7JA 1RZIA 3X1NA 2VLKD 4I7ZC 5B1BB 1N7ML 1MLCA 3PFUA 4X5XB 4IS6A 5IQNA 1V5JA 4HA1A 1NTDA 4A63A 5EEUA 1Q94B 5C1MB 1NKOA 3MCLH 3FFCA 2DM4A 2F53D 2WNXA 4MD5A 4P5TD 5AKRA 3JYBA 3KPLA 5KJ7E 2QPDB 3AU0A 4AXWB 3PAZA 3RVVC 2WAQA 4HKBB 4HISA 1FZJB 1I4FA 1JYVA 4NN5C 4PJ7A 4MX7B 5FECA 3ZUNC 4WWKD 3WKNA 4TUOB 1D5MA 4OM1L 4Z3GA 2FHCA 5HYJE 3QDME 1J7VR 3FQ2A 3Q8AA 4F2MB 4OJYA 3HS0C 2IPTL 2UY6A 3BKJL 2DQFB 4HIEB 3OM3B 3IN2A 5ILTL 3MYJB 4UYPA 5EU7C 4YHLL 2H6PB 1FZOB 2HUHA 2DWYA 3FN3A 1DYZA 3UCQA 2R0LH 5CR1A 2P26A 2R0KL 1GC1L 2XTLA 4NM8L 4F2FA 2QBWA 2ZWLT 4EZMA 3NCMA 5DYFA 4PJXB 1IBHA 5A1AA 2O6EA 4K3JH 3B34A 3HHRB 3O4LD 5C8JB 3V0VB 1MFNA 3EYFA 5TDOB 3APNA 4N86A 1R3JA 1F11A 5F3HB 3ASWA 3NK3A 1WWCA 2AV1A 4ZNEA 3C9NA 5AUMA 5SWQA 1BLNB 3P77B 4JFEE 1G7LA 2WXKA 4OCYL 5FYKE 5CFHA 4M5YH 4Z76B 5B1KA 2WZAA 2XWDA 4RAVA 4RISL 2PTTB 5DUBB 3U83A 1FNGB 4AUUA 4ZAKD 3QYMA 1A7QH 1KT2B 3MR9B 4R5TA 2ZKWA 3IWVA 1V7NL 5F9AC 3DIVA 2WQWA 4XO9A 4NHCH 2GT9A 4BSVB 1RJZA 2YRLA 5IMOB 2PPCA 1DTUA 4M3HA 2VDNB 2VM9A 1UWXH 5DA0B 4ZFQA 4E9VA 4M1GL 2WGXA 2ZOKB 3MJWA 4TOYH 1IM3A 2WQUA 4R90L 3FRPG 1UTDA 3HHMA 4QRQA 2HRHA 1M71B 2XJLA 2WSPA 1EXUB 3VVWA 1TZAA 1XR9A 2RACA 3F7QA 3QA3A 4DGUA 4PVLA 4M6AA 4MNQB 4QY8B 2XG5A 4MJIE 4NUJA 3QQ9D 2YXVA 4P9HH 4JM2C 3V9CA 4XMUA 2DM2A 4V1DB 3IXAA 4JGNA 1XH3A 2CBQA 4HCFA 3MV8D 4U2YA 3UAJA 5G4NA 5DC2A 3VM7A 5GS0H 1YYCA 5I1KL 1DVXA 1HYSC 4LAQL 5JHDB 4PJAE 1KDJA 2CALA 2WC7A 1W8NA 2QSTA 3CFTA 3QFJB 4FKKA 3NDZE 1GC1C 3EYVA 4G8GB 3H2QA 4HUKB 1PLAA 1UXSB 1KBWA 3PGDB 1MY7A 3AQDA 3NFPA 4CC1A 4F8NA 4JUTA 5JPNA 4Y4HA 4AW7A 1P4LA 3QQDA 4UBDC 2ADFH 4G9FB 2LQRA 5DUMH 2G3ZA 4BRVA 5KAQG 4L3FA 3FRUA 1DBJH 5AZUA 3QW9A 1BXXA 2Z65C 2ZUQC 3CLEL 3TL5A 2VM3A 4A68A 5IBTH 2XY2A 4HETA 2FR4A 4MB3A 1DQLL 5B22A 4OCXL 3S2AA 4AEFA 2UXTA 4ATTA 4XI5C 3TVMB 3UADA 2CXKA 3ZT6A 1G9MH 2V2WA 5T1KA 5CP7A 4H1LG 4HIIB 3CQPA 5C6PB 1YEDA 4WJG3 1CLZL 3SDXE 4EN3C 3LHAA 2FH6A 2XFGB 5EF3A 3HPJA 3QE5A 2EIJB 3H54A 1Q9LB 4L4VD 4NO0A 4UV4L 2JKLA 3KXFB 5LGJB 1YEHH 4TLKA 5HGHA 3QZPA 3SZ6A 4FABH 1I3UA 3V4UH 1AR2A 4K9EC 3RGVB 1CDJA 5I0DA 2NMSA 3THMH 2ZOLB 5E8DL 5F7UA 3GS7A 3ZTNH 1CGUA 1TTAA 3FH5A 5DFVD 3MODH 3HFMH 5AVUB 4QLWA 2QKIC 3WXWL 3HC4H 2PWEA 3QR1A 1DUYA 1UB5B 2VXTL 3D0LA 2WVUA 4HWBL 5C09E 1QNZL 2XN9E 5ERWB 2IAMA 2DJ4A 2FT6A 1ZLEA 3KPMB 4G80B 1VSCA 2ARJA 4PLKC 1D5XA 1DJHA 2QPUA 4NPYA 5AB2A 5I8OH 4X8JA 1A6VL 4Y2OA 2WLMA 3S37H 2ZTBA 4L0YA 4L3EB 3NFNA 3ZDZE 4OCSH 5A3ID 3OGCB 3B9KA 4AQ8C 2X9YA 5D7EA 1F42A 3N0PB 4GW5B 1JG9A 3VWKB 3GMOA 5BZDA 2XA3A 2ZCKH 2R39A 4LSTH 4ZMOA 1QACA 5DMGC 1RMFH 4QIRA 5I5RA 4BUGA 1ITBB 2WSDA 2YUVA 5CCJA 1X5ZA 1CLOL 3F85A 1JCKA 1SMAA 3ZO9A 1YEJL 1QAWA 4R2GB 4XVTL 2CK0H 5KANG 4A7GF 1KTCA 4ODTL 4ABUA 3TA3D 1N67A 2X2HA 3H1ZA 3CDYA 2Y24A 1FBIH 3QUHA 3VNZA 4EE2A 1NSNL 1DLFH 1S7QB 3JZ7A 4K9JA 4XNQA 1G6VK 3MVSA 4Y1AA 1WCBB 3O6FA 5EPMA 1U41A 3IFLL 4EUPG 2EDOA 2VSCA 4TNVK 4DK3A 3QUZC 2BSDA 3KEDA 4Q6IA 3HNSL 2VZVA 4FZEH 2H6UA 2O93L 5HYFA 1CFQB 3UJJH 1S7RB 1YMMD 4TUJB 4ZNCD 5I66B 3IJSA 2VDRL 5FUCC 4X42A 1IC0A 1MEXL 3IJHA 5M95B 3I6GA 1RERA 3ARGB 1XH2A 1AHWA 1AO7A 4HMCA 3D08A 4UQCA 1U21A 2DLIA 1IC5L 3HC0A 4WY7L 5TQ0H 3SBQA 1QI4A 5HY9A 5E6SB 3FU9A 2BINA 3PWVA 1CI3M 3VH8B 2P8MB 3BXNB 3C09B 2F54E 3VTMA 5C0CE 4NNXB 1IM3D 2CJ3A 1OTSC 5ISZA 4PRPB 1OV8A 2Z4QA 5D2LF 3B8YA 4XT1C 2XN1A 3U82B 4GO6B 2YHGA 4PP2B 2BSTB 2Y9RT 5GGUB 2XQYK 3EZ8A 1S9XA 4ERSH 