2DRUA

Crystal structure and binding properties of the cd2 and cd244 (2b4) binding protein, cd48
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
180
structure length
180
Chain Sequence
FQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYEMVSKPMIYWECSNATLTCEVLEGTDVELKLYQGKEHLRSLRQKTMSYQWTNLRAPFKCKAVNRVSQESEMEVVNCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords chimera of CD48 antigen and T-cell surface antigen CD2
publication title Crystal Structure and Binding Properties of the CD2 and CD244 (2B4)-binding Protein, CD48
pubmed doi rcsb
source organism Rattus norvegicus
total genus 38
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2006-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2druA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2druA02
4MNQE 1MCJA 1D5XB 4AEHL 3KYOB 1VSCA 4N0FA 1AR2A 1TQCC 3NFPA 5MERA 2IAMD 5GZND 2H3NA 3ZE1F 2DLFL 4HCRA 4HKZB 5C0ND 5JOEA 5SX4I 2Y06H 5BRZB 4P2YA 5GJSH 5JW4M 4JZJA 3VFNB 2AERT 4OFVA 3BN9C 1WBXB 5I1LA 1Q38A 5EPMB 2DKUA 2KUTA 3UBXA 3OBAA 1U8MB 4F7PA 1CFTB 1P7QB 2XZAH 5LGKA 3C6SB 3VH8B 3PDDA 1I9RL 3MRRB 5DHVB 3HI5H 2BNRB 1ITBB 4NJ9L 1KLUA 2YC1A 3H42L 3UTQB 2NY0D 1X6NA 2A1WL 1VFOA 25C8H 2DAVA 4HUVB 4PS4L 3C09B 1BZ7B 1YPZE 3TM6A 3EZ8A 3UTTE 4HK0B 5HXMA 3WEXB 3QO0B 3QUZC 4LMQE 3U4EB 3C5SB 2GY7B 3WIFA 4XNZC 2O5ZL 1VFBA 4POUB 2AV7A 1H3WM 1XF3B 4WCYL 5FYKD 1ZOXA 5B38G 5GGVL 4QEGA 3WLWC 5CBEA 2NCMA 4BQ6A 1Q94A 5FOBB 5EU7C 1ZGLM 4PREA 5EIIA 1BIHA 2HFGH 5A43C 2R0ZL 4JY4B 4U1KB 4M6OL 5AG9A 4JM2A 3RGVA 3O45A 4R7DB 2AK4D 2F54E 3OHXA 1VPOL 5I17B 3TWCL 1W8OA 2NYYD 5T3XD 5CEXB 3TV3L 3VD3A 1OLLA 3P77A 1F3JA 3WNPA 5CGYC 4H1LA 4GXUM 5DUML 1LNUA 3QG6B 4PRPE 1WZ1H 4L8CB 4BFEA 1BAFH 3IAQA 3NA9L 1CE6A 2DD8L 4KMTH 1IKFH 3PV7A 3T2NH 1FFPB 1RZKH 1FZOB 5F88A 2R4RH 1IQWL 2P5EB 3WFDL 3KPSD 2YD5A 1U8OA 3WMSA 2HFFB 2R23A 1A7RH 1EHNA 1SYSA 5EN2A 5FECB 3GMLA 2I9LA 2YA2A 3LKQB 1GVIA 1XGTB 2NY5C 3LS5L 4K23H 