2PKDA

Crystal structure of cd84: insite into slam family function
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
EIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of CD84 provides insight into SLAM family function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords SLAM family member 5
total genus 26
structure length 107
sequence length 107
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2pkdA00
2B5IB 4OZFH 3PHOA 1FBIH 2NXYD 5SWSA 4LRNL 4F7EA 1G84A 3CCHA 2H1PH 4LHUA 3I84A 1WFNA 1X4ZA 3HS0B 5IW3A 5CJOL 3AAZA 3RX8A 5E1AA 4QO1A 3CMGA 1K4CA 4ODVL 4XPGH 3QQNA 4WHCA 1DE4A 1NL0L 4Z0BH 1VDGA 2EDRA 3DYMA 3DMMC 4C58B 5CP3A 5EU4A 4F7TA 5TE7L 1P4BL 2R69L 1KB5L 2QADC 1RULL 1NFDB 1LP9B 2ADFL 4FQ1H 3RNKA 4ORGA 3RDTC 1X5XA 2VLJB 2HKHL 4BQ9A 3QEGL 1QSEA 2BDNH 4DOHE 4S0SD 4Q9RL 4GJTB 4OCRL 3TPKA 2IANE 4U1JB 5EA0L 4OLVH 4UAOC 1T03L 5J11B 3FN0H 4OIIL 3RWGA 3G04B 4X4MA 1EX0A 4L1DA 2X40A 4U1MB 4JR9H 2X89D 4WW2C 1N3NB 3UTZA 2IWGA 1HWHB 5D2LE 4KDTC 3FO0L 1FC2D 2HTKD 2R2HA 4JFQB 2VWEC 3QDAA 2HFEB 5F3BB 3KR3H 3QUYB 5IGXH 1J05A 1MIEH 3Q6GH 4P48A 3E0GA 3TNMB 5CZVL 5FOBA 5ISZE 2YEZB 3HB3C 3FQUA 1UWEL 1DSFL 3WO4B 3LPGA 5JW3H 2RHEA 3B3IB 3X12B 3EDEA 4MXQD 3OKLA 3QPXH 4IHOB 3UTPE 4H8WC 4M7ZB 5DMIL 5MEQB 5GGSY 4FQLL 4NM4H 3DVIA 1WCBB 1EO8L 5H37G 1KCRL 4NOBA 3WFZA 1A9BA 3S96A 5C2BL 4RMQA 4F58H 1T1XA 4OZIA 3GMPA 4MAYB 4UIKL 3DX8A 4L3EB 4D9LL 2O93L 4J4PD 3WS6C 3S37X 3HZYA 2IQAA 2P24B 4XH2A 3G6AB 1CGTA 4QRSA 3UPRA 3TCLA 5JHDA 5DMGD 1S7UA 1G6VK 1T03H 1EFXB 3OV6A 3FT3B 4MNGE 3WHE1 4C4KO 4P9HH 5CHNB 1DANT 2NLJA 2J8UE 2FWOB 2NY2C 5JMOC 4JG1L 5JLZA 1HHIA 1OGTA 5BOZG 1U41A 2VLLA 3NAAL 3QISA 3FFCD 1DN0A 1SEQL 1PDKA 3ALPA 4G8FB 3EFFB 3ULVL 1H5BB 4J2XA 1V8HA 1DLHB 1LD9B 1UEYA 4WI2A 1JFQH 3GGWA 3IDNA 1KPVA 3NCCB 4YDLB 5EBWA 3HB3D 3O4LD 1ROWA 2FLBT 3ZT7A 4WNQB 4Z76B 3B2VL 3TZVA 1RZKH 1BP3B 5I73B 3WYRA 3VGAC 1XZ0A 4M03A 4XAWL 4L9LA 2CJUL 3HPJA 3MRJB 4MJIA 1DUZA 5D1ZA 2CKBB 4R4BA 3O8XB 2PTTB 1MCKA 4WWKB 4Y19D 5CWSA 1N59A 3GMOB 3VXRE 5D9SA 3QPXL 1D6VL 1XZ0B 4JFFA 4XPHL 1C1EL 3WIFA 3MV8E 2X1QA 3MNZB 7FABH 4GUPB 3GEWB 1CDCA 2DN7A 3RDTB 3L3OB 25C8H 3EYSL 5L8JB 4ZPVA 2JJUA 1A4JA 3N06B 1MCOH 5DZLA 2JJWA 5FIEA 4NQCE 4PJ7A 5EFIB 3BJLA 1T7YA 4PP2B 2HAZA 2WAHA 5CP7A 1CTOA 1WAAF 4V2CB 4O02H 5JXAL 4UDTB 3BPOC 4R96A 3TJHC 1KLUA 2L7UA 1V7NL 3A67H 1BZQK 4L8BA 3EFDH 1BECA 4V1DE 1FP5A 5D1XD 3ECBB 2DQFA 3CVHL 3SDDD 5DD1L 3EOAB 1MRDH 3BX7C 3DX8B 2H26A 2PO6D 3BQUB 1P4LB 5D71H 3WLWD 3F7RA 3FQNB 3MUZ1 4UTBL 5C0BA 2QLVB 3KPPB 3EO1B 3KDMA 4EVNB 3BH8A 4TTDD 5D1QD 3WE6B 4OD1L 3RVWD 4PGBA 4P4KC 3WFEL 5IKCB 1INQB 4KRLB 2B2XH 5HHOA 1W2KT 3DSNA 3EYVA 5F3HB 1OOAA 3IFPA 5I1JH 4G7VL 5FCSH 1UFUA 4MDJA 1TFHA 3SCMB 5SWZB 1X5YA 4U1IA 1OSPL 2KQMA 3D0VA 4P4KD 1N26A 1MI5D 4M3KB 3SEPA 5IHLB 4OZFG 1F90L 1ZA3B 1FFOB 3GGWB 4NCC2 3V0WH 2X2YA 2O5YH 1KJ2B 1QSZA 1N6QL 3MOAL 5SWZA 1CD1B 3VXMB 4OUUA 5MHSE 2HJFB 1LDPL 4XBEH 4PJFF 2HVJB 2VISA 4PJ8A 1JZ7A 3I50H 4GAFB 3WMSA 1L7IH 4GFTB 4QOKD 1CD0A 1KEMH 2YRPA 1YMMA 2XQYK 4X80L 5CEYA 3ARGD 4UI2A 5B39A 2J8HA 5E99L 5HXMA 5TF1H 3GM0A 2V2TA 4HFUH 4YHMH 1WGOA 2A6KB 5J0BA 2EEBA 4WW2B 3HI5H 3HUJA 1EGJL 5EBLB 5GIRA 3MMEB 1C5CL 1MHHA 4HUKB 4OF0A 4KHTH 1NDMB 1XGYH 5CP3H 2CUIA 3G5VB 5DT1L 5H2BB 1KUMA 3KPTA 1YJDH 2ESVD 3C60D 5F6IB 1FE8H 3LCYA 3CU7A 4YNYB 3PWPD 2NY3C 3TT3H 3DO3A 1AKJA 1U3HC 4HK0B 3UPCA 3QH3B 3TBTB 5F1OB 2Y5TA 4AEHL 2BSED 5HDQH 1S9YB 4PRPB 5B3JF 1YY9D 3I02A 4NZUL 3IVKA 4OQTH 3U48A 3UTSA 4CUCA 4FQPA 1JYNA 2DJ4A 4JKLA 3KYOB 1A9EB 4EI5C 2J6EA 4JQVC 3PABB 1IGMH 1D5MB 1E27A 3FO1B 1GOHA 4HMCA 1VESA 5FV1L 4YBLB 4PJ9D 2I9TB 1LK2A 3FOLB 4XBEL 4C56A 4R3SB 5JDJA 1OY3B 4FRWA 1JGVH 3FB8B 3PP3K 4Y5XB 2HA1A 2OZ4L 3FCTA 4YDJB 2FNBA 1T1YB 4XZUB 3S34H 2X4SB 5KG9A 1F90H 2PNDA 3PWUB 1D3CA 5L2JA 1J8HE 5FB8B 4NO2A 2O5YL 4UT9L 1TJGH 3WIIH 3V5KA 4QHUB 4IDLA 4QKXB 3S37H 1FYHB 1OQOA 2OBGA 1IVLA 2XV6B 1A6WL 4KAQL 1U8PA 2VR4A 4I1NB 4EXKA 3HR5B 3KPRB 1A5FH 4JFXB 2BRRH 2H2PC 1WT5C 1RZ7L 3HA0A 5JQ6L 4UNTA 2H8PB 1E4XI 3CXHJ 4PREA 1LILA 4HFWB 5FGCE 2XTJD 1A1MA 3OAUH 3P40A 5IT2H 3I6GB 2D7TL 2F54B 1MLCA 4TPRH 1SVZA 4LPUA 1IGIL 4JRWA 3MV9B 4E42A 5F70A 3STZA 4WENB 1M1SA 4XP5L 3OAZH 1JZ6A 3BPCB 1NLBL 1JPTL 1NGYB 1FNHA 2GT9B 4U3XA 4LPCA 4J6RH 2ZPKL 2CR6A 3IF1A 2MWCA 4GKSB 1G9MC 4F9PA 2VDLH 3WFBL 1WICA 3CFEA 5TDNA 1VGKA 2XQYG 4RFOH 5BQ7B 1FC1A 4PP1C 3V5DA 2AKRA 1GIGH 4LDLB 4XRCA 3MYJA 4GAJH 3DXAE 5I8KH 5JXEC 5L9DH 4GS7C 4JKPH 4LMQE 4GKSA 1ED3B 2OR8A 2NX5A 3DHJA 5KN5B 5C0DB 1T5XA 4X0KB 4S1RH 3RUGE 3DVGB 3PG2A 5E8EA 2ITCB 1P1ZA 1TTGA 4HC1H 4HK0A 4MNQB 5JW4M 4LLWB 5FUZH 4ZUUB 4G6JL 3ARFB 3D3VA 1IZKA 4KROB 3MYJB 3NCMA 4MA7L 5F88A 2Q76B 4KKNA 4FS0A 3TPUA 3U1SL 2PW1B 3EJZD 1UH4A 3I3DA 3V6BR 3S36L 2VDQL 3DVGA 3BP5A 2NR6C 2R69H 3BI9X 5DFVD 2X4OA 4U6VH 1PY4A 1OARH 1YEEH 4LLUA 3U7AA 1FAKT 2CGRH 1R5WB 3QB7C 2Q76A 1PKQB 1AI1H 4Y1AD 5J89A 4OM1H 5B4MC 1T80A 2X9WA 3PNWB 3PWUA 3FZUD 2IFFH 1RMFL 3OXSB 4LEXH 4ZFFA 3ZMRA 3CCHB 3BDBA 5EC2A 2QSCL 2ZJSL 4YXKH 1HXMA 4X6DB 1V5JA 3DNKA 3MA9L 4WI3A 3LS5L 