5C0AE

1e6 tcr in complex with hla-a02 carrying mvw peptide
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
246
structure length
246
Chain Sequence
DAGVIQSPRHEVTEMGQQVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSLWEKLAKNIQYFGAGTRLSVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hotspot autoimmune T cell receptor binding underlies pathogen and insulin peptide cross-reactivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 53
structure length 246
sequence length 246
chains with identical sequence J
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0aE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0aE02
1N2RB 3TBYB 1RZJC 1A7BA 3REWA 4XXDB 1EJOH 1A7QL 4WW2B 2R1YB 1YC8A 4POUB 3DVGA 2BNUB 1CK0L 4Y19D 4U33A 5HI4D 3RWIA 1QHPA 3CFBA 2OM5A 1UM6H 2QQLH 4JRYB 2DQEH 5D2NC 2DQDL 2FJGB 5DHVA 2V2TB 4LRIC 2HMID 5KVFH 5I2IB 3O3BB 4M7JH 1B0RA 5CJXC 5E00B 1TVDA 4FG6D 1KEMH 4NCDA 4XHJD 3OXRA 1NDGB 4FTVA 5AAMA 4ZTOL 5ID0A 5IJVA 4WI7A 4YX2L 3TIEB 3CFKA 4U6HA 3FMGL 4JFFA 3VFWB 1EBAA 1RJYA 1XZ0B 3QFDB 1D5IL 1EEUA 3VXPB 1S5HA 2FB4L 4J8RB 2FBOJ 1HZHL 4EN3D 5KOVC 2R4RH 2P8LA 2BSSA 3HFML 1H5BA 4JB9H 1T89A 1D5XA 5F6IC 5DI8A 4BSWB 5DHYB 4H8WL 4YBQC 1NAML 5ANMA 1UXSB 4FABH 4MXVE 1CD1B 4RQQB 1KOAA 3V5KB 5EWIL 4YFEA 1B0GA 1ZMYA 2XFXA 4HWZA 5DO2C 5C86A 5JHDD 4D94A 1SYVA 4KRPD 4HIHB 3RTQA 3KYKL 4HUMB 2DRUA 5F9AC 4PIRF 1KENL 1RZIB 3DMMC 4TULL 3DSFL 5HDBF 5LVEA 4WHTA 1U0QA 4MQSB 3U82B 2CPCA 2LVEA 3JTTA 4LLYA 1UWEL 3J8F7 5CILH 4M7LL 2HMIC 1DFBH 5DD1H 5BO1H 4L8DB 2RAMA 3RTQC 4OT1H 1EFQA 1F2XK 1HHGB 1X5AA 3CLFH 3VFSA 2VWEC 5F1IB 2IADB 3LRHA 1A9EA 2GJJA 1R3LB 4IMLB 4PD4K 2Z8WC 1CK0H 2AEPH 3U7WH 2FB4H 5IMLA 3IJHB 1HKLL 1GGBL 4PJ9D 3UPCA 1DQJB 4DAGL 4EDXB 3BHBA 4JM4L 4G43A 4EI5C 3TT3L 4OGAC 4QOKB 3P9MB 2Z31C 3RWDA 4Y2DA 12E8L 3C09C 4P9HH 2PETA 3AS0A 5D6CA 5D96C 4RGOH 5ESVB 1JPTL 5M94B 3SCMD 3TNMB 4P9ML 1XGUB 1HSBB 4EVNB 4JY4B 3WYRA 1YMHA 3IDYB 3OKMA 5FHBH 5EOCH 2A83A 4Y2DC 4XP5H 4FS0A 1NBVL 1AD9A 4XAWH 5AD0B 2VLRA 5KS9A 5L8KB 5GZND 1RJZA 4OIAA 2CDGA 2YR3A 1FCGA 3PIQB 1BPVA 1SY6L 3RA7H 1JGUH 4UNTA 3MR9A 1A14H 1FV1B 3JWDC 5IHUL 1I7RA 2RR3A 5FO9B 2D7PA 3ARVA 4Z7NE 3DX6B 1DUYB 4H0HB 1MRDL 1OAYL 5E7BA 1T5XA 1IKFH 5EUKB 1H3PH 3VRLF 2YD7A 4LCYA 5A3ID 4OZFA 2D4DA 2G75B 3IETB 1V7ML 2Y7QB 2A73A 1QR1A 3QWRA 5DJ2B 4JG1L 1JNHB 3ARGC 2DD8H 3DHJA 1MIMH 4CNIA 5BW7C 3MJ9L 3SDAB 3VFMB 3WLBA 3SDXF 4ODTH 4U1HA 3HUJE 4MNGB 4DEPC 1FO0A 5E56A 1YN7A 1P2CA 5GXBB 2C3XA 5GS0D 2FJHB 2NXZD 1JWMB 3BUYB 5T1LD 4ZOCA 1BQLL 1QFOA 5IVNA 4NC2B 1J1XL 6FABL 1WC7B 2JLLA 2XWBB 3KPLA 4U6YA 1U91A 3QZWB 2R2BB 5D93C 1S9VB 4XPGH 2VC2H 1H8NA 1CDJA 4F7TA 3ESUF 3HZYB 4AG4H 3G9AB 4ORZC 1G6RH 3QIWA 2APWA 3VXOA 5E8DL 3HMWL 2FHCA 1JGVL 1GC1L 4G6FB 1UADC 3V4VL 5HDLA 1IAII 4FQ2L 4OZ4B 3RZCD 1QKZH 3U30B 3V5DA 4F33B 2X1QA 3S4SA 4JKPL 2X4UA 5JIHA 4DFIA 5ALBH 1Z9SA 4CW1A 2NLJA 4OD3H 3QIBC 1AHWC 2ZOLB 3QNZA 2VE6A 3LD8B 4KFZC 4NPYA 2HT3D 4ODUB 4JVUA 2ADJB 1UXWA 4JCLA 3TBSB 3V5HA 3TBVA 4IDJL 3GJFH 5JOFB 2B1HL 5I1LA 5IESH 3REWB 4P5TB 3GJFB 4PGCB 1PLGL 5EOQL 1AHWA 4L4TD 2JJSA 1JZ6A 35C8H 3O0RH 4L5FL 4HUUA 5HYQA 4OUOA 3L3GA 4MXWH 5FCUL 2APTA 1C16B 4GKZA 5HTSA 2M8XA 3GM8A 5B3JF 1GGCH 4HAGA 4Y5YA 1WT5C 3I50L 3NCYS 2RB8A 5EOCJ 4YUEL 3O4LA 4NQDB 3LMJL 4I2XA 1NSNH 3FRPA 3O3UN 2WMPA 1G7IA 1A47A 2DTML 3TN0D 3U0PB 1A4JB 2JK5A 3ULUE 3MACL 3PJSA 1WT5A 5GJTL 3MLRH 3TPUB 3QEQB 2JIXA 1NCBL 5J11C 1AI1L 4KVCH 5I0DA 1Z3GL 3VFGL 4J7RA 4CMMA 5TE7L 3T3ME 4V1DD 1G9NC 2R8SL 4GMSH 1X5FA 1JJUA 4LU5L 1S7VA 1UEMA 4GH7B 4LAQH 4NM4L 4JQIL 1R5WB 4M6OH 1CLZH 3GHEH 4FFZL 2XV6B 4WFGE 4LPVA 3RWEB 1NDMA 1RSFA 1XF2A 1PEWA 5E8PA 3O9WA 4X6CE 1JWSA 4O5LH 1J7VR 4X4ME 3VXRB 3N1MC 4H88H 2C3WA 1K2DA 4ZQKA 3EJYD 1E6OL 4APQA 3ILQD 2IQ9L 1F11B 4AT6A 2VDML 2R0ZL 1IC1A 4GO6B 1FVDB 1R3IH 5FUZL 1ZE3C 4M3KB 1MAML 4WHCA 4LSQL 1MNUH 3EYSH 5BS0B 4PRHA 2H9GA 5KG9A 5HGBB 1T20B 1YEEL 3VXRE 2D7QA 4YGAB 5E6YA 4CMHC 3T1FB 4NQVB 3O0RL 1O0VA 4WEMB 1JN6A 3IFPB 3LSOA 1NCBH 1BHGA 5FCUH 5DEFA 1X4YA 2ATPB 3OKYA 3OMZA 4I9WE 3GI8L 1AO7A 1W8OA 5DJXA 4HLZG 3W11D 3GSNA 5IB4A 3PQYA 5E5MB 5TE6H 1CE1H 1IGIL 2J5LB 1NSNL 4M48L 3FTGA 2QR0A 5JLZA 4YHLH 4HG4J 3ISWA 2BC4B 5FOBB 4FQIL 3C8HA 1XEDA 2W9EH 3SKJH 1HN1A 2AJXH 5D1QD 1RZGA 3QIUD 1PY4A 4KJYA 2V7HB 5A2FA 3MFGB 4PJFF 2VDKH 4N8CH 1J8HB 5J13B 4KHXH 1CR9L 1CGXA 1CQKA 4JDVA 3TCLB 3QUZD 4JR9H 4NZUL 5DD6B 1ZHKB 1JI2A 4OT1L 2ZUYA 3NFPA 4Z77B 9CGTA 3AVEA 5IM7B 3IDXL 5BV7L 1UC6A 4LARH 3MJ8B 4UIKH 4S2SB 5DFTA 3TA3D 2P45B 5GRUL 2G75A 1I3RB 4BKLB 3Q5OA 5J6HA 1VPOH 3UTSE 3BWAA 2DWEB 5K59F 5FM4A 3MO1B 3ULUF 2NR6C 2X70A 2YKLL 3VFMA 3WLBB 2BK8A 5C0IB 4OZIE 4E42A 3MRHB 5IBUB 4U6TA 2WANA 1LO2H 4NKIH 4KTDH 5L7XH 5FGRA 3VRIA 3B6SB 3KWWA 1PGRB 1BBDL 2M2DA 3P30L 4HX1B 3JWOH 4DGIL 1WC7A 3BZ4A 1KELH 4X6DF 4HH9B 1QRNB 2ESVD 3NIDF 5T3XH 3TA3B 2ZOKB 1D5ZB 2IQ9H 2H2PC 1DLFH 2FIRT 3IFOB 3QG6B 4KZDH 1BREA 1W72B 1P6FA 5JXED 2XTJB 4Z7VA 5CCKL 3NCCB 1NUGA 4GS7C 4LCIH 1IGIH 4OBRA 2HVJA 1A6VH 3U79A 1G7HA 4YQXL 2EYSB 2J2ZA 4KHTL 4TTGA 1N8ZB 3KPPA 1A1OA 1W0VB 