3W5MA 5EBLB 4YHPA 5E2WL 2P8MB 1A6AA 1MFAH 3IRZA 3LQAL 2D7MA 5DS8A 2H8PB 4XXCC 4YHNB 3B5HA 4P9HL 3L5IA 5IWLC 3GMPA 4O5LH 4Q9BA 1G7QB 3MCLL 4JJHA 4GKNA 1N6QH 1V5JA 1Y18A 4GAJH 4Y16B 2ARJA 4LLVB 5D7LE 3W39B 4FFYL 4HFUH 1G7IA 3SKNB 3CSYA 5DD5L 3RL2A 2HLFD 3PWPA 32C2B 2W9DH 3GUTB 3E6FA 4PJEF 4TNVK 2W65A 1FC1A 3W0WA 4JQVC 4JFEE 2YPLB 3OGCB 3I02A 3PWVB 5DGRA 4LIQE 5I6XC 3CH8A 3O3EA 3PL6D 2NY6C 5K9QI 1E4XL 1Q9WB 3KLAA 1KUMA 1QFWI 4LCWE 5F7LB 2DIJA 3QWOB 1NCDH 4ZO8A 4B0MM 3OGOE 5JOPD 4G6FB 4HLZH 4U0QB 2VXSH 5FHAH 1G9MC 2RJMA 2DTSA 5JW4Q 3GKZA 4FQXC 3DVGA 1S9WB 2VXTH 2RHEA 2FX9H 3GO1H 2BNUB 1ACYH 1DQMH 3U0WH 2ZPKL 1Z2KA 3UXFA 3W9DB 2VQUA 4N0CD 4JCLA 3O2DA 3QIUA 5I74B 2VE6A 3RWIB 1DCLA 1NGPL 1QFWH 2LTQB 3RWDA 2NY7H 3HCVB 5DJ0B 4U1GB 43CAB 3WE6B 4DJMA 4YXLH 2C3HA 5KVGL 4PJXF 4L4VE 4U05A 1A4KB 3GK8L 1I7UA 4JFEB 1DBJH 4LLDB 5CUSL 2W0KA 1CD1B 4Y4FD 1YUHA 5I66A 4P57B 4LCWB 4Z18A 4FFVD 4X9FA 5IB3B 1HIMH 1KCUH 1NMCC 5HYJB 5KVEH 3KYKH 4ZS7H 1CXKA 2NY5H 1A6VH 4G6JH 4ORGA 3D69B 3RY6C 1JN6B 4YHYB 1FIEA 2P47B 1QBMH 1JNNH 1FL3B 4LASL 3C5ZC 1HSAA 3G6DL 4ZAKA 4HULB 2Q86B 5BRZD 1MHEB 1YEGH 5J6GA 3TT1L 3MLWH 5I1DB 1KN2H 1T0NA 4YK4C 3WIIL 1JF6A 3OJ2C 2CDEA 3GHEL 5F9AC 4HIXH 3EFFB 1VENA 3MV9E 1EEZB 1P7QD 2QSVA 4GH7B 1DBBH 2WP3T 2IMMA 4GBXB 4Y5YC 2OK0H 1D3CA 4OLYL 2BNRD 3WNLA 1RVFH 5EOQH 4CUCA 5C07D 5IKCB 2F19L 3IVKA 4P46B 3QB7C 4NO0D 1XZ0A 4H25B 1OTTC 1L6XA 5GGTH 5FDYA 5AYUL 3F7PC 4HUUB 1A1OB 4HKJB 3QR2A 1C7SA 4AEEA 1BBJA 3OPZH 1JHTA 4LSSL 2WIIB 5GGVY 4K2UL 1TQBC 3FQRB 4QHMB 2DMCA 4G5ZH 4M4RA 4UTAH 5L2KA 3O2WH 2FO4A 3TBTA 1KB9J 1I75A 4Q74A 5JHDE 2P7TA 4YDVB 2ILLA 3PHQA 4L8BB 3KYNB 2SEBB 3E2HC 4R26H 2FHCA 5DC0A 1MCEA 1ZS8A 2K7PA 2IALA 2EEAA 3MV9B 4F37F 4WJ5B 3MLRH 2JF1A 1CFNA 1ED3B 1HH6A 3QIWD 2ZUSA 3C6LB 3R06A 4QXGL 1MIEL 4MZ3A 5TE6L 4KPHH 1IC4L 4D8PB 3GMRB 3VFWA 1TVHA 1UYWH 2XKNB 5DJ2B 5IV2B 1IJ9A 3BKJH 4PB9H 1OQXA 4QHLA 3NCCB 1MFEL 4JKPH 4WUKH 4XTRC 1TJIL 1DFBH 3OJVC 