2X3AA 1WA1X 1LILA 2YD6A 1XCQA 1N2RA 4X4YB 2QSVA 3WUWA 2H0EA 3CK0H 3VJ6B 1OVZA 3BAXA 3AREA 3RL1B 4QT5B 3ROLB 2NY5H 1CLCA 3LQMA 4YHYC 4U3SA 2H3NA 1KNOA 3UAJD 1EUUA 3I2CL 5I1EH 4LGPB 5E99H 3GZQA 4AIEA 2Z0BA 4ZRGA 3VW3L 1P9MA 2K0RA 1KTBA 2HWZH 1QSFB 5K59E 4P3WA 3GRBA 5FYKH 4JDVB 1EAQA 5E2TL 3QDMA 1KPRB 3VXUD 5HYJA 1AACA 1FDLL 1UD4A 3VYPA 4ESKA 3PG2A 4X6BB 3RX8A 3PUCA 3WO4B 4FNSA 4Z7UF 4PY7A 4Y4HD 2JIXA 1K4CB 1YJDC 5I8KL 1HCZA 2JKRM 4NUGH 1NGQL 5EO1B 1ZPUA 4PJFF 2A9ML 4XC1L 2XVKA 1VADB 2OJZH 3HLAA 1S7SB 2AEWA 4YVUA 4HLEA 2IVFC 2XC8A 1NLDL 2XZCL 3AFLA 3PJNA 4BQCA 2J7LA 4O51B 3R18A 4NQVB 4QRUA 1OGAB 2N1KA 3NH7H 4TNGA 4G8AC 1ZGLM 4GLRH 4TULL 4B7LA 1OAYH 2EEAA 2EICA 1DBML 5EO9A 3SOTA 3INUL 4AJWA 1FCGA 5GS0D 4LAJH 2V7HB 3CD4A 1XH0A 3BD4A 4JFEA 4U3XA 4BXSV 1ZHBA 4JLRA 5KSUB 3KPRB 4NO0D 1ADQL 3VXQB 3ARBB 5J9PB 5E4EC 3P4NB 2OMTB 2PP8A 3NK4A 1JGEA 1ND0B 3IDYC 4UTAL 1AQHA 4I5BA 4PJBB 2A6JB 2MOGA 3PL6B 3QUGA 1X5HA 1B9KA 1M9SA 2NXZC 1V3MA 1PVHA 2WCPA 5EORL 3REWA 4YDKL 1ET8A 2VJXA 3CFQA 1KGCE 2FWOA 1S9KC 2WWKO 3JTSB 2WKOA 3LEVL 4NKDA 2IAMD 1M7UA 5T1LA 4ZFOA 4N8VA 4HK3N 5K9OA 5HPMA 3P4OA 4KZ0A 4JHVA 1AGFA 3N41B 5IY5B 3TONA 3TEZA 3FHEA 1JF1B 4ZXBB 1A3QA 2LFEA 3LIZL 3O3DB 3WDJA 1KTLB 4M00A 2ICCA 1K8IA 3DX7B 2V3EA 1F4WL 4GT0A 1F18A 3MCYA 3LB6C 3BIAX 2PWGA 2AXHA 3EUDA 4AQ1C 2A3TA 4MJIA 5I9QB 3RFZA 5H4YA 5JTWA 2I26N 3TBSB 2XWZA 3TBTB 3HNVL 3FTYA 3CWGA 4IGBC 4ISVB 3KPOA 1CJYA 4NN6C 1WD9A 4HC1L 4O02L 1N8OE 5L7XL 1MHEA 4Z0BH 5F9WC 1ML0A 3QAQA 1LK3H 4W9EC 4PJAA 1FPTH 5E8NB 4ABVA 2NNAB 1KELL 4Y1AD 2GITA 2E75C 3MJGX 4MZ3A 3O6FD 2W95A 4WNSA 3V0WH 4APQA 2VT0A 3LKSB 4NQCB 2EYSA 3IPBA 4M1CD 5D6DA 3T2OA 4LPVA 4NNYB 1JS4A 4GMTL 2FQFA 5IQ7L 3VXOB 5LGKA 4XAWL 3HG1E 3EJJX 1BMWA 5CZXD 3KJ4C 1OARH 4UMSA 3HS8A 5J6SA 1UA6L 1A7RL 1R47A 1AGDB 4PJIB 1RUMH 5ACMA 1AO7D 3L4VA 1WZAA 2J6EL 3CX5K 3FYEB 2V5YA 4P23C 3RPBA 4AK2A 2DH2A 4UQBA 2D3NA 1X5GA 4QYOA 1NIFA 1IX2A 1HDMA 2VLKB 4RESB 2ORBH 2C3VA 4ODWB 1PZUB 4ADGA 3SDXA 1WZ1L 1SOSA 3T0WA 3GSOA 5DJAA 4TSAL 5ISZD 3MUHL 1A3LL 1WCQA 4WK2B 2OMVB 1XSKA 4Q52A 3T9WA 5IB5A 2B1HL 4ZYKB 3II2A 4AJYV 2IIJA 5GS2D 2F53B 3LAFA 4XRCA 4EXKA 3WHE1 5EN2B 3WKMH 3BN3B 4NC2B 3LNHA 2BHYA 1CT8B 1ID5I 3MNWA 4MA3A 1OT1A 2DQGL 3W82A 2NUPA 4XXDB 3ARED 3TO4A 1VB9A 3VRJB 4CVUA 4WWKB 5C09A 2XN9A 4K7PL 5KSAA 5J6GA 3RHWF 4KZDL 4BQ8A 4J3SA 2XN2A 1MREH 1N3NA 5FGBA 5AAWA 4I8DA 2YGPA 1HQ4A 4R7DA 4XNYH 3ZE2F 4BFEA 4CSZA 5L88L 5E7BA 3ZQXA 1PZ5A 2V33A 1BM3L 2FECI 2PWHA 5EUOE 3SPIA 3GM0A 2I07B 5A40E 1TCRA 3BLKA 1GGTA 1MZZA 2KI6A 3RWHB 5IHBA 5GJSH 1SEBA 1QHPA 2JIXD 5J8OA 3KVQA 3DX0A 3TJHD 2ZXWB 4HIHB 5C0FB 2L7JA 4TVPL 2R1WA 4TLTA 5GZOA 1KBVA 5AZEH 3LKQA 3KVPA 3O4LB 5DS2A 1TITA 5AD0B 1TLKA 3FONB 1SBSH 1QFOA 5DHDA 5CZKA 1JNHB 1U36A 3QRLA 4HF5L 5AAPA 5DZNA 2Q5BA 1YC7A 2XIBA 2GI7A 4Z7OF 4FNRA 1XIWB 3DA0A 3Q6GL 1XZWA 3SYAA 1SY6L 3T3PE 4U1LB 1BD2E 1VEOA 3U25A 1YC8A 4G1EA 4N2EA 2N01B 4HOWA 2HVBA 4LEOB 4JFED 2AKRA 4WW2F 5FYKD 4HXAH 3MRGB 2A4CA 2JCCF 2VE6A 4F1ZA 2C9RA 1WJ3A 2G9HB 1FIEA 2ILLA 4XWOC 5T1JA 5K1NA 2O61B 3F6JA 3ZT5A 5C08E 4RA3A 4D0DB 4RMSA 1B88A 2W5PA 2MEJB 3POHA 4WEMB 5ABDE 4DESA 2E7LA 1PFCA 2YAFA 4G8IB 3BKCH 4I4WA 4UB0L 1X7QA 4F7EA 5GGSB 1NEPA 4N2IA 1QBLH 4AJVA 4YO0B 4L37B 4YZFE 1J5IA 2H32B 3TZVC 5DMIH 2ZXDA 4DZBB 1XGQA 1FGNH 2OL3H 1P7BA 4KK6D 5T1LD 2PPEA 4IU2A 3NPZB 1CDHA 2F54A 5IMMA 1IC1A 5C0CA 2DWEB 2WZ0A 1VRSA 