1JHKL 5D1ZC 4P0DA 1F42A 4KY1L 5I0DA 4PLKD 4LSTH 4R0LC 1B2WL 3NH7H 3MRNA 3WNOA 3X13A 4N0UB 2XWJB 2NY6C 2HLFD 15C8L 4N8PA 4HD9A 4YC2C 1MFBL 1IFHH 4I9WD 1I4FB 4K8RH 3AB0B 4LLMB 1YEKL 1FCCA 2XZCH 2YBRA 5ESAA 5IROA 3IGAA 1SMOA 2EDWA 4UT6L 4DFHA 3ROLB 4HHAA 1I1AB 3RAJH 1JHLL 2A73B 1CIDA 4GAYA 5ILTH 2W92A 5C0IB 3MRDB 1QBMH 2NYYD 2EYTB 1AXSB 4OZ4B 2E7MA 2RQ8A 3NIFE 1DQJB 1EJOL 3LEVL 5EU5A 3PXHA 3D87B 3MRQB 4OM1L 2I26N 1F8TH 3T77B 2GITB 3J7HA 1FL6A 5H8DA 4DZ8B 4YHNB 5C0FB 4V1DB 4EIZC 3ULUD 1X6LA 5C0EA 3P3YA 3VXUE 3SDAA 3GM8A 4AL8L 1LEKA 3EKCA 4MX7B 25C8L 3EYSH 1AY1L 1NBYA 4EN3C 3X3GH 4NJ9L 4X7DC 4ZAKD 1S7QA 3T2NH 2QADB 1KTRL 4DZ8A 1BF2A 3PGCA 4R4NC 1XR8B 2W1NA 3IU4L 1BD2A 1U6AH 2UWEE 1TCMA 1YYLH 3O3UN 1HSAB 3UPAA 4WV1B 1OW0A 5A2LH 5SWSB 3PE9A 3DUUB 3V7AE 1KSRA 1IEAB 3CDCA 3OKOA 1XF3A 4WFFD 4BKLB 1QR4A 5F1KC 3BAEH 5GRVL 1AGFA 3WO3B 1HKLL 2E9WA 1XH3A 1N2RA 3FONB 1SQ2N 3MRRA 3VMPA 4XNYL 3TCLB 1NGWB 4LLQB 3NZHH 3WNLA 4QRRA 4HUNB 1JGEB 3S3PA 1E6JL 1KV3A 4I48B 4PJ7F 1A1OB 5BV7B 3WXVH 4IS6A 2GJ6D 3HLAB 2A83A 4H8WL 2OR7A 3P0VL 4UQ2B 4OT1L 3QDME 4G8GD 3ROOA 3NFNB 1LO5A 3WXWL 5BRZE 3SDXE 3ARGC 3V9FA 5DTFA 3WO4C 2A9NH 3TIDB 1JI2A 5E6ZA 5CKGA 4HEPG 5TGBB 3K1DA 3LAFA 3O4OC 4QGTA 1N5YH 4J3WA 5IFHL 2BY3A 5C0CB 4DK3A 4CL7A 3LKSB 2A83B 5LBSH 3P0YH 5HGHA 1DLFL 1FH5L 4HWZB 4LVNC 1UB5B 4RRPA 1PKOA 1MUJA 3JV4B 1H3WM 2R1WA 5FCUH 3LS4L 4CADB 5EIIA 4ZAKC 1K8IB 1VFAA 3MLZL 3D9AH 1FGNL 4K3HA 4BZ1L 5ITFA 1YYLL 3SJVB 5JOPE 4KUCD 3VFNA 3EYUH 5I16B 5HHOD 3N1MC 3MRJA 3BDYH 4LP5A 5HVGB 1G7LA 4QXGH 12E8L 1YNLL 2R1WB 3LN4B 3O2WL 2DQIL 4LCUB 3NCYS 5EOQL 1G9NH 3ZDXE 4GO6B 5IM7A 5CZKA 2MKLC 1T2QL 3VFNB 2C26A 2BX5A 3BKMH 3TA3B 1QKZL 1R5VB 3WLWC 3VH8B 3NABL 3NPZB 4M62H 3W82A 4TUOB 1LEKB 5KSAC 4XAKD 4I2XB 2NY1B 2PXYC 1DN2A 4PJ7B 5EFIA 4MD5B 1L7TL 5F7MC 4QOKA 5IB1A 3FQXB 3HZVA 3HZYB 2WBJD 4M6NL 2F53E 1I85A 4QRSB 3E6HB 1KLUB 4MA3A 3VH8A 3ABZA 5E2TL 4LNRB 1IAIH 3NCBB 1C16B 4XC1H 2FHCA 3U7YH 3UDWA 2DIBA 3QP3A 1MREL 1RFDL 4QRQB 1DDHB 1U0QA 3TH3T 3IFOA 1FYTA 1MHEA 2OJEA 3DURB 4UBDD 1JN6B 4LSSL 1P4LA 4N1CA 2IJ0C 3DRQA 3GBMH 5CEZH 4JN2B 5JTWA 1AQDA 1IC1A 4EBQL 3U36B 4GXVL 1FSKB 1KG0B 1CXLA 3LSOB 1N8ZA 4J8RB 5HBBA 4NQVB 1KEML 4PJGA 1G7QB 3EFFA 2DM7A 3EJZC 1JP5A 4QHMA 3VWJA 5D7JC 5TF1L 1IC4H 4MJID 4FQJL 1UEMA 1BQHB 3CDGB 3ULSB 4F9PC 1S5HA 3CXDL 4ACPA 5K9OA 2B7DT 4GG8B 3EGSA 3GHEL 2EYRA 5E94B 3SE9H 2HN7A 2BRRL 1T66D 2HRLA 1ITBB 2BOBB 2F5AH 5C0ND 2R4SL 1WAAE 3QWRA 1Z9MA 2Z8RA 3P30L 1INDL 4G8IA 4NQXA 4I3SL 4Y88A 1BVKA 4IBLT 2A77H 1AO7E 4HT1L 4HLZG 1HSBA 1YN6B 1C12B 1IGIH 1YYMH 3CFDB 4C4KT 4JFDE 3NIGE 3BPLB 1HI6B 2IANB 4WHTB 4QRPB 3DI2B 3OB0H 1WZ1H 1G7LB 3E2HB 5C07B 5GSVA 5GRUL 4Z7OE 1TZHB 2AW2A 3RY5A 2C4FT 3TJEH 2OQJB 4WW2A 3AM8C 3G6JF 4KQ3L 5IM7B 1C12A 4DUWA 3QQ4A 3A6CH 2V9TA 5HVFB 4WWKC 4K94L 5DJDA 4H26A 4MDIB 4U49A 2Q7NA 5DJ6B 3TGXA 2NTFA 2YXMA 3IJHB 3R0NA 3AM8A 4HGMA 1JPFB 4GAJL 1OAYL 2HFTA 3ARSA 4MNHB 4QRUB 1YN7A 4MJ4A 1J88A 1S8DB 2NY5H 3STLB 1DBML 4LSSH 3AREC 5C0GB 2AJVH 1RAMA 1N0LA 2P8LB 4DVBA 2OSLA 4HS3A 1TPXC 3TZVD 4K9EL 4M48H 3D39A 4TUJB 4X6EA 4MWFA 5HHMD 1C16A 5GGQH 1FZMA 2D0GA 3GRWL 3ZYOA 1Q94A 3WHXA 5C0GA 1LK2B 4OD2B 3MRFA 4FP8H 3TA3C 2XIDA 5EO0B 2DL2A 1TQCB 3SOBH 2EDLA 5E00A 1FCGA 5SWZD 3HAEB 2BC4B 1KCUL 5GRVK 2DMCA 1JF1B 5IR1A 4JGMA 4IRZH 4U1SA 5DD0L 2K9UA 1RUPL 1J0YA 5IBUB 2VZSA 3WS3A 5IEHB 3VWJD 3V5KB 4GQ9L 4OZGB 2Q86B 4Z9KB 4KQ3H 5IHZA 2HJLB 5GGVY 4F80A 2XRAH 1XGPB 4I0PA 6FABH 2AEPH 2LVEA 3ZTNL 3KPRA 2W60A 1S7XA 3RIFK 5DQ9B 2YPKB 1I7TA 3D85B 2AJUH 4RAVA 2WP3T 4HJ0D 3VXTA 3EDKA 2QADD 3VG9B 4MAUH 1E4JA 3GBLA 3SDYH 5BRZB 4G8GA 4K8RL 4PLNC 5BVPL 3QHTC 4DVRL 4L9LB 2FGZA 3BPCA 4GOSA 1WT5A 3BD3A 4K7FA 4N0RA 4QRPA 4EDWH 4H0GA 5D96B 1LO0H 2AEIT 5D7LD 5DK0B 2YD9A 4YGAB 4HXBL 5K93A 1F4WL 3KLDA 4U05A 1J0ZA 5EU6E 4X4ME 3RFZC 3ZDYE 4HWNA 3FQWB 4NBYB 3O3AB 5BS0E 3I9GL 2PTVA 3NTCH 2ED8A 4X7FC 1CFTA 3H7BB 5KN5A 1A6PA 1XF4A 1RZGA 3FT2A 5JW5A 1TVBA 4GW5B 3VXMD 3ARXA 3H42H 4P99A 4JY6A 4X6BA 1G6RB 1X5ZA 3FOLA 2X1WL 3ARFA 1QRNA 4JG0L 4LEOB 4LHUD 4YEFA 3DMMD 1GC1L 1KCVH 5I2IA 1HK6A 4PFEA 1OPGL 2DQCH 1HOCA 3T09A 5E8DH 4IM8A 3WD5H 4YE4L 1PD6A 4F57H 4OZHE 4NO2B 2XXCB 1ERNA 2JELL 5IMMB 3CH1B 3QAZC 4C56E 3RVTD 2C3WA 5DJYA 3C6LC 4KWUA 1AY1H 5HJ3A 5FYLE 4R4ND 3MNVA 3D18B 2CIIA 1TZGL 5JHDE 5KSBE 2FRGP 5B21A 3V0AC 1XIWC 1RK1A 1SYSA 3CVIH 5FUOL 3F65A 4PRHE 4FABL 1GC1C 3WFBH 1MEXL 3SJVE 5E5UB 5BW7C 2GEEA 2D0FA 2H2PD 3KXFA 2V5SA 1MLCB 5EO1A 5ESQB 3TBSB 1MI5E 3BPNC 1J1PL 3PV6A 1ZA3A 1NMAH 4N0UA 1AGBA 2AABH 3I75B 1RUKH 3RVVD 4M8QB 4Y4KD 1AIFA 5JR1H 4KUZH 3L5XH 1FO0H 4L8DA 4WFEE 3C9NA 4H0HB 4FQXD 5KSVB 1MHPL 4KFZC 4YHKL 2OZ4A 2E5EA 4PJ8B 5CMAA 4GRLD 3BHBB 4KTEL 5D1XC 5DFWH 2F8VA 4BH8A 2VZVA 5EZJA 4ZYKA 3GSUA 4P5TA 1N5YL 4DJMA 3U4BL 4HS8L 4OFIA 3RWIA 1F5WA 4LSVL 4XNUH 4DEPB 1QBAA 3T0EC 5DURD 5KVMC 5HHVL 5FKAB 4YEEA 1AGDA 3SGEH 4YPGB 5FUOH 3WD5L 3RWFB 1ND0A 2XN9B 5IV2B 1IT9L 4NQEA 1B6DA 1NBYB 5C09D 3U79A 1CICB 2HFFB 3CSPA 2XKNB 3QH3A 4GAGL 4LSPH 1R3LB 5AUMA 4N0CD 2ZSVB 2CK2A 4HJGA 4MYWB 5CINH 