2PKDA

Crystal structure of cd84: insite into slam family function
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
EIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords SLAM family member 5
publication title Structure of CD84 provides insight into SLAM family function.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 107
sequence length 107
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2pkdA00
1I4FA 1XF3A 1Z2KA 4Q9RH 4C54A 2XZZA 1BOGA 1U2HA 4WO4D 5F9JA 2B0SL 2EXYD 2W9DL 3KJ6H 3IGAA 3V7MA 4ACPA 2AXJA 3KJ4C 4M7JH 1FSKB 5CMAA 2X2YA 5D1XB 3DYOA 3NFNA 4NDMB 3L9RA 4K8RD 2CLVA 1NMCC 3NPSC 5DK0A 1A7BA 3D2UA 2YEZB 3ZL4L 3GJEB 5BO1H 1EAPB 2QHLA 3C60C 2J8UE 3JZ7A 1NDGA 4MB5A 2YWYA 1CFSB 3QCTL 2D0HA 3AC0A 4Z7NE 1TQCC 4Z7UB 3V0VB 5BV7C 1I8LC 3AUVA 1L7TL 5ID0A 4R6UA 2FBOJ 4HDIB 1KCVH 3U6RB 1QKZH 2Q1EA 1IL1A 2VSDA 1YMMB 3ORJA 4MVBD 4D3CL 2VLJE 3LKPB 1MUJB 4HWEL 4PBXA 4MXVF 1Q9WB 4JFZH 5D7LD 1HHHA 2Y07H 2BVPB 4OGYL 4N0UB 1YEHL 4BUHA 2K7QA 1TJIL 4I13B 4YWGH 5JHDE 2JELL 4HPYH 1RD6A 3MLUH 5HHME 2YUZA 1BGXH 1RZFH 1EVUA 3S3PA 1NAKL 3VXPA 4IIQB 3CUPA 3NPSB 5JDJA 5HHQB 4GG6A 4UAOB 1KF9B 1JHKL 3T0AA 1KJ2A 3ZKMC 1RU9H 2YC1A 5E99L 1MCDA 3QCVH 4YHML 2H2SD 2HLFC 1E4XL 2DQCH 4P5TB 4LNRB 4JPIB 5HYJB 4UV7L 1HHIA 3UJJH 4BFIB 2BERA 4TVPL 4MB3A 5E56A 5KSBB 4OLUH 1UKSA 5EBLA 1T6VN 1NFDE 2J8UF 2VQ1A 1QOKA 3BN3B 1XGQB 5EORH 5FYKU 4YDLC 2VLKB 4QHNA 3UMTA 3ZSTA 3IT8D 4OGAD 2OP4L 1QLRB 2PKDA 3WFZA 3UX9B 3NCCB 4HZAA 2DLTA 5B22A 4DGYL 1FV1B 4MMZC 1FVDA 5L2KD 4X80L 3S3SA 5CD5D 2YOCA 3RHWK 3MR9B 2R0ZL 3OKDA 5DD6B 5GJSL 2W9EL 4Z0XA 4WVRA 5EU7C 4M7LT 3I50H 4GRLA 4M8QB 1YEKH 4QXGH 3I9GL 4F7TB 1KACB 2CIIB 3P4NA 5FM5O 1H5BA 5MENE 1JGDB 1XF4A 5GXBB 5IB5A 4F3FA 2NXYD 3HG1A 1EO8H 1F6LL 1M05A 3MRHA 4ZFGH 3O41B 1CICD 2V5MA 3RA7L 5INCB 5CINH 4GMSL 1QQDA 4HV8A 4E42A 5I2IB 4YDLB 3GSXA 1G7LA 2IQAA 1FAIH 4M00A 5CUSL 4I48B 4QCIA 4DKEL 4ETQA 5DHYB 1CVSC 2DAVA 5IKCB 2NXZC 3D3VB 3PV6A 3H9SB 5HPMA 4KC3B 4JO3L 1NFDF 4LVOC 5GRJH 4K8RL 2AJUL 4QTHA 4LCYB 2CKNA 3QDJB 5TPWL 5JOPE 1F90H 5D1ZA 2OX5A 1IAMA 1Q9OB 3WDIA 4V2CB 3QG7L 1JNNH 3BT2H 4WU7B 5FF6A 4TQEL 5TE4L 4XPGH 4M6NH 5C6WH 3X12B 2H9GB 2AJVH 2Z91B 1JMZA 1MFDL 3GKWH 3LIZH 2BCKB 1IGYB 3NABH 4CBPA 1CFQB 1R5IB 1JGLH 1MCWW 1X3DA 3O8XA 1KBGH 2BNUA 3CFDA 4AYFA 1P6FA 2PUQT 1X4YA 4GBXD 1I7RB 4PJEB 5F93C 2VIRA 4P9MH 1CF8H 3UJIH 2VLRA 2R2HB 5IM7B 4WRLA 2BY1A 1QPPA 3QNXA 2NXZB 1PAMA 2VDQH 1WBZB 3GMRB 4H88H 5CZKA 3D85B 3BZEB 5J06A 4J3XA 4YR6B 4NQSA 4FNLH 3E6HA 1E0OB 5EPMB 3E3QC 2H8PB 1JPFB 1FH5L 1T7WA 4X7TB 4GAJL 4LOUD 2A9MH 2PR4L 4XP9H 3FB6A 5TF1L 1CFVH 4K3JH 3MRIB 2H1PL 3P0YL 3IFOA 4XNQB 1KNOB 3MCLH 1RIVH 2GJJA 2YD2A 4GG8B 3V7AE 2WW8A 3T4YB 1IFHH 4EUPA 4KZDH 4AIOA 1TPXC 5HJ3B 4KHXH 1JTOA 1KULA 4L9LA 4AENB 2AVGA 3O4LE 2VITA 4OQTA 1KPUA 2X05A 1QP1A 3BGMA 1K4CB 3CDFA 3RVWC 1IMHC 3VFGH 3VFMA 4M93B 3UDWA 1B2WL 3MJ6A 1BF8A 5ALBH 3ARTA 2WUBL 4ZUTA 2J6EL 3VGGA 2IFFH 3VXQA 4L5FL 4F7MA 5B39A 4QWWD 3MRBB 3T0EB 1WWCA 4NQXB 3JWOC 4U7KA 2DB8A 3WE6B 5IOPA 4UT9L 1T5WB 5C0GA 3H3PH 1M71B 1FPTH 3ROLB 3WFCL 3T0WA 3RWCA 1I3GH 5C0RL 1B6DA 1MRFH 3EOYG 1FN4A 1NGQL 2PW1B 3PWUB 5JZ7C 3O6FA 1BZ7A 3RPKA 4H0HB 3CVHA 3BWAB 5ISZB 1U3ZA 5HHXH 4YFLI 3VFWB 2O26U 4LDOB 2DLFH 4LLMA 3SGKA 1OAQH 5E1HB 2BOBA 5TQ0L 3LKRB 4JQVA 1TPXB 4LU5L 4XHQA 1GSMA 2DQUH 3VA6A 1ZK9A 5I8KH 1JPGB 1XZ0A 2N56A 1NGYB 1SY6A 5ANMA 1F02I 3CMOH 3RVVC 4G6AD 3VFNB 1WJ3A 1DUYA 4ODVL 4RMWA 3X13B 1I1CA 4Z95L 2WLYA 4LSTL 3GIVA 1JI1A 4QYOB 4R4NC 4OZFG 4LASL 2FRGP 2ZUYA 1UA6H 4NWTL 3VFPA 3UPRB 3L3JA 1FC2D 3DETC 2O5ZL 1HCFX 4BK5A 1A6VL 4Y8DC 1A6WL 4J1UA 4O4YL 2VMFA 2NNAB 1OB1B 4LPUA 1I1FA 2UZYB 3SPVA 3O6MH 5D1QD 1A7NH 4NKMA 1AGDA 5F9OL 3PQYB 3OL2A 1A6TB 3IFNH 5BW7C 3S34H 1OTSD 2FGZA 4HK0A 1I4FB 1VADA 3BQUC 4LSRH 1XF3B 3UYOD 5I1CH 1BOGB 4ZFZA 5D2NE 4P2QD 3S35L 4LLYB 1A3RL 5GZNC 2FX7L 5CMAB 3F8UB 1SMAA 5JORA 4Y4FC 3NFNB 5BRZA 3L9RB 2CLVB 3H42L 5DK0B 3D2UB 5BV7H 4EEEA 3MV7A 4PJGE 2RGSA 4J3SA 3F6IA 4TSBH 2H41A 3QHZL 1KXVC 1BWWA 3P9WB 1NDGB 1N64L 5I9QB 2BSRA 3SKMA 4M6OL 5MENA 2VC2L 2GITA 3EYUL 2WSKA 5ID0B 3GMQB 1E4KA 3F58L 2V5YA 3LKNA 3GI8H 1IL1B 4K7PH 1EEYA 5I8OL 2XYCA 1HH9B 1EPFA 4LDLB 3K46A 1U8KA 4HUXA 3W0WA 1HHHB 5F1SA 4I0PC 1PDKA 3ZT7A 1DQDH 3B4NA 2ZCHH 5DT1L 2UZIH 2HTLD 4G8FB 4HCRH 1T7ZA 4POYA 2BDNL 1NAMA 2AEIT 1UKQA 2HT2C 3VXPB 1TJGH 3CUPB 5GJTH 4GG6B 1AC6A 5J4MA 4WW2F 3DHJA 3QPXH 4P5MA 4FQ1L 1KJ2B 1H5BC 5EUOE 4OAWA 4ZS6C 4LRNH 1RFDH 3L5XL 3DPBA 3HRPA 4PJGF 3QXVA 3PXHA 4XNMA 5DC0A 5EIQA 1OHQA 5EBLB 3V4VH 2B2XL 1JHLH 4HF5H 2K7PA 4WI3A 2VQ1B 5F1KC 1JPTH 3JWNC 4HWUA 3WS6A 1E4XI 4ZFOA 4LEXH 5C0AD 4QHNB 1D9KD 4JO4L 5CP3H 1RZ7L 2EDYA 4XVJH 4HJJH 5CGMA 2YD5A 2Z0BA 1FVDB 1VHPA 5AEAA 1RMFH 3TZVA 4LCUA 3THML 3EYQC 3OKDB 3DX7A 4Z0XB 1INQA 5LCVL 1IZJA 3CFCH 4Y4HD 4GRLB 4PLJC 3DSFL 4D9RE 1MWAA 2V9RA 1YPZE 3P4NB 1H5BB 1XF4B 3TN0A 4JM2F 5IB5B 4F3FB 4M48L 2J2ZA 4PS4L 2CRMA 1CN4A 3HG1B 1M05B 3MRHB 2CMRL 5CFHA 3UC0H 5EIIA 3CXHJ 4LCIL 2J4WH 5GSRA 3LDBB 1VFAA 4OD1L 3P0VL 1JRHH 3O8XC 2CRIA 4P4KA 5EUOF 