2DRUA

Crystal structure and binding properties of the cd2 and cd244 (2b4) binding protein, cd48
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
180
structure length
180
Chain Sequence
FQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYEMVSKPMIYWECSNATLTCEVLEGTDVELKLYQGKEHLRSLRQKTMSYQWTNLRAPFKCKAVNRVSQESEMEVVNCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chimera of CD48 antigen and T-cell surface antigen CD2
publication title Crystal Structure and Binding Properties of the CD2 and CD244 (2B4)-binding Protein, CD48
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Immune system
total genus 38
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2006-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2druA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2druA02
4S2SA 4P3WA 4R96B 1LEIB 2RCSH 4ZO7A 3MV7E 1KPUA 1RMFL 4B7IA 5DMKB 3DROA 2MCPL 2F9BT 5GRZA 1A6AB 5TPWH 4NO0B 4OM1H 4FQ1L 2VLKE 4YDLC 2PCPA 1BX2A 3MRFA 4HPYH 4QRPA 1IZJA 4ZUTA 1MOEA 1UYWH 4N8VB 1N2RA 1DQDH 1NGZA 1HWGB 3ISWA 4IEFB 3SE8L 5C08A 3OL2A 4KK9C 5JNYB 2VXSL 3IF1A 4KK5C 3U0TA 3R8BB 4ODSH 2EE6A 4OLVH 3JWOL 3GNMH 5GRJH 5J6GA 4PRIE 4M1GL 3MNWA 3UC0L 1A7RL 1KB5A 1CD1A 2Y6SC 3AMKA 4I3RL 2XY2A 3LEYH 1N5YL 4G42A 4QKXB 1INQB 1P5UA 3SO3B 3MLYL 1H5BC 3DX6B 3SE9H 3HRZA 4LK4A 3BYTA 1CICD 4MS8C 3TH2T 5D7KE 4JHWH 2FB4L 3ZHKA 3LSOA 3ET9F 3P73B 1KTDB 4E42A 1RQ5A 4X8JA 4L8BB 1R3KB 3ULUD 3O3DA 3RKDC 1BJ1J 3SCMD 2VE6B 1YEJL 1NEZB 1AXTH 4M1CD 4EI6A 1WBYB 1G7MA 4HCRL 3SDXF 3VXUA 3R4DA 1YN7A 3NCFB 3QDGA 3OKEA 5JZ7D 1FVEA 1GZQA 5LGHL 1INEL 5EFIB 1QQDA 3JV4B 1FAIH 1I7ZA 1BGXL 1E27A 5TH2B 3ARDC 5KVDL 3MRRB 2BC4A 4MCZB 1JHLH 1XGPA 4Z8FH 5FGSA 1ZKAA 2F8VA 1F11A 1T66D 4NN5C 3MA9L 1S7WB 3EYVA 43C9B 1QLEH 2R1YB 4YHMH 4EN3C 1IC4H 5LQBL 4OCSL 2XACC 3ZL4H 3Q3GB 3BAEH 2ZNXA 3HZMA 3LQAH 5BRZB 4HUVB 2FJHA 4RNRA 3CPLB 2P7TA 2VDKL 4KK6D 4NQXB 5HYSG 5B39A 4ZQKB 4MJIE 3RA7H 1DVFA 5FV2A 4L4VB 2BRRH 4Q0XL 1V7NL 4IS6A 5FB8A 1OVZA 3GIZL 3O4OC 1DBBH 3FN9A 3RNKA 3AGVA 4QGTA 4LQFL 3VI3E 4V1DD 5CSGA 3WIFA 4KUZL 4DZ8A 5J11C 3T1FB 4P5TC 4KRPC 3H7BB 4YBQD 4KDTC 4ODHL 3MUHL 5IB4B 5E2WH 4LLYA 3FB7B 1UJTA 5DJ8B 1N0LA 3LQZB 4R7NB 3L3OB 1MHPL 3QT2A 3I3BA 4BUHA 3TF7C 4PP2A 2JCCF 3QISA 3NIDF 4M6NL 4JKWA 4P2RE 2HT2D 1HN1A 1NBQA 5BV7C 1LO0H 3C8KA 4NZRH 3E6FA 4F2MA 1ODAA 4U6YB 4BK5A 2OR9H 3QO1A 1EXUA 1N3NB 5C07E 4PR5A 3CMOH 3V5HB 4APQB 5L6YH 1OP9A 3RWEA 1JUFB 2BDNL 3GEWB 1D6VH 4M48H 1OM3L 3CGTA 1U8MB 3NIGE 5F88B 4FG6D 1CK0H 1RUKL 4DUWA 5DQ9A 5DK2B 1MCWW 3R0NA 5JW5A 1PYWA 2OLDA 5C92A 3UTTB 2CIKB 1U93B 4YHKH 4M03A 2P5ED 3QNYA 5F71A 5DRXA 2PR4L 2XZQL 2OJEB 2X9WA 5D70H 1DLHA 2BVYA 2DKUA 1V3KA 3MRIA 4XPAH 4K3GA 1B4JL 1QD0A 4FNLH 5DHVH 5IJVB 3W11C 1D3CA 3KNBA 4HFUL 3I3EA 5IOPA 4WV1A 1BQHG 5GGSB 3ARGD 3I50H 1BVZA 3DGCR 4JFFA 3VXNA 1RUML 3CDGB 1T2QH 2EICA 3U4EA 2D7NA 3BD3A 1VADB 2DQEL 5B38A 3EYFB 1MRFL 5GRVK 4OT1L 2MKLC 3CX5J 2YMXH 3GSOB 1ORQA 4BFIB 1VGEL 5CEXB 5FA4A 4I9WD 4Y4KB 1QRNE 4GRMB 3I6KA 4NYLB 2IMMA 3U30B 2W91A 1WCBA 3VGGA 1M1SA 2X10A 3JV5A 4RWYL 4KZDL 4H0GA 1FCCA 1XF2B 3QAZC 4G5ZH 5MEPB 4R4FL 3W0WB 1LGVA 2XWTB 4C57C 1J8HE 2LQRA 1T5WB 4U1LA 1R3JA 5FDWA 2NY1B 2ZJSH 1MLCA 3QHZH 3QFJB 1F3JB 1P84J 5K9KB 4Z5RA 1E4XL 1UXWB 5HHQB 2WWMD 4LSPH 1UACL 3ARVA 3KHQA 1BJ1H 4HWBL 3BN9C 1J10A 1M7IA 2XWBB 4GRLB 4I18A 4QRUB 3SY0B 4PJIE 3ARBD 3BYYA 3LZFL 1MCCA 2B2XH 4JY4B 2QSVA 3MR9A 3TBWA 1SVCP 2H26A 2V17L 2ZUVA 1DVFC 4J8RA 5C0ND 3CFKA 1RZFH 5CBEB 3B83A 3C5ZC 4ISVA 5BVPH 3VFNA 4ZUUB 4YEEA 4O5LL 5E70A 3TPUA 4PJAF 1FRGL 2EEBA 4QNPF 1FZKA 4LPUA 4WIQA 1XR9B 5IMLA 2CO7B 5KSVB 4P4RA 4NJAH 2F54B 1RHHA 5CILH 2NXYD 5CUSL 2BY2A 3FT3B 1B0GB 3U36B 4LSSL 4P46A 2DM7A 2ZCKL 1FAKT 4DGIL 1IM9D 1GIGH 2DDQH 2H32A 4FHBD 4JKPL 4XC3H 5D1XB 4Z76B 3ARPA 2Q76A 3OKMA 3DHJA 5DK3A 1YQ2A 4I2XE 4U1GC 3GZKA 1GOFA 5A3ID 3OB8A 4DEPC 2H2SC 2P49B 4YHOL 1A02N 4O2EB 4ONFL 1RZ8B 1D9KB 5JIHA 1WC7B 5ADOL 1OGAB 4Y1AA 4UT7H 1F6LL 4R6UA 4NKMB 3DURB 4OCWH 5DWUL 1UZ8A 2NX5E 2PN5A 4N0FB 4JRXE 3GMMB 1FPTH 4L3CB 4XGZA 1MEXH 1XGYL 2E8YA 3HNSH 1TJHL 1FG9C 5IB1A 4M1DL 2MMXA 4TTDD 3BGFC 1UB5B 2QLVB 3REVA 3PWLB 2VJXA 3HUJF 4ZS6D 1V3LA 4WV1C 1SEQH 3SDCB 4GRWH 4AG4H 2RR3A 4XBPB 5IK3A 1OCWH 3V6FA 1CFNA 4J7RA 2OZ4H 3HR5A 2NLJA 4OFVA 1C08B 1CZ8L 3CVHB 2AK1H 5CBAB 1JIBA 3MROA 2IAMA 3DV6B 1MFAL 2DB8A 2YSSA 3KYNB 4JFZH 3I3DA 4PGDB 1XZ0A 4ZXBC 3O4LB 1A14H 5F6IC 1I9EA 3REWA 3LRSB 3X3FL 3MLRL 4GUPA 3IDNB 1YPZB 1Q9OA 2OJZH 2QSQA 1G9MC 3MLTB 3QWRA 5HSFA 2YEZA 5T5FH 2NXZB 2AV7B 3LKNB 4XNQB 1FLRH 1GGUA 4KQ4H 4WNQA 4DZBB 3WXWL 3VFSB 3OGCA 4MJ5B 1T21B 3BX7C 2WANA 4NNYA 2WK2A 5BOZG 3GHBH 2BVQB 2C1PA 1UVQA 2I24N 1FFOB 2OMBA 2V9QA 4M4PA 5HHVH 1NBVL 4U2ZA 3BOVA 4NZUH 2Z91B 3GMRB 4HUXB 1MPAH 3FZUC 3NTCL 2GIYA 2ESVE 5DUBB 4CGTA 1TETH 4EUPA 3B9KD 5EA0L 4FA8A 4LFHD 4P4KD 2ED9A 1Y0LB 5I18H 4RMTA 5H94A 1J86A 1Z0MA 3VRJA 4L4TB 5IM7B 4OLEA 1S7UA 4LKCB 4I18C 1BD2E 4Z95H 2BMKA 3MUGA 5I2IB 1AQKH 2B4CC 5HGGS 1NGPL 2ZSWB 1FL6A 1OPGL 3DHMA 4WHTB 2HRLA 1SY6L 1JFQH 4JZOB 4L8CB 5MHSE 1T5XB 2R2EA 4YHIB 3P4MA 1GC1C 4MVBC 3K2UH 1N0XL 