5C0AE

1e6 tcr in complex with hla-a02 carrying mvw peptide
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
246
structure length
246
Chain Sequence
b'DAGVIQSPRHEVTEMGQQVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSLWEKLAKNIQYFGAGTRLSVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Hotspot autoimmune T cell receptor binding underlies pathogen and insulin peptide cross-reactivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 53
structure length 246
sequence length 246
chains with identical sequence J
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0aE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0aE02
4IIQC 5GZOC 2P5EB 4JPWL 4MD0A 4PV9B 5GS0D 4TTGA 2RJMA 5JORB 1FFOA 1CFSA 2VL5B 4GMTL 4GKNB 1IM9A 1CL7H 2FIKB 1FBIH 2BY0A 3MBED 4LPXA 2R29H 4X9GA 3EYFA 3KYMB 4JY6B 5GRJL 2FJFA 5J13B 1XF3B 3NCMA 2R4SH 4F80A 1W8OA 5C0DA 3RKPA 2ICES 4XMPL 3TN0D 2P47B 1CDBA 2VKXA 1MI5D 2Z35A 5D2NC 3B2VL 1CXKA 5I1EH 4XMLL 4RWHA 3F8UB 3P30L 1I9IH 1N5AA 4XCEB 1U8HA 3KPQB 4YFLF 5I18H 3S36X 1MCJA 3MRNB 5FB8A 1V3JA 3IB4A 3RX8A 3SJVD 1C5BL 1EEUA 4MXVE 5DMIL 4Z18A 4PS4H 1WEJL 4X4MA 5LG1A 2EH7L 4FN0A 1KCSL 2J8UF 3DV6B 2GJ6D 1DQLH 1YNKH 2JTDA 4I18A 4OCMC 2YPLB 1FFQA 5DRZB 2DM2A 1MLBA 3WKNA 1CXHA 2FX9H 2YUZA 3MRGB 5ABDE 3QG6B 3QDHA 5DRWA 4ORGA 4ZUVA 1T83A 2YEZA 1FNSH 3T08A 3VI3F 3GBNH 4GAJL 1M05B 1KCLA 1FL6B 2VDQL 1TPXC 5JW5A 1WAAE 1AC6A 4NNYB 4RRPA 1M71A 5TPWL 3LAFA 4I48A 4OZHB 2D7QA 3S96B 1SBSH 4B0MM 2W65B 1TIUA 1U95B 3DX8A 4TNVK 4A6YB 1MFBH 1KN4H 3AB0B 3O3EB 3GKZA 2ATKA 1K4DA 1QFUH 4G6KL 4RZCB 3RY5A 3F7YB 4GW5A 5JA8B 1NLBL 1XGTB 1FCCA 2GW5A 2QQLH 5CUSL 1ETZA 3JTTB 4PRDA 3PWPD 2OP4L 3IDJB 3C60B 2D9QB 4NBYB 3WFEH 4N9GA 5J13C 1XGRA 1HWHB 5H94B 1Z0MA 5B4MD 1MCFA 2ZUVA 1ZLVK 2AKRA 1J1PL 5F6IB 3OB0H 2NY4B 2BJMH 5JIHA 2OK0L 1I1YA 1J8KA 1BQLL 1G7QB 1JF1A 1T3FA 2RGSA 1WF5A 2ITCB 4FZ8L 5HYQB 2P24B 3S37L 4HC1L 4U0RB 3H9ZA 2W0KA 2R4RL 4JFPB 2FATH 2ICEB 3WE6A 1G9MH 2VUYA 3STZB 5D1XD 1JRHI 3D85D 2OR9H 4PJHA 5DZOA 4M61B 5EU6B 1EFXB 3SDAA 2DQIL 4WEBH 4MJIE 5E8OA 3MQIA 3ECBA 2YXMA 2NTFB 3BUTA 5CWSB 5E2UH 5IVXE 5F7DA 4PJIE 3RPKA 3HRPA 4XPTH 1HYSC 1W72H 3CC5A 5CP7A 4OF0A 2HYMA 4P4RA 3NIDF 5DUMH 3VFTB 3O6LL 3WYRA 3OXSB 5GGQH 1D6EA 3HZYB 3WFCH 1CDUA 4MDIA 2QL1A 4JN1H 2J7LA 5MEQA 3WS3A 3GSOA 5J7CC 4HT1H 3T65A 4LCCB 1W0VB 4R0LA 2R1XB 4QXTA 1INDH 4P46D 4BH8B 3AB0C 1F6FB 3U4BL 1KJMA 1MHCB 5KW9L 4Q9CA 2CR3A 2XWTA 4WFHD 5FA4A 5L2KD 3QDMD 1RZIB 4KFZC 3OHXA 2VZ1A 2QHLA 4JCLA 3TJEL 4L3AA 2VWEE 3LQAC 4ZS7L 3C60C 1ED3B 1RZKL 5IUSA 1HH6B 3IXTB 1CTNA 3HC3L 1PFCA 4YBQD 1UKSA 3SQOH 2G2RA 4IMLA 5CEYB 5F6IC 2NY4C 4YPJA 4YEFA 5MI0B 2IMMA 4NZDA 5FYKU 3QCTH 3OJDB 4XVSH 4KTEH 1X9QA 3LEXA 4TSAL 2G9HA 1QR1B 3KXFD 5L88H 4U0RC 1ZVSB 3G6AB 3P40A 2CDFB 1KB9K 5DURB 1BJMA 4JM4L 2PYFA 4LLAA 5FHAH 3GIZH 4XWGH 2EDYA 1AFVH 5D7SH 5JNYA 1WJ3A 2C9AA 4PJBA 3VFSB 1EDQA 1KG0A 2M2DA 3AAZB 3HB3C 5HGGS 2Y7QA 3UZEA 2CLVA 3MV8A 4JPVH 1KV3A 4Y8AA 3KPSE 1U92B 2FIRT 2EKSA 5BZDB 1NCBL 5KVMC 5I76B 1ITCA 2BNUB 2W0FA 3IGAA 1EMTL 2AI0L 2DJ4A 3IS0X 5T1LB 4TTDD 3QXAB 5I8EB 5DD1H 2Q86B 3JWNC 4JO4H 1G7PA 5EFIB 4HWEL 4I3RH 1JNNL 4LCCC 1GZQA 3ORJA 2ARJQ 2FO4B 5ITBH 4YIQA 3QZWG 3CFBB 3HMXA 2J8HA 4NRXB 4W6WB 2JIXD 3TNMA 4ODXA 4Z7NF 4P9MH 4MVBC 2W0LA 5L8LB 1MI5E 1QHOA 4H20L 3G5XB 1GOGA 1ZHBA 1I9RL 1IC7H 1W72B 1FAIH 2FR4B 4NQDA 4L9LA 1WBXB 4X80L 4HXAH 1HKLL 2CDGA 2PR4H 4G7VH 3WN5A 4JO2L 3TBVB 3D3VE 4LOUD 1M6OA 4QWWC 4EN3D 5C0FA 5EZLB 1O0VA 3AXLA 1KJ3H 1S7VA 3OGCB 5D7KD 3E6HB 4AH2A 3V7AE 1TNNA 3JWDH 4LIQE 5C08E 3M1BA 3S9DB 3LB6D 1XGPA 1ZHKA 4HK0A 1E4KC 4KHXH 1T0PB 2VDLL 4GW4B 5FCSH 1SMAA 3P9MB 3FTGA 3HUJB 1BGXL 4NSKB 4JFQB 5EDXA 3MJ7A 2NY5L 1VB9A 5DR5L 2HG5B 4HIHB 3GRWL 3Q6FA 5SX4H 3O6FA 1G6RB 3DXAE 3PWUB 3BIBX 5DFVC 4JFFB 2E9BA 1I3GL 3I3BA 3TBWB 3R0MA 3MBXL 4F3FA 3N1QC 2F8OA 4P23B 5I1LB 2WNGA 4JVWA 1NCAL 3QUZB 5CD5C 3NFNA 3KPRA 2C1PB 4L4VD 1HSBB 1PX4A 1KFAH 2LU4A 3RJQB 1F2QA 4P5KA 4U7MA 1G9MC 4MXWH 3ZTNL 3RVWD 3G6JB 3TBYB 2D7TL 2BDNH 4YDJA 3O6KH 2YC1A 1D5ZB 3VFRB 1R24B 1UWGL 3BI9X 4R4BB 3VRIA 4IM8A 1DL7L 4JFDB 2X4TB 4LSQH 2EDQA 4XP6L 4GMSL 2VDKH 5I1IH 3S5LA 4Z78A 2IANA 2XPGA 1RZ8B 3W2DH 3UTQA 1ZV5A 3S8WA 4JDVB 1CBVH 1XCTB 2QSCH 3U4EA 1QSFD 4X6CE 4D0BA 3S98A 4EKXA 5GGRA 2E9WA 1IC4H 1KNOB 5IW3A 2W38A 3RBGA 4HIXH 1KT2B 1XGUB 1KJVB 3PP4L 2H9GA 1A9BB 1A4JA 4E0RB 1VFUA 1JNLL 2UZYB 2Y5TA 1CICD 3QJHA 4S2SB 4OLEA 2NZ9D 3FQNA 4GSDH 1U8KB 3TZVA 3JV4A 1H3GA 2OJEB 3OKLB 1F4YL 3UYRL 1JI1A 2ZCKL 5CINL 4FXKB 2DLIA 1NCNA 1ZA6A 1X4XA 2OL3A 3V4UL 2MHAB 2ZSVA 3GMLA 1PZ5B 4P23C 4K23H 4QLRA 4PGBA 3LN5B 1AY1H 3QUZC 4WFHE 5IW1B 1Q9OA 4YR6A 1MCPH 1TDQA 3VXOB 5CEZL 3K2UL 4LL9A 3BP5B 1U6AL 5HY9B 3LKQB 3LCYA 4HH9B 5B39G 4Y5YB 4L4TB 2AJXH 2VERN 3H0TB 3S36L 1EEYB 5E4IA 1FVDA 1MCDA 4FHBD 1HCVA 4HUUA 4PJ8D 3O0RH 3EHBC 4U1SB 3MCKB 5C8JA 2R0KH 5ACMA 3T4AB 3BDXA 1NDMB 4R7NB 4OD2A 1UH2A 1K6QL 1E4XH 3TBSA 4LLUB 4LEOA 4JFZH 5C6PB 3RGVB 4QOKE 1VEPA 3T0VA 3WMSA 1EHXA 3C8KB 2AEIT 2QLVB 5A43C 4BSWB 5B22A 4PJ7A 1NCTA 4XCYA 5IF0A 4ONOA 2XZZA 1KTDA 5CZXC 