4RRPA 4ODWA 1QQDB 5CKAA 4E42B 5IVXE 2E7CA 2R9HC 1LEGA 4G8EA 1G7LB 1FFNA 2O5XH 1U3JA 4ETQB 4QCIB 3MLXL 1OTTC 5DJZA 3WHE1 1KYOJ 2X4UA 1H15A 3G04A 4UUJA 4HUVB 3PV6B 1XT5A 2NQCA 3QNYB 5HPMB 3GK8H 2WV3A 1KTLA 5IFAH 1IT9L 4MNQA 4QTHB 5D1ZB 1KIQA 3VFRA 4PBVC 2GAZA 4ZMAT 2JIXA 1QSEA 5D7KD 4JB9L 5FF6B 4DKDC 5T5NG 2X4TA 3QUYA 4HXAL 4LCWE 4Y1AE 3NA9L 1X5AA 1OARL 1DSFL 5EU3A 1A7QH 5JPMA 4FABL 5EOQH 5IT2H 1AO7A 2CUMA 4L9LC 1QBML 3RHWF 3G6DL 4EOWH 3CLEH 3O8XB 1HYSC 4JHAL 1JNJA 3ZLQC 3HMXH 4LLUA 1NSNH 3UDWC 1I3UA 4GKZA 3AGVA 3MLRH 4A6YA 2VIRB 4QGTA 2VLRB 2EECA 3X14A 1A14H 3QNXB 3VWJD 1OT1A 2OK0H 4PY8I 4M6ML 3ROOB 3U4AA 4I5BA 3WUZA 3Q1SH 3E6HB 1AI1H 5KVDH 4P2YA 3VFSB 1MSPA 2KZWA 1WIPA 4P2OC 2CXGA 3V5KA 4LMQI 4YIQB 1BVLA 4H8WL 3FB6B 4WTWA 2X4SA 5KJRL 4G6KH 4EDXA 2X4PA 4F7EB 5FGRA 3AU1A 4HEME 5CJ8A 3TPUA 4OD3H 4OSUL 4EUPB 4JQVC 4JREC 1CS6A 4G8GD 4AY0A 2BY0A 4AJ0A 3RWJA 4XPTH 4WFHE 2GI7A 4GFTB 1WTLA 3QJHA 1DBKL 4GQ9H 5I76A 2VITB 3FFDA 2ZCKH 1KPUB 4Q58C 4PJBA 4TUKL 5DMGC 3S3JA 1DEEA 3JWOH 3VFMB 5B8CA 3SE3A 4EDWL 3PGFH 4ZUTB 3MJ9H 3P30H 1U95A 4ZODA 1GOFA 1P7KA 3BSZL 5B39B 4F7MB 4ZUUA 5F72S 1J0YA 3S37L 5T3XH 4M1DH 1IBGL 1PKQA 2ZPKH 1XF2A 5IOPB 1U8LA 1PZUB 5C0GB 1U8NB 1Z9MA 4MA8L 3SDAD 3RWCB 5AAWA 1E4WL 1FN4B 4DKFH 4QHUA 2MSPA 1QFHA 3O6FB 1BZ7B 3NN8B 4JFEE 1QFWH 4R3SA 1OQXA 2F8OA 4MAYA 3RGVD 3CVHB 4LAQL 5L7XH 2ATKA 3QISA 3KWWA 4LLMB 1EBPA 2BOBB 3BKCH 4UOJA 3CFJA 3U2SA 2JJTA 2RQ8A 1QVOA 1XZ0B 4PBWD 1JV5A 1F6FB 5ANMB 3X3GL 4LF3A 4LSUL 4WWID 5KSBF 2EIDA 1RHFA 1DUYB 2P5ED 2YD6A 3WO3B 3GNMH 1HK6A 2O5YH 1PSKL 3D0VA 3GIVB 3RI5K 4D0BA 2KBGA 3FMGL 3ZKSD 1ES0A 3G5XA 3P3YA 3VFPB 3L3JB 4DUVA 2RB8A 1KB9J 3OTTA 2FSEA 3F62A 3MPCA 3EDJA 4M4RA 4YBQD 3KJ6L 4OZHA 4NPYA 3QUZA 4J1UB 3EJZD 2DI7A 4YXLH 2DQGH 1I1FB 3SPVB 4D8PA 1ZLVH 3FJTA 5K9KA 5F7UA 5E2WH 5BZWA 1E4KC 3VE0A 3ESVF 4NKMB 4J8RA 2IG2L 5C0BD 2IEPA 1BQLH 3H3BC 4NO0A 5CLWA 5C0FB 1JZ7A 3GHEL 5BO1L 4JHWH 1KTRL 1CXHA 1XFPA 3BPLC 5LQBH 4JRXA 4HK0B 1VADB 3HNSL 2NY4D 3FQWA 4JKMA 4CGTA 2DBJA 3UO1H 4M7KH 4WFFD 5C07E 1A0QL 3UBXA 3NOIA 3SOBL 3C5SA 4U31A 1TENA 5DFVD 1KJ2H 2Y9RT 4AL8H 4U3CA 4PY7A 5JORB 1NCAH 5DJ2A 5BRZB 1DP0A 3MV7B 2FB4H 2NY0C 3UTSD 1EHXA 4JM2D 2Q87A 3VXRE 1EX0A 2E8ZA 3DX6A 4YWGL 1Q8MA 3BVNA 5KVMC 2BSRB 3SKMB 4CL7A 2QADB 1YPZA 2GT9A 2GITB 2FECL 4FQQB 4EI5D 3B9KA 5BS0E 1T66C 3LKNB 1EEYB 5I1JH 4FQ2H 1F42A 2J3SA 3EUUA 3WS6C 1NBYA 1U8KB 1PZ5A 4HUXB 2X4OB 1Q0XL 3O6KL 3QCVL 4JRYA 3W0WB 4O9HL 5J13B 3FT3A 3WLWC 2Q8BL 2DQCL 2IAND 5BOPA 2LTQC 5IVXA 3RWEA 3V79C 4MNHA 1I3VA 1SYSB 3UJJL 5AG8A 3SO3C 2CKBL 3P73A 3TA3B 3TZVC 4MQXD 4OLUL 2HRPL 1NAMB 1NC2D 4YFDB 5FO7A 4UDUA 5FA3A 4NYLA 4PJEF 5KZCB 4S0SD 3FO0L 2NY0B 4LVHC 2AI0H 5MEQA 4UTAL 4P5MB 4RFOH 2I9TA 3TN0C 2EC9T 3O4OB 1S9VA 2OXHA 3ZE1E 4LCWA 1ZA6A 4Y1AA 3GIZL 3VFVB 4OKDA 1BBJA 1KJMA 2CDFA 5CILL 4U6XA 4XNMB 5SWZD 1DL7H 4HW6A 2QSCH 4HKXA 3LN4B 5F7DB 5HYEA 3VA2C 1I9RL 1I1AC 4JKWA 1GIGH 4ZFOB 5KSVA 2AJYH 5C0CE 5IB2A 1GYAA 4POZC 2F5BH 1EO8L 5E2TH 5CSBA 3CMGA 1Q72L 5IHUH 1D5IH 4LCUB 2FGWH 4Q7DA 3SGJC 5D1XD 5T1LB 3DX7B 1D5MA 4FXLA 3TESA 1INQB 3B3IA 3KPRE 5IP4A 4IS6A 1MWAB 3TIDA 2MQCA 2P42B 3TJHC 4PJ8C 4U1NA 3TN0B 3MZTA 4HBQA 4HMDA 3OF6D 4TSCL 5I19H 5EIIB 3WXVH 3OG6B 5GSRB 1VFAB 1ADQA 4P4KB 1AFVH 3U9PL 5EC1A 1YMMD 4HJGA 4ODWB 1F3JA 4QXUL 4AK1A 1J05A 1LEGB 3OKNA 5DZOA 1FFNB 2AJVL 1R24A 2RR3A 5JQ6L 1WZMA 4M43H 1J87A 1FCCA 1QR4A 2X4UB 1H15B 3G04B 4UUJB 2YBRA 5DURB 3LZFL 1FG9C 1KTLB 4LHUA 4MNQB 3VFRB 1J18A 2EEAA 1R3KA 2BHUA 2GAZB 4P23C 3VGFA 1U3HC 4WHTA 1QSEB 1JPSH 4IRSB 3H7LA 2YD7A 3MRJA 3QUYB 3R8BB 3WNOA 5DR5H 3QG6A 4FQIH 4PV8A 2VDQL 2JJVA 3U7YL 1HZHL 5EU3B 5GRYA 4P5TD 1OM3H 5JPMB 5HYJD 1X5FA 3BO8A 2P7TA 1AO7B 4LSVH 1KEGL 3W5NA 2ORBH 5J12C 1N6UA 3AAZA 5C08E 4K71B 3RJDA 5FV1L 3DXAA 2HKFL 2W59A 4LLUB 1NLBH 4XP9L 4GKZB 2DQEL 2XOTA 5D72H 5AYUH 4A6YB 2FZ3A 2VLKD 4DK3A 5CIPA 3BKML 5F7WC 5D2NC 2A6IA 1ZT1B 5E6ZA 4B5EA 4ZSOE 5F3BA 2D7OA 4I5BB 3CC5A 4UU9A 1MCOL 1UZ6E 1A02N 4KK9D 5LKNA 3HZMA 3LRHA 2ADGB 1R0AL 2G9HA 1IAKA 4NP4H 4YC2B 4QNPF 5ALBL 3V5KB 2GFBA 5IVZA 1BVLB 2BOCA 1SY6H 2ZUWA 4FFZL 2X4SB 4PIRF 4WV1C 4EDXB 2X4PB 1OGAE 4YDIL 3AU1B 3TPUB 4IMKA 1KJ3H 1OLZA 4PRNA 5DVLA 1FPTL 3RWJB 3DSNA 1PVHA 4GAGH 3QJHB 5HVWA 2EIEA 5I76B 3IAQA 3OGOE 2BNQA 4PJBB 1DEEB 3ULUF 5B8CB 4RIRA 4WUKH 4GRWB 5HHXL 1PGRB 3UROR 1CIUA 4KPHL 1U95B 1OAQL 1P7KB 4ZUUB 4ZTPH 2APVA 5CZVL 5C07A 5I73C 2OTWA 5TE7H 1PKQB 2DQUL 1OCWH 2V2WA 3LRGA 1XF2B 3D3VD 2VAAB 1U8LB 4P9HC 5KVGL 3CMOL 3EIFA 3Q6GH 5F7EL 3QDJD 4JN2A 4QHUB 4R3SB 5IB3B 4MAYB 3VXRA 2ATKB 3NGBB 1MIML 3IYLW 5D4QA 1UZ6F 5HGBA 1S5HA 3QEHA 1TXKA 1E27A 3CFJB 1GL4B 4U6YA 3U2SB 1F6AA 5IB4A 1QVOB 3QQ9C 1AXIB 1QPXA 1JV5B 3GMOA 4ODBD 3T09A 2VDNL 5DFWH 2XN9A 4LF3B 2R23A 5L0QB 1IC1A 1MRDH 4LQFH 3KPNA 3DX9A 1ERNA 2V5SA 1QSFE 3AROA 4WHCA 2KH2B 3FO2A 3C8HA 1T4KA 4PJFE 3D0VB 5IFJA 4I0CC 2CUIA 4LLQA 4D0BB 3S34L 1ES0B 1A8JH 3G5XB 4QT5A 2YD8A 1RZ8A 5GZOD 2APFA 4NUGH 3D85D 4LSRL 1DQML 5FECA 2FSEB 4NWUH 3PP3H 1VFUA 2VDRH 4Y0GA 5JXED 5M7QA 2ICEB 5D7JA 4OZHB 4NPYB 3QUZB 