5C0AE

1e6 tcr in complex with hla-a02 carrying mvw peptide
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
246
structure length
246
Chain Sequence
DAGVIQSPRHEVTEMGQQVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSLWEKLAKNIQYFGAGTRLSVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hotspot autoimmune T cell receptor binding underlies pathogen and insulin peptide cross-reactivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 53
structure length 246
sequence length 246
chains with identical sequence J
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0aE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0aE02
5B4MC 3A6CL 2KBGA 2Q6WA 1T5XB 1DN0A 3DUSA 4H1LB 3WFDL 3K8MA 3ARGA 3P4LA 1NDMB 2YRLA 4RWYH 3PL6D 1MNUH 4NP4H 1Q0XL 2PCPA 4F33A 5GSVB 2JJTC 4HW6A 1BJ1J 3NTCL 1JRHL 1TNMA 2A0LC 1WTGT 4PLNC 1IGIL 4D9RE 5DYOA 4I0PA 3QI9C 1FFQA 4HXAL 4JQIL 4KDVA 2JJSC 1TTUA 4RFEA 3L3DB 2F53E 1QTYT 1T1XB 2AVGA 4RMQA 4H8WC 5T1KB 2QQLH 4M03A 1BBDH 4QHUB 5BW7A 2ED7A 3SOBH 1L7TH 1EH9A 4X6BA 3QUYB 3VG0L 2X1OA 1LO0H 2ZOLA 1M4KA 4LLDA 1BM3H 4FOMA 3UJTH 5LGHH 4Y4HA 2VDPL 5I17A 4RISH 3O2VH 4XC3H 3IDJB 5I1HL 3MMEB 3QEUB 3HUJA 3N85H 3VXUA 4DCQA 4KKNA 4Y88A 4FQHB 5D6CB 5GRJH 3RKPA 4AT6B 4HSQA 4F7TB 3D1MC 5CSBA 1N5YH 3LMJH 3P11H 5A3IC 4MNQD 5C0BE 1A5FL 1A14H 3Q6GL 4CVXA 1DE4B 5KVGH 2R0WL 1AGEB 2CO7B 1BVLA 4Z95H 3P77A 2GJ6E 2HFFA 4HZAA 1WBXB 3WUZA 3H3BC 2JIXD 2SEBA 3P9LA 1PZ5A 3BPCB 1A6UH 2YD1A 3NCYS 1J0HA 5I19H 4V2BA 5JXED 1EJOL 1X6NA 4BSWB 2D7OA 4PJ7B 5JZ7D 2NY2B 3KLHD 3ZHKA 2DM2A 5IM7A 1J9CT 2D0FA 4JR9H 3MC0A 5GSRA 3RPKA 1FYTE 4L8SA 5D9SA 4GLRH 4UT7H 1SVCP 1I7RB 4TULH 3K0WA 1MFBL 3O4LE 3PL6B 4JKKA 2BVTA 4PS4L 3ULVC 1DQDL 1E4XH 5L2JA 4P23D 1S5HA 5HHXL 1OM3H 3PHOB 4NHCL 2CO6B 4OLUL 3MA9H 4YWGH 5ESAA 5EOCH 2F8XC 3TN0D 4HWNA 2GITB 3EAKA 2VWEC 3P4MB 4J4PD 5BXFA 1WF5A 2YRPA 1KXQE 1NC4B 4HIXL 4FS0A 3L95B 1OAXH 2CLVA 4LDOB 2ICEB 3S98A 4HJ0C 1HXYA 3CK0H 1S7UB 3IETA 4K3DL 3CD4A 4M93C 3TWCH 4H26A 2H45A 5EWIL 4QHUA 1AY1H 1TJIL 1TQCB 4Q0XL 3L5JA 4PRIE 4XTRC 2KH2B 5F21B 1WIUA 2APFA 1R5IA 1T83C 2BVYA 1OTTD 3QNYB 4HUUB 2XNAA 5C1MB 1FZKA 1UWEL 2FECL 1L9NA 3QISA 3BH8A 4K9EL 1MY7A 3SDXE 4JM2D 5FM8A 5E1HB 3QUZA 4CRPA 1JMZA 1M7DA 2B4CC 4QRTA 2AXFB 1K3IA 4GRMA 4C4KO 3QUXA 4NC1E 2UY6A 5IW6A 4BFEA 1LK3L 4P48A 1NGPL 3X12B 1DDHB 4RFNC 5IVXB 5D7SH 1D5ZA 4Q97A 1T5XA 3OJ2C 1HH9A 2BNQB 2C3GA 5CLWA 1DFBH 3O3DB 4KRLB 1ETZA 4XAWL 4L5FH 3VMPA 4PTTB 5DURB 5HGDB 2W65A 4KRPB 1C5BL 4HV8B 5E7FA 1MH5B 1UT9A 2GAZB 1QLRA 4ZUTA 2XQYG 4GKZA 4Z78A 5K9OB 4PG9B 3T3PE 3GUTB 1YY9D 5JQHC 3SE9L 3WN5A 4XPHH 3GK8L 3HR5A 3NCCB 3D5OF 3UZVB 3RVVC 5DD1H 5DQ9B 3DMMC 2E27H 2AP2A 3DVNB 4CVUA 4QLRA 5DDHA 3IF1B 5EIIA 2VLKE 4JO1H 5SWSD 2VLLB 2RCSH 3DHJA 4LVOC 1SY6H 2ADIA 3NZHH 4RA3A 5LJYH 3HC3H 3SCMC 4TSCH 3RBGA 3ECBB 4LLYA 4DN3L 1O7VA 2X4PA 2ZCKL 3BWAB 1KF9B 2VIRB 1Q0YL 4NN6C 5CP7A 2PXYA 1DCLA 5CCKH 4YC2B 3ILQC 4QRRB 2ZWLT 5D7JB 3JTSA 3ZT6A 1RUAH 2QSCH 3QXVA 2UZIH 2IPUK 4XP6H 2RAMA 1WWCA 2XFXB 5CLTA 2QSQA 5MEOB 5KOVC 1CQYA 2XZQL 4NQSB 4P4KB 3IDIA 4HUNB 2O61A 1YEIH 3PWJA 4OBRA 4N0FB 4PGDA 1FAIL 2EIEA 2C7UB 2ESVD 2R1XB 4MXWL 4LIQH 3PNWA 1U8HB 2P43B 1W2KT 2GFBA 3GSRB 2FYYA 4JFFA 4QRUB 3I3EA 1YZZA 4IRJD 1QSEA 3DI3B 3E2HB 3W5NA 2X4NB 4JFXA 3J7HA 1NFKA 2M2DA 5CJXC 1FNEA 2NXYD 4PD4K 5FYLL 1KN4H 2DQFB 1FL6B 2EH7H 3LKPB 3JUZA 3VXTB 3RWFA 4PR5A 4OT1L 3N0PB 4AG4H 1EVUA 4XVUD 1WAAA 4WTZG 3QHTC 4N8VG 1ORQB 1H9VA 1KJVA 3D85A 3BDYH 4RGMC 4KJWC 3STZB 4JRXE 4L4VD 2VJXA 4J12A 3LEYL 3B83A 1RUML 4KAQL 4QOKE 5EBWA 4FG6C 3N50A 3QIWB 4AENA 4PJGE 3PGFL 4X6DA 3FMGH 3SKJL 3TPKA 4UTAL 1IE5A 4G8FB 3D9AL 1E28B 2DQTL 4NKOA 4C59B 1FAKT 2IAMA 2NY6C 4JHAH 3RU8H 4XBEH 2F5AL 5E6ID 1XR9B 3QQ9C 3DO7A 5I1LA 2HLFD 1J5OH 1OTUD 1RIUH 5C0IB 4MQXD 2A38A 1MWAA 1BX2A 4WW2B 5ACZB 2YOCA 3W2DL 3T2PA 2IBZX 3BZ4B 3VGAB 4F7PB 2I9LB 4KVCH 1EEYB 3MRRA 3WXWH 1XGYH 3DUHA 1X5IA 3CZFA 3T0EA 1PKOA 4CMMA 5EA0L 5HXMA 5CJOH 1JYNA 1LO4H 5IVOA 5JHDD 4MNHB 5TE6H 2O5ZH 2HTKD 4NN5C 3V2AR 3BAEH 1ORSA 2HT2C 5TQ2L 3T1FA 3HI1B 3MNWA 3F7YB 2J8HA 3MYZA 5DO2C 2B1AH 3HI1A 3MNWB 1I4FA 4OF5A 5L8JB 4G7VL 1ZT4A 4OCNC 5H8DA 4DVBB 4PB9L 1IGML 1ZANL 1FC2D 3CVHB 2YPLD 2LVCA 2FEDD 4PTUA 1Y18A 2PTTB 2BVOA 1TLKA 4NQUA 3ZE2E 4ZMAT 1DQMH 1EEZB 4OI7A 3LEXB 1HYRC 4MA8H 4PGBA 2YUZA 5GS1B 1FRGH 5MEPB 3U83A 4MD5A 1GOGA 1MLBB 2BNRA 2KL6A 4LKCB 3PWPA 4U1NA 5LGJB 1KPUA 5IKCB 3VWJD 2XZCH 4J8RA 5IF0B 4M8QA 4BUGA 4PRNB 1JWSA 2Y4SA 3ARRA 1CD1B 4EI5B 1K2DA 2IBGA 3WNNA 2PUQT 4XMKL 3QIWA 3SKMA 4AENB 3STLB 1A3LL 5BVJA 1IC5L 4QGYA 4PJXF 4QRSB 5EZLA 2Q7YA 2OQJB 2D7PA 3RNKB 1XF1A 1IGYB 4UBDC 2HT3C 4WNQB 1ZA3A 2I60L 4NO0B 1A9BB 1OB1B 3E6HA 1IKNA 2HFEA 3H9SA 3QDJA 4AIZB 2FLBT 1MI5A 3QG7L 4I5BA 3V6ZA 2GEEA 2X1QA 3VXOB 3X3FH 1D9KB 4G9FE 3BWUC 3WLWC 3L3HB 3B6SA 3HNTL 1OD7A 2Z35A 3PWVA 4U3CA 4X80H 5T33L 3BGAA 3S5LB 3ZDXF 5FEBA 4QRUA 4NZRH 1IEAB 2Y06H 4YGVB 1IKFL 3I50H 3PNWB 2ENSA 3UTTA 5CJQH 2OTWB 1T0MB 1VKXB 4ZS6D 4I1NB 2OMBA 1NBYA 4MXQD 4PB0H 4HS8L 3TA3D 3SBWC 3WNPA 4YDVB 4Y5VA 4D8PB 4LCWE 1UVQB 1VPOH 