4NQXB 4GBXA 4HT1L 3CZUB 3BP5B 4JRXE 1JPSH 2A1WL 4XOCA 2VXQH 4OCRL 2CRYA 1AZUA 4OAWB 4TM9A 3O9WD 3NIGE 3F7KA 4BM7A 2FNWA 3QXAA 2Y0SA 5DJYB 1R3KA 3MRJA 3UPRB 3MV8B 4MJID 1SLWA 4RAUA 4GAGH 5CMAA 4I0CC 1EO5A 1FL5A 4XN2A 4OZ4B 4ZOBA 3EYOB 4IDJL 3NJFA 5DYOB 1X5LA 4E36A 3QNXB 5MP6H 4PJEE 4TSCH 3CH1B 2BHUA 2UZXB 1RFDH 4PJDF 4IRJC 2H41A 5K9KB 3L9BA 1XBDA 4PH8A 4WTQA 2RFXA 1NDMB 2MTAA 1U8MB 4FEMA 3QJFB 4LU5L 5AVTB 2VZ3A 2OL3A 4I18B 2VN6A 2WJ5A 4APQD 2OCJA 1AXTL 3TBBA 1IZJA 2JV6A 3OPZL 3W5MA 4K94C 4ODVH 4M4RB 2O5NA 5GRYA 3NACL 4JDTL 4DTGL 1I7RB 2BW5A 3FCTB 2VXQA 2Y1VA 3GJEB 5HHMD 1EZVY 1X9LA 4KRPC 2GIYA 4LRIA 1TPXB 4LSVL 5D4IA 2DH3A 1CICC 4K3DL 4NI6A 4PV9B 4XPGL 4Z7IA 3TJEL 4I9WE 1N64H 3QP3A 5GGQH 4ZFFB 1BX2A 2CBPA 1IAIH 3IPFA 1KLUA 5IWLC 4NZRH 1G7JB 1RZIB 5I1LA 5EU6E 35C8L 4BDVA 2F58H 1QFWH 5SX4H 1MLCB 4JFSA 4FQXC 3D07A 3VNYA 1DANU 2EDXA 1JRHL 3D05A 4AVKA 1F90L 4IS6B 3D8MA 1A3RL 1IGIH 4GG6F 3ESMA 3A4EA 4L2LA 3FFCB 4K3EL 5T1DH 3SBWC 5KS9F 1X4ZA 4MD5B 5I1IH 1OE3A 3RX9A 3WV0A 3CQQA 3KPLB 1I3GH 3UACA 1Z9NA 4LIQL 3IAGC 5HI3C 1U2YA 5E24E 5ANHA 3SBRA 4CMHB 2DQHL 3N91A 1I4FB 2V0AA 3TO4D 4PJ7B 5FECB 5IG7A 5JPMA 2C5DC 5C09D 4C57C 1D5MB 2XN9D 3MLYH 5KSAD 4XP1H 3MXWH 4XP6L 1CYGA 2UY6B 5EBLA 3SOBH 3QUML 1Y1DA 3R1GH 1G87A 4FFWC 4LPYA 3MJ9H 1R0AL 2HMIC 5DD6A 1T7XA 3J27A 3AG4B 4DGYH 2ED7A 3QUXC 5TE7L 4WV1C 5FF6A 1ZK9A 1Y1UA 2VDMH 4TUKH 5DC9B 5KUMA 3KJ6H 4FFVC 4DKTA 4JFZH 4DW2H 1TJHH 5HVFB 2D7QA 5JUEH 1QNIA 1J0IA 3W39A 1EPFA 5C0RL 4PI2A 5JIKA 3FRPA 1E50A 2ZOUA 4HFUL 4YHML 2YAHA 2QQLH 1TJGH 3ULUL 3TIEA 4JO4L 3IGUA 2DOCA 3EYFB 4PPTA 4ZO8A 1R3JB 2OTPA 1F11B 4PMFA 4KX7A 2AV1B 2XV3A 3C9NB 3GIZL 3HI6L 5AUMB 5SWQB 1TU2A 2OSYA 1G7LB 3EH5B 3RILA 1A9BA 4AG4L 3FB5A 3DBXA 2KPNA 1FFTB 4RAHA 3AJ7A 4RAVB 1ET5A 2ZCZA 5HDRA 1OCCB 2JB6A 1OSEA 4A6YL 1CFSA 5CKAA 1IGMH 1PG7L 2FUQA 3HG1A 4H1LH 4R4BA 1K5WA 2K3HA 3L08A 3MJ9A 3I85A 2GT9B 1RJZB 1PLGL 3QNYA 5I71C 3CQFA 5E56A 1KFAL 1GA2A 3S34H 4Q97A 4Z7NF 4XZ4A 2W0PA 3EGXA 4PG2A 1OSZA 4EPSA 4YQXL 4PW4A 3HG0A 2WXRA 4M9OA 1IM3B 1FC1A 1BA9A 3L1GA 3VFOA 2V8MA 3NCXA 2EILB 4QRQB 3TF7C 2AMUA 5A16A 2Q3AA 1P7KA 3CXHJ 4AWJC 5C0CD 1XR9B 5TPWH 3QUYC 4GQQA 2JXMA 4HJGA 4GBXD 1HINL 4KITB 3NCEB 3FT0A 5INDA 3CPUA 2VXUH 2FEDC 1GMIA 2LV4A 1O7DC 3QA3B 4PUBH 1M6OA 4FHBD 4XCFH 2JLPA 2MMXA 2XG5B 1EZUA 4NUJB 4PB0L 1VFAA 4DGIH 5HGDA 5EEXA 1P6AB 4F24A 4OIAA 4FQLL 1HJCA 1N5YH 1O75A 2GHZA 3I9IA 3IXAB 2MNWA 1XH3B 4QXTA 3ULVL 3IJYA 1LO5A 1GY2A 2YEQA 4H1LA 2Y07H 3WCYA 2VXSH 2BRRL 2EZ0C 5HHXH 5EZOH 1WTGT 5JZ7C 4U7MA 3FUJA 1H3TA 4XHQA 3R4DA 2R15A 3EYVB 3N9GH 3NFPB 5E4OA 5EUOA 5JPNB 4Y4HB 2XI9A 4NBXB 4UNUA 1P4LB 4F9PC 3QQDB 3ULUC 1DN2A 4GRMA 1QVOA 3CZEA 3D87B 4HUXA 2OYLA 4LBEA 1NM4A 1HL8A 3FRUB 4WHCA 5IJDC 4MJHA 4EUPH 2WVSA 4XO4A 1Z9PA 1YAZA 2A7BA 2RGSA 1SXCA 2EP6A 2C34A 3IKKA 5IFHL 3TF4A 5F72S 4ODSL 1LEKA 4LOFA 2FR4B 5I6XC 4GI8A 5AENA 1NMAH 4KMLB 2V2WB 1JDAA 1EHAA 2JKXA 5CP7B 5T1KB 1J12A 2O4EA 5ITBH 3PWJA 3SKJH 1YEDB 4OQTL 3X2QB 2HT2D 1RUKL 3HPJB 3N42F 2Q1EA 4NO0B 5F6IC 2P80A 2DTML 4IIQA 1BD2A 4QF1A 1E90A 1JVLA 5HGHB 4QWWD 1AANA 4MSWA 4W9GC 2YD4A 4KI5F 3ZYJA 5E1GA 1NUGA 5C08A 5FW6A 5FOBA 4L1TA 2IG2H 3OMAB 1TTBA 1DUYB 3D0LB 3PUUA 3LS4H 2WGNB 5I1GH 4EUPA 1GGYA 3FBKA 2IAMB 4TRPH 2BY1A 3TTSA 3AQXA 2XBTA 4GNKB 3BE1L 2ARJB 4UILL 2VH5L 1D5XB 3LH8A 4NPYB 4UQ3A 4X8JB 2VZSA 4Y2OB 3ORJA 1INEL 3SDCA 3SE9L 1IEAA 3Q9QA 5EHFA 