3SJVE 3NCMA 3F7VA 3SGEI 4D8PB 1M7DA 1NMAH 5BZWB 3VE0B 1O0VA 4XH2A 4NO0B 1T80A 1QNZH 25C8L 2EYSA 3MROA 2MPAH 5JOFA 1NCDL 1NBQA 3MGAA 2X1OA 4JLRA 3LN5B 4X6BA 4JRXB 3RZCC 1S7WB 3FQWB 3MOBH 3OR7A 1P84K 2APBA 3QCUL 4RFNB 3UBXB 3C5SB 4BQ8A 5F7MC 5I30L 4PJIA 4K7PL 2HVKA 5HI4C 4I2XB 2PF6A 4PY7B 2HAZA 5DJ2B 1N3NA 3T0ED 2YPLE 3IDUA 5EB9A 5JXAH 1T2XA 2ED9A 4WWKC 2A74A 5A1AA 1DQDL 3SEPA 4LCCA 2QSVA 3DX6B 4R90L 4PJFF 3OJDA 3QUMA 3BRFA 1C8PA 2GT9B 4X99A 4APQA 3EO9H 1EJ6A 3CX5K 4OBRA 1CVRA 1OAXH 3B9KB 1TJGL 5J11B 5C92A 4XPHL 1GPOL 2DWDA 1Z3GH 4P2RE 3RI5F 4OCXL 3K81A 2WWKT 3QPXL 1KGCD 1NBYB 3DOSA 1PZ5B 4GMTH 3BPOC 3QIUC 4X7SH 4JRYB 3R0MA 1ACYH 2FECI 4I8DA 5IVXB 1K3ZA 4NFCA 4MNHB 3HR6A 1NL0H 1SQ2N 2XT1B 3P73B 2VE6A 3BHBA 2YXMA 1TTUA 3UTPD 2N4IA 4YK4B 1JHTA 4TULH 5D6CA 4OLVH 4XB7A 4UDUB 4HF5L 5FO7B 5FA3B 1R5WA 3EYOA 3RWFB 1MJUH 5FYLE 2D0FA 1S5IL 15C8L 1QRKA 2HT3D 4Z0BH 1SJEB 1DBAL 4RZCA 5MEQB 1T1ZA 2JCCE 1FZMB 1CD1A 2I9TB 3WKML 5FB8A 4OT1H 4U1JB 3TH4T 3ARPA 5JZ7D 4Y1AB 1ZA6B 4BSWA 1BBJB 4HAFA 1FNLA 1Z5LA 2DJUA 1KJMB 2CDFB 4UT7L 3IFLL 5GSVA 3CFCL 4HKXB 3OAUH 3X17A 4LBEB 3PQYD 2W91A 1HOCA 5KSVB 3U0WH 4PJHE 3BPOB 3GSNH 4R8WL 5IB2B 3IXTA 3S97C 3GZKA 2ZG1A 4TNWK 4EUPG 4YHKH 3DUSB 1PX4A 1J9CT 4OF0A 1BFTA 3E2HC 4KJPC 3MRQA 1UT9A 5K93A 5I1DA 3DECA 4QTIH 1JNHA 3HS0A 1B0RA 1D5MB 1XEDA 4M02A 4PJ9C 1MI5E 5E8PB 4IS6B 4JRWA 3U1SL 3D2UD 5D70L 3D0LA 2GSGA 3SDYL 4X9IA 3TIDB 5LGHH 5B39G 3AVEA 4N1HB 4KKLC 5HHNA 1JF5A 4B41A 3NH7H 3Q5YA 3OPZL 4OZIE 4ONFH 2O61A 2EDFA 3VXUE 4X9FA 1OSPH 5GS2D 3ULUD 4AEIH 2EH7H 2JCCF 2HJKA 5EC1B 4HJGB 1F3JB 1J05B 2GJ6E 3OKNB 1Z9SA 1AJ7L 3EOBB 3O2WL 1P9MC 1R24B 4N9GA 5ESAA 1R3LA 1U58A 4P59H 2YBRB 5IT2L 3H6JA 4P5KA 4OIIH 2VDMH 1PYWA 2FH8A 2HLAA 4PG2A 3OAZK 4LHUB 4RAUA 4RSVA 3EYSL 4IM8A 4PJHF 1IGMH 1NSNL 1R3KB 4O5LL 1O7SA 4WHTB 2QQKH 3MLRL 2ZUQC 5MHSD 1IM9B 3T04D 1EEUA 2X10A 5H37H 5CEZD 3MRJB 1BJ8A 1A14L 1UWXK 1WAAE 2AV7A 3QG6B 4TOYH 4LRIC 4JZJC 1CD0A 2OTUA 4IMKC 1UJ3A 4XPBH 1ODAA 1UH2A 1AI1L 3BO8B 2P7TB 5KVDL 5HGAA 5FXCH 1PJ9A 4OI9A 2JJWA 3AAZB 4N0RA 3ARBA 5CCKH 1DBBH 2WIIA 3DXAB 3SDXE 4UQ3A 3GHBH 4OZIF 2XACC 2FZ3B 5EN2A 2BMKA 1A7PL 2A6IB 3C08L 5EZJA 5F3BB 1ZOXA 4KY1H 2RJMA 1FIEA 4OM1L 1IJ9A 2W92A 1TJHL 3CC5B 4UU9B 4HPOL 4XBPA 1L9NA 3HZMB 3JWOL 1KEML 3N9GH 2X5PA 3PP4L 4ZFFA 2G9HB 1IAKB 4G9DA 3T1WA 5AUMA 3PGFL 4H5SA 2GFBB 5IVZB 4GRLD 1T2QL 1XCQA 2BOCB 4HQQL 1AE6L 1CBVL 1AR1C 4FQJL 4PRNB 1A7OH 3HG1D 4QOKA 3P4MA 3MOQA 4V1DA 3H9YA 2QQLH 1EHAA 1T1XB 2VJXA 3M45A 2BNRB 3LSOB 1WAAF 1MIEH 2BNQB 4OZ4A 3HFMH 1NKOA 4RIRB 3TNNA 2FO1A 4P9HH 3OJ2C 1VGEH 3Q0HA 5LVEA 3BKCL 3GI9L 3ZTNL 5E6IB 4FP8H 3WIIL 5C07B 1QFWM 4JGMA 3S36H 5A3IC 2OTWB 5CJQL 3W82A 2V2WB 5F1NA 4JKPL 2XWJA 5EU6D 2OJZH 4XI5D 5CD3A 1A9EA 5ITBH 4LARH 2V17L 4JN2B 2V2TA 4TUJA 5D7JC 5D1ZD 1NGPL 3GNML 3WSQL 3MGOB 1ZGLP 2C3WA 5HHVH 1UJTA 4RISL 4JY4A 2FO4B 3CGTA 5CGYC 3QEHB 1E27B 1F6AB 4FTVA 5IB4B 3ULUL 2I5YH 3GMOB 2DQTH 2XN9B 2R23B 1F2XK 1FDLL 4XVTL 2DQGL 4YPJA 2RCSH 3DX9B 3SBWA 2ADJA 5E2WL 4HX1A 3CAFA 2IPTH 1T4KB 3A6BH 1QBLH 5IFJB 2AK4B 2CLRA 2VLRD 4FXKA 1OTTD 1D5BA 4PJCA 4QT5B 4TSAH 1RZ8B 4U1LA 5DRXB 5EU5A 1LP9F 2YRLA 5FECB 1FYTA 3WJJA 1PLGH 5CEZL 2VN7A 1YECH 1B4RA 3F7VB 5ENWA 2WIMA 2FIRT 1KJ2L 5KOMC 1M7DB 3QIBA 1CXFA 4OTXH 1FVCB 4XH2B 3RUGE 3MROB 2EYSB 5CJOH 1VPOH 4GLRI 5JOFB 1UZ8A 5FDYA 2KQMA 3BD4A 3DVGA 4X6BB 4HG4K 5DLML 1SJHA 4LGPB 2ESVE 5HGDA 3OR7B 3GBLA 2CGRL 4ESKA 3X11A 2YKLH 1DVFB 3V7AG 5EBGA 1BZQK 4PJIB 5I1JL 1ZKAA 2HVKB 2KPNA 5CEYB 3VG9C 1DE4A 3V6ZA 1N3NB 4RRPG 4Y5XA 1QR1A 3IJHA 4RMSA 3UJTH 4CMMB 2YUVA 2A74B 3RU8H 4LCCB 2EH8H 4KVCL 5I74B 5IGXH 4OCWL 4KWUA 4R26H 1F4WH 3NZ8A 4G7VH 3O6FD 1CFTA 2NTSP 2NZIA 4X99B 4APQB 4YE4H 3OGCB 1O7VA 3VWKC 1DBJH 2QSQA 1KLGB 2DQJL 2DWDB 1EGJA 1X6LA 4OCLC 5I6XC 5FUZH 3V6OA 1CE6A 4RGOH 4U6VH 2VE6B 3BHBB 4AZ8A 3QDGB 2XQBH 1VERA 1JHTB 4HFWA 3WFEH 1JI2A 1DL7L 5D6CB 3VG9B 1R5WB 3EYOB 3W9EA 2AJYL 4HZLB 4JFDB 1N2RA 4G3YH 4RZCB 4XP1H 1T1ZB 1C5BH 4PTTA 1W0WA 1CD1B 1ADQH 1QHOA 4JPWH 5FB8B 5IHUL 1FGVH 4UILH 3WXWH 4QRRE 4BSWB 1N5AB 1Z5LB 3WO4C 4LNVA 3L3KA 1TCRA 4S1DC 2DQHL 1AXTL 3O9WC 5GSVB 4Z9KB 1CLCA 1MCQA 3U30C 4HUNB 3UXFA 1A6UH 3TO4A 3IXTB 4JM4H 4JHBA 3MODH 3HN3A 2DLHA 1WCQA 4DGVL 3CZJA 5F1OB 5F44A 3MRQB 4PG2C 5I1DB 4GRWF 4RCAA 1JNHB 3HS0B 1B0RB 5BRZD 3BZ4A 3T3ME 1FLRL 2KZ1B 4CJ1A 3MV7D 3D0LB 3QIWA 1DN0A 2GSGB 4EZMA 2E9IA 2HVJA 2ITDA 2VAJA 1BZ9A 5HHNB 4Q0XH 3QBTB 1MJ8L 3BDXA 1F5WA 2VDPH 2QADD 1AGBA 3G6JA 5CIPH 4G80A 3HAEH 2IWGA 5GHWH 4XTRC 2HJKB 3MCG1 1D6EA 2AEPH 2H3NA 2VLMD 4OQTL 4XT1C 1SEQH 4N9GB 5FM8A 4LIQE 3W0WD 5ESAB 1R3LB 2DDQH 1U58B 1L0QA 3C87A 4P5KB 5HVGB 3I2CL 1PYWB 4HH9A 5DD1L 5F7HA 2OR9H 2HLAB 1WWBX 3TA3D 4RAUB 1L0YA 4NCDA 1CE1H 4G6JH 3T3PE 5D72L 5AYUL 1OD9A 5JNYA 5KZCD 4HS8L 2QKIA 2NY0D 1CLZH 4M4PA 1B9ZA 2AV7B 4N90E 5DRZA 4TNWF 1OOAA 1UJ3B 4QRSA 1S7XA 3CVHL 1BQHA 4HIXL 4ERSL 5T1DH 3RVUC 3PWJA 2I24N 3MJ8A 3IDNA 5HGAB 4ZS7H 3T3MF 1PKOA 5B4MD 4NP4L 1U9KA 5DHVA 3GSQA 1CXLA 1RUPL 3ARBB 4WI7A 1WQVT 2WIIB 2XZCH 4G9FA 2ZUSA 4MA3A 4UQ3B 5HYQA 