3MLSL 5M95B 5FUOL 4Y5VB 4D8PA 4KZEL 1AR2A 2XY1A 4JJ5A 2AKRA 3TVMC 4HWZB 3U46B 4H8WH 4LSQL 5J13C 4YBQD 2QHRH 4PY7A 1AXTH 3BWAA 3MRHA 4XI5D 4R4NC 1BGXL 4QRPA 4M48L 2DQCH 3CFIC 3H8NA 3RNQA 1IEAA 2L0DA 2AJXH 2DI8A 5KS9B 5DVOA 3VJ6B 3QUML 3RWHB 4KK8D 5EC1B 4OI8A 2DMCA 1G7PB 5IB5B 1A7NL 4BELD 2YPKA 2XTLA 4QTIL 4Y2DA 4BFIA 1DVFA 2YWYA 2GUOB 3CAFA 1L0QA 4PJ9A 5FYKD 1N26A 3ZYJA 1QLRB 1U8JB 2VXSL 4XWOC 1XCTB 1NGYB 2VLKA 2ZUQB 2OQJA 5ADOH 2JLLA 3ZL4H 5IMOB 5GJTH 2YBRB 4PTTA 1YC8A 2P46B 4QXGL 3FQNA 3EIFA 2OJEB 3S5LG 3QG7H 2DLFH 1KJ2A 4HPOH 1RZFH 3L3GB 4EDXB 1HH9B 2WWMD 4RCAA 3TC9A 3FRPA 4C57C 5D7IB 4ZS7H 4NJAL 3ULUF 3ZKQD 1EA9C 4IOIA 1PY4A 4J8RB 2DN7A 2NY7L 4D9QD 5IF0A 3TBTA 4XMPL 4RRPG 1DBML 4UQ2A 4PRHD 5M94B 3QWOB 4GLRI 4MJ6A 2B0SL 5CD3B 2CLZB 3MV8A 3DYMA 3WUWA 3BKJL 4U0QB 1B6DA 4Y4KC 1V8HA 2CUHA 3O2VL 2FEEI 1HKLL 2BSSB 4TTDC 1WZMA 1IGFH 1HHJB 4DEPC 4LGSB 1MFEH 3BDBA 2OXGA 3O6LL 4XP4H 5ITBL 4R4FL 1UB6B 2Z8RA 3NBNA 2R8SH 3BKML 3PWNA 3SOBL 2HP4A 4L8CA 5DJ6B 1CFQB 3RDTB 2VDKH 5EOTA 1XF3A 1D3CA 4KMLB 1A7PL 1R24A 2D31B 4OLXL 1KEGH 1DANU 4FMFA 1A7OH 1KBGH 3KPMB 3T0EB 1WLHA 1KLGA 2AJXL 5F8RC 2DJUA 2EZ0C 3N85L 3O9WD 4NFCA 4U6XB 3OJVC 4WEMB 4NQEB 3PL6A 1A7QH 2VDNL 2MQCA 4KY1H 2V7HB 1I3RB 5K9JH 1RIHL 2FL5B 4ENED 2EECA 5I1KH 4HKXA 1PW3A 2DD8H 2H2PD 3LKNA 1GAFL 3VXSB 3QRGL 1A6WH 3OKNA 4UIKL 2YEZB 3CSBA 3LRGA 5DMGC 4PJBE 1R3KA 4O2FB 1NL0L 3U0WH 2F58L 1NMCC 1QVOB 1W72A 4HMCA 1YMME 2IAMC 4M7JH 3P9LB 3TEUA 1UQSB 1EHXA 4LNRA 5TDNB 1FG2A 1FYTA 1U8IB 1XF2A 1L6XA 4RGMB 4LCWD 3U0PB 4LU5H 5L88H 1HSAB 2R1WA 4U1JB 2JK5B 5J6GA 3UO1H 4Z8FL 1BFOB 4YR6A 3HNTH 1YA5A 1C12B 1TETL 3S35L 4C56E 3CDFA 4Y19A 3C9NB 1TMCB 3LPGA 3NPSB 1UJTA 3SGEH 1BWWA 1CLOL 2GJ6A 3I2CL 4EN3A 4LSRH 1HHGB 1JHLL 3WSQL 3LIZL 3X11A 4NGHH 5C0BA 5JDSA 4TPRH 2QEJA 2AABH 3HAEH 2IBZY 4ONGL 2CLRB 4AM0B 2BRRH 4YQXH 5JHDB 2AGJH 5HHNB 2V5SA 2D0HA 3SEPA 3IRPX 3WD5L 3L6FB 2V7NB 5IG7B 4MJIA 2EH7L 2GTWB 4JM4H 1TCRA 2F19L 1IL1B 4GQPH 1MCBA 1GJIA 5GGUA 4MD0B 4K3JH 2X4QB 2Q76B 1X5ZA 4LLVA 4HKJB 4HKZA 3JTSB 1WFOA 1IARB 5E4EC 1S7WA 2EYSA 3G6DH 1YEJL 3EO9H 2B5IB 5CP7B 1CD0A 5BCAA 3QA3A 1I1FA 4MNQB 3WNLA 3QWRA 1OGTA 1AHWB 5IFAH 1HQ4B 4NKQB 3NIFE 3VXME 4BFGA 3CX5K 3QIUD 2DWDA 1EDQA 4QT5A 4EUPH 3VXPB 1MHEB 3FZUD 1QSFB 3GMLA 1RHHB 2B39A 4PJDF 3H9HA 1DN0B 4BSVB 5CEZH 3VXQB 4MCYB 5KTEL 4RQQB 3CC5A 2J8UF 5D2LE 2FX9H 2R0WH 5J3HD 4UT6H 2XWTA 4JN2B 5HDOA 2R2HA 5H94B 1INDH 3RJQB 1JPFB 3CLEH 2YPLE 5GRJL 5F6HI 1A8JH 3Q1SH 4JZJB 2NY3C 4N8CL 4Z8FH 4LPVA 3F12B 3G5XB 3OKKA 5I1EL 2R29H 4OFPA 2R4RL 4TUOB 4MJ4A 3DX6A 4P3WA 4Y16D 5BJTA 4P5MB 2NXYB 2ERJC 1TETH 3CIQA 1CFVL 3SE9H 4LLUA 1JZ6A 2P8PB 1OPGH 5LCVL 2NMSA 2EYRA 3MNVB 1F4YL 3DETC 3K74B 3LKQB 5IVXA 1KCUH 3X12A 4DUXA 2BZDA 3D18A 3OR6A 4ZO9A 3VFVA 3GBLA 1Q9KA 1AJ7H 2D03H 5KTEH 5IJVA 4TOYH 4LHUD 2JCCA 2YD4A 4U0RC 5FGRA 1R3JB 3MJ9A 3PGCB 3CX2A 2HJLA 5D96C 1M05B 4NQVB 1J11A 1NGXB 4JO2L 1Q0YH 4GH7B 2NX5E 2HT4D 5IESL 1KENH 3O3BA 2NY4C 5D7SL 1VFAA 4KI5C 4WI7A 4LK4A 2PW1A 4JFYA 3TIEB 8FABB 3BVNA 2D9QB 1G7JA 5HBBA 4XMPH 1R5VA 1MCOH 3EO0B 3NCBB 1RUQL 1PQZA 1S7UA 1I9IL 3IETB 2OI9B 4OLXH 4KKLC 4YZFF 1WC7B 3K7UA 4NSKA 4UDTB 4OIBA 1RV6X 5I1AB 2PYEA 1DQQA 1HE7A 3HMWH 3BP5A 3CMGA 1JGDA 2EDOA 3O4OC 4U1HB 2XQBH 2OK0L 4YE4H 1OAUH 5HTSA 5HI5D 3LS4L 4FQCL 1BOGA 1ZA6B 3EO1B 3BKMH 5IMLB 1NLDL 5F3BA 1CDIA 4JO4H 3VFMA 5T3ZD 5KVEH 1MFBH 4FTVE 4HBCH 4ZTOH 4NQED 3S36X 3C5ZA 4X83A 5HY9A 1XH3A 3FOLB 4MNGB 1CXLA 2FIKB 5IBTL 5C6TH 2ADJA 3WV0A 3ARBD 4X4XB 5B3NA 2UV3A 5KSVB 3S96A 5DUPL 1JK8A 4KHTL 5IHZB 5L6YL 3H7BB 3OAZK 3BPNC 3IVKA 4IMKC 5E00B 5EU4A 1Q8MA 2NX5D 4ZUUB 3NIGF 4M48H 1WBZA 1D5BB 2GJZA 3V4VL 1PZ5B 4LSSH 2B7DT 3KJ4C 5I76A 1WBZB 3G08A 2FRGP 5FGBA 5DEZA 1G9NH 4YDIH 1JPSH 3INUH 5BVPL 4PLKC 1J05A 2YD6A 2FLRT 2C1OB 3IFPA 1X7QA 1I8MA 4X4ME 4K2UL 3O6FA 4C83A 4OD2A 3OJDA 3EYUH 4M1CC 1ZT1B 1H5BB 3ZO0A 3IGAB 4LSTL 2AEPH 4JQVC 1OARH 4QHKI 4Y8AA 4O5LL 1BP3B 5DZOA 4APQD 1RIVL 2IANE 3SO3B 4R7NA 3VD5A 4N0CD 3TBSA 3U7WL 5EUOE 3WIIL 5DMYA 1F4XL 4Y4FA 4LHJB 5DFVC 1SMOA 4DOHE 2YXFA 3CXDH 3FOMB 3C8DA 2A1WH 2A6JB 5AUMB 3X13A 4K9EC 1GHFH 4DGYL 4U7SA 1K8IB 3OF6A 4L8DA 4OM1H 1K6QL 4JKLA 3NH7L 1AE6L 3NACH 3PABA 4LLQB 5SV3A 3LN5A 4JDZA 4MQTB 2AJSH 1FL3A 1RJCA 4G6AD 1CI5A 2A0LD 3B43A 2O26U 3M17A 5JXEA 1G9NL 3FFCB 1S9WA 2YSSA 3O9WB 5C0ND 1MRFH 1MELA 4ORGA 1RZJH 4LSPH 1RJZA 4IMLB 5GRUL 1R3JA 3QHFH 2YD3A 2J8UB 4GBXB 5DXWA 5FM5M 4M43L 2RQ8A 3EOBB 2H32B 3ZKXB 1G9NC 4HCRL 4KRMB 3B5HA 4NDMB 4WU7A 4LPCA 2WK2A 2FJFA 1T66C 4FTVD 5T33H 1JP5A 2BMKA 3WHXA 1SJHB 5ACLA 2VSDA 1FNLA 1R5WA 4AQOA 4R2GD 5E2UL 1IFHH 1M7XA 4TUOA 3BP4A 4KKAD 4UNUA 3TN0A 3W81A 4E41B 1F4XH 3VGAC 4U0RB 4PRPD 3WS6C 3IFOB 4C56B 5BVPH 1BIIA 4GAFB 4Z7NE 4YHPB 3MNZB 2PO6C 1XR8B 4OZIA 4N0YL 5LVEA 5KBNC 3EFDH 3ULUE 1ZSDB 2ZG2A 1YJDC 4ZOCA 4MVBD 2ZP0T 3REWA 3V4VH 3GGWB 3ARPA 3FB7A 5HHOE 2FDBP 3C60B 5D72L 3SCMB 3AMKA 1WITA 1AGFB 4BQ6A 5E1AB 5EOQL 2RJMA 2VDOL 2W60B 4F58L 5L2KD 2FO1A 5IB2B 4DFHA 4MCZB 3QPQD 3UBXI 1P4BL 1P7KB 5FA3B 3TT1H 5JA9A 4PBWD 4LLVB 2VZ1A 1EMTH 3IU3A 2ZKHH 3D9AH 4OZGE 