3NFNB 3WIFA 5KYUA 3ULVC 1BECA 1JK8A 4IMKC 1EQWA 3B9KB 3QQXA 3WFCL 1W0YT 1O6VA 5I1JH 3GMOB 4JRXA 5BZDB 1JXFA 2VW4A 2HJLA 2VLME 3STZA 3L13A 3BPOC 2FLBT 3NCJH 3VD3A 1E4JA 2PWFA 3NTCH 4YOKA 1KXQE 3BGFB 1TO4A 5D7LE 3QNFA 2IWGA 2K6YA 5JW4M 2P5PA 5ALCL 3DO4A 4L3AA 4X9BA 3F65A 2FHBA 1ADWA 4XNQB 4PJEA 2WWKT 2KHAA 3BAEH 4Y1AB 5HJ3A 4BWUA 3O6FB 1YNTA 5EPMB 1IQWH 1BZ7A 4J23A 4KKZA 1I85A 3ASNB 4Q6IB 1BVKA 1MFAL 1MQKH 4B9YA 4ZQKA 2B8OT 3ZZLA 2A74C 4G5ZH 3FTXA 4HGKC 1OCZB 5FHAH 2R1YA 3IJSB 2ZG3A 3IJHB 1NUDA 4AITA 2WPGA 3I6GB 3HG1D 3U1SL 1DUZA 4NLHA 1I8AA 1QKZH 2ENPA 1VFUA 5DD5H 3EDFA 1JGVH 3ZUCA 1AHWB 1AO7B 4OUOA 4TVSa 4LSSL 3O4OB 5AVQB 4OM0H 4FQJH 3HC0B 4ONGL 5EOCH 3CIQA 4KXDA 1OAXH 5HY9B 3JWOL 1R3IH 3PWVB 3P0GB 2WXMA 1G5AA 2DMCA 4BFIA 4N28A 3KEHA 5JHBA 1NBCA 3MRQA 4M7KL 5DWUL 5ISZB 3L9EA 4LSUH 4QRRD 2Z4QB 3FO1A 4DKDC 1PZBA 4WI7A 5EU6A 1T83A 3L4UA 1JNNH 3D7PA 3LKRA 3QFDA 2VSMB 4RMQA 4ZTPL 1FFNA 3GKWL 2D7NA 1S9XB 2QR0A 1TG8A 3E2HB 1SQMA 3A6CH 2IPUG 2YBGA 1XCQB 1N2RB 5TTRA 2YARA 3N1QC 5DMJB 1NFAA 2XSKA 1WPCA 2IQAA 5FGCE 1XR8A 3LN5A 1BVLA 3WUWB 4YSOA 1UOLA 3AREB 1HL4A 3RI5F 5T5FL 4U3SB 2H3NB 3AY4C 1CR9L 1KNOB 2DQEL 2FGWH 4ACTA 2VQ1A 4AVIA 4PWFA 1TCMA 2IGFL 3ASOB 4LDCA 3E8UH 2BSRA 4C56E 3UYRL 5HYJB 3QDMB 4ZQTA 3I9GL 3UBFA 1E6JL 3VG9C 1BFOA 1ILSA 1BQHG 1MIML 2PW2A 3FCSA 2ZSVA 3BAIA 4JPWL 4PY7B 2QSCH 2JIXB 2P8LA 2LU7A 3SGKC 4WUKL 3HG3A 2PYFA 1JBJA 3ZXAC 4WF7A 2FECL 1TZIA 1NEUA 2EXWC 2FD6H 3HLAB 1TNMA 2ZP9A 1I75A 2I9TA 4JVWA 4DETA 3CHSA 4U3HA 4RZKA 1ZT1A 4QRUB 3NCWA 1JL8A 5C0ND 4A7TA 5ITFA 1FAIL 3NRPA 3Q6FA 1HEJC 2F7QA 5AW3B 5BQDA 4E0RA 1ZLSH 1KIPA 5EO9B 4JFDE 5D1XC 5AYQA 4JFEB 2YA1A 1ZEAL 3K0YA 1ZHBB 4JLRB 2GBVA 5EV7A 1F00I 4LP8A 4S1SH 2P80D 4MQSB 5JIPA 4TPRH 1BD2D 1F2QA 4L1BA 3TFBA 1I8KA 1QSVA 1JGEB 3S3DB 5D2LE 1ZHNA 4IOFD 1GGCH 1XEDA 2RCSL 4I5BB 4JG9A 1M56B 2GAZA 4R96A 4O58H 4WAFA 4DP7X 2I60L 1KIUA 1X9RA 3TPUA 5F8RC 4KKPA 3REWB 1YEIL 5C08D 1IAOA 3S3PA 2AW2A 3CN0A 3NQKA 4JY5L 4DSYA 2FWOB 1NBQA 1NCHA 2CE6A 4NKDB 5F0MB 3EXLA 1CYXA 4ZFOB 5T1LB 4N8VB 5D93C 5K9OB 1F3JA 2FWUA 3P4OB 4PW3A 5HPMB 2YD3A 1AGFB 1DL7H 2DMGA 4L1DA 3SDCD 1HNGA 4KUCD 3P3TA 4M48H 3ZDWA 1K8IB 3CC5A 4HJJL 3O9WB 1ACCA 2ICES 3PPSA 4LOUD 2G2RA 2IXQA 2EDLA 4JRXD 3DVIA 4KAQL 4QGTA 5I5IA 1AD0A 3O6LH 5JA9A 4NN7B 4TYUA 4MJIB 4Z7UE 3RFZB 2FAUA 1F58L 1A5FL 1I1AA 2ZCHH 3V0IA 3IFNH 4UOJA 3BH8A 3SO5A 1SNRA 4KKNA 4XMZA 3KPOB 3K8KA 4PJFE 3D2UA 3OZLA 4XPTH 1BF8A 1MHEB 2UZPA 1D5ZA 1B90A 1UA3A 1HNFA 4PJAB 3MZGB 2GITB 3U6XA 4APQB 2XWRA 5IQLA 4ECNA 2EYSB 1CUOA 4JJOA 1A6UL 5BVJA 1D9KA 4PCSA 2L0DA 4GQPH 1XGYL 3HB3C 4HUCA 2YPVH 5ALBH 1UWGH 1SPDA 2G4EA 4P3CL 5F1IA 2EXTA 1F0LA 2A99A 2YD9A 1FGVH 1E4XH 2AEQH 3BAJA 4GINA 3IMRA 4UZGA 3PWPE 4R7XA 3MRNA 5KN5A 3RAJL 5LJYH 3HBGA 2GC4C 5DK3A 3DIDA 5J12B 1F1AA 5FWQA 3PAVA 3HKZA 1IILE 4QYOB 1UZGA 2KPWA 3JV4A 4Y2DC 3LRLA 4U1NA 5GHWL 1FRGL 5TJWK 1HDMB 3ZSSA 1CFVH 25C8H 3AT0A 1FO0H 3O2WH 2C3VB 3AQYA 4IRSA 3Q48A 5EZJA 4I9WD 4DWHA 5B7EA 3SDXB 3BP6A 4PJHF 3GSOB 5DJAB 1GS7A 3RB7A 2QQNH 3GUFA 4WWOA 5FAAA 3I6KA 2DWXA 2F8OA 2D0HA 2H9GA 2N1TE 5IB5B 3V0DA 3GSVA 4L9LC 2SEBA 5BV7H 5IOKA 4XRCB 4L8SA 1GTNA 5TE4H 3MNMA 4Y2LA 2YPVA 4ZO9A 2X0UA 4MA3B 3MNWB 2NUPB 3TO4B 1JDCA 1MCWM 1ZE3H 4FNLH 5C09B 4P2OA 2XN9B 2ATAA 5J1SC 4H2CA 4EKXA 2AEOA 5KSAB 5J6GB 2QQQA 1T7VA 2ZKXA 2FJFA 1N3NB 1BQ5A 5EMYA 2C9AA 4N0CD 3L4CA 1HQ4B 3PWLA 4LO9A 2W9DH 