4N5UA 5HI4D 5DMIH 4NC0B 5IFAH 1G1YA 4K7FA 5BO1H 1CFQB 3MNZB 4PJGE 5JPMB 1ZA3B 4E5XB 1EA9C 3IFPA 3BWAA 1SM3L 3CSGA 4OFIA 1E28A 3BJLA 1RZJC 2HTLD 2J4WH 5E1AA 5ETUB 2JJUA 4WW1B 1UH3A 4LLVA 4YXKL 1I1FA 2NY3B 2N7AA 3DRTA 3KYOB 2E27L 4LLQA 5E9DB 4MCYA 4NPYB 1HZHL 4P46C 2VISB 4UAOC 4HUMB 1TVHB 4UINL 4MA1B 1NCWL 3UAJC 1HHJB 2SEBA 5LGJB 3V5DA 4HC1H 4PJ5A 4XP6H 4DFHA 3BD5A 1DBAH 2X4NB 2J5LC 2VLRB 3FOMA 3GUTB 3VXTB 3H2WA 1CLYL 5F97E 2E9IA 5EUOE 5E6ID 4ODUA 3UYOD 3VJ6B 3T0EB 3BQUB 2IQ9L 1TJIL 5E8NA 3QUZC 4I1NB 3HUJA 1KC5H 1CXFA 4X4XB 1TCRB 3MBED 1I8IB 5SV4A 4ZG1A 3IKCA 5CJOL 2R23A 3F7YB 4ERSL 3NAAL 3DLQR 3MV9D 5EIIA 1PSKL 1HSAB 1YEEL 3OQ3B 1JYNA 4NKIH 4FFZL 5EBMB 3VMNA 2WUCL 1GYAA 4OLZL 3DI2B 3WIIL 5H8DA 4QTIH 5E8OA 1A9BB 2CJUL 3VFUA 2W9EL 4I0KA 3BXNA 5L7XH 4HWNA 4F8QA 2IAMC 1CT8A 3THML 3O41A 3T4AA 4CMMB 4QXGL 1KN2H 2FR4B 2DQHL 1NLDH 3O6KL 4M8QA 3EBAA 3WHE0 2AERT 4MXQC 4QRRD 4UDUB 1S7RA 4YGAB 1CD9B 1QUNA 3DV4B 3HC3H 1DUYB 3EO0A 4Z0BH 5EOQL 5TDPA 1A6TB 3ZSTA 4LCWE 2AJUH 3TJHC 4XPFH 4X7SL 4X99B 3ECBA 1QBAA 4PTUB 2A6KA 5FA3A 4O02H 1MWAH 2FX9H 3PWJA 1OAZL 3HE7B 2D9CA 1AJ7L 2YRPA 3VXQB 1J05B 1AP2B 3HNVH 1S5HB 5IVXA 5JW3L 3ZLQC 1N8ZA 2BVOA 3KPLB 3KLAB 1KJ3L 1U95A 2ED7A 1T7VA 4BQBA 5DO2D 1U0QA 3RBSA 3GBML 1A7QH 3W0WD 1LP9F 1QBMH 5IIEB 1MI5B 2H8PB 1VFUA 3DECA 5BCAA 3LPWA 3BKCH 3MRDA 1Q38A 4PJXF 1R5VA 2Y7QA 1JHKH 1MCEA 1MHCB 4GKOA 5ABDE 4K8RC 4X6FA 4KKBD 3DGGB 5J12C 5DHVB 1A22B 4GQPH 1P7QB 3BVNA 1MJUH 1JNLH 5SWZB 2IQAB 2BSTA 4WUUD 4KKCD 5CP3H 2DWEB 2UWEF 4L1HA 4XH2A 1AGFA 5EOTB 1NPUA 4MQTB 2A38A 1XR8B 1A6WL 5GS1B 5KZCB 2H3NB 4HH9B 3ZE0E 5EU3B 1HOCB 3TNNA 3WJJA 3R0MA 2NY5H 3OV6A 3S37H 3HLAA 3MRKA 4I0PB 3PDOA 3H6JA 4HIHA 1JVKA 5CEZL 3QQ9C 1TNMA 1PZUB 1G0XA 5KVEL 2VDQL 5A2JH 1K3ZA 5D8JL 4PJEA 5DD0L 2GCYB 4PJDB 3PQYB 5FYKL 5MEND 1DLFH 4IOFC 3L3HA 3SE8H 4N9OB 5D4QA 3TFKC 2E7HA 4HK0A 3CZFA 4NQEB 4XNMA 4NWTH 2UUDK 5B8CA 4ELKA 2OM5A 2R56L 3UC0H 3DO7B 4Y19B 4JPIA 1CXIA 1PQZB 4MQSB 2KKQA 3Q6FB 3T65A 1FIEA 3FB5A 2HVJA 3UYRL 4M7LT 4N5EC 1E6OL 2DL2A 1CLOH 3TN0D 1FG2A 1I7RB 2ZP0T 1CICA 3LS4H 1FNEB 3VWJD 5DK0A 5T3XL 3AM8A 3P4OB 5HGBA 2FB4H 5BMFL 2XZCL 1F90H 3U2SA 4JDVA 4CW1B 1TITA 3O9WC 3SCMA 2FRGP 3D39B 3BD4A 4CRPA 1E4WH 2XQBH 3B5HA 4JHZA 4N9GB 4UOJA 5DHYA 3RUGF 3TZVB 1B4RA 1YY8A 3GJFB 3VXUE 3OZ9H 1HH6A 1V3MA 3BN3B 4LSUH 1SVZA 5B4MC 3BZEB 3QDGE 1ND0B 1IAMA 1DR9A 3L3JA 3BPNC 1SJXA 3BMVA 4UV4L 3FT4B 2Y25A 3QNZB 1TLKA 3P4NB 1JNJA 1D5XB 3S3SA 4EZMA 4EI5B 1JF1A 4BFGA 4WW2B 1VDGA 2A83A 4JHAL 1P4LB 3RL2A 1J0JA 3IAQA 1FVCA 3MNVA 1KLFA 4HWUA 5LQBH 4P3DB 3AS2A 3RU8L 1OAYL 1G6RH 4OUUB 3RX8A 4J3XA 5F1NB 1N64L 3FKUS 5CZXC 5CJQL 5TDOB 4DKFL 1YUHB 2IBZY 4TUOB 3SKOB 5IFJB 4YHNB 4K94L 5KSBA 1I8KA 1A3LL 1JPGA 4O4YH 4UTAH 4BH7B 3DIFB 4XX1G 2E5EA 3IYLW 2GSGB 3LKRB 4CVUA 1WUNT 1V7NH 4OM0L 3GIZH 2VDPL 4V1DA 5H2BB 3PUCA 4BZYA 4MNGA 5E99H 5CFHA 1AR2A 4XCCH 4KUZH 1OTTC 3GM0A 4ZDHA 2CDFA 4G7VL 3SDAB 4MQ7A 3VXOB 5GRVL 1H3GA 1H15A 3F12B 1YEGH 3TBVB 4G9DA 1ZT7A 4LASL 3ALWA 2P45B 3BO8A 4HPOL 5DFVD 4TSBH 4GRLD 1T2JA 1G9NH 4GRWB 3PWPB 2XTJC 3MLXH 5CHNA 4JAMB 4FRWA 1FBIL 1XCTA 1FL3B 5C0RL 1G6VK 2IH1B 1MCWM 2H1PL 2R1WA 2HTKD 2ZUYA 3QQ4A 3WIHA 2VSCA 1L6XA 2EYSA 1TPXC 3WJJC 3WKNA 1YDPB 3ZTNL 3OKKB 2JTDA 1JHTB 4TULL 3UJJL 3D0VB 2V7NB 3QXVA 4WI9A 3O2DA 4OZFG 1QKZH 2NY6D 1QRKA 3N06B 4OGYL 4GG8A 4MD0B 1K8DA 2P5EA 3NH7L 5DI8B 4KRLB 1U8JB 4RGND 3FAXA 4I8DA 4N0RA 5LBSH 3WNPA 2ADIB 3QDJD 4MGXA 3BIBX 3UROR 2XZQH 5KS9B 3NZ8B 4LHJB 5FUCC 1LEGB 4H1LG 4Y89A 4PGCB 5LAXA 4AIZA 4MA8H 1MIEH 5JPNB 5J6HA 4NT6B 3J8F7 4N0UB 1OAKH 4JCLA 5I1DB 2XQYK 5D1QD 3CSPA 2Z4QB 1A6UH 1MRCL 1CG9B 2NCMA 1BQLL 3EIFA 4JFFE 1F4XL 2OTUA 2PTTA 4XWGH 5IHUL 1JPSH 3DMMD 2DQEH 4XB8A 4HGWB 1ZHNB 5DEZA 1CICC 1MRFH 1UQSB 3P0YH 4I5BA 3L7FA 3CUPA 1MCBA 1QACA 4S1SL 2VKWA 3DTXB 1HHIA 3AM8C 2EYRB 1J1PL 3SDXE 4DUXA 4NQSB 4X5LA 1CFVL 4MJ6A 3MV7B 2BNRD 2Z31D 1BBJA 4NUJB 3ULUC 1Z0NA 4BSVA 4EQ3A 3SCMC 3ZDXF 4AM0B 3WNNA 3B8YA 4M1CC 4YGVA 2YA0A 2VLKB 4CN6A 5INCA 4NP4L 1OHQA 4N1HB 5JUEL 2BVEA 2VDMH 2FIKB 3B43A 1NL0L 5DRWB 5JZ7C 1YJDH 4OF3A 4HBCL 3PWVB 3QFDA 3PP4L 3CSBA 3B6SA 4W68A 3MACH 2Q8AL 3UYPA 1RU9L 3CSYA 1TVBA 2A74A 3OR7A 3BZ4B 5K93A 2DQFA 4F3FA 4U6HA 3BKJL 1K2DA 3MODH 4PRIB 1T66C 1C5BL 4ZPTA 1U6AL 1WIUA 5CD3A 3OAZK 1ZGLB 4LMQE 1D5BB 1QFWH 4H26A 1UACH 2YD5A 4HWBH 3T1WA 4UMGA 1R24A 3MGOB 1E6JL 1T04B 3ULVL 3ARBA 4ELMA 1FP5A 2E6JA 1D7FA 1PW3A 5E2JA 2R9HD 3H9SD 1T0MA 4XZUA 3LZFH 1X44A 3OAYH 2O5XL 4KK6C 1L7TL 4JJHA 4JM2D 3RI5K 2VLJD 5JOFB 1CFTA 1NFDA 2X7LB 2XXMB 4I4WA 5A40E 1IAOA 4W70A 3BEVA 1KNOB 1T1WB 1KIPA 3VD5A 1T22B 2Q1EA 5C9KA 4NDMB 2JCCE 3NIDE 4ZOEA 5D71L 4QGYA 1FRGH 2GITB 2I9TB 4J1UA 1QSFD 1IAKB 3TYGL 4O58L 2N56A 1EHNA 1SJHA 25C8H 4N0YL 1CR9H 2A77L 2P1YA 3X14A 3WSQL 4CBPA 1C1EH 3U1SH 3ZYOA 5JDSA 5CUSH 2HT2C 4QTHB 3QUXD 1JYXA 3PG2A 1WVZA 4PJCA 2CSPA 2AJVH 2DJUA 4TSCH 1IM9A 1X4ZA 5KSUA 4O00A 4Z0XB 2K7QA 5HBBA 1K6QL 4UOW0 2Z0BA 1ONQA 2X1OA 1JWUB 3VMPA 5MERA 1DBML 3MC0A 3EOBB 1TZIB 1T7XA 4FG6C 2G9HA 1KG0B 4NBZB 1RUQL 4UQ3A 1HYRC 4LCCB 1NDGA 2AGJL 2EEAA 4MJIB 2MFNA 3K1KC 4X9HA 