2V5SA 3TYGH 4TUJB 4HWBA 3QDAA 3TPUA 5I66A 3BD4A 4MJ5A 4XTRC 5AWNL 1JGUH 3D9AH 5SX5K 2VLMD 4G3YH 2AJUL 3D18B 1VEMA 4NO0A 4P2QA 1CU4L 5HYJA 2GAZA 3OKNA 2VLRD 5KVFH 1A6VL 3BMWA 3CH8A 5IMMA 4KUCD 3MLRH 1T0MB 2R0WL 3QEHA 3OZ9L 4TOYL 4P59H 4TULH 1PBYA 1FJ1B 1XCQA 4R8WH 1I7RB 4XBGA 1N6QH 4GAYA 4PGCB 4M1CC 3JWDC 1QO3B 1IAKA 1RZ7L 2ZKHL 3K1KC 3VXMB 3H9YA 4HXBL 4E41A 1YMHA 3BXNB 4DKEH 5K9OA 3UP1A 1ADQA 4ODTL 4KKAD 1YNTB 4Y5YC 4QKXB 5I30H 1X5ZA 4OCSL 5H37G 3CLFH 1M7IA 5D2LE 5C70A 3NVQA 3MOAL 5TE7L 5KSVB 1WT5C 1NMAH 3MJ6A 3RQ3A 1BIIB 3JVGC 4UUJA 5T1DH 3RZWA 5HHQB 4X7FC 4XCNB 5FUOL 4I4WB 4NHUA 3TV3H 5LQBL 1N4XL 4G8EA 4N0FA 5ID1B 1XF5A 4QRRA 3RGVC 3O2DA 4HKZB 1MRDL 4I0KA 5EO9A 2HTLC 3WDHA 4TSBH 3MR9B 4FXGB 1T7WA 3VFUB 1EJOH 1U8OA 3ZHDA 5TH2A 4CW1A 4MS8C 5LCVH 3QRGL 4OLUH 3BPOB 3SE9L 1UZ6E 4M7LL 3MREA 3MTRA 2JJTC 4M1DH 4D9LH 1L4IA 3ARQA 1M7DA 4C59B 3MA9L 1QBLL 5GGSB 1G0XA 5GSVB 5KVDL 2FHBA 4LF3A 4WHYG 2B4CC 3F58H 4DZBB 1CD9B 4G43A 1KEMH 1R5WA 2XIDA 4YO0B 2IQ9H 2I07B 2HFFA 4DQOL 3HC0A 1OTSD 2E9JA 1AXTL 1NKOA 4K71B 1F8TL 1WBYB 5GGVL 1SMOA 2Y25A 2NX5D 3LKRB 2W0PA 1AJ7H 4O2CB 1TFHA 2ZJSL 5IMLA 1GGUA 3CFEA 4NRYA 4G6JH 2ZUWA 5DJ8B 4HCRL 4OD3H 1IAIH 4YDLB 1BFOA 2XNAA 1JWUA 5IW6A 4LHUB 3CD4A 1C5DA 1NPUA 1JPGA 2KQNA 1RUAH 3VRLF 2NTSP 4H1LA 5I74C 5BJTB 1NJ9B 3MGTA 3E8UH 3C5JA 4G9FE 1I8LC 1ZLSL 4KJWC 4OGXL 2YPLD 3UMTA 1FDLL 3DARA 4XBEL 4XPHL 2BC4A 5FHBL 1JHTB 5T3ZH 4RQQB 2XG4A 4CNIA 4JDTH 4YQXL 1K8IA 3BHBB 4I0PA 3FQXA 1CYGA 3ZE2F 2ICCA 4I1NB 4KK5D 3RWEB 3UC0L 2GJJA 3MRCA 3IU4L 3ARVA 4O2EB 3BPOC 1YEFH 5IV2A 5HHNA 3GMNA 4PJFA 1DE4A 4QCIA 5GGUA 5CGTA 3QEUA 2E6QA 2R56H 4PJ9A 2R0LH 2PW1B 1G9EA 4WTZG 1OL0A 4L5FH 4XNYH 4LPTA 5FCUL 5I19H 3C5ZA 1EVTC 3L3IA 2R2HB 3O41A 4ZFOB 3PGCB 3ROLB 1G7MA 4JQXC 4I3GA 3UTPE 4N8VB 4NZJA 3VD5A 3B5HA 2JJSA 4LNRB 2Q76A 3C60D 2M8XA 2VXTH 3FB6A 2LU3A 3HAEA 4YUEL 5HGAA 5I1JL 1KPVA 1KC5L 1WWAX 4UOW0 4I13B 3OJMB 3HC4H 1X5GA 5D9SB 4K71C 2AK1L 5T3XH 2NY4D 5F7NC 1V7NH 4MLIA 3MO1A 5IB1B 5J9PB 4HGKC 5DFWH 4NZRL 4TPRH 5GS0L 4NOFA 4EBQH 1I1AB 3QFJB 3FMGL 3MUGA 4EUPH 1A02N 2G5RA 2X05A 1A21A 1RD6A 1UCBH 2NMSA 2A6JA 4C58B 4UTAH 1JTOA 4C56D 3AS2A 1F11B 3HB3D 2ZCHH 5KVGL 1UQSB 3BGMB 1D5IL 2GFBB 1MUJB 1RZGA 4BSJA 1A6WH 1E6JH 4OLVH 3E3QE 2PW2A 3TM6A 1RV6X 1ROWA 3R4DA 4Y1AA 4QRQB 2E7BA 2YRZA 4HLJA 4RBPH 4WUUD 2XWJA 4GKSA 3OB0K 5TGBB 2XTJB 2ICWB 1BEYL 1OAQH 4X4XA 4NN6B 4LLVA 1LP9E 3UBXA 4B7LA 5IR1A 1NDGA 1JTPA 2HWZH 1WIOA 4HV8A 1J8HB 3IAQA 2MCPL 1D9KA 1S7TB 4TSCL 4FFZL 2DM7A 3ULUE 4HJGA 5DEZA 3HI6L 2X9XA 4PJ7F 2X4QA 5LGHH 1KIQA 3ARBB 3WIHH 3TLRA 2AJ3A 1A8JH 1N6VA 3REVB 1FVCB 3VD9A 2DF3A 3SHSA 4YHIA 4MJ4A 4MVBD 3T1FB 1JZ4A 5KAQG 1YMME 1ZT1A 1EHAA 5BRZA 2FSEB 3U0WL 4PJEE 5IBTL 5D7IA 1UXSB 3P11H 1QRNB 4OT1H 3BPCA 4HS3B 5HHOB 5IQ9B 5E5MB 2YD9A 1FORH 2ZG1A 3SCMC 5E1AB 3MJ8A 2ZG3A 3Q2CA 3QIUB 3QXDA 4NCDA 4XHJC 1OP9A 1DUZB 4CADB 1LGVA 2JJWA 4QWWD 1N7ML 3LKPB 3BUYA 3DI3B 4JB9H 4CL7A 5B3JF 2Y5TB 4UIKH 3BQUB 4QHKJ 4JY4A 3OKEB 2DQDL 4HQQL 3S88H 4HEPG 3BZEA 4PV8B 3X13B 1I1AC 4M5ZH 3IXAA 1FN4A 1IILE 3V6OC 3T2OA 2ADJB 4LCYB 4NRZA 4JZNA 4OLYL 3P9WB 5DJCA 4FQXB 4IMKA 4KHTL 3TA3D 1EHLL 5TE4L 4WV1B 2GSIB 2OSLA 2D0HA 1XF4A 3VFVB 4RRPG 5JR1L 4X7TB 2EC9U 1NKRA 5AG9A 3QH3A 4RFNB 1CDHA 2CRIA 5DFVD 4A2MA 4CKVX 1JZ2A 4XNMA 3DO7A 3INUH 3WJJC 1UWEH 2XTJC 3ARGB 3X3GH 1WICA 3CX2A 5ESVB 4NN6C 1G9NL 2KQMA 3VXRA 4ZFFB 4EUPB 2LU7A 2QADB 4Z7WA 3RHWF 4UTBH 5TDNB 5IJKA 2A9NH 3C09B 5JW4R 2EIBA 2XA8L 1MVUA 3ARBC 3G6DH 3KS0J 1YYLH 2EZ0C 5A2KH 1C1EH 2X1OA 3UEZA 2CIKA 4FQCL 5SWSB 3BT2H 3F6LA 1AGEB 3MV01 4UQ3B 1E28A 2BVOB 3MJ9A 1NEZB 1CFQA 1N8ZB 2YK1H 3QIUC 3S3SA 1R3HA 5ECJE 3P0GB 5BO1L 1NBQA 4OZ4A 1BFTA 5E00B 5ETUA 1W0WA 3MV7B 3RPIA 4ERSH 5L6YL 3QISA 5IHUH 3UZQA 5EUKB 2DQUH 1JNJA 3O8XA 2FEDD 5EU4A 4FQJL 1Z9SA 2BRRH 4D9RD 5SWZE 1K3IA 1TVHA 4HDIB 3LH2L 1OAKH 3EO9H 4FQXC 4NQTA 3L3GA 4LCUB 3P4NB 2F53D 4K7FA 2R69L 5FKPA 4WV1C 5DRNA 4JFOB 2AJYL 3NCEB 2EYRA 3THMH 4NO2A 2VDNL 3JTSB 4OCWL 3OSKA 5JXAL 1YJDL 2CDEB 4RFNC 3A6BH 3BMVA 5IB5A 4PG2A 3ME0A 4M48H 3IETB 1NGXA 4O2FA 3QHFH 2F54A 2HN7B 1AKJB 5AG8A 2GEEA 2NY3B 4P23D 2QQNH 5JDSA 4ZUSA 1U2CA 2WW8A 3ARGC 1EEZA 3QUZD 1VFOA 4KI1A 2VZOA 4X7EC 2QKIB 4PRAA 1JUFA 1KELL 4J3SA 5DYOB 3OPZL 1DN0A 3GK8H 4ZFGH 2WWKO 3C09C 1WSST 3CVHH 4YEEA 1GHFH 1UYWH 1MCOL 3DX9B 3VCLB 4YHMH 3FN0L 1JZ3A 4WFFD 3B9VA 3EYOB 2CKBH 1ZSDA 1WLHA 2F15A 4WGWB 4EIZC 1NFKA 1T5XA 2EEAA 4RCAA 4HZLB 4PR5A 4KVCH 4X7SL 2VH5L 5JMOC 2DDQL 1RI8A 2BVUA 1CFVH 5HPMB 3EHBD 2Z92A 4PJFF 2P5WB 4J3WA 1EO8H 5EO9B 4YE4L 2FYYB 3L3HB 3FO0L 6CGTA 4KI5C 1I8IB 5JUEH 4UV4H 5I1AB 1JZ7A 4FG6C 2OZ4A 5MERB 1QACA 1DZBA 1V8HA 4C56E 1M4KA 2VJXA 2XRAH 1LK3L 1SVZA 2WK2A 4EDXB 3PABB 3O9WA 4WEUD 2DL2A 4JPKH 5MEPA 2O93L 5IHZB 4NM8L 3EJZC 5CZXD 1J88A 5FYJD 4AMKL 2VXUL 3HNVL 3DV4B 3RGHA 4MA7L 4I77H 4XTRD 3D2UA 3DHMA 4M7KL 2DAVA 1C12B 2CIIA 1GGTA 1KJ2H 2I9TB 4H26A 1BZ9A 5E2JA 3MACH 4NKQB 3CCHB 2H45A 3DTXA 3H9SA 4FQLH 12E8L 3D69A 1MWAH 4M1CD 2H1PL 3U7WL 4MNQD 3Q6GL 3HPJA 5B38G 3LS5H 4P2OB 3HE7A 5LBSL 1OVZA 4YPGB 3NIGE 2YPKA 4TYUA 3M17A 