1OP9A 5F6IC 5ILTH 5EN2B 2BMKB 5HXMA 1KJ3L 3WLWD 1E28A 2R0LH 3BGAA 5EZJB 2IBGA 5LAXA 2PTUA 1MQKH 3HHRB 1LDPH 4LP5A 1EO5A 5D5ME 1YEEH 3K8KA 1D3CA 3BX7C 4CKVX 4YDKH 4ZUVB 1JGUH 5D8JL 3OKKA 3SKOA 4WUKL 5AD0A 5AUMB 5T1LD 2YPKA 4H5SB 3UBXG 3BP4A 2X9WA 2XY1A 3REVA 2FHCA 1HIMH 1XCQB 4ZTPL 1NFIA 5IFHH 4HIIA 3WCYA 2A6KB 2E27H 2N7BA 4OF6A 1OAUH 3HPJA 1Q38A 1HKFA 5TDNA 2HT4C 4QOKB 4LKXA 2AXGA 4KAQH 4V1DB 4MD0A 4KJWD 2XY2A 4YXKL 1I1RA 4NQTA 4LLAA 3VDAA 4OZ4B 4OBSA 4P4KD 1LHZA 3TNNB 2R1XA 2HMID 3SBWC 3O3EA 2H2PD 3CCHA 1UH3A 2RAMA 1JCKA 4K3GA 1IGIH 5F1NB 2XWJB 2Y1VA 5DUMH 3QRGH 4X0KA 5DURD 4PGZA 5GIRA 1A9EB 4X6DE 4MNQD 3WJJC 2V2TB 4TUJB 4I3RH 4K3EH 4KQ3H 1QSED 4UZGA 5H94A 4IRSD 2BY3A 3QUYD 3GJFK 4JY4B 4Y4KA 1J0ZA 3TJHD 2B4CL 3IDGA 4NQEE 1FC1A 1GGBH 2VZSA 3LV3A 4FTVB 4NWUL 4XBGB 1MEXL 3T0VA 3RWIA 1AO7D 4HIEA 4L8SC 3CSYA 2C9AA 3QPQD 1ZHBB 2ADJB 2R1YA 3KXFA 5D2LA 4Q6YA 3RVXC 3CZFA 4PB9H 5A2LH 4FXKB 2X44D 1KCUH 1D5BB 3QUMH 4JFOA 4PFEA 4PJXA 4PJCB 4PRPA 3T8XA 1RJCA 1NAML 4U1LB 1P7HL 3U0TA 5EU5B 1FYTB 2QR0B 1LO4L 4FHBD 2P4AB 4P57A 2BHZA 1KCKA 5ENWB 4TNVK 2EKSA 1CU4L 4YHPB 3QIBB 3QT2A 4OFDA 1C7TA 4JHZA 1WWAX 1YNLH 2FYYB 4XMLL 3TM6A 4EN3A 4X6DF 1NANI 1CCZA 1K4DB 1UZ8B 3DGGA 5I75B 3DVGB 4N5ED 2IALA 4XNZC 5DI8B 1SJHB 1UM6H 3R0NA 1RUAH 4XPAL 3MO1A 2IAMD 2HTKC 3ARDC 3X11B 4ZFOL 3CSGA 4JFQA 5KVFH 1H8SA 3RDTB 5E8EA 4JCMA 2AKRA 5I1EH 2VR4A 4IOFD 4PJ5E 2VDOL 1ORQB 1DE4B 4NKDB 4HT1L 4Y5XB 1QR1B 3DURA 1IC5L 5FFLA 5KSAA 1A2YA 4X6CE 1MCFA 2IQ9L 4Z7QE 2P48B 4M6AA 2DMKA 1HCVA 1A7RH 2MOVA 3NZ8B 1MWAL 4DQOL 5HDBE 1CFTB 4MAYD 4TULL 4LHUG 4OLVL 1FGNL 3E8UH 1DEDA 4H25A 1AXSA 4G6FB 1OP3H 5EOTB 4CN1A 1CE6B 4OF8A 3TO4C 1PQZA 2DD8L 4H20L 3F12A 4EI6A 3RKDD 2F15A 1A5FH 4HFWB 1EHLH 3ARZA 5M95B 4P3CL 3FO9A 1CL7L 2LQRA 3C6LA 1I8KA 3DGCR 4FG6C 3W9EB 1N2RB 3SQOL 5E03A 2AJSH 4HKZA 3QIWC 4WU5A 4F37F 2FX9L 4Y88A 3ZKNC 4PTTB 1W0WB 2Q3AA 1YN6A 1LDSA 3DVFA 1DR9A 3QUZD 2DTSA 4G6ML 3DLQR 3L3KB 1TCRB 1DFBL 1S7RA 2LFGA 4JN1H 4HMCA 1ZLUK 3FAWA 2LAAA 2OYPA 3KLHC 4Z7QF 2VN4A 4NO0D 1GGYA 4W6YB 5LGHL 1NCCL 2D9QB 4F9PA 1MCBA 3TO4B 5IMMB 4JRXD 5HDBF 5EZLA 4XX1E 5T5FL 4A6YL 3MRLB 1KG0A 3N85H 3O2DH 5E94B 3PWNA 3LCYA 3AREA 5GQBA 2DMBA 1Z0MA 4HJ0C 2WNGA 1MCNA 4AEHH 4DTGL 1YEGL 3REWA 5D5MA 1WZKA 3BZ4B 3LQAC 1B90A 3QIWB 1DN0B 2AAVA 4WHDA 1G7MA 4OZGE 1KOAA 1MHCA 2IADA 5DS8A 2HVJB 3I85A 3JTSA 1BZ9B 3V4UH 2FJFA 1K8DA 1IC4H 1ZVSA 3FRPA 4HXBL 3U9UB 1K9TA 4YHZL 1T21A 4NJAH 3WDHA 2AXHA 5DUBA 4K94C 6FABH 1UKTA 3G6JB 1IGML 2C4FU 2VXVH 3GMNA 43CAA 5ITFA 4G80B 4NKIH 3B9KD 1KENL 2B7DT 5HYFA 2P45B 4C56B 2D7PA 4IRZH 4J3OC 1D6EB 2H3NB 4TOYL 2YZ8A 4FQXA 4RWHA 1H3UA 1YA5A 4JRYD 1C08A 2BVEA 1DDHA 2UWEE 5JUEH 1TNNA 5DVNA 1S3KL 4HH9B 1IC7L 3RL2A 2VQTA 2R2BB 1CR9H 4K2UL 3NPZB 4K9EC 3RY5A 5CSZA 1MREH 3QQ3A 4XAKE 5JNYB 3QUXA 1RJYA 5JW4N 2H26A 4OM0L 3I6LD 4QRSB 4RGNB 1S7XB 1BQHB 5DJAA 3P40A 3D9AL 5CJXA 3BN9C 2NYYD 3PWJB 3MJ8B 3IDNB 4XMKL 3KYMA 3N9GL 4ZAKA 3WFHB 3AY4A 5CZXC 2WWMC 4OZGF 1UG9A 3LKSA 4M03A 3AS3A 4G9FB 4MA3B 4YO0A 3QFJA 5HYQB 4L4VA 3STLA 2ENSA 4JFHE 4MMXC 1E28B 1A7OL 1XH3A 1I7TA 5LAXB 3LHPH 5L88H 1TTFA 3CFEA 4MA7L 2QQLL 5BXFA 4KRLB 2D4FA 4AG4H 4PB0H 3JUZA 3OKKB 5AD0B 2EYTA 1VGEL 1VA9A 2X4NA 3BP4B 3REVB 3V0AC 5IUSA 1NFIB 1KCSH 4HIIB 5E9DE 1J8HA 1QFOA 4Y4KC 2F9BT 3B5TA 2EXWC 3HPJB 1OL0A 5TDNB 1TQBC 4N0CC 5FHAL 4LKXB 2AXGB 2Y7QA 4LARL 5JIHA 4MD0B 3ULVE 3ZYJA 2BJMH 12E8H 1E6JH 4MWFA 1JZ2A 4X9HA 4OGZA 2R1XB 5HVHC 3B2VH 4DW2H 3O3EB 1KELL 3CCHB 3S7GA 5FYLH 3MOAH 2DIBA 1GZQA 3BD5A 5K59F 1C1EL 2WP3T 1QLEH 4IOSD 4X0KB 5GIRB 1MH5B 4OLXH 3JWDC 4DOHE 4X7CC 4LHUD 1MNUH 4YHIA 2E7BA 1FORL 3HI5H 2G2RA 3K0WA 2IPTL 4X6CA 3A6BL 5H94B 3ZDZE 1IM9D 5KW9H 3D39E 4MSWA 4RX4A 4C59B 2CJUL 2NY6B 2QHRL 3IDGB 1OD7A 4TSAL 4EN3C 1TDQA 2E8YA 4X4MA 5I1HH 4KMTH 4HBCL 3LV3B 2DM2A 1ZHLA 4JKKA 4XNXH 4RDQG 5L9DH 3RWIB 3DO7A 3C8KB 4HIEB 3CU7A 1HSBA 1YECL 3CSYB 3DMMC 3QB7C 4NQDE 3DXAD 4PGCA 2R1YB 1Y6NR 2VUOA 3RPIB 2D7QA 2A0LD 1Q0YL 5KS9E 3KXFB 2R0KL 5D2LB 4U7MA 1UB5A 1VPOL 3RWDA 3ULVF 4JFOB 3TEUA 4PJXB 4O00A 4PRPB 3T8XB 3SDDA 5IBUB 2Z31D 1B0GA 3U0TB 5I1IH 3LS4H 5KSAC 1F45A 3TBSA 4X5WA 4Y16B 3BAEH 4P57B 4R97B 4K3DH 3DV6A 1CGTA 1I8MA 2EKSB 1M1SA 1OAZL 4NZUH 4JR9L 4XHJD 2GY7B 1N0XL 5EOCL 2WQ8A 3MYJB 1IEBA 4EN3B 4Z7VA 4H26A 4PR5A 3OX8A 5AZEH 2GY5A 2RIKA 4U1MA 3DGGB 3Q6FA 5M94B 2IALB 3RU8L 1YYMH 2YRPA 1J0KA 3MO1B 2BNRD 3TO2A 2BNQD 4JFQB 1FG2A 4KKNA 5K9QG 5E8EB 1MJJA 1CDHA 4LDEB 1IRAY 1I9IH 3W11C 2VQUA 4PGBB 4M5YL 3X3FL 5E6ID 1EEZA 3DURB 1L6XA 1GGIH 3QEQA 4G5ZH 5DHXB 5I66A 1A2YB 2IJ0C 4RGOL 3SKJH 4JDZA 1QUNA 5KS9F 3GSRB 1ND0A 1YQVH 1T89A 1NCBL 5GRUL 2XQBL 3WFEL 3JTTA 2YPVH 4N0YL 3VD5A 1EA9C 2HG5A 3S5LA 4R4FL 4H25B 2G5BA 4JQIH 1EUTA 3WYRA 2EDHA 3FOLA 1G9MC 1AR1D 2AABL 3CFBA 4FQLL 3VXSA 5DK3A 1MHEA 3N06B 1ED3A 1C5BL 4OLEA 5B38A 1PQZB 1ADQL 3CD4A 3GRWH 3KHOA 4FOMA 4LSQL 4W4OC 3QI9A 1G7JA 2XN9D 2IMMA 1ZHKA 1FRGH 3F12B 3FQUA 5FIEA 4C4KO 4TNVF 1J1XL 2P5WE 5HGGS 4JGJA 3GSOB 2UWEA 1TNMA 2VXUH 1FNEA 1AQDA 2WLZA 1MF2L 1F3DH 3FO9B 2AK4D 3C6LB 1I8KB 5TGBA 