2X89A 3D3VE 3BRDA 3VWKC 3T0BA 2ICCA 4D0CB 4G5ZH 4PJ5A 1TZGH 4HPYH 3OBAA 5E95B 4RGOH 1Y0LA 3OXSA 4O02L 5LXGH 3QNYB 1WLHA 4KRMB 1V7NH 3A67L 4PJBB 2FH8A 4XWOC 3RTQA 2GW5A 4KK5D 1QQDB 4ZPTA 4WHDA 5LWYH 5TDPA 2I5YH 1BFVL 1CF8H 4ELKB 4NBXB 3D18A 4CU6A 4YFEA 3ARQA 3MBXL 5HVHB 2Q3ZA 1Y18B 4RDQG 2BVEA 1PZUB 1UKSA 2DLIA 4ZUTA 4LSQL 4FQHA 2P8PA 4K07A 4ZG1A 2V7NA 5F7DB 4D94A 1UM6L 2C9AA 1NQBA 3RHWF 4XNZC 1KELH 3K4DA 3WFEH 5JW4R 1NEUA 4JRXA 2VQUA 3IGAB 3BZFA 2B2XL 3F7YB 4XP4L 5I76B 1H8NA 4HULB 3I75A 4ODHL 5LJYH 5MENE 3BZEA 1CXEA 3ARYA 4N8VB 3QO0B 3MFFA 4N68A 3ZKMD 5BS0D 3GSRA 3DX9B 3N1PC 5I1GL 3UJTH 4O4YL 3HG1E 5KSAB 1I1FB 3SPVB 2PXYB 5HDLA 3QI9B 3MXVH 4G8EB 3DI3B 5GGUB 5IUSA 1CLCA 2R23A 4BH8B 2NQCA 1D6EA 5D96C 3IF1B 1M4KA 1I3GH 2YXFA 4FTVE 2QSVA 5DEGB 4M6OH 3SDAB 4KPHH 1YEIH 2GTWA 2FJHA 1I1FA 5C8JA 2AS5M 1I1YA 5IOPB 2L7JA 5LWYL 2ED7A 5D7SL 2ARJQ 3PV7A 5T3XE 3M8OL 2YUZA 1VEMA 3P4OA 5IVXF 5A2JH 2Z91B 2DD8L 3VXUD 4HS6A 2HFGL 1LEGA 4HLZH 2ZUVA 3TNNA 5GGSB 3SDXF 4PJ8C 1Q1JH 3BO8B 2OCFD 2NY4B 1OAZH 4KTDL 3FN3A 4HJGB 5JZ7D 1EK3A 5CGYC 4GG6F 3FFCE 1A6AB 4OKVA 4FFYH 5I73C 5DI8A 1IEBA 2NZ9D 5IVZA 2PW1A 2EIZB 1QD0A 4HS6B 3B83A 1BD2E 1RUQL 5M95B 2WWKO 2IPTL 2OMBA 1LEIA 2YD2A 4X80H 2EIBA 4NFBA 4PJHF 5F21B 2CJUH 1Z9OA 1HILB 3S4SG 1FIGL 1OTTD 3OKYA 2XKSA 2Y5EA 2VXQH 1MAKA 1OAYH 1XF2B 3NFNA 4YGVA 4HMEA 4IOFD 1ACYH 2FEDC 2YEZA 1YEDA 1OAKL 1IMHC 1N8ZB 3INUL 1DVFA 1CN4A 4G42B 4O2EA 4CNIB 5EC2B 5D7JD 2HWZL 1ORQA 3GMNA 3UO1H 2VOTA 1EXUB 4FQHB 1ES0A 1VERA 1HZHL 1U91A 3GMQB 2CDEB 4HWZA 3BQUD 3PXJA 4H1LH 3SBWC 1KCSH 1EZVX 4YHLH 4CN4A 5ALCL 3QUML 4NO0D 3KG5A 3MLXH 3PWVA 2B0SH 4UNUA 2Q8BH 1G9EA 3ZT5A 1KB5H 2WIMA 3MGTB 4Q2ZA 3MSPA 3P11L 3OF6D 4HMDA 4NYLB 3LRGA 1XIWA 2ADJA 1EXUA 3BD5A 4WTWA 3SGEI 3GI9H 2ZCLH 2XACC 4XP1L 3VWJC 4G9FA 4P5MB 3GSVA 1F3DH 1SMAA 2X4RA 1BVKB 2ZUSA 1WBYB 3L7FB 1PBYA 4JQXA 4P2OC 5J6GA 3MGTA 4P46C 2EDFA 3QIWB 4NYLA 1DBBH 3UTTA 3VRJA 4HWBH 5HHOE 3MTRA 4ZSOB 4IRSA 4OF7A 2R2HB 1D9KC 4D0BA 5I15H 3U4EA 3SQOH 1TMCB 1U8QA 5D1QA 3ZKQD 3ZSSA 5I19L 5T5FH 2E7CA 5L2KD 5L2KA 2GSGA 4WU7B 4XMLH 1P84J 5AWNH 4HCRL 3ALXA 3X12A 4WWKD 5ETUB 5DJDB 5D1XA 4QGYA 4EBQH 5HHXL 5DF0A 1SEBA 2PXYD 1UXWA 2HKFH 3F12A 4L8SC 4AM0A 1LEGB 1AO7B 5E08L 1QSEE 1S7RB 2D03H 4OZGF 2AP2A 4YHLL 5IBLC 1FFNB 4L3EA 1T0MA 4NC2B 5E2WH 1RHHA 5I8CB 3S35X 1PZ5B 4TVPE 2NY1C 2IAND 2DAVA 5JXAH 4U7MA 4U1LB 4JLRA 1P2CA 2HLFC 3CK0L 3TCXA 5TDOA 5E0QA 2P5WA 5GGVL 2HT3C 4ODXB 4EJ1C 2Y36H 4MQTB 1MCRA 2BNQB 4MA7H 2H3NA 1RK0A 4P23B 2VDLL 2G5BB 1XGTA 3S5LG 2O61B 1ZEAL 4NPYB 4MAYD 3KVQA 4ZPVB 1P4IL 5HGAA 4RFOL 1V3LA 3IXTB 3HAEA 5I1KH 4QRRB 3BP6A 1MVUA 3MACH 5K9OB 5E24E 4XPBL 4F7CB 3MC0A 4JANA 3REWA 5IEHA 1UZ8A 3VG0L 1NBZA 3P77B 4PLJC 1T83C 1LO5B 1KIUA 3N1QC 1F4WH 4DN4H 4U3HA 4L9DA 2F58L 1Z6JT 3VD7A 3EDJA 2AJXL 5JDSA 1ZE3C 5TE7H 2WK2A 3T1WA 4XBPA 3LOWA 5B8CC 1ZT7B 4PLJD 4OCLC 1FNLA 3QEUB 1IAMA 2R0LH 5ICXB 3MREA 2QTEA 4LAQL 3DSFL 3SGDI 2YKLH 4MNQE 1QLRA 4Q9RH 2RCSH 1K8DB 3CUPA 5D93B 3DV6A 3QXDA 4AG4H 5D7IF 5C3LD 1I8LC 3QG7H 3UTTB 1PSKH 4JDZA 1PY9A 3N1GC 1EDQA 1IFHL 3EYFB 1K6QH 3WEXA 2F5BH 4ERSL 2EE6A 3MLZH 4BZ1H 2E27H 1I9IL 4POZC 1YN7B 4OFDA 3UP1A 2J8OA 3B6SB 2MKWA 3WS6A 3OAYK 1E28A 2J3SA 3DROA 1KJ2H 4HIJB 2FJGA 3U0PB 2BCKA 1F4YH 1GGIH 1A6WH 4JEGB 4KAQH 4WHYH 4XVUC 1MCDA 3WEXB 4G6KL 3F12B 3H7BA 1FVCB 3ZE1F 3CH8A 3RWHB 3CVIL 3EUUA 3MV7B 1TVBB 1A7PH 4HUUA 1QFUH 1ZT1A 4WGWB 4ZDHB 3VXME 1FVEB 2XWTB 3SGJA 4JFDD 3TT3L 2D9CA 3JWOL 5E6ID 1FNSL 3HZVB 4OD2A 3IDYB 4MQ7B 4I3RH 2DB8A 3VD3A 3DGGA 4NN7C 2O5ZL 5D7KD 5MEQA 1CCZA 2P45B 1HOCB 4FFVD 4X6DF 4ZD3H 4OAWA 3ARZA 5DVNA 3RKPA 2GFBB 4PGBB 2AEQL 2N7BA 2E7HA 3C5ZC 4HGWB 2D4DA 5IB5B 4JFFE 2EXYD 1UJ3A 3MRKB 5JUEH 3LRSB 1RFDH 4D0DA 4MDJB 4D9RE 4RFEA 1AQDB 1H3VA 2FJFB 1ZHNB 1WEJL 4XP6L 2C1OB 4CDGC 2BNRD 3DX7A 1U92A 1BFSA 4JM2D 4F7CA 1HYSC 1JV5B 4NQCA 1YDPA 1GIGL 4YHZH 4JDVB 3T4AA 3CLEL 4KV5F 2M26A 3NCYP 5FOJA 4G5ZL 4P2RA 1CLOH 2V17L 4WEMB 1QRND 1QVOA 3QYCA 3EYOB 3DRTA 1XR9B 4LAJH 5DEFA 3NOIA 4R4FL 4G6KH 3K2UH 3KYKL 3QUKA 4DKDC 1LWRA 3L9RB 5J56B 2VISB 2XZAL 2IG2L 2BOBA 2DYPD 2EXWD 1NEZA 4U2ZA 4WY7H 1XAUA 2AXGA 2A9NL 2AJZB 4KMQA 5HHMB 5F96H 5D2NA 3B2VH 1X5GA 3WKMH 2P7TA 1NAKL 2GUOA 2BY1A 3DV6B 4Q0XL 2BVTA 4MZ3A 4Q97A 3UJTL 3LRHA 5EH1A 5ERWB 4BUHA 4YO0A 3QULA 2VLME 3JBG7 3VXUB 2D31A 2XPGA 3HZKB 3PP4L 3NZHL 5GHWL 5FYLL 5D72L 3F5WA 5HI4D 3ULVH 4UBDC 5J57B 2VLRB 4PGCB 2BNRB 2FD6L 1FFRA 1HHHB 2OL3B 3WUWG 2DQTL 1J87A 1A02N 3IS1X 2VXVH 2ZJSH 4ZMAT 1LNUB 3VXSB 2EDDA 4R90H 4TN9A 4X6BB 4F2MB 2X4PA 4H26B 4PJAF 3TVMB 1CF8L 2JK5A 1DUYB 2Z8VC 4D3CL 2X6MA 2Z35B 5GJTH 2ARJA 4Z95H 1D5BA 3PABA 1ZT1B 5DMJB 3MV9A 4E42B 4HIXH 3MO1B 5C09E 1GZQB 1CU4H 4NZUH 3BW9B 4TVPL 5IFAH 1MEXH 1RD6A 3TVMA 5BV7H 1CI5A 1OB1B 3H3KA 1YNTB 4PRIB 4X6EB 3KS0H 1J5OL 4HJJH 1DL7H 1BMGA 2C3VB 1IM3B 3G6DL 4P5TD 5I30L 3QJHA 1NLDL 4PLOB 4XNQA 2DQFB 1RZ8B 4XWGL 1NMCC 3JVGA 4PV8A 4NQTA 2DI8A 4XRCB 5JHLL 5CJXA 1OCWL 2FGWH 3D25B 2DLHA 5LG1A 5EOQH 3O4LE 1HHKA 4JFZH 1P1ZB 2QQQA 1ULVA 4M1GH 2JB6B 4Z7VE 4N0FB 3MRIB 4RAUA 