4EBQH 3SKJL 2UZIL 2W60A 1F97A 3TH3T 1G7MA 1C5DB 4Z7OF 1AGBA 3CXDH 3ALWA 1FVCA 1UZ6E 5CJBA 2VLRD 4GW5B 3QEGL 5E8EA 5JR1H 1DBBH 4L3CA 3PHOB 4NPYB 1R3IL 4PJ8D 1LILA 4AEEA 3C8DA 4PRIA 3BZEA 1LMKA 3QO0A 1Q1JL 2XTLA 3MRMA 1P4LA 3B9KC 3UJIL 5I2IA 2P44B 1PEZA 4ERSL 4WW2C 4XNUH 1CFSB 4RMWA 5CKAA 2FDBP 3WFEH 4N90E 4N8VG 3LD8C 4FTVB 3BDYL 3MV8E 3T0EC 3LN4B 1ZSDA 3V6FA 4W4NA 3CFCH 3CFKB 4U6HB 3VGBA 3SBWC 3QUXD 2FHBA 4N5EC 3U4EA 1OGAE 4QRPB 2X4RA 1LEKA 1L6XA 3JVGA 4U3XA 1S5HB 4ZOEA 3C5SB 5DURD 1A14L 1RZKC 5SX4H 4OKVA 4NFBA 5CJOL 2HVKA 2QL1A 3BGAA 1EO8L 1MCWM 4NKIL 2AKRB 5I1AB 2EYTA 5DI8B 4P99A 3DRTB 4DN3H 5C0ND 4LVEA 1UXSA 5HD8C 3CX2A 4ZD3L 2IG2H 3QEQA 4O51B 2HT2C 3BJLA 4NO2A 3BYYA 3V5KA 1EUUA 3S36H 2DM3A 1DLHB 4M8QA 1RZJL 1BVKA 3B3IA 5DJYB 2Y5EA 3RU8H 3OKEB 4OQ1A 2FGZA 2DQFB 3FQRA 2R15A 2VKXA 2VUYA 3DOSA 2F53A 5JHDA 4LCUA 5EZIH 1I3VA 4Y4KB 4MVBC 4XC1L 4EN3C 4TQEL 1T04B 4LGRB 5IQ9B 5GSVB 1HHGA 1FZJA 3EYQC 3IKKA 1T2JA 4JANB 4AG4L 2H26A 1E4XH 2OZ4H 1KCLA 3VWJA 3C6LD 5DJZA 2MCG1 3RIAK 5GRJH 4D0BB 1N5YL 4G8IB 4D9LH 4W6YB 4N0UA 4ZO8A 4JVPA 4Q0XH 4XMPH 4G3YL 4ZUUA 4YUEH 3MRNB 2Y07H 3SY0B 5CZVL 5D7JA 5E8OB 1CXLA 1YY8B 5T5FL 3MV8A 4WIQA 1FIGH 4ERSH 3ULUL 5IFJB 2BMKA 2EDKA 1XGRA 3I3DA 3RWDB 5HI4C 4Z76A 5D5MA 2D9QB 4FTVD 5FYJD 3OKNB 4JHBA 1OTTD 1X7QA 2PW1B 5DEFB 4GLRI 4TSAH 4KXZI 1R24A 4XXCC 3CDFA 1CIUA 3TNNA 3MLSL 5BOZG 5GRZA 1IGFH 5D1ZC 2EC9T 4Z8FH 5CBEB 3VXSD 1Z9OA 3KYMA 1JK8A 2Y25A 2BZDA 4HIIA 1CG9A 2KQNA 3KPOA 2NY5L 2YZ8A 4KMTH 1G9ML 4PY8J 5IWLC 4CL7A 2V7HA 5JR1L 3N9GH 2VXUL 5C2UB 4WGWB 2BFVL 5IHLB 3WKMH 4X83A 4PREA 3L3IB 1LEGB 3TCLA 2PTVA 5CLTA 1UM5L 4TOYL 3INUH 2N56A 4G3YH 5EO1B 3NFPB 2FEDC 2PF6A 5JHLL 1A9BB 2Y07L 2FX9H 5EA0L 3S97C 1NFDB 2EDNA 4G9FD 4LVNB 3ARDD 4TULH 3LKQA 3STZB 1VDGA 5IFAL 4IOFC 3WNPA 4XAKE 2WW8A 4JPVL 1HINH 3MOBL 1EFXD 1UCTA 5MEOA 2EH8L 1CGSL 4HIXH 3QR2A 2W9DL 1FCCA 1QO3B 1KJVB 2XG4A 5EN2A 3VCLA 2BVPB 4FQJL 1ACZA 2BXYA 1AO7E 3MXWL 4H25B 4B53A 2DQUL 3ULUC 1NEUA 4YHOL 1SM3H 4OM0L 5D5ME 1FNFA 3VRIB 3QIWB 3OHXB 2XNAB 4OI8A 3X14A 3O2VH 5EOTA 5EBWA 2BCKA 3SE9L 4RFEB 5H2BB 1CS6A 4LVOC 1U8IA 1CR9H 4QXUH 1RUAH 3P73B 4X8JA 3UXFA 3CFDA 4P57A 1NC4D 3IB4A 4R4NC 5I1IL 3BPOB 4XI5D 4HPYL 2R1WB 4XMKL 3IVKA 4MHHG 5D2NE 2UZYB 2ADFH 1QFWH 1ULVA 3CFBB 3FB5A 4P2RE 5SWZB 1FSKC 1TZGL 3MRGA 2AQ1A 4UIKL 1JMXA 3KPPB 5HGAA 1F3JB 3BD4A 1CT8B 5DHVH 1G7MB 4HPOL 3B2VL 1C5DA 3PXHA 2AV1A 4XWGH 1R5VB 4GRMB 1E4XL 1FVEB 1VSCA 2GEEA 2C3VB 1PDKA 4F37K 1AHWB 1SY6H 2W0LA 3ARFD 4X7TA 4R4ND 5K93A 1HHIA 1D5MB 2UWEE 4JDTL 2M1KA 2OTWB 1OAYH 1YN6B 2XQYK 3U46B 3NGBB 1ED3A 2XA8L 4CVWA 5DZNA 1BQHG 3V4PL 1M05B 5IFAH 5T3XL 4N8CL 5DHYA 4YDJB 3IDIB 1RUQL 1HINL 3MOBH 2H1PH 4KK6D 5KW9L 3U4EB 5IUSA 4MZ2A 3IJSB 1T7VA 1DEEB 5C0DB 2FX8H 4L3AA 4YXKL 4LPCA 2D4FA 1NC2B 3EJJX 1TCRB 5J1AB 4LSVH 3O45A 4O58L 4HIHA 4JFZL 3B8SA 5D6DC 3RX5A 2Q8BL 2I9TB 2EO9A 4MQ7B 5TGBA 1NL0L 2Z9TA 4D9QE 1J0HA 2OZ4A 5CGYC 2Y72A 5EIVA 1VENA 4R0LB 1D7FA 5D8JH 2YMXH 1MF2H 2WV3A 1U42A 3SO3B 3QXAB 5EZLB 4IHOA 4HKJB 2A9MH 3RP1A 2BVTA 4M9OA 2QEJA 5CD3A 4PD4J 3O8XA 5FO7A 3R4DA 4IMLA 3QBTB 4TVPE 5L7XL 2V6HA 3T3PF 2ICCA 4XP4L 3T2NL 4LSSL 1I8MB 1TQBB 5D72L 2QSQA 1U8PA 1HH6A 3BWUC 3DARA 2KBGA 1EJ6A 4JQXC 3LKOA 3MNZA 4G6JL 4GG6F 1RU9L 4U3CA 4LHJB 3UTPE 1LO5A 1E4JA 1VFMA 2HKFH 3GI9H 4JANA 1BP3B 3ZLQC 1ITCA 5J1TC 1KCRL 2NY0C 4I3SL 3BUTA 5DRNB 5J9PA 1YZZA 4IOIB 5KVFL 2OI9B 5IT2H 5DD3L 2R2HB 4KHTH 4MAUL 3NA4A 1YPZB 4G6AC 4K3JL 3RWJA 2F58H 4JFDA 1DJSA 4O4YL 2NW3A 2DL9A 1ZLSH 2B1HH 4BFIA 3QUZB 5JLZB 1NMCC 1ZVSB 1DZBA 1BJMA 2YBRA 2PW1A 5TQ0L 3E3QE 4BZ2H 3VGFA 4MA1B 5GGQH 3P4NB 4OZHA 4QCIB 3KXFB 1TTGA 3DX6A 1CDYA 3MBXH 4JFED 4JREB 3IRZA 3EDDA 4I18A 1MWAB 3BE1H 1FZMA 4FQHB 3S3JA 5KAQF 2J5LC 3GMOB 5F9DC 4BFGA 4U0RC 4HHAB 4LGPB 2XQBH 3OKKA 5T1MB 2PYFA 5DD6A 1UG9A 5EWIH 3Q3GA 4MNQD 4FFWD 3CVIH 1FIEA 3UP1A 1OGAA 3IU4H 2E7HA 5HDQH 1T0NA 3GBML 4G8FA 2HKFL 4IJ3C 1YN7B 1KENH 2VXVL 2AQ3A 3LQMA 3HNSL 4KGJA 5HI3C 4X4YB 2NY4C 1EGJH 4Z5RB 3DVNA 2V17H 5FFLA 3BUYA 1B88A 2KDGA 3KPNA 1JZ2A 2VQ1B 3IFNH 2GTWA 1KPVA 1N5AA 2XWBA 3KPLB 3MRBA 4U6YB 4YHYB 5JPMA 4OFKA 3BWAB 2DKSA 5D72H 1LNUB 1P4BL 5T5FH 3ULUH 5F7KC 4H88L 2H41A 4KI1A 1UCBH 3LCYA 1FC2D 5JORB 1KIRB 3JZ7A 1IEHA 3VXOB 3L95B 3P4OA 4D0DB 1G6RA 3RWHA 1SMOA 4RMQA 3RGVB 5I30H 2X9XA 4G6KH 3UJTL 4JKLA 2FH8A 1WWBX 3RVXC 4KKLD 4BZ1L 3WDHA 1OWWA 3GJEB 1DVFB 3IXTA 4MDJA 1SY6A 1CXIA 3GGWB 1AR1D 2AI0H 1JMZA 3U7YH 1BVLB 3OPZL 2AXJA 3HMXL 4WFED 4KRNA 3HE6D 2GKIA 3TZVD 2HVJB 3GI9L 4YDLC 4OV5A 1UYWL 3QHZH 5I18H 5JOFA 3QUXA 1L9MA 1W0VA 3MRKB 1EGJL 4F7EB 2XWJA 1RZFH 2DLHA 4DAGH 3WKNA 4TOYH 4PJ8C 1RAMA 2L0DA 1JF5A 2GITA 4TNVK 4XWOD 1IAOB 2P4AB 2CRMA 1DSFH 2Y4SA 4MJIA 4GJTB 4XNQA 3VFOA 3MBED 5FM5O 1E27A 5HGAB 2XQBL 4R3SB 3GSQB 5JW4Q 1UKTA 4HS8H 2AQ2A 4EXKA 3MSPA 3QHTC 2WQRA 1FNEB 3GMLB 4Y5XC 5EC2B 4PJ8A 2D31A 3T0AA 3PGCB 5T33H 1EHNA 4AEFA 1A3QA 4CU6A 3QDMA 2C3VA 4P5MB 2DS4A 5EO0B 1CICD 4I1NB 1A6ZA 5IT2L 4FFYL 4FXGB 3PWVA 1G0YR 1X5IA 2HTLD 5F88A 2IFFH 2Q8AH 1YN6A 5F9JB 4LCWB 4JR9L 1DBKL 5L88H 3SCMB 4JFPB 4XH2A 5HHXL 5A16A 