4YJZL 5ADOH 2CGRL 4JE4B 4S0TD 1F97A 5TGBB 1ZMYA 1JZ2A 5DWUH 1EGJH 1P7KB 1MUJA 3WUWB 2BNQD 4QRTB 1WWWX 1MFNA 2DYPB 2P47B 1OGTA 2FBJL 1YNLH 4TUKL 5ECJE 5FYLE 5F7EH 4X6BA 2ATPA 1TJHH 2CK2A 1JGLH 2YD2A 4M1DH 3NFNB 2XA8L 4RIRA 2IFFH 1A0QL 1CL7H 1QFHA 3FOLB 5ILTL 4FFWD 1OP3H 3LHPH 1ZHLA 4P2RB 3EYQD 3OKLA 3V2AR 3L5XH 2ICWA 5H35A 5D6CA 3KLHD 4XP4L 5IMKA 1P9MC 4ZOBA 2EC9U 2VLRD 1NGYA 2YR3A 4FXKB 1WWBX 1P2CB 2YZ1A 4BZ1H 4WEUD 3G6AA 2WUBH 4CNIB 5CAYB 4RSVA 1A4KA 4OBRA 1QLFA 2YN5A 3TCLA 1OAXL 1JZ3A 2PNDA 3GMOA 3BQUD 3X3FH 1EBAA 1V5JA 3FFCE 3X12B 2VXVH 1KTKE 1CDUA 1AC6A 4YNYB 4YXLH 4KVCL 4CDGC 4JGUA 1AC0A 2DKMA 1DQML 3U0WH 1C5CL 2DTML 1IBGL 3LCYA 4XVSH 5MEQA 2WV3A 5DMGD 3V4PH 5JLZB 1ROWA 5BJTA 4LLMA 3GHEH 1AKJB 3B9KA 3L3GB 3RIAF 4P4KA 2WWMC 5EA0H 3VH8A 2W0KA 3DYPA 4G6MH 1FFNB 3BT2H 4R4BA 1QSZA 3KDMA 3ARBC 1INDL 2ID5A 3EO1A 3VFWA 5E8PB 1L0XA 3AY4C 3ZO0A 5CD5D 2OQJB 4UI2A 2F8OA 4G3YH 1R5IA 3OR6B 2VLLA 1QRNB 4PJAE 1QHOA 3MA7A 3D85D 5E2TH 4X7EC 5C0NC 1UJ3B 4QNPE 4FABL 4KWUA 2MPAH 4PRNA 3HE7D 4OKVB 5CINH 3KPOB 1YEIL 5CSBA 1SM3H 4Y8DC 3RVWC 4HF5L 5I66A 3DUSA 2NNAA 2VKXA 4JQIL 4ZO8A 3FQWA 3MOBL 2NXYC 5BXFB 3F7QA 1NGXA 3Q5TA 1S9KC 3OKNA 4S1QL 4HKBA 1AGCB 4XPGL 1IEBA 1MJ7L 4OCMC 1ZLUK 4I77L 4O2FA 2HN7A 1NBYA 3A6BH 3A6CL 4JJ5A 5ICZA 4PJIB 1H3UA 1RJLB 3AS0A 3Q2CA 5DVMA 3IDYB 4K23H 1MH5A 1P6AB 5A3IC 3FCTB 4XRCB 4X4YA 1PLGH 5E6IA 2J6EH 1S3KL 3D2UD 1JF6A 4ZD3H 2DM3A 4M93B 4QHNA 3MBEA 3HUJE 1Y6KR 4JKKA 5I8CA 5DMKA 2BHYA 3VXPA 1QA9A 4I0PD 3MV9A 4M8VA 1G6RB 3NAAH 5LJYH 4TTDC 5D5MA 1PSKH 2YRLA 4WI4A 4NC2B 1OT2A 3FMGL 3GRWL 4EQ2A 4ZS6C 4QF1A 4OZHF 3JWNC 4HAGA 3PHOA 4Q6YA 5ACZB 4OLZH 5DJAA 3WIIH 2CJUH 5JR1L 5I71B 5I1AA 4J2XA 4PUBH 5E2UL 4JFPB 5JHDE 3RHWF 1AGBB 5AAWA 4HV8A 1AFVL 1WV7T 3MRHA 1BWWA 4QXGH 2VABA 2HRPH 4LF3B 5I75B 4QRRA 5EORH 1JK8B 5DT1L 2EDYA 2MHAB 2ZCLL 3ZKND 2EO1A 4H1LB 5HHPA 2G5BB 1ZEAH 1Q9KA 2IWGA 1MVUA 2ITDA 2BVUA 1ZANL 1JP5A 2C3VA 1CGSL 4NRZB 5FECB 1RSFA 2OXGA 2L7JA 2NX5B 2P4AB 2R8SL 1AJ7H 1YEHH 4JPWL 5HDQH 4JRXB 1OTUD 3M17B 2FD6L 4K7PL 5DC4B 4BFBD 4NC1E 4X98B 4CU6A 4XBEH 4A6YL 3QNXB 1LDPL 2H6PB 1IGJB 4ODWB 5I1LA 3TNMA 3GKZA 4K2UL 2OX5A 1U8HA 5D1ZD 3B9KC 3W0WA 1KSRA 1WTGT 4P4KC 1U42A 2B7DT 3DSFH 4F7EB 4A6YB 3GSNA 3JV4A 5DYOB 5SX5K 3W39A 4S11A 1EO5A 4U49A 1MJ8L 3O2WL 4LHUB 1JZ4A 1V8HA 5E5UB 3IDIB 5C0BE 4EDWL 3IDXL 2ZKHH 2V2WA 4U6XA 1AHWA 3FFDB 5B39G 43C9A 5IVOA 43CAA 2YZ8A 3LS5L 4ZSOA 2AQ1A 2X4RB 1ED3A 1AD9A 4WUUA 1II4E 2W38A 1YY9D 5HI4C 3N1FC 4MWFA 3U9PL 2D4FA 4IDLA 2F19H 3HKFA 5E8EA 4OF8A 5IQ7H 1BOGA 1I85A 3FB8A 5F9WB 3S3PA 2LU3A 3WDIA 1LE5B 4ZFOA 2Q3AA 4M7JL 3CPLA 1C12A 3P30L 3P2TA 1A6WH 1BIIA 2VZ3A 1JPTL 3WO4B 1FNGA 5BQ7A 3WEXA 2HTLC 3AVEA 1DEEA 4H20L 2ARJB 1MQKL 2R4RH 1AGEB 1FJ1B 2FJGB 2VAAB 3B4NA 3EJZD 1G7PB 3K7UA 5KVEH 2ESVB 5D8JH 5DD0H 1MLBA 5J3HD 3ARQA 5JIIA 5MENA 4ZFFB 3S35L 1BJ8A 2DAVA 4NM8H 4Y16B 4U0QB 4R7NA 3LQZA 5FUCE 3SJVD 1RUPL 4MHHG 3L3OA 1BD2B 3V7AG 4NWUH 2EH7L 5CS7A 4HWZB 4LVNB 2GYSA 2QHLA 5SWQA 2Y5EA 3WLBB 5EO0A 2EDXA 3IU4L 5M7QA 5ANME 4LPCA 3GB7B 3PWPD 2R56H 1HHHB 2APFA 5E6IC 5FCUH 3WFDL 2CLRB 5I30L 1N3NA 3K74B 2NY2B 1MNUL 5DJZA 3UTOA 2R29L 2HFGH 3U83A 5DEGB 2HG5B 3UYRH 4C83B 1ZA6B 3NN8B 3TN0A 3MBEC 4U4BA 2X1XR 1A7NH 4P57B 3GJEB 3NCJH 3ULSB 4PJGB 2ITCA 4RAUB 5IMOB 2G75B 3FQRA 3VWJA 4Q9RL 3U46A 2A6IA 5IW6A 4FXGA 3R1GH 2YRZA 5TE6H 5B3NA 1NAMA 4JR9H 1CE1H 5I1HL 5IHBA 3O2VH 1BZ9B 1EVUA 1FGVL 1GGCL 4R7DB 3UZVB 2IGFL 1U8NA 1VEOA 4ZNCD 4YDLB 2W9DL 1LO4H 1J11A 5TF1L 2XNAA 3CLFL 3RWFB 4OD3L 1HSBA 1IGIL 2D7MA 3KR3H 5GGSA 5KJRH 4ODVL 5FO8A 2FO4A 5CCKL 3ZE2F 1G0YR 1G7LA 3ROOA 4ENED 4YBHA 1NANI 4BSWB 4I3SL 3NOIA 5EUOB 3SO3C 2BXZA 4O9HH 2CH8A 2FX7L 3GSOA 4BFIA 3PDDA 3G08B 3NPSB 5GSVB 1CQKA 3SQOH 5JOPD 4GRMA 5I8OL 2D03H 1LP9E 3CDCA 3MOAL 1R0AL 4S1RH 1T7YA 1G7IB 5EZOL 1HDMA 4M9OA 2EXYD 3HC0A 3RP1A 1FE8H 4UUJB 4D9QD 2GK0A 5DO2C 5L0QC 5D2NA 1L4IA 4G9FB 4PJXE 1H3TA 2VLKD 3IDUA 5KN5A 4YK4C 1XF2A 3BSZL 1J0KA 5LCVH 3SGEI 4OM0H 5CIPA 4X6DF 2VDPH 3TYFA 3QWOA 4JM2F 2LVEA 3MJ7B 1FO0H 5EB9A 3CFEA 4BZ2H 2UWEE 3K46A 1F3JA 2NR6D 1AHWC 2QR0A 3I2CL 4LARH 3KS0J 4XNXL 3UZEA 4KKBC 1UXWA 3ARDB 5HYQB 2J3SA 1S7TB 2GJZB 3LEXA 5JOEA 3GI8H 1ACZA 1OOAA 1LNUA 4HPOH 4DJMA 4GRLA 4KKCC 4Z7VB 1KN4L 3CC5A 5IW3A 1KJ2H 1OAQL 3SY0A 2WIIB 1A47A 3L5IA 4NQVA 3MV8E 4LCWB 5E03A 4HBQA 1Q9LB 5C0RH 4FP8L 4D0DB 4R26L 2H1PH 1NCUA 4MAYB 2FX8L 5FYLH 1RD6A 1TJGL 5HHOB 4ETQB 4B50A 2X2YA 4OQ1A 3ZTNH 2X4PB 5T1MB 2M26A 3BEWA 4OLXH 1G0DA 4RRPA 1HINH 5FYKU 2FEEL 4NGHH 3TJEL 2D9QB 4GKZB 1C8PA 2PETA 2IADB 5DS8A 2P5EE 1S5IH 3NH7H 3PV6B 4KI5F 4WDIA 1JI2A 2EKSB 3QDJA 4ODXB 2WM0A 1UC6A 1FYHB 4KRMB 5E08H 3GO1H 4LSQH 5J11B 2HJFB 4P5TB 4QRQB 3U6RA 2QSTA 5F96H 3FT3A 3CFBA 4ZYKB 5BV7L 4DVRL 1MREH 5D1QA 2OBGA 5D6DC 4OQTL 2CDGB 3RZCD 3L95B 1I3UA 1MRCH 3BP5A 5DJ6A 3EOAB 1WEJL 5F7KC 5E95B 4U1MA 5FK9A 3DMMA 3S5LA 3TN0C 5BV7B 5B22A 3QCTH 5EZJB 5L2KD 3AXLB 5HI3D 3VWJC 2P8MB 3OKOA 4I9WE 3LMJL 1U58A 3L7EB 4P2CG 4S1SH 3RUGE 5C0FB 4S2SB 1J1PH 3K4ZA 3O45A 2BNRA 2Z31A 5C6TH 2CUHA 4H25A 1KPUB 3DROB 1F6AA 1BVLA 4NKMA 3SKJL 1WZMA 4NCC1 2QQKH 