3C08L 4OSUL 2VUYA 1A0QH 5HI3D 1QVOB 2ZCHL 3WL9B 2V7NB 5F7DA 3ARDB 2YD6A 5JIIA 1HHGA 1BJMA 3D2UA 4KJYA 5EIVA 4PJHE 4LSVH 4Z7WE 3IFNH 4NNXA 1SYVB 2HKHH 4ZNEE 3DHMA 5GJTL 5DD3L 4U1HB 2A74B 4UDUB 3NH7L 2AXJA 5B8CB 4ENEC 2CK0L 2DD8H 4YJZL 4PJAE 5DRXA 2Y07H 3VFOB 5TQ0H 3UZEA 4NQUA 3CXDH 4OZFB 2DQTH 4ISVB 1WTGT 4AH2B 2YR3A 3ARRA 2R1XA 1QO3A 1YEKH 5IMLB 2W65B 2XQBL 1OL0A 4QTHA 5E2UH 5KS9A 4XMPL 2DQUL 2JJSA 1ONQB 1KJMA 5CEZL 3VRIB 2BSTB 2LAAA 1L9MA 4MQSB 4YZFF 5ALCH 1FFQA 3RWFA 3IKKA 5E9DA 5B38B 1A8JH 2ED9A 4JPWL 3VXPA 4MGXA 3O41A 3MUGA 4HT1H 4JHAH 3WJJC 1CD8A 4CJ0A 2FR4A 1GCFA 3TN0A 2PETA 5DHYB 3VXQB 3G5YB 4MXWL 5H2BA 1NCBL 2CD0A 2Z31A 4GBXD 3ZHDA 3A6BL 4G6FB 5ISZD 1U36A 2NY7L 3IXAB 3MXWL 4LLMA 2ZZUT 1Q38A 2SEBA 4JFYA 4G6FD 4QWWC 3HZMB 4NRXB 1N3NA 3UTZB 3E8UL 4IRJC 4LHQB 4WI5A 1FZJA 1T1ZA 1A4KB 3G5YA 4GBXC 5IBUG 5C09B 2D7MA 4X4XB 5I2IB 5DJ0A 1HIML 4QCIA 5LGHL 5C0NC 2C1PA 3LKOB 3QUZD 1WZMA 3U46B 2HT2C 5CFHA 5I1HL 3FO1A 1HWGB 3ARBA 5HYJE 4OSUH 1OPGH 1F00I 4DTGH 2R8SH 1CZ8H 2E7LC 3FO2A 4BSVB 2HRPH 3VXNA 4JAMB 5DJYB 5FO7B 5HHPB 5IB4B 4JPKH 3O2WH 4U6XB 2ESVE 1TETH 1YPZB 5JQHC 1OAUH 4OCXH 1TXKA 5T3ZH 1OTUD 2YN3A 3QPQC 1QBBA 2P5EB 3Q48A 1ZLVH 4GRLB 3K74B 4GRMB 2ATPB 4K7PH 5C08D 3C5ZA 3O0RL 3WFDH 2X10A 4OLZH 4XH2B 4JM2F 3FQTA 3QIUD 3FHAA 5IVOA 4PJCA 1CLYH 1U3YA 3FMGL 3ET9F 3MCLH 3P9WB 5DQJB 5IESL 5IVXE 3I2CH 4LFHG 2HYMA 2BVQB 2VDOH 4W81A 4M6MH 3GNML 2VITA 3OKOB 1FAIL 4HHAB 4ZFZB 4JFPA 4WTZA 3RPKA 2X4UA 1AIFB 4QT5A 2A1WH 1RPQA 2ZUQC 3KLAB 1DQJA 1FQ9C 4ZXBC 4F7EB 1HKFA 3EO9L 3C8HA 3LQAH 5IK3B 1NC4D 5HYEA 1KPVB 3G9VA 3BESR 2K3TA 5HGDA 2B1HH 4JCLA 3GSUB 4P5TB 5EUOB 2X42A 3FTGB 3VI4F 1T0NB 4LGPB 2E9JA 1FL5B 1RQ5A 3Q0HA 4LVHB 3TNNB 1RIVL 2GSGB 1BGXH 4WU7A 1X5IA 1G7JA 5D8JL 5IP4A 1JGUL 4UV4L 3HPJB 4NCC1 4ODSH 3SHSA 4YBQC 5FKAA 1QYGH 2V5RA 1DUZB 4YAQB 1ND0B 2XN9A 4Z5RA 3INUH 1BPVA 4UOW1 4WTXA 1MJ7H 3H9HA 4OCYH 1AO7A 5E8EB 3SY0A 3AS3A 3GMOA 1CZ8L 1R3LA 2IADA 1RZ7H 5DUPH 5AUMB 4ZUUA 5GGRA 5JQ6H 3S8WA 3VJ6A 1OLZA 4DN4L 3SCMC 4HBQA 5E6YA 2NW2A 2J88L 3VWKA 1I7ZA 4M02A 2QQKH 2J7LA 2W9EL 5CGTA 4Z5RB 2VLRD 1JPSL 2YC1A 3BH9A 3LN4A 5TDOB 35C8H 5CLTA 2EDQA 2VMFA 3W0WE 3PHOB 3VXOA 3VRLF 3O9WA 1INEH 4OLYL 5TFSH 2XWBB 2EDOA 1CLYL 1DQQB 2HFEA 3CFKA 2FL5A 1Z0NA 3L3HB 4MAYC 3CFBB 1JTPA 4LCWE 3L3GA 1YEGL 1ZSDA 3JTTA 4J3SA 1KTKE 4LVEA 4ALAH 2WBKA 4Q6IC 3O9WB 2EYSB 4Y4FA 2MPAH 1GGTA 4X6DE 3LKPB 4WO4A 4ZODA 1UYWH 4LKCB 5DDHB 3IJYA 4HWEL 5J9PB 3RI5F 4PJCB 3MPCA 3L3GB 4J1UA 1ZLVK 5F72S 5FKPA 2AEQH 3L7FA 3WE6A 4NWUL 4YHIB 1LDPH 4OD3H 2OM5A 5BS0B 4OCYL 4Y4FB 2WW8A 4NNPH 5E6IC 4OZGE 4OV6F 4O2FB 3G6AA 1UH3A 1QFUL 1I4FA 2DM3A 1DZBA 1NUFA 3BP7B 3WNPA 1FDLH 2UWEB 4M1CC 4WI9A 3SPVA 5K9QI 4DGYL 2I9LB 4X4YB 3VWJB 1JJUA 5KVEL 5CD3A 3OX8A 4FQ1L 1WCQA 3K3QA 1BQHA 4OFPA 2OP4H 1R5VA 3LEXA 5SX5K 3GSOA 3S36X 3VFTB 5A2IH 5ITBL 3FTGA 4M61A 1BBJB 1VPOH 2V9QA 4K23H 4B7LA 4CVUA 4XXDB 5L2KE 1P7QA 1PX4A 4KDVA 2ENYA 1NAMH 5INCA 4PRIE 3VRLE 1KJVB 1OSZB 1GAFL 4GG6A 3TZVC 5GRXG 2BXZA 3ARTA 5CEYB 4ONGL 5F96L 1IGTB 2CIKB 5E2JA 3FRUB 5T3XD 3BJ91 3RGHA 1FG9C 3MA9H 1DFBL 1J8HB 4M61B 4XNMB 2ICWA 3S9DB 4WNQA 4ZXBB 1QSED 1DQLL 1HCFX 2HT4C 5GS2H 4RGNC 3T3PF 5D70L 3VJ6B 1R3HA 2WQ8A 4QRPE 1UKQA 1A6AA 4OKVB 3MUJA 2YD4A 1UWEH 4JN2A 2ZG1A 5HD8D 2O26U 3BP6B 4RSVA 3H9SB 4PJ5E 2VDPL 1BZ9B 4TRPH 3NVQA 4BKLA 4PB0H 1UZ8B 3UZQA 3ZE2F 2P4AB 4X5WA 3IRZA 5F89A 4K71B 4LASL 4XBGB 3HCVB 4FXGA 3V7MA 5IB3A 5J6HA 4OKDA 1SBBA 4HX1A 3KR3L 1X5LA 5C07D 5DSCA 5IGXL 3KYOA 1Z9SA 3QI9D 1CDIA 3NA4A 1H5BA 1J0IA 4I48A 3EGSB 1UM4L 5HHVH 1OP5H 3MZTA 2PUQT 3FRPG 5EU7E 3GMQA 1ZT7A 4K2UH 1MCEA 2VC2H 4XBGA 5J6HB 5DLML 5E6IA 1KPUA 3EYOA 3PGFL 3W81A 4JY5H 5DTFB 1GOGA 3CUPB 1WQVT 4I77L 2IBBA 3DXAB 5C0JA 5E1HB 4M7LH 2BFVH 5F7UA 2DJUA 3TYFA 1KEGH 4X7SH 1XT5A 4MNQD 2VDML 4L5FH 4LCYB 4OM0L 4GKNA 1T89C 2X4RB 1H15B 1EGJH 3TH2T 3GSXA 3JWOH 1ADQH 4ONOA 1EHNA 4MB5A 4U1GC 1MF2H 4NN6C 4MS8D 5BVPH 4HFWA 5FECA 1F11B 2F74A 4GUPA 1DFBH 4P2RD 4Z7WF 4PY7B 4GSDH 3IJHA 3LEXB 3VFTA 2CRIA 3OXRB 4JRYB 5BZDA 1IBGH 3O2DH 1SEQH 3MLYH 3BGFB 3CPLB 3SQOL 3QNXA 1UM6H 1SY6H 4M1DL 1B0GB 1JNNL 4D8PB 1CDYA 3L5IA 5HYSB 2ARJB 3PDDA 4OUUB 2A6JA 1S7TB 43C9B 4WTZG 1CICD 2DQUH 5CEXA 1YNKH 3LZFL 4QOKB 4YDIH 5IB1B 5DD5H 1PZ5A 5E5MA 3W9DB 1NFIB 5IQ7L 1EVTC 2A6DA 5DD3H 1AGCA 2FJFA 3MCKB 4P2QE 2AJ3A 3JV6A 3L5HA 1PLGH 4WW2F 2Q87A 2IPUK 2CDFA 3GMMB 3IFOB 4L9LC 1NDMA 4IMKA 3RJDA 1F6LL 1CIUA 1U58A 3VFSB 4U3CA 3DRQB 1U3HD 2R2BA 5DVOA 2YPLA 3E1F1 4NWTL 2BNRE 3DRTB 3HRPA 4NHUB 1RUPH 5DJCA 3SKNB 3PHQB 4FQXB 1J8HD 1S78D 4G43A 2IH3A 2QV2A 3OGCB 3MRCA 4FMFA 4RIRA 5C0AA 4OCRH 3FJTA 2OXHA 3D2UB 2ADGA 1SJEB 1MFBH 1FZKA 5HHME 3NABH 2X41A 4HEME 3KGRA 3RPIA 1ORSB 2I9TA 2VXTH 1OGAE 5IMMA 3MBEC 4JPKL 3VGDA 3RZCA 4DKEL 2CLZA 1FV1A 4S2SB 1BX2A 1KT2B 4ISVA 1VFBA 4L4TA 4MB3A 3RIAK 1IC5L 5DJZB 4NZRL 5JIHA 4F33A 1CXKA 3LV3A 5FECB 4OFKA 1T3FB 3ZLQC 4Z7VB 4PY7A 2WBJC 3GMRB 3AS2A 4KTEH 3MJ8B 1O5DT 1HNGA 3UTTE 3GSNL 1Q72H 1T89A 5DMKB 1Q0XH 3TT1H 2YWZA 4HS8H 1VB9A 3KPRE 3CPLA 2HVKB 4P4RA 1PGRB 3TBTA 2FR4B 