2X4UA 5C0NC 1NSNH 3BZ4A 1XR9A 3EO1B 5EZIH 1TJHH 4ZMAT 5HGBA 1FGVH 5DJ0A 4XB8A 2N1KA 4M6OL 4OZFA 3GSVB 4KMLB 5DZNA 5FKAA 1BQHB 4PB0H 2C7UB 3VE0A 4IRJB 3MRPA 3ULVH 3FB7A 3PIQB 1CE6B 3WV0A 2VAAA 2AK4E 3L3OB 5C6WH 5I1CH 5EO1A 4LBEA 2QSVA 1N59A 3U36A 4JGMA 1P4BH 1WQVT 4ONFH 1IGMH 1DBML 4XPGH 3OMZA 3ULVF 5HDBE 5TDPA 4HPYH 3MRIB 4YDVA 3TVMB 32C2B 3P0YH 4IDLA 3RGVD 4K55A 1BJ8A 4JO3L 1WTGT 3PV6B 5ILTH 3DGCR 3CVHB 2HTLD 5K59E 4OCXH 5D7IF 3Q5YA 1S3KH 5I16B 5DJYA 5HVWA 1IGTB 5DK0B 2CKBB 4JFHD 3QBTB 1NC2B 3IJSA 2DQTH 4PJ5D 3QEQD 3TF7C 4H8WL 4XI5C 1CIUA 4YHPB 1WC7B 5EO0B 3V5HB 2W9DL 4JKMA 3DI2B 2VLJB 2V5YA 2VOTA 2VL4A 4WTXA 4LAQH 1MHEB 5GGVY 1DLHA 2Z31A 1DR9A 1MQKL 2ORBH 3OF6D 4M62H 3GSWA 4J3UA 4L3CB 5EB9A 1CIDA 4ZOCA 2QHRH 3OAUL 3OKOA 3GFUA 4NKOA 4QXGL 1LEGB 2PETA 1EGJL 5JHDA 1A7RL 1C08A 4LSUH 4Y19D 1J5OH 1J9CT 3JWOH 2PUQT 3UPRB 1FYTE 3ALWA 2PYED 4NC0B 1B3JA 1K2DB 3LKSA 1ZA3A 3IFPB 4U7KA 1KLGB 1YNLH 3S5LG 4ETYA 4P2OC 5BOPA 1NGPH 2X4OB 1CF8H 4HS8H 3F12A 4YAQA 4XC3H 1HHGA 4FZEL 1YDPA 3E2HB 4NT6B 4ZXBA 3T0BA 5KG9A 1PKOA 2IH3B 3F7PC 1WFUA 3RWJA 2E8YA 5IBUB 5IK3B 1KJ2B 5EOTB 1O5DT 4Z7WF 5IFAH 1DTUA 4I0CC 1JV5A 5C09B 1N5YH 2UVEA 1DBBL 5E6YA 4AEFA 2VITB 1QA9B 5IHLB 5LXGH 4KJWD 4D9RE 1MWAB 1AR2A 4LVOB 1GGCH 2O61B 2FBOJ 4OJFH 3W11D 3TVMC 1PVHA 3KPLA 1AD9B 5FDWB 4YXHL 4M3JA 3A67L 4HWZA 3HI1A 4FNLL 2FH8A 2E7CA 4W70A 3MLTA 1G7JB 1PLGL 3HZKA 4U6XA 2X89A 2J1KA 3O3BA 1J18A 1P4IH 1HEZB 4R97B 5EIIB 4TVPL 2OQJB 2HJLA 2P8MA 4NKMB 2E7MA 1BF8A 3BVNA 1U58B 4G8GA 3CFIC 3SKJH 1GGIH 1RU9L 4J4PD 3V5DB 1NAKH 2D4DA 2GUOA 1KPUB 2AJSH 4AEEA 1XF1A 3SKMB 5KSUB 2UWEE 3WJLA 3D0VA 2DQFB 2L7UA 2GJZA 3BPCB 2JB6B 4OGAC 1B0RB 2VDRL 3AY4A 5CP3A 1ND0B 5F21B 1YEGL 1A5FH 4D8PA 5IMOB 4CU6A 3BSZL 4GG8B 1BBDH 1B90A 1IGCH 4TQEH 1Z2KA 1DDHB 4I2XB 1GGBL 1JPTH 3UBXI 5J6GB 1LP9A 1BLNA 4HC1A 4JEGB 4BFEA 2HMIC 4AG4H 1TXKA 1XGYL 3R06B 1A3LL 4O5LL 3FQWB 3T2QA 5CJOL 2ATPA 1I3UA 3CPLA 1CXIA 3OKKA 3MLUL 1ZT4A 5HYSB 3NPZB 3KNBA 3E2HC 4URTB 3KPNA 4WHYH 2LAGB 1XF4B 3JUZA 2I5YL 4MX7A 1HDMA 4LHUD 3JSSA 2HKFH 3DX7A 1CGWA 4PY7A 5HJ3A 3MNWA 4W4OC 4NQCE 1ZGLA 3K3QA 4FQ2H 1ONQB 1AXSA 3PG2A 4PJGB 4Z9KB 4AENA 1B4RA 4LVOC 4MQSB 3PWJB 1GPOH 1FIGH 1GIGH 3V0VB 2BSRA 2BNRB 2YD7A 5GRVK 3GDBA 3PWLB 5E5RB 1HE7A 3KYAA 1AQDA 4H0GA 2Q3ZA 2X4RA 2KPNA 4Q6IA 2Z93A 1LEKA 3MLWL 4AJ0A 1HCFX 4ZO9A 3UTZB 4X9IA 3OKYA 1H3PH 1CE1H 1OGTA 3M8OL 5HI3C 4BH7A 1I7ZA 3ULVC 4KKBC 5C07E 2K3TA 5K9QI 2Q8BH 3IFNL 5KJRH 1KIPA 3ES6B 1YA5A 4XP1H 5CAYB 4MNQE 2NYYC 3C5SB 4B50A 2OTWA 3LDBB 3KYNB 1TTFA 1CFTB 2FD6L 3V6FA 3MRJA 2X10A 3O2WL 2ZOKB 1U8PB 1I4FB 5EUOB 2HRPH 3BKCL 1IGFH 1AD0B 1TZGL 3TFKC 5H35A 4V2BA 2J6EL 4LSSH 3SCMD 4Z77B 4XHJD 1CFBA 5J1SC 2AQ1A 1Z9MA 2IWGA 4GLRI 4ODHL 1FHGA 2XN9E 1T2QH 2Z91B 1BECA 4DGIH 4CU8A 5ICZA 1ZKAA 3G5VA 1I1AD 3QFJD 4YGAB 3DMMA 1T1XA 4PRBA 4BZ2L 3MSPA 1F58L 3PWNA 1KBGH 1VFAB 3QQ4B 1Q0YH 1YEKL 3QUXA 1I75A 3DLQR 5HHXH 2AEPL 3NCYS 2BOBA 3WLBB 4H88L 1ZXQA 1R5IA 4ZOBA 5T5FH 1XGQB 4HF5H 1OGAB 2Z8VC 1TETH 3LEYH 4MD5A 3W5NA 3N85L 4XPBL 5D1QB 3BIKA 5KOVC 1OM3H 3QUYB 4POZD 4S1SL 4NQEB 2VE6A 1MNUL 4H5SA 3U7YH 2XTJD 2C3VB 5K33A 5FYLD 2EDWA 1Q1JL 4Q2ZB 1PDKA 3FOMA 5AD0A 5A2FA 4P9HH 1J8HD 2XFXA 2JELL 5E99L 4Y19E 3ARBD 3ARPA 1QSEB 4HW6A 5D7LA 2DLHA 4HUKB 2R23A 3O4LE 3LDBC 3RVTC 3CFCL 4K9EH 1UGNA 1VFBB 4YDIL 1ZWIA 2XZCH 3HG1E 2CRYA 3WD5H 5I8KL 4NPYA 5J4MA 1FLRH 1HNGA 1X4YA 1UWXH 1XMWA 2HKHH 1EZVX 5HHOD 1SQ2N 1X5HA 4RBPK 3QUKB 4LCWA 3VGBA 5I1HL 1DSFH 3ZTJG 5I1KL 3NCYP 4QY8B 4KU1A 5EC1A 4X6DF 5GHWL 4H25B 3QIUD 5DJXA 4H1LG 3QFDA 3P73A 4CU7A 3SGDI 5GS3A 1U93A 1MFDH 4EEEA 1KXTB 5FYKH 5GJSH 1S7RB 3NACL 4A6YL 1CDIA 2A6IA 3EGSB 4XVUC 1FFNA 2VQ1B 4LKXA 3ARDD 3VD7A 3FOLB 2B2XL 4JFEB 5D5ME 4PRID 3GRWA 1MPAL 4JM2F 3V79C 4V1DD 2VLLB 3GSXA 4UILH 4FQXD 1YQVH 3H42L 4OFKA 2P8LB 3LQAL 4JZJB 4Y89A 4HLZG 1U8QB 3MRKB 3BEVA 3NAAH 1Q8MA 1U8NB 1Y6MR 1QFOA 5EZOL 3WLWC 4PFEA 4AT6B 2IBZX 1PY9A 3ZHLA 2V2TA 3IDUA 5JPMB 1SEQL 3PGFL 3QUYC 4QF1A 5T3XD 4J8RB 4MGXA 1A6UH 3QO0A 1FFRA 4MQXD 5DVNA 4PTUB 5DDHB 5DEFA 4RA3A 4RSVA 1T21A 4HIEA 1CL7L 1IM3B 1FBIL 3BP6B 2FWOB 5GSRA 2B39A 2R29L 3RWDA 3HAEG 4IEFB 6FABH 4QHKI 4R6UA 3EYQD 2DMBA 2OP4H 4Z7QF 3I9GH 4GW1B 1A64A 2R4SL 2WLYA 4M93B 2Q7YB 3QDJB 4Z95H 2BSTB 3DVNB 3DNKA 5I1EL 2EEBA 3V6ZA 1KN2H 3VJ6B 1P7QD 3RHWK 3FONA 3GSQA 2UYLA 4K94H 1I9IL 4EDWH 1EVUA 5I18L 4KI5D 4APQD 1Y6KR 2E9IA 3BW9A 3MRQB 4NYLA 4FG6D 3KPMA 2J4WH 4PS4L 3UCRA 2CRZA 4NGHH 5C9JB 5JQ6H 1BZ7A 4LFHG 5EBWA 1NAMH 2X4NB 1DQLL 1YNKL 2X9YA 2ZUQB 3WXWH 2CJUH 3PQYE 3EJZD 2AGJH 3DIFA 4HIIB 3STBA 2HJFB 4X6DB 3NOIA 2BSSB 5E7BA 2FX9L 5JIKA 1XF2A 1XEDA 3DVFA 1P5VA 3V7AG 4JZJC 1FNSL 3UBXG 2Y06H 3GBNL 4DOHB 4G6FB 3UZVB 4HUVB 3PDDA 4OF3A 1IGJA 4WW1B 3FT4A 1UACH 1T7ZA 4NQXA 2YD1A 2RR3A 1SBSL 1ZS8B 2NY0B 4JM2B 3ZDZE 5C0RH 1MFBL 1KN4L 2GTZA 2DKUA 2V2WA 4QT5B 5CBEA 2OS7A 2ZSWA 2L7JA 3LRSB 5FK9B 4OUUB 3QT2A 3ZKXB 1QFUL 3PGDB 5KW9H 1OWWA 2BNQD 4U1LB 2QQLL 2H8PA 3V4VH 1X4ZA 3W9EB 3VXUB 3QNXA 3UTTA 4OLWH 3IU3B 1XH3B 5D6DC 5C0ND 3WFEL 2RAMA 4Y4FB 5DC0A 3DYOA 2IAMB 2MQ0A 4YGVA 2EDLA 