5CZVH 4JN1L 4LRIA 1EZVX 2F58L 4I48A 1KCUL 2AK4E 1BX2B 5C86A 1AE6H 3MRFB 2P24A 1UKSA 2FEDD 4ZUTB 1NL0H 1N2RB 2Q3ZA 4OJFL 1NGZB 4HUKB 4F37K 4HBCH 1K8IA 4L4JA 1R3LB 3WS3A 1KB5L 1QP1A 3IF1B 3DX8A 3U0TB 1RU9H 5INDB 1IM3A 1Y18B 4PRBA 5HHME 4F7MA 5J6GB 4QLRA 3BKJH 3U7YL 3H9HA 3CVHA 4TRPL 3MNWB 4NJ9L 4EOWL 5D7LE 3DV6A 4TNVK 1UKQA 4AQOA 3KYNA 5C07D 5C0AD 4PGDA 3CK0L 2H9GB 4NM4H 4G42B 1E6JH 3H9SA 5LXGL 4QCIA 4JZJA 3P11H 1YPZA 3HRZB 3I75A 4X6DA 4F7PA 4JM2A 3MLTA 2O5XH 2VLJA 4EUPG 1LD9B 2AV7A 3H42L 4D94A 3LSOB 5D2NC 1NFDE 3VFSA 1T21A 1B88A 2DI9A 1IC5H 3O3DB 4NNXA 5GRUL 3MJ8B 4EI6B 5E94A 1G7MB 3GGWA 3KXFD 3VXUB 3D25B 1EEUA 1YN7B 3QAZB 1QSFA 3QDGB 3OKEB 1GZQB 5DUBA 2C1OA 3V52L 1I9RL 1PFCA 1QQDB 3LN5B 1KCVL 4G80A 1I7ZB 4O58H 3TYGH 1E27B 2VN4A 4LEOA 3HMXL 2JKXA 4U1JB 3QH3A 2BC4B 4D9LL 2A77H 1XGPB 5DFVC 4HS8L 4DAGL 3QUXA 4GRLC 5D2LA 1F11B 4KZEH 2DOCA 1UWGL 3EYVB 1MFEH 5IBUB 4WWID 2X41A 2ZSWA 2R4SL 2HTKC 3QP3A 4WHTA 5T3ZL 4JZOA 5FEBA 3IU3A 2RIKA 3HZMB 3KHOA 1T5XA 3NZHL 2ZG2A 1VHPA 5FUZL 5AZ2L 3MLUL 1Z5LB 2F5AH 2FJHB 5H37G 1GSMA 3P3YA 4FS0A 3BKMH 1F4AA 2P8LB 2BJML 5J8OA 2NY6C 3KS0H 4ODTL 1UM6H 1DVFB 4M5YL 1CXEA 2Z35A 3CU7A 3U4BL 2CGRH 4RGNC 5J57B 4TTGA 4ONOA 5AZEL 5FB8B 4LGSB 5ETUA 1G7HA 3RNKB 2BNQA 3PGDA 4K9EH 1J8HD 4YFDB 4DZ8B 4F7CA 3L1OL 3NFPA 4PLNC 4AIXA 2NY0D 3QEQD 2XA8H 4LLYB 4FZ8H 1HKLH 3WXVL 2KQNA 3CCHB 4U3HA 2YHGA 2AJSH 5EULV 3SKUD 5FOBA 1CBVH 3DMMC 8FABA 2X4NA 3C8KB 2VLRA 3LDBB 4JQVA 4XP4H 3VXTA 3P0VL 1EXUB 1LK2A 4PR5B 2B39A 4IBLT 2PYED 3RWEB 5JMRA 2P44B 5CKGA 3LPGA 2Z31C 2DQGL 3BQUA 3OX8A 1LEKA 4U1GB 4W6XB 5DQ9B 4FQIH 4X4XA 4C55A 1I8IA 1U3HB 1F13A 2BSED 5J9PA 5JW5B 3P77A 1PYWB 4LRIC 3HI6L 4YHPB 4I0CC 2N7BA 1HSAA 3QNYB 4L3ED 3RJQB 4JANA 2AJ3A 5TE4L 5DRXB 1C5CH 4FQ2L 4OCRH 1DLHB 1DBKL 2BOCB 5KSAD 2VRAA 3SKNA 3PGFH 3PXJA 2WW8A 1D6EA 3MRIB 1W8OA 3HG1D 3BGFB 2JB5L 4OF7A 2X70A 3KNBB 1A9BA 3ZHDA 3HC4L 2AI0H 1CS6A 1YNKH 4JO1L 3FHAA 4WV1B 3K8MA 3OTTA 3SOBL 4JFFB 4CMMA 1CDYA 4ONGH 2FR4A 3VXNB 2HWZH 4X4MA 4LSRL 1D5IL 3TGXA 5B38B 4UDUA 1INDH 2R9HC 4JZJC 4KH2A 5I76A 1U92A 1ORQB 1G9ML 3X13B 5FA4B 5CZKA 3INUH 1DUYA 4JM2C 3EDJA 5IW1A 1HCVA 5BOPA 3ARTA 3D85A 1A7OL 5F6IB 1A9EA 3I6KB 4NBYB 3MLSH 3QIUD 4OD1L 4PTUA 4KTEL 4HGMA 2Y9RT 4X6CF 2HA1A 3HE7A 4ZS7H 1WCBB 2E7BA 1IEAB 2GUOA 2NX5D 4WU7A 3RIFF 3OAUH 4LLDA 3VXQA 4NFBA 3WFZA 1AP2A 4H0HB 2OK0L 2ADGA 2X44D 5E24E 4XB7A 3WN5B 3KPLA 4RCAA 3QXWA 3WFEH 3TESA 4U1LB 1R3JB 1AXSA 4TNWK 1AD0A 1BAFL 4H88L 4ORGA 1RJCA 4Z5RB 1NMCC 1MHCA 4PY8J 2B4CL 5F89A 1AXIB 4K3HA 4HS3A 3RIFK 5DSCA 2O5YL 1M7IB 4I77H 1KGCD 3G5ZB 7FABH 4I18B 1NGQL 3A6CH 4HJ0D 4X8XA 2IQAA 4MXWH 2UVFA 3HI1A 4XPTL 4ODBD 3PWUB 3MR9B 3TBWB 3D2UA 4F58L 1XR8A 4J8RB 5EU3A 3TEUA 3CFKB 2J8OA 3NABH 4E41D 3TT3L 1RZJL 2H2PC 3BRDA 5E8DL 2J8HA 4X80H 4I0PA 4ISVB 3VFNB 4QHKJ 2JCCB 2AXGA 1CE6A 3MV9E 4GW1A 4IOIA 3G5VB 2BP3A 5D5ME 1FZKB 1NCDH 2GCYA 3MLWL 5IMLB 1GOHA 2W65A 1OLLA 1RK0B 2NYYC 3MO1A 4YUEL 3OKDA 4FFWC 4MD4A 4RAVA 5JXAH 1L6ZA 4Y16D 4ZFZB 5TE7L 3KLHC 4YXHH 1WFOA 4UAOB 3T0AA 3U7AA 1F58L 4JQVC 5EBWA 2MCG1 5SX4H 4LLWA 3V8OA 4NZTL 4JPKL 4J3WA 4R3SA 2H32B 1AFVH 2Q6WB 1FO0B 2O93L 1OARL 1YYLH 5DEFB 4HQQH 3ARZA 4FQXD 2J5LB 2YPVL 2I5YL 3BQUC 4BQCA 5AYQA 3N9GL 2CUMA 2E3VA 3H9YA 3T2QA 4Y2DD 1M7DA 1ZANH 2A9NL 3H3PH 1KJ2B 3LQAC 2AJYH 3P4OA 1OQXA 1DTUA 1P1ZA 1UZ8B 3MREA 1VFAA 2R8SH 4JPWH 1UCTA 5DMGC 4CW1A 1Z3GH 5ALCH 2CRMA 2BY1A 4XGZB 4PS4L 1FH5H 2V6HA 3AS1A 4K3JH 2CMRH 4R2GB 3VFVB 5IB1B 2J2ZA 2EDTA 2UUDH 2HFFA 5D1ZA 3REVB 3BW9A 5EH1A 3W0WE 4PJ7A 5F7DA 4UU9A 2ZCHL 2PW1B 4XCFL 4ONHA 3CFCL 2F5BL 5IK3B 1XCQA 2FO1A 3V6FB 1CFNB 3HA0A 3FT4A 3ARXA 2NLJB 4WEBH 1MJ8H 4JKLA 4X6CA 3EDDA 1UWEH 4MB4A 3V5KA 3MROB 2IAMB 5DR5L 2YSSB 5CD5C 5KVMC 2VERN 2G2RA 2AP2A 4YH6A 1W0VA 2K1MA 3JSSA 1X5GA 2YUZA 4IJ3C 3REWB 1MCQA 3KG5A 3KPMB 4FTVD 4GUPB 4PRAA 4JQXA 3S36L 1Q9OB 2X9XA 4Q2ZB 3HE7C 4LPTA 5F1NA 3FFCB 4K71C 2YEZB 3S4SB 5L88H 2WBJD 4TUOA 4WNQB 3SKOA 3OGCB 4M7JH 1X5AA 5DRNA 2EO9A 1GH7A 4NNYB 4X7CC 3DBXA 3BPCA 3DIFA 5I8EB 1W72L 1UVQB 5KTEL 1IKNA 1KOAA 3GSQB 4IOSD 3C6SA 5D72L 2Y36H 1NCAL 1U41A 1CFSB 1RUAL 3QIBB 1GRWA 4EUPB 1U8IA 1XF5B 5MENE 4DTGL 1IGCH 4K8RL 4W6YB 4XXDA 5H94B 3JUYA 3SJVA 3VRJB 1S7UB 2Z8VC 1N7MH 2BMKB 1PKQE 1DEDA 3MUGB 5F3HA 5C6WH 3IRPX 5IEKB 4OKDA 1FL6B 1XT5A 3PWPA 5J12B 4PJAB 4R97C 5F7YC 2R2EB 3P4MB 2OZ4A 1MNUH 4MB3A 2AEWA 2R29H 4MAYD 4U1IA 2XZZA 1JL8A 4ZTOH 2RQ8A 2P5WE 1VB9A 3OKKA 4I0PC 4LQ1A 4Q9RH 3AC0A 1IFHL 1MCSA 3BWAB 3CZJA 4YDKL 3RWJA 2Z92A 5IT2H 4RZCA 4LSTH 2GY7B 3I9GL 4K07A 2I9LA 4LLVB 2BFVH 5ALBL 1RVFL 5DI8A 3CX2A 1I1FB 1U8JA 2CXGA 4AMKH 3C60D 5GRWA 2AJXL 1CGTA 3H8NA 4LLQB 4ZAKD 5I16B 1LEGA 4TQEL 1U8LB 4MCYB 4FQLL 2W9DH 5TF1H 1TQBC 1JMZA 1NKRA 3CLFH 4BQ9A 1Q0XL 1HIML 3OPZL 3MLVL 1UCBH 3VFOA 1MAML 5ISZD 3SKMA 2SEBB 3GSRA 4ZUVA 3WFHA 4ODVH 2WP3T 3V5DB 2XG5A 1EUUA 2R0KH 5ELIA 4JGMA 5CCKH 3VXSE 4KK8D 4GAJL 4I3SH 4LCYB 5DLML 5LVEA 1UQSA 4M00A 3ARRA 4UOW1 5TQ0L 2DQUH 3DTXA 15C8H 3HUJB 3IXTA 1ZVHA 2QEJA 1DDHA 1UGNA 1A6VL 5I8OH 1OTUC 1PG7H 3IKCB 1R0AH 2R23B 5F72S 5I1GH 1C5DA 5D93C 3B9EA 2FLRT 2VLKA 1VPOL 