1IE5A 2NYYC 4RGND 4DW2H 2NY3D 5IW1B 1OQOA 2HVKB 2WWMD 1QBLL 2A6JB 5F1KC 1FNAA 3S88H 3M8OL 1UYWH 4PJCF 3EAKA 1JNJA 2PYEA 5ADPH 3ZKMD 3TYGL 3KPQB 1RZ7L 4EOWL 3HC3H 1V7MH 3JV4A 5E7FA 1CDIA 4I3RH 4LPWA 3RWEA 3VDCA 3DJ9A 5FK9B 5E8PB 3SN6N 4RGMC 1X5HA 4X4MA 1P4BH 3S7GA 2I9TA 5E8DH 4PP1C 4HKZA 5LGJB 3KYNB 5IHUH 2IADA 4MGXA 4RDQF 2DN7A 4APQB 1NUFA 4OQTL 4PB0H 5I1GL 4JZOB 2X44D 2ZCKH 5FGCE 4MNQE 3IDNA 2ZG1A 4LCCC 2EDQA 3K8KA 5I15L 4RMTA 5C0AA 3N85L 4EDXA 4I4WA 5C7XL 4PJ5B 1T20A 4QRRB 2F19L 1V05A 1R5IB 3PWLB 3FO2B 1IZJA 1YEFH 3HG1E 2BRRL 1I3UA 1HYSD 1JVKA 4OCXL 2DI7A 2GJ6B 4IDJH 5FGCB 1N6QL 1U8HB 4LCIL 1A4KA 4EVNA 1DN2A 3LH2H 4KJWD 3MLZH 3OKMB 1PZUB 4U31A 1OW0C 5L2JA 3EYFA 2V5MA 4TSCL 4KQ3L 1FYTA 4RAUA 2ICWJ 4B50A 2FX8L 5DLML 5FOBA 2X5PA 3UTOA 4FZEL 3QIUA 1FN4A 4JO1H 2HJKB 3QA3B 1A5FL 1X7QB 4PB9L 3H0TA 1BECA 3E6HB 1PFCA 1D6EA 1I7RB 3QCTL 3NAAL 4MQTB 4KTEH 1U93B 2F54D 3NZ8B 4KJQD 4GBXA 3QO1B 5IQ7L 1UACL 2J1KA 3WIIL 1I7ZA 1Q72L 2ZCKL 3KYOA 3RWCA 2Y7QA 4F3FA 2VTFA 3NIFE 3VGAC 4Z77A 5J3HD 1HDMB 2MQCA 3V0AC 5IM7A 5ALCH 1HH9A 4QXGL 4OCYL 5H8DA 1FZMB 5D7KD 4QY8B 1DFBL 5DD1L 1HXMA 4X7FC 1JRHH 3I02B 5L9DL 3QPQC 2XXCB 5HHXH 3I6KB 5F72S 4LHUD 3VWKA 4IOSD 2DWEA 1L9NA 2XACC 5C0FA 3O4LE 3ZKXC 5JA8B 2GIYA 3QP3A 4WWKD 3M8OH 1BFOA 2FZ3A 4CJ0A 5KSBB 1OGAB 2J6EH 1DQQB 1Z5LB 1LEIA 1KCSL 2OQJA 3HTLX 1TZHA 1MSPA 1MFEL 4PGEB 3HZYA 3D0LB 1E6OH 1FFPA 2R8SH 3DI3B 1NBYA 5DD3H 5EZJB 3NACL 2YD2A 1EMTH 1U95A 3LQAC 3HNVL 2X89A 5BS0E 2BVPA 4N0YL 2Y1VA 1A22B 1OB1B 2C5DC 4UQ3A 5K59E 3S88L 1D3CA 1DN0B 4PRNB 3S4SB 3M1BA 5TDNB 3VD5A 5HVFB 3MLUL 1F3DH 4JCMA 3GB7A 1DVFC 2VLLB 1OGAD 4ZTPL 2XNAA 2EDJA 2QTEA 3U0TB 4FZEH 1S3KH 4LSSH 3X14B 5IW6B 1JNLH 4KRMB 2W60B 4OZIF 4G8EB 1NAMB 1OAQH 4M5YL 3TVMC 1AGBB 4WUKL 1IM3A 4OF8A 3FONA 2BNQA 4YDLB 3P9LA 1IKNC 1MNUL 2LV4A 4MB4A 1WICA 1RUPL 3BRFA 5HPOA 4E41E 5SWQB 1TJHH 4JVWA 1H3PL 3I6GA 5E4EB 3MRGB 5HI5C 5DT1L 3ROLA 2UY7A 3NBNA 2Z92A 3LS4L 2NX5E 2DQHH 3OR6A 3PWJB 4ODTL 1F90L 3FZUC 4JFDD 4WTXA 3P4MB 1CF8H 4HUVA 4DTGL 5DFVC 1T83C 3QNYA 4ORGA 4U1IA 5EC2A 5I71C 4I3GA 4PJFE 2N1KA 4PV9B 1AP2A 1IEAB 5JW5A 5HDOA 4Y8AA 4YPGA 5KVDH 4OCRH 5J1SC 1TVBA 2CLRB 1J9CT 2N7BA 4HC1L 1G7PB 1T1ZA 2WINB 3EFFA 3AXLA 5FM5M 1I8KB 2IALB 5I75C 3MLXL 3QJHB 4XH2B 1YEKL 4XPHH 2ZUUA 5A16B 3HNVH 2PR4L 4R96B 1NUNB 3OWEA 4NZTL 1WAAF 1BQLH 1DLHA 5KVGH 1DQLH 2PYEE 5FV2A 1NFIA 3HC4H 2VRAA 1BQUA 4HEME 3WL9A 3MX0A 3PUCA 1I1AD 4QHKI 5DJDB 3RHWF 1JYWA 3MLUH 1JYVA 3KPQA 2ENYA 4KKAD 5DUPL 4R26L 4OZGB 2Q7YB 4KHXL 1RI8A 5D7LA 1FJ1B 4KKBC 5CP7A 3VXRD 1NBQA 2DM4A 3BW9B 4UILL 5FKPA 3UTSD 1HCVA 1DLFL 4JHWL 4HBQA 5HYJB 5CEZE 3C60D 3QXAA 2VITB 1RUMH 4XVJL 1JGUL 5T1DL 1U3HC 1YNKH 1I7UA 2DQIL 4OCWL 4K3DH 1CI5A 1OVZA 5BV7H 4K8RD 3QDJB 4LLMB 5HGBA 2FEEI 4LBEB 3SE9H 5CD5D 1WTLA 5BCAA 2P24A 2R0WL 4RX4D 2VDPH 1I8MA 2ZWLT 2EZ0D 3O11A 2PCPA 4ONHA 1CL7H 1XGQB 5E99H 4DKAA 1MVUA 4PGZA 3RWGA 3LKOB 1AO7B 2FLBT 4PJ5A 3VXME 2XZQL 5I1KL 1XGRB 4A6YB 3PQYB 5D5MB 2VIRB 2H32A 2NZ9C 2BY0A 3LB6D 5DR5H 5A2IH 5CCKH 3ARFB 4LCCB 1KLFA 3NFSH 1TIUA 4XVTH 2F5BH 1QLEL 2ADGB 2ZKHH 5CJ8A 2Q76B 3BP4A 2R2HA 3IYLW 5E8NA 2Z31A 3HG1D 4FTVE 4OCLC 4IRSA 3O41A 5EU3B 3FOLA 4LPTA 4HMEA 4V2CB 5DDHA 2CUIA 2RJMA 1VFBB 1JK8B 3QIUB 4XHQA 4R6UA 4G7YH 4PRBA 3T77B 3AY4C 3K4DA 5ADOH 3MTRA 3HMXA 4L9LA 3NTCL 2DYPA 2I26N 3ARED 3QI9C 5C3TA 4I18B 1HHKB 3QJFA 3QAZC 4QNPE 4OF7A 3RWCB 1A9BA 4WI8A 5HJ3B 3SKOB 1LDPL 2QKIA 4OQTA 4L9LC 1ORSA 1DQDL 3VW3L 3S5LB 4ZS7H 3UO1L 2F8VA 1HXMB 4U4BA 4XP6H 3O6FC 4WU7A 3HCVA 3FQNA 3MGTA 3QEUA 1S7QA 4ZUWA 4HD9A 3CSGA 1GGIL 4RIRB 4FP8H 1TXKA 1KPVB 1NCCL 4PRPD 4G8GB 5F9OL 1X3DA 2FZ3B 1QRNA 2YA0A 3UBXB 3D3VB 4K3GA 4EXPX 3VD4A 4AEHH 1N4XH 2XKNA 4RNRB 1EH9A 4HIJA 3IFOA 1YYMH 3NPZB 4PJHE 5DTFA 1BBJB 3JSSA 1NBZB 2DQIH 4OCWH 2A74B 3ILPB 2DQGL 4WV1C 4Q0XL 5IK3A 3RWHB 1M6OB 3RU8L 1CLZL 4MD0A 3WIFA 3SDXE 4G8GE 4XCEB 2KQMA 3CDGA 4X4ZA 1OB1A 1EO7A 2P5EA 1JRHI 3HI5L 5F8RC 1VACA 5L0QB 1T1WB 3C5ZD 5CHNB 1DN0A 3RKDD 4CADA 5E99L 3FFCB 4NZDA 2Q6WA 5E8EB 3O6LH 3RVTC 4NP4H 1E4KC 2VL5A 3CPLA 1BX2A 3K8LA 1C1EL 2EKSB 4PJXA 3V79C 4XVJH 1CT8A 2GSIB 4P2RD 4LHQB 3KXFD 4JFFD 3FONB 4L4TE 3IFLL 5BZDA 3LS5L 1KJ2B 1GAFL 4F7EA 2XWJB 5EG6C 1QR4A 1RK1A 1IC5H 5SX5K 4FQCH 1P9MC 2Z93A 4YHNB 3RQ3A 3MBXL 3BP6A 5DZLA 3EBAA 4G42B 4OLEA 4NQXA 5F71A 4J1UB 2YUXA 3W39B 1PYWA 1ETZB 3ARBC 3SPVA 4HXBH 1IGTB 1S8DB 1PY9A 2AXHA 2IBZX 3ZE0E 3AS1A 4D9RE 3FAWA 5IBLC 2W9EL 1TJGH 1XF3B 3HNSH 5LXGH 5D1XD 1IGMH 3WNOA 3ARBA 1IEAA 2MCPH 1RULH 5JW5B 5IG7A 5BJTA 1JTPA 5L8LB 5I75B 3PWPA 1BQHB 3D85A 4L9DA 2IQAB 4XPGL 3S35X 3N9GL 1AY1H 3FHQA 4G7YL 2A77L 1CLYH 1ES0A 2WIIA 3NIFF 4R0LA 5I9QC 5I16A 2D7OA 1RQ5A 1WZMA 1U3HB 1INQA 3X3GH 1IZKA 3NCYP 1KXVC 3TBWB 3TWCH 1PG7H 3QUMA 4ZYKA 4GFTB 1B4JH 1T04A 5CD3B 3U36A 4F15B 4I5BB 1CDUA 1S7TA 3QRFM 1SJEB 3MA9H 2YOCA 2APVA 3KYNA 4JKPH 5KN5A 2HRLA 3GSVA 4BSVA 3ECBB 3RUGE 2R2EB 3V0VA 4D0BA 3VRLE 1C12A 4BZYA 4G8IA 4PJDB 2G9HA 2KKQA 4WW2F 4JZJB 1NC4B 4BYHA 2YWZA 4NIKB 4NT6B 4KTDL 1UA6L 2BY1A 3EJZC 3GMNB 2Z91A 3AMLA 3HA0A 2EE6A 1AGFA 1JGLL 5SWZE 1NQBA 