1ITBB 1A6UL 2OCFD 1XGPB 1H3GA 3WMSA 4HKZB 4WU5B 1HXYA 5DZNA 3AS1A 6CGTA 1KIUA 1YN6B 2XZQH 2PYEA 3IDJA 4TRPH 1CL7I 1JGVL 3TNMA 1RVFH 4BH8A 3ME0A 3EYFA 1AGFA 2F19H 1S7RB 3WD5L 1N5YH 1H3PH 2I60H 2W0PA 1VESA 4PD4K 3VGAB 5LGJA 2XTJB 1AGCA 3ZYOA 4Z76A 3UTTE 3U48A 1JPST 4JPVL 4BH7A 4Q0XL 1P7QD 5F9WC 1EAJA 4RFEA 4YZFE 3HRZA 3LQAH 2B5IC 1KG0B 4U1KA 3IDXH 5A2FA 5JR1H 3PWNB 4Y19A 5CJ5A 1DVFD 3FHAA 2A73B 3AREB 5H2BA 3FZUC 1OWRM 4F33A 3TVMA 4ALAH 1LO2H 3REWB 2AEPL 5IW6A 3HNVH 2X70A 1FZKA 4K94H 4ZD3H 1DANU 1JNLH 5LG1A 1SEQL 1G7MB 3HMWH 1MHCB 2IADB 4OCNC 5DHVH 4OCSL 3JTSB 5TE6H 5IJKC 1IE5A 2FJFB 1K8DB 1ZVSB 3L3GA 1OQOA 1T21B 4DEPB 2XWBA 5E9DA 5J89A 1CE1L 1UM4H 3WN5C 4APQD 4ZAKC 43CAB 5IVOA 3L3DA 3LEVH 3B9DA 4K7PY 2AP2A 1CLZL 4TUOA 3DI2B 4FQXB 2GSIA 1P53A 3CK0H 1P4BH 3MJGX 1GXEA 3IB4A 3F7QA 4K9EH 2AGJH 1C08B 2JJUA 1I85C 3KHQA 4WUUE 2Q6WA 1UYWH 4M7LL 5E2VL 1AD0A 2B5IB 3O6LH 3UYRL 4ZS7L 3VW3H 2EKJA 3RL2B 3DTXB 4E5XB 3QDGD 5EZOH 4AQOA 1RUML 4PRIE 5CSZB 3TH3T 2D2OA 3QQ3B 1G7HA 1MRCL 1MPAH 3QUXB 4YZFF 1RJYB 1N6VA 2H26B 2DL9A 4JFDD 3DYMA 1CXIA 2ADIA 1LDPL 1R3JA 4PREA 5DJAB 1RHHA 3D39A 4HIHA 5CKGA 3TV3H 1S7QA 4U4BA 5DA0B 1GOHA 5IROA 3JV0A 4ZAKB 1JUFA 1P5UA 4PLNC 3L3IA 5ESQA 3LKSB 4F58L 1CDIA 4OF5A 3QFJB 4M7ZC 2E27L 4L4VB 3STLB 3RTQA 3TWCH 5EWIL 4XNUL 1A64A 2AERT 1I7TB 3QR2A 4KQ4H 4XBEH 1KIRA 4QGYA 4JFFE 3CFEB 4KAQL 4RNRA 4YFLF 1T7XA 2JB6A 5BXFB 3WFDL 1I8IA 3KYKH 5GS0D 4KXZI 1GGUA 2G60L 4OFPA 1DZBA 2C4FT 2VRAA 3VCLA 1F4HA 1J11A 5JQHC 4XNYL 2EYTB 2AJZA 4RAHA 1OWWA 2X4NB 4YGVA 4NC2B 4C83A 1J8HB 1BAFL 1CGWA 4YPGA 2F74A 3QRGL 5FGBC 3C09B 2Y7QB 1RIHH 2P8PB 2WAHA 4I3RL 1KLUB 5C09E 4HFUH 4NIKB 1RURL 2AK1L 2QJDA 3JWDH 1S7TA 4UMGA 2PXYC 1IKNA 4X6EA 5FM4A 4TTGA 5D7IE 1G6RA 3QQ4A 2C3XA 1GZQB 2E7MA 1YC7A 3L5IA 4PGEA 4HWBH 5J3HD 3SCMA 5C9KA 3B43A 1G0DA 2R29H 4KDTA 3FHQA 4PRAA 3N1PC 2BK8A 1YJDC 2AEQL 1ZT4B 4YHIB 2FDBP 3VXMA 4NKOA 4F9LA 1FYHB 2G2RB 4X6CB 3UBXI 5EO0A 2VDKH 4N8CH 4GXVL 1RULL 2NY1C 1BBDL 3MREA 4MSWB 1KCUL 3ETBF 2OLDA 1KTDA 3MLSH 5DZLA 2XTLA 1F4XL 1U8QB 4UOW1 4M1CC 4UINL 3DO7B 2DM3A 4I9WE 2I26N 4WGVB 5HHOE 4OFKA 5GRVL 1I1YA 2FWOA 4QY8A 3ARBD 5J1AA 2DI8A 4PGCB 5FDWA 5DMIH 5FYJD 3G6AA 3MNVA 4IHOA 3WJLA 1S78C 1YNLL 5ICYA 1ZANH 1UB5B 2R15A 3PWPA 5CLTA 4O2FA 4TVPE 3SDDB 5L8KB 1UM6L 1CGYA 1B0GB 2ERJC 2R0WL 3OJMB 4XWOD 2JTDA 5INDA 3LVEA 3G08B 3TBSB 4NNXA 4X5WB 4UNUA 5KVFL 5D7IF 3VFUA 3NCYS 3DV6B 1GHFH 1I8MB 1ZLWH 1QRNE 4KDWA 3IDIA 4J12A 3TCLA 2D0GA 3RJQB 1IEBB 3RVTC 3NCJH 4Z7VB 1F58L 4H26B 4PR5B 3NBNA 2Q20A 1HE7A 3AS2A 4U1MB 2IGFL 3Q6FB 4LIQH 4QOKD 5EZIH 3RVUD 4V1DD 4ZXBC 2J5LB 3SDCD 1UCBL 1P4IL 2R8SL 2YR3A 3TO2B 1YEIL 2OZ4H 3UTTA 3U4BH 1FG2B 5SWSB 5DD3H 2YSSB 3MRRA 4KZEL 1KC5H 4LFHG 4FMKA 3MRMA 1AY1H 5I16A 4PLKC 1KCRL 2E7HA 3GBMH 2VXQL 3GSVB 1EEZB 4KGJA 3KNBA 3QEQB 3UZQA 3SE8L 4D2NA 1SBSL 2OQJA 4JDZB 2Q8AL 2GEEA 3CH1A 1ND0B 1G9MH 4B53A 1V7ML 2ZSVB 4ODXA 3MA9H 5K33A 3MV9A 3NACH 5F1IA 1OVZA 3S5LB 2G5BB 1XIWA 2VZUA 4PJAE 3FOLB 4AIXA 1FIGL 5E5MA 1U6AH 4FFWD 5IESH 3QO1B 1WZ1L 3VXSB 2UZXB 1FNSH 2R69L 4DVBA 1MHEB 1ED3B 4MDJA 2SEBA 4B7IA 4FTVD 3WLBA 5B38B 1F00I 3QI9B 1KUMA 1BQHG 3FQUB 4ZOAA 1DCLA 1CI5A 1RUKH 2UWEB 3H0TA 3IKKA 5FYKD 1FNEB 1AQDB 3V8CA 4BQCA 3C60A 4XAWL 5TGBB 4OIBA 3T2PA 3VRJA 2FIKA 1HXYB 3BP7A 1I8LA 1OSZA 4S1RH 4OUOA 1FYTD 5D7LE 4KTDH 1E6OH 3IDJB 2PYEB 4YX2H 2LE9A 3TNMB 1EJOH 4BH8B 3EYFB 1AGFB 4YQXH 3CVIL 3BZDA 3QIBD 4LMQE 4NJ9L 5LGJB 3GSWA 5FKAA 1AGCB 5KAQG 1FE8H 1T7YA 2XKUA 2OJEA 4HAGA 3ULVC 3JSSA 3U83A 4BH7B 1KLFA 3V4UL 1IC4L 5D9SA 4RFEB 1KFAH 1MFCH 4NJAL 3HRZB 3PHQA 6FABL 1RIUH 4C55A 2X1PA 5EO1A 3EYVA 4HCRA 4Y19B 3RDTD 4NKIL 4XP5L 5H2BB 2DRUA 1KPRA 4XWGH 4A2MA 1NEZA 4S2SA 4F33B 3TVMB 4KJQC 5IW6B 2V7NB 4KROC 4WY7L 1F4YL 2X70B 2XA8H 1FZKB 4BQ6A 1I7ZA 4QRPA 4OCRH 2NY5C 3QDMD 3DVNA 5JUEL 4NZJA 2DWEB 4JANB 3L3GB 1CGSL 1YEJL 1VFOA 5FKPA 4KRPB 3TFKC 2XWBB 5E9DB 3T0DA 5I1AA 5L2KE 4JO1H 4CMHC 2YMXL 3U46A 2D7TL 4MNGA 2FEDD 4NSKA 3L3DB 4GUPA 4G6FD 4U05A 1J0HA 2DTML 1ONQA 2CUHA 4TUOB 3H3KA 1HILA 4UI2A 1R3IL 2GSIB 3K2UH 2BFVL 2VERN 1IQWH 3ZHKA 3RTQC 5FCUH 4N68A 1UWEL 2MCG1 3W2DH 1AD0B 1NPUA 3D1MC 2W65A 4GW5B 4R7DA 2A38A 1ACZA 5T1KA 1U93A 4L8CA 1AIFA 1G7HB 3HI6L 4ODSH 4XCNB 2B1HL 5CP7A 1ZHNA 1N4XH 2LABA 4Q9CA 4J4PC 3B83A 1DLHA 3INUH 2WUCL 4QHMA 2ADIB 3PL6A 1FAKT 1EZVY 4R0LA 1R3JB 4PREB 3FT4A 4WEBL 5HI3C 5I15H 5IBUG 1RHHB 4HIHB 1S7QB 3BIAX 4OCMC 1XR8A 2R2EA 1JUFB 3K4ZA 4RGMC 5I8EA 5ESQB 5DD5H 2HKHH 4ODHH 2EO1A 3MLVL 4OGXH 5HHOA 1IKNC 1WGOA 3RTQB 5FGCE 1SVZA 3V5HA 3RIFF 2IH1A 1AQKL 3EAKA 1KIRB 4U3XA 3NCFB 2JB5L 5FYKL 2JB6B 2LAGB 3NTCH 2XV6B 1I8IB 4QXWA 4E41B 3E1F1 3QHFH 3VCLB 3B2VL 4WGWB 1CFBA 1WLHA 4MHHG 3T77B 4YGVB 5DJ0A 3K74B 3CJJA 1W72A 4D9QD 3MOAL 3OR6A 1XF5B 3QIWD 1FL3A 4CUCA 3NAAH 5F8RC 2C3VB 4YPGB 2F74B 4IRJB 5E2UH 3TYGH 5JIPA 4M62L 4Q97A 3ECBB 3MXVH 4O2CA 3BP5A 2YUXA 1CGXA 3GUTA 1K2DA 4OB5H 4C56D 5KW9L 3HMXA 1HDMA 1EMTH 1S7TB 4X6EB 1TZGL 3RY4A 3WJLC 1G6RB 1YJDH 1CDCA 3QQ4B 4PGEB 3P9MA 2J8OA 4ZNEE 4QHLB 3SCMB 8CGTA 4H0GA 3C2AL 2A1WL 43C9A 5J7CC 