1EAJA 2OK0H 3PGFH 1K85A 3D48R 3DUUA 3MJ8B 3HZYA 2BXYA 4Y5XC 1CGVA 1OHQA 4R8WH 2Y1VA 2JJWA 4DWHA 3NZ8A 1N8ZA 1MJUL 2YN5A 2DWEA 4HZLB 4KJPD 3MTRA 1A1MB 1N7MH 1VEMA 4J23A 4TSAH 3A6BL 5IB4A 5C0BB 4WI9A 1A7NH 4X80L 1K4DB 1YPZE 3OKYA 3ALWA 3VG0H 3W2DH 1JPGB 1H5BA 5EU7C 5EA0H 2XTJE 43C9B 1MCPH 1ZMYA 4YHZL 5CEYB 4PGCB 2D7TL 1X7QB 1OTTC 4H20H 2YS4A 1ZVSA 3GEWB 1CVRA 2VQUA 5GHWL 1MHHB 4PJ7E 2O5YL 5E5MA 2OS7A 1BQHB 4AEIH 1IC7L 1P84J 5FO8A 1FBIL 1G0XA 5GS0H 2F74A 5INCA 1KGCD 2P5WB 2YA1A 3IXTB 5DEGA 3VXMA 3BE1H 3ZKSD 2L4OA 5FUCE 1DUZA 1U8IA 1A1NB 3BKCL 4KZEH 3FQXA 3DX9A 3DGGB 1UH4A 3HNVL 1J1PL 1ZANH 2NW2A 4PRHE 4PJEA 5CGMA 1QVOA 3MLRL 4XP4L 4HEME 4P2CG 2AJZB 5F9OL 1UG9A 3WO4B 4KXZI 4L3EA 1IJ9A 1TPXC 3KYNB 3ZDYF 5IBLD 3S96B 2O5ZL 5MENE 2FBOJ 3LKNB 5DR5H 5TDOB 4R0LC 4KTEH 1CGYA 1D9KD 2V2XA 1Q1JL 4M61B 4WFGD 4LEOB 3O6KL 3O3UN 4NCDA 1IM9A 3ZKNC 3GIVA 1YY9C 2OSLB 3GNML 4JVUA 4FQJH 3K2MC 3FKUS 5FDWA 1H5BC 1MIEH 4RBPK 3LOWA 1UM4H 3L7EB 3M07A 4Z0BH 3LRSB 1WTLA 3FTGA 5DJCA 1N6UA 3CMOH 1SEQH 4OZGA 3UMTA 5J6HA 4P0DA 2NTFB 2VLMD 1IC1A 4LF3B 3OHXA 4Z7QE 5ADOL 1ZHLA 2HJFA 3L3KB 4IRSC 3PGDB 3PWNB 5E9DB 1TDQA 4IDJL 2AEQH 2NXZC 1G7JB 1A0QH 2Z8WC 4GW5A 4Z9KB 1AD0A 1EHNA 1OGAA 2HKHL 2X4SA 2Q8BL 4IJ3C 4NZJA 1T83A 3AU1B 3VDCA 4B0MM 2G75A 5CJXA 1QYGL 4LU5L 5D2LF 5DC0A 3VFNA 3BT2L 1FJ1B 4MA7L 1XGYL 1DBAL 4NQDB 4HAFA 4LBEA 4KK9C 2V6HA 5F6IB 2ZSVA 3CSYA 3GB7B 5FDYA 4LSUL 3ISWA 4X7SH 3QG6B 5AG8A 4KKCD 4DZBA 3ARDD 4YFDB 3QO0B 4CGTA 1BQLL 5GGTL 4H1LG 1ZHBA 3WDIA 3U4EA 3D3VB 4IRJC 2EYRB 2AV7A 4D0DB 4P5TC 4DGVH 2E3VA 5I18L 5EORH 1D5XA 4PJIF 1IGJA 4RAUA 1QFOA 1AD9B 4OCMC 1SJVA 15C8L 5D1XB 2HJKB 3MLTA 1Z5LA 4JM2A 1I8LC 2BOCA 4XVUC 5GGQH 5ILTL 3THML 2WLYA 3X14A 1FFNB 1GVIA 2VN4A 4UI2A 1T89A 3WSQH 3KJ6L 5HDBF 2OZ4L 2FBJL 2VAJA 4URTB 5GXBB 1H0DA 1NBZA 4PJGF 1FV1B 1GPOH 4AMKH 2JJSA 2NY5L 4YO0A 1F97A 1RHHA 1L6ZA 2HTLD 5SWZB 3GMLB 5T1DL 3EYSH 1CL7L 1T7XA 5E9DE 3IDYB 1SJXA 5KG9B 3I02A 5B38A 3C8KB 5DHVA 5ETUA 3N9GH 4OJFL 2EDTA 4OD1H 3TYGL 4PP2B 4G8GB 1VGKB 2YD8A 1SQ2N 1EPFA 4JG0H 1OCWL 5EU3A 5E2VH 2VKWA 4Z7WA 4HWZA 3BFOA 5F96H 3IDNA 3FAXA 5JHDE 4F3FA 5CBAA 3AROA 4MQXC 3AM8A 4OZ4A 1T1YB 4HKJA 4P4RA 1AKJD 3VRIA 1CXHA 4M1GH 5GGUB 2GSGB 2OL3A 5HHVH 1YNKH 3I02B 2DM7A 4I9WE 2FJHA 4Y19D 4MJIB 5DT1H 3KPLB 2Y7QB 5CEXB 5I18H 3PG2A 1N0LA 1TVDA 1OAKL 1INQB 1C5DB 4ZOAA 1A6TB 3LSOB 3DV6B 4WO4B 5FHAL 2P44B 3VFTB 4OF3A 1MREL 1MCKA 3ARTA 1FFNA 1DBAH 1VACB 5ID0B 1GXEA 4FQLL 3L7FB 1RJLA 1F4YH 5DK0B 3LN4A 5GHWH 5GJTL 5ISZE 1CFBA 1G9MC 5D5MB 1IAII 3SGKA 3U7YL 1ZE3C 3GSVA 2CIIA 3UJIH 3MRNB 4OZFG 4TULL 4GMSH 1XGRB 3LKOA 3OXRB 3T04D 4LGPB 5FYLD 5CGYD 5DZNA 1N5AB 3PIQB 3WFHB 2DD8L 4XNZB 1GGYA 3QDME 1CE1H 1FG9C 1ND0A 2MPAH 3LEVH 5B39A 2CK0L 4Y4HC 4YK4C 1FIGL 2O5XL 3EYFB 1AY1L 1TJIH 3WS3B 5FK9B 3BX7C 5FOBB 4JG0L 3SY0A 5KZCB 5IW3A 3STLA 1LNUA 1UJ3B 1NL0H 4U1MB 2BY0A 3MLVH 4NKMB 1QQDB 1ZTXH 5DMIL 1CD1A 4EI5A 1G6RB 4LIQE 3UBXB 1JWUA 4OCXH 2X89D 1ZLSL 3V0WL 3ARXA 1KACB 4IOSD 1A4KB 1YNKL 5LXGH 4EJ1C 5EUKB 2R4SH 5EBMA 4XHJD 4CU8A 1MCDA 2XI9A 3RGVA 6FABH 2Z91A 1WT5C 2VDML 3UP1A 2DQGH 3D0VB 4CUCA 1RIHH 1UB5A 2NCMA 4M5ZL 4P2QA 4I3RL 5GRVL 4G8GD 4KI1A 1I3RA 5L8LB 5GJSH 3UPCA 5FHAH 3UTTE 2W9EH 4FFYH 5CKGA 3UTQB 1RSFA 1MCHA 2HJFB 4NOFA 4PTUB 3HE6D 4LL9A 3OHXB 1HOCB 4PJ8B 4P99A 2I9TB 3OKMA 2X89A 2VO5A 3HE7D 4QHLA 3PWUA 4OZGB 5T1LA 1JTTA 3HA0A 5DJCB 1DR9A 3ME0A 5C0EB 4XC1L 3FTGB 2NPLX 5EOTB 3T77A 1GZQB 4L9LB 4MZ2A 1WICA 4LDEB 4HJJL 5EWIH 5FDWB 3QDJE 1QSZA 4YNYB 1XZ0A 4OJFH 1MFNA 3MRLA 1ACYH 4ELKB 2KQMA 4R0LB 2NZ9C 4CMMB 4FNLL 4XPAH 4EI5C 2VDOH 4F58H 2FGWH 4JHBA 3K3QA 5CD5C 1CT8A 1C08B 2K9UA 2VZ3A 3L1OH 4I9WD 4ZPTB 2ICES 2R23B 4XGZA 2A77H 4Y2DC 2NNAA 4WTZA 5JOFA 2RR3A 4L1HA 1UWGL 5IB1A 4EI6A 1AQDA 4P2YA 3HZKB 2ZUSA 1FFOB 1CFSA 1BBJB 4X7EC 1PG7H 3MOBL 5DEGB 15C8H 5DK2B 2VDPH 5C0CE 3QXDB 2QQKL 2IAND 1S7VA 3W39B 1KJ2B 1BQHA 4ODUA 3GSQA 2BVQA 5I6XC 4GW1A 3L3IA 5SWSE 1K9TA 2Z8VC 4GKSB 4I4WA 4PP1D 2ZCHH 1FH5H 3TV3L 1A2YB 4UV4H 1QEWB 4LSSL 2VDNH 3G5YA 1E4XI 1PFCA 1MWAL 3K4ZA 1JCKA 2MNUA 3WNMA 4JN1L 5D5ME 5IB4B 3QNXA 3KYOB 2ZUTA 4DVRL 2HG5B 5IB5A 3HG1B 4NRZA 5HYJB 3VH8A 5DUBB 4NPYB 1Q0XH 1J8HE 2VQTA 3RWHA 2WWMC 3VJ6A 4ZQKA 1OQOA 1VGEL 3ROLA 1FO0B 5HD8C 4WFFE 3B9KD 1AFVH 3IU3B 1DL7L 3DI2B 4PGDB 4PY7B 1MSPA 2NY6B 2ADGB 1QFHA 4ZOBA 4G3YL 4NZRL 4QOKB 1GIGH 2I26N 5CSGA 4KVNH 4L9LC 4YHYB 2H26B 4OZHE 5ID1B 3QXTA 1XF4A 4PBVC 3OTTA 3RWIB 1X5KA 2QQKH 2FCBA 2BHUA 1EERB 3TCXA 4FQPA 5C8JA 1N6QH 1AHWC 5AZ2L 3CFDB 3MLSH 2CRMA 3MV7D 4NO0D 2W91A 3MLWL 3GBNL 3U9UB 1UACL 1YYMH 4PJ5D 5FHBL 4ZQKB 4ZFFB 2Y5TB 4FHBD 4MB5A 2IADA 3QEQB 2VLLA 2I5YL 4M5YL 4YXLH 3DGCR 4OQTA 5HJ3A 3RUGB 1NC2D 4P4KC 5HVGB 4JFEA 4LOUC 2Y07L 5D7KD 1MRFL 5LBSL 2NLJA 3VXOA 1SM3H 1A6AA 1UJ3C 4I77H 5F1IA 5HHQB 2EZ0D 3O9WC 5GQBA 1DJSA 4U2YA 4HQQL 4EN3D 4Q9QL 1AJ7L 1XGUA 4Z78B 2W9DL 3CXHK 3OX8B 1Z9MA 4NO0A 5DJZB 2I27N 3QIBD 4QTIH 3L5WA 1MFDH 4RFOL 5CIPH 1WZ1H 3MLUL 3GHBH 3BRFA 4K3EH 4WFGE 3T2NH 1F4WH 3WL9B 2G5BB 4HD9A 1EK3A 3O3DA 2ORBL 2AEIT 3EJZC 3QXDA 5DK2A 4Y5YC 3IDMB 4YHKH 3Q2CA 