5JMRA 1QFWL 5F93C 2BMKB 1ZWIB 1B3JA 4AYFA 3PWLA 5JOEA 5F3BB 2IGFL 3SKMB 1RZ8A 3OTTA 4C54A 3JWDL 4LNVA 5TDPA 1KG0A 3S34H 2PCPB 3HMXH 1XGYL 1X9QA 3V6ZA 3RWGB 4UQ2A 1KTLA 2GYSA 3W9EB 3EYFB 2NY0B 1AD0B 2J8OA 4UTAH 4HSQA 4L4VB 3BKMH 3Q48A 3PHQA 3CFIC 4FFVC 3IDUA 5I1EH 1ZVSA 1IQDA 4OM0H 2E5EA 4TSBH 4D0CB 3HI5H 2OCFD 2AJYL 3IDMA 3H0TB 5HY9B 3ARUA 4U1MA 4KKCC 5GRWA 1MJUL 1D6EB 1DL7L 1QBMH 2P46B 4HIEA 4JN1H 3NH7L 2OMBA 3QUYC 4NP4L 1RULL 3NCMA 1TETH 1T3FB 3CAFA 1W8NA 4M1CD 3DI2B 5D7SH 4L1HA 5K9OB 3CXHJ 2PYFB 2APFA 5GZOD 3R1GL 5FUCC 2GJZB 5I8EB 3BIKB 3RAJH 5BOPA 2YXFA 4M6OL 1T0NB 4NBZB 4POYA 1TZGH 3V7AG 4K94C 4OLXL 1LO3H 3UBXI 4OLWH 1P7QA 4M02A 1EGJA 3I02A 3KPNB 3I6KA 4OCRL 1IC7L 5GS0L 4UB0H 3MYZA 4WUUB 4S0SD 3T65B 4WI3A 1LNUA 1FL3A 1MRCH 2VDQH 3I9GL 4PJCE 4W4OA 3TT3H 1ORSB 3H8NA 3S5LA 3RWFB 4Z9KB 3TH2T 3VXUD 1DQQA 1JPTH 3OSKA 4BQ8A 5FECB 1VB9A 3NA9L 3W0WA 4HZLA 1S9XB 1ADQL 4G9DA 5IEKA 1D9KC 2JJUA 1X5XA 3MRCA 3SGJC 1IC4H 5C71A 4RNRA 1RV6X 3TO2A 2YPLD 4XPBH 3KS0H 4DGYL 4JJ5A 3IXTB 2XPGB 4MA8L 4WDIA 5TQ2L 4C4KO 4ELMA 3P73A 4X8JB 5AZ2H 4OI7A 4U2ZA 3S96A 3X11A 3JUYA 4P5KB 3CMGA 5HHVH 4JQIH 1YECL 3GSOA 4NSKB 1URLA 5A2JH 4DUVA 1M6OA 2AV7A 1I8LA 3WBDA 5SWZA 4C55A 1F6AB 1F4XH 3FQWA 4ZDHA 3VFVB 3VFNA 4YLQT 4F80A 4FFVD 1EEYB 2XT1B 2UUDK 5CSBA 3SDAD 2BNRA 4G8EA 4HGKC 4PTTB 4ALAL 4YIQB 1CGUA 2AV1B 5C6TL 1N6QH 1UWGL 3UMTA 3P9LB 1KBGL 4Z95H 4MJIB 4LLQA 1ZT4B 2CRZA 1CZ8H 4P4KC 2J3SA 2VDRH 4GXVL 2RHEA 1I9IL 1B2WL 2QJDA 3NN8A 5CWSA 3ARZA 4PLKD 2FR4A 3PP3H 3NA9H 4RISL 1KJ2A 4DN4L 1FIGL 3F5WB 1RMFH 2V9TA 4UINL 4KK8D 1G7LB 5IF0B 1G9MC 1BAFL 4HDIA 5EO0A 3WXVH 1GZPA 1T80A 2Z93B 2UYLA 4JN1L 4MD4A 1AO7D 3IDIA 5GS2D 1OTUC 3VXMA 3F7QA 5IB2B 5KTEH 1VPOL 5ENWB 5EU4A 3MLYH 1N5YH 5JTWA 5BZWB 4KDTA 2DLEA 1ONQA 4DQOH 4ONFL 2QSCL 3O3AB 3NGBC 5MEPA 5DRXB 1PYWB 3SPVB 5JW3H 3NTCH 4JM2A 2WBJC 3VXUE 1MEXH 1T66D 1OP9A 2OTUA 3TBTB 1BEYH 1UWXH 4M5ZL 4WWKB 1G7PA 2B5IC 4ETQA 5C0CA 3JV4B 5F7NC 1MJUH 1CFNB 4WHYG 3BEWA 3QJHA 5DWUL 4X6CB 4LMQI 2R39A 4KDWA 5IG7B 4R96A 5I66A 5KSAD 3D85B 3RVWD 2WBJA 3MRDB 3BEVB 1T7ZA 3O8XB 3TO4D 3QISA 4LEXL 3I75A 3MLVL 1KJMA 4NRZA 4X6DA 5MERA 4BZ1H 2NY2C 1SM3L 3ZE2E 4FZ8L 2IBGA 2ID5A 3SDYL 1IRAY 2CIKB 4I4WB 5F9WC 4EBQL 4MWFB 3MLTB 2FJGA 5DHVB 3VGGA 2EIEA 5BRZB 4O9HL 3PL6C 2AXGB 3ECBA 3VG0L 4L29B 1RURH 3W9DB 2JIXD 3GMPA 3RVVC 5F44A 4IOIA 3TIEA 2NY6C 3R8BB 4JFFB 3F7YA 3ARXA 5FGBC 4G6KL 1XGQA 3QFDA 2HKHL 2OMNA 4NRXA 3PL6A 2HN7B 4RAUB 4NCC2 2AABH 3CLEL 1ZLWK 3U1SH 4A6YA 5KZCD 2W0PA 2D7NA 2O93L 2DLGA 3CFJA 4UUJB 5TDPB 3DV4A 3GMMA 1KB5H 3HE7A 4QHUB 3ZYZA 3BZDA 1OSPL 1W0YT 1X6NA 4BA8A 1KUMA 2ARWA 3GBLA 3CZFA 2KPNA 1G7QA 2E6PA 3SDCC 3C5ZC 3RKDC 2ORBH 1CD1A 2X40A 3NZ8A 1EPFA 1HE7A 2PTTB 2G5RA 3O41B 2FECI 2R29L 3X3GL 5DHXB 3GMOA 3TFKC 3ZDZE 1XIWA 1RD6A 1YY9C 1QRND 2ESVB 4OD1H 2W0FA 3LKRB 4MA1C 4JRXD 3SDYH 3PWPE 5JNYA 4CN6A 3TEUA 3T2PA 3RZCC 3NCJL 3UBXG 4NO0D 1QSZA 4G8FB 4HFWB 5AWNH 4BH8B 1MCNA 4N9GA 1S9YB 2DWDA 3K74B 3UZVB 3K1DA 3BISA 1B2WH 5C0FB 1RZ7H 4F9PC 5B3JE 1MAMH 3PGDA 3RZCA 3X12A 1WISA 2NY7H 3MACH 5IVXA 5DUML 3G5YB 5F1OB 2Z8SA 1FG2B 1Z5LA 1LEIB 1YEEH 4QRTA 3IJHA 3NCEB 1IGML 3BKCL 1ZV5A 1ZLUK 1WBXB 4PJFB 3MYJB 4HS8L 1YNTA 3AM8A 1P7QB 1QSEE 4XPFH 3BHBB 5EBLB 5FUOH 1NGQL 3KR3L 4G43B 4RMUA 4D0DA 1T22A 4IRZH 1E28A 3MRJA 4MJ2A 4ZFOL 3S37H 4XCCH 5GRJL 1E6JL 5DMJB 1N0LA 5LJYH 3RWFA 2R1XA 2ARJQ 4GG8B 1UQSB 4Q58C 5ICZB 4KQ4H 4P2OC 1DQTA 4PRNA 3DV6A 5I76A 4IM8A 4NWTL 3HNTH 4MAUH 1C7SA 5DUBB 4G9DB 5C6PB 5IB1B 2I9LB 4YHIB 2P5WE 5KSVB 5I19H 3BP7A 3U7AA 4ZD3H 4ZO6A 5CBAA 5D70L 1FAIH 4BJLA 1MH5B 3QSKB 1EV2E 4GAYA 4OZGE 1MPAH 3WIFB 1WWAX 2Q86B 1NFKA 1NAMA 4XCEA 4Y1AA 1P4IL 3A6CH 4DWHA 4PV8A 1KJ2H 4TUKH 3ULSA 4EQ2A 3EO9H 4P4KB 4ELMB 4R2GC 3HR6A 2JE8A 1T1WA 3MR9B 3JTSA 4PJHF 4RMRA 4CDGC 4ZUVB 4NSKA 1KEGL 1HI6A 1M7DB 1IBGH 4HQQL 5T5NG 3KPRE 3R8QA 3I6GB 4GMTH 3VFNB 4LCYB 1BX2B 3TVMB 2EKSA 4PJXB 1EEYA 4Y2OA 2VDOL 1YJDC 1WZ1L 2XIDA 4UNVA 5F7WC 4XPAH 4JPIB 1FYTE 4KI5F 1G9MH 2O5YL 1FNEA 1MF2L 1N0XH 4H5SB 4OV6F 1KCKA 3PGCA 4R4BA 2VWEE 4Y19E 6CGTA 5CIPB 4K7PX 2A9ML 2Y6SD 4XP1L 5E6ID 4LLQB 4MLIA 2FL5B 5C7XH 1KYOK 2E8YA 2VQTA 3T0XA 5IIEB 3KPRB 3B2UC 2YPVH 2IPKA 3G5ZA 2F8XC 4G42A 3N0PB 1OAKH 1I1AA 3K7UA 4X7DC 3SCMA 5IBTL 5KVEL 2D0FA 3H2WA 3PWNA 4NWTH 1GCFA 4MNGE 3FL7A 1AXTL 4YPGB 1BWMA 2AS5M 1YUHA 2IPUK 1IAKA 4E5XA 4HDIB 3OZ9L 5ACZB 4KJPD 5TPWH 1LDPH 3AXLB 2EH7H 4GG6A 3FO9A 1P4IH 3A6CL 5ENWA 3T8XA 1I1AC 1XF3A 5SV3A 3G5VA 2CUHA 4X7CC 4MHHI 2V17L 3FT4B 5GGVL 4Y4HB 3P0VH 1A3LH 5C07B 5JPNB 3ARBB 1JZ5A 5C3LD 4PJBF 5BJTB 3BZFB 1J8KA 4HJGA 2IQAA 4YQXH 2NY2B 1DBMH 2QADD 3WO3B 5BMFH 1EERB 3CUPA 3UDWA 3VU2A 4KTEL 2ZSWB 1V7NL 3DX9B 3IF1A 4KRPC 2XY1A 5BV7C 1U92A 4LRIA 5FKPB 5GS1C 5KANG 1WUNT 5DO2D 5HYJA 1UCBL 2NLJB 4F37F 2HT4D 5AYQA 4RGMB 1J1XH 3TBWA 2PXYA 4QHMB 2X4SB 4NN5B 2EDDA 3BEVA 3TBVB 4PRHE 3QDJA 4LLMA 4KAQH 3F6LA 5ITFB 3LHPH 1YEHL 3H3PL 4PGCA 2Q3AA 3I75B 1HHHA 3O6ML 3HE7D 4DKFL 1I9JH 1P5VA 3MCLH 5MERB 4LSUH 4NNXB 4QRQB 4WY7L 2G9HB 4XP9L 2PXYC 4HJ0D 3L3GB 2ITCB 1A4KB 5E6IB 5B38A 3F12B 3B2VH 