4R7DB 2APSA 5DTFA 4DN4L 1HL5A 1PZ5B 2DEWX 1NWOA 3FCUB 2NY2C 1KJMA 3GSRA 1MCPH 3L4XA 4FE9A 1TCRB 5CEZL 1NJ9A 3QWOA 1FO0A 2CO1A 1SEBB 1T22A 4KXZH 3CVIL 4XO3A 3FULA 3X3FL 3OKYA 3RIAF 1AJ7H 2D4DA 2R1WB 5DRWA 1JMXA 2WSKA 5CLYA 3LPWA 1RV6X 3KH3A 2NDGA 4ELKA 4M93C 3LKQB 2JH2A 3OJVC 1KXQA 1KCRL 2NY7L 1TQUA 1PLCA 1S6NA 5D7LA 3SEPA 3F83A 2ZJSH 4QJ4B 2YXMA 2NTFA 1AZZC 3CFMA 3BKML 1F6LL 3E6HA 3NSYA 3QT2A 3LZFH 4JANA 5KSBF 5C97A 4G1EB 1ZTXL 1L6PA 2AKRB 3PPEA 4LKXA 4JHAH 2JJVA 2FO8A 3OPUA 4NUQA 4RFOL 4ZODA 4FXLA 5I6NA 2VE6B 4F80A 4M02A 4GMSL 3EYUH 4KKQA 1H19A 5AW9B 3B7UX 1DCLA 1INDH 2HLEB 4EAEA 5FB8A 5JXAL 4HQQH 3ZO0A 4I4WB 1X7QB 1P4UA 1REIA 4F7EB 3LRHA 1NMBH 3P3RA 2OMXA 5I28A 2ICEC 1XGQB 5A43C 1P5UA 5AVSB 3MUJA 4IU2B 5I75B 4R26L 4NQDD 2Q20A 1N12A 2F54B 2FSEA 5C0CB 5IMMB 1NFKA 5IESL 1CGSL 4GBXB 3O0LA 3RFRA 4ONFH 1O9VA 2KZKA 3ZKXC 2X28A 1IU1A 4XCYA 2ZXAA 3ES6A 2GY7B 3NJKA 3ZE2E 2J1KA 5F2FA 3S8WA 3VD0A 5AOMA 4ZUTA 3CHXA 1J0ZA 1Q1JL 2X44D 3P9WB 1RVFL 3QXAB 4M56A 4OBSA 5D2NE 3WIIH 1U3HC 3QHZL 1PEWA 1R3KB 3MRJB 4WJ5A 3DI3B 5JDSA 4LEXL 4JPSA 3BYTA 4IOIA 9PCYA 4RAUB 3GD1C 3GSNH 1IBZA 1I1AD 5CMAB 1FL5B 4NZUH 1L6ZA 4MAYA 1X4YA 3VWJC 2GY5A 4DP6X 1JTTA 1NOLA 3CBRA 3D2UD 4KHTL 1P7QA 3AADB 4O2FA 1MW2A 4A7GA 1LJMA 3WFZA 1YEKL 2B1AH 4S1QL 4C56A 3TH3T 5FYLL 3TT1L 1CG9A 2RFXB 1W6WA 2QVMA 4KO9A 4Y9FA 2OL3B 2YJLA 2MSPA 3D4ZA 3VFGL 1D9KD 1CXLA 1HHIA 4Z7OE 4G72B 5ESAA 3X3GL 3QIWA 4R7NA 3FUMA 4DO6A 4YE4H 4HGMA 1BGXH 2ODHA 5C3IA 5JOFA 4NC1E 4QMEA 5EO0A 2L7EA 4X5LA 1H3PH 1ZHKA 1A7NL 1KCSH 1NCAL 3L7FA 1NIAA 1NFDF 4RNRA 4N2LA 1EJ8A 1V3LA 2R56L 3GI8L 1QA9A 2HT3D 2OI9C 3ZDXF 4KZCA 3GSNA 3V6OE 1BX2B 1FVDA 4FG6D 1KLUB 2H5UA 2OMWA 3BAWA 4JL2A 4I0PA 5EEYA 3FT4A 4Y9EA 4YC2B 5I1LB 4BDVB 5AVRB 3V5HA 4ZI8A 1XB8A 3E1ZA 4IRSD 4JFDA 1JPTH 2CWRA 3U7AA 3E80A 1OTTD 2ICWA 1WAAF 3Q2VA 4M6NH 3EBGA 3SE3A 3KDMA 2J5LB 4LLMA 1NKGA 5GRJH 4YHOL 4J3OG 4Y5XA 5D2LA 3BUYA 4OIFA 5TDNA 2ZYRA 3WJLA 3FT3A 3OKOA 2IANE 5CBEA 3MGTA 4QTIL 2W91A 2YKLH 1KCKA 5E6IA 3QGVA 5IG7B 5JPMB 3L4YA 4HUNB 1KJ2H 2DZEA 5A2FA 3P3UA 3NT0A 4UQ2A 7FABL 3ARTA 3R0MA 4FFZL 4JFHE 5EBLB 2KL6A 4QOKD 5IKCA 3GUTA 4OT1H 1A9VA 3IMVA 3PQYE 5F89A 1GMEA 1VFOA 1B0WA 1W0VA 5DD6B 1U8JA 3KGRA 3PV7A 4KPHL 1DVFC 1JFQL 1RIUH 1ZT4A 2WAHA 5FF6B 4YHPA 2VLMD 4Z7UA 3W39B 2AMGA 5CLZA 1TMQA 4MQXD 1UA7A 4CU6A 3FRPB 2DKMA 2Y6SC 3GZOA 5IBUG 2X40A 1JV2A 1K8DA 1QWHA 3TIEB 4WI9A 3EH2A 2Y72A 3LXCA 4FXKA 4J3WA 2P46B 4PJFA 5D7LD 3D4GA 3HTLX 2Q7YA 4KOBA 2LOEA 1AY1L 1EZVX 3L95A 4YXLH 5E9NA 3WN5A 1TU2B 1A9BB 2QTVA 3FB5B 4B9GA 1KJ2A 3DBXB 4FD0A 2OS7A 4R84A 3IAQA 3V4LA 3E3QC 2JB6B 3NSCA 4KK9C 1CFSB 3DJTA 5DUPL 1CDBA 3DKHA 4IU3A 4R4BB 3HG1B 3U6RA 1SFHA 5EIVA 2XQBH 3QNYB 1H6FA 5C70A 3PWPA 4PLOB 2VDMB 4HOZA 3EGXB 1I53A 1F4XL 5KS9E 1OSZB 1DQML 1SXZA 2HRGA 4FTVE 1ET7A 1I3VA 3A67L 3DNKA 4AYMC 1HIML 5FV1L 4OB5L 5MERA 3MBWA 3VFOB 1ASPA 4GB9A 5A16B 1P7KB 2VWEE 4HJGB 2JXMB 4JPIA 5INDB 1QO3A 5I74B 3RVVD 3TN0A 3KCWA 4OLYL 1U3NA 4W9JC 4AYFA 1BVNT 1M6OB 1ZV5A 4H26A 1JV5A 2E7MA 1VFAB 1XFPA 2N7SA 2X2YA 4G7YL 3M46A 5HGDB 5CZVL 1U2CA 2R0ZL 2CGZA 3ZE1F 4QXTB 5EWIH 1Q1PA 3Q7JA 2ESVD 3IJYB 1KJ3L 1LO5B 1L0XA 2AXWA 4H1LB 2R0WH 2UXVA 5C0AD 1JZHA 3APDA 4MAYD 2N56A 4JQIL 4R9HA 1SJVA 4PGZA 9CGTA 4P06A 1DFXA 4M03A 5EIQA 1P7QD 3PP3H 4ZOCA 4HS8L 3LNIA 3UTQA 4C56D 3LZOA 5EUOB 2J1ZA 5GSRA 3HBPA 4BCYA 1WT5A 4WK4B 4HJ0D 4L4TE 4GRMB 4OJCA 1QVOB 