4X6CB 3BEVB 1REIA 3GIZH 2P1YA 3WEXA 4OM0H 4L4TA 4NBYB 4MSWB 2CR6A 1DQDH 1E4XL 2VUOA 4O9HH 1KPUB 4GRLC 2VDLL 3CCHB 1U8NA 1RIUL 3MYJB 1P7QA 2H1PH 4X6EB 3RZWA 4WWKA 3KPSB 4NJAH 3MPCA 5C6TL 3VU2A 4HJGA 3BW9A 2BFVH 5TGBB 2CDFA 3OXSB 4UV4L 1BQUA 1CLZH 1CT8B 3A6OA 1WFTA 3BQUC 5CS7A 2C5DC 3DBXA 2XQBL 4G3YH 1F5WA 1LK2B 3DTXB 3NGBC 2DYPA 3CVHA 4Y4FB 4LRNL 1YEEL 4OCWL 4QCIB 4L4VB 2VITB 1WCQA 1SHMA 3QI9B 3MLZL 2E7MA 4CW1B 3MOAH 5C92A 3QJFA 5FYJD 1KB9K 4WWKD 5D7LA 3RHWK 4MWFA 4OD3L 1SMAA 2X4OB 2HRLA 3G6JB 4HK3N 3BESR 2I9TA 4U1KB 2DBLL 4PJXE 2A77L 4DUWA 4OZFH 2ID5A 2VLRE 4XCFH 1DTUA 1T03H 4GAYB 4BKLA 1I8MB 5FYKH 2EDJA 2J5LB 3VD4A 3VFUB 3VWJB 1BX2B 5ACZA 1J05B 4ZNEA 1MWAB 1OP3H 1W8OA 2DQHH 3VFSA 4HUKB 2QHRL 3FO9A 3KR3L 1CF8L 2IPKA 3G6JE 2NXZB 1IKNC 4NN7C 1S7SB 4XAWH 5DF0A 4BK5A 1YNTA 3O8XB 3VD7A 3P2TA 3RL2B 3FZUC 4O2EA 1CLYL 4JRXB 3OJMB 4TQEH 1G1YA 2FEEL 3D39D 4U1MA 2Z93A 2VLRD 3BPCA 5EBWB 3NIDF 1FPTH 3MUJA 1F45A 3LZFL 1EV2E 5KSVA 1G7LA 1FGVH 1OW0A 4JRYA 5BZWB 4KK6D 1NGWA 4UTAH 1AGBB 1DE4A 4XCCH 4HDIA 2RB8A 4U1IA 2VUYA 5EO0A 4AG4L 3C2AH 4XBPB 1S9XA 3T2QA 1QBAA 1RZ7L 3FO0H 3QFDB 3P9MB 4HGWA 3VXTA 2CGRH 3RUGE 1F58L 1WSST 2EICA 3CXDL 3O45A 4YAQA 1LGVA 5CBEB 5J89A 3MLXL 3FQTB 3ULVF 4EDWH 2VLRA 4MHHI 2EXWD 3BP5B 1A64A 4N5ED 3MA7B 2P8MB 3RVWC 2DQHL 1HQRB 2DQEL 5A2JH 1WC7A 4NSKB 1CLOH 3C5ZD 3OZ9L 4LCCA 3EO0A 4JY4A 5CEXA 4K94H 1S78C 4NM8H 2F5BH 3ARBA 3C2SA 4YHIA 4Q2ZA 35C8H 3KYKH 2MMXA 4HK0A 1FAIH 5GJSL 5D7JA 4J3OC 4OLYL 5C0AB 4LLAA 1PX3A 2C4FT 4NQVA 5K9QI 2FR4A 2F8VA 4QO1A 5D71L 1JI1A 1LP9A 4TVPH 3HS0A 4ZAKD 1NQBA 3H0TA 2G2RB 2BJMH 3KPRB 1ULVA 1QKZL 1YEEH 4OCWH 3VFOB 5B38B 3VFVB 25C8H 1TQBC 5E94B 3VGBA 1RUAL 2QSCL 4XPFH 4NHUB 4EIGB 3HAEA 1HKFA 2AJ3B 5DS8B 1OT2A 3NFSL 2B4CH 2JKXA 4QGTA 3V6OA 1JNLL 2R2BA 3N1FC 4LGRB 2ILLA 3OKLB 2A6KB 4Z0BL 5FECB 1S5IH 4YZFE 1MI5E 5BJTB 2VABB 2WLZA 5EORL 3SJVB 1ZLVH 4X9GA 3QH3B 1L4IA 3BP7A 4FABH 1T6WA 1J1XH 4HS6B 4HIJA 1V3MA 3B3IB 3ARBC 2VDRL 1YEFL 1NC4D 3CC5B 4HPOL 5FECA 1Y6NR 2QTEA 3GMNA 4JG1L 4MCYA 1ODAA 4Z7QF 1FN4B 4PJ8D 3MA9L 5JW4M 2WBJB 4NQEE 3EGSB 1MY5A 1X5JA 3CU1A 5TH2B 2HA1A 5TE7H 5E94A 1KCRL 3TWCL 4X5WB 1I85A 1X5GA 4JFOB 1M7DB 1ZEAH 3U0TA 4HLJA 1ES0A 3DHMA 3QUXD 1ED3B 4KROD 4NQDA 2EDBA 4UUJB 4RAHA 1LEIA 1OVZA 3T3MF 1NCBL 4NYLA 3AUVA 2ZCLH 5IIEB 1MAMH 1FZKB 4PLKD 2B20A 3C2AL 4PUBH 5HHOD 3CFCL 1R5IB 2B4CL 3NABH 3BZEB 3RL1B 3MBEC 4G6JH 3OG6B 1AI1H 1GZPA 3BEWB 3TJHD 2XYCA 3OAZH 2OM5A 3SDCB 4H26B 5JW3L 5IEHB 3HPJB 5L88L 5ECJE 4H8WL 4LSQH 3AGVA 2XRAL 4AM0A 4LHUA 5EBLB 4K3HA 4NQDD 3VG9C 5JDSB 2OR7A 4FP8L 2XKUA 3VFWA 3B8YA 1M71A 5I2IA 2XKNB 5E8NA 3QCUL 3NFSH 1S9YA 4YAQB 5CBEA 2V5YA 3QQNA 4E0RA 3CVHL 3G04B 5FIEA 4YHLL 2DM4A 2Y9RT 4K7FB 3WDHA 1T80A 1ZTXL 1PKQB 3BISA 1C12A 2Z4QA 4NUJA 2W0FA 1X5AA 4KDTA 4U1IB 1NUDA 1GGCL 4I48B 1ZWIB 4XH2B 1I8IB 2PXYD 4XBGB 1YPZF 3DNKA 5IVZA 5TDNA 1RY7B 4I0PC 2VXVL 3EOTH 1W72B 1ONQA 4OGYH 3SDDB 4ZFOA 1CDBA 1CXEA 4O2EB 3QIUB 4HXAH 4FQQA 4P46B 2YEZA 1NCTA 3B2UD 4WFFD 4TTGA 3PL6C 5CP3A 3O6LH 5DMKB 4DN3H 2HFFB 1LO5A 1GIGL 3PF2A 4HKXB 3RHWF 1AGEA 5KVGL 2DLTA 2F74B 5JTWA 2JJUA 1ZWIA 4G9DA 4M7KH 4RDQG 3MV9D 2NW3B 3DURB 5FKPA 3QQ3A 2VXUL 4X9HA 2MCG1 3ZKMD 4MLIA 2UWEE 1JUFB 4JKPL 3VRJB 4Y5YB 1KLGB 4HBQA 1KXTB 4O51A 3QFJA 3CLFH 4QF1A 1MUJB 1QO3A 2X4UB 3L3JA 4BQ8A 3VD9A 4IDJH 4M93B 1IAKA 3FT3A 4S2SA 4LCYB 1NLBH 5I15H 3HI5L 5I17B 3R0MA 1ZXQA 3RDTC 1VADB 4BZ1L 3BE1L 4FTVB 4OUOA 1BQLH 3KLAA 2B8OT 5DJ6A 2XQYK 4HUWA 4MNGE 4MDJA 2EE3A 4B7IA 1YJDH 1UB6A 4L4VA 3ULUL 4X8JB 5IMMB 4HG4J 3DUUB 3MLXH 3RWJA 4YHNB 4OFYA 3BZEA 1WCBA 2UVFA 5D71H 3O6FD 2VISB 5DHYB 1L0XA 4OGYL 3C6SB 1TIUA 1FVDB 4I0PB 3WFBH 2VLJD 3NAAH 4K94C 3JV5A 3OXSA 1ZHKA 1P7KA 3O6MH 4X99A 5FA3A 3PXJA 5ICYA 4LCWB 3SE4C 5A3ID 2E6QA 1D5IH 2IG2H 3K81A 4FQ1L 4XPTL 5CD3A 3CPLA 5EO1A 4KTEL 3NCJL 1BJ8A 5GSVA 32C2B 4F33B 1UCBL 1CR9L 5FGSA 1P7QB 3U0TB 4XRCA 3BYYA 4K94L 4UILH 1F4WL 4FQIH 1Z3GL 3AS3A 5DJ0A 2KQNA 4P2QE 3T65A 2JB6B 1KT2A 4LRNH 1NDMA 1VDGA 4Y4FD 3WFDH 2XOTA 3DVGA 3D69A 4U6TA 3GI9L 4P3CH 1QACA 3KLHC 4UAOB 1FN4A 2VXQH 4HIIB 1MFAH 4HC1H 2XN9B 2VAAA 2VB5A 1A6WL 5ENWB 2BVPA 2HWZH 4JANA 4KJPC 1HHIA 2DIJA 4K7PX 4FXGA 1DQJB 1JHKL 1HI6B 4YBLC 3GZKA 1P1ZA 4ODBD 4XNZC 1N2RA 4JHAL 5DJZA 5F88B 3VXRE 5JHLL 5KSAB 4F57H 4G6FD 1ACZA 3I85A 4FFWD 1UXSA 5DVLA 4M9OA 4PJFB 1A7QL 2BDNH 4ZUVA 2VABA 3NPZB 2HN7B 3MGTA 3SHSA 5FUZH 4KTDH 4HIHA 1U91A 1ZLUK 3TN0C 4J4PA 3V0VB 1NAMA 4TNVK 2D7QA 5HYSB 4M6MH 5HJ3B 3RUGA 3QRGH 4LVNC 4MB4A 5HI3D 1IAIH 2BMKB 4RISL 3QEQA 1A6ZA 3SO3C 2HYMA 4RA0C 4JO3L 5EUOF 2Y5TA 1ROWA 4HJ0D 1V5JA 1CICB 3ROOA 4QRPB 5T5FH 4FFYL 3MREA 4ETQB 4M1DL 5HYEA 2PN5A 8CGTA 4WHCA 1UCBH 2J8UA 4GBXA 5FYKU 3F8UB 4Z0XA 2I25N 1DANT 2ZJSL 3O0RH 1MCRA 3HG1E 4JRXD 4UU9B 3S4SA 3D39E 4KJQD 3MO1A 4WJ5A 5HSFA 5JZ7C 2BDNL 5IBLC 4JDTL 3PV6A 1RFDL 2I07A 1KIQA 1RURL 1TZGL 1D9KC 4ORZC 4Z95L 2ICWJ 3BZFB 1NBYB 1BFTA 3WBDA 2QADD 4UQ3B 3H2WA 1MI5D 3OKOA 2OTWA 1HQRA 3FN0L 3HCVA 1LQSR 4ZUSA 3MA7A 5JQ6L 3QBTB 1IQDB 4PUBL 1MCIA 1ZGLM 3NIGE 1AGDB 4UILL 3VXSD 1Z3GH 3V5DB 4G80B 3G5ZB 2KDGA 