1CXFA 1EO5A 3QXTA 4M93C 3G5YB 4RIRA 4JHBA 4G80B 5T5NG 2BJML 5DK2B 1FZOB 3TBTB 2JCCE 5KANI 3LZFH 4G42B 4ZO6A 3BKYH 4MLSA 3QXWA 2BVYA 5ANMB 1B4JH 1G0DA 8FABA 5K9QG 1CD1A 2FATL 3IDNA 1G9ML 4ZUUA 4P9HC 3RIAF 2OR9L 1I1FB 2ENYA 2P45B 5I8CB 2UY7A 3KWWA 4AM0B 4WEBL 4JM4H 4WI4A 3ZE1E 4IRZH 2ZUQC 2FJHB 3HKFA 2X4SB 4UDUA 5E9DD 5E2UL 1LO5B 1JGEA 3GMQA 4XT1C 5CKAA 2XKNB 4K9EC 4F9LA 4XPTL 1V7MH 3TIDA 1W72L 1WZMA 4F2MA 1TVBB 5DUML 1RUPH 4PJAE 4CVZB 5GGQL 3WFCL 3BRGC 3GMMA 4JN1L 2VQUA 3KPOB 3MPCA 3ARRA 3P3YA 4HT1L 4OFPA 2DIJA 4Z5RA 4YHNB 2NY0C 4M43H 1INDL 4ZUTA 3L5JA 1Q9KB 1WZ1H 1NAMB 3M07A 1FGNL 3KJ4B 1MCKA 4Z7UA 4KJPC 5ESQA 3VFOA 1HYRC 1LMKA 2HFTA 2I9LA 2RIKA 3PL6D 3RDTB 3ZKXC 5ISZD 4JRWA 1FFPA 4PLJC 4P2OD 4RAVA 4WO4D 1HI6A 1IAOB 4RAHA 3GM8A 5C0CA 3FRPA 1I9RH 2IPKB 4Y4FC 5IB4A 1AO7A 2QQKH 2IAMC 4P4KB 1G6RL 3SDXE 4ETQA 1X5AA 4OLZH 3SQOL 2EO9A 5I1GL 1OOAA 3IDIA 4PRPB 2GTWA 3MLXH 3HLAB 3CFKA 4OKVA 3QCTL 3U2SB 4XVSL 4KTEL 2IEPA 3MGOB 4C57C 3IVKB 2FEEL 1FZMA 4U1KB 1YEDB 5EU5B 5L88L 1NBZB 2OMNA 4WGVB 1ZGLM 3ZSSA 4KRPD 5FHAL 4XWGL 1NCDH 3RA7H 1DUYB 1AFVL 5D7SL 4BQ6A 3QHTC 1HHIA 5FM5M 1DQDH 4WI2A 4U1NB 4ZFZA 2OJZH 2D31B 4WWKA 5DJDA 5KTEH 1J0IA 4JPVL 2NY6B 4UZGA 5KSBB 3OJ2C 2EDDA 1UADC 5FOBB 1K4CB 3TCLA 4QRPE 1FPTH 4PJDF 1YEIH 2W92A 2WINB 1WK0A 4QNPE 2VLJD 3K4ZA 4K94C 5ICYB 5MENB 4Z76B 3Q3GA 4OGAD 5DD1L 3TO2B 4JRYA 3OG6B 4JO4L 4I3RL 5J11B 2VYRE 5ITBL 3UTSB 1NFDA 1FNEA 4KTYA 2UUDH 1AGCB 3EOTH 5DD0H 1BM3H 1GJIA 5FYJL 1BVLB 3KJ4C 4OZGE 4HCRA 4P9ML 4XPFH 3FL7A 3BRFA 4N8CH 3RDTC 2FECL 1QLRA 1ZOXA 4JG1H 4LLDA 4JRXB 4M8VA 5DQ9B 3C2SA 3VXTB 3FQRA 1IC7L 4RGOH 1FAIL 3VWKA 1ZE3C 2RB8A 1U8LA 1IC1A 1S7XB 4HXAL 5C0BB 5DD3H 5BQ7A 2PR4L 4PRHE 4GMSH 2A6KA 5AZEH 4OCLC 4P4KC 4WRLA 4Y5VA 3CJJA 1R5VB 4M5YL 4UQ2B 4EI6A 1OARH 3N1MC 3C9NB 3DWTA 1KJ3L 5D8JH 5DD6B 3GHEH 4LHQB 3JWDL 1OPGH 1BWMA 4C83B 2JJUA 2EDXA 3WNOA 2QR0A 2AVGA 4KHXL 4J12A 5BS0B 5CEXB 1IQDB 1SYVB 4N0UE 4QTHB 5INDA 2YOCA 1BQUA 4HMCA 5GJTH 4OV5A 3ARFA 2PN5A 2BMKA 3FQUB 2NY6C 2ZCKH 2D4FA 3FRUB 5HI3D 3STLB 2KBGA 4KKBD 1C7TA 4DGVH 3TO4D 4YHOH 3C6LA 3T0DA 4MNHB 4GJTB 3B4NA 5B38B 2NYYD 1HQ4A 1KFAL 3CVIH 1F5WA 3JV5A 1H3VA 4MA8H 3S34H 4MXWL 4N9OB 4HWUA 5J11C 2BDNL 2P49B 3TFKD 4OZFG 3TYFB 3O6KL 1OB1A 4WFEE 2APXA 4PJDB 4TVPE 4LRIC 4XBPB 1UVQA 2EDNA 4QTIH 4YNYA 3D39E 3QXUA 4NC1E 2R2BA 4FXLA 3SDYH 2FL5B 4N1EA 3MBEA 3EFFB 4LSQL 1ITBB 2VDKL 5I1IL 3KYOA 2A83A 4Y16D 4NO3A 3W2DL 4WU5A 5AEAA 1FL3A 3UJTH 2EC8A 1QUNA 2QSCL 5JIPA 5IGXH 3WIFB 1TCRB 2KDGA 4JCMA 5ENWB 1OW0C 1UEYA 3TN0A 3NCJH 3T3PF 4MWFA 2YHGA 2AJZA 4S1RL 1IC4L 4OI7A 4OFYD 4HIXL 5E94B 3GSNH 3IDMA 3F5WB 2AABH 3OR6A 1IL1B 1RVFL 3DPBA 3AM8C 2BNRD 4GSDL 4L8DB 4BQCA 3CXDH 3DETC 2GJ6A 3EO0B 4LKCA 3MMEA 3W0WB 1XIWB 3HTLX 1R3KA 1HXMB 3GMOA 5KANG 3LIZH 1A1MA 1A6VH 4JFXB 5E8NA 1U3HB 1INEH 5DQJA 2VLKE 1I7TA 4K23L 5TQ0H 3T2NH 1FC1A 4ODBD 1AY1L 4TOYH 5HI4C 4IRSD 5ISZE 2XY1A 3SDCB 4L3EB 1MCPL 5F89B 3RVTD 3SDDA 1CFNB 3SE8H 4HUXB 1WV7T 1TENA 1II4E 3BW9B 2ZP0T 3QIBB 1KTRL 4PTTA 1MELA 1QQDB 4HBQA 5FYJU 4Z7VE 1V5JA 2AJXL 3GUTA 1DVFB 4NWTH 2IPTH 3NFSH 1B9ZA 1UT9A 3FB5B 4HKBA 3SE3C 3I6KB 5C1MB 3O0RL 2RFXB 2R0KL 4OAWB 1BWWA 3PWPA 2V9QA 4OI9A 2OTPA 4XVUD 5DJAB 1F4XH 4XNQB 1RK1A 5KS9E 5JLZA 1VACA 1E4XL 3W39A 3RNKB 1QFWH 4JFZL 4FQQB 1WAAF 1A3RH 2G75A 4DCQA 3MV9B 2Z9TA 1DQJA 4HH8A 3W5MA 2BRQA 2CO7B 2AV1A 2D2OA 2DLTA 3QPXL 1F6AA 3D25B 4PREA 3WLWD 3TYGL 4KROB 2Y1VA 4XX1G 1VADB 2ILLA 1S7WB 2COQA 3D9AL 2EECA 4WHTB 4FTVB 4G3YL 3QUYD 2FH6A 4ZYKB 2VABA 1A1NB 1MH5B 4KTDH 5FV2A 1Q94B 3JV0A 2P5EE 3PQYA 1OCWH 5KVFL 1NGYA 1XIWC 4LLQA 4OSUH 5C0AE 3MLRL 4UIMA 1X7QB 3AREB 4P59L 5D70H 1U3HC 5J6HB 4KC3B 5AUMB 4TULL 4DGYH 2IFFH 4R8WL 4RA0C 1N6QL 1ORSB 2J2ZA 1HQRB 1TTGA 2EDFA 5K9KB 3GSNB 5DA4A 4NJ9H 3SDCC 3VXSB 2VZTA 3FO2A 1EEQA 3WEXB 1K5NA 4DKEL 2A73A 1J05A 1A4KB 5EU7C 4DQOH 3QIBC 3D1MC 4P46A 1VKXA 1N0XH 5IEHA 1P5UA 5I30L 4DKDC 3AS3A 3CLFL 1DVFC 4DKAA 3QNYA 3O2VH 1NC4D 1PKQE 5L2KA 3QDMA 5IVXF 1NMAL 4LSRH 1RHFA 4YFEA 4PJIF 4JFYB 4Q74A 2APWA 3MRRB 2VR5A 5T1DL 5C9KA 4M6MH 2GSGA 3MLPA 1MAJA 2FRGP 3BO8B 2V9TA 3EUUA 1VGEL 2ESVE 5LAXA 4H0HB 3TV3L 3TZVC 4ZFOL 4R96A 3ILQC 3QXVA 1RFDH 2WP3O 4JFED 2ITDA 3UO1H 5JZ7C 2Z4QA 2YD6A 4Q58C 1EIBA 4TSBL 2JCCA 3IFOB 3SPVA 1L6ZA 1U2HA 1KXQE 1H5BB 2EICA 4NUJB 1UWXK 1EJOL 1HSAB 5LCVL 2EXWC 2YD4A 3K2MC 2FHCA 4OLUL 1AGFA 1INQB 1YPZF 5GGTH 3NFPB 4E42A 1U8IA 4M1DL 3G08B 4D9LL 4R4NC 1GAFH 3L3KA 1LE9B 4S1QH 4P5TD 3MRHB 4HUWA 2KZWA 3F58L 4UB0H 3QIWA 4KMQA 2NW2A 1KEML 3AREC 4U1IA 1CLYL 1HINH 3OR7B 3FO9A 1XR8A 2V2XB 3OKMA 3ISWA 2OYPA 3BEWB 2IQ9L 3FT3B 5DI8A 2C3GA 2FB4H 1RURH 2K9UA 1OSPH 3VI4F 2Q6WA 3GSRA 1NBYB 4YUEH 5ACZA 4JDZA 3O45A 5GRVL 1OWRM 3L5HA 4KJYB 1AJ7L 5FGBC 4KRLB 5FYLL 1LDPH 4JKLA 1UM6H 2VISA 4OD3L 1IAIL 2XOTA 4JG0H 5GIRB 3D5OF 5E6IB 4G9DA 1RUAL 5DS8A 2IALA 5GS0H 2DBJA 2C26A 5F7EH 4PYGA 5JTWA 3VWJB 1XZ0B 1FV1B 3W82A 4KXZH 1UJ3B 5D1ZB 3CH1A 1DJSA 2L4OA 5T3ZL 5CCKH 4MJIB 4X9BA 1J87A 3V2AR 5J57B 3TP4A 4EN3A 4JDTL 1Y18A 4QRSA 5A1AA 3IF1B 5IVXB 2SEBB 4PJIB 4NN7B 1H5BC 4DEPB 2J8UE 1KIRB 