3MRLB 4WDIB 1H9VA 1AGBB 5IROC 3AB0C 3WHE0 3GMRA 1CE1L 5FDYA 3QIUC 1T22A 2R2EA 5EOCH 3QUMH 5DO2C 1JGUH 2QHRL 3O8XD 1ZHBB 4EQ2A 1I8KA 3BKYH 4U7KA 3P11H 5FYKE 2HVKA 5E5RB 1MCJA 1OARL 1LO2H 3STZB 4R97B 4XP9L 4OTXL 4CW1A 4UIMB 1JL8A 5FFLA 4X9IA 4PJIB 2B1HL 3Q3GB 5GRWA 5GS3A 1M7DA 1XGRA 3I2CL 2X70A 1ZHBA 2IFFL 2O5XL 3MNVB 1FAIH 4RBPH 4JO4L 1FIEA 3IFLH 3S3JA 5HDQL 5TE6L 1AQKH 1A6VL 4OBSA 4PGDA 1DQTA 1A22B 4M43L 1INEL 4BSVA 1QHPA 2CMRL 2FBJL 3U9PH 4OGYL 3LH2H 2FYYB 2QR0B 3QIBA 1ZHNA 4MLIA 3O3DA 5JORA 1CXFA 2JIXD 3PHQA 5LCVL 3MBXH 3D39D 5FGCB 4PJDB 1XCTA 1K85A 2YRLA 4P2RB 4JCMA 2VZUA 4IRSD 3DETD 4J3VA 5I1IH 5A3IC 3WLBB 3I6GA 1LE5A 1BIHA 3O3DB 2AQ2A 1DEDA 4Y19A 2W60B 5TFSL 3VD4A 2DQEH 2BVQA 5KW9L 3UJIH 1QYGL 3CFCH 1QFOA 3ZTJH 2VL5B 1MJ7L 5HDOA 5I66A 2X4NB 1UWXH 2Y1VA 3MR9B 1KN2L 1DBAL 2VWEE 1X5FA 4JFED 3BP4A 4RMWA 1LE5B 4H20L 4KI5F 1VFBB 3K46A 4N90E 3E8UH 3HNVL 5DJZA 5HHNB 1S3KH 1AD9B 5KVDL 4MCYB 4HKJA 5C6TH 4NKDA 5H37H 5I18H 3NPSC 1VADA 1HHJB 2JCCE 1KNOA 1EEZB 4X7TA 4RBPK 1MELA 1BWWA 4FQIL 4CU8A 4KU1A 1AHWA 3KLHC 3QUZA 2VLRE 4OTXH 3KXFE 1G9ML 5FA3B 2BVOA 2DTML 4UIKH 1QACA 2APXA 1LNUA 4U6YB 3W0WD 2JF1A 3OKNA 3PP4H 2OJZH 3B9KC 3MBEB 3L5WB 5DRNA 2OTWB 1K6QL 5E9DD 4P2YA 4E41E 1I7UB 4N0UE 4WFFE 4RMRA 3QDJD 1I3VA 3O11B 3UCRA 3VI3E 2E27L 3H9SD 1L6ZA 2FHFA 1WITA 3QUZB 4Z0XB 4AEEA 3MRGB 2VABB 2XOTA 4U2YA 4DGYH 3T65B 3U0WH 1IKFL 1YEHH 4UUJB 3MO1A 4LU5L 4WFED 3SY0B 4DVRH 3JTSB 3OR7A 5ADPL 2V5TA 3ARBB 1MNUH 4WU5B 5CIPB 2DWEA 2OTWA 2WBJB 4LEOA 2FLRT 4R8WL 2A2QT 1J86A 3K7UA 2Y23A 2I24N 3ZE1E 4K3DL 1A7BA 1AXSA 4OD3L 2W9DH 4ZXBD 3A6OA 3QDGA 4F9LA 1YPZA 2ZCKL 1OM3H 4GBXB 4M6ML 3IDGB 3VCLA 4Y5VA 3MRQA 4JO2L 2BHUA 2IBGA 2XYCA 1E4KC 2DWEB 2PR4L 1I9JH 4LIQE 4JRYD 2P8PB 1NEZG 3T04D 5EZOL 1IC4L 1N0XL 2YRZA 2FYYA 3QIBB 4FFZL 2VDQH 3WFHA 1MWAA 4GW4A 5F7EH 1KCRH 3SDCC 4X8XA 1REIA 5DFTA 3HE6B 1JWUB 1N7MH 1OCWH 2APVA 2FGWL 4NDMA 3V4VH 3ARPA 4GMTL 5I76A 4YHOH 4HF5L 1NBVH 4MZ2A 3LKPA 5J4MA 2JCCF 3IJYB 1A1NB 2GTZB 4G9DB 3GK8H 4M93C 5JIPA 4LOUC 1N5AB 2QQNH 4JZJB 1KG0A 3LSOA 2D03L 4R26L 4EUPA 4NNXB 4D2NA 1MFCH 3OKDA 4PB0L 3TBVA 4UV4H 3EYUL 4RRPG 1EMTL 2Z31D 1E0OB 4O2FA 1F4HA 5HGDB 4OI8A 5I1LA 4MXQC 4E5XB 4L4TD 2QKIA 3DYPA 3KPSA 1A1OA 3ARED 4NKDB 5KOVC 4NO5A 4M6OL 3LMJL 1QLEL 4YBLC 4OZHB 1RULH 1OHQA 2ADFH 3RU8L 5EZOH 1JHKH 2KH2B 4XNUL 2FB4L 1RZJL 2X05A 4W4OA 5DS8A 3RBGA 1IAKA 3GO1H 4TSAH 2R4RH 1E6OH 2JB5L 3C2AL 4F7TB 4BK4A 5T3ZE 4X7SL 1UADC 3O3BB 2AGJL 4L1HA 5EZLA 1QBML 4BM7A 3BRGC 1IGTA 2CIKA 4RMUA 4S1QH 1ADQL 2OI9B 3UBXG 1TZHA 3T65A 4KI1A 4MXWH 4RISL 5DLMH 1A3RL 5D7LB 4IRSB 4JZOA 5I1JL 4HWEH 5C09A 5CZXC 5DJ0B 4YFLF 4R7NA 1EMTH 3G04A 3U6RA 4RGOL 1ZHLB 2DKMA 4NWUH 4PGEA 4CMHB 4QRUA 1GHFH 4PJAB 3V7AG 5J12C 3GBNL 1PFCA 2FECL 1SJVA 4CNIA 3LKRA 2JTDA 5JOFB 4NUGL 4IOIB 2R29H 4RWYH 4U33A 3ZYJA 4Y89A 1OQXA 4N9GA 4JM4L 5IMKB 2V2WB 1YMME 1NLDH 2NXYB 5FM5O 4L8BB 4AM0B 4HX1B 4LCWA 5EULV 1IC7H 4FQCH 5GS1A 4RMTA 5I1KL 5HYSG 4NM4L 3HE6A 1EO8H 4JDTH 3BZ4B 1MWAL 4PV9A 3KYAA 3OKLB 1JZ3A 1HKLH 3P73B 4NRYB 3PWNA 1M05B 4Y5YC 5FAAA 3GJFB 4ZFGH 2EDHA 5ID0B 4B0MM 1DDHA 3GMPB 4U0QB 1RZFL 4I3RL 5IKCA 5KVGH 3OX8B 4OZGA 1DL7L 4UTAL 4HH9A 1BFOA 3KS0J 4J3UA 4LOUD 4HUVB 3D6GA 1A3RH 3LD8C 5GS2D 1RZIA 4P46D 2WUBL 3AMKA 1NDGB 1W8OA 2CH8A 3TO4A 5IB2A 4YDIL 1H15A 1S7XB 1BZ7A 1JWSA 3QI9A 4ZTPH 3TJHD 4KXZH 1PKQE 4S1SH 4GRWF 4PJEF 4LVHC 5AAWA 1RURH 1U8JB 3QG6A 1ZGLM 5KS9E 1RZIB 1DJSA 3GKWL 4RWYL 1UXWB 4OBRA 4KI5C 1WK0A 5T3XH 5ACZB 1P7KA 2ZSWB 5SX4I 1UJ3C 3HNTL 1KPRB 4QF1B 4A6YB 5GXBB 3MZGB 4KJQC 2GSIA 1KTLA 4RGNE 3UTQB 4YZFE 3SN6N 3QEUA 3MREB 4Y8DC 5E99H 4OJFL 3VFMA 3H7LA 3GBNH 1U93A 2FX9L 5HYSA 4XNYH 3HE7D 2J6EL 1OP9A 2NZ9C 2Y4SA 3HUJB 3LQZA 4LDOB 4PJDF 4QRQA 5J8OA 1KENH 2J1KA 4X6CF 3X14A 2BNQA 1NGQH 1S78C 4YFLI 4TNVK 4L8SB 3DURA 1I7ZB 3QCVL 4BELD 3ARFD 4QRPD 1RZFH 1TITA 2PTTA 1RJLB 1OT2A 3G6JA 5DSCB 5D93C 5SWQA 2BK8A 4J8RA 4LLVA 1VENA 1L0YA 4TUKH 2ZG3A 2KQNA 4XCEA 5IFHH 4HDIB 2VXQL 4IEFB 5HYJA 4Y4KC 4OCSL 5IMKA 5E8NA 2LVCA 4BYHA 3CGTA 1RURL 3WUWA 3THML 3VGFA 4KKCD 4MQXD 4LPWA 4CVWA 1D5MA 1E27B 2EC9U 1CGUA 4GRLC 2C3HA 4ZUVB 2E9BA 4DAGL 4PJXE 5CEZD 4XPHH 1N64L 2OTUB 1JWMB 3AFLA 4XMKL 1G7IB 5TF0A 3L6FB 3LB6D 3QSKB 3CX5J 4ZO6A 2H6PA 2GY7B 3HE7B 5BOPA 2MPAL 1CU4L 4KJQD 3QXDB 2NX5E 4QLRA 5L2JB 1XEDA 1SYSB 1OGAD 4Q9BA 1RJZA 1V7MH 1CT8A 1K2DA 4OZIE 3PL6A 4G9FB 1CDHA 1G7PA 3KPPA 3VMNA 1AC6A 4KZEH 1D9KD 1JNLH 2BC4A 4ZTOH 3BP7A 5C92A 2QEJA 4PRNB 5L6YH 4AL8H 4HQQL 3VG9C 1RIUL 1F3DJ 5L7XH 3AXLB 4O5LH 5IQ7H 2Q8AL 4MDIA 1NMBH 4PB9L 2BCKB 1FPTH 5EZIH 1B3JA 1B0GA 4M7KL 5IT2L 4FN0A 1TQBB 2MQCA 3DPBA 5TQ2L 4CRPA 1G6RH 3L9RA 1HE7A 1I7TB 4ONFH 5EBGA 1E4XL 3STLA 3D85A 4KTYA 1F58L 5ITBH 1QFWL 5EOTA 3H9YA 2N7AA 2X09A 3HE6D 5DHVH 1KJ2A 1SBSH 2ZOKB 4LPVA 4L29A 5ESVA 2XY2A 3QDJA 2R2EB 3DXAD 3AVEA 2A6DB 4Y0GA 5C0CE 3EOTL 3HMXH 2BY2A 2P7TB 4PJFE 1T04B 4JKKA 1DEEB 1MCLA 2QQLH 2VAJA 3GMMA 2BVUA 5FO9B 1IGCL 1GRWA 1A6ZA 2ZWLT 5EOTB 3HZKA 4HUWB 3MRKA 1MNUL 4L29B 2ZUTA 2DLFL 3LDBC 2YOCA 4JLRB 3RY6C 1MCPH 4MA8H 3SJVD 4P23C 