4NNYB 4PYGA 1C1EH 1DBKH 5D70H 1G7IA 4M7LL 3WFBL 3TO2B 3R1GH 4P59H 4TUKH 1C5CH 4QHMA 1UKQA 1WVZA 1PG7L 2Y36H 4WDIB 4Z7VF 4DKFH 3TNNB 4WU5A 1JYXA 1JHKH 1CD8A 1NAMH 1JNHA 3V6OE 4HH8A 1T7YA 4P5TA 1RK1B 1HNGA 5LXGL 3IT8D 2Q3AA 4F57L 5JW4N 1TPXB 2DDQH 3HPLA 1OLZA 4OKVB 1BD2B 4TUJA 1FNAA 3VXSE 4JEGB 2R29L 3P30H 3VG9B 3MRBB 3CSPA 2LTQC 4AEHH 5CSZB 4IIQB 7CGTA 1AQDB 5C7XH 2QLVB 1S3KH 3TIDA 3IJYB 2FGWL 3U79A 4QRPD 4UT6L 1PY9A 3SDAD 4P9MH 4FXKA 1EX0A 4PREB 3VXUE 3K1DA 5HHPA 1FO0L 4MDIB 4MAUH 3HUJE 2A6DB 3LEXA 3UJIL 2J8OA 4R0LA 5EDXA 1G0YR 5EU5A 3SGEI 1QKZH 1PYWB 3T08A 2EEDA 4PJ9D 3RFZC 3V9FA 4X9FA 1RU9H 1ZA6A 4ZXBC 5IMKB 1KCUL 3BXNA 3QIBA 3T77B 3GM0A 1YQ2A 5DI8A 3BPNB 5DJAB 2EDHA 2XTJB 4NZUH 2AXHA 3AS2A 2X1PA 5I74B 3DRQB 1IEBA 4H0GA 1CXIA 5E8EB 4OZFB 2A9ML 1UEYA 2DLEA 5IFAL 3LPFA 1B88A 2E6JA 4N0UA 3SJVD 4HJGB 1FZJA 3KNBB 4D0CB 5D93B 3IXAA 2X05A 4I3RH 5KVFH 5FO7B 3KXFD 2EDDA 4J6RH 4PJCA 4UZGA 3H9ZA 4O4YH 3ZKXC 5EC2B 4YDIL 4JCLA 3KWWA 4HUXA 1JWUB 2V2WB 3DXAA 4OZHA 5BW7C 2JCCB 2V9RA 1A6VL 3P73A 1Q9KB 2NY6D 3MROA 5CEZE 5GISH 4HCRA 4P2RE 4A6YB 2R4RH 1A21A 3GK8H 1U41A 4ZNEE 4F7EB 1U8MA 1I1YA 3KXFA 4G8EB 2LU3A 1SYVA 1W8NA 3EYVA 1WAAF 3FT4B 4P5MA 2DQFA 2DI7A 5HHOB 1KJMA 2IH1A 3SKNB 3S9DB 1KFAH 4LHQB 1A3QA 4E42A 1W0WB 1CDYA 5E08L 1U3HB 1OP5K 1RJLB 2H3NA 4M7ZC 2GHWB 4KC3B 2X70A 3Q6GH 3DVFA 1QRNB 2VE6A 4GRLB 3QDMB 5D1QD 1I9JH 5EZJA 4XC1H 2F8OA 2WUBH 3VFGL 3LSOA 3QEHA 3QXAA 4M3KB 1QFUL 3RWGB 2YRZA 3LD8C 3TPUA 1F42A 3HKFA 1YNLH 4CDHA 4KZDL 3ULVE 3MRFA 2JB5H 4QT5B 5EN2B 5DTFB 2F5BL 3RWIA 1QBMH 4OBSA 1RUQH 3CUPB 2MHAA 4IJ3B 1I1FB 4QHKJ 3NCMA 5HYQB 1S7TB 2A83B 3KPOA 3BDYL 1QPPA 1OTUC 4MQ7B 2LU7A 4U49A 4DK6A 5IFJA 5ICXA 3SPVA 3RZCD 3TYGH 3CUPA 4H5SA 2FX7H 5DTFA 1OAYL 5F9JA 3NMEA 3PP3K 2E9IA 3QIWD 3EJYC 4XPFL 3DROB 3O8XC 1FV1A 3AFLA 1PZUB 1D6EA 3F5WB 3V6FB 3RWEA 1T1WA 4RMUA 5DO2D 5E8PB 1Q94B 1QHOA 1HHGA 1XGPB 3G6JF 2DRUA 5C09A 1X5FA 1A6VH 5ERWB 1QR1B 4JM2B 4ZAKB 2ARJA 3BDXA 4ONFH 1MH5A 2GAZA 1CDGA 2DKMA 2NZ9D 4HV8A 4UB0H 3HE6B 5ALBH 1I8KA 4QKXB 1KUMA 5FGCE 1FGNH 5A16A 1A9EB 2CSPA 1DEEB 3KXFB 4G8EA 3SKOB 1S7VB 1JN6A 1C7SA 1KELL 2YPVL 1BBJA 1AIFA 1FG2B 1FYTB 1U92A 3QUZC 3QG6A 3U9PL 5LAXB 4QRTB 3BH9B 2FNBA 5DEFB 2HKHH 2PW2B 1KCRH 2VR4A 4MXQC 5TE4H 4EUPB 3GRWL 3TA3C 5FB8B 3DXAB 5IROA 1I1CA 2X4RA 4LAJH 1NGPH 4JHWL 1YEHL 4J3XA 1I1AB 5DUMH 3SDDC 2V2TA 4YXLL 1EO8H 1PVHA 2BC4A 1OAQH 4XCCL 3JUYA 3B2VL 5FO7A 2HT3D 2YA0A 4U31A 2WUCH 3BJLA 1T20A 2V7HA 3KNBA 3UJJH 4D0CA 5IJKC 2FD6L 2Y5EA 1AXSB 3MV7A 4OD3H 4XX1G 1FLRH 3OAUL 2FH6A 2WBWB 3PGDA 1YEIL 3PXHA 3FB5A 3QDGE 2P5WD 5I1GL 3QNZB 2K7PA 1NCAL 2OYPA 5J9PB 5KVDL 1H15B 4QHLB 3C8HA 1R24B 1MPAH 1T2QL 3ZTNL 3UAJC 1IGFL 1FSKC 3GMPB 3W0WB 5GGTH 1R3HB 1DLFH 1JNNL 1CLCA 3U4AA 5FKAB 5EU6E 2X4TB 5IHUL 1V3LA 4POZC 3H3KA 5AZEL 1LE9B 1FLTX 3GBMH 1JHTA 1Q72H 2V5MA 3J8F7 5FUOH 5DHXB 3VFRB 5EZIH 1E6JL 3EUUA 1NEZG 3T1WA 2HMID 1T1ZA 1CU4H 4N1HB 4Q9RH 1MVFA 2H6PB 3HE7A 3V5HA 4NQCE 5JPNA 2ICWA 3IDGA 1CFVH 2E9BA 4FNLH 3TVMD 2ZSWB 4O02H 4ZO6A 2AJZA 2IGFL 1BGXH 4UQ2B 1R3IL 2DL9A 4Q0XH 4YBQC 2BX5A 3WIFB 4R4ND 1O0VA 4Z18A 1X5YA 2J1KA 5FOBA 3VI4E 3WS3A 5BRZB 1VA9A 3HMXL 5INCB 4HIEB 5D1XC 4XPBL 2ADFH 1BF8A 1A7BA 1BD2A 4WV1C 3PIQA 5SWZD 2JF1A 4PJAE 5E0QA 4QYOA 4EDWL 5ADPL 1C1EL 3OXRA 2AK4A 5C08E 1I8KB 2BFVL 3WDJA 4G6ML 4WDIA 4IS6B 3LD8B 5SX4I 4OGAD 5SWZE 1KCKA 4JZJC 4I3GA 5JO5B 5C09B 4ZNCD 1FVEA 2KUTA 3LN4B 2ENYA 4Z7NF 5INDA 4AEEA 1F2XK 3QIBC 1F13A 1U3HC 5I15L 5TPWL 5KVMC 3QUYA 4GRWE 3AS1A 3FCTB 5DRWB 5FGCB 3ZDXE 4YXHH 4U2ZA 1DQLL 2H32H 2CXGA 1MCCA 2IALA 1HHHB 3L3DA 1LP9E 2GSGA 2VXSH 3GMOB 4X6FB 3EYQD 5I73B 4PJIA 1OF2B 4U4BA 4LPWA 3U46A 4XNMA 3IDNB 4R6UA 1VGEH 2AABL 1Q1JH 4LCIH 5HYSG 1Q9WB 2H2PC 2NY4B 4DN4H 1ZK9A 3MV9A 4YPJA 1N5YL 4N68A 5DHVB 4HT1L 3ES6B 3KPPA 1WFUA 4FQXB 3OSKA 4EOWH 5KG9A 4UU9A 1DBMH 3FB7B 2C1PA 4ZFZA 1IGCL 4R7DA 4GSDH 2ZG1A 3REWB 3JV6B 1LD9B 3IFNL 3AREB 3OQ3B 1FDLL 1HWGB 2HH0L 4OFDA 1XF5B 3UTSB 3K46A 5IR1B 1G9MH 1NANI 1P2CA 1BIIB 2BOCB 4AEIL 3SKNA 3S34H 1KJMB 2IH1B 3NOIA 5CZKA 2ADFL 1C16B 1U91B 3V8OA 5ITBH 5F7LB 3IAQA 3ZYZA 4X7TB 2R2CA 1D5XB 2HAZA 1R5WB 2X2YA 1WQVT 3U30B 4S11A 1UXSB 3G6AA 5HGBB 5ANMB 1OB1A 3H9SB 5KSAA 4ZUWA 5C0JB 1MHCA 1GGIH 5LBSH 3EYOA 3NN8B 1TTGA 3QO1B 2X44D 4PJ5A 3L5XL 4UV7L 2Q7YB 3FO1A 1ZT7A 1IM3B 3N1QC 2DTML 2CH8A 4E5XB 3SGKC 1ZV5A 1B0WA 1J87A 1NC2A 4JFHD 4LBEB 5J1AA 3QUMH 3FQUA 1FFPB 3IDXL 1UADC 4EVNB 3M17B 3QZWA 4G7YL 4Y4KB 1FL5A 4LKXB 1F6AB 1WISA 1MLBA 2BNRB 5KN5B 1MHPL 5CJ5A 3BP6A 5EO1B 3JWDC 5HHMD 5GS1A 1K5NA 5ESVA 1F02I 4PJXA 1CTNA 4DZ8B 4F2MA 3JWOL 3S88H 4NP4L 5D70L 4M3JA 1XIWB 3AC0A 2BVOB 4HXBL 5GRUH 4QNPF 1FORH 3JWDL 3S37X 1NLBL 4CVZB 4ISVA 5B8CC 4JG1H 4DVBA 1JF5A 1RVFH 3FFDB 5DJAA 1WT5A 5CEZD 2BXZA 1RZ8A 5J3HC 3NCJH 3KLAB 4NWUL 5HVHC 2Y06L 3GSNA 4D0BB 3CVIL 3HRPA 3W11D 1JWMA 5HPMA 4I2XB 1MNUL 5E2WH 2XWBA 5EU5B 5JUEH 5F7KC 3QULA 1KB5B 2BRQA 1MVUB 5KS9F 1V7NH 3DSFL 4NC0B 1SJEA 3KPNA 3ILPA 4S1RH 4K8RC 4AIOA 3S35X 4Z76A 3O3AB 4K7PY 3AXLB 3QUMB 4BH8B 5C0IA 1AGCA 4G7VH 5CHNA 3LQMA 4U1SA 4ODWB 3OGCA 4BZ1H 4PGJA 