2F5BH 4G6FD 4Q97A 2IH1B 3RZCA 3CDGA 3QWOB 1FG2A 3BYTA 4DAGH 4X98B 1ZT7A 3BDBA 4MJ6B 2EDRA 3RWFA 5CSZA 5IIEA 1HHHB 2R56L 4ZPVA 4M1GH 2R0LL 4FFZH 1S9YA 3NZ8A 2FJGB 2VMFA 2R1YB 4PP2A 3UXFA 1DEEB 4XNYL 3VI3E 4KJPD 5I19L 5IEKB 1AP2B 2AXFB 2YMXH 1IAMA 1A6ZB 3DVGA 4PLJD 3KGRA 5E08H 4K3JH 1YPZB 3L7EB 4QRPA 4JLRB 3VXUD 5CBAB 1BJ1J 2NNAB 4Y4FD 2IAMD 3AU1A 1MIMH 4GG6A 1OD7A 1IKNA 2XICA 5CKGA 1KOAA 1RSFA 3HC4L 4C55A 3ZMRA 2H41A 5T3XL 5IVZA 3LV3B 3VGGA 1V7NL 2CXGA 5DJZB 2AV7B 4TPRL 4EBQL 4UAOB 5IJVA 1PQZB 1U3JA 4NNPH 4NDMA 4HGMA 25C8H 1UCBL 1QBBA 2DWEB 3WFDH 2V9RA 1N2RB 4UTAL 1UJ3C 4WI7A 3SE4C 2ZCHL 4L29B 1NGZB 1JPSH 2MWCA 1EHLH 3RWIA 3FQTB 1A6WL 1E6JL 1Q9WB 3X11B 1QSFA 3IKCB 5JOFA 1E4WH 1P4LA 1JTTA 1D5XB 1YN6A 3KPSB 2H6PA 4NN7C 4DEPC 3JV6B 1OAQL 3EDDA 1EGJA 5C2UB 5I17A 5I0DA 5F88A 4G8FB 2HWZL 3WFHA 3ZKNC 3B6SB 5CIPA 5KZCB 5FO9B 5L2JB 4D0CA 5LGHL 4IDJH 2BVEA 3WIHL 1QRKA 2QBWA 1A7PL 3NIDE 1P9MA 2CLZA 1LO2H 3QDGE 3L95B 2V7NB 3RDTD 3FFCE 2IMNA 3F7VA 3T0EA 3V9FA 4X4YB 4IOIA 4OT1L 3WS6A 1C16B 1FORL 1MI5B 4UDTB 1WIPA 3P4MA 4U6YB 3L3JA 5CHNB 5DJ6B 5F9JB 1HN1A 1MFNA 4L4JA 4P4KD 1PYWA 2GQHA 1AC0A 3WO4B 2IADA 3F7QA 4JB9L 3TNNA 3SJVB 4PRPD 3PNWA 4TUOA 4UIKL 3BESR 3D3VB 3S88L 4LEXH 3CFDA 1R3JB 3MNZB 4M5ZL 4B53A 4UAOC 4IOFC 5DHVH 3KPPA 3ZDXF 4DVBA 4QRUA 1JWSB 1OF2A 2M1KA 3BAEH 5C08B 4F7MB 3S7GA 4KMTH 2C3XA 4JJ5A 2I60H 1MRFH 3ULSB 4CMMA 1HHKB 1KCRL 1LEIA 4ZSOA 4CBPA 1MHHA 4WWID 2BCKB 4PUBH 3EIFA 3QCVH 4NCC1 2D03H 1YJDH 4M7ZB 4R26H 4OI8A 3DXAB 3INUL 4JN2B 3X12A 1UWEL 3HZVB 1S9XA 3X3GL 4QHMA 4U05A 3V7MA 5MEND 4U6HA 4P2RA 2A2QT 1D5BB 2W9EH 4HS6B 4WW2A 3MRFB 3MUZ1 5EBMA 2DLGA 4UTBL 2P46B 2A9NL 1IGYB 1T5WB 1D3CA 1RULH 3EYSH 3G6DL 5JOPD 4IIQA 1YYLL 4I5BA 3ZE0E 2VLRA 1C1EL 3FN0H 1SJHA 4LAJH 5H2BB 3REWB 4F58L 5HHME 3KLSA 1MHPH 1LNUB 3BT2L 4JRXD 3KDMA 4JFDE 1ZLWH 4X7SH 4IS6B 5BZWB 2VH5H 5C7XH 4J7RA 5L9DH 2VLKA 1CI5A 3ARSA 3X14A 5BXFA 2VN4A 1JN6A 2YK1L 2IBZY 4YE4H 2LVEA 1BD2E 1DQQA 3RUGE 4XAKD 4MDJA 4AEHH 4Z7NE 3B9KB 4YHKH 4ERSL 5IHUL 1H0DA 5D2NA 4OZIF 5D1XB 3D85B 1HWGB 3BH9A 5F1NB 2DQUL 1ORQB 4X6CB 4MNGA 4Y2DB 3K4DA 2BRRL 1MCNA 1F3RB 1OAKL 3EO9L 5BS0D 1MJ7H 4UIMB 5DFTA 5HSFA 4NQSA 2FCBA 3BDYH 3DETD 2DM3A 2PTTB 2X70B 3HS0B 1Q0XH 3P4LA 3B2UD 4QRTB 4XP4H 3THML 2I25N 4FQIH 3MROB 1F6LL 3A6BL 2J8OA 3VXNB 3AC0A 1BREA 4L8BA 1AIFB 2L0DA 2DQCH 2ZUYA 1SYSB 4M48L 4U1GB 3QHFL 2R8SH 3QWRD 1W8NA 4M7ZC 3GSUA 4J1UB 2QQNL 3RWGB 4JAMB 1KF9B 3SBWC 1TQBB 4QHNB 1NFIA 2J6EA 4XRCA 4NQDD 5DHVB 4RISH 4OIIH 4ZFGL 3GK8L 3L7FA 4HFUH 4JGJA 4LLWB 1NEUA 4AEIH 2JK5B 3CVHL 3FRPG 3VDAA 4G7YH 1GHFL 3LVEA 1UYWL 3DECA 4GRWH 4D2NA 4DZ8A 4YHML 2DD8H 4X4ME 5IMKA 2GY7B 2CKBL 2P5EA 4YBLB 4PV9A 4KVCL 5JORA 4KY1L 2VL5A 3HRZB 4GKNA 4GRWF 2FIKA 5DJ2B 1CFVL 5B4MC 5M95B 3KYMA 1EO8L 4FA8A 4P3CH 3U46B 4L8SB 2VZUA 4JY6A 3Q1SH 2X5PA 4MAYB 5JUEL 4UV4L 2HVKB 4MA3B 1OSZB 1T0NB 1XF3A 2IQAB 2ZPKH 3KXFB 1WCBB 3B9KC 2XRAL 1UZ6F 5FM5O 3LPFA 1KUMA 1RUMH 5CZVH 2DN7A 1UA6L 4QOKB 5D1XC 1UM5H 5IWLC 4JPKL 4BKLB 4XCEA 3KPQA 4Y2DC 3X3FH 4KZDH 3MRMB 3MRNA 4NOBA 1T20B 1N64H 4MB4A 3PF2A 1VSCA 1PD6A 4I77L 2K7QA 3GNMH 3RTQB 4XP5H 4JVPA 4ONHB 4YWGL 3DV6A 2GHWB 3W0WD 4OZIB 2YPLA 5DRZA 1XIWD 3QP3A 1KJ2L 1WFNA 4FMFA 4OF6A 3MACL 4S1DD 4X6BB 2YWYA 5D72H 1T89C 3MRGA 4U1GC 1OP3H 1U3HD 4FQLL 3QG6A 4F37F 4HKXB 2MTPA 1MWAL 3DJ9A 1TQBC 1M05A 3FB8B 4LSTH 1FL6A 4OTXH 3VXME 3SDCD 5JW4N 1EGJH 2JIXB 3LS5L 4NNYA 1A7RH 3QEGH 2Z0BA 2ED8A 3QIBD 5KOMC 1JYNA 4J6RH 4OZHA 1Y0LB 2GIYA 3S96A 1NGWB 2W65A 1U95A 4A6YA 2F74B 5DD5H 5I0ZA 2Y6SD 1NSNL 5EZIL 1TJHL 2ZNXA 1FGVL 4LPWA 1DVFD 3RBSA 3O3EA 4YBLC 4O4YH 3VD3A 4IJ3B 4PB0L 2YD3A 1E27B 4RZCA 3ULVL 3F7YA 1XGTA 2HFEB 3KYKH 4OQ1A 4S11A 5I1CL 5D2LB 3JTTA 1UJTA 2MNUA 1UC6A 1GZPB 4L8SC 3IDJA 3C60A 5HGDB 4ONFL 1H3XA 4MAYC 1IGML 1JI2A 2VXVH 5H94A 3TZVD 1BBJA 1QEWB 4HPYL 3ILQD 1MJ8H 4KZEH 2C4FT 1CS6A 3P0YL 4PB9H 3MV9D 5JZ7D 1A3QA 2CSPA 5ILTL 3EOAB 1CGTA 3S4SB 4OCXL 4E9LA 4HG4J 1YY8B 4GRWB 1S3KL 1FH5H 4LASH 1G7QA 4P5MB 4CGTA 2ITCA 4OIAA 2H32H 2V5RA 2DLEA 5HYQA 2P24A 4PG9B 2EXWD 2DQTL 3Q5TA 3PP3H 4JFPA 2ICEA 4GH7B 2XWBB 3STZA 3RTQC 1NUNB 4M61A 5EU6A 4X6FB 1EFXA 1S8DB 4R4ND 1KYOK 4X5XB 3PJSB 5KVEH 4KUZH 2NTFA 4LAQL 1UM4H 2DJSA 1HZHH 5CWSA 3D48R 2NLJB 2ORBL 4FABH 1QLEL 1T22B 5BCAA 4L4VB 3RX5A 4M62L 1Z9OA 4M4RA 1HHJB 1RJYB 1V3MA 3ARED 5JOPE 2QHRL 3VFTA 1H15B 3BSZH 4LSUL 3OXSA 3HZYA 3JWOL 2G60H 1ZEAH 2FZ3B 1YNLL 5IJVB 4HAGA 3RY4A 3RI5F 3ZKQD 1NGPL 4F9PC 2E6JA 1CF8L 2H3NB 4LCCA 1CLZH 1W0VA 2APTA 2R1XA 4HS8L 5J1AB 1MQ8A 1NMBH 4HGWB 2X1WL 4BH8A 4XC3L 3CXHJ 3HNSH 4PJBE 1MHCA 5HI5C 3QR2A 3CNKA 5IFAL 4IJ3C 1RZIA 1FRGH 3MV8E 1N5YL 4OM0H 2R15A 5C0GB 5GGRY 5DSCB 2P4AB 5F70A 3VFMB 1X44A 2WQRA 3MCG1 5LXGL 4UINH 2WZPD 1ED3A 1IEBB 1YECH 2XXCB 1HH6A 3ULUH 4FOMA 3IXTA 4G9FB 1GGCL 4OJFL 4NO0D 4KUCF 3PWVB 1LVEA 5CEYA 4KVNH 1CICB 2AEWA 1FVEB 3ULUF 1G7LB 1P4IL 3OJDA 5A2JH 3UDWC 1EBPA 5DUBB 3QQ9C 1IZKA 4GKZB 4JKWA 2B7DT 1QR1A 3SKJL 1E4KA 1GGIL 1ZVSA 3G6AA 2CDFA 4NM4H 4K3GA 2AJSL 4IBLT 4PJEF 4E41D 3VFSA 1GGYA 3AAZA 4GUPB 4ZTPH 3EZ8A 4F33B 3C87A 3TGXA 2J5LB 