5D2NE 5DJDA 1I7TA 5D1ZC 1X4XA 2ZUUA 2VZSA 1WSST 1IKFL 2FIKA 5DRWA 3BSZH 5GISH 5IVZA 1T03L 1PY4A 2XOTA 4LDLB 4LIQL 5E8OB 4AH2A 3VFUB 2ED8A 3VCLA 3RJDA 3BXNB 4X7TA 3BZ4A 5JHDB 2FGZA 4YDVA 4KPHL 1CT8B 2V2XA 3O41B 5IP4A 4PGZA 3T4AB 3BPNB 3GKWL 4LBEA 2VLME 1PZ5A 3I2CH 4M61A 4XNXH 4PJBF 4XP1H 4M8QB 1EH9A 5HYFA 4FQPA 1B2WH 1RULL 3FTGA 1YY9C 2GW5A 4JQXC 3TPKA 5ACLA 1IC7L 5K9QG 1OAQH 3EO0B 2V2TA 4JG0H 5DUPL 1EHLH 3ECBB 5FKPA 4HC1A 3KJ6H 4R26H 5FA3B 2ADFH 4DW2H 3PWJB 1TJGH 2NZ9D 4S1DC 1WTLA 3P40A 1OSZA 1IQWL 1IKNC 1LHZA 3BHBB 5IVXB 3M1BB 1P4BL 4JPVL 3EJZC 4XMPL 2BVOB 3QCUH 1U95B 1KCSL 4XVJL 1IGMH 3Q5OA 4NDMA 1GHFL 1QNZL 2DIAA 1U36A 4M7LH 3SDAC 1A3RL 4OB5L 1BIHA 1DN2A 1JF5A 3GK8L 3OAZH 4HXAL 1BFVL 3GMPA 5C0IA 2I9TA 1JWMA 1KCRL 3QDJE 1IAKA 4WJ5B 1IL1B 4POZD 3MRDB 1EAJA 3RVVD 5C0BB 1A5FH 3D69A 1R5VB 3QXDA 5DUML 2Y7QB 4HJGB 4QTHA 4U31A 3QRGH 3RZCA 2KPNA 3I6LD 1TTFA 3WKMH 3BVNB 4RMQA 1IGTA 2YWZA 1I4FB 5L2KA 3EOBA 1OW0A 1AGFB 4RX4D 1Z9MA 1KG0A 1F00I 2Z8RA 4FMKA 4G8FB 4IRZL 2WWKT 1TPXB 3HLAB 4MAUL 4JDZA 4MZ3A 5GJTL 1KENL 4PG2A 5DD3L 3W82A 3EOTH 3PDOB 4HIHB 4KFZC 4GLRI 4JFQA 1GGIL 3WBDA 4GBXD 2P8PA 1I1AB 4PJEB 3E1F1 3ZE2E 4UNVA 1MCOH 2J12B 4M7KL 3QDHA 1MWAA 5CEYA 1X6LA 1S8DB 1X5KA 4HULB 1LK3H 4OJFH 5FCSH 1MCNA 4QWWD 4QHUA 3ZE1F 2DQCL 4HK0B 4GMTH 1HWHB 3CZFB 4GJTB 3IFNH 4XNMB 5EZIH 5I1IL 5EBLA 3DWTA 5B8CB 4ENEC 2XA3A 4ELKB 5ANMB 3QEUA 4D3CH 3U7YH 3SE3A 4LSVL 4JPIB 5C07A 5C0AA 3FQUB 3T65B 1GAFH 2ICWI 3FB5B 2HVJB 1ES0A 2VC2L 4HHAA 3DPBA 2FATH 3MYJB 3O3BA 2GY5A 3ULUL 1FG2B 2HT4D 1RZ7L 5ENWA 5LXGH 4X6DE 1JZ8A 5FO9A 5DK0B 4Z7WF 4PG9A 2EXYC 3QEGH 1U3HD 3VXRD 3X12A 1X5ZA 4EXKA 4WTZA 5HGBB 3VH8G 3U2SB 4RDQF 1MSPA 5CP3A 4CVXA 2C5DC 2CO6B 4QYOA 3SCMB 3MFFA 1KYOK 5DHYB 3HRPA 1FIGH 3V8CA 3KXFA 1VESA 1YY8B 4P3CL 3E3QC 1A1NA 3U48A 1HH6B 3SDYL 3GIVA 1J88A 4XP9H 3B9AA 2J7LA 2NR6C 3QDME 1LE9A 3IFOB 1H3PH 1A21A 3L3GA 1X5IA 3L3JB 4YAQA 4KJYA 1KCVH 5DRZB 5F7FA 5KANG 1YECL 3BDXA 3HMXH 5F6HI 1JGVL 3MCLH 2G60L 3GI9H 4D9LH 32C2B 4PBVC 1FFNA 4HS8H 2W0FA 3RDTD 2Z8WC 1JF1B 5D2LE 3QBTB 1J87A 5CLTA 3MZGB 2A83B 5EPMA 3RL2B 4DK6A 3QXAB 1IAII 4B5EA 2WBWB 1I75A 2I26N 1IZKA 1NC4D 2OQJA 2PYFB 3NFSL 1IGFH 1DQJA 1BZ7B 1WBXB 1LP9B 4KI5E 5AZ2H 3LY6A 3EO9L 3QPQC 3T8XA 1J1OL 4OKVA 5KSBB 1I8KB 3AFLA 1DFBL 1JPGB 3OGOE 1I9JH 1W8NA 5FOJA 1UM5H 4NQUA 4M5YH 4TSAH 5FHBL 3BUTA 3VD4A 2CKNA 5FYJE 3AS3A 4L8DB 5AZEH 5KOMC 5IUSA 1MF2H 1J8HA 3MLPA 4V1DB 2BNQE 4YEFA 5IFHH 4TVPE 3BGAA 1ACYH 4KJQD 5EOCL 5JIKA 4U1NB 2CDFB 2UWEB 4MQ7B 3QEQA 4EBQH 2V5TA 3OJ2C 3HMWH 5L8KB 2HMID 2Y06H 2VZOA 4G9DB 5HVWA 3U79A 1ZT7B 1CU4L 4N90E 3WIHL 3BO8B 1T0NA 2LTQC 3L5JA 4Z7OF 3DXAE 3ZKQD 2GFBA 5HI3C 4OIBA 1OW0C 1XCTB 3RVXD 4LAQH 1FNSH 5C2BH 2B1HH 2R1WB 4LCCC 3QQ4B 5GGRB 2PYEA 3QO0B 4DK3A 3O2DL 2EYSB 4N8VG 4WFGD 4MA3A 3LPFA 2O26U 3IETB 3ARWA 4PG2C 3FHQA 5LWYL 3QCVL 4J12A 4OTXL 5J56B 2ERJB 2A2QT 1VA9A 4G8IB 2A6JA 1AIFA 4OAWB 4OD2A 4NHCL 3I6GA 1G6RA 1K8DB 2P5EB 4L3EA 4P99A 3STLA 2FEDC 5C2UB 2F74B 4J3SA 1YMMD 2DQTL 1IC1A 2ATKA 4KQ3L 5F8QC 2QSCL 3DJ9A 4Y5VA 5KSAA 4IM8A 1DBKH 1QOKA 3DARA 3CH1A 1FNFA 3HG1A 1JGUH 1QG3A 5GS0H 4XPHH 5LAXB 4AIZB 5DQDH 3MRGB 1SEBB 3B9VA 1L0YA 4X6EA 3W9DA 3ARGB 3MJ9L 5FAAA 4JFPA 5B21A 3SE3C 1TCMA 4Z7WA 1FDLL 5GZOD 3GBNH 4XNZC 1I1YA 2OTUB 1DBJL 3V4UL 3QG7H 4OCXL 4X4ME 4LF3A 1ERNA 4OGZA 4XC1H 2MHAA 4I2XA 4JDTH 1NEZG 2J8UF 4I5BB 1XAUA 3CUPB 3U7WL 4Q9QL 3QXTA 2VDOL 4JGJA 1A7OH 4MJ6B 1VFBA 1J0IA 3QIUA 4M6MH 1BBJB 4HLZG 2NX5A 5FM4A 5JW4N 4BYHA 4YGVB 5JHLH 2FL5A 3M17A 1J1XL 5INCB 4KROD 1GPOL 3N1QC 2AK4B 4X98A 4TPRL 2JIXD 3TC9A 5FYLD 2OK0H 2H6PA 2NY5C 4R2GD 1IGJA 5EIVA 4ODWA 4QRSB 1C7SA 3JWDH 1JRHH 1CVRA 4KKAD 3B6SB 2FECI 4HMEA 2YK1H 3TV3L 1SMOA 3CSYB 1TVBB 2A74B 3CXDL 4PD4K 5KVGH 5HHMB 4F3FB 3UZQA 4U6HB 1HH9B 1K2DB 1WBZA 3T77A 3FRUA 4BQ6A 4CADA 5D7LB 4ZPTB 5BVJA 3IDIA 3EFDL 5CD3B 4YPGA 2B4CH 3ZDYE 5EIQA 3FFDA 2V5RA 3N85H 4H26B 4XAKE 2GSIA 4H5SB 3N1GC 2ZSVA 1R24B 5C0CD 3ARBB 4ELMB 5KVFL 1RFDL 4MXVF 3WNOA 1KEMH 1T0MB 4XZUB 4GS7C 4KI1A 3FFCD 1J18A 3KWWA 1CFTB 1LE5A 1NFDB 3VW3L 1YEFH 2F53D 4I4WB 1EMTH 3N0PB 1IAOB 3TT3H 3BEVB 3BE1L 2ARJA 5E8DH 1KIPB 5E4EC 5SX5H 1FJ1A 5DJXA 3T2PA 3SN6N 1JN6A 4FQQB 1EX0A 1G7PA 5DURD 5F9OL 5MP6L 1QHPA 4ALAH 4J1UB 4CKVX 5E5MA 1SMAA 3QIBD 2AEIT 3MLWH 4KMTL 4OIIH 2R2BB 1SJHB 1LO5A 4PLJD 3O0RH 1A7PL 1EEZB 2A9ML 3CD4A 2NXYB 1PAMA 3EAKA 4Y16A 2X4SA 3PWNA 5JDSB 3HI5L 3LIZL 3BDBA 4QOKD 4PJCB 4PB9H 4HWZA 4U6VH 4IIQA 1IM9B 3WLBA 5KSUB 2CRYA 4JPKH 3GB7A 2L7UA 5ITBL 3HCVA 3OMZA 1ONQB 1E4KC 3LOWA 2CLRA 4FQXA 3QR2A 4JO2L 2C3WA 4M93C 3E2HB 2YPVH 3A67H 3MXWL 4WFFE 4FFVD 2I25N 4Y2DA 5T5NG 3K4AA 1NDGB 5D7SH 1EEYB 3ULSA 4YZFF 2G75A 1KLGA 4HWBA 1DL7L 1NUFA 3DVFA 2C4FU 1JNNL 3HAEH 2DQIL 2DLFL 1QEWB 4IRJD 1FZMA 4MNQD 1MUJB 3VRIA 3RWHA 4Y5VC 4JM4H 5KSAC 1NCBH 1BZ9A 4R7DA 4X6BB 2D7TL 2ATPB 2R0LH 2EH8H 4RIRB 3QUMH 3OXSA 2J8UA 1FYTD 4C4KT 1MIML 1JMXA 4BA8A 1J5OH 1ZHLB 3OKLB 4NUGL 3VG0H 1NMAL 2ICWB 5H35B 5I75C 5D6CB 4X6CE 5FDYA 3EYUL 1U91B 5MEOA 4BSWA 1ZLWK 5DQJA 1S9WA 1A4KB 4LDEB 3SE4A 1SBSH 1MHHA 1HK6A 1QLFB 1OQOA 5F7LB 3TCLB 3QIUC 