3G08B 5HYIA 4W4OC 1U58B 4PJEB 4PJDA 4PRDA 3TIDB 3H3PH 2IAMB 1OAZH 3DGGA 2EO1A 4F7CA 4GQ9H 2GJZB 1JFQH 5DQJB 5BV7B 5IWLA 3LY6A 5IBTH 2MPAL 3MRDB 5IROC 4U1SB 4H0IA 3E0GA 3SDDA 1D5IL 2IG2L 4XPTH 3T3ME 4WEBH 3VGGA 1NGZB 1A02N 3BKYH 3D2UB 5CJBA 3ILPB 1UZ8B 4UNTA 1DBBH 2HKFL 3C08H 3M8OL 4CMHC 4NT6B 4YHOH 2XWBB 2VDMH 3FJTA 3LKRB 2EKJA 2BHYA 2WW8A 3HZMA 1EXUB 2UWEF 2DJSA 4PRPB 3LH2L 2ZOKA 4C56D 2FB4H 3ZMRA 1CFNA 1DN2A 5IVXF 2DJ4A 1QNZL 4X0KA 1RZ8B 5JXAL 1N4XH 4U6HA 1N8ZB 1EFXD 3DV4B 3BSZL 5H2BA 2F54B 1J0ZA 3TBWA 3FN9A 3WJLC 5HVFB 2JCCF 5C6WH 1F58H 3GSRA 4JFFB 4POUB 4MJ5B 5C07E 3FL7A 5I1AA 5HI5C 1NFDA 4UINH 1JV5B 4OLVL 4OLZH 12E8L 5AD0A 5CWSA 1WBYA 1LHZA 5KANG 4PRID 1GGTA 3QUXC 3QDAA 3G9AB 1MCQA 2Z8SA 4LFHD 3BVNB 2PW1B 3GO1H 4JFYB 3TIEA 3T3PF 1Z9OA 1SYSA 3SDAA 5KN5A 4LQFL 5MEOA 3HC4H 2XG4A 1KTLA 4NQCB 4Y4KA 3E2HC 4E41D 1LWRA 2UY7A 3WYRA 4IRJB 3S4SB 4HH9B 4KI5D 3PQYD 4YUEL 3RVTD 4UUJA 2EDWA 2F53B 4G43B 2VZUA 5DLMH 1CICA 1CN4A 3ROOB 4HF5H 2G5RA 2YC1A 4TPRL 3FMGL 1OAXL 1B0RB 3ARED 4OZIB 1UKSA 3O4LB 1MCSA 3LKQA 4WO4D 1NANH 4PGEB 3S7GA 3CFKB 5FYKL 2AJVL 4OLUH 2EIZB 3OG4B 5E6YA 3QFJD 2CK0H 2HN7A 3MGTB 3F12A 3OKKB 1II4E 3S35H 4JZJA 4PJFA 3RGHA 4S1RL 1PKQE 3VGHA 1NAML 5MI0B 4LSVH 3WFEH 3R06A 4PRAB 2R2HB 2FJFB 2UZYB 4XP5H 1UYWH 3RBSA 5HVHB 2PXYC 2GW5A 3AREA 2HVJB 4JANB 4R90H 1OGAD 2A6KA 2EH8H 1J12A 1TJHL 3OKLA 1HINL 2DL2A 2P49B 2XTJC 2AJ3A 5DS8A 3MUY1 4C55A 1MHEA 2RCSL 4NHUA 5I74C 5EFIA 2Q20A 3B2UC 4XB7A 3LVEA 3T65B 1KCVH 1XAUA 4XC3L 4PGZA 5L2KE 1FL3B 3D85D 3BH8B 3PABB 4LLQA 3S36L 4G6AC 5IQ9A 1D6VL 3GI8H 1L7TL 1K8IA 3VMNA 2BSRB 3OPZH 4MD0A 1CQKA 1P4LA 3FOMA 2IALB 3IS0X 3BIKA 2F19H 3MV9E 2CK2A 2GTWA 4M1CD 4DTGH 3V52L 1T2JA 2AJUH 4JRWA 4LCCB 5T3XE 5JDJA 4OZIE 4WI3A 4Z7UB 4BJLA 3SDCC 4FTVA 4JZNA 2Y36L 2P24A 1RZ7H 3FO0L 2W9DH 5D1QA 3U6RB 3BMVA 3WLBB 1IRAY 4J1UA 3BGFC 35C8L 2IF7A 2VZOA 4QF1B 3PWLA 4RBPH 4C83B 4PRPA 3Q5TA 4OQTH 1MJ7H 3K1KC 1G84A 3QQ3B 2Y25A 3HZMB 5C07B 2I5YH 4M5YH 3WHE1 5IGXH 3LKRA 1BZ7A 3IKCB 3U0PA 5F9WC 3WCYA 5T3XD 2PO6D 1XF2B 1JGUH 1LO5B 4JRYB 1VERA 1YEJH 3KYMB 3L5HA 2J7LA 2AK1H 2FSEA 2R0LL 4NRXA 4ALAH 4M7ZB 1ITBB 4TSBH 1A7OL 2WBJC 1VFBA 3H9SE 5GGVY 1N6QL 5C0RH 4P46A 3HZVB 4N5UA 4R90L 3TH4T 1NSNH 1CBVH 3OKEA 1MRCH 1MJJB 3V95A 3MRDA 4TRPL 1J0KA 4MQSB 5C70A 1F90H 4KUZH 3NCFB 3HZVA 3CSGA 5DRZB 1BHGA 4GXVL 5I9QC 2SEBB 4PS4H 5L2KA 3DJ9A 4OM0L 3MACL 1IAOB 5TFSL 4ODWA 2IPKB 4YC2C 1JHTB 3QPQC 4OIIH 5A2LH 5GS1C 4PRHB 4YXKH 3IB4A 4R9HA 4PD4J 2XA8L 4LCCC 3MSPA 4M9PA 5CILL 5IVXE 1UWEH 5FKAA 4LLWA 4GAYA 3DX7A 5D1ZC 4E0RB 5C0FB 4U1KA 4X98B 4TNVF 2R15A 2Q8AL 1M71B 3QDMD 5D1QB 2PR4L 3RGVC 3SQOL 1DQQB 3GSNB 4D0BA 2ICWI 1W72H 1CFQA 2MSPA 4KH2A 3GJFH 2V17H 4OGXL 2IMMA 4QCIA 1AXSA 3MV7B 5DJYB 1FNSH 4HKBA 4ISVB 4OTXH 5F1KC 3KVQA 4RGND 3RL1A 4CMHB 1T1XA 3ABZA 4S1SL 4BQ9A 4KJQC 4TUKL 4R2GB 1AC6A 5FF6A 5KJRL 1SY6L 3NZHL 3PJSB 5F7EL 2BSRA 5GS3A 4YDKH 2NTSP 5IIEA 4GG8B 4XWGH 3BRGC 1MAKA 4H1LH 3UBXG 3C09C 1JIBA 1ED3A 2VKXA 3O2WL 4JPIA 1FL5B 4LKXA 3F7VA 4JFOA 4PYHA 4IOIB 4AZ8A 4K8RH 5JR1L 3TA3A 4X6CA 1CS6A 1SM3L 4ZS7L 5LWYH 2XPGA 4L3ED 1INEH 2CKBH 4JM2F 4FQXD 3JZ7A 5FYJL 3QQ4A 4XXCA 3MRGB 2VLJA 1JPSL 2VNCA 5I1IH 4UTBH 1MHPH 3MGAA 3G5XA 2KZWA 2XRAH 4HIJB 1IM9D 3RA7L 1TQBB 1ZAGA 5ERWA 3RIFF 1QR1A 1S7QA 3ULVD 2N7BA 5IVNA 1DVFB 4NKDA 2DLGA 5ELIA 2NLJB 3SBWA 4GOSA 1CGXA 3GHEH 5JLZA 3CFKA 1D6EB 3B9DA 2FO4B 2OTUA 4PGEA 4OFKA 2PYEE 2FWOA 4Y89A 3VRLE 3DROA 4BSVA 3REVB 2DS4A 1J86A 3C60D 1T04B 2DOCA 3MBEA 4K2UH 4KTDL 4ZFFA 4HX1A 5E2TH 2X10A 4IRSD 4XWGL 2DWDB 5CAYB 4AEFA 3T0VA 5AAMA 3VFOA 4NBZB 1CK0H 2GT9A 4LSDA 4JFFE 3FB8A 4HUMB 2ITDB 4XTRD 4Y1AE 2FR4B 1YMMA 5FGBC 3SDAC 2AW2A 2XIDA 5F71A 2F54D 4HGMA 1FNSL 4WHTB 1BECA 4HKZB 5D2NE 4PJBA 2GSIB 5TPWH 3TO4D 2V17L 2Q76A 3V52H 2HVKA 4G5ZL 2ZUQC 3VI4F 3OR7A 4ZTPL 3SDXB 2BNQE 2H26A 2ZUYA 4JZOB 2EEAA 1TCRB 5D2NC 3HI5H 3UXFA 1L0YA 3BGFB 5FA4B 4EOWL 1T6VN 4PJIB 5CWSB 4MMXC 3ZKND 2Q8AH 3S97C 4MLSA 4RIRB 3GJEB 4PLJC 3ULVH 3QHFL 3ARDA 1JV5A 4M43H 1KOAA 1CYGA 4ZXBD 5I30H 1Q72L 1QA9B 1HHHA 4N0YH 5GGRB 2BCKB 3ZE2F 2Z92A 5DUBA 4HUVA 5CJOL 3HC0A 4AQ1B 5F7FA 2VRAA 3FRUB 1U8OB 3QFDA 4S10A 1DQLH 5EPMA 1BFOA 4YR6B 3ZDZF 2FIRT 2R1YA 5D2LA 5DSCB 3BI9X 1U8MB 1NSNL 1UXWA 1T3FA 4MB3A 4GKSA 5CUSL 3MRQA 1U95A 4X7CC 4QYOB 1QOKA 3QUYC 5BVJB 4WTXA 1XGTB 3W39A 1BLNA 1CXFA 3GSNL 1A4JB 1XIWC 1NFIB 5MERB 4XZUB 1FRGL 1YNTB 1KG0B 2C3VA 4M1GL 4Y8DC 3DIFA 4HS3B 4ONHB 4ZTPH 3MRIA 2AGJL 1S7XB 1OL0A 1JNLH 4EI6B 3WIFA 3E8UL 4KTYA 5ESQB 2IBBA 2N56A 3UYRH 1CD9B 4I3SL 2VH5L 2X1XR 3MGOB 1U8QB 2DAVA 3ARDC 3K2UH 4LKCA 4WI5A 5D2NB 2NNAB 3ILQD 3IDGB 1EJ6A 2H2SC 1FZJB 4HPYL 3S37H 1MIMH 4N0UB 4P5TD 4F15C 3DWTA 4FP8H 3FAWA 1LEKA 4XMKH 5E8EA 1K8DB 4QTHA 4YUEH 1M7IA 4ZOEA 4GAGL 1FE8H 3WFEL 5B21A 4P23B 2XY2A 4HGKC 2P5ED 3UPRB 4WUUD 4RX4A 4Z5RA 4R26L 1IGMH 4YNYA 2AV1A 2HLAA 2Z0BA 3MR9A 2DLIA 3N1MC 5H35B 1KIPA 1I1AC 1G6VK 1UENA 5E70A 3ET9F 3GRWH 1HHJA 1XIWA 1M7IB 4G6MH 1K8DA 4RWHA 4K23L 5LQBL 3TFKC 2UZIL 2X5PA 3WUWB 4WW2A 1U8PB 2XZCL 4PREA 3VGDA 1ZLSH 2R2EB 4JQXA 3I6LE 4UOJA 5F3HB 