3VXPB 1ODAA 1A5FL 3DRTB 1U92A 4J3XA 3IDGB 5BZDA 4F7EB 1BBDL 1IGCL 3PNWB 3RRQA 3EJYC 5I76A 4TQEL 4BJLA 2NZIA 2BNUA 2H32B 1JPTL 5JMRA 5T1LA 2R2EB 5IROC 3EKCA 4AG4L 5IHBA 3QXAA 3C6SB 5I8EA 2Q86A 2H2SC 5IBLC 2JE8A 2ZG2A 5EFIA 5HPOA 3BWUC 4H0IA 4P2CG 5I73B 4PJ8B 2FO4A 1MCCA 1QP1A 3CFBA 7FABH 3VFWB 3UAJD 2A74B 4NRXA 2KH2B 5FGCE 5J3HC 2HKFL 4JQIH 3O3UN 4WTWA 3FO1B 5I71B 2X42A 3E0GA 3G5XA 1NANI 1MFCH 1W72A 2FR4A 4FQ2L 4PLNC 1WBXA 1JGVH 1U91B 4H88H 2C4FU 3DRQB 3KPRE 3TBVA 4MJID 1GPOL 1GIGL 4ELKB 5EZLA 3VRLE 2A38A 1CICC 1ZGLP 3OGCA 2NZ9C 3E6HA 3MRLB 3CUPB 3LN4B 2D7PA 4ZG1A 4O58H 3OXRB 4PP1C 1H3PL 3GB7B 3HCVB 1CE1L 1RIHH 3ZKND 5JW3H 2Q8BL 4GW4A 2OBGA 3JBG7 3P9MA 5KJRL 3HUJA 4NSKA 4XP1L 4JFQA 2IANE 4XPAH 2HG5A 5T3ZE 4HIHA 1RIUH 3NN8B 4HIJB 3ILPB 1G6RA 2J5LC 3PWUA 3NZHH 4JFFA 3TBWA 3LPGA 5HHPB 2HRPL 3OV6A 1IGFL 1QRNE 4P23A 5EBLB 5I1LA 1YMMB 4LSSL 1RK0B 3DSNA 3QUZA 1KB5H 4PJEB 2C1PA 2DTMH 4WUKL 3CSBA 1HSBA 3BKJH 3U82B 4E5XB 2GK2A 1Z5LB 1VGKB 3RP1A 3GGWB 3TC9A 2YN3A 1T2QL 3G6JA 3TBYA 4DGIL 5I73C 4PJ8C 3QULB 1MREH 5DMYA 1CTOA 3NACH 4I0PD 1D5ZA 3VFRA 3MRBB 4HSQA 4KJQC 1OP5H 1R24A 4R4BA 4YHZH 1J0KA 2H26B 1KBGL 4PYHA 1Q0YL 5HHXL 4ENEC 5I71C 3QI9B 4JFDA 2X4TA 4OZHF 5EA0H 5CLWA 4RMUA 3MLVH 3QUMH 5T5FL 4HF5L 1RZ8A 3LQAH 4N1CA 1TETL 3LEYL 3WJLC 4PJ9D 4JDVA 1XCTA 5L0QB 2HTKC 3QO1B 3U6RB 3AMLA 3I02B 1OM3L 4NFDA 3I50L 4OLXH 3E3QC 3U7YL 1KNOA 3KPSD 4OFVA 1KT2A 1LQSR 1XGUA 4NIKB 1KJVA 1A9BA 4E0RA 5CD3B 4P9HL 1I8KB 3D0LB 4OKDA 4S2SA 5KZCD 1A6TB 2F8VA 1U8KA 5FO7B 1WITA 2OJEA 3OKLA 1FSKC 5HD8C 4KK8C 3DROB 3BJLA 3SQBA 3ULUC 5JO5B 1VCAA 4FXKA 4K9EL 3WHXB 3WFZA 5JXEC 2XZCL 4GOSA 1UCTA 3WD5L 1UH4A 1FLRL 5FUCE 2MHAA 4WI8A 3T3ME 1FNFA 2DJUA 1UXWB 1PZ5A 2HKHL 3FFDB 4WJ5B 2NX5B 4OCYH 4FFYH 1DSFL 4KKAC 3LN5A 4PJ7E 3OB8A 3VH8G 5IW1A 4YHLH 1RJLB 1MFDL 3QG7H 3VXOA 4NQVB 5AAMA 5FYKL 5GJSL 4LU5H 3BFOA 3MV7E 1S7SB 4JKPH 3BP5A 2BY2A 2E5EA 5HY9A 3LKQA 3D3VD 4HH9A 4Y5YA 1N3NB 2HVJB 2UZIH 5EPMB 4L4TA 2DKSA 1CD0A 4TN9A 4P2QE 3AVEA 3H0TA 3DUSB 5HYJE 1EEYA 2VSDA 5FDYA 4UILL 1WT5A 1YQVL 4NZTH 2CUIA 5C08D 3JVGA 3EYVB 3QI9C 4U1SA 3MCKA 5SWZB 3NAAL 5B3JE 3U9PH 4WNQB 1CK0H 4QHUB 5FIEA 3T4AA 1D9KD 1NDMA 4R7NA 4BFIB 1KB5B 5LGJB 4LLUA 4YC2B 4NZUH 1C5CH 4N0YH 5L0QC 3RGVA 4E41E 3C8KA 1A6UL 3DXAD 4BSWA 3H7BB 2C3HA 3NIGF 5DO2C 5BRZD 4JQVC 2P8PB 4TUJA 4GXUN 1ES0B 4MJ2A 5EULV 2JJTA 3U48A 5EC2B 4PGEB 6FABL 3D18A 35C8H 5F7WC 3QUMB 4LPVA 3DUUB 3UROR 3I9GL 5TFSL 3HR6A 3R8QA 1CDYA 5EIQA 1BBJB 5HDBF 3I84A 2D7OA 1OTSC 4Z95L 1T0MA 4QRRE 2YKLH 3DMMC 2P5WE 5E2VH 1KN2L 1FJ1A 1L6XA 4K94L 3TWCH 4EDWL 1I7RA 3PHQB 4PGCA 5AZ2H 1QO3A 4PD4J 3VXMA 2J4WL 1WBZB 2I26N 3BXNA 1EBAA 3B9KD 4NGHL 4ZAKB 3BZDA 4F7TB 5JQ6L 5BVPL 5I9QB 1YNTA 1NAML 3WXWL 2CJUL 5E56A 4YDKH 4C56B 2AGJL 1YC7A 4Y2DD 1V3KA 4JHAH 4RNRB 5KSVA 1CGXA 1XT5A 1BIIA 2VDPH 1I8LA 1UFUA 5TE6H 1ZLWK 2Y06L 3RU8H 5HHQA 4WUUB 4EI5B 4XCNA 1EAPB 3MXWL 4I4WA 4KK5C 3KHOA 4YC2C 5ID1A 5JW4M 3IS1X 1UACL 2UVFA 5IB3B 2WBWB 4HKZA 1G0YR 1DQMH 5GZNC 5C0RL 2YPVH 1G7HB 3IAPA 4FS0A 1K8DB 3MR9A 4FXGA 4HFWB 2VDMH 3JXAA 4NBZB 3PXHA 3VFUA 1L0YA 4J23A 5K93A 1FGNH 5JIIA 3V4VL 1CL7I 3N1FC 1MY7A 4OF5A 4OLWL 3WHE1 5MHSE 4R7DB 1ZHLB 4Q9RH 2CXKA 1N26A 5GGSA 5GSVA 4YFLI 1LK2B 4NHCH 2FDBP 4JQXA 5HYFA 1G6RH 4DZBA 3S97C 3H9HA 3LZFL 2FGZA 5I1GH 3HUJF 1DP0A 3DX6B 1X3DA 4YO0A 3N50A 2WUBH 3BKYL 4MAYD 2I07A 2AK4B 1B4JL 1IQWH 2ED7A 1WBYA 4JGUA 5DMKB 1JNHB 4ZAKC 2EIZB 3CU1A 3LKRA 4O2CA 2DWDB 5I9QC 4ODWB 4IRZL 4PJFE 4QOKD 4AIZB 1AGDB 3TA3B 4R9HA 4HK3N 5DJ8A 4LHUA 3RX7A 4J3TA 1D6VH 4PY8I 1WUNT 1V7ML 4IHOB 1KGCE 5BJTA 1NJ9A 1T4KB 3RTQD 3G6JF 3BP4B 4QHLB 1JFQH 1RUPL 4EI5C 1T1YB 4MQ7B 1JHTA 4RQQA 4NNXB 3MNVB 4X99B 5HXMA 1IGIH 4M43L 3BHBA 1WZ1L 1ZLUH 2F19H 3RWEA 4GXVH 3SGKC 1AHWB 3S3JA 2W07A 3DGGB 43CAB 3LS4H 4O2EA 5FYJH 4MD4B 2ZWLT 1FYTB 2Y36H 2ZOLB 3NABH 3KHQA 2W60B 3G04B 1S9WB 2PW1A 2QQKL 1BVKB 2YWZA 5HI5D 4JPIB 4F37K 4OLZL 4ZFOA 1H3UA 2R2HA 3PGCA 1S7UB 3ROLA 5C09E 3LQZB 3MLXL 2DKMA 4N8VA 4M5YH 4Y1AE 1IKFL 4LNRA 4X8JB 1OP3K 3MLZH 3TH4T 3OTTA 3D2UD 3CK0H 3MX0A 2XQYK 4GRLB 5D9SA 1REIA 1NCDL 4RFOL 3RA7L 1NUDA 4TNWF 3ARXA 3AS0A 1DQDL 5IB1A 5J9PA 2OJZL 5F3HB 2F53B 3TA3C 3GIVB 5KTEL 3QQ9D 3L6FB 1I1AA 3QFJA 3H9SD 4KPHH 5EU3B 5F3BB 3V6OA 4EQ3A 1F90H 3NCBB 2C4XA 5ERWB 4P57B 5ALCH 1FPTL 5BRZE 1YEIL 1F11A 5D7IE 3H6JA 5F97E 1UQSA 3BGMA 4MSWB 3EDFA 2GFBA 1MUJA 2UWEB 4N68A 5CMAB 3ESUF 5IVOA 4QRQA 1QFHA 1IE5A 4NO5B 5F8QC 3WJJA 5TGBA 2EYSB 3EJYD 2LABA 2X7LB 3UJIH 1R3LB 3EOTL 2ICWA 5DD0L 1BM3L 1AHWC 2WBKA 4XPFL 4N8CL 3QNZB 2W9LA 2EO1A 4JG1L 1EJ6A 4LVNB 2LVCA 1J8HA 2H2SD 4K8RC 4RGOL 1CZ8H 1S7TA 3PP3K 3PUCA 5IBLD 1MCWW 3Q5OA 5DD3L 3ARBA 5K9JH 5AZEL 3REVA 4XZUB 1FVCA 2PKDA 5J3HD 4WVRA 3T1FA 1OARL 4P49A 5A3IC 2FSEA 5D8JL 4UNVA 1QKZH 2B4CH 3GHEL 5BVJB 1JJUA 1UXSA 1QRNA 5IQ9A 4HS3A 5HHOA 4O00A 5E5MA 3RI5K 3WIIH 1OPGL 5E1AA 4L9DA 3OKDB 4Y2OA 3ALXA 4S1RH 3QIUA 3B9DA 4G9FD 1DUZA 1I85C 4CADA 4NQCB 1MAKA 4X7DC 43C9B 5BOZG 3KLAB 2FEDC 4GRLC 3LKPA 3VXRE 4Z7WE 2Z31D 3RVVC 3B9EA 1RVFH 3BQUA 3OKEA 5GJTL 2LAAA 4M6NH 1JMXA 5EOQH 4JY5H 