1MVFA 3ULVC 1BM3L 3QUYD 1EERB 5F9WB 1U92B 5F9OL 4QYOB 1C08A 1JNLL 2EDEA 4EN3B 2ZUWA 3RHWK 1MY7A 2DIJA 5D7IA 1A6ZB 1AHWC 4G3YH 5AYQA 4AIOA 4H20H 1LO4L 4JFHD 2JJTC 4BZ2L 2MQ3A 4NPYA 5E8NB 3MRCB 5C0AB 4QRTB 1AJ7L 3ZTJG 1BREA 4OI9A 2ADGB 5SV4A 1FPTL 1D5BB 5F97E 4AIZA 2IPKB 1GZQA 3S36H 3MLVL 4XT1C 1BQUA 4J3OC 1ORSA 1G6RA 3EOYG 4IJ3C 2OMNA 2LFGA 4F7PA 3QHFL 1MLBA 1R5WA 1YEEL 1D6VH 5DQDH 3FQRB 4R4FH 4PJXB 4FQXC 1MPAH 1UT9A 4YHOL 1AI1L 3IDIB 4MJ2A 5E7FA 2UVEA 1BFTA 3QUYC 3WDIA 2R2CA 4TNWF 1VKXA 1OW0C 4W4NA 2DTSA 1UA6H 2DIAA 2EC9T 3DARA 1ZEAH 4FFZH 1HYRC 3ARDD 3FB8A 4Y5XA 2CLRB 5ICXA 3P0GB 4K9EC 1IGCH 5C08A 4Q6IA 2P42B 2P1YA 3HG1D 3P9LA 5JA8B 1S9KC 4PRNA 3RVUC 2ITDA 2W0LA 1AXIB 1DTUA 1NBVL 4HGKC 4MCYA 3F7YA 3QCTL 4N0FA 5GHWH 4LCIH 2B4CL 3ARGA 4FQQB 4OCNC 2VE6A 1F6AB 2BVPA 3V4UL 5D7LE 4P3WA 4M4RA 3F7VA 1KACB 1FJ1A 5DC0A 1CFTB 5SWSE 3B8YA 1J10A 2VXVL 2FIKA 1SYVA 5I75C 5DA0B 4TPRL 4EDXA 4JY6B 1FYTD 4KJWC 3MJ7A 4N5EC 1KTDB 4CW1B 3RKDD 2A73A 3DTXB 5I1DA 5C0IA 1A6UL 4NO3A 4AK1A 1XGRB 5D7JB 5GS0C 1CTNA 1QO3B 4RDQF 5DXWA 3JWDC 3QJHB 3H3PH 5AG8A 1B90A 3UJJH 1T7WA 4XX1G 1F4XH 4WU5A 5DJXA 5T5NG 4OT1H 3ARWA 4RX4A 2BSTA 1KXQE 2V2XA 1M6OB 4MMZC 3PDOA 4HZLA 3RIAF 2YMXL 4LLYA 3S4SA 4JPIA 2OX5A 4LRIA 3U30C 1ACYL 5BQ7A 4JZJC 1KULA 3QIBD 1JGDA 4ZQKA 1I1AD 1LP9F 3HC3L 1K5NB 4RAUB 4WEBH 4UB0L 1CDJA 1FNGA 3S88L 3RWJA 1JPGA 4FQXA 5EUKA 3E2HC 2DRUA 4GW1A 4N8CL 2CKBL 5C0RH 4P2CG 2D7TH 3CMOH 1T1ZB 1K3ZA 3M07A 2O5ZH 5DGRA 4U6VL 5AG9A 4JG0H 2CLVB 4OLZL 4F7MA 1TVDA 3BP4B 3MV8B 5C7XL 3ZE0F 3GSNB 3U46A 3Q1SL 4ODWA 3M1BA 4P3DB 3UTSE 4DGVL 4G42A 4NN5C 5HHNA 1KC5L 1VFUA 3ZKXC 5KSVA 3W5NA 3QNYA 5D1ZD 5CMAB 1CBVH 2HLAB 4F57L 5KS9B 5F9AC 1ONQA 2W9EH 5MEND 3L3KA 1EEZA 4UINL 4JY5L 1QBLH 3TH4T 5CLWA 3AREB 2C4FU 5J3HD 5LVEA 2R0KH 2EE2A 4JY4B 1CGWA 4N5UA 1FRGH 1MWAH 4NQED 1JTTA 4X5XA 2ARWA 2EE3A 5I6XB 5HD8C 3F7QA 3OAYH 1GJIA 4GRMA 2P47B 4X6DA 4EKXA 1WIOA 2C3XA 4HPOL 5KZCD 4FHBD 1GHFL 2IQ9L 4ZFOB 1CFSA 1M71A 1TIUA 3IXAA 3BMVA 5KTEL 2FIKB 2AV1A 4PJHA 2M8XA 4AENB 2R29L 1Q9LA 4EUPG 5DGQA 4UILL 1EBPA 4ZFZA 1XFPA 2NY7H 3BZEB 4CN1A 4YBHA 3BPLC 4DUXA 3EJYD 4N8VA 2JIXA 4IRJA 4R7DA 1TJGL 3WIIL 3BEWB 4A6YL 1FBIL 3BYYA 4YXHH 1YZZA 4R2GD 1ZA6A 3HC3H 3QEGH 4UIMA 3BW9A 1B2WH 2QL1A 4RAHA 5IK3A 2IG2H 1NGXA 2ATKB 4Z7NE 5T3XL 3PHSA 5C9JB 4FG6C 5IJKA 2NY2D 1J05B 1OAKH 3FN9A 5CKAA 5EUOA 4LQ1A 4XC3H 2I60H 5A16A 4GLRI 5DRZB 1FDLL 1JNHA 3QDGE 3T1FA 5KSUA 1JRHH 1TDQA 2F54D 5IJVA 5C2BH 1VGEL 3MV9D 2H32A 1CFNA 3KYNB 4MA1B 3VG0H 3E6HA 3EJYC 1CLZH 1UM5H 4ZNCD 5A16B 3BPNB 2APFA 3MLXL 1ZS8A 1NGPL 5GGTA 1NCDL 1NSNH 1N5AA 3OKEA 5GS1B 2IAMD 3BO8A 2HG5A 1LE9B 3P2TA 5D2LF 5KSUB 2NY2B 5ECJE 3Q6FA 1QOKA 5IJVB 2OJEB 4NHCH 2N1KA 4QWWD 1XGTB 4RMSA 1BJ1H 4U6HA 4QT5B 3GSNA 1I8IA 4L8CA 4DAGH 3U36A 3O2DA 5ID0A 1LEIB 1MVUB 4JRYE 3VXOB 1JF5A 1UVQB 3CC5A 3VFWB 1XF3B 3ESVF 3Q6GL 3QO1B 4F58L 5JLZB 1NFDF 5M7QA 6CGTA 2E8YA 3BE1H 5DVLA 5CD5C 3RA7H 3MRHB 1I8IB 4L8CB 5AWNL 3S3SA 4KGJA 4Y5VC 3TO4B 5IB2B 1DVFB 1C7SA 3LB6C 2XG5A 4XCCL 3T0EB 1DBMH 2V7HA 4MCZB 5KANG 4HIEA 1UVQA 4JFEB 1N64H 3WDJA 4YDKH 2UV3A 3HLAA 2XZQH 1BBDL 4JPVL 1KJMB 4JHBA 5MP6H 2PKDA 1J0JA 5EZLB 5CINL 1DCLA 4ZFOA 1AFVL 4XAWH 8FABA 4J1UB 4O51A 3A0OA 3VXPB 1IM9A 3MOBL 5JZ7C 3QXVA 3QFJE 1WUNT 3GRWA 1WWAX 4MCZA 3AROA 4WV1C 1WTLA 3BD4A 4JDZB 3WJLA 3RUGF 4HUXB 4JZOB 3R06A 1VHPA 4F3FA 4FXKA 3RWEB 4IRJB 4LP4A 5D1ZB 4UZGA 4X8JA 5GSVB 4WWKA 1Q0YH 2XA3A 3QXWA 3JTSA 3OR7B 3PL6C 3BN9C 3EOTH 3BKJL 1A7OL 3MLTA 2EICA 4M00A 1NUNB 2IBZX 3U0WL 5LBSL 4BZYA 4OM0H 2CK0H 1A7NH 4P9HC 3KJ6L 1ACZA 4HXAH 3V5HB 1I3GL 4LCWB 2VN4A 5IHUH 3VCLB 1JFQL 4U1NB 2DBJA 3EYQC 3EFDL 1QFWH 1CGYA 1W0WA 1NUDA 4O00A 3RWCA 5GS0L 5FO8A 3PP3H 4HV8A 3T4YB 5D1QC 1RI8A 2EH7L 1IKNC 4A2LA 4NCDA 5CJQH 1A14H 1JGVL 1CQYA 4TUOA 3V8CA 4H25A 1RHFA 2G60L 2R0ZL 3GZKA 3B3IA 4S1SL 2VDRL 4P3CH 3SDCA 3TA3D 1S9WB 4YHIA 1NMBL 4PB9H 1Y6MR 3U7YL 1GGYA 5FYKH 4GRLA 3M17A 4XPTL 4IHOA 3QRFM 5KSBF 5EU6A 2YUXA 4K2UL 4Z6AT 2VIRA 1MFEL 4NP4L 4RFEB 5JW4N 5GGRY 2C1OA 4OZIB 3GNMH 5I1EL 1OTUC 3WNNA 4LFHD 5EBMA 1CFVH 3BEVA 1H3TA 4ZSOA 4CAGA 3GK8L 1BQSA 2Y72A 5IBTH 5F9JA 1CWVA 3U4EB 3AAZB 1F45A 3OJVC 7CGTA 3MLVH 4WJ5B 5ACZA 3HKFA 3VFGH 5KVFL 3FT3A 3QHFH 1L4IA 3NFPB 4QHMB 5CSZA 1MREH 4KTDH 4NO5B 4ESKA 3AXLA 1FG2A 3QPQD 4MA8L 2GK0B 1GC1H 5ETUA 3ULUF 3WCYA 3BT2H 4P2QD 4J6RL 1W72H 2EDYA 3HI6H 4G80B 1J1OH 4XCNB 3ULSA 1BGXL 4G8FA 1O7SA 5KAQG 1U8KB 2FX8H 4G3YL 1C5DA 4Z95L 5BRZA 5ANMB 3AU1A 3SDXA 3MLYL 4B50A 3SDYL 3X14B 3GSWA 2GJ6B 5I15L 3IDNB 3RDTD 4K7FB 4Y1AE 4YAQA 4APQD 2XY1A 4EDWL 3IYLW 3QT2A 1RJLA 4L4TE 2Q7YB 4M4PA 3TZVB 2NY4D 4MXVF 1YN6A 1VA9A 1YNKL 2H3NB 2X4PB 2XI9A 3LKQB 4IJ3B 4JVUA 1RK0B 4FTVD 4P23A 4OF3A 4TSBH 3WDHA 3HCVA 5IB3B 3I6KB 2R4SH 2XA8H 2IGFL 3MRPB 2Z35A 3ULVF 3TF7C 3G6JE 4GW5A 5A2FA 5I18L 1H3UA 4JGUA 3BVNA 1RIHH 4ODSL 4P9ML 4HIJA 5J7CC 3WIFB 3U0PA 3T4YA 2FH6A 4IRSC 5DJ6A 4I9WE 3RJQB 3CFBA 2CGRL 3GI9L 4W70A 2DL9A 5DZNA 1YNTA 4OLUL 4YLQT 2VLKD 2W0FB 32C2B 4HQQH 4I5BA 4RCAA 3SDCB 4WI8A 1S8DA 2NZIA 3DXAA 2Z92B 2P8MA 4TVPD 4LQFL 