3T0EE 3QNXB 3ARDB 4HWEL 5IQ9A 2B4CL 2YUVA 4FXGB 4XNMA 5DVLA 3KPRE 3X13A 4GRMA 1HCVA 2P5ED 3EFDL 1F90L 3KPPA 4FQPA 4Z0XB 2M1KA 3VDCA 4FTVA 4ACPA 2GSIA 2B20A 4WEBL 2EH7H 3FB6A 6CGTA 4HS6B 1N3NB 2PNDA 4YUEL 5JHDB 3UTZA 4M8VA 1UH3A 1K8DA 5E2VL 5T3ZH 3U2SA 1K8IB 1LK3L 1N0LA 2VZVA 3NN8A 1HHKB 1JUFB 1PSKH 2NZIA 5FXCH 3I2CL 1FSKC 1KTRL 4CADB 2BFVH 3VWJC 1I8MA 2KKQA 1GZQA 3BQUC 4IRJB 3X3GH 4PJHF 4N8VA 3HC4H 1CDYA 4NQED 4Y16D 1HH9B 5AUMA 5EOCJ 4HX1A 3VXPA 3MO1B 4HMDA 4P4KC 4LEXH 1FZKA 1B0RA 1U8HB 4LKXB 1UXSB 4RGMB 4ZPVB 3T0EB 3ZE2E 3QUYA 1DQLL 1FL5B 4KROB 4HGMA 3T3PE 4CRPA 2YPLD 3GRWA 3FOMB 2APXA 3LKSA 4OCLC 4A2MA 1LP9B 3KPRB 3QDGB 1A5FH 3T1FB 2GKIA 3IJSB 4MSWA 4PLJD 2GUOA 4UUJB 4JN1L 4G7YH 1TVBA 1NLBL 3ARGA 3BYTA 5MENA 2DB8A 3DYOA 4MWFA 3X3FL 4HUNB 5EU5A 3FQNA 4WW1B 4RRPA 4POZD 4QRUB 4WU5B 5IVNA 1U41A 1XF5B 4KJQD 1CBVL 3K2MC 4OFPA 3VRJB 4QO1A 4ZFGL 4DKFH 4CL7A 1CXHA 1QR1A 3S4SG 2X40A 4U6HA 2Z8SA 3FMGH 4NC0B 4L8SC 4WFEE 1EHLH 4ONHB 3TZVB 3DRTB 4J3WA 4OLWH 2YBRA 1FYTE 4G80B 2EE6A 1KIPA 4NIKB 4OZ4A 4YR6A 4Q9RL 1QEWB 3GMNA 1KJMB 1Q1JL 3NABL 4B7IA 4Z7UF 2GTWB 3WN5C 5BVJB 3SBWA 4KC3B 4MDIA 5D7KD 4G8IA 4I3SH 1V7NL 3D2UB 3MOBH 4LCWD 2DQGL 1KOAA 4PY7B 4QHKI 3HZYA 4MAYB 3QI9A 1R3JA 1PGRB 5C2BL 4I4WB 5CEYB 1CR9H 5HYJD 1BZ9A 4OZHE 2MNUA 1GOFA 3MJ9H 3GSWA 1UWGH 5FKAA 2BVOA 5HGGS 2EKJA 1TETH 1B2WL 4GOSA 1FO0A 5F9JB 5HGHB 4L8DB 5DRXB 5MI0C 1PKQE 2YHGA 4JFPB 3QDMB 4LNRB 4PV9B 4PJEA 1K3ZA 2PR4L 5LGHL 5DSCA 1UVQA 3U36A 1FVCA 4AEHH 1L0XA 4X6CE 1F00I 1FYTB 1KIUA 2B7DT 3IDUA 5L8KB 2VRAA 2DBJA 4UZGA 1ES0A 1DQDL 1NAMB 2DLFH 1WFNA 5FO7B 1NBYA 1XH3A 1MCPH 4Q97A 3LQAC 4GBXD 4RDQG 4OB5L 3BRFA 4BSWB 1XT5A 4U1SA 3IKCB 3WSQH 2HA1A 5E94B 2BCKA 4BSJA 4FFWD 3VXMB 2KL6A 3K0WA 3ROLA 3D25A 2DYPD 1CICB 2EXWC 1ZSDA 5EBWB 4OZHB 4XPTL 4OKVA 5CZXC 2L0DA 3EJYC 3U0PA 4XVTH 2HRLA 2AABL 4RIRA 1CDIA 3VMOA 3CPLA 1R5VA 5I76A 1BOGA 3FFDB 4P0DA 2PYFA 1PKQB 3CFBA 4C57C 5E7BA 2IADA 2X4SB 4YDIH 4PJ8B 