4PV8A 3X13A 1OAUH 4PP1D 2ADJA 4GKOA 3WUWB 2P1YA 4LCYA 3HPLB 1TITA 4FQXA 2BOCB 5I2IB 4DGVL 1KENH 4YHOL 3BYYA 4WV1A 2GSIA 5AAWA 3VFVA 1IVLA 4RMTA 4X7TA 5C07B 1A7BA 3ARTA 3CVIL 5DQDH 1U0QA 4MNQB 1DFBH 4MA8L 1Z0NA 1ZMYA 3S34L 4NKDB 2YUXA 5E4EB 2EDTA 1HNFA 2ADFH 3ARGA 3UTPD 4EOWL 5FEBA 1T2XA 2VB5A 2YSSB 5F72S 1EHNA 1I1CA 3CX5K 4QTIL 5ESVA 4M9PA 3SDYL 4ZFFA 4EUPA 2D3VA 4LVNC 5D5MF 3F6IA 2PNDA 5TDNA 3WNNA 3BOVA 5ESAB 3FT2B 3BGFB 3UJTL 2XN9B 4F7CB 4KJQD 1AI1H 4L8CB 5IGXL 3L5WB 4G6AC 1PG7H 4ENED 5SWSA 2EH8H 1AGEA 3NCJL 4UQ3A 2F54E 4ODUB 4Q9QH 2BVOA 3GSNL 1NEZA 1N8ZA 3B5GA 3MFFB 2AABL 3QPXH 2HTKD 1PEWA 4P3DB 3CGTA 5E00A 4PJ5B 3MCLH 3MV7A 3QEQB 3GJFH 3CXDL 5CSBA 4ZDHB 2GCYB 5EUKA 3WIHA 3H3PH 2CKNA 1IEAB 5TDOB 1FZJB 3TEUA 3LIZL 4HDIA 5FF6B 3NA9H 2Y72A 1INEL 4LCUA 3P4NA 5TQ0L 3T2NL 1YUHB 2CD0A 2XZAH 5IG7B 5HD8D 4KK8D 4BQ9A 4JFOA 4QXUH 3ULUD 1DCLA 3SE8L 4Y19B 3JTSA 1CDJA 5JXED 2NXYB 2CDEA 3MRDB 2PYEB 3FAXA 3O4LB 4U1HB 3U0TB 5E4EC 3IETA 2HN7A 2PO6B 1AKJA 1KLFA 3HG1B 1YMMD 4MCYB 3MC0A 4NWTL 2IPTL 3NFSL 2QKIA 4TRPH 2VR4A 1TZHB 5DYOA 5IQ7H 3BPLB 5ITFB 5KN5B 1KLUB 4M3KB 3VCLA 3BGFC 3DX9A 5I74B 1CGSH 1F4XL 5DC4B 3UX9B 2X4PB 1RZJH 3EYOA 1QFWL 4HBCL 1A3RL 4HZLA 3RNQB 1VGEH 2PXYB 1A6AB 5DZLA 2XYCA 3V8CA 5HPMA 3QI9D 3MLYH 2P5WA 4M03A 4UU9B 5D5MB 3V0WH 1JCKA 1WTLA 3P4OB 1JPFB 1MCEA 2FYYA 3L3HA 1KULA 3H9SE 1IJ9A 2YRLA 1RJZB 3GBLA 1I8IA 4F7PB 5I1AA 4HKJB 3MZTA 4NJAH 4GXUM 2BK8A 4I9WE 3DURB 5MERA 1ZLVH 4GRMB 4KTDL 4EDXA 3PABA 5DO2D 4ZQKB 5I8OH 1HOCB 3NCFB 1OCWL 4AK1A 5IHZA 5ADPH 3LSOB 2GT9B 1TZIB 4Z0XB 4OSUL 1RIVH 1OP5K 3VMNA 3DV4A 5KSAB 5D70L 4YX2H 3QJFB 1RJCA 4DGYL 2IFFL 2QSTA 1A47A 3QCUH 2BHZA 3H9HB 1C12A 1CLYH 3ARUA 4OFDA 4NJ9L 3BX7C 2I9TA 2NXYC 4X5WB 3TJHC 3CCHA 3DMMD 3EYUL 4XNXL 3GJFB 4CVXB 1N0XL 2I24N 2PO6C 4FQHB 2VXQH 3HN3A 3E6FA 3QUXD 4YZFF 1UZ8B 3P77B 3O2VL 5FYLH 4L1HA 3JZ7A 4TUKH 4KDWA 1HIMH 5F7HA 5C0JB 1X5JA 4P2OA 4LSRL 3BPLC 4N8PA 4YPGA 2CO6B 4GBXB 4M6ML 4LPCA 3HNTH 2CRMA 3SKNB 3EO1A 1QBMH 1JGDB 2YS4A 1E4XI 1FL5B 4KDTC 3GSVA 1RFDL 5C0IB 4X6DE 3UO1L 1BQHA 2C7UA 5ICXB 4IRJA 3L5IA 3PIQA 1CE6A 2PXYC 3W11C 1L7TH 3L3OA 3ZSTA 5SWZD 4ZS6D 3BZFB 1S7QB 5GRWA 2GI7A 2HLAB 1HILB 5JHDE 4Y4HB 5D7LD 3MRIA 3TVMA 32C2A 5E8PB 5FYKE 4F57H 5GGTL 1X6LA 3PV6A 4J4PC 5GZND 5JDJA 3CVHA 2ARJB 1GAFL 5I16A 1CXEA 1IGTA 5DK0A 4S1QL 2CKBA 4I8DA 1NC2A 4UB0L 5KSAC 1YEHH 4YHPA 1LD9B 1WC7A 1HINL 5EO0A 3V5HA 1OLZA 2VLJA 3WNKA 1GSMA 2FB4L 1RURL 1OSPL 4AQOA 2OI9B 3SCMB 1MHEA 1I7UB 1JZ6A 1YN7B 4LGRB 3ARYA 5M94B 1EXUB 4L3CA 1LDPL 1UM6L 1LEGA 3LHPH 1TJGH 4JG0L 5C0EB 3K46A 4XWOC 5ANME 3B3IB 3UPRA 1GRWA 4N0RA 4Z7QE 1K2DA 1QPXA 1VENA 5F7EL 3IFPA 1KLGA 4G8GE 3BE1H 2OR7A 4ZAKD 2X4OA 4GBXC 3VFPB 2V7HB 4XX1E 3CMGA 2XI9A 5C92A 4NT6A 4GQPH 5CCKL 3KAAA 4QNPF 2IH3A 4LLMB 3LOWA 2VIRB 5IK3A 3HFMH 1KJ2A 5EOTA 2GK0B 4OD1H 5C09A 3ZT5A 1QVOB 3WXVH 5E8EB 2VITA 4W4OA 1IZJA 1QA9A 2X6MA 2F5BL 4EI5D 4ISVB 1MWAA 4MXQC 3B83A 1KTLB 4Y4HC 4OZGF 4PJAB 3MUHL 1FO0H 4DAGL 2O61A 1A7NH 1AD9A 5FDWA 2APVA 1G7JA 4XC1H 4M1GL 1HXYB 5EIIA 1HEZA 1ZANH 4OCNC 1MJJB 2OQJA 2NXZD 4KI5F 4NKMA 1RZJC 4CJ0A 1E4JA 1U58A 2VN7A 2YMXL 1A7PH 3U0PB 1NUFA 3V5DA 3FCTB 5E08L 1KPUA 4K3JL 3RWCB 3LKNA 1IAIM 3SKMA 5KSUA 3VH8B 2DQFA 4OQTH 5B21A 3HR5B 2JB6A 1MIML 2OI9C 5EN2B 1U8MB 1B0RA 2HLFD 1ND0A 4W68A 5HGHB 2WWMC 5IMOA 1J1XH 5DEGB 1A0QH 3SDXB 4BSVB 4GG8A 1URLA 2EDEA 1NANH 2A6DB 5DWUH 3IJHB 3ARDB 5EZJB 2AK4D 1DDHA 4I2XA 4NNPL 5C3LD 5J6GA 2R1WB 25C8L 2RCSH 3R06A 2VAJA 4PRIB 3FQWA 3WFDL 4V1DB 4KV5E 1UEMA 4ZPTB 2CLRB 1JHKH 4WI6A 5CEZD 5HYSA 4JR9H 1JPSL 4DTGH 4Y4KB 1WVZA 3OQ3B 4AIOA 1KCRH 5JW4Q 1NCWH 5IB2B 1E4WL 1UB5B 1MCRA 5CJBA 1IARB 1OTTC 4UV7H 2GY5A 4U1MB 4POZC 4PGZA 4OFYA 2WLZA 5HTSA 1ONQA 2WP3T 4PJGA 5D93B 3F7RA 3PWJA 4Q9BA 4MAUH 1A2YB 2A9MH 3V0VA 1D5MB 2BNRA 4IDJL 3UTSE 3PWLA 3U79A 4LLYB 3S35H 5BV7H 4PBWD 1MVFA 1LO2L 3UTZA 1PGRB 4K8RD 4P3WA 4OZGB 4ZO7A 1FYTD 4F58H 3SEPA 3U30C 5F93C 5EOCJ 3RL1B 3T09A 3K0WA 1PJ9A 3ES6A 3IFLH 2Y07H 1P7QB 3SKOB 4XGZB 3C5SA 3OX8B 3ESVF 3KYNA 1CFTA 4PRHB 4APQB 1FO0B 5DHYB 2ZOKA 1ACYH 1U8PA 5A3ID 1I4FA 3SOBH 4ZD3H 4G5ZH 5EUOA 1TNMA 2WUCH 2Y23A 1AD0A 4LEXL 4EVNB 1T6WA 3RJDA 1BZQK 4Z77A 1ZLUK 5GRYA 1G1CA 2ADIB 3ARDC 1AH1A 3RVXC 3BAEL 4GRLD 4BUGA 4KMTL 2C1OB 2I60L 3ARZA 4LCIH 3RVVD 1MRFL 2Z91A 2FBJH 3HHRB 4N0UB 3CLEH 5D7LE 4DFIA 1UB6B 2MMXA 1G7IB 4Y4KC 3CSYB 1BJ1H 3QQ4A 4PUBL 1VFAA 3QCVL 2D03L 4R26L 3WLBA 4NP4H 2WBJB 1XGQA 2LTQB 2Y4SA 4TNWK 4MQXC 4LCWE 1OGAA 3QQ3B 4UOJA 2W9EL 5C0CD 5D93C 2WIIB 3OAYH 2IC2A 4X9FA 2V6HA 1VHPA 5D1QA 2BNQB 3B43A 2CMRH 1RULL 3QUYA 4KQ3H 1P84K 4NQEA 3EYSL 2C3VA 5I1DB 1E6OH 3EYQC 5IOPB 2YBRB 1BOYA 1QOKA 4Q2ZA 1MHPL 3I6GB 1RAMA 4KY1H 5C7XL 4KDVA 5L9DL 3D39B 1T1WB 1JIBA 4MCZB 4CN1A 1QSEA 2PF6A 5ALBH 4WCYH 4X5LA 3GMPB 1SEBB 1F3JB 1VFBA 4AEHL 4G6AD 4WWKD 1P6FA 4YHKL 1VA9A 4APQC 3CMOH 4X83A 1X5LA 2FX8H 1UKQA 4QEGA 5BMFH 2AAVA 3ZYOA 4LHUG 4CN4A 3QUKA 3SY0B 5BV7B 4QY8A 5MP6L 1UA6H 4H25A 2F8XC 1W0YT 5E9DB 4NQCD 5GRXG 1MJ7L 1S7RA 2VSCA 3BDYL 1SJEB 5CILH 5CZKA 3EGSA 2VQ1A 3FOLA 1Q0XL 4XP4L 4YWGH 4FQ1H 1OAYH 