4FTVA 3GMOB 1G9NC 3R06A 4UILL 1L9NA 3HNTL 5HYJD 4XVTL 3WFBL 3O6LL 1RPQA 2WBJA 5GHWL 1U8KA 5EN2A 5K33A 4IMLA 5FUOL 1NAKH 4WI2A 2MNUA 1J8KA 2XFXA 3S3JA 2MOVA 2R0WH 2DBLH 1A4JA 2OTPA 1W72H 3PJSB 4KTDL 1CQYA 4AEEA 3KYKH 1IAIL 4LLMB 3MJ7A 1I8LA 2EXWC 4YFLI 1OAUH 3VH8B 5JHDD 4J6RH 2BSSA 3BP6A 4GKNA 1A1MA 5A2FA 4R4BB 3SJVE 4NQDE 1S7TA 2GJZA 5ACMA 4HXBL 4RRPG 4X9IA 2ORBL 3EO1B 3VFWB 2AEQL 2OXHA 5IBTL 1R5IB 2VLLB 4FQJH 4JY6A 2JB6B 4GG6F 2UYLB 1CXKA 1DUZA 4KVNL 3Q0HA 4JG1L 4K7PY 4MAYA 5A1AA 1R3IL 2HJKA 3WO4C 5D96C 5ID0A 4PRHE 4PRNB 4LNRB 5DHXB 1MFBH 1LILA 1ZHKA 4UV7L 5DD1L 4HLJA 5FHAL 1IFHH 4GW5A 1FGNL 2EDWA 5H37H 3TA3B 1QSEE 1EJOH 4GKZA 5ESVB 2ICES 2NNAB 3RVUD 4PPTA 1RIHL 3C60A 1JNHA 3FQWB 3FQNA 3S5LG 4IHOA 4ZAKA 4UNTA 4Y16C 3WUZA 1S9VB 2AV1B 2YBRB 1NGXB 4X7DC 2HJFA 1AY1L 4GFTB 5HVGB 3OKNB 1YJDC 2AABL 4HKBB 4LPWA 3BFOA 5C0BD 2M2DA 4IIQC 4HKXA 1IT9H 1U3YA 4WY7H 4HDIA 4ZYKA 1IEBB 5ISZA 4ZNEA 4XP5H 4O2FB 2HN7B 1NBYB 2NY7L 2DQJL 3C8HA 4DN3L 3L95A 1Y6NR 4JJ5B 5ICZB 3UDWA 3EOAA 1MH5B 3F5WB 2HKHL 3ETBF 4WI5A 5CGTA 1A6ZA 1RURL 3BGMB 4WHYH 1F4WH 3AXLA 1I3GL 4X4YB 5E6IB 4XMLL 4FQCL 2DMCA 2YA1A 3A0OA 5KW9H 5C0FA 1NCCL 5A2IH 5JOPE 1KJVA 3MBEB 2BZDA 4LCIL 1RZIB 5I8CB 3STZA 1RK1A 5F44A 3VXPB 1QA9B 3MV9B 4JLRB 2H45A 3TP4A 4D9QE 2YD7A 4OZGF 5D5MB 2W60A 4D9RE 4Q6IA 2VWEE 4XCNB 5EWIL 1I1AD 1VPOH 2ZZUT 4LU5L 4QF1B 4GMSL 1UB6B 5HDOA 4O51A 1OF2B 2HH0L 3PHOB 1PVHA 1T03H 1R3LA 5DJAB 1DP0A 1T6WA 1RY7B 5GGTH 3E3QE 5INDA 1QFUL 3VFRB 5I1AB 1Y18A 1NC2D 1OL0A 2LVCA 4F7TA 1F8TH 5HYSA 1CVSC 4HV8B 4OGXH 3MRHB 3P9MA 4PJ8D 2YD6A 4WUKL 2VABB 3VMOA 3SE4C 4QRRB 3P9WB 2H9GA 1WIOA 3NPSC 4ZUSA 1VKXA 5HHPB 3MYZA 4PJDF 1Q9KB 5HHXH 5FYJH 1MVUB 2ITDB 2B0SH 4H8WH 2C3VB 1EIBA 2LU7A 2WBJC 1KELL 1K4DA 4JO4L 1VFOA 5EOCJ 4TVPH 5GRYA 1LD9A 4V2BA 4QXUL 4LNVA 2VXQL 2XRAH 1HILA 2IFGA 4TOYL 1IQWH 3C08L 2J6EA 1P4BH 3GSNL 4XMPH 2Z93A 3MJ8A 5L0QB 5I1LB 1KCSH 3TNMB 4N68A 1U8HB 1I8LC 1GHFH 2P43B 4YK4B 1L7IH 3D25A 4NRYA 3MRJB 1FNLA 3FN0L 1KCLA 2HLFD 2OL3H 3GK8H 3BP4B 3TT1L 3UBXA 1BFVH 4EIZC 3GSNB 3LN5A 3W39B 4GG6A 4HIXL 3V6OE 1U3ZA 4U1JA 2HAZA 2YUVA 1WZLA 5DUMH 2DS4A 3X3GH 2V2WB 4U6XB 4NO5B 1AHWB 4KY1H 5C0JA 3K3QA 43CAB 4G7YH 4CU7A 4ZSOB 5MI0B 1ED3B 3K81A 4BELD 4MAYC 3EFFB 1AD9B 4WUUB 1UH2A 3ARUA 4K3EL 4UTBH 2WBKA 1EO8H 1HYSC 4MWFB 5L2KE 3KAAA 1H8OA 4RX4A 5E8EB 1BOGB 4F8TA 1Z5LA 3FB8B 5EU7E 2AXFA 1NUGA 4PYGA 4AL8L 4ZFOB 1Q0YL 1C12B 2ZWLT 4WI8A 1BIIB 1G9EA 1BJMA 2P8LA 1FNGB 5BQ7B 1BQHA 3WEXB 1DEEB 1Z2KA 5JW4Q 4OLWH 1KENH 5DD3H 1NKOA 4ZMAT 3C60C 1EUTA 4GBXA 1GGIH 4WW2F 2LABA 5E2VL 4ZAKC 1BM3L 4KC3B 2DQDL 1JZ6A 4DKEH 1MLBB 3T08A 5MENB 1UWXH 1AGDA 3GJFK 3MMEA 2PF6A 2DM4A 3CCHA 3BDYL 4GQ9L 4MA7H 2DQCH 3RTQD 4KMQA 2ZG1A 4G6KL 5FXCH 3UDWC 4B7LA 5SWQB 2DJ4A 5EO0B 4RGNE 2H41A 3MV8D 3TIDA 2XN9D 5EZLA 1FC2D 1XIWD 3LKPB 5K9JL 5C0AE 2OP4L 4NNPL 4OZGA 5DJZB 3ZKXB 5D7JD 5CGYD 3TN0B 4XNYH 4OCYL 4CU8A 3TLRA 2K7PA 2P5WB 1NAML 2UVEA 1ZE3C 2ITCB 1ADQL 3FQRB 3IFLL 2DTSA 3VWJB 4KJPD 3U46B 2A6IB 3VXRA 1U3HA 5IW6B 4FXGB 1F4YL 4QT5A 4UBDD 4YX2H 4Q6IC 4JB9L 2IPTL 4YHPA 4IDJL 1NAMB 4TN9A 4XAWL 4MQXD 3LRHA 3UEZA 2ZUXA 4UT6H 4PJBE 2RFXB 1U8NB 4Y8AA 1YYMH 4FZEL 2BOCA 1F2QA 2R2CA 3KXFE 2XNAB 4P2OD 4RFOL 4F15C 1HSBB 1EEQA 2O5ZH 1P7HL 1TQCC 2DI8A 4OBSA 1MFCL 5FO8B 3RWDA 2FO4B 3RGHA 3LKQA 1T83A 3VXSB 2G60H 1G7LB 5EO1A 3RDTA 4PIRF 3ROOB 5ADPL 4JEGB 3PIQA 1I7UA 5DGQA 1HE7A 1NC4A 4QHMB 2GTZA 1OSPH 3X13A 2FHCA 3MRPB 5KS9F 2VDLL 3SDXA 2NZ9C 35C8H 1H0DA 1KLUA 2VN7A 3V6BR 3D5OF 1RIVL 3VFGL 3E8UL 1IEAA 1J1OH 1HDMB 3HC0B 2GK0B 2QQLH 5D2NB 2X5PA 5KN5B 2AK4D 3WN5A 3JTTA 4PJHF 5FHBH 5ITFA 1J0YA 1KEGH 5CIPB 5EU5A 3VG9B 4EXPX 2B1AH 3BKYH 3TYFB 4OLUL 3QWOB 3V4VH 2OTWA 3HAEB 3RVVC 1QPPA 3CFEB 4E0RA 3C2AH 1M6OA 5HHMD 3V0WH 3QEQE 3ZTJH 2QR0B 3NGBB 1TZGL 3PGCB 5D7LD 9CGTA 3NCYS 5KAQG 1WZ1L 2ZOKA 3LEXB 4L9DA 4P9HH 3QUMB 3K4DA 4KK9D 5AYUL 1LNUB 5TQ2H 3G5ZA 3CC5B 2W0LA 3S88H 4WTXA 4K3DL 1T20B 4GSDL 4NQVB 4WVRA 4UB0L 1N6VA 3O6MH 3HZYA 3PP3K 6FABL 3T2NL 2Y6SD 3PWUA 3GSUB 2PYEE 2VR4A 4XTRC 1K4CB 1NFIA 5LWYH 3BEWB 3ZE1E 1YQVL 4GBXC 3WNLA 2NY6B 2HKFL 2YN3A 3T0VA 2JCCA 2X40A 5F9AC 2E7MA 1J0HA 5TFSL 1J7VR 1YMMA 5DS8B 4RGNB 4L3EE 2DMBA 3G5VA 4WDIB 4Y5XA 4L8SA 1R3HA 2KDGA 2R1XB 3QDJB 3G6DL 3RKDD 2QSCH 2VQ1A 1RK0A 4HKJA 1ZGLM 3F58L 3HG1E 4KGLA 3U6RB 3JXAA 1REIA 3O3EA 3CFBB 3KPNA 4ZFZA 3DVGA 1ZOXA 3ULVF 5D1QB 1DSFL 3LDBC 4Z7WE 1FDLH 3BP5B 5DJ6B 4ZFGL 2Q6WA 1FO0A 4U1MB 4XVUD 4HK3N 1PX4A 3D0LA 5FK9B 5DEFA 3DMMB 3S5LB 1LO2L 2HT4C 5T33L 4YWGL 3O11A 3WFCL 3L9RA 3BJ91 3EOYG 3OKOB 4B41A 1U3HC 1U58B 5HGHA 4Q9QH 4F9LA 5TJWK 2VDOH 3DX7B 3O45B 4FN0A 2BNRB 2Z31B 1CDGA 4H25B 1ZLSL 5DVLA 5HYEA 1B0WA 1KJ2A 3PHQB 1F6AB 1BVLB 1XH3B 3O6FB 2B20A 3FONA 4KHXL 5BZDA 3L3KA 2JIXA 4RGOL 2L4OA 4PJ9D 4I48B 3VFVA 2E9WA 4DGYH 2P24B 3VRLF 3NA9H 3RPIB 1UKTA 3S97C 3CVHL 2FHFA 3HZVA 1K8IB 3WS3B 2PW1A 4L3AA 2Q8BH 3DX8B 3TV3H 1T83C 3CXDH 1IM3B 4PRBB 4YQXL 1MRDH 5FM8A 4F7MB 3RDTC 1IJ9A 4YLQT 4KRPD 3H9HB 1UA6L 1TMCB 1HXYB 1JZ5A 2VL5A 2IG2L 3EFDH 4RISH 1DN0A 1FFPA 2Q86B 4ZODA 5T1DL 1N6QH 3MX0A 4CN4A 1HHGA 5C0CA 1KGCE 5I1JL 