5D8JL 3CJJA 4LCUA 4PJXA 4Y0GA 4Z76A 4FG6C 3UC0L 1A22B 4U1IB 2O5ZH 2E7BA 3RBSA 3ARYA 3BIKA 2I24N 4DK6A 2NX5B 4K9EH 1LK2A 2FHFA 1CGXA 2V7HA 1KSRA 1AP2B 3QPQD 5GGVH 3K46A 5J3HC 1R0AH 3VFSB 2NZ9C 4O58L 2DQIL 4LAQH 3GEWB 3B9KB 1YY9C 1URLA 4A2LA 2HJKB 3PHOA 2MHAB 4K3DH 4M6OH 3PIQB 3ARDD 3TNNA 4PP1D 5FA3B 5DJZB 5CHNB 4LLAA 5ICZB 4WUUA 3RAJL 3LKRB 5GSRB 2HG5A 5I2IB 3UAJC 3CXHJ 3P11L 1JGDA 4IRZL 2DD8H 3BW9A 1P53A 4TUJB 4NSKA 3T8XA 3OJMB 4UTBH 3AM8C 1IQWH 4HKXA 3WFDH 3QRFM 1AKJB 3SPVA 1OGAD 1SYVA 3BO8A 3D0VA 3LS5H 1ZT1A 4Z7WE 2PN5A 1KCSH 3DV6A 3FT2A 3KJ6H 3ARUA 5F8RC 3SDDB 1WCBA 4IRJD 4OZFA 5E2WH 5FYKL 5FHBL 4AH2B 4OGYH 1R3KB 3FO0L 2CJUL 3BDBA 3L6FA 4UIMA 4P9HH 4YC2B 5EU3A 3JTTA 1MCKA 5J56B 3PDGA 3S35X 3VFOB 4X7TA 3LQZB 3TJHC 4KROD 3BMVA 3PP3K 1JPTH 4JJ5A 4OTXL 1NFIA 3KPRD 3QDGD 4Z0BL 2P44B 4E0RA 2OL3B 5IJKC 1B88A 5DD5H 1LGVA 4KK9C 5SWQA 4LPCA 1JPGA 5T3XL 3H2WA 3JV4A 4CJ0A 3OXRA 3VXUD 5GGQL 4YX2L 2HRPL 1NBZB 1J8HB 4HV8A 2KZWA 43C9B 4QRRD 5JPNA 2E6QA 4GKOA 3Q6FA 2ZG3A 3C8KB 3FQUA 4W6YB 5E0QA 5B38B 2GHWB 5GGRA 3KNBB 4QXUH 3QJFB 1I1AC 3FT3B 1G7HB 3CFCH 3D1MC 3WO4B 4ERSL 5I1HL 2M2DA 4M48L 3IXAB 1G6VK 5E1AB 5IIEB 5JXEA 3G6JE 4FZEL 1S7UA 5CFHA 5CIPB 2UZIH 3O41B 1XGUB 4Y4HC 2ZPKH 5HD8D 4P2OB 4JG0L 3DOSA 3C8HA 2IANB 5F44A 3RL1A 1JWSA 5ID1B 3OAZK 4F7EA 5D2LF 1UFUA 1REIA 1VGEL 2BOBA 1NGPH 3TCLB 4Q6IA 4BH8B 2YD7A 3D2UD 1IC1A 2OBGA 5LGJA 1JWMA 2HFTA 4IHOA 3UPRB 1I1YB 4KQ3L 4MAYD 4TTDC 2J8OA 4ODUB 3CX2A 5KVGH 3GK8H 5I19L 2R9HD 5CUSH 5CZVL 1FN4B 2AJVL 5H8DA 3I85A 4PJHA 2CKBB 3RNKA 3TNMA 4PR5B 3V7AG 3S3SA 5BVPL 4PD4K 2A6DB 4Y8AA 3SDYL 4ODTL 2B4CC 4DEPC 4QOKE 3QDMD 5IMKB 4OFYA 4P2QE 3IAPA 1FHGA 4XBPB 4QHKJ 4J8RB 3I6GA 3MLZL 2QV2A 2UUDK 5J4MA 4ZXBB 1CI5A 2Q76A 4LASH 2BVTA 5C0AA 2BNQB 2ZJSL 1GOHA 3TT1H 2X9YA 3WIIH 2Q7NA 3GHEH 5JO5A 3P4OA 5FUOL 1GGYA 1JV5A 2R2BA 4FABL 5D7IE 1S5HA 3MNZB 4HIJA 3VXMD 4HDIB 3LAFA 3SKMA 1EEQA 1KIRB 5GXBB 1CICD 1VEPA 3C8DA 3SGEI 5ESVA 5C09B 