4OD2B 2EH8H 3CSYB 4S1DD 4LK4A 3AC0A 3P40A 5DYOB 3T4YB 4FQXA 2EXYD 4GXUN 4HWEL 1LWRA 3BPNC 2H32B 1XH3B 5HI5D 4J3TA 3CC5A 4HS6B 2F15A 5CEYB 4K9EL 5A2KH 2E9IA 1HIML 3SKMA 3MXWH 1G7IB 4GW4A 4LIQE 1JUFB 2WUCL 3QDGB 3GMRA 3B83A 1A7PH 3HI1A 3QULA 5EORH 1ROWA 3L3HA 1CU4L 4MQXD 1H9VA 1U2CA 2VLKB 1SYSB 3DMMA 4JY6A 1DBML 3FOLB 2VISA 1T03L 2XA8H 2BOBA 4TUOB 4UOW1 4LKXB 4ELMF 5DEZA 5KANI 5CMAB 5GHWH 3F8UB 4ZO9A 1Y6NR 2VXTH 1QSEA 5KS9F 3REVA 2W07A 4FNLH 1WBZA 4PJIE 4JFXA 4YXKH 2ADFL 2IPTH 3D9AL 4Y19A 4QY8A 4OLUL 4XP5L 3WNMA 4DKFH 5LKNA 2NY2D 2ZUVA 4GXUM 4YBHA 1AXTH 2FRGP 2B7DT 5EIIA 4NBYB 1HHJA 1U8JB 5SWSE 3BIAX 2Q87A 4EUPH 2W0FB 4FABL 1R3HB 2QKIB 3OG4B 1YNLL 5CEZL 2EH7L 4QO1A 1INDL 4NZTH 3MLYL 4R7DB 4EI5A 3RNKB 4LHUA 3VWKD 2QSCH 1ERNA 3MLRL 4GUPA 1KACB 4WU7B 5DQJB 3L3JA 3HCVB 2W65A 3FQNB 3MGTB 3MOQA 2OJZL 4BM7A 3L3OB 3D3VA 5BO1L 1NGZA 1NAMH 1MCOH 1WEJH 4NDMA 2E27H 4Q7DA 3CZJA 3PWUA 4U6VL 2BERA 2F54A 3UROR 3CFEA 1X6LA 5DTFB 1M7XA 4PJBE 1JGEA 2W59A 1NBZA 1PG7X 1MI5D 2A74A 1T21B 5T1LB 4RGNE 5IEKB 3GSWB 1KCVH 4DUXA 4MAYB 3WEXB 1CL7L 1QACA 1G0XA 3H3PH 3RL1A 2E7CA 1U8KB 1GH7A 1VACB 1JGDA 3WHE1 2YWYA 4CVZA 2D9CA 4Z7NF 3RDTD 3DV6B 3F7PC 1IVLA 4PJXF 4ZXBD 4KMLB 3A6OA 3HAEH 3NCBB 4HZAA 2H6PB 4P9MH 4GRLD 5H37G 5BW7A 1U8QB 5ECJE 4PJDE 5GSRB 4S1RL 4PV8B 4QRSA 2C1OB 1U8NA 5BZDB 3UZQA 4R26H 4YHKL 1YEHH 3JTSB 4PJ7E 1HK6A 1S7RA 2BVOB 2P8MA 1J1OH 3C2AH 4JM4H 5T3ZH 3OR6B 1DE4B 3FO1B 4K94L 3VGEA 2NX5A 1PKQB 4TNWF 2P1YA 1YQVH 4I0KA 3Q6FB 2VLJB 5GGTL 2YA2A 1KPRB 4GRLB 4Z7WE 3KPSA 3ULVC 1I3RA 4WTZA 5ABDE 3QNYB 4PLJD 1BZ9A 2AJSH 5E2WL 1AFVL 4J1UA 5FUOL 3LOWA 4L8SC 4WI4A 1IFHH 3BKYL 1OD7A 2HTKD 3W0WD 5LWYL 3F5WA 1AP2B 2IAMB 4FQ1L 4MCZB 1S8DA 3EYOB 4ZSOE 3BAEL 4U7SA 3U4AA 1CGVA 4WJ5B 5DK0B 1J05A 1MELA 1QA9B 1WK0A 2OR9L 4MXWL 3DIFA 1ZS8B 2AJUL 4QNPF 4ZFOA 4L8SA 1ACYH 4MS8D 5GGUA 1ONQB 2ZUQC 1S7UA 5GIRB 4HH9A 2IH1B 3GZKA 4Q9CA 1P7QD 5D70H 5JQ6H 2ED8A 4R90L 3HB3D 1WQVT 1Q72H 1BQSA 3BN9D 4G9FB 1INQB 4UAOC 4OFPA 1BM3H 3INUL 2BSED 4EUPG 3G5VB 5D7LB 2IPTL 1KJ3H 3BEWB 1XGTB 1FQ9C 4KVNL 4I0PB 4KDVA 1T7YA 2WBJB 4OF6A 2OL3B 3W0WE 3CUPB 5DMGC 4LSRH 2OP4L 4AMKH 4HKXB 2BSRA 2QBWA 4FQ2H 2ITDA 2O5YH 5E9DD 4WUUE 5HHOD 3ES6B 3BKYH 2DQTH 3VFWA 5F6IB 3DTXB 4FQ1H 1U41A 2X4SA 1G7JA 4QEGA 2HTKC 2C26A 3FFCE 2BSTA 3OKLA 5ALBL 4J8RA 1A0QH 3GSRA 2FGWH 1ZWIA 1QQDA 1GPOH 3NPSC 4BUHA 1NLBH 3EZJB 4ZFGL 5DMIL 3T0DA 2VIRA 2XG5A 2C1PB 1ACYL 4LCCA 4BFBD 3CIQA 3LN4A 1P84K 3QNXA 4JGUA 3TV3L 3QQNA 5ANMB 4UQ2B 3DX7B 2AEQL 2D7TH 2CDFA 4QRPA 4HKBB 1MCPH 4JGMA 1YDPA 2HN7A 3C5SA 5H35B 1WSST 1MFEH 2ICWA 1SYVB 3RTQB 3C60B 3DRQA 1MIEH 4UUJA 3FN3A 3HE6C 3TZVC 5HHNA 3VDBA 3JXAA 1YYLH 4U1MB 1GC1H 2IFFL 1EMTL 3DRTA 1NL0H 3O9WC 3KHQA 3DUSB 4JY5L 4IEFB 4XPAL 3M17B 1UZ8A 4XNXL 2CDEB 4NO2B 2CIIB 3CXHK 5KTEL 3UTTB 4Y8DC 2YUZA 5HJ3A 1WFOA 5JNYB 4Y4HD 5BVPH 32C2A 5HVGB 2V9RA 1Q9LB 2DQJL 5GGSB 4P2CG 3RBSA 4I0PD 3D85D 3RL2B 1V3KA 2YRZA 4N0CD 2PO6D 5EB9A 1FBIL 5BXFB 4F7MB 5D1XA 4LDLB 4G6JH 4MNQA 4NZUH 4LF3A 4CGTA 1IL1A 3RI5K 1KIPA 1F4AA 4L5FH 2IMNA 4Y16A 1BM3L 4LL9A 1RFDH 4L3EB 4Q2ZB 5DRZA 1YMHB 3VWKC 4PY7B 1YNTB 1H8OA 4K9EH 5DUPH 3ARSA 2DQHL 5D7JB 2RQ8A 4X99B 3BXNB 1YMMD 4ZTOH 3ILPA 2WQ8A 4MMZC 5IBLD 2XZZA 5DRWB 3H9YA 2VLRB 4O4YH 4NO3A 1TTUA 5HVWA 2Y23A 1HKFA 3ARTA 4QGTA 1QLFA 4NUGH 5ICZA 5DMYA 2D7TL 4EEEA 1LO2L 3ZT6A 2A0LC 3GSOB 4PJGF 4XNMA 4YHIA 3HFMH 3MREA 1VFAB 3F7VA 2G60L 4WEBH 3UTPD 5HYSA 1KTKE 3CK0H 1FC1A 5DJ2A 3WSQL 2VLMD 1T7XA 1OLZA 4LRNL 4N0FB 4MA7L 3AAZB 1R6VA 3I2CL 1NKRA 4W6XB 4C59B 5F97E 4ONGL 4ZUVA 1FFNB 4P23D 2P5ED 2CSPA 2HKHH 2DBJA 1P2CB 2W92A 3CVHH 1BOGB 3MA9L 4IIQC 5MP6H 2JELL 4QRSB 1CLCA 3OAZK 5AZEH 3TVMA 5A1AA 2DBLL 4JO4L 2CUMA 3GSUA 1ORQA 4UT9L 3WNKA 1G7LA 5HPMB 5IF0A 1CGTA 4X9BA 1K8DA 2F58L 3ZDYE 4HJ0C 2QQKL 1UWXK 2W1NA 2A6IA 3R1GH 2VLJA 4KK5C 3SGEH 3GKWH 3U30C 1S78D 4X9HA 4HK0B 3WIHH 4ZFFB 1K6QH 4YK4B 2JCCF 2AEQH 5IIEA 4LLAA 2MWCA 2YN3A 2J88H 5EFIB 4TSCH 4S1QL 1GGUA 1XR9A 2E9JA 3WLWD 1RVFL 2IAMA 4K3EH 2GAZB 1YMMB 2NW2B 5KVMC 2R0LL 3EYOA 5DD5H 4O02H 1KB9J 3NH7H 1MHEA 2YUVA 4ZUTA 1WAAA 4UZGA 4E0RA 4M6NL 1OARH 2ESVE 3T8XB 3MODL 4XNXH 5DD0H 2IH1A 4TSBL 4ODUA 2FD6H 5KSUB 4Q74A 4N0YH 2G5BB 5DURB 2V7NA 3VD3A 4X4XB 1U8IB 1S7TB 2B5IB 3BZFA 4CUCA 5IVOA 5FB8A 5D7KE 4NQCE 1AR2A 4LOUD 3BN9C 4OCYH 3OKOB 4XGZB 5ITBL 1U8LA 4IRZL 1ZGLM 2FWOB 2MHAA 3I9GH 4MX7B 4YBLC 3IDJA 3L1OH 3QPXL 1TLKA 3S36L 1MAKA 4IRSD 4IRJA 2HA1A 4PY8I 3EDKA 2VLME 4WGVB 2XYCA 3WUWA 2HWZH 4GRMA 3SBWA 1FVEA 3KDMB 4ONGH 2HFEB 5I9QB 3TJHC 4OGZA 1HHHB 5F9WB 2GK0A 2HRPL 3QHFL 5HDBE 4PGBB 1ADQA 3OKLB 3TPUA 2UZXB 3VXSE 3HE6B 3TZVB 1KTLB 3GSNL 1AD0A 3L3KB 3B5GA 4GMTL 1FFRA 5D9SA 2D03H 1J1PH 1M05A 3O3EB 2BVQB 4Y4FC 2YD8A 4TPRH 1R0AH 1KB5A 3P30H 3CVHL 3P77B 2CDFB 5C0DA 4NQEA 1AGEB 4ELME 2YPLB 2VLKA 4O2EB 4J6RH 4N8VB 2I60L 1XF2B 1YEGL 5J1AA 5L8JB 4Y4FA 3C60A 3DRQB 1MHHB 5TQ2H 3U83A 4NFDA 1L0QA 3UTSA 3HMWH 4EIGB 3VXRA 5I1DB 5ILTH 4M5YH 5HHNB 2FO4B 1EJOL 4P3CH 1RY7B 5B39B 4TSAL 3REVB 4IRSC 2P47B 2IH3B 2AJSL 3HRPA 4BH8A 4Y19B 5IV2A 3L7EA 1Q0YL 1F3DJ 3C60C 2UZIH 4XB8A 