5J1AB 3HFML 4HBCH 3IDMB 3ULUC 5JHDD 4C56B 4RX4D 3CH1A 4O2CB 1LO3H 4LKCA 4PJXA 5GRZA 4X9GA 3HI5L 3VFGL 4NRYA 4ETYA 2DDQH 4C57C 4YDJA 2ZUUA 3GJFA 3C5SA 3PQYA 2LABA 3RIFF 3DO7B 1U8HA 2BFVL 4ODUB 5JOEA 2FWOA 2JB6A 4DW2L 1HHIB 1OGTB 4KJWD 4N5ED 1PYWB 4WFGD 5FK9A 1EFXD 2BMKA 3TM6A 4LPXA 4WUUD 3BH8B 3HR5A 1IT9H 1U8HB 1ITCA 4FZ8H 3W11D 1NCUA 4X4ZA 1EEUA 3LY6A 1E28B 1Q1JL 3DROB 2BP3A 3BIKA 4MXVE 1NC4A 3RAJL 3WNMA 5ILTL 4HCRA 4EZMA 3GSOB 1NLBH 1HN1A 3JUZA 3ARVA 5F7EL 4Y19E 4OZFA 1U8KA 2HP4A 4MJ5B 1P7QB 3D5OF 4OF6A 3KPMA 3TT1L 3IDXH 4BQ6A 3MRBA 3UC0H 2ADIB 3MJ7B 4TSBL 1HINH 3BXNA 4M1DH 3CJJA 2PO6A 4MJIB 1OGAB 3AMLA 3LKNB 5F9DC 1X7QA 3O6FC 2HJFA 2XRAL 3PUCA 3KPMB 4FOMA 2RCSL 2YK1L 1G7HB 3ULVE 2VTFA 2ORBL 2JCCA 3MNZA 4APQC 4F37K 3VGAB 3OG6B 3VFSA 4Z7VF 2AJUL 1ZGLB 4EI5A 1WBZA 1MQKH 2F5AL 2VLRA 1QSFA 3C60C 4EXPX 3L3JA 5F71A 5E2VL 1Z3GH 4NHUA 5DJCB 3PDGA 4PPTA 2HJKB 2W91A 4I3SH 2AJXH 3MMEA 4RGND 4JFFD 3TN0D 1I8LA 4LVOC 4FQ2L 3HC4L 5B4MD 3MLWH 3OR6B 5F1IB 4AY0A 4X5WB 2D4FA 3WN5A 4FQIH 4FXGB 4JG1H 4KQ4H 4K3JH 4PTTB 2DQHL 2EXWC 3QAZB 1S5IH 4MD0A 1S7SA 5CCKL 5EWIL 3BYTA 3QCTH 4IMLB 5IESH 1WWWX 3V95A 3BKCH 3OAZK 5TJWK 4X6CA 4KH2A 1QPPA 3CXHK 4M5YH 1R0AL 3ARBC 4G6JH 4P2OA 4PRBA 4XTRD 3UBXI 4JAMA 3KDMB 1P9MC 1IEHA 2VXTL 3M1BB 4P3DA 3ZL4L 4OZHF 4QHNB 3CLEH 5T1DL 1NFDE 2P5EA 4PGDB 3SGJC 4JKPL 1INQA 4F33B 3TC9A 1CK0L 3S35H 1F97A 3G5ZA 2AJVL 1DQMH 3FCTB 2YA2A 5BXFB 5JUEL 4JHZA 2PR4H 3EO0A 4QHLB 1I1AC 3H3BC 3X13B 4JM4H 1TJHL 1F11A 4XC3L 1PAMA 3WL9A 2UUDK 1C1EH 3CVHA 5E2WL 2X4UB 3W0WB 7FABL 4LASH 3BDYL 1CXHA 2DBLH 5FUCC 3RVXC 2IAMC 2AV1B 4PJHB 2YBRB 5ESAB 3RVTC 3L5XL 3KPLB 2HTLD 2DQIH 2EKSA 4PJ5D 5SV3A 1HIMH 2ZUQB 1OGAA 4PJIA 1NCDH 4S0TD 2IMNA 3MRDA 4Y2DA 4Y4HD 3QWOA 1G6RL 3C6LB 1S7TA 3KPOA 3QQ3A 3LZFH 1F58H 4XNQB 3B9DA 5B38G 4IIQA 3RGVC 3BHBA 5F9WC 3CSYB 1CGSL 4D3CH 1WZKA 3CLFL 3B2UC 5C9JA 1AHWB 4XCFH 2QR0A 1S7VA 2WQRA 2Z91A 2HTKC 2AJ3B 3RWJB 4P5TC 1C08B 3RX5A 2J5LB 3L5WA 3MBEA 2CQVA 1RVFH 1U8OA 1I7UA 4XP1H 2NW2B 3S5LA 4UU9B 4PTTA 1QLFA 5BCAA 5ICYB 3BAEL 1MRDL 2BSRA 1AXTH 4OLWL 5HI4C 5LAXA 4OF5A 4XWOD 4XNXL 1QUNA 2VDKL 5IHBA 2KUTA 4GXVH 1LE9A 1ZHKB 5K59E 4U1HA 1QNZH 5IIEB 2C7UB 5JOPD 4AT6A 3KNBA 2HT2D 4X4XA 1ODAA 2XTLA 1PG7H 4YIQA 4PG2A 1N2RB 2LV4A 3OJMB 1QLFB 4ZOAA 1A47A 3UJIL 1K4DA 3MA7A 4NSKB 4YK4B 2QQNL 4QTHB 1JGLH 3QZWG 5IIEA 1FORL 1X5JA 4UQ2A 4W6XB 3RZCB 3VRIA 4M7LT 5J1TC 3ROOB 5DDHA 3MLRH 4MSWA 4RGNB 3H6JA 5T1LB 1GXEA 3KPSD 3ZYZA 3WFHB 3O9WC 4NFDA 3U82B 4DKFL 5GISL 1ZGLP 4JVPA 1YA5A 4YHML 4XX1E 1Y18A 4NUGH 1EJ6A 3OKNB 4M6AA 2A6IA 5GGTL 4DK6A 2E7LA 3ETBF 1T3FA 1BQLH 1KB5A 2MCG1 3D9AL 4KROC 1KGCE 3FB6A 4PRHD 4CDHA 5KSBA 1CFQB 2D0HA 4PJGE 2Q6WA 4ORGB 4P5MA 2AI0L 5CD5D 3DVNA 1OAQL 2VLJA 2VZ3A 2KL6A 4XI5C 2HMID 2UWEA 3TJEL 4NRXA 1YNLH 2WIIA 2XTJE 5D70H 4XWGH 3VFPA 5D1QB 9CGTA 5K9KB 5F7NC 3UXFA 1BBJA 1LO2L 1GSMA 2F9BT 4QTIL 1U2HA 3GUTA 1RVFL 3QUXB 3DX6A 4L4VD 4X9BA 1YEIL 4CVZA 5HTSA 2D3VA 2UY6A 1OSZA 4GG6B 4OLXH 2Q3AA 3VXNB 3PDOB 4HZLB 4PJ9A 1MJJB 4CVXB 3V6OC 4KK5C 2YD5A 3TV3L 3K81A 2WP3O 4ZXBA 4L4JA 3SQBA 4O4YH 1VCAA 5HYIA 4MNQA 2AERT 1JWUA 4NDMB 1ZANH 1JPST 1Q8MA 1ADQA 1ZLUK 2R0WL 3LS4H 4MMXC 5JPMB 4LAQH 4K3EH 4E41A 5ID1B 3OGOE 1KLFA 4N0YH 2YA0A 1Q72L 3BP5B 1OF2B 4PS4H 4YX2H 1RV6X 3VA2C 2XZQL 2P46B 3KJ4C 4LLDA 3HRZB 1FGVH 4IOFC 4IRZL 3RL2A 2EECA 3K8KA 3DOSA 1G0DA 2O61A 4R7NB 4JFPB 1MH5B 5E4EC 2QSQA 2CRZA 4KJPD 2EDXA 1K4CB 1P4IH 1IGYB 2DQEL 4OQTA 2IH1B 1M7IB 5DR5H 1G7QA 4NQDB 3HAEG 4U1KB 1EO5A 2XN9D 4XC1L 2DI9A 3VA6A 2M2DA 1HEZB 1MY5A 4G6ML 3BEVB 1ZVSA 1WWBX 3CFKB 1AGFB 5AYUH 4KJPC 3FONA 4DTGL 2V2WA 4YGVB 2DLEA 3DJ9A 3FFDB 1DN0B 1BOGA 1A7PL 1YEJH 4CMHC 4B41A 1RY7B 4LQFH 1UA6L 1FNSH 5C08E 1IAKB 1HEZA 1DLHA 2NY4C 5JXED 2A6IB 1QSFD 2G2RA 1UCTA 3R06B 1IAIL 3GJFK 3O6KH 5GQBA 3FFDA 5BV7L 5L9DL 4WW1B 4OGYH 1TENA 2R0WH 4MB4A 5I75B 1B6UA 5DUBA 4W6YB 3IKCA 1NCWL 1QR1B 4G7YL 1FFPB 4KKAC 3GSWB 1VFOA 4H5SB 5FGSA 3SO5A 4HC1L 2F74B 3NCJH 3I85A 4JQVA 1R5IB 4HWBL 2R56L 1TNNA 3KLSA 4YBQD 4Z0XA 2R0ZH 1ZAGA 3DWTA 4D9QD 1K8IA 2OQJA 1BEYH 2UY7A 5EU7C 1R3KA 5I8KL 2J6EH 4U7SA 1UWGL 1I85C 2CDGB 3P9MA 1DQQA 1NGQL 2CR3A 4PBVC 4N1HB 5B22A 3JWOC 3QFJD 4JM2B 4UQ3A 3EHBD 2ZCKH 4KKBD 3JTTB 3R8QA 4XXDA 3TWCH 43C9A 2UZXB 2DWDB 2OJZL 4HIIB 1RIVH 3IDJB 4V1DD 3F58L 4EOWH 5HYQA 4FFVC 1Q9WA 2FX7H 4IOSD 4WO4B 1NC2D 1CR9H 2WWMC 4IDJH 4EI6B 2W0FA 4FA8A 4PJFA 1AGCB 1FZMB 5TQ0L 5T5FL 4ZUSA 2FATH 4HIIA 1P6AB 3C5JA 4KZDH 5D6CA 1X3DA 4OGZA 2NLJB 3EOAA 4TYUA 1R3HB 1EBAA 5E2UL 1U58B 1PW3A 4HC1A 2B1AL 4U1LA 1A1NA 2GTZA 4LEXL 2DQGL 3MV7D 1I9EA 4KK8D 3QDGD 3ZYIA 2R56H 1HINL 2OXGA 1BZ7B 4U1KA 1B4JL 5D6CB 2F54E 2XG4A 4ODUA 3HMWH 4Y16B 2GI7A 1WVZA 3NFSL 3NBNA 1GGUA 2Q86A 1BLNA 4ZSOE 5F3HA 3ZE0E 1CLOL 3OQ3B 5HGAB 5DWUH 2GY5A 3TIDA 1SJEA 5TGBA 3V4VL 1YUHB 2WINA 1PEZA 3AU1B 3C2SA 3SDXB 4JANB 3V6FA 4ALAL 4L4VE 5EA0H 1RUQH 1Z2KA 3RWDA 1KYOJ 3BIKB 3BPOB 1NEZB 1WFOA 4PRAB 4I8DA 1JWMA 1MCWM 2AVGA 1L9NA 4JR9L 1FRGL 2PYFA 1MRCL 2FZ3B 1T83A 4BFBD 5DUBB 4MLSA 4S11A 4H88L 2GUOB 4Z8FH 3GIZH 3FO0H 3GIVB 