1A3QA 4PJHA 3QHTC 3ILPA 3H9SB 5BS0E 3KPMA 4QCIB 4JZJB 5I1CH 3I75B 4X6DB 4DQOH 3T0WA 3BISA 4Q2ZA 4F7PB 1RZKH 3MRMB 3FFCA 4JM2B 2VLJB 1VGKA 3MQIA 3IDGA 3S4SA 1FCGA 2F53A 1BF2A 2RCSL 4E41E 3VFPA 3WN5C 5C7XH 4NNXB 5I8EA 1MCHA 3AU1A 3GSQA 5CJBA 5FV1L 3BP7A 5E94B 3GGWB 1U3JA 4OM1L 4Z7OE 1CFSA 1QSFB 3QDMB 3QIBA 1ZXQA 4X7FC 2C1OB 1UYWL 3WCYA 4YE4L 1DQDL 4G80B 1MFDH 1XF5A 2MJWA 4LEOB 2HLAA 1QR1A 3UXFA 3QH3B 2YKLH 4YO0A 4DN4L 2A9MH 4RGMB 1EZVY 3RWCA 4ODSL 1NLBH 4QOKA 3QUXB 4OLVL 4PB0H 5D2LB 3GNML 3HI5H 3W11D 4EKXA 1NMCB 3RVXC 5E4IA 1ZTXH 2HFEA 5IEKA 5SWSD 3BH8A 3ARED 5DVKA 4PJAA 3IU3B 3NA4A 3SGJA 1BOYA 2ADJB 3VD3A 3FO0H 4HUNB 4JO2H 1H8SA 3SE9L 4AEIH 3RZWA 4NSKB 4JHWL 5DD5H 4M3JA 5I0ZA 2Z35B 4IRJA 2HVKA 4MNQA 2DICA 4Y5XC 2GT9A 4L8SC 3TA3D 1G7HB 4KJWD 2BNQB 3PGDB 3UP1A 3CDYA 5IMMB 3SGKA 1AXTL 2AW2A 5HTSA 4F7CB 3PV7A 3NFPB 4CVZB 2D7TH 4XNUH 2GEEA 2EECA 1KPVA 5I16A 2OSLA 1U8LA 1FYTA 4MDIA 3VI4F 2J8UE 4ZO6A 4MX7A 2YS4A 1I1RA 3S98A 1FAIL 1KPRA 1GGTA 1YC8A 3AAZB 4QHLB 3RPKA 3OF6D 4U1HA 1BMGA 1JHLL 2WAHA 4Z8FL 5FOBB 1KFAH 3DXAB 8FABB 2OL3B 5E5RB 4J3OC 2NY4D 12E8H 1OP5H 3T2OA 3GMLA 2BHUA 1LK2B 1QLEL 1TZHA 4YHML 4DFIA 1IC4L 3ZL4L 1XGQA 1Q9WA 4LCYA 4F9LC 4EVNA 3TWCH 5K59F 2BNUA 3LQAL 4LRNL 4FTVE 1EDQA 1QO3A 3OX8B 4YIQA 1BEYH 5CSZA 1LEKB 5HYJA 2CKBH 3HNTH 2AQ3A 3VGDA 2QQNH 5J9PB 3P77B 4KROC 3RA7L 5T3ZD 5FUOH 4R2GC 2BRRL 1PBYA 4HZAA 2FGWH 4JANB 1OGAE 2AJ3B 2EE9A 4OSUH 3E0GA 4KKAC 2VZTA 4NBXB 5IB3B 1X7QA 2M8XA 2UZIH 3QZWA 5FGBA 3SKNB 2ZOLA 5GJSL 1D6EB 3C5ZD 2JJVA 3SDDB 4UIKH 4CAGA 3SGDH 1CFBA 2R0ZH 2X70B 4WGVB 1N4XH 5E2WL 4MXVE 3D9AL 5D7IF 4G8GE 1KYOJ 5JHDA 5IHLB 1EJ6A 3WE6B 5I1KL 5HD8D 1PX3A 3VGFA 2YA2A 3DNKA 2XKSA 1T1YA 1PD6A 4C59B 4XBGB 1LO0L 2CPCA 4NZRL 5I76B 5I9QC 1U92B 3QULA 2VH5L 5EUKB 2OR9L 3KPQB 4U0RC 5IESH 1I1CA 2D31A 5F9JA 5IW1B 4PP1D 3CMOL 3QIWD 2MTPA 5L6YL 3D85B 1A9EB 3O4LE 4IJ3B 1TXKA 2M1KA 4Z7UF 1D6VL 4M48L 4KVNH 3D18A 5E6ZA 1CK0L 4K71B 4WU7B 2GUOB 4Y2OA 4LLDB 3BHBA 4DUVA 3WD5H 3M1BA 5J1AA 3TIEA 3V7MA 1X5JA 1VSCA 2ADGB 5FHAH 4YHKL 1Q8MA 1JGEA 1FGNH 1LO3H 1Z9SA 4MLSA 3QIBC 5IJKA 3F7RA 4BKLA 1IGYA 4WENB 5D70L 5JORB 3HE6D 2R2HA 1AXSB 4JFYA 4WJ5A 4XPAL 3ELAT 1IL1A 1AD0B 3UO1L 4FNLL 4HT1L 5C0BA 4ORGB 2YD9A 5CJ8A 5C0EA 5F89B 4PFEA 4HJGA 5I15H 1QSVA 4YZFE 4HS3B 5ISZE 4ZNEE 5DSCB 3MPCA 5GS0D 1T2QL 4BJLA 1W0YT 1DQLH 1KB9J 4FFVC 1ZVYA 3WUWG 1I4FA 3HI1B 4PREB 2YMXL 5FKAA 4R97B 1NUNB 3IXAA 4ZXBD 3D2UB 1ZVSA 1X5XA 4G8FA 4HFWA 7CGTA 3ME0A 4J3VA 4IRJC 4LVHC 5L8JB 5AWNL 3HS0B 4KXZH 1WAAF 1RMFH 2MCPH 1FN4A 1CE6B 2AXGB 5DVOA 1ZAGA 1BLNA 4GW1B 4IOIB 1I8MB 3SBWA 5GZND 3DUUA 1I1AA 1DE4A 2DLEA 4G5ZL 4FQ1H 2W65B 1G1CA 5CP7B 1DQTA 4NN7C 1S8DA 2VMFA 3MO1B 3OKDB 1TENA 2JELL 4MD4B 4RAVB 2VXTL 2BK8A 3HR6A 2VXSH 3QHZL 1NC2A 1TQBB 3PE9A 2NTFB 5E9DE 5EBWB 3JWOH 4LLWB 1FC1A 5ANMA 4PJ8A 3QPXL 4R3SB 4M1GH 4LSPL 5JMOC 1ZS8A 2R15A 2PXYD 1A7RH 4DKAA 3FQUA 1T1XA 4I3RH 4UQ2A 4H0IA 1O5DT 4HD9A 3RNQA 3NVQA 1N5YH 3MYJA 2B2XL 1F02I 1NDMA 4G8EA 3MLYH 4IMKA 2P5WD 1M7DB 4FMFA 4CMHB 3E6HB 1EERB 2DMKA 1WJ3A 5EU6E 1P1ZB 3MREB 1RZFL 2CLVA 1VFAB 2J88L 4K55A 3WO3B 5FGBC 2ENYA 5JW4R 3M8OL 5D93B 3ROLA 2D2OA 4HLZH 1YEJH 2ZNWA 2RBLA 4PBWD 2HFFB 5D1ZB 4HCRH 3BW9B 3K8KA 3RL1A 4AENB 4PJ7B 5F7DB 4UU9B 3MUZ1 4K9EC 4ONHB 3IFOA 4LPXA 1XCQB 5LGHH 1INEH 2WSKA 4PJGF 4Z7UA 2HYMA 5DRZA 1BGXH 4GG6E 3OXRB 4OF6A 4L9LA 5KVDH 4X6CB 5T1LB 32C2A 3V5KB 5GS2H 3VXSD 3DSNA 2EIBA 2RHEA 4PD4J 4JO3L 3IJYA 2EE2A 1GIGL 2DDQL 3QXAA 3MA9H 3MJGX 2G2RB 3I6LE 1T7WA 1W0VB 4PJFF 2PYFA 4OCSH 1BZ7A 4PRAB 4G6AC 3QDAA 2CK0L 4ZPVA 5DDHA 3GBLA 1WBXA 1LP9A 3AUVA 1X5LA 4WU5A 4NC1C 3QUYD 1U8OA 5C09D 5DRNB 2WLZA 1RZGB 2C4XA 2VDKH 3ZYIA 5ERWA 4UT7L 3DBXB 4PJXA 1A2YB 3GMNA 3BPCB 4OCWL 3QUZD 3RVUC 5IB5A 5IGXL 5IJKC 3QXUA 2AKRA 5DMJB 4Q0XH 4L8DA 3C6SB 1FPTL 3MCKA 1MEXL 3HNSL 3OAYK 3BZFA 3HHRB 3P9LA 4LQFH 2X89D 1S7XA 4C58B 1S7SB 5L9DL 1SBBA 4U1NA 1U8IB 3F62A 2FIRT 2UWEA 4ODHH 4XXDB 1B90A 4AG4L 2FYYB 3RTQA 2VLMD 3SJVB 4J3TA 4NQDB 3BDYH 3NCYP 2OZ4L 2OMNA 1MHPH 3UTZA 1KTLA 5F7HA 4Q74A 3ZHLA 2AK1L 4M6NH 4U7KA 5F3HB 2VTFA 3MV8A 4JFZL 2XN9A 1P69B 4OZ4A 5K9JH 1A14L 2RB8A 4OZGE 5D7JA 5GGRA 3SHSA 4ACPA 3JTSB 3QO0A 2YD8A 4OCLC 3VU2A 2R39A 3T3PF 4PRHB 1P5VA 2BDNH 4U1IB 4NO3B 2OJZL 2LFGA 1OM3H 3IETA 1KIRA 5T5FL 1ADQH 1RUKH 2EDRA 3L5WA 1FLRL 3RWJB 1T89A 3VXRE 2Z92B 3EJYD 4HKZA 4G8IA 4P23B 3SBWC 3BRGC 4OAWA 1F4YH 3GSWA 1QSEB 1I1AC 3C5SA 4RZCB 4YBLB 3TBTA 3GHBL 1IEHA 1I3VA 2IPTH 4JB9H 4JHBA 2I9LB 4IDJH 4QXTB 2F74A 4WFHD 4Z7VF 4XAWH 1J0ZA 5HHVL 3G6JF 2PR4H 1H3WM 3T09A 5IB2A 1C7TA 4XHJD 4P2OA 1MPAL 1AO7D 1TETL 1B4JH 4PJDE 5B8CC 3MRGA 1XGRB 4HEME 1SEBA 4HFUH 4PJ8C 1HHKA 5I18L 3ARGA 3S37X 1PEZA 3VFOB 3SKMB 3TH4T 3GSRB 4ZUVB 3IB4A 3WFHB 5IG7A 3M45A 4Z95L 1ORSA 1RUMH 4NQEE 4JN2B 2X42A 4IMKC 3TBSA 2X4OA 3WLWD 4NKOA 4OT1H 2VDNL 3RUGA 1EO7A 1VGEH 2GJ6D 5E7FA 1MVFA 5DF0A 3IXTB 2VDLH 3K2UL 5DGRA 1V05A 1DDHB 1YN6A 5HVFB 2X4UA 3L3IA 5BO1L 4HIEB 4JREC 1T1ZA 3O6FD 1C5DB 1RIVH 4LHUG 3SPVA 1Q94A 4RWYH 2AK4A 1YEDA 5DJDB 1I7TB 4KZDH 1G7JA 1QTYT 2J4WL 4F57L 2XKNB 2C3XA 2HLFC 4N0CD 1CTNA 4NQCE 4QRSA 