5HGGS 3UTTA 1DBJH 5LXGL 4WI9A 3ZL4H 2H9GB 2IG2L 4H0IA 4WHYH 4TRPL 5F89A 2UY6A 32C2B 4NQVA 4F58H 4HWNA 4JO2H 4GMSL 1Q9LA 2VDRL 4GXVH 4ONFH 2VDNH 3ARRA 5FDWB 3NFNB 2AAVA 5FECA 3QEHA 3RPIB 1ZT1A 4F7MA 1T22B 4NC0B 1MLCA 3CDYA 1QNZL 4MD5B 4LF3B 1SEQL 1I75A 3BH8B 3IDYC 4Y5VA 4K3EL 5E24E 1FLRL 3DXAB 5D1ZA 3DGGA 4ODSL 5JOPE 1F45A 5L6YH 5DSCA 4HCRH 2XPGA 2ZJSL 2ADIB 1XGYH 5EBMA 4V1DE 2I9LA 1OARL 1YPZA 1D9KB 5K9JH 4NO5B 1F42A 4JREC 5C8JB 2AK4E 2AV7B 3AB0C 4Z0BH 3EHBD 4I13B 4KK5D 3VFVA 4F8QA 3LIZL 3DO7B 2NY1D 3BO8B 2EC9U 2VZTA 2YBRB 3RL1B 2EDBA 3UYPA 3LRSA 4DUWA 3V7MA 3RVUD 3MV8D 2BNQD 5B3NA 2CLZA 4LLVA 5I1JL 1RU9H 5HYSB 4QRRD 1NGYB 5DGQA 1XR8B 1RIUL 1CDCA 5JIPA 3WXWH 2GT9B 3VWJD 3KPMB 4M43H 5CWSB 2FR4B 1OF2A 3UC0L 5HHOB 5TF0A 1RZKL 3B9AA 3ZMRA 1MCPL 1U6AH 5MENB 4CAGA 2EICA 2OR7A 5C6WH 5IR1A 5BRZD 4XTRC 5T3XD 2IPKB 3B9DA 2I60H 3D25A 1KPRA 2JCCE 2DMBA 2EXYC 4S1DC 2A0LD 1FGVH 2CMRH 1EHLH 3ZE1E 4OIBA 5AWNL 2PXYD 2ZOKA 1X5GA 2F9BT 1MFDH 4XP6L 1S7SA 2I07A 3KLSA 5JHLH 4GG6B 5DJ6B 1KIRA 4WWKA 3IDXH 3DUUB 4NC1E 3P4OB 5C0CB 4ETQB 1AXSA 3CVHB 2VUOA 4OTXL 1ZS8A 1SEQH 5FA4B 3G6JA 1JE6A 4L8SB 4X6CA 1N4XL 2FLRT 3RVWC 2GAZA 2NW2A 5IROC 1KN4H 3FRPG 2Z4QA 4MXQD 1FZOB 3DX9A 4UTAL 3ZDZF 1V3LA 2IJ0C 1FVCB 1UVQB 1FBIH 4Z8FL 3ARYA 3BKJL 3Q5TA 2OJZH 3GBNH 3UTTD 3UC0H 4NQDD 3T0EB 5IROA 4B0MM 3C08L 1ADQH 2BY2A 4HAFA 3OF6D 3DUHA 3QO0B 3SGKC 1QYGH 4UDUA 1P4LB 3TN0B 2YEZA 4ODVL 5JDSB 3MRKA 3QCVH 1A6UL 4YXHH 2AGJH 4M1GH 4TYUA 1N6UA 1VKXB 1RUKL 2V5RA 4HKXA 2ICEB 5KJRL 4MDIA 1MRCL 4ONOA 1WTGT 1IAOA 4PRID 4LOUC 1YQ2A 3GMPB 2H2SD 5B39G 2MHAB 4MX7A 4I2XE 5E6IA 3H7BA 3ROOB 3IDJB 1T4KB 2MNUA 3T0EE 2XRAH 4LFHG 3T4YA 3WS3A 1QBAA 5CEXA 2VB5A 3PL6B 2F5AH 4Z7WA 3CC5B 5CEYA 1DQML 1MCKA 1WZLA 2FJFA 4JPWL 3HUJB 5E6IC 3WXVL 2ZJSH 3O2VL 4AQ1B 1SYSA 1M71B 2B4CC 4JY6B 1YQVL 3CZFB 2VR5A 4LCWA 5JXEA 2BRQA 3WXWL 3L3KA 3DROB 2EYRA 2WWKO 2PTTA 5EUOB 3LIZH 3T3MF 2PR4H 1BD2A 4UU9B 1QKZL 3B3IB 5DJYA 2ESVA 4LCWE 3WS6A 3OKEA 2NCMA 3VXQB 4YJZL 5FYKE 4EI6B 5C6TH 4ALAH 4NQEB 1ZA3B 4ZMAT 2QHRL 1H0DB 4HUXB 1MPAL 4K07A 4OD3L 2CH8A 5LGHL 3S35L 2H45A 5C0JB 3RX7A 4POZC 2MQ3A 4C56B 1JPFB 3UTSB 3ARQA 4HKZB 5LGJA 4M43L 2Z8RA 1L0YA 2H26B 1YNKL 4WTZG 2YD5A 4R7DA 4TN9A 3G5YA 1EO8H 2XQYG 1A1NB 1FG2A 3ZDYF 5H94A 4NKDB 3TWCL 4XBEH 5DQJA 4ENED 3KVQA 2R2CA 2X4QB 1KN2L 1Q0XH 2XOTA 5I8OL 5EU6D 1UKQA 3D3VE 2B0SL 3WHXB 2ICES 4O9HH 4XP1H 4R90H 4MNQB 4Z76B 4OSUL 7FABH 4X6BB 3L9RB 5EULV 3THMH 3BGMB 5GPRA 4YDVB 3OKDA 5C0RL 2M26A 1UQSA 2MFNA 4U7MA 5JW4N 3N06B 4EIZC 4ZUSB 1U36A 5DUBA 1NEZB 5D1QA 3GSXA 2ARJB 3QQ3A 1MFCL 4PBVC 1CXFA 3EGSA 2CO7B 3KHOA 3LPGA 4K9EC 3P3YA 3FO0H 1NEZG 3LQZB 1IGCH 1BF2A 2OZ4L 4PUBL 1XGPA 3D18A 5CSZB 1D9KA 5CUSH 1FO0H 5D1QC 4KXZH 1ZGLB 4NQSA 3SGJA 3MLVH 2CK2A 5FCSH 1M7DA 1MEXL 2AERT 1XF1A 4PRDB 4XP4H 1WIUA 4KUCD 5C0EA 4KI5C 1NCAL 1FPTL 1K3ZA 2H3NA 2WBKA 4YPJA 4R4BB 1SBBA 4PRHD 3EUUA 5CIPA 1PKQA 4LPYA 3UTZA 2WP3O 2B1AH 1NGYA 2FL5A 4YX2H 4YO0A 4DK6A 4PJIB 4KAQL 3KLDA 4QRPE 4AENA 1REIA 4HW6A 2XRAL 4U1GB 3QFJA 4XCNB 5DLMH 1IGFL 3GKZA 3P4LA 5D7IF 4M00A 5ANME 5EN2B 1ORQB 3FFDA 4XC3L 5DUMH 4G5ZL 3FB7A 5F1NB 1IAKB 1N3NA 4Y1AE 1SJVA 4JPWH 3T08A 2XKSA 1F3RB 1QA9A 4OI9A 1NLDH 4QHKJ 1OY3B 5CJQH 3TO4A 5EZJA 3FO0L 3WKML 4GRWB 2VXTL 4AM0B 3WN5A 2K1MA 2VQUA 3FT4A 2VYRE 4U1SA 2PW2B 4OLZH 5BQ7A 3AMKA 2IEPA 3EKCA 3SGDI 5C07D 1SJXA 5EU5A 3TO4C 4KDTC 3DETC 2FIKA 1JZ3A 4DGIH 3WN5C 3WCYA 4AIXA 4U2YA 3BDBA 2ICWI 2PO6A 3E8UL 5AAWA 1I85A 4U6VH 5DS8B 5JUEL 5CILL 3JWOC 4JM2D 4PRPE 3LEYH 4I0PA 5FEBA 1II4E 4OSUH 1DR9A 3HZKA 1QEWB 3KPRD 4RGNB 1C1EH 4ZODA 1N2RA 3TBYA 3MRIB 1LP9A 3DETD 3E6FB 5I8CB 2BSRB 5E08H 3MA7A 4UBDC 5BV7B 5B22A 4JLRB 1YC7A 1FDLL 1OLLA 4UV7H 3IFLH 3BJ91 1U8MB 5CGMA 1YEDA 2FNBA 4I0PC 5DK2A 1WBYB 3BH9A 1ZGLP 4JRYA 4JRXB 4WFHD 1WCBA 3STBA 1WZ1H 4Y4HC 1BJ1J 1QQDB 4DGVL 3GMQA 4LSPH 1B0RB 2KZ1B 4Q9RH 1CD8A 1MCSA 2OK0H 1XH3A 1D6VL 3RWIB 1A3RL 2GY7B 5IMOB 5FHAH 4KRPB 4DCQB 5IB3B 4PB0L 5I1GH 1JUFA 1I9IH 2RCSL 5TF1H 3HB3C 4HMCA 4ZTPH 5DVOA 1AIFA 4JZJC 3C8KB 1ZLVH 1G9NH 2BNQE 3UJJH 3KPTA 3OXRB 1VEOA 2BOBB 4Z7WB 3MCKB 4PV9A 4HMDA 1KPUA 4M7LH 1A7QH 4I9WD 1RJYB 1UGNA 1OL0A 2CLRA 3QIBD 5FXCH 3WMSA 3UZEA 3G6DH 4JGJA 5K9QI 1RHHA 1IFHL 1RIUH 1KB5B 4W6WB 1UZ8B 3LH2L 2DQEL 4JFXB 4PJAB 3GKWL 3K2MC 2CIIA 1AGEA 4KI5D 5EZLA 2YPLA 4O2EA 3A0OA 1I9RL 4HXAL 4Y4FB 1ZA6B 2OR9H 3G04A 3ULVD 1DBKH 5L88L 2Y5TA 1MFBL 4DN3L 1RVFH 4Y4KC 1LK3H 2FO4A 1FORL 3MQIA 1ZA3A 1DANT 1NLDL 5HGDA 4YXHL 4CKVX 4EI5B 4RGOL 4S1RH 4PJAE 3NAAH 4WW1B 3WFHA 3MNZB 1RZIA 5I74C 2OXHA 4P2QD 1IM9D 1KGCD 1NJ9B 1JPFA 4X9IA 5D1XB 4WHTB 1LO5B 1CICB 4O02L 2ED9A 3L3OA 3QWRD 4M7ZC 3GUTB 2A1WL 4NKDA 4XC1H 1T1XA 1V3JA 3HS0A 4QYOA 5CLWA 3O11B 2VC2L 3BMVA 2X4QA 4GKNB 4JQVA 3RWJB 5L2KB 4Q97A 3BXNA 3T0VA 3LZFL 4Y5VB 4YDVA 1A3LL 3ARFA 3LDBC 1JTOA 4MB5A 3AM8C 1U8KA 1FZKA 2OYPA 4DKDC 3MV01 2N4IA 2JKXA 5DSCB 4GBXC 1F4YH 3MV7B 5IJKA 1BVZA 4OCXH 3QPXH 3L1OL 5ESQB 3G9VA 1C5BL 1XCQA 4LSPL 3OB0K 4OGXL 1FE8L 4OCNC 5KJRH 1EBPA 4AEIL 4HHAA 3PABB 1JZ7A 4M03A 4PRBB 5LCVH 2CR6A 3T77A 1LE9B 4QHLB 1CFTB 