3TCLA 1D6VL 1E8ZA 1Z32X 3PWUA 4HUXB 4PRNA 4LBEB 3QIWD 3P0VL 1SXBA 1T6BX 3GLEA 3L1OL 4KUZH 5LUMA 2OFQA 4M7LH 5L4FA 3OJ2C 4LCYA 1LEKB 1VEPA 3KLLA 4PB9L 1AGBA 4ABQA 1RJYA 3GINA 3P9LA 3PAYA 3TVMC 4ZMAT 4Z7NE 1EAJA 3LKPA 4OJFL 2DEYX 3D4CA 2WZPA 3RIKA 4E9LA 5DJ8A 4N9OB 3SGEI 4H13C 4H8VA 4I0PD 2WXJA 3UG4A 2ZYIA 3MI6A 1XTLA 3T3PB 5JQHC 4IIQB 1BD2B 4QF1B 3EOAA 4LPCA 1CU4L 4RLDA 4ZMTA 4KHXL 2W9EH 4NM4H 3BZFA 4NO2A 4Z3HA 3ZX1A 5I18L 2EDQA 4MSWB 1BQUA 2XX0A 3BRGC 3RGVC 1MJJA 3HNTH 2H2PC 1J9RA 4NERA 4I1PA 2ZOTA 5C08B 3OGOE 4F8PA 1CFBA 3ZOAA 2HKHH 5FOBB 2JJSA 3K6NA 3OSVA 4EUPB 4R4ND 3DARA 4XPAH 1KEGL 5E6ID 2YRPA 4YHZH 3UEQA 4UQ3B 3CSYA 1OAJA 3SDCB 1SDYA 8PAZA 2VUOA 1TENA 1IEAB 1ZDQA 2GPZA 2MH4A 3WIFB 5KYUB 2X7LA 1JK8B 1BFSA 3FMGH 4FYSA 1E4HA 3RWGA 4G71B 4O2CA 3V8OA 4P2QE 4AV5A 5PCYA 3TWCH 4JRXB 3H0TA 3VWKC 5D7SL 2HJLB 2WQAA 3HC3L 4KMTH 3STZB 3NIGB 1L9TA 5AOZA 3LH9A 1HYSD 3KL5A 5D2NA 3QI9A 1E67A 5IJKA 1CPUA 5B1AB 1WEJL 1DQTA 3MLWL 4R2GC 2WTPA 4TL4A 1PNCA 3LPPA 3TT3L 5KVGL 5HHVH 1WA2X 1DN0A 4IDLA 3DGGA 3MBXH 1ZSDA 4MXQD 1UM5H 1J0YA 2X2IA 4UBDD 4PJEB 5HJ3B 3SE4C 3P3YA 2O5ZL 1S46A 1YNTB 3QXWA 1FA4A 1BZ7B 1Q0XH 3KW8A 1OPGL 1KYOK 1BVKB 3CSFA 1TTFA 4ZQKB 3PAUA 4ES8A 1KEMH 1W0WA 1MQ8A 4KKCD 3FU3A 1YRKA 1N4XL 2R1YB 4XC3L 2ARJQ 1GKEA 4UINH 1SDDA 1EJOH 2FHFA 4L4JA 1DUZB 3C2SA 4LHQB 5FLVA 3OL2A 3ARGC 3MLUH 2X1PA 4WW2A 3WJJC 1JPST 4I85A 1NCCL 2HRPH 3RJDA 3NJXA 1F4HA 3PWPD 4KI5E 4DKAA 2EXYD 2MHAA 2FX7L 2XZAL 1WVZA 2M83A 2N0MA 3CVHH 3U9PL 1BQHA 4BFIB 1T66C 3QJUB 5FKAA 3V6OA 4DO4A 3C09C 3MRQB 3OV6A 4M8QA 3L6FA 4Q4EA 4QRPE 4D2NA 3FO1B 4RIRA 5EU6B 3MKKA 2XWJA 3C5XA 3DYOA 1F2XK 4JR9L 1WG3A 3LKRB 3QFDB 1ICTA 4G3YH 1EUTA 1FFNB 4Q6YA 3LKOA 2QR0B 4FLQA 5HDOA 3TN0D 3VE0A 4D9QE 1I9IH 1MG3C 3FQNA 5KBMA 2IQAB 4BZ1H 4IBLT 1XR8B 3LN5B 1BVLB 1JK9A 4OGAC 3EFDL 3QPXH 4GYBA 2IANA 3MRFA 3NZHL 5DVPA 1GYAA 4FULA 2BZDA 2OCFD 2VQ1B 4LK4A 2E76C 3NP3A 1MF2H 5HP5A 3VU2A 1MCCA 2BSRB 3GBMH 3ML9A 2WKGA 2APFA 2CO2A 2Q87A 4G6JL 3KLSA 3O6KH 1BZEA 3CVHA 4DEWA 4K2UH 3VXPA 5BOPA 1BFOB 2XJKA 2PW2B 3FCSB 3V9EA 1IBFA 2ZSVB 3PQYA 1FIGH 4KKLC 3WO4C 2P8LB 3WXVL 1JGUL 4RGMC 2Y1ZA 4QXGL 4U49A 4KZEL 2DLHA 3HRPA 4JY4A 5J56B 5E95B 1UM4L 4AIXA 2PYFB 2WBXA 1T0NA 5HHOE 1TZIB 4MRBA 4XMKH 5EC1A 2I9TB 2BP8A 3T2QA 1ZT1B 2BJMH 5DQ9A 2B2XL 3W0WE 3NEXA 2AQSA 4BZ1A 5I17A 4TQPA 2JI1A 5ITFB 2QVFB 1RZJL 4M6ML 4XPFH 3Q6FB 2WWOA 4N8CL 3NCBB 4E0RB 1KIPB 5A6LA 2WZPD 1L3NA 3FO0H 1U58A 1OAQL 1LK2A 2F0CA 4M3KB 5H4ZA 4KO5A 5FCUL 3KM1A 2XYCA 1UD5A 3ARBC 1I8KB 4NP4L 3VD1A 1ZHNB 2GAZB 4JB9L 4R96B 1N0XH 3CNKA 1IKFL 2ZG2A 2ZT9C 4H8WC 1KIUB 3ECVA 3PL6C 3TPUB 4DP2X 2IOMA 2F8XC 1OTSD 1IAOB 3CUPA 3GBNH 1EXGA 4YEFA 1XX9C 4G7VH 4UIKH 4ZW5A 5KS9A 4FTVA 2XKSA 2OX5A 4GRLA 5EEWA 3FFOA 4NIYE 5F9OL 4ODXA 3IEAA 1F3JB 3DHMA 4XNUL 1JGLL 3X1BA 1TVDA 2DTSA 5EA0H 2YMOA 1LWHA 2WHVA 4ZXBC 4PSPA 3CC5B 4XP4L 2IV9A 5IIEA 2FWLB 5DQDH 2DQDH 2G2RB 2IXQB 3WMSA 5E70A 3TESA 1AD0B 2RA1A 2AHIA 4XBEH 1YYLL 1KCUL 2DLEA 3A6BL 1I1AB 5BS0D 3QI9D 1O6TA 5I9QC 3EH3B 4AEEA 3BH8B 3ETTA 1WITA 3IDXH 2X42A 2CA3A 3D2UB 4JK0D 1D5ZB 3SY0A 3ZPDA 5LWYL 4M43L 1GHFH 2EDRA 1VFBA 3AM8C 1NCTA 1NICA 3QSKB 4IIZA 4Q0XL 5C0BE 5BVJB 4RFEA 1D9KB 3CN4A 3GK8L 1QBML 1NKRA 5E94A 4HJSA 1OCWL 2OM5A 4J3VA 4R8WH 2KBGA 2P5EE 3IFOA 2NOYA 4LVNC 3C8KA 5F1IB 2VRQA 4L4TA 1RZJC 5DFAA 4U1GB 5IROA 2UYLA 3AGVA 4X7FC 2W8CA 3EO9H 3RJQB 3ABZA 3MRNB 5KN5B 