1IRAY 1N59B 5T1KD 4GH7B 3SJVA 5GZOC 3IAPA 5I16A 4KZDL 4E9LA 4PRAA 3IRPX 3PL6B 1S5IL 2NPLX 3L95A 1ZK9A 1PEWA 1MI5A 2Z4QB 1KENL 4KDTA 3I9GH 3NTCL 2HT3D 1NAML 2FD6H 3BVNB 1G7HA 4CMMB 4OV5A 3RQ3A 1CG9B 5HHQB 3P9MB 4ODTL 3FQWA 4LBEA 4AIXA 4A6YH 2VH5H 2JK5B 1KJ2L 5BW7A 2UZIH 4UAOB 32C2A 1M7XA 1LO0L 2R4RL 3NIDE 4JFOA 1T21B 3ECBA 5EUOE 1FN4B 4P57A 4X83A 3P4NA 1Q9KA 3FQXA 3RY6A 3QQ4B 4KVCH 5F6HJ 3U7WH 2ZOKA 5IHUL 3K80A 2X70B 2RBLA 4MNHA 5CJXC 4HUUB 4UILH 1T04A 5FA4A 4ZUSB 1TJHH 4JFOB 2X44D 3Q5OA 4PUBL 1BFVH 4MHHG 5CEXB 3MV01 2XICA 2UWEF 2F53D 4MJIE 1RJZB 3GIZL 2P8LA 4DVBB 3DGGB 3MRMA 4PP1D 5C9KA 3GJEB 5JHLH 3PWLA 4P2OB 4L3EE 5JHDB 5F7FA 4GQPH 1VACB 5BMFL 3WXVL 5JXEA 4XVUD 2J4WL 2ENSA 3F62A 4M9PA 3T8XB 5HVHC 4JQIH 4ZO7A 4M1GL 2VLKB 2VC2L 3GJEA 4HUVA 3ARBD 1EUUA 4X5LA 3WLBA 5CBEB 1MFAL 4Q74A 4Q6YA 4JFXA 3DX7B 5C70A 1YUHA 2YSSA 3QQ9D 4JO1H 3TBSA 2HVJA 4I18A 4B7IA 5CSZB 4XHJC 3WS3B 5GGVH 2VLKA 1HXYB 1FG2B 1CGVA 1YMMB 5EC1A 1JZ5A 2Z93A 5LGHH 5D2LA 4M8QA 4ZFGL 3MODL 2J88H 4XCNA 5CUSL 5B3NA 4G8IB 4NQXB 4AH2A 5LKNA 5JPNA 3CNKA 5TE4H 4U31A 4HKBB 1RU9L 4N8VG 3JWDL 3BFOA 3RTQD 4NZTH 1JZ2A 3MV7E 4RGMC 4NHCL 5ISZA 5EO9A 1H5BC 1FL3A 3MLSL 1YEHL 4O9HH 1IE5A 3BIBX 1MCWW 4RAVB 3F6IA 2VB5A 12E8H 5GRJH 3BDXA 5I71B 4RNRB 4KRPB 4Y2DB 3OJDB 4KROD 5EN2B 3LEYL 3E6FB 4GKOA 3VGBA 4QRRD 2L4OA 1ZLWH 4XVJH 2RJMA 4YDVB 3H3PL 4W4OC 1XGQB 5T1LD 1JYWA 5EIQA 4KC3B 3HPLA 3LEVH 5ENWB 1LMKA 1MHPH 4YHKH 2Z9TA 1S9YA 4PRPA 2XPGB 3VXQA 3CSYA 2YPVL 2NXZB 4GAGH 4LPYA 4YPGA 1Q0YL 2X4QA 2DQJL 1T7ZA 1WC7B 3UZVB 4KKLC 4X7EC 4UUJA 5I74C 3T2OA 3C8DA 1YC7A 4KI5D 2ICEA 4P4RB 4P5KA 3OKMA 4BZ2H 4G43B 1ETZB 1YY9C 4YQXH 1AFVH 3D3VB 3CZJA 2BJML 1MLBB 4M7ZC 1T22B 2FX9H 1N6UA 4RIRB 1DP0A 2DJSA 4TUJA 3BGMB 4OD1H 5IF0B 3G08B 2Y6SD 2IAMB 3GHBL 4M5ZH 4XHJD 5FYJL 3CFCL 2VUOA 5KG9B 4J3XA 5FYJD 4R26H 1U3HA 4NZDA 5DUML 3I6LE 1UG9A 1YEFL 4QHUA 5CBAB 4UOJA 4PJBA 2G75A 2CLZB 3MLSH 4O9HL 4YFDB 4YIQB 1F2XK 1HZHH 5DK3A 4LSQH 3G08A 4CGTA 4U6XA 1GGBL 4ELMB 2LTQB 3P9LB 4ETQA 2BZDA 1J12A 3SKOA 5CGYD 4D9LH 5T3ZL 4PG9B 4PV8B 5T3ZD 4UTBH 3IAQA 4NRZB 4Y16D 1K5NA 2AJSH 4NM8L 4DCQB 1K2DB 5D7IE 4E41D 2IALA 2NY6D 5IVXB 4J4PC 3CVHB 4ZO8A 4KHTL 5TE4L 5CBEA 3JWDH 1HHKB 1IQDB 3FMGH 3IB4A 1UACL 4CBPA 4Q9QL 3SDAD 2ZP0T 3OKDB 5I9QC 4EDXB 3UBXB 3MRIA 4HPYL 1IJ9A 3EZ8A 5L0QC 4K94H 3QNZA 1KYOK 3MV8A 2IFGA 3ZKND 5KVFH 1JUFB 2NYYC 3MJ6A 4KK6C 3RRQA 4HKBA 1VGKB 1MIMH 5EU6D 1P5VA 1T20A 1EHLH 3X11B 1V3JA 1FL3B 3UBXA 4UDUA 1WZ1L 5K33A 3MOAH 3OMZA 4AEIL 1MFEH 4IRJD 4YWGH 4PJIE 1MFNA 3HI1B 1YEGH 1X7QB 3SDDB 5ACLA 1Z9LA 1YY8B 3L3DB 4JPIB 1RZKL 3E6FA 3QFJB 2GTWB 4NOFA 4XXCA 4Z7OF 3QUXA 2J12B 1NJ9A 5FO9A 4G9FE 4PBXA 3DUSA 5EU3B 4ZS7H 2RIKA 2V6HA 3O81A 4WWID 1ZGLA 2EZ0C 1KFAH 3O9WD 1T66C 4LVOB 4PJ9C 1OP3H 4AJ0A 3QFJA 3AC0A 3H9HB 2D9QB 4NKQB 5JORB 4HG4J 1Q9LB 4PBWD 3QUMB 4P5KB 2XQBH 3TWCL 1NAKH 3GFUA 4YHPA 4UB0H 5T33L 4AT6B 5JPMA 2XZZA 5MENA 2DMBA 2Y9RT 1OLLA 3BGMA 1SJXA 1BD2B 1HQRA 1NL0H 4Z0BL 1KEGL 2IAMA 5EOCL 1QEWA 3ZO0A 4HWBA 1BVLB 1LHZA 5D72H 3ULVD 2XKNA 5TQ2H 5D5MA 1AD0B 5E4IA 1U3HB 3FRPA 1FZJB 2EO1A 3CX2A 3ULUH 3R8BB 4JHWH 1SJHB 1F3JA 4Z78A 2X4NA 4NGHH 3UO1L 5ANME 3N9GL 4NQSB 4XZUA 3U2SA 1YEDB 3QDGB 4YWGL 4ELME 5LCVH 3QBTB 1M7IA 2GIYA 3V8OA 4P4KB 3T1FB 2PN5A 2ICWJ 2Q8BL 1HH6B 6FABL 1ES0B 4TQEH 3NN8A 4ZS6C 2X5PA 2PCPB 4YK4C 5FO7A 5HHPA 1BEYL 2GHWB 4M43H 3AS1A 5HI5D 5J9PA 4Q6IB 1CFSB 1M71B 1ZS8B 4QTIH 1DBKL 2FEEL 3PWNB 1KIQA 2YWYA 2BVOB 3EO0B 4DKAA 4XCCH 2W9LA 4PREB 3ROLA 2ATPA 1XIWB 2ADJB 4GAYB 4OLUH 4HH9B 2PCPA 3O11A 4R7DB 4WIQA 3FAWA 4LKXA 3KXFD 1JUFA 2WBWB 3RL1B 4NKMA 1MRFL 1NDGA 3O6LH 4XB7A 4EUPB 1JHTA 4UV7L 2FCBA 5FYKL 3TBVB 4Y4KB 2AK4D 5DZOA 1KLGB 3QCUL 4NKIL 1AQKL 1QFPA 1FLRH 2AXFA 4N0YL 3TFKC 3HN3A 1VFMA 3KLAA 4LLAA 2WWMD 3LH2L 3QQ3B 2DQCL 2XTJC 2QKIB 1P7KB 1VPOL 2ZSWA 4K23L 3IDGA 1L7IL 3MGOB 4H1LB 3BGAA 4JFEA 1S7QB 3UMTA 3QUXD 4YHYB 3E3QC 3BRFA 1DBBL 1EA9C 1EH9A 3B9KD 3NGBB 4JM2A 4UQ3B 4WUKH 1U93B 2WLZA 5EUOF 1NPUA 5AEAA 5IW6B 1I8MB 2FJHB 3DECA 1JRHL 1OF2A 1ZWIA 3MGOA 5E9DE 1DQLH 4JHWL 1JGDB 4LLWA 3NAAH 4XMLL 5F7YC 4AEFA 5F8RC 3EO9H 4M3JA 2W59A 3IDYC 4FXKB 3RWEA 1AKJD 2WUCL 4UU9A 2VDMH 4L5FL 5MENB 3MJ9H 3HNSH 1YMMD 2VXUL 5L88H 4EI6A 4A2MA 4WGVB 4JZJA 3B8SA 2QSCH 3VDBA 5E56A 4ODTH 4GW1B 1AD0A 1ZLUH 2IADB 3H9SA 5GGRB 4C54A 4U6TA 3CC5B 2V9RA 4KKLD 1ZVSB 1TCRA 2XFXB 1OD9A 4NC0B 3SGKA 3UYRL 4BQBA 3SKMA 5E8OB 5EB9A 3RI5K 5KOMC 4KY1H 4JJ5A 1IBGL 4I3GA 2NY0B 5C86A 1A6UH 1I7RB 2MMXA 2YK1H 4AQOA 3FO9A 5DJAB 4P4KA 4X9HA 3FOMB 1N4XH 4HIEB 1KCUH 5JA9A 2F58H 5F1NB 4Y16A 1HILA 5IQ9A 4XPFL 4FTVB 1JIBA 1O0VA 5E8OA 3WUZA 4R97C 1NFDA 1JK8B 3QA3A 4JJ5B 5DMYA 5E6IB 3NCFB 8FABB 2E3VA 5EZIL 3C8KB 5I8EB 1TLKA 1U8LB 4ZUWB 2ESVA 1L6XA 3VGHA 1G7MB 5ITFB 4H5SA 3MNWA 1P84K 4JO1L 1EEQA 3FB6B 1MCOL 1JK8A 3QA3B 3UYPA 1J18A 5LGJB 1QG3A 3WIHH 3B9EA 1M05A 4R9HA 3QEQD 5I8EA 1U8LA 1T6VN 3NIFF 3C6SA 1KLGA 4P2QB 4NNYB 4LSUH 1P6FA 3K8LA 2CDGA 1D5ZA 1J1XL 2AI0H 2CRMA 1PQZB 4N9OB 5F3BA 2YS4A 4NWTH 2GAZA 5T1KB 4DN3L 1FSKC 2Z4QA 2FECI 5DJ2A 4PGEB 5C8JB