3AAZA 1P6AB 2V2WA 5EIQA 1AD9B 1ZGLA 5I17A 4X0KB 5TFSH 1FFNA 1MFAL 2A2QT 3D1MC 1DUYA 2YD3A 1C7TA 4DFHA 3QRGL 2CDGB 2EDWA 3PP4L 5DC0A 2UWEB 4EKXA 4GRLA 8CGTA 2ATKB 4XBEL 3RZWA 5KZCB 5DVKA 3QCTH 2NY5H 2A73B 3JWDH 1FV1A 4IJ3B 4LSTH 5GS3A 4ZXBA 3MRBB 4OQTH 5B8CC 5CAYB 1EVTC 4TPRL 4U1JB 5HPMA 3RDTA 5I8OH 3V6OA 4Z78A 1KXQE 2OSLA 1FL6B 1AGDA 3D39E 4PJGE 4PRAA 4U1HB 1S9WA 2W9LA 4OZFB 1A6PA 4GRLC 4XTRD 1J05B 5CD5C 4ZXBC 1TJHL 1JWMA 3O81A 2VABA 4OZGF 3T1WA 5CJ5A 4KUZL 3V6OC 1L4IA 4X5XB 1ZANH 2XTJC 3WD5L 1MJ7H 5C0GA 4P3CL 2XKNB 3RIFF 1UB5B 3SQBA 5HHPB 1JYXA 1S9VA 5JZ7C 1DVFA 4OCMC 3QIBB 4MDJB 5A40E 3ARDA 4G9FA 2XY2A 4MA3A 1JFQH 4M61B 1IKFL 4J3VA 1BVLA 4OBSA 2VAAB 3DX8A 5F7DA 1Q9KB 2MSPA 4YHPA 4OV5B 3H9SE 5ISZB 1XGTA 2A38A 5BVPL 3MLWH 4UDTB 3B5HA 2WP3T 3EO1A 4JM2F 3KLAB 4F33A 3FAXA 2VLRE 5EU5B 4HC1H 2FIKB 5JA9A 4ISVB 4WEUD 1U8LB 4UB0L 4ODHL 1CDHA 1UH2A 3S3SA 4DKEH 5GGSY 4J3XA 2DQCL 3FQTA 1QFHA 3MUZ1 3FB8B 3H7LA 4MCYB 2BSTB 5C0RH 1KCSH 3JWNC 4P5TC 1SQ2N 3GSRB 5LAXA 3WUWB 3ZKQD 3BQUB 4CW1B 5FM8A 5GS1A 2GCYA 5IVZB 4P59L 3ABZA 4PG9B 4R97C 4Y5XB 1BFVH 5JW4M 3QNXB 1MFNA 1UWEH 2FYYB 1OAUL 1IT9L 3HZMB 4GKZB 4XHJC 2DDQL 2BHZA 2FX7L 4P5TA 5J12B 4NUJB 4N8PA 1H5BC 1B9ZA 3WS3B 5D2NA 1LVEA 3I6LD 3Q6GL 1E4WL 4P2RA 1J0ZA 3MXVH 2YRPA 1YDPB 3ZDXF 4QXWA 4WO4D 5CJXA 1YECH 1OTTC 3MUJA 5EBGA 2A6JA 3BFOA 4PGJA 2DBLH 2DQUH 3SJVA 1H3UA 4FXLA 3VFUB 5JZ7D 4UT9H 5FUCE 1OAKL 4J3WA 4M5ZH 2NPLX 4G6FD 1EHAA 1F90H 1VADA 3ZYOA 2GSGA 1QFWM 3I2CH 1KTRL 3PWPB 1NAKH 5FGSA 1FGVL 3W5NA 1IEBB 5BS0D 3VJ6B 3EO9L 4OFIA 3FN0L 1HNFA 2B4CH 4BK5A 3L6FB 1T89C 1ZTXH 1EDQA 2YXMA 3MLPA 2Y6SC 4JZOA 2CLVA 2MKLC 3QUMH 1KJ3L 4X7SL 4X9GA 4BSJA 1FDLH 4UV7L 3RHWK 3I50H 4I48B 1FL5B 4F9LC 3GRWH 5HYJD 1ODAA 1ZA6A 4CMHB 1JWSB 4M1DL 2WNGA 1MRFL 1BFVL 2AXFA 1LE5A 1PD6A 1NGXA 2X7LA 1MQ8A 3HC0A 1K3IA 4XNYL 4PP2A 3EDEA 4UMGA 25C8L 1T1YB 2IAND 1F11A 1T2QL 4P48A 1QPPA 1H15B 4Q2ZA 5DRZB 5AZEL 1WIPA 3NIDE 3EOAA 3VFPB 4F9LA 5FHAL 1MLCB 2R0LH 5L2JB 5TE7H 5DJ8A 2BX5A 1AGFB 4X99A 2EKJA 5JIIA 1YEJL 1CXEA 1JHKL 1NFDF 4KRLB 5DRWA 1T66C 3WD5H 5F3BA 2F53E 3U1SL 1K6QL 2HJKA 2ZG3A 3BGMA 4D9QD 4C56D 1Q94A 3GHEL 2DYPD 2ZNWA 1VESA 2VH5L 3H6JA 4ZUSA 1BIHA 3C08H 3SGEI 1E4WH 4NJAL 1ZAGA 3NOIA 2J8HA 3MRPB 3NIGF 4AL8L 3GSXB 4L4VD 5DD5L 2BY3A 2APXA 4NFCA 3EGSB 4NN7C 4HLZH 5TDOA 3BRGC 4QOKE 3VRJB 1RZGB 4LSRL 4OD1L 1ZHBB 4PJEE 3WFDL 2YD1A 3CU7A 4K3DL 1AQKL 4RAVA 1E0OB 4Z7UB 5CP3A 5C09D 3X3FL 2GFBB 4U0QB 2DQCH 3PV6A 5GHWL 4LFHD 3VFRB 5K9OA 4NYLA 3U0WH 3IAQA 3S98A 4QHLA 4PJ5D 2FGWL 3BIKA 3HN3A 1JCKA 3QXVA 2DOCA 3SDDA 1UEYA 1KT2B 1RUML 3FFCD 3Q0HA 4J3SA 5B8CB 4RBPK 4XP9H 3LKSA 2A6IB 3GK8H 1NMBH 1AKJA 1YY9D 2LQRA 4GRWH 1IGYB 5J8OA 2DI9A 3CSBA 2IPUG 3QH3B 4HV8B 43CAA 4FQIH 15C8L 1U95B 1OSPH 2JJTC 5FHBL 1X5ZA 3QIWC 5CZXC 3FFDB 1MUJB 4NJAH 3ZKSD 4PRAB 3WFCL 1N3NB 5IOPA 1A0QL 1A6AB 4HC1A 3TJHD 1YEGH 2XZQH 3DUUA 3STLB 5J6HB 1YEFL 4P46D 5TDNA 4U1GC 4A6YL 1W0WB 2VL4A 2PUQT 3NVQA 5C0IA 4X5XA 2XN9E 5J6GB 3QXWA 5CFHA 2HJLB 1R0AL 2V7NB 3TA3A 2Z4QB 5D5MF 4X4XA 2B2XH 1FZOA 3QIBA 3MV9E 5TE4L 4JFQA 5C0BE 3RVVD 2EDXA 2X1OA 2EE3A 4KPHL 3DVGB 1JPGB 2XN9A 2J6EL 1HSAB 3DX8B 4XNUL 4C58B 3BE1L 3D9AH 4YNYB 2NY7L 1TFHA 3FQWB 43C9A 4NO0A 3VG9B 2V2TA 1W72A 4L1DA 1N8ZA 1F6FB 5E1AA 2MCPL 4QRRE 3HZKB 1ZHLB 2BNUA 5E00A 2ICEA 1N64L 3T2OA 4JO3H 5CEZH 3PWJA 2AI0L 2HTLC 2YC1B 4GW5A 4XVSH 3CJJA 1ZLVK 3X3FH 4UT7L 1RFDL 3GDBA 4JFYA 2EEAA 4MCYA 2FBJL 5CEXB 4PGBA 1WCBB 4BQ9A 1NDGA 2Z0BA 4HCRL 4DGYH 3V7AE 5IJVB 4NC1C 5D9SB 3RPKA 3QEQE 1NCAH 1EAPB 3SJVE 1X4XA 2BVQA 1L7TH 1KSRA 5JOPD 4LEOA 1IAMA 4MA7H 5DVNA 2JJSC 4QOKD 5EUOF 1QHOA 3OQ3B 1Q9WA 1V5JA 4LPXA 3VXNB 3DPBA 5BZWA 3O3AA 4R0LC 3VI3F 4HWZB 3GRWA 1GOGA 4N8VA 4OKVB 4WEBL 1I1YA 2DM7A 4TQEH 5K9KB 2OTUB 3SJVB 3VFUA 4RDQG 2VMFA 1KEML 4OLVL 2FATL 1LDSA 2XTJD 4Z0BL 3RRQA 4JE4B 2VXUH 2VKWA 3O9WD 4KKLC 2X89D 3GHBH 3LEVL 4APQC 2EYTB 4YDIH 1SVCP 4UT7H 3O3DA 1CFQA 2D7MA 1HCFX 1J12A 4L8DA 4X6DB 1GGCL 1CYGA 5KSAA 5CZKA 2L7UA 3P11L 1QBML 1MVUB 2CIKA 1EFXB 5EO9A 1HQ4B 3MODH 2JTDA 1UH4A 4MD5A 5T3ZE 5JHDB 2AXGA 5JQHC 1RHFA 3UPAA 3VWJB 3Q6GH 4OFYD 4B5EA 4CVXA 1T1YA 1MQKL 4YXLL 3MXVL 4Z7WF 4HWBA 5MP6L 3TNMA 3HC4L 4N0UB 3WFCH 4W68A 2ADGA 1UJTA 2HLFC 4QYOB 4QOKA 5C09E 4R8WL 3F7YB 1NGPL 3LEYL 5D1XC 5E8OA 2EEDA 3QYCA 1CLYL 3VXMD 1OP5H 5DDHB 1VFBA 3MOAL 3QPQD 2FATH 4CBPA 1D9KD 3OAUH 5IHZB 1MIML 3CFJB 4GBXD 1D5BB 1J8HE 3QAZB 1YA5A 4XVSL 1Q94B 4RMSA 3SY0A 1TNMA 1JGLH 1XGPB 1FZKB 3D18B 5TE4H 1D6VH 4M93B 1TZIB 4AZ8A 5FO9A 4L9LB 3MV7A 1MWAH 3VA2C 5AD0A 2YD4A 1XF5A 4Z6AT 4N9OB 4U6XB 1BBDH 1Y6MR 3VGAB 4FOMA 3TYFB 3VMOA 1KIQA 4KJQC 2PN5A 3P9WB 4KK8C 4Z7QF 5CEZD 4D9LL 5L2KD 2LTQB 2RIKA 3UYRH 4PLKC 1OAZL 1J1PL 4M4PA 3SDAA 5I1EL 5CBEA 5C08D 1X44A 4XVTL 2GK2A 2YSSB 3IETA 4NJ9L 4P4KD 3DBXA 1IJ9A 2GFBA 4PS4H 4HFWA 4E41A 3S37X 2AABL 1LO0H 3CLEH 3KPOB 1DQMH 2HRPH 3MROB 4POZD 4YHOH 2ATKA 4M1CC 1DL7H 2PTUA 3C2SA 2NZIA 3QUYD 5EORL 4QXGH 3UBXA 3QIWD 2DJSA 4JKWA 1TCMA 3VXTB 3QQ9C 4QRUB 4HIJB 2EXWD 2OSLB 1AGDB 1N26A 1WBXA 2ORBL 4PJFA 3CDCA 3DYOA 3TV3H 4ZPVB 4F7TB 3HPLB 