4EQ3A 3BD3A 1F2QA 1IBGH 2DLHA 5HHVL 4PB0L 5D93C 1H3UA 1TJHH 2YWZA 5I73C 5EUKA 3KPSE 1IC5H 4IIQA 4Y5XB 3DIFB 1IT9L 1KG0A 2C3VB 2VXTL 9CGTA 3BEVA 1YUHA 3BD5A 1C8PA 4B5EA 3LRHA 2G5BA 4OKVA 1PJ9A 5HGAA 3N9GL 1DZBA 4TVPD 1JL8A 2BP3A 3MRQB 2B1HH 5E6IC 5FK9A 4WU5B 1OTSD 2DTSA 3D85B 1HILB 1T21B 4WFEE 2R8SL 3IJHB 2F5AH 4M7JL 4OF7A 4OCLC 4ONGH 3CFEA 4PR5B 3HE6A 4JDVB 1UH3A 5HDBE 4L5FL 3TT3L 1I7UA 4RGNE 4F15B 4JFZH 5D7KE 5E8PA 1XF5A 1BREA 3ZSSA 1XEDA 1IGTA 5IEKB 4HEPG 4RMVA 4BM7A 3QUZD 3ZT7A 5TQ2H 1UZ6F 3MRHB 3V4UL 3NCYP 3QCVL 5GIRA 3VWKD 1K3ZA 4V1DB 2ATKB 3V7AE 1HIML 4ZODA 3D25B 4LLMB 4FXLA 3B9AA 4JJ5B 4LPYA 5GGSB 1RZFL 1K4CB 1IT9H 2VXTH 3PV6B 4Q6YA 5ID1A 4LNVA 1HHKB 3LS5L 4KPHL 2VDKL 3HC3L 1BM3L 4WIQA 1MREH 3D25A 4JRYD 5C3TA 4U3HA 5DGQA 4W4OA 3EDKA 1EGJA 2OL3L 3OB0K 3R4DA 4MAYD 4POYA 2K1MA 3UTZB 3P40A 5EN2A 3O11A 4HIXH 1TZIB 2YZ8A 2ARJQ 1IZJA 3HE7C 2OTUB 2D4DA 4OCSH 4QY8A 2UVEA 4KHXH 5E8DL 5EU6A 2DQDL 1TFHA 3WN5B 3LZFH 4R97B 4GO6B 4ZUVB 3LQAC 4K3JL 1W0WA 5AZ2H 1MI5B 4POZD 4XCYB 1A2YA 5EZOL 1ZGLB 1EZVY 1T21A 2J5LC 1CZ8H 2HJKA 3MLTB 3V4PL 3MJGX 5D1XA 3HI6L 1AXIB 4I4WB 4U6VL 4FXGB 2V5RA 3IAPA 4GW1B 2VLJB 5I16B 5D7JD 2BNQA 4KDWA 5LGKA 3K2UL 3PQYA 5E5RB 4PRNA 3B9KA 1LE5A 1TQCC 1KT2B 1VB9A 2NY3B 5GS2D 1JZ5A 1UEMA 3GB7A 3KJ4B 4F9PC 4JPIB 4J7RA 5E6ZA 3QUZB 4P9ML 3IYLW 1FDLH 4JFFD 2A9NH 5CZXD 4ZSOB 2R2EA 4OIAA 5MP6L 5MEPA 4PY8I 3V5HB 2R23A 1DBBL 1U8PA 5CIPA 3BGMA 5AYUH 1YC7A 2AERT 2ZUUA 4K7PH 3VFRA 1EEZA 4H25A 1OGAB 5FV2A 4PP1C 1HIMH 1WCBB 4W6WB 3X3FL 1GC1H 1KPVA 1CL7H 5GISL 4OGAC 3EOAA 5IV2A 1I3VA 5DVKA 1XZ0B 4O4YL 5BMFH 2R0ZL 5B38G 3W0WA 2AV1B 2HLAB 4YBHA 4CJ0A 3T8XB 4NZDA 3WJJC 5C0EA 1VSCA 1NC4A 4KK8C 3VXRD 3HFMH 4M1DH 2GITA 5DVMA 2IANB 4PJ8A 4N0RA 3ARFD 5C0FA 2DB8A 4L4VE 5HD8D 2YD2A 4DGIL 3PV7A 2OSLA 1S5IL 3C5SB 3GMRA 4NM4L 1EUUA 3DURA 2NW3A 1IM9B 2BSTB 2Y72A 4R3SA 2MKWA 1N4XL 1KPVB 4FFZH 1GH7A 4MA3A 4QXTB 2VOTA 1ADQH 2R0KL 2LABA 2L7UA 1FZMA 3DYOA 5DMKA 5TDOA 1AR1C 2OZ4A 4IM8A 3MRIB 2EDKA 3L5XH 1JBJA 4ODHL 4UAOC 4FQQB 4FXKB 3T0ED 4IRZH 4X6DB 4TSCL 2A73A 1QFWM 2OX5A 1ONQB 5JA8B 3BH9A 3VCLA 2IQ9L 7FABH 2YN3A 3DX9B 4S1QL 1U95B 4JQVA 3B9KB 3HC4L 2Q8BH 1LE5B 2VC2H 3VXMB 4HWUA 1I8IA 2R1YB 5D2LB 3VGFA 5JOPD 1GL4B 3HB3C 5F9WB 5DD0H 1N5AA 5I1HH 5J0BA 3FQRA 3SQBA 3VI3F 1JF1B 4P4KD 4BQCA 2YPLA 1PKQA 2ZUWA 3BQUD 3MRNA 2QKIA 4PJFE 3BPOC 2CIIB 3VXUB 4DCQB 3TH2T 3HC0B 5IK3A 3VWKB 3VW3H 5HHXH 1Z9LA 4NN6B 5A2IH 5I2IB 4J1UB 1YEDB 4LP5A 2OI9C 3TO2A 1H8OA 5CUSH 1OSPH 5BS0E 4CN1A 4ODVL 2P24B 5F1OB 3RWEB 2AEPL 1RU9L 3ZTJH 4CJ1A 4U1LB 3DV6A 3I9GL 5KW9L 3F5WA 4N0FA 4TVSa 4JFPB 3MQIA 3NZ8B 2AS5M 4XMLL 5HI4D 5FA4A 4P4KA 3HZYB 3MJ8A 2VC2L 3BIKB 4JPWL 2CPCA 5F9JB 2Z31C 4JZOA 4NHCH 3O81A 3MV11 2VH5H 4I3SH 4OSUH 1TVHA 4Q9QH 4P4RB 1FO0H 4GRLD 1KTDB 2D9CA 3D3VD 4QRRA 4F3FB 4Q6IB 1YMMB 3C09B 1IKFH 4PJ7F 1R0AH 1OWRM 1DBJH 3H9SD 1VGKA 3P9WB 4MGXA 4MJIE 2W9EL 2LQRA 2L7JA 3OBAA 2G60H 3NCEB 1LO4L 2MTPA 2JELL 4Z7VE 5E99L 4OIIL 4WJ5B 1OT1A 2NX5B 2RFXA 3MRFB 2N4IA 1T04A 4MS8D 2BVUA 1NFDE 4Z0XB 4NCC1 3FO2A 4YO0B 4C54A 1RURH 1TZGH 2FWOB 3FFCE 5I19L 1YEGH 3BD4A 3IF1A 5EIIB 2B2XH 2FECI 3QXAB 4Q9BA 3EDDA 5FYJH 4GRLA 1J10A 4V2CB 1IGTB 5IEKA 1IC4H 3HR5B 4WWKC 1OSPL 5IQ7H 4YHMH 3W11C 3WNOA 1MCPL 2PR4H 3SQOH 1QSVA 1D6VH 4GS7C 4C56A 5BZDA 4GKZB 4XPGL 4O58H 4KMTH 1ITCA 3TM6A 1SEBB 4AJ0A 1P53A 5JR1H 4M4RA 3FT4A 4D2NA 5IGXL 3EYVB 3RAJH 5I0ZA 1IAMA 3CFEB 3I3BA 4Y2OA 4Z7UF 1OLLA 5E2UH 4RZCB 1KLUB 3QQ4B 4XXDB 5GGVL 2CIKA 3GHEL 1SJHA 3U4EB 3W5MA 3DX8A 3TA3B 4XP9H 2OJZH 3L9RB 3RVWD 1B0RA 4A6YA 3MX0A 5AWNH 2BVPB 4XHQA 3U7AA 1F90L 4KUZL 4JHWH 3H0TB 4XVSL 5KSBA 5KW9H 1ZLUH 1IC4L 3P0VL 3DRTA 3DVGB 2BNUA 3LCYA 4ODVH 3KWWB 3WUWG 2D3VA 3DPBA 4FFVC 4Q2ZB 2AK1L 3Q48A 2FJGA 3O6KH 2ZG3A 4KK6C 1VFMA 4CADB 2QR0B 4KK5D 4O2CA 4ZAKC 3U7WH 5GGVH 5GZNC 4JFDB 1FVDA 1QLFB 1DBJL 3QIUC 4OZFA 3SKUD 1CDCA 4R96A 4N9OB 5C86A 4MJ5A 3RTQC 3F7PC 1EGJL 3BAEL 1EZVX 1JI2A 5I30L 5J6HB 3V6BR 3MACH 4XPGH 4YDKL 5H2BB 1PDKA 4XP6L 3U4BH 1EO5A 4XXCC 4P2RD 1AP2B 4U6HB 4K71C 4CL7A 1I7TB 5MENA 3ZT5A 3BXNB 5TFSH 1A1OB 4GG6F 1CFNB 2NR6D 2NY1C 4LLWB 4KQ4H 3P9MA 1E6OH 4HGWB 3MZGB 4GAJL 3C5ZC 4P2OC 2B2XL 5EO0B 1JJUA 3JWOC 4Q74A 4ZDHB 4KGJA 4PRHA 1ZT1A 3V79C 4P23A 1NMAL 5JHLH 4KRPD 1AGBA 5DD5L 5LWYL 3MLYH 1BAFH 5D9SB 1IAOA 4OD2B 3I6KB 5GSRB 3MV8E 5C07D 3GI8L 4HCRH 5IBUG 3TO4A 4WHYG 1UC6A 3GSWB 2EO9A 2AJYH 4P2RA 3WXVH 4BSWA 1A3RH 1BEYL 5L0QB 3TZVD 4HS8H 4LVHC 2IQAA 5F97E 4L3AA 3OGOE 1RJYB 5CILH 4HS3A 3OAYH 4ONHA 1G6RL 1QD0A 4NRXB 1D5BA 1A1NA 3ZTJG 2FD6H 3UTPE 3OGCB 3AREC 1NFIA 4ODSL 5MERA 3FO9B 4LARL 4RNRA 3QUMA 4HK3J 4BH8A 5DRXA 5F7EH 2GJJA 3JV0A 1KGCE 5C07A 4P5TB 3ARYA 4F7TA 1CGUA 2BY1A 4Z7OE 4UMGA 3I6KA 2ADJB 4RFNB 3QULB 1NCDL 5FCSH 4WEBL 1UA6L 2MKLC 3QDGB 5EH1A 3KJ6H 4F7MA 4JFHE 1RULL 2VLME 1MCOL 1S8DA 3MFFA 3B2VH 4LLDB 1YPZB 4NNXB 3HMXA 2FGZA 3GFUA 3QI9A 3O2DH 4NZTL 5K59E 3HR6A 5FFLA 5CINL 1D5MB 5B4MD 2DYPB 2D7MA 1IQDA 5T1KA 4F9LA 3GSXA 5TE4L 1AQKH 1GSMA 3DMMB 1R0AL 4GG6B 4PFEA 5GRXG 2OLDA 4I13B 1OCWH 4RIRA 1BFSA 1PQZB 2UUDH 5D7LE 3QCTH 1FYTD 