1SF5A 2NRDA 3UTSE 1PY9A 4P5RA 4TQHA 1AIFA 4UV7L 3K4AA 1FH5H 1G9NL 5BUGA 1PY0A 1T4KA 2X6CA 3PHOA 5HI5D 3V4PL 3EH1A 3VFWA 2VR6A 1ETB1 3FT9A 3JV4B 4U1NB 2A2QT 3GLDA 5CNHA 4AKPA 4IRSB 2KMWA 5EZJB 3B4NA 3ZKMD 3BP6B 2IF7A 3IGAA 4WU5A 1MHHA 3AWEA 1FG9C 3GSXA 5J0BA 2WCGA 3I6KB 3UMNA 3JWDL 2H9GB 4MCZA 4LLDA 2OJEA 3GSVB 2UXGA 4PS3A 2SEBB 2VR4A 4L8SB 4HJ1A 4XVUC 4OCWH 2DD8L 2W0KA 1X5IA 5C6WH 3J2PA 2X0VA 4OZHF 1PF3A 2IAND 1JNLL 4PRIE 5EG6C 4P2OB 4N2FA 4WWKC 1XGRA 1XXDC 4H0GA 4CDHA 1ESOA 2FJFB 3WFHA 3PWLB 5DTFB 4NQSA 2KZWA 3EHBB 4PD4J 2OW7A 3D0AA 1KJMB 1VGEH 1YYMH 3GSRB 4JFHD 1BDYA 4Z5RA 5F1OB 2JB5L 1DR9A 4JCWA 4LL9A 3WEOA 2ITCA 1NJ9B 3QWOB 4L1HA 1FO0B 1OT4A 32C2A 3PQYD 4P2QA 2JKIS 1VENA 5DR5H 4NKQB 1T22B 1R3LA 1XF1A 3ETSA 4XP9H 5DRWB 1KTKE 2IDTA 2JVUA 5HHPA 4F7KA 4OR1A 3EJZD 4PM1A 4ELKB 2OULB 5AWNH 5BV7B 4JM4H 5DFTA 1E27A 3ZE0F 5D7LB 3MAWA 1CBVL 2BNUA 1IKOP 1HN1A 1QLRA 3B7YA 1JPEA 2ZF9A 3F00A 2NTFB 4GAYA 3DX6A 4FCAA 1XIWC 2ZF8A 4NAMA 3E6HB 5CSBA 4JANB 2IH1A 3EJYD 3OR6A 2RB8A 1CVRA 5F96H 1OP4A 4LKXB 1G9NC 2FTAA 2E9BA 4Y1SA 5FDWA 2UVFA 5LAXA 1P84K 4ADJA 1QI5A 1KLGA 4JG0H 5DA4A 4JPQA 5DZAA 3R7QA 2OMNA 1NA8A 5E9AA 3NCFB 1TQTA 2XYBA 2D7TL 2WYIA 3PREA 3N85L 4XPHL 5FB8B 2CZNA 4V33A 3V52H 4XMPL 4PJBF 4BH7A 4G5AA 3JWDC 4F37K 6TAAA 12E8L 1HXYA 2DJSA 2FBJH 2OMXB 4OY9A 1WZKA 5D5MF 2BZ7A 2VDPL 2X70A 4J3OH 2PTVA 1P5UB 4FTVD 4GRLD 1IRAY 4PBVC 5AG9A 1G0XA 5F9DC 1UUNA 1Y6MR 2CJUH 2XUWA 3GO1L 4UUJA 4CVXA 2FSEB 1OP9A 4LRNL 1M1SA 5AB1A 4QRPA 1YSOA 2ADIA 3BD5A 3LS5L 4XCYB 1MCKA 3ES6B 3HC2A 1HZHL 1WTLA 4ICXA 4ZUTB 1TQBB 1I9RL 5H2BA 3QQ9C 4EOWH 1P4IL 2WANA 4X80H 4WJ5B 1CF8H 1RUAH 2AQQA 3B43A 5JDSB 1ZWIA 4IOIB 5C7XH 5FGCB 3V4VH 4C83A 3BIKA 5LVEA 4X5RA 1QFPA 4MAYB 4GSXA 2HH0L 4IEFA 1HCFX 1P7QB 2K3TA 1MVYA 3FT1A 4O2FB 5D6CA 5IGXH 4Z3TA 4C56B 4F15B 1GZHA 5GGSY 5I8EA 1CG9B 1X5YA 2Y7QA 2ZP0T 4RBPH 1U8PA 3IJ9A 1KCLA 2AXJA 4I18C 1HHIB 2FT7A 3KL0A 2BZCA 5ESAB 3QIWB 4UQDA 4R7NB 5KSBE 4Z3EA 3BUIA 3GXNA 3NZ8A 4FI7A 2F1BA 3FFDA 1BWWA 4F8LA 1DBAH 4XAKD 3NAAL 5JOFB 2QFPA 3WKQA 5IROD 3G6DH 5EO0B 5HHOA 4Z78A 1ZHKB 1EERB 2W80C 3L7FB 2KLRA 1MOEA 2XVGA 3QEGH 4WK0B 1D2PA 4RNRB 4HAFA 1TPXC 3QJVB 3W0WA 1QA9B 3V4VA 3GSNB 4LOEA 2FIKA 1FVDB 3UC0L 2OMWB 4I0PB 5DGQA 3FT4B 2L7UA 3MGOA 3V5HB 3PY9A 1UG9A 4JFDB 5CN2A 2DICA 3HG2A 2ICWB 5BRQA 3HJ0A 2GBUA 5FUZL 3KDMB 4LLMB 5AVXB 2HPTA 4YFLF 4Y5XB 5D2LB 4E68A 3BUYB 5TDNB 4F57H 2V9RA 3HBZA 2IDCA 3FT3B 4D9RE 4K3JL 3UFIA 2JWYA 3FHAA 3OKOB 3QK0A 5CBEB 3MGTB 2IWEA 4M5TA 5DVKA 1A21A 5E6IB 5FYJL 2FL5A 1PU0A 4CMHC 2TRYA 4JHBA 1FQ9C 5FM8A 1RI8A 4U6XA 4S0SD 3VFNA 4HBCL 4HIQA 5HDBF 4LPXA 5AVZB 5DO2C 4K73A 1TOXA 5TFSH 4UQ2B 4M5YL 1LE5A 1S9VA 5IKCB 3GUTB 5ICUA 3BUPA 1PJ9A 4XB8A 2A6DA 4RGOH 2C4FT 5A3IC 5I0YA 3X1GA 4P2RE 5F89B 1E0OB 1W0VB 4DP4X 3WSQH 1U8JB 4E42A 1VKXA 3HLKA 1HNYA 1ZT4B 2AJUH 3DV4A 4YHPB 4LZKA 4QRAA 3FL7A 2BIOA 4Z7UB 3GYRA 2JI2A 1B2WH 4BKTC 3VI4E 2FNBA 4U6VH 4I48A 5IJCC 1ZJBA 4TOYL 1JV2B 1K8DB 5D1ZA 3O81A 4X5QA 1NGYA 4FXKB 4PJFB 4LMQE 2ENYA 2HUEA 2GFBA 4KROD 5I2IA 4RGNE 4H40A 4P07A 2Q7YB 3KLAA 2OK0H 2A4EA 3EH4B 3L95B 3AS0A 3WU1A 2GIMA 1OZTG 3WN5B 4UQAA 4HSQA 4MNHA 3FZUD 3ZDXE 5CM1A 3FF8A 2XACC 1KJ2B 1MHCA 3M17A 5DHXB 5C0BA 2Q3XA 3MLSL 3FTZA 1E7UA 1TFHA 4ZD3H 2P43B 1XEUA 4OFDA 1SDAB 2GTWA 3K6IA 1HVXA 3FKUS 4KRPD 1ZVNA 2P5EA 1MDAA 3ARDA 4LHUG 4LARH 4IU3B 3U6RB 5ADPL 1CICD 4G6KH 5IFJA 1MJ7H 1WAAE 3H6JA 