5L9DL 4FXGB 1MFAL 1DQTA 3FOMA 2W0FA 4WW1A 3LB6D 1VFBA 4HJ0D 4DFIA 3VXMB 3SHSA 4MAUH 4NKOB 1WISA 5DWUL 2QQNL 5EO0B 5HDQL 3FCTA 1UXWA 3OKMA 3MREB 4L1HA 1N6QL 3FO1A 1CD9B 1KTDB 4AEEA 4FFYH 4HLZG 4RGND 3DX8A 1BD2A 1ZTXL 5J0BA 3LS4L 1HINH 1ZA3A 4PJAA 4YHYB 2X41A 3J8F7 1EGJL 1KXTB 3QXAA 2W60B 1I1YB 1F13A 1NCWH 2FWOB 4QY8B 3HTLX 5GGRA 5J1AB 4G9FD 5DD0H 3MNVB 1YZZA 4IHOB 1CXEA 1GAFH 3QZWA 4UIKL 5BQ7A 3MJ9A 4PP1C 3PWPB 3KPQB 1T0NA 4O2FB 4JO2L 1U8MA 1RZKL 4KJYA 1P6AB 3AMLA 5INDB 3O11A 4DVRH 2D31A 4NNXB 3S4SA 4KTEL 1T3FA 1X5YA 1SMOA 4QRQA 3VFUB 1MFEH 1WZLA 1MCKA 3HUJA 1WICA 5D7LA 1NDMA 2VXSL 3IDIB 3TCLB 3M1BA 5IMKA 1XIWC 4Z7WA 1KJVA 3LD8C 3QDAA 2OMNA 3SKJL 3QEUA 2PCPA 4JG0L 3KLDA 3PDGA 4EIGB 2YA0A 1TVHA 4PRHA 5CZXD 3FRPG 3UTTB 4PJ7A 4KUCD 1HQRA 2VZ3A 3MRRB 2OR8A 5C71A 3MRMB 5KOVC 1TZHA 3BKJH 2A9NH 1W0VB 4NBZB 3BJ91 3K1KC 3MLTA 3T2NH 2VZ1A 1I7UA 4ONHA 1WFTA 3T0XA 4NQCA 3KNBB 3BDBA 1V7NH 5GGSA 1BX2A 2J7LA 2JJSC 4MJIA 2OQJB 3CH1B 4RWYH 3TT1H 3BIKA 4ODXB 4P2QE 3WNKA 3MV9B 1Z9LA 5BW7A 2APTA 5F1IB 2D9CA 4MCZA 5D6DA 4GSDH 1BF2A 3D69A 2NY6D 3BQUA 5L2KA 4NC1E 5E5MB 3FONA 4N0CD 4DVBB 4KK6C 2SEBB 1MCPL 3QA3B 3CXHK 3WLBB 3KJ4B 2A77L 2VR9A 3ZYIA 4KGLA 2D03L 4K07A 4Y4FA 1XGYL 4NN7C 2YHGA 3V0WH 1NMCB 5K9QI 3C5ZC 3H0TB 1A4KA 5JIIA 5GGUA 3KXFD 3Q3GB 1KYOK 3KPSA 1J1OL 1CGUA 5TDOA 3C60B 3RGHA 2C7UB 4PRPD 3VRJB 1TQCB 3MRFA 2FIKB 3WFBL 5BV7B 1CICA 3GDBA 5HD8C 1OSZB 3F7RA 3NIDE 4M5ZH 3EHBC 4Y16D 2D3VA 5FOJA 5F70A 4EQ2A 4O02L 4D9LL 5JR1L 3ULVH 4GH7B 3BPNC 4KKBC 4XMPL 3LH2H 1L7IH 1U91A 3CPLA 3PGCA 4ALAL 1LO2L 3ILQC 4XVUC 4GAYB 3GSWB 5FKAB 5GISL 1SHMA 1NCTA 5C0NC 4I0PA 1JNLL 5AWNH 4JZOB 4HGWA 3LKQA 3O2VH 1FO0A 3R06A 1F8TH 1RY7B 3QWQB 1AC0A 4YBLC 3PHQB 4BZ1L 3BMWA 4NN7B 1MHPH 2YK1L 5MEOA 4GS7C 3B9EA 5L6YL 5EO1B 3EYVB 3ARFD 1Q1JH 4KVNH 3LEVL 4EXPX 35C8L 2NY5H 1KPRB 2K1MA 1FBIL 1NEZB 4S2SB 1T5XA 5ESVA 4YNYA 1YYLL 3HR5A 4DN3H 1QG3A 3IKCA 4QRPB 2AGJL 5C0AE 1FFRA 1CLYL 5FA4A 3DVNB 1IARB 5FK9A 3PL6C 1TIUA 3VW3L 4NM8L 3GJFH 4R0LC 4X4ZA 5FKPB 3QFDA 5I1AB 3M17A 4KI5D 3FFCD 1JTTA 2EYRA 4MNGB 3U46B 2VL5A 2CK0H 4GUPB 1QSZA 3A6CL 1NC4A 3NIDF 1W8NA 4PGDA 1ONQB 1HILB 3CFIC 3RQ3A 3L6FA 3WNMA 5I71C 2HJLA 2AV1A 5FHBH 4YBLB 1J5OH 4GS7B 1W0YT 2GTZB 1RZJC 2ZCLL 2W65B 5T1MA 4PJDA 2HWZL 4R7DB 1U92A 5T1KB 1U93B 1I3RB 3QXTA 3HZYA 1AIFB 5CP7B 4F2MA 1ZHNB 3C6LD 5E08L 1H3TA 5IQ9A 4J3WA 3KR3H 1DLHB 2I07A 3RNKA 2EDKA 1NMBH 4U0RC 2XRAH 1IZKA 4I3SL 4QHMB 1KCLA 4XBEL 3PL6B 1UWGL 4R0LB 4YHNA 3FT4B 1S9KC 4PUBL 4P99A 5K9JH 1KTKE 2YA1A 4RMTA 1NBVH 1G6RH 2R2EB 1VACA 5SV4A 3HC3L 1PFCA 3QULA 2FHBA 1FZOA 1RI8A 2BVTA 3UTQA 2XTJD 5D7KE 1BQSA 2F5AH 5HHOB 2F54A 4LVOB 2F53A 2WBJC 3V5HB 4KK5D 2ZWLT 2IH1B 3VMNA 3FQTA 1RIHL 3WS3A 4HUKB 3M8OL 3ARED 5EG6C 4K23L 2NY7H 1H3VA 4HS3A 4P3DA 3E0GA 5I1LA 1W72B 1KB9K 4JFPA 1J12A 3OR6B 1FL3B 4S1SH 1P2CB 3IF1B 4LSSH 2ATPA 1CTOA 4KUZL 4W81A 5BVJA 4WO4C 1UB6A 2R29L 1GC1L 2EXYC 4UB0H 4HIJA 2CR6A 4XP6L 3MBXH 5IV2A 1R6VA 3VMPA 3BEWA 5JHLH 3MLZH 4DK6A 5C70A 4O2CB 3BP5B 1YNTA 4K8RC 2IPKA 2VKWA 5TFSL 2VDKL 3GUTB 1K2DB 2I9LA 1HDMB 1TVBA 4NN6C 4YHOL 3S5LG 4ELME 2FATH 4FQXD 2CH8A 5I0ZA 3MLSL 2VDLL 43C9B 2ED7A 4OLYL 5EFIA 3RBGA 4P2OA 1MCWM 4G8GE 5B38G 3FOMB 2W0FB 4WW1B 4LPTA 2J8UA 1VFBB 1ZSDA 1B4JH 3SE4C 4MVBC 1PG7L 3ULSA 1FP5A 3QUXD 1Q9LA 2ZKHH 5F96H 4IDJL 1UXWB 3OKMB 2X4QA 3FO1B 5GGTH 4C57C 1KN2H 5DJ6A 4H1LA 2FD6L 1DQJA 3DX8B 1BD2B 2VLJA 1ZLUH 3IS1X 5LXGH 1BM3H 1ZA3B 3OHXA 4OJFH 2DLIA 4PJAB 4NQVA 3T65A 4ZAKD 3IJYA 2XIDA 4TPRL 4ORZC 1ZT7A 5JHDA 1G6VK 5GGRB 3MV8B 3QXUA 5AZ2H 1YEFH 5ADPL 3QFJD 2Q76A 1HKLH 2UV3A 3QZWB 4L4VD 5BQ7B 2H2SC 4UTBL 5I1GL 3NZHH 4DCQB 1T0NB 1X4ZA 1U8MB 1LE5A 2ZP0T 4U7SA 3O11B 1IQDA 2D31B 2Y25A 4LL9A 4QO1A 3S4SB 2B1AL 4ELMF 5JW3L 1T3FB 4QRQB 5BOZG 5DJ8B 1LK3H 5DD3L 3IXAA 1HNGA 3CIQA 3HUJB 3OB0H 1NDMB 3BE1H 4X4XA 2P5EE 3M1BB 4C58B 5IMKB 2LU3A 5D6DC 1WFOA 3DIFA 1J8HD 1DQQA 5F21B 4Z7WB 1NFDA 1KJVB 1GCFA 4ZO6A 5CD5C 1T03L 3IDYC 3PXJA 5F9JB 2PCPB 3IGAB 5DO2D 3AFLA 2DKUA 2YXFA 1TVHB 1CLOH 4PRHB 3MACH 3TT3H 4PJ7B 1HQRB 1BIIA 3QAZC 4JG1H 5DEFA 2FJGA 1ZEAL 4MYWB 1TZHB 5D71L 3EO1A 3V52H 1IILE 2NXYC 3U7WH 3MLTB 5C0BE 5F7LB 4NZTH 4ONHB 3ZHLA 3DVIA 1JZ4A 1IGCL 4NQCB 3T4AA 5GGSB 1CICC 4CU8A 4YXHH 2DBLL 4MJIB 3MRDA 2W9LA 3BIKB 4LPXA 1D9KA 5C2BH 1NH6A 4WFFE 4Y7MA 4PRBA 4MCZB 5KTEL 1QTYT 2IF7A 4RX4D 1SM3H 3CXDL 3D69B 3BQUB 4G7YL 2FR4A 4KK8D 3FONB 2VISA 5EA0L 3UTSE 4F8TA 3TYFA 5JOEA 1UH4A 5K9OA 2ICWA 1EJOL 4Y4FB 2AJXL 4L8BA 2L7UA 3KAAA 4EBQH 4JPKL 1KB5A 1A4KB 5GGUB 3VG0L 2NXYB 1N8ZA 3KPSB 5TDOB 2YC1B 2HP4A 4KRMB 5E4EC 3CLFL 2B0SH 2W9DH 2CK2A 1JF6A 3MRFB 3SDDD 3KYAA 2CRZA 3HNTL 1HHIB 5IR1A 1I9JH 1MJ7L 3MLWL 3C5JA 5SV3A 1K6QL 4PRDA 3TJEL 4GBXC 4K7FA 1U91B 3CPLB 3PGCB 3VH8A 1SJVA 3ZL4H 2R4RH 2MCPH 4O58L 4LSPL 1PG7X 2XA8L 4I0PB 4RMVA 3TLRA 3QCTH 4HGWB 1VENA 3LKQB 2A83A 1PD6A 5HSFA 1FL5A 1FO0B 4Q9QL 1L7TH 1A6AA 1T1WA 4JO1L 5MEOB 4LOUC 2VR5A 3LEYL 5SWSD 5A2IH 4QRUA 5GGVL 4D3CH 5MP6L 2VH5L 3E6FA 2K9UA 2Q3ZA 4HWEH 1T5XB 5SWZE 5T3ZD 5ESVB 4YNYB 4EIZC 4F15C 3RFZC 2PTTA 3HR5B 