4M6NH 4WGWB 2QBWA 2QR0A 4KROC 4O2CB 4YEFA 3RQ3A 3ZE0F 4EQ2A 5TDPB 1FHGA 3MYJA 4I0CC 1BFVL 1EFXA 3N1GC 4WHTA 4ALAL 5TQ0L 5C3LD 4FA8A 5C2BL 4GUPB 5C0RL 5I8OL 3GGWA 3RRQA 1QYGH 5LQBH 2GJ6D 1I3UA 5IUSA 1F4HA 1TVBB 1X4XA 2EDYA 5I75B 1YECL 3QHZH 1KJ2L 5TH2A 3C6LD 3L5WB 4XPHL 1BZ9A 3IFLH 5JNYA 1RD6A 1H3WM 1MAJA 2WBJA 4PRAA 1H3PL 3OX8A 3UC0H 4DK3A 1N59A 3OZ9H 1MAML 1NAMB 2DICA 3OMZA 4WVRA 3D3VE 4E41A 4JPVH 4OZIF 5EOCJ 4N90D 3RI5F 2VQ1A 5K9KB 1Z2KA 5E56A 3F6LA 5CEZL 1BPVA 1MLCB 1JPFA 1CGSH 5BS0B 3IDUA 2ZCKH 1F3DJ 3SJVA 2BSED 3UTSA 3PDOB 3P4OB 4O02L 4JB9L 3U9UA 2M26A 2WBJD 4RQQA 3TH3T 4OCYL 3CFDA 2K3TA 3CDGA 3SE3C 1KCLA 2LTQB 2X9YA 4G43A 1RIVH 4JFEE 5J11B 5DFVD 3NABL 3O6FC 3HAEB 4QRQA 1I1RA 3ES6A 3KPPB 4NM8L 3ARGC 4GJTB 1VENA 4NQCA 4EXPX 4PJHE 3P0GB 1GGUA 3H3PL 5GZOC 4XCEA 4KDTC 1Q9WA 2HFGH 3U2SA 4UT9L 5SWQA 4XNMB 3QCTL 3LH2H 4G8GE 1NCCL 1WBYB 1SEQL 1GAFH 2WM0A 4MMZC 1CTOA 3FB6B 5JXAH 1G9ML 2CRZA 3ZKMC 4YHIB 3D39B 5C0NC 2YD9A 1TENA 4Y16A 3TP4A 2CGRL 3LIZH 5L9DH 25C8L 2VDLH 5DJDA 1CZ8L 4JY4B 4B7LA 4YHOL 1U6AH 2X9XA 1PD6A 4YQXL 3RGVD 2JTDA 4UOW1 2P8MA 3AS0A 1AQKL 1KEML 4JREC 1EXUA 3AY4A 4F7MB 4KHXL 3GMQA 4JY6A 3THMH 1FVEB 1LILA 2Q1EA 1YEDA 5C08D 4UV7H 3WNKA 1MCFA 2X4UA 3L3JB 4ESKA 3NIFF 3O45B 1A3RL 1BEYH 3OWEA 1GOFA 3FFCD 2C1OA 3IFPB 5E2JA 1NGZA 5C2UB 3FQRB 1J1PH 3MRJB 4OF8A 4HDIB 4L9DA 4JY5L 4DQOL 2FB4L 1LMKA 4HFWA 4HF5L 5DQJA 5I76B 3HZKA 4PG2A 5DGRA 2RHEA 2MWCA 3ZE0E 2BJML 3HLAB 4XNYH 2J4WH 3RZCA 2Z93B 3TJEH 2WIIA 2ZPKL 4JRXA 3OKEB 3MXWH 5CHNB 4U6VH 5E00A 2HWZL 3BKYL 3BT2H 4FMKA 5JPNB 4F8TA 3F7RA 3W9DB 4R26H 3BN9C 5J7CC 4FZEH 4X4XA 3ALXA 3EOYG 4OLWH 4WCYH 4MA3B 4QXTA 5EU6D 2FL5A 3F62A 5DFTA 4I48A 3FOLA 3LV3A 3CFCH 1LE9A 2W0FB 2BSTA 4R3SB 2QADC 4NQEA 3VWJA 5C7XL 5F3BB 1CGSL 3JTTA 4NQTA 3RAJL 3RUGF 3AB0C 4B41A 4J3UA 5FCUL 4LHUG 4MXVE 1R3HA 3G04A 3MJ9L 3W9EB 5CMAB 2FX9L 1ZGLP 1H15A 3PWUB 5HGHA 2FX8L 3U6RA 5JORA 2NY2D 4CVZA 4HHAA 4QXUH 2WQ8A 3QJFB 3FONA 1JZ4A 1JTOA 1Y6KR 2F9BT 3LMJL 3WE6B 1A5FH 4W68A 2VMFA 5IEHA 3GMMA 5IHLB 1K5NB 2P45B 5ESVB 1JGLL 1B90A 1T0NA 4X5XB 3UYPA 1T20B 4FQ2L 4NWUH 2R39A 4AH2B 1VFAB 1TCMA 1P4LB 2E8YA 3V5KA 3TO4C 3QZWB 1DSFH 5IQ9B 4LSUH 4EVNA 3SGJC 1A4KA 2EDXA 4NYLB 4A2MA 4ZSOA 4JO3H 3PGCA 1MFDL 1FE8L 4G42A 1FORL 3JWDH 4EUPA 5BQ7A 1P6AB 4P9HC 1KULA 5E5UB 5DEFA 2VN7A 1ZT7B 4P9HH 3S34L 4WI8A 1U92B 4MJ2A 1ZLWH 5JIHA 5KVFL 3EGSA 4JQIH 2UYLB 4APQA 1LO3L 3LB6D 3LS5H 2Y07H 2CIKB 4NFDA 3WFHA 1DEEA 4RZCA 2YBRA 5AAWA 4LFHG 4YHYC 4C4KT 1MCLA 5TJWK 1F3JA 3DX6B 1KN2H 3PP3H 4NKIL 3KGRA 2WAHA 1PX4A 4CN4A 2HRPH 5KSUB 1F3RB 1ZGLA 5BZDB 2HKFH 3C08L 3KPRD 4XCYA 2GIYA 4PJ9B 2WIMA 5DD6A 3DLQR 3V4UH 1XGPA 5HHMB 4K3EL 5IR1A 2A9NL 1VACA 3B9VA 3FT2A 4JKMA 1SBBA 2EYTA 5ID0A 2DKSA 3MOQA 3GRWA 3UDWA 5TE6L 5CJ8A 5A1AA 4R7DB 5E03A 4FG6D 3QEGL 2BRRL 2R9HC 4J6RL 4XX1E 5B39G 2VDQH 1QSFA 2FJHB 3O11B 2APBA 4L8BA 3G5VB 1CVSC 3MV9B 1AHWA 5KAQG 1IGIH 3KPRA 3JVGC 5MHSD 4OZ4B 2G2RA 3UTOA 4UOW0 4KI5F 2GK2A 4PJAF 2HLFC 3KPOB 5JQ6H 4HH9A 4K7PL 3MLWH 5K9JL 1CU4L 4Q9RL 2X4QA 1TVHB 1JPST 1XF4B 4XP1L 1KTLB 4MA1C 4P3DA 1WV7T 1U3JA 1U8LB 5EZIL 1H3VA 4JN1H 2FHBA 4TVPE 4FQ2H 4KK9D 5E99H 6FABL 5IG7A 3M45A 4L4TD 3MOAL 4KXZH 3W82A 1QBLL 1CDHA 4G5ZH 1H0DB 1CDJA 4JQXC 1MFCL 3GKWH 3UTTB 1EEQA 2HT2D 1D7FA 4KKCC 1FO0A 2QHLA 5AG9A 1CLYH 5ISZD 5C09E 3X14B 4DEPB 1P69B 2H3NB 3MV8D 2F54A 2WZPD 1KNOA 2FZ3B 4XPBH 4DGYH 1JMXA 4X5LA 1ZHNA 2FEDC 4IRZL 1OY3B 2BY3A 3LEVL 2QKIB 3FHQA 1YEKL 1AE6H 1IGJB 4RAUB 3PHQB 1KB5L 4U7KA 5ITFB 4XBPA 4ELME 2ZZUT 3VXNB 4YDJA 3UROR 2R1WB 4U1JA 1KEMH 5TF0A 3D3VA 4E41E 3G6DL 4NT6A 1ZA3B 1JVKA 3QO0A 3MXWL 2B0SH 4NKIH 1G7LB 3RNKA 4OZHF 4JCMA 3MROB 3G9VA 2R4SL 3UZEA 5KJRH 5IOPB 2A73B 2CXKA 1R3KB 3PP4L 3EYUL 2ICWB 3O8XA 2W9LA 1G7QA 3QXUA 5C0CB 4OGXH 4A6YH 1T1ZB 3E3QC 2EKSA 5KSAC 4X7FC 3INUL 3SKJH 2AJSL 2VWEE 4XP9L 3IXAB 5DMJB 5IB3A 5F3HA 4K8RL 3VFSB 4PJHB 2D03L 4XMLH 2QL1A 4Z76B 4OV5B 2CMRL 4WWID 2OP4H 5F1NB 2Q86B 4XP5L 3BIAX 1CL7I 4D3CH 3QIWC 1NCWL 2OBGA 2NTFA 2VL5B 1RZIB 4ONFL 4G9FB 1FNFA 5H35A 4NM4H 1W0YT 5L8KB 5FYKE 2G9HB 4FFZL 4E9LA 4ELMB 3CX5J 3WKML 1MWAH 2EDNA 3X3GH 1LDPH 4YX2L 5E4EB 5JW4Q 5T1LB 3CDCA 1PYWA 3L3OB 4FQLH 1NLDH 2VL5A 5JW4R 1HOCA 1WZ1L 3MLUH 3TVMB 3CZFB 2ZCHL 5F1NA 1JHLH 2FX8H 3STBA 3RX8A 2BC4B 5GPRA 4OV5A 5AYUL 3BGMB 4WUUA 4TVPL 1OP9A 1CE6B 3O2WH 1HSBB 3EZJB 5FB8A 5J4MA 4DW2L 3DO7B 3MRMA 4PG2C 2PW2A 3CCHA 3QJHA 5D8JL 3EBAA 4HMEA 1EBPA 4XNQB 4XI5C 4ZO8A 1I9IH 1S7XA 2ARWA 1DUZB 1T5WB 5FO9A 2YK1H 4XZUA 1QQDA 5C6PB 2GTZA 3GM8A 1BLNB 5I16A 5JOEA 4E5XA 2OJEA 3HRZB 4JAMB 1AKJB 4LASL 5I71C 4KHTH 4KJYB 4KAQH 1RK1A 3Q6FA 4NO5B 4XHJC 5L6YH 4PV8B 4WI6A 3QO1A 4PJ5B 4RGNB 3WMSA 1UXWB 5D7IF 4TRPH 4NJ9L 2ZNXA 4ZUWB 3EJJX 5DSCA 4X4YB 4ZAKA 3DOSA 3ZTNH 1J0IA 4LPXA 4YDJB 4MD4B 4HBCL 5ITFA 3S4SG 1JNNH 1EO7A 2E27L 4R4BB 1A6AB 1U8OA 2VXQL 5F1IB 1UWXH 1OAYH 3BPOB 5TF1L 1RZGB 1S7RB 4OLEA 4PJAB 1VEOA 3VXRA 1Z6JT 2X9WA 5DD3L 5FYLH 1KELH 1U0QA 2DQIH 5D5MA 4OF0A 2CKNA 2Z92B 1FCGA 2DIAA 2IADB 5D7JC 2YK1L 5GGRA 2FYYB 5J12C 3GSUB 3EO9L 1U8HA 4LRIA 4PLOB 4N8CH 5D4QA 3GJEA 5FAAA