2Z7UA 3AUWB 3B2UD 4PGEA 3IU4H 3CPLA 3UAFA 3PWPB 1MRCL 2VIRA 4H4NA 5D71H 5GS0L 2OMBA 4GQZA 5FHBH 4YSEA 2ITFA 2J5WA 1JE6A 3UTSA 3B7SA 1X3DA 3WKPA 5EEVA 4KI5D 3JXAA 1SJMA 4GSQA 4UZSA 4JJ5A 3SDYL 2DIJA 5JIQA 3KVDD 1DDTA 3IGFA 2CDEA 3MBWB 5MERB 1ZLVK 4PJGF 3UZEA 5JW4N 3NOIA 2PPFA 1JHLH 4V2BA 5DUML 1X5AA 4NOFA 4QRPD 5F9JA 4JPIB 1FWXA 1QO3B 1DBJL 1B0IA 1T2XA 4TQIA 5T8IA 3QCUH 3TN0B 4XN1A 4GFTB 4K23L 4AYFB 1IAII 1II4E 1MJ8L 1QHOA 4H26B 1JV5B 3FQRA 1N70A 2C7UA 1QFWI 5IBTL 5SX4I 1BVOA 1PSKH 4B9IA 1Q9OA 2F74A 3HPLA 2Y4SA 4IMKA 4LVHB 3B3IA 1P1VA 2LW3A 1FFPA 2HMID 4AOFA 4PRIA 5E1QA 5D4JA 1GW0A 2I7OA 3QUXD 2DQTL 4P8QA 4GG8A 2K4AA 4CN6A 3K6SA 5FKPA 4YSQA 3EO0A 2DBJA 1YEHL 2C9XA 4IQHA 3UTQB 4FABL 3U2JA 2ZOOA 5GSRB 4O2EA 4Y4HC 3THML 5JPNC 1JF6A 2F08A 2E5EA 2RTTA 2UVEA 3TCLB 3ZTNL 3PWUB 2PPDA 4PRNB 2IPKA 3MODL 3HFML 4HEPG 1RPUA 2AJYH 3HC4L 3NJLA 1PTZA 1RK7A 1NANI 5LGHL 4YFDB 1S7TA 3AAZA 3BC9A 2FX8H 1FNFA 2X5PA 4LCYB 4C47A 1LO3H 1AGBB 3L9RA 3QORA 4JHWL 4NWTH 5HHOD 5I8OL 1VEMA 1RJYB 2P52A 5KVEE 4P9HC 3S37L 2FATH 3CFUA 3EJTA 3QYCA 5IVXF 3P9LB 1OP5K 1U93A 3W0WD 4RMBA 3F58H 3LKPB 4DP1X 1ZLWK 3WFDH 4F93B 5DJ8B 1UEYA 4HIXL 3ROOA 5GS0C 3E9TA 3UABA 3DSNA 1UYWH 5CO1A 3X13A 1MXDA 3EOAB 1RMFL 5FXCH 1OM3L 5CJOH 2BM3A 2B4CH 2EJ1A 4NO2B 3BZFB 4ANUA 5BVPL 1IE5A 2GKIA 1E30A 1TYEB 1FLRH 3HHSA 3L5JA 2VMJA 4OFVA 5HVWA 3VM5A 1MJJB 1AQDA 2B3RA 2PYEE 3SBPA 3EAKA 1AKJA 4AGOA 1FBIL 3I6SA 2LTQB 3SKMA 4HD5A 1SM3H 3GM8A 4D0CA 1L0PA 4DNLA 3QUYD 3ZE1E 4NZTH 1HE8A 2IAMC 4TQEH 4Z77A 3CSYB 4XX5A 2Y69B 1RZPA 2A0LC 1E8WA 3PJSA 4Y2NA 3K2UH 2X7LB 3L5XH 2ZKHH 3CBKB 3RWGB 4J8RA 4O2CB 5AYUL 1G9MC 3B9KC 3AY4A 3F64A 1M2OA 3H0TB 2J88H 3ZE2B 1X5XA 4YGVA 3MOAH 3QDGE 1JHKL 2IALA 1NPNA 4N24A 5D2NB 3T3MF 1J8KA 3QI9B 3OJMB 1JP5A 1SBBA 1WFJA 1XMEB 3SD5A 3SHSA 4C59B 2GUOA 3ECBA 3ESNA 3BGFC 3TM6A 2I9LA 3ZTJG 1PX3A 3VUAA 1J05A 1DN0B 3DGGB 3NJMA 4TVUA 5D1ZD 1ZSDB 1K2DA 4DPAX 3SGKA 3OZ9H 2MPAH 1S3RA 5IM7A 4DPBX 3O6FC 4G8FA 4JQVA 4JPKH 1TETH 4PRHE 3T0EE 6FABL 3MRIA 2ENSA 4Q6IC 4ERSL 1COBA 5C0BD 1W0WB 5I82A 2E6PA 1J18A 3IB4A 5CZXC 3BH9A 4Z7OB 1PKQE 4ZPTA 2P5ED 3ARDD 3U0WH 1SDDB 5KSBA 2CNZA 2NY5L 3BAYA 4HJEA 3TBYA 5KANI 2G3MA 4WW2B 3W1ZA 4KQ3H 5E99L 1AHWC 4F9LA 4PWKA 2HWZL 4N3UA 3O4OC 5LBSH 3VXSD 2MHAB 4KTDH 5FYKL 4H0LC 1JXKA 2CM6A 2H1XA 5D7IE 3IDYB 1BQHB 5F7DA 2G2PA 3IRCA 4GKNA 4AEHH 3RTQA 5FKAB 3T6QC 4PY8J 2EDTA 4M8QB 3L6FB 1OPOA 4L5FE 4RIRB 2FB4H 2XWJB 1QHQA 5DD0L 2X2JA 3G6JF 3LXBA 4NUGL 4UT9H 3D25A 4AQAA 3LKOB 6PCYA 3U79A 4DOHE 2PLTA 1LEIA 3VE0B 2OJZL 3E2HC 1X9UA 5F7EL 3FQNB 1W91A 1NLBH 1N59A 1JK9B 3OKLA 4X8CA 3MRRA 3T4AA 1L6XA 3DVGA 1QLFA 3AREC 2IANB 3MRFB 2EDMA 1VLXA 2OTWA 3TX4A 1OAYL 4ZMWA 5E2VH 2H47C 1E42A 2QVTA 2BP5M 3C5JA 3OAYH 3Q06A 1P9MC 2X1WL 1RHFA 4PRID 5C7ZA 4GQ9H 4WEBH 4KRLB 2F8VA 5LBSA 4B96A 1CXEA 1K6QH 3CVHB 3MJ8A 1U8CA 3VXPB 4BE6A 2HLAA 1JVOA 2NUTA 1OWWA 3PQYB 4JDEA 3VQLA 2R29H 4P2RA 2CUHA 4IBTA 3BDYH 2W0LA 1RUQH 4JY4B 1JZ5A 4C4UA 4LESA 3UC2A 1WFMA 1HS6A 4DQOH 1P5VA 1T0NB 4UT9A 5HBBA 2GB2A 5IW1A 5EC1B 3VI4A 2BP8B 2WB7A 4P4KA 5HDWA 1BPLB 3QORD 5I17B 5DQ9B 2WYZA 3B9DA 3MDJA 2BLFA 3INOA 4LB8A 2CCLA 4WEEA 3F6IA 3KJ4B 4KH2A 4OTXH 3BT2H 2NY5C 1YNKL 5DHMC 3WIHH 2WB1A 3US9A 1UEMA 2ZX8A 1BAFL 1DBBH 3C75A 3H9SD 5IHUH 3T08A 1XSOA 4BK8A 2DMBA 2EC8A 1MXGA 1U58B 3RWIA 1LK2B 3H9YA 4UOZA 4JO1H 1MHPH 3LNEA 4NDMA 1MRDH 3OHXA 4OSUL 1FORH 2R29A 3K7UA