5DUPH 4FQIL 1GOHA 4D0DB 5L8JB 4JFEA 4DJMA 2DQCL 2VLLA 2R8SL 3VXQB 3LN9A 2P8LA 4JZJA 4G8IB 3O3DB 1U8QA 3QZWB 4KGLA 3MRKA 2X09A 4RFEB 4U1JB 1U8NA 3SN6N 2WBJC 4I3SH 2LTQC 5C07D 8CGTA 3E6FB 4RISL 3WS6C 4L3EE 4OIIL 4OUOA 1LDSA 4AT6A 2B0SH 4HFUL 3PL6B 4AEIL 5ISZB 5JPMA 4G7YL 2HJKB 4WO4B 4J8RA 2DD8L 1HKFA 3VDBA 4RGNE 4PTUA 5DDHA 3TH2T 1JVKA 2DQGH 4N8VG 4HHAB 5HVGB 2BHUA 4Z7VB 2E7LC 1IM3A 1A9EB 3BP6A 3SGEI 2WAHA 2FWOA 1M7XA 3QWQB 4RAUB 4P3CL 4KKNA 4GAFB 3Q1SL 3VFGH 1OQXA 2R9HD 3Q48A 3GMRB 2P42B 2VZSA 4Z7OF 2XN9D 1JRHH 3T1WA 4GW1A 2ZPKL 4OIBA 3CZFB 5DRXB 5KS9B 1WWCA 1T1ZB 2Q7YA 3QDJA 4WU7B 2PTVA 3AUVA 1MJUH 1RUML 2BSTA 3DVNA 5CEZE 5CZVL 4KRPB 3VJ6A 2NW3B 1UM5L 1PZUB 3QQNA 1I9JH 5BV7C 3O11B 3RL2B 3X3FL 4XXDB 4KZDL 3RY6C 1N64L 3MRQA 3CFJB 3HE6B 4RX4D 2D7MA 3GNML 4FTVE 1FNGB 3BN3B 2XZQH 4XP5L 5C9JA 2B1HH 1HH9B 1SJXA 2AXJA 1MLCB 2X4NA 3UTTE 3WUZA 1O7VA 3IKKA 3TPKA 4HIIA 5CJXC 3SKUD 3I2CH 2HJFA 4X6DA 2BSSA 5D72L 4WHCA 5F44A 3I75B 1QLEH 4UT7H 1WISA 5C0AB 1X5FA 1QTYT 2HH0H 4LSTL 5ID0B 4GFTB 4OTXL 2JLLA 3VXSE 4HUVA 3QEGL 4X9HA 1CVSC 1UENA 2G5BB 2NXYD 3BP7B 4WW1A 3TJHD 3BWAB 3BD3A 3VFNB 3PL6C 4J6RL 3O4LD 1ZS8A 4JM2A 5EWIH 4WO4C 5DD5L 2EDBA 2PO6D 4QT5A 3GJFK 4PJXF 3VGHA 3HG1D 3K81A 2GITB 3LRSA 4M00A 5FK9A 5E24E 1SY6H 4O4YL 4OUUA 4PJGF 5FO8B 1A6PA 4WENB 3PGDA 4U1LA 3V5KB 1P7KB 3KYKL 2X40A 3U9UB 3MOBH 1PKQB 2HRLA 3W9EA 3VGFA 3VXUA 1AGBB 4AZ8A 3IU3A 4NC2B 1CLOH 1XH3A 1CG9B 4PGDB 4Y4FA 3RAJH 3ETBF 2VXVL 3MA7B 2IAMA 1LE5B 1MJ8L 1FAKT 3TT3H 5C86A 4KZEL 4PB9L 4R4FH 5DK3A 3G5YA 1J11A 2ESVB 4ESKA 5J1TC 4ELMF 4G80A 2PXYD 3P9LB 2EYTB 5DK2A 1FZOA 2ZUXA 5E5UB 3TBTA 2C5DC 1FH5L 4LASL 4KRPC 3ZYZA 5F9AC 4G42A 5E95B 2AEQH 5H37H 1X6NA 5ANMA 4HMEA 3U7AA 4MZ2A 4XXCA 1JYVA 4Z7UE 2VTFA 4PPTA 2PCPB 3HE6C 3HZMB 1I1FA 4YJZL 5I8CA 3SDDD 5EUOF 4DVRH 4AM0A 3A6OA 5KVEL 2FJHA 2X4SA 1FG9C 3LKNB 4KUZL 2MQCA 5C0CE 3TO4B 1UM4L 1BX2B 1HZHL 1LO5A 4FABL 1AO7E 2XKNA 5AYUH 3VG0H 3P0VH 4Z0BH 5KSAD 4U2ZA 5B39B 1TVBA 2BZDA 4HX1B 4CVZA 4EUPG 2G60L 2AP2A 1ZEAL 3KPOA 4WI9A 3T2PA 3W9DB 1PEZA 1B0GB 5E2WH 2BVQB 2E27L 3AFLA 4YHNA 3BPNB 1CLZL 4WDIB 2OLDA 1NMBL 5F7MC 4PJCF 1Q9KA 1BOGB 3HNSL 2DB8A 1NAMA 4XWOD 1A1OB 4R3SB 4Y16B 2X1XR 4Q0XH 3RDTA 3N1GC 3OGOE 4HJ0C 1FRGL 4OM0L 4ALAH 4GBXD 5JPNB 1NEZG 3IDYB 1IAOA 3ZYJA 1VESA 1NLDL 4UINL 1X5KA 1YECL 3ULUL 3VRJB 2IPKA 3BH8B 1RMFH 4XCFH 4PJXB 4P4KA 1IT9H 3EOBB 4P99A 3GO1H 5T1KB 3QA3B 2DBLH 3PQYD 4PRPA 4KVNL 4JANB 4O51B 4JRYE 3HLAA 3LKOB 5D7JB 3U2SA 1JHLH 3MGOA 1NFDE 1YEJH 3IVKA 4MXQD 4AL8H 2CK0H 4U1KA 1YEDA 5EU5A 2UZXB 1NBZA 4Y4HD 4NM4L 2J8UB 2EIDA 2ENSA 1NH6A 4XH2B 3O3AB 4M7JH 1DUYA 4ELMB 4XVTH 4M6AA 1KSRA 5EH1A 4U1NA 4ZTPL 4U3CA 2D31A 1X5XA 3TO4C 1S9VB 1I8MB 1SBBA 5MEOB 4IRSB 5KSBA 2YA2A 1YPZE 1RHHB 4W4NA 5FOBA 1K4CA 3IRPX 2DQEH 1RQ5A 2WINA 3MYJB 5ICYA 5MENA 4Z76A 3N9GH 4XVJH 5FECB 1P2CB 3TO2A 2VR9A 3T8XB 1CT8B 4WUKH 4N5UA 5M7QA 2WWMD 3BPNC 3L9RB 4NCC2 1NL0H 3GJEB 3UTSA 1R6VA 2DLFH 2BHYA 1QD0A 7FABL 1CGUA 1AGCA 4LRIA 5BW7A 5L7XH 1LILA 1BVLA 4Y16C 1KPRB 4NFBA 1U9KA 4JQIL 3LMJH 1F13A 5FUZH 4JRXA 3VI4E 5SWQB 3P2TA 1CR9H 2MPAH 5DQ9A 3VXTA 1MFCL 2BVPB 1YYMH 1F00I 4UT9H 4ZUWB 1H8NA 3IDYC 5IM7B 3TIEB 5HVHB 1S7XA 1AR1D 5C0BA 2H2PC 4L1DA 1MCWM 1JGVL 2RQ8A 1ZVHA 4PJCB 1JYWA 4N0CC 1Q9LB 1R5VA 4UQ2A 1S5IH 1OW0A 3C9NA 3J8F7 5DLMH 4R90H 4QGYA 5T1MB 5IFJB 1OTTD 1UH3A 5D7JC 5DD6A 1TCMA 2DIAA 3I50H 2EDHA 4Y8DC 3QIWD 3EDJA 4O58L 3U1SH 1B88A 1GVIA 4C83A 3LRGA 3ZE0F 5INCB 1LO4H 1RIHL 5JW3L 5BS0A 3AM8A 5CEXA 5F1IB 1IQDA 1SYVA 4QTHA 5IKCB 2WMPA 2YR3A 4M8QB 1TJIH 4XPAL 1NBVH 1RIUL 3FQUA 3M45A 3MOQA 3IJYB 4IRSC 2ADGB 3NZHL 4UT6H 1QFPA 3RUGF 3FRUA 3STLA 1I3RB 3QWRA 3UTOA 3QDGB 5GS1B 3RWHB 3FFCB 1U8JB 4PRNB 1KB5L 3T4YB 1O7SA 4MNHA 5B38A 2DTML 2OX5A 3R0NA 3BKJL 1FZKB 1NC4B 4YLQT 2CGRH 2OXHA 4Y5XB 3SJVE 2E7HA 1MREL 5A16B 3TYFA 2O5YH 2GJ6E 1BQHG 4PJDA 2D7NA 4XBPA 1G1YA 3RVXD 4YHZL 5MI0C 1T7VA 3SE3A 2FL5A 3EFFA 3R1GH 5EA0L 3RZCD 2AXGB 2DYPB 3MLVL 1Q38A 1T04B 3QUML 5HVHC 1JWMB 1P1ZB 4JZOB 7CGTA 5KAQF 4PBVC 2MKLC 4Y4KD 5F7UA 4ZTOH 3WIFA 1TCRA 2IJ0C 5ENWA 1S5HB 2P7TB 1KYOJ 4OLXL 1DBKH 4X0KB 1QLFB 4F15B 3O6MH 4U4BA 5IESL 5E94A 3L3DB 4QRPD 5J89A 3GZKA 5DVMA 2Q1EA 3F5WA 1IL1A 4ZNEE 5D4QA 4P5TB 5E03A 5D6CB 5LGKA 1JK8B 1ZHNB 2OTUB 4L8DA 3SGJC 3EO0A 2KL6A 4Z8FH 3PWPE 3G5ZB 3ROOB 4X6EB 3W0WA 3MODH 4QYOB 4OCRH 1XIWA 5DTFB 1HXMA 4X7CC 5TFSH 4JFXA 4K2UH 1U3HA 5GS1C 3WDJA 2DOCA 5HHMB 4DW2H 4OCYL 4FFYL 3WL9B 4HULB 5B8CB 1NUGA 4KAQH 5TQ2H 4YHLL 3BRDA 3SDCA 4L3EA 3QG7L 3PDOB 5F89A 3T77B 1CFNA 1MFAH 4LU5L 4HUXA 4N1HB 4PRHD 5FA3B 2I27N 3QIBA 4JKPL 3MZGB 4Y5XC 1BD2B 3RUGB 1QQDA 2UZIL 5IBUG 3DBXB 4J3VA 5HDQH 1ULVA 5BVPH 1DVFA 4ODSH 5CJQH 4FFWC 2LQRA 1PG7X 3FB5A 3I6KA 3PHOB 4NZTL 1XAUA 3H3BC 4U0QB 5CGYD 2RFXA 4OBRA 4OAWA 5J8OA 5JQHC 4K7PH 4MD0B 3U9PL 5DJAA 1CK0L 1FFOB 1CFSB 3MXVH 4XNQA 1OAZL 1IM9B 3RNKA 4DKFH 4NZUL 3NTCL 1C5CL 3EYFB 3MXWH 4FQQA 4N0YL 3EFDH 2VRAA 3MV9A 3ZDXE 4K3HA 1QYGH 2FJFB 1ZAGA 1LO0H 1ZVYA 3T0ED 4PJHF 2WBJD 3NMEA 4F15C 4ZNCD 3T0AA 5C0DB 3D25A 5F1SA 4KGJA 3WSQH 2Z35B 5EORH 1VADA 3JUYA<