4R4FH 2NW2A 5IVZB 1RJZA 3RI5F 4Z78A 1EV2E 5T3XE 4AH2B 4L9LC 3EUUA 3VCLB 4D0CA 4X7TB 4YDVB 1HH9A 2Q7YA 2V2XB 1MCJA 4LBEB 5D7LA 1PZ5B 4M61B 3DVNA 1E4XH 3H3BC 4JZNB 2C9AA 4HC1L 4H5SA 4KGJA 1KACB 4XP6L 5JIPA 1EK3A 3FTGB 1DBAL 2X4TA 4PJ5D 1BP3B 4WFEE 2EZ0D 2V2TB 3QJHA 2C4FT 2APBA 3EDEA 4UB0H 5FKPB 1CGUA 4WFGE 1KC5L 2V17H 4N5ED 3TO4B 1OSZB 3GSVA 3IRZA 1H5BA 5F3BA 4TUJA 1CLZL 4RMWA 1OY3B 5IVNA 4FQQA 4O5LH 4YBQC 5TFSH 1MCFA 1YMME 4NKIL 3GMPB 3QDMD 5C0IB 4NRXA 1JWMB 1KULA 3O9WD 3RTQC 2R2BA 1EEZA 4QTIL 3HPJB 3D69B 3QXDB 4JFED 5L7XL 2EIZA 4ETYA 4LSSH 3RZCB 1X5FA 1DJSA 2BOBA 2ZCKH 1OWWA 3QHFL 4DGIH 2IAND 4JKPH 5CGYC 2LTQB 4AY0A 1IGTB 2QTEA 2VYRE 5L2KB 1MCKA 3V6ZA 4KI5D 3BH9A 5EDXA 4KJPC 1BHGA 5T33H 1Q1JL 2AJUL 4XPFL 1T89C 1EEYA 2ERJC 4D0BA 4UBDC 2FCBA 4YHOH 4O02L 3IJHB 4ONFH 1MWAL 2FX9L 1UM4L 4JDZB 1QFWI 4MQXC 3D3VE 1QEWA 5FYJD 4JFQB 4JVUA 2L0DA 1ZHBA 2P8PB 4TVPD 4PJ9A 3T4YA 1EAPA 1DQQA 1MWAB 4P2OC 5CEYB 1XGYH 1NUDA 4POYA 4U1SA 3TBYA 2VSDA 4HZLB 3QYCA 3GSXB 1QBML 2CIIA 4QHUB 3ARGC 3CFJA 2DIBA 5F7NC 1QVOA 2FJFA 4N90D 4WGWB 5EBLB 1PEWA 4YQXH 4K7PX 2BXYA 4ZO9A 5IHZA 2EDJA 3QEUB 5AAMA 3DXAD 1DANT 1CZ8H 3I85A 1B0RB 1CXLA 4XNZB 5C07B 5C0AB 1U91A 2IG2H 2G5RA 3ZT5A 1MFAH 5FGCE 1SJVA 3QEHA 1ES0B 4HHAB 2VITA 5C0CE 1MJUL 5GSRB 3ARFD 4LDOB 2XIDA 3O3BB 4PJHE 4RQQA 5ENWB 3MLRH 5FO9B 3RX7A 1R5WA 4PG9B 3UTSE 2NY5L 3WXWH 2F53E 4CVXB 3S37L 5CWSB 4QYOB 1JGDA 1V7ML 3MFFB 1UXSA 4PJBB 3T0XA 2HJLA 4NKDA 3PJSA 1WCQA 3KXFB 2A73B 2QHRL 1NBVH 1A1NB 4R0LB 3EDFA 3GIVB 3SDDD 4RMRA 1LE9B 3NTCH 1DLFL 3C6LD 1ZLWH 3UPAA 4YAQB 4KJYB 4YE4H 1OB1A 2VZ1A 1SYSA 1CF8L 3FJTA 4DN4H 4NWTL 2W0FB 4QOKE 5EPMB 4M43L 4ZTPL 5SWSA 3AREA 1NGPH 5DJ2B 2WLYA 4W6WB 5I74C 1OPGH 1QFOA 1DQJB 4X0KA 1CL7I 2IPKA 3H0TB 1SY6H 3S35X 2JB6A 2UYLA 1JZ7A 1CLOL 2XG4A 4GS7B 1N0XH 3T8XB 3ES6A 3LS4L 4LNRA 4PGBB 3T04D 1ZT1A 3DX9A 4IRSD 4Q58C 2JE8A 1F90L 1YEKL 3AB0B 3KGRA 3TA3A 3ULVE 2QADB 4MNQE 5ESVA 1J8HB 2GK2A 5E4EB 1KT2A 3WHXA 1E4WL 2XQBL 4YXKH 4UDTA 2NY0B 2E27H 1A6PA 3QEQB 3OZ9L 1S9VA 2AV1A 2YBRA 4Y5YB 4LSUL 1FYTE 4HJJL 1HZHH 4NOFA 1W0WA 4HK3J 4LPYA 4P5MB 4UINH 3UCRA 3OF6A 3IVKA 4DVBB 1NCWH 4XAKD 4XVUC 1T0NB 5C0GA 3KLDA 2GFBB 4CVWA 3E2HC 3F5WA 3LD8B 3X11A 3ABZA 1HQRA 3BGMA 1CLYH 3HMXA 2PYEB 2VR5A 1G6RL 3FQXA 4MA3B 3VRLE 3M07A 1RJYA 4Y7MA 2IQ9H 4LRNH 4PGEA 5HYJE 1TJIH 1FV1A 4XPBL 1RZIA 5DJYA 2A6JB 5HPOA 1AIFB 4OD2B 4PJ9C 5CJOH 4O4YL 4JLRA 4ERSH 3I6GB 4UTAL 4L3EB 3STLB 3OBAA 5I19L 4XCNA 2ATKB 4PY7B 3W9EB 1YEEH 4GAGL 4Y5VB 3OB0H 5KSAB 1UB6A 4YC2B 1OF2A 4FFZH 3C5ZA 5E99L 3CH1B 3QQ3A 1F45A 2WUCH 1HQ4A 3HG1B 4XCCL 5GJSH 3FN3A 4X6EB 3W9DB 3VFRA 2W9EH 2XPGB 3D9AH 4JFDD 2JJTA 4Z7WB 1YEGL 3BIAX 1I1YB 3VXMD 3THMH 2EDLA 5I1KH 3FO2A 2DQHH 2D7QA 5BZWA 1MJJA 3ZYZA 4TSBL 5HYIA 3O6KH 1IQDA 3D6GA 1KJMA 1G9NL 1K5NA 4I2XB 4YHZL 3MLXL 4WFFD 4L29A 2VH5H 3QIWA 5EOQH 5GGUB 2D0GA 1VFBB 3QIUB 1L9MA 4X7SH 3UBXG 2Y23A 1MCPL 4XI5D 5DJCA 1OAZH 3H3KA 4RA0C 2FL5B 1B3JA 5ESQA 2X4QA 1QKZL 5JW3H 2NW3A 1JPFA 1PG7W 1KJ3H 4LLUB 5IBUG 2XZAL 1S78D 4JRWA 3S34L 5LBSL 4X9BA 3MRJA 3GBMH 5A43C 1XF4B 3HE6A 3BP4A 3O8XD 3PABA 3IDJB 3DYMA 5HPMA 3MBXL 2BVPA 1WBZB 3T77B 3TM6A 3UO1H 4MA8L 4LL9A 3FRUB 3UBXI 1MIEL 4HT1H 4CADB 5BVJB 5T1LD 1S7VA 1OAKL 3FAWA 4M62L 3RGVD 4YPGB 4NO5A 4WCYL 3ZZ1A 1A6UL 4XT1C 3AREC 2ZUTA 2GSIB 4HX1A 4PLKD 5FYJU 2ZSVB 4OV5A 4XWGL 5EO9A 5BS0B 1JPSL 4GXUM 3EFFA 3WYRA 3O81A 3P0YL 5A2KH 4ZXBA 3KPRE 1MHEB 1YC7A 3KWWB 1WZKA 4HIJA 4CJ0A 2AVGA 4E41B 5D96B 3TA3C 3VI4E 2ZUSA 4KJWC 5AWNH 1T3FA 4GAYA 4RFNC 2DLTA 4G6FB 5DJXB 1JN6B 5CEZH 2VDQH 2VDML 5E5MB 1YJDL 3PF2A 4X4ZA 3D87B 1D5MA 1LO5B 1XF3A 5FYKH 2FDBP 3MACL 3U0PA 2JELH 2VXTH 2X4SB 5K59E 3C8DA 4NQDD 3PWNB 4P5KA 3MODL 1PKQA 2CUIA 4IIQB 2NY4C 2DI7A 4BM7A 1QBLL 2ARJQ 3ZSSA 3QPXH 1QFWL 2PXYA 1TFHA 3HCVB 4XX1E 3G9AB 3LKPA 3ZMRA 2XY1A 4FQXB 4JCMA 2CRZA 5J7CC 3C9NB 1EVTC 4X9FA 4PRHD 4OZHA 1E6OH 4Y2DB 2P5WA 2YPLD 3OSKA 4KV5F 4PV8A 3IGAA 1KLGB 5E7BA 4FQHB 5T3XH 3PL6D 2W0PA 4P23D 5CKAA 3OG4B 2CDEB 1FZMB 1QSED 5D7IE 5BMFH 2XZCH 3MRLA 3GJFH 4JVWA 2J88H 3VRIB 3RWHB 3MGTA 2RAMA 3X17A 3BPOB 2CR6A 3K0WA 2RFXA 5B38G 3M8OH 1UG9A 3S7GA 1S9XB 3OXSB 4JFOA 2J8UB 3RVWD 2VB5A 2JJTC 1EFQA 5HD8C 1X3DA 25C8L 3KPSD 5C9JA 3T3MF 1CR9L 5F7MC 4Z7UE 2OCFD 1C1EL 4UV4H 3U1SL 1TNNA 4Y4HB 2BRQA 3VXSA 2AJVL 4TSCL 5MEOB 4AT6A 4OZIF 3JVGA 5DJ0B 5DQJB 1ZT4A 4JO3H 4PP1C 3QIWC 1S9WB 4JHAH 4QHMA 1MHHB 5HGDA 2DJSA 5HDLA 3MRPA 1KCKA 4FTVB 3IJSA 4JFXA 3R06B 3RU8H 1OAYH 2APWA 2CK0H 2VUYA 5I17A 1I3RB 2WBJB 1N64H 1U8KB 2E6QA 4LKXA 3KYMA 1EFXD 1Z9OA 3QUYA 5CJQH 5EN2B 5C09A 4DKFH 3DVIA 5FO7A 4IMLB 4K94H 4R4ND 4D9RD 5C6PB 1A3LH 1URLA 2XFXB 3QUZA 1KIQA 5D9SA 4OUOA 1A4JB 3VGAB 5IGXH 5IR1A 1EGJL 4CN1A 3HE6C 4P0DA 1YNLL 2X89A 5F7EL 3A6OA 4MYWB 2W9LA 1JGLL 3HAEA 2R69L 1UFUA 5L9DH 4G8GB 2IFFL 1BQUA 1CL7L 4G7VH 4PRPE 3KVQA 2BSSB 3S96B 3BP6B 4GKNB 1A1MB 3PGCA 1MY7A 3LHPL 3RWGB 4MSWB 5AEAA 3TVMB 5GS0C 3O3AA 5J89A 5MI0C 1ZGLP 3QUMA 3L5XL 4LASH 3KPPA 4C56D 2KUTA 4KU1A 4LMQI 1BFTA 4KUCF 1WAAE 2LE9A 1K9TA 1T20A 4N8PA 3UTQA 3WJLA 4BZ1L 2XN9E 2WUBL 1I85C 1FBIH 4JY6B 2JLLA 3LB6D 1DUZB