4OGYH 5D7SL 2NY2C 3MXWH 1N59A 1YEHH 4MXWL 1HH6A 3IKCB 1KIPA 5LWYL 2JELH 3O0RL 3QEQD 4WENB 5FA4B 1WK0A 5FK9B 5CSGA 1CTNA 4LEOA 1NAKH 1A47A 3QFDB 1I1AA 1YY9D 3M17B 4HV8B 3GSXB 2IQAB 1JHKH 2EDXA 1QFPA 2VL5B 3O4LA 1RZIA 2NW3A 1NC4B 3PGDA 1N4XL 4PGDB 5E99H 4YHMH 1QFUL 2D4DA 1RZJH 3VXSD 3SE9L 3U0PA 4XXDA 3WNNA 4UV7H 3L6FB 4BZ2H 3RL1A 4FZEL 3GSNA 2HJLB 2AV1B 3EKCA 3WNLA 1UVQA 1F2QA 2EDLA 3QI9D 3SGJA 1UQSA 1UADC 2EE6A 5T5NF 3S35X 2VB5A 1C5CH 1W72H 4ZTOL 2X1WL 1G9NL 2Y06H 4PJDB 5T1MB 4Z7UE 3B2UD 1U92B 5FM5M 3PNWA 3HE6A 2FX8L 4PJ8A 4PLKD 1OAKL 1KXQE 2UY7A 3HZYB 4WTZA 4YUEL 2NY2B 3A6OA 4F2MB 4YDVA 4DGYH 1YMME 4JFYA 4X80H 2I07B 3RNKB 4FQCL 2ZUVA 3UAJD 2NX5D 4OQ1A 4YHNB 2BNUB 3CFDB 3NTCL 2PYED 4U6HA 5GJSH 4Z18A 4N0FA 2GK0A 4WFGD 1INDL 3H2WA 1VACB 1WEJL 3HZKA 5IK3A 2VZVA 1FZOB 2ZOLA 3ZDXF 3IVKA 4DGIL 3ZTJH 4LP4A 3KPOA 2F54B 4X9GA 2F53B 4NQSB 4R4BA 4HEPG 4WHYH 4W68A 2F8XC 5BZDA 5T33L 5GS1A 1NGWA 3RA7H 4P23A 4JJ5A 2VXTL 1U3HA 3BFOA 5KSUA 3WS3B 4LVNC 2X1QA 4XCYA 1U8OA 4Y19D 4Y8AA 2DS4A 3NFPA 3BYTA 5CUSH 4DKEH 5DMYA 4XCFL 5KSBE 3IFOB 5DRNA 3TVMD 3L7EA 1OTSC 4F8QA 4HS3B 4XXCC 4P3DB 4WCYL 2D7NA 4JFPB 3DNKA 5TQ2L 4JO3H 2XZAH 4AT6A 1MAML 2BRRH 2VLKE 4K8RH 2AJUH 2ATPB 4L9LB 5CHNA 5BVJB 5TPWH 4Z7UF 4HIJB 3GBNL 3BGMB 4B50A 4KRPD 3QG7H 1GJIA 5B3JF 5IV2B 3BEWB 4TQEH 5TE4H 3FQXA 1YNTB 2IPKB 5D2NA 4WW2A 3VXQB 4DAGH 4M9OA 1I9EA 1MFDH 2HFFA 2I9LB 4U49A 1TVBB 2R2CA 5FUOH 3ZO0A 2XG5A 4F7PA 2QL1A 3BW9A 4PJGA 3BOVA 5EFIB 3AB0C 3VI3F 3GO1H 4P2OB 3VFOA 5T3ZL 5DQDL 1DLFL 2P49B 5C0BA 2J8UB 3UCRA 1NCWL 1VEOA 4WV1A 1ZSDB 2L0DA 2R56L 1XCTA 4KKCD 5C9JA 1FVEA 3ULSB 4JREB 2MTPA 4MHHI 1Q9LB 5I17A 2ZJSH 3RAJL 2CDGA 3S88H 2V2XA 2X4QB 1IAIL 1DQLL 4ENED 2HTLC 5DJ6B 4H1LB 1FH5H 2VLJB 2CLZA 2G5RA 4DVRL 3D3VE 3OHXB 4NQVB 1IAIM 2PR4H 3T65B 2WQRA 3IJYB 1GH7A 1MFEL 3P0YH 2H1PH 4Q6IA 1ZT7B 1QACA 3QDJE 5JHDB 3UTSA 4JM2A 1CK0H 5HHMB 1NCUA 2EZ0C 2P44B 4H8WC 4LPWA 3RTQD 5L8JB 4Q9RL 3PWLA 3WV0A 4L3CA 4ZYKA 1LE5B 4M7JL 1IQDB 5E8DH 5EUOA 2WUBH 5E8NA 4E41D 2J6EH 4L5FH 1AGDB 3IXAB 1D9KC 3GSUA 1EFXA 2QLVB 1EFQA 4X4XB 1NEZG 4J3VA 4PJEE 3DIFB 1DQQB 4DZ8A 1NFDB 5DUPH 5C0RH 3DWTA 4IRJD 1NGQH 4ZFZB 2VLLA 5C8JA 2A6JA 4KKAD 4QHKJ 3F5WA 3TT1L 1KCVL 2VOTA 1QKZL 3V2AR 1ZXQA 4Y4HC 3OAYK 5TQ0H 1BIIB 5EBWA 5DEFB 2FJGB 4LU5H 1EXUA 1J1PH 4NBYB 1J88A 4EKXA 1AH1A 2QTEA 3H9HA 4JFZL 2Y07L 5FOBA 3ARVA 1F3RB 2WBWB 5C0DA 3SCMD 4FFVD 3T4AB 4DFHA 4HPYL 1FL6A 5DEGA 4ODVH 3MLUL 5MENB 1BGXL 1RZFL 3PJSA 3MRDB 4Z95H 5F7FA 3EOAA 2CDEA 3QWRA 4J23A 4LSTH 2Y6SD 1XGTA 3I6GA 3VXMD 3MRCA 4YAQA 1D9KB 5KG9A 5CEXA 3U36A 4LASH 3DRQA 2M2DA 3ZKQD 1T20A 3BPLB 1FO0H 1YC8A 4LKCA 5JW4Q 1RU9L 3RZCA 4NHCH 4GT7A 2FR4B 1HEZA 1A6VH 2VISB 1JE6A 1A6WH 1OF2A 5KANG 2Z35A 3T0EE 1V8HA 4WFED 4M5ZL 4JAMA 3L3OA 3LOWA 1YNKH 3TYFB 3EJYD 2EDDA 2DIAA 5K9OB 1H8NA 1VEPA 1ETZA 2ICWB 5F9OH 4L8BB 5EORL 2C3GA 3UZEA 1EAPA 1KB5B 4WWKA 4MZ3A 1N8ZB 3S37X 5L8LB 1CFSA 1A6PA 3PWPD 4OAWB 1A3RH 3HZVA 1KGCE 3C5JB 2FX7H 3DV4A 3TBVA 4PRDB 5C7XH 1YMMA 3FRUA 5DVOA 5IW1A 3I50L 1Q1JL 4K7FB 1YEKL 3HB3D 3H42H 4QXGL 3WHXA 3VH8B 4NNPH 3UTPE 1Q9WA 2XPGA 3LPFA 3QIUA 2XNAA 3PHOA 3VWJC 3ZYZA 4DN3L 3QHZH 2LTQB 1N64H 5DJCA 2BSSA 4AIZA 3SO3B 2A83B 4ZFGL 4HUUA 4M6OH 3TZVB 3T1FA 1FL5B 2VC2H 3EYUH 1T1WB 3F58H 5CINL 5I8OH 1V05A 4OI7A 1J8KA 1FAIL 4TN9A 4NN5C 4LVHB 4QRUB 2WZPD 3E6FB 3VDBA 4WI5A 4N1CA 1LVEA 3HE6C 1A3LH 1UFUA 1N59B 1HH6B 3LMJH 3PQYE 1KIPB 5GRJL 2IC2A 2ILLA 2EDEA 4AM0A 4OV5A 4W4NA 2CPCA 1F90L 2BDNH 3MLYH 5BCAA 4QKXB 2IBZY 1JNNL 3BT2L 3EOTH 3ZTJG 3G5YA 1HHKA 1I1AB 2YS4A 1EV2E 3MV9D 4S11A 4XPGL 4M6NL 4G8EB 3O4LB 2KQNA 4NRZA 4FQ1H 4JVUA 2NW3B 3GKWL 5F3HA 3LIZL 3PGDB 4QNPE 5DJZB 1I75A 3NABL 2N1KA 2DICA 4KV5E 4L4JA 3U0PB 4XXDB 1JGLL 3L5XH 1MFNA 3LPWA 5FAAA 3RL1B 5HYSA 3GSNB 3MRNA 4NM4H 5ACZA 2IFGA 1KBGL 1UVQB 4XCEA 1UQSB 1YEDA 3RGVC 1KIQB 4PJ9A 2B2XH 3L3HA 1NBVL 5GS1C 1G6RL 3PP3K 2JIXB 2NZ9C 3MFGB 4P9ML 1CF8L 3UJIL 4JO4H 5LJYH 2X4TB 3PNWB 1G0XA 3HE6B 4PJ8B 3ULUE 1RZ7H 5IBTH 3LS5H 4JFEA 4H88L 3C60D 2KDGA 4YDVB 3BD3A 1A1OA 4JFYB 2PO6A 4FNLL 3ARUA 3QZWG 3OQ3B 1DBMH 3THMH 1AHWC 4F57H 1SYVA 3ET9F 4N0FB 2GK0B 5LCVH 2A9ML 5J1TC 4I48A 1CFVL 4K3JL 3S4SG 3HZKB 5IK3B 5DHYA 1P9MA 3MCLL 1RIVL 1IFHL 1Z6JT 3FN0H 4WW2C 3X14B 3D3VA 4KZDL 3IVKB 4M48H 1BJMA 1RJLA 3HAEA 4KHXL 3CSPA 4JJHA 5MHSE 4GG6E 2CMRH 3KPOB 5CEZE 3QDJA 4R4BB 4YBQC 4LCIH 3FB5A 3EJZC 2XA3A 4OD1H 3VFGL 5GS1B 1NGWB 1WITA 4OLWH 4JJ5B 4P23B 1U3HB 1CD8A 4WI2A 3RX5A 5KSUB 1HXMA 4XCYB 1U8OB 2IFFL 2VSCA 4KV5F 3NFPB 2Z91A 1FFOA 5D96C 5JO5A 4LRIA 4JZJA 4MQ7A 5DRNB 3MLXH 4H1LH 3ZKMD 1NUNB 3L7EB 3OJVC 2HLFD 3PE9A 3W9DA 3H3PL 4QRPD 3CH8A 4GQPH 2NY4C 4AT6B 4EQ3A 1I3GL 5J12B 1MRFL 3FFDB 3ARWA 1GGTA 4PP2A 2ZUXA 3DBXA 5DFVC 4JB9H 5E4IA 2CRYA 1B4JL 2DLFL 3FQXB 4XVUD 5D2NB 3NA9H 4WW2B 1HWHB 3OV6A 1MLCA 4Q6IC 4XPFH 4CVUA 1OARH 2HFFB 1DSFH 2PW2A 1QEWA 3K1DA 5I8KL 3WUWA 4JM2C 2ICCA 4DZBA 4NC0B 3H9SD 4FABH 1S7VA 3ZSSA 2E9JA 2KUTA 2H8PA 3ZKXC 1QBMH 3G6DH 1LEKA 4XCCH 4F7PB 3BW9B 4PJGB 4JHAH 4X7TA 3MUHL 3VFOB 4DN4H 1JL8A 3HG1E 4EI5C 1BWMA 2PN5A 