1AKJB 5EBLA 1BBJA 4JZNA 5MEOB 4FMKA 1E28B 3MRJB 2IANB 3QQ9D 3QH3A 2VDPL 4ZFZA 1HOCA 2XTJE 3O2DH 2VABB 1KJVA 1MQKH 4YXLH 4MJ4A 5T5NF 1MUJA 1OAXH 1FFOB 3S34L 4OZ4A 2R1XB 5F7UA 3V5DB 4LMQE 4M6ML 5DJ0A 5EZOH 1KNOB 4HBCH 1MJJA 3KAAA 3ZSTA 5D7LE 5I73C 3ARDB 4D2NA 3BGFB 4PJIF 4YR6A 3FFCA 2Q6WB 1DEDA 3BP7B 3VCLB 2PO6B 1UM4L 2NXZC 1F8TL 1MY5A 3OAUL 5F7DB 3R06B 5EOTB 4HF5H 4LQFH 2Q3ZA 5DVMA 4W70A 3E6FA 4XAKD 2XZAH 1AXIB 4RBPH 3EO1B 5DQDL 2CGRL 4ZO7A 2R1WA 1U8MA 3V8OA 1JNNL 5EBWB 2B0SH 3FB5B 2ADJA 4ENEC 1CGSH 5GGRY 1JNLL 5E5UB 3BP6B 5I1LB 3FQTB 4PJ7A 4YC2B 5E1AB 3CFDB 1ITBB 4K8RH 3WO4B 4Y5YB 5JO5B 1ZHLA 1JHTA 2NMSA 3IVKB 4ELKA 3RNQB 3W39A 4AEIH 2DTSA 1P69B 5L2KE 4UBDD 3MUY1 1CE6A 5IVZA 3MBEA 1FSKB 3UEZA 3EFDH 4PG9A 3U0PA 1DCLA 2G2RA 4JDZA 5FYKU 3DVFA 5I1JH 1AC0A 1JHLH 4DVRL 3BN3B 1CFBA 4JM2C 3O4LB 4NQDA 3LS4H 2E3VA 2R0KH 3U46A 3B9KA 4GKSB 5T1KD 5EU6B 4CMMB 4P49A 1EAPA 1A7RL 1CL7I 4E5XB 4PJ9A 1Y0LA 2HFGH 4UU9A 2J7LA 1ES0B 4PJBA 3LS5H 1NMAL 4MMXC 2JIXB 2A6KA 5IFHL 4PJAA 2D2OA 3D87B 3RY5A 1CBVH 2VDOH 2DAVA 2EECA 4ODSH 4XPBL 4ZYKB 4PJ9C 1QSVA 2EIDA 5TGBB 1Z2KA 1MHPH 1OAZH 3WFBH 2IC2A 3LMJH 2EIZA 3ZE2F 2YD9A 4HXBL 2CJUL 4PJDA 4YEFA 1CXHA 1FP5A 2AK1H 1CD0A 1G9EA 1RMFL 4MQ7A 4HG4K 5C70A 3VWJC 5J11B 4X5WA 1I4FB 5C08E 5BS0A 3D39B 5F1SA 2EDHA 1BAFH 3O3DB 3TJEL 1AI1H 1NCNA 1U8OB 5FO7B 2FBJH 3K3QA 1F58H 2HH0L 5FGBA 1UB6B 4LLWB 1RUKH 1FVDA 5MHSE 4X6FB 1JN6B 3IFPA 3LSOB 3PWPD 1VEMA 3BPCA 3T3PE 4PRHB 1VHPA 1JZ8A 2WUBH 4R7NA 3EYVB 1TPXB 1BIIB 4XX1G 1Y6KR 4GRWF 3P0VL 4OZFG 1ZXQA 2AVGA 4MNHB 4OD2A 4EN3A 3L5JA 1J5OH 3OX8A 5DYOA 3SDXB 2FH6A 4M93C 1A7NL 1IQDB 5E2VL 3ULVF 2C9AA 2EC8A 5DQ9B 2GY5A 5IMKA 4U1KB 4JFHD 5ESAA 3QCVL 3H9SB 5ISZE 5HHMD 3OR7B 3LQAL 4WVRA 3BP5A 3FQUA 4YFLI 4NKOA 2NW3B 2BC4A 3OPZH 5D7JC 5DFVD 4Y5VC 4JY5H 4TUOA 1A7RH 3LDBB 5IHZA 5IWLA 5KOMC 3PABA 1QLEH 5CMAA 3IAGC 1KLGA 3QXTA 1BZQK 4QTIL 2NTFA 4PJEF 1UH3A 4LKCA 1LD9A 4KJYB 5T3ZD 2J6EA 1PSKH 3KXFA 4KZEL 4M1GL 5DFWH 5GGVY 4Z7VF 4AIZA 4E9LA 5JUEH 4XXCA 4F9PA 3MRQA 2VXQL 4BK4A 1A8JH 1EVUA 2BVYA 3N50A 4U6XA 4Z7UA 2BDNL 1W72L 3ZDXE 4KROB 3T4AB 4G6MH 4PJIA 4BKLA 2OX5A 1EK3A 3LV3B 3O2DA 4QGYA 3MO1A 3MUGA 1T6VN 3MJ8A 4Z78B 4GSDH 5CZVH 4FQHA 1T0MB 3RNKA 3TIDA 1Q0YH 3PXJA 4HPYH 4P46C 5HYJE 1CBVL 5SWSB 1KEGH 3K4ZA 1A6UH 4Z5RA 4H1LG 4M7JL 1S9XA 1DVFD 3O2WH 4QLRA 3B6SA 3Q3GB 1VA9A 2WK2A 4YHYC 4I77L 2E7LC 4CRPA 3RVUC 2Q8AL 2R0ZH 2F8OA 2QLVB 3JV6B 3W82A 5GS2H 4HPOH 1OTSD 4XVUD 1U58A 3BGFC 1UB5A 1UA6H 1KCUL 3PWUB 3ZKNC 5IOPB 4QTHB 1OPGL 1XMWA 2GTWB 4M61A 3S96B 4OZFH 4PRPA 4U3HA 1CXKA 3N1GC 3IAPA 1Q9KA 3V4UH 5ISZA 1W0WA 3UJIH 3IJYA 4GQ9H 1MWAL 3DO3A 1I3GL 4UDTA 2HJLA 3BDYH 1ZOXA 4Z7VB 4LLDA 2Y9RT 5TE6L 3LKNA 4N90D 4NQTA 3N1FC 2XZCH 1GOFA 3O6FD 1N6VA 3TESA 3PHOA 2H6PA 4K8RC 4KQ4L 3U9PL 3R06A 5DK2B 3DSFH 4LHUG 3FB8A 4PYHA 4HFUL 2EDFA 3VI4F 5E2VH 1LO4L 1U8NB 1OP5K 2H2SC 3VGHA 3QT2A 2ZP0T 4KZDL 3CLFL 3QUXB 4W81A 1UT9A 3SGKA 1QBLH 3RIFK 4PJ7B 1IGJB 3GSQA 5D2NB 2KZWA 4L4VE 4P2RB 1JHTB 1OPGH 4LARL 1PKQE 2YK1H 5DRXA 1ZSDB 3V6FB 5FKAA 4Z0XA 1CE6B 1GSMA 4FQCL 3MBEB 2G60H 1KF9B 4YC2C 3H9SD 3MJ7B 1RHHB 3LY6A 2YKLH 3H3KA 2UUDH 3VXNA 4YHML 1CZ8L 3I3EA 2AJZB 1T5WA 5LCVL 3BT2H 2AKRA 5GIRA 3B9KB 1S5IL 2VZOA 4GKSA 2V5TA 4Y4KD 4C4KT 5IW1A 4Z7UE 4OJFH 5E2TH 3G04B 4QTIH 15C8H 4P2QA 3PP4H 4BQBA 5K9KA 4G5ZH 1LO0L 1EZVY 2WBWB 1F2QA 5JXEC 2HJFB 3SDCD 2VZVA 4HS3B 4MWFA 1T03H 2YN5A 4NQCA 5IQ9A 3IU3B 1FZJB 2H32H 3K80A 4TTDC 5CSGA 1U3HD 2ITDB 3BKJH 4U49A 5LQBL 1FPTH 5FYLL 3MRNA 5FYLD 3ZE1F 3ES6A 1C08A 4C83A 1OSZB 2BVUA 2P5WA 4D8PA 1OP3K 3IS1X 2AGJL 5IFJA 1FNSH 3QHFH 5JQ6L 4XCYB 3VFTA 4HGWB 5ETUA 4WFGD 1J87A 3OKNA 1A6WL 2C1PA 1YNLH 3W2DH 5C0AB 3IU4L 3WIIH 2ZUXA 1BIIA 3GBMH 3QDAA 3EHBC 5E2TL 3MRPA 1RJLA 4HKBA 2YHGA 2Y36L 5J0BA 3PHSA 1R3KB 3LN5A 2BOCA 4ODXA 3E8UH 1CICC 1XIWB 4LLUB 3S4SG 5IMKB 4U1KA 1R24B 5E0QA 1K5NA 5KS9E 1D5BA 3LKRA 5HYEA 4DJMA 2E27L 3QB7C 1CFTA 4NBXB 2FECL 3BP5B 3U6RB 2X4OB 3GIVA 4OAWA 1CLOH 3KYMB 4HIXL 2P7TA 2RFXB 2Z35B 4Q6IC 5E9DB 4HIIB 1XF4A 1XT5A 1MCDA 5CP3H 1XF5B 1PG7L 2YK1L 2X4TA 3FZUD 3QA3A 1SVZA 4MAYD 3ZE0F 1V7NH 2AJYH 3HI6H 2NTFB 1X5KA 4ODVH 2J4WH 4QWWD 5F96H 3FRUA 3RDTB 2OK0L 3L3IA 1DANU 2K7QA 4Q6IA 3MRQB 1ZVHA 4GBXB 5F7MC 3DGCR 3G6DL 5IKCA 4KQ3H 3QCUL 1OTUD 4F3FB 5JXAH 4NWUH 3RIAF 3B9VA 1MCLA 2ZCLH 1ZEAL 2EIBA 3VWKB 1IGYA 1NFDA 5DJCA 4HV8A 43CAB 4NQDE 3UJJL 1J5OL 4X5LA 4WCYL 5C0GB 1KTDB 3QZWG 2C4FT 4GG8A 3DURA 2IF7A 4X7EC 4HK3N 5C0CE 4XPTL 1P5UA 1TZHB 2P42B 1K4DB 3LPFA 1JGVH 2NNAA 3DXAD 3AS3A 3NCJH 5IB1A 5GGTH 3ZKXB 1VGEL 1RURL 1UACH 3D6GA 1QP1A 2VAAA 3RKPA 2VDQL 4FA8A 4OCSL 3BKML 4KK9D 3O6KH 2BCKB 1MI5B 1XCTB 1BFTA 4RFEA 2WUCH 4NO3B 3D0LA 1G9NL 3QEQD 4P57B 1INEL 2E8ZA 3VDAA 1MJJB 3VD9A 3B8YA 3M1BB 4RWYL 2NXYB 5DJAB 4YNYA 4NRYA 3MREB 3U9UA 4TRPH 43C9B 3U0TA 4JPVH 3S35H 2OXGA 5I8KH 4NO0B 4B7IA 4X6DE 5HI3D 3GNMH 5BRZE 5F8QC 1VGKA 2E9WA 1KCVL 5LAXB 1FNHA 5F7FA 3RAJL 4PJEA 3D0VB 4UOJA 2PO6C 3U48A 1I85C 1LO3L 4Y5XA 4JFFE 4X7TB 4WFHE 3VG9C 4HWBL 4Y0GA 4PP1D 1D5MA 1A1MA 1KN2H 3L7FA 2WAHA 3ARWA 5C09B 2Z92B 3PWNB 4OB5H 4P2YA