1X6NA 3MRIA 4M61A 4WV1B 4GG6F 3KWWB 3BGFC 5E70A 3T4YA 3LQZA 1XCTB 5T1KD 5AZ2L 5C9JB 1FVEB 1YEFL 1UA6L 5I17B 1HKLL 2CDGB 5BS0A 2V2XB 4M6MH 4KDVA 1MOEA 1YMHA 1C12A 1WIUA 3HC0A 2CLZB 3BZFA 3C9NA 1OAYH 2PETA 4MQXC 3O6ML 2BP3A 5EU6E 1A7NL 4H8WH 1LK3L 4Z77A 3K8LA 1C5DA 5KJRH 1IAII 3IFNL 5I73B 1TETH 3WE6A 1MVUA 3QXWA 2NXZD 4NGHH 3O3BA 5IG7A 5E5RB 1A9BA 1DBKH 5I1CL 4TUKH 4L3CB 4YGAB 4ZYKB 1JK8A 1FHGA 1IM3A 4EDWH 1D5ZA 5EUOB 5DSCA 5K9KB 1G9EA 5E8NB 3BSZH 4J8RB 2WM0A 1HNFA 3S37H 5BV7L 1IBGH 2J1KA 3MLPA 4Y5YA 3PIQA 3GSUB 1EFXB 4TSBL 1X5HA 2CO6B 4MA8H 4DZ8B 2VLRE 1BFVH 5IWLC 4BSVA 1U8HA 3X13A 5C0CA 2VLLB 1AR2A 2A6JB 1KB5H 3H7BA 3F5WB 4LAQH 1FSKC 2LU7A 3WIHA 3ALWA 3GI8L 4QYOA 4P48A 1EXUB 1A3QA 1SM3L 3H9HB 5FOBB 1LEIA 3X3GH 5C0DB 3KPRA 2ZCHL 3PF2A 2UZIL 4HCRL 5DRWA 3BVNB 1FL6B 5DEGB 1YPZB 3PJSB 3RIAK 2LU4A 4OFIA 5ISZD 1PSKH 2CDEB 5GJTL 1XGTB 3I6GB 3MRCB 5FYJU 4YAQB 3FMGH 5KG9B 3SGEH 5CEXB 3U36B 3DRQB 1T20B 4LKCB 3MV11 3RZCB 3L95A 3FT3B 1HEZB 1T0MA 4LLYA 3O81A 4LRNL 3RWEB 1OF2B 3D48R 2Z35B 4NRXA 1RFDL 1BD2D 1I9JL 3RVWD 3FKUS 3L5HA 4JAMB 3WDJA 1XGRA 3L3OB 2O93L 4ZPVA 2MHAA 5DXWA 3V4VL 1ETZB 1WIOA 4IIQC 4NKQB 2IG2H 1JHLL 1IEHA 1NJ9A 4NYLB 1JPTL 3OWEA 4UAOC 3GHEH 4LEXL 3MV8D 2R4RL 2MCPL 1ZLSH 4WWKB 4XVJL 3VFTA 2HYMA 4HJJL 3HNSH 1EDQA 3VD7A 2YD1A 2OI9C 4OZFH 4P5TC 1RMFL 1S9VB 1BEYH 5T3XD 1GOGA 1T7VA 3HZVB 4X5LA 1A0QH 4LCWB 3GMQA 4S0TD 3SOBH 4L4TE 3DV4B 2CO7B 4U6XB 3TBVB 3VWKA 4LPVA 1HH9A 3FRUB 5ANME 5IW1B 3K8MA 4LLVA 3WHXB 3PABA 2AQ2A 3O3DA 5C08A 2WINA 2XPGB 3QIUB 1BVZA 2XNAB 3PHOB 2WWKO 3MXWL 4G8FA 3RVVD 5DJCB 2BSSB 3QUKA 4AIZB 1HSAA 3UC0L 4HUUB 1V3LA 4KK9C 3T1FB 5C86A 2J4WL 3G9VA 4ZSOA 1JRHL 2ADFH 2CIKA 4PRHD 2MKLC 3B3IB 4R4ND 2O5XL 4D94A 1Q0XH 3O6KH 4HUMB 3DETD 4O9HH 2DKMA 4U1NB 1RZJL 2Q8BH 2OI9B 3GK8L 2HJFA 4NQCD 4BZ2L 2CKBH 2PO6C 5IFAL 4AM0B 1OGAA 4OV5B 2HRPH 4MJID 3O9WA 5EIVA 1C5CL 1W72L 4GW4A 2Y06L 1RK0A 3G5YB 5DYOA 1HHKB 1X5JA 3FO0H 4Z7NF 2Y23A 1JWMA 4NRZB 4UTAH 3FN3A 4ZO9A 5F3HB 1A7QL 3BQUD 1QZ1A 4XC1H 5BRZE 5EOQL 5I1KH 5IBLC 3GIZH 3MV7E 3E2HB 5HYSB 4EOWL 3MRNB 5A43C 3CLEL 5ACZB 5GZND 5CILH 2H32H 4XCEB 4H1LG 1YEDB 3HMXL 4PJ9B 4Y4FD 3L3HB 4ISVA 3DYPA 1I9RH 3O2DA 4K7PX 4D0CA 4PV8B 3KPSD 4JFEB 5DVMA 2P8LA 2LV4A 1Q72H 2OK0L 1A1OB 5LBSH 1FJ1A 2PO6B 1JF1A 3Q1SL 2VLME 4UDTA 1N7MH 4EXKA 3V6BR 1CG9A 3W0WE 1SYVB 5KBNC 4Z7OE 1LO3H 5IMLA 4G6KL 5ALCH 1MHHA 5CIPB 4OD3L 3MMEA 5CS7A 4HUVA 3QNYA 5GZOC 1QSFA 1RJLB 4I0PD 3HAEB 5EU6A 2XZAL 4XPTL 2BRRL 4PJFA 1QHPA 4GQ9L 4TSCH 5JXEC 2ZCKL 3FB5B 3JVGC 3Q5TA 2HT2D 1P1ZA 1PEWA 3KYOA 3DI3B 3U9PH 3TBTA 2ZUQB 3GMPA 4QXUH 1HXMB 3MJ9L 3P30L 2X89A 4DAGL 2MQ3A 2YN3A 1LNUA 1FFOB 5JO5B 5T3XL 4M1DL 4JZJB 4MQ7B 3SJVA 3B8SA 2FBJH 5JQ6H 2ZPKL 3ZDYE 4ZS6D 5FUOL 3W9DB 3PDDA 2VO5A 3LZFH 3RRQA 1WBYA 4DKFL 3GO1L 4OKVA 1QFWL 4M93C 4PP2B 3DBXB 5L7XL 5E00A 1LP9E 5DDHA 1JJUA 4WI8A 1G1CA 4Z5RA 3T0EC 1OTUC 4WNQA 3QP3A 1MLCB 3U7YH 1HZHH 1NC4D 2FLBT 2PW2B 4U1IA 1QEWB 1PG7W 2ZJSL 3BUYA 3WUWB 3S88L 3ROOA 4DZBB 1S7VB 1BOYA 5DK2A 1S7SA 4Z7OF 3VFSA 2BHYA 1KEGH 2YPLA 3BMVA 1LEKB 3EYQD 3MRPA 2BRQA 2HFGH 4K3HA 3HE7A 4YIQA 2HKFH 2X9XA 3OXRA 3VDCA 4PGJA 3ZE0E 2DQEH 3LAFA 3VXRB 2ICWJ 4PLJD 2O5YL 4F7EA 4M61B 1JWSA 3I3EA 1H8OA 3BKMH 3LQZB 1CK0L 5HGBB 2ZNWA 1S5HB 2NY2D 3VD4A 1T6WA 4Y5YC 4U6YB 5BS0B 1YMHB 1C12B 1MCOH 4P2RA 3HC0B 1R0AH 3BZFB 3C9NB 3N1FC 3MRKA 2DN7A 3O8XD 4YXLL 2NCMA 5E8DL 3KPNB 3FO2B 2R9HD 2IPUG 4U2ZA 3ZDYF 4BSJA 4Z77B 1BQLL 4FFZH 1C5DB 4MNQE 4YDIH 3TH2T 1G7QA 2HT3C 4LLQB 4JHWL 1MVUB 3VH8G 2Q7NA 5LQBL 1U8NA 1QSEE 3O3BB 5IG7B 3L5WA 5DUPL 2F54D 1A9BB 2F53D 2YD9A 3UO1L 4M7KL 5D7JB 3NN8A 4NHUA 3QWOA 5SX4H 1JK8B 1IM3B 4OLZH 4OF3A 2JCCA 4QRTA 4AL8L 1D5ZB 5DSCB 3P11H 1NCAL 4KPHH 1AO7E 1CDUA 3DHMA 5CZVH 4A2LA 1J1PL 1CDJA 2FB4L 1ORSA 4Y5YB 3PIQB 2RFXA 1EIBA 4L4TA 1M4KA 4L3EE 4JLRB 3KPPA 2QBWA 5KVGH 3BESR 3NMEA 3ZE0F 1X4XA 5F7EH 3SGDH 2P24A 1V3KA 4L8SA 4BSVB 2GKIA 1U8HB 4PJHA 5C0CB 4E9LA 1HYSD 1UM5H 3H7BB 5A40E 1MIMH 4FQ2L 1FO0L 3EDDA 3JV6A 5CWSA 4NHCL 5F6HJ 2VDNH 4RMQA 1LEIB 1W2KT 1MI5A 3KPRB 5I9QC 3OJDB 3QUMB 5DRWB 5HDLA 1YNKL 2AW2A 4P2OD 3SY0A 3ULUC 4JDVA 4DWHA 4OZIA 5C0FA 3VXUA 4PJBE 4NZRH 2AI0L 3I3DA 4RFOL 3QEGH 4GRWE 1C7SA 2EC9U 1DQMH 3L95B 4WTZG 3BRDA 1T0MB 4GLRH 1BIHA 2GJ6A 3ARDA 5HPOA 3QYCA 4NRXB 5DMGD 1INEH 1PKQE 2VLJD 1MCCA 1Q9KA 1XGRB 1QBBA 4ZPVB 2MHAB 4RMUA 5C7XL 4QHKI 5IMOA 2QSCL 4LHQB 2BXYA 1NJ9B 5FUCE 1OP5K 2FH6A 5JHDD 25C8H 1GIGL 4NNPL 2NR6C 1NCDH 5HHMD 4HS6A 2X4RA 4OI8A 1JGEA 4W6XB 2F5BL 3VFTB 4X8JA 5E2TL 2XWTA 3CDCA 3CU1A 2G75A 4N8PA 4V2BA 1D5IL 1WAAA 3MUZ1 2FGWL 3QCUH 4FQQA 5I30H 1Z0NA 3VWKB 1MFBH 3QJFA 4LLVB 5I6XB 3MX0A 3PABB 1HOCB 2X4OA 3O3DB 5C08B 2WINB 4DUWA 1A3LL 2GW5A 5HI5C 1NUFA 3SDXA 1IGJA 3LMJL 1SYSA 4KHTH 4R90H 5KANI 3QUKB 3TA3A 5I19L 2VKXA 1HSAB 3W81A 3MLYL 3AS0A 4PJBF 5H37G 3WXVL 2MKWA 3RIAF 3FQNA 4ZSOB 3GRWA 3C6SA 1U2CA 3EOTL 1AFVL 2CIKB 4XPHH 1GPOH 5C3TA 3N50A 4GRLC 4OCXH 4CJ0A 2EEBA 4OZHE 4YJZL 2EZ0D 5TJWK 4M43L 1J86A 5IHBA 1MCRA 1JRHI 1U41A 2XXMB 2HJFB 1OW0A 3VFVA 3NFSH 5MERA 2O61B 4NM4L 1PY9A