4OLYH 4QTHB 5HHPA 3QWQB 2GCYB 4C56A 5F7DB 3OAUH 2F19H 4X5XB 1N8ZA 4UNUA 3S3JA 3BGFC 2EXYD 4HUWB 5D2NB 1YNKL 3A67H 3ZKNC 4EI5D 3CDCA 1PX3A 5HHNB 2Y5TB 3CK0H 3TVMA 3HAEG 1IEAA 5AYUH 3K4AA 2W0LA 1MWAA 4QT5B 5D1QA 1FORL 1YMME 2W9LA 4DAGL 4KI5E 2GJZA 1PQZA 3O4LD 2DRUA 3AROA 1CFVL 3ES6A 3HPLB 1DSFL 4NKOB 4LSSH 2ICWI 2NX5D 3FOLA 4K2UH 3KXFD 5JOFA 4PJCE 1BJ1J 5C0EB 5CP3H 1UEYA 1A3RH 3FFCA 3QG7L 4KQ4L 4HT1L 4YHML 4NN5B 5I8KL 3HNSL 4LDEB 1NC2A 4MCYA 4N5UA 5D7IB 3ZHDA 2R69H 5D1XC 2Z4QB 4IMLA 3OQ3B 1W72B 4QXGH 1MIEH 5BJTA 1IC4H 3GM0A 4K3JH 5HGAA 1AI1H 2NNAB 4F7CA 1DQJA 2R0KH 1TJIH 1UH4A 3VI4F 4OIIH 1NGXB 2ATPA 2OQJB 3JWDH 4HWEH 3SJVB 3PABB 2MJWA 4HUMB 5GISL 3RIFK 3V0WH 3L5WA 1MCWW 3AU1A 4B41A 3DI3B 3RVUD 5EH1A 1F90H 1AKJD 2NTFB 2MKWA 4EJ1C 1WFOA 2HAZA 4LBEA 3S35H 3HZMA 4WI3A 5C6WH 1IQDB 3T1WA 4H8WH 5E8EA 3SDDD 4MJ6B 4YUEH 1LMKA 2MSPA 4HG4J 1LK3H 4HJ0D 1X6LA 3G9VA 5DMKA 4LFHG 1GGCL 1ETZB 2EDQA 2VITA 4NUGL 5E00B 3ZT5A 3OR7A 2P5WE 3X14B 1ORSA 3SDXE 4JDZB 1YEFL 1QO3A 4RQQA 3S98A 3BE1L 2VLRD 4P59L 5ESAA 3Q3GB 3DWTA 4OLEA 3U0TA 4X98B 2AQ3A 1DQLH 4KRNA 4OCYH 4WNQB 4RAUA 3P40A 4X0KB 4F7TA 1KEML 3ZL4H 4CMMB 2XG4A 3TIEB 5L88H 5F97E 1J8HD 3FQXB 1IC5L 4F58L 1ZHLB 4W6WB 4QRSA 5DK2A 4J3VA 2WQ8A 1CDCA 3MRMA 1YPZF 1NLBH 1IGFL 4NM8L 2ID5A 4QWWC 3FQWA 5SWSB 4QF1A 1OAZL 4PLOB 3T3ME 1ZHKA 5FYLD 4ODWB 1R24B 4HBCL 3ULVE 2LVCA 4KUCF 5DRNA 5HHOA 4NCC1 3IDGB 1ZWIB 3GMQB 3ARFB 2E9JA 5CSZB 1HN1A 3HC3L 4ZFGH 4R96B 2CDGA 2ZOLA 1YYLH 4XVSH 4P2OD 3VW3L 5KVDL 1EHXA 3SDXB 2IAND 3NPSB 3WNMA 1IKNA 1AO7B 5AZ2L 5DQJB 4KKCC 1DQTA 2AS5M 2DDQL 2Y4SA 2YEZB 4Q9RH 1X5AA 1S7QB 4NRXB 3RDTA 1Q1JH 4N68A 3PQYE 4N9GB 2IAMC 5LXGL 5GZNC 3O6KH 2AJZB 3AS1A 3FCTA 4XX1G 3STBA 3BP7B 5C0NC 1JGEA 5KG9A 2HJLA 5FO8B 4ZSOE 1DN0A 1A9EA 1RK0B 5I1GH 4WO4A 1F6AA 2AJSH 2VUOA 1J87A 1S9YB 3PWNA 4R4ND 2FX7L 4L3CA 5C2BH 5INDB 2ZCLL 1I7ZB 1UB6B 1FFNA 1UH2A 2UYLB 1G7PB 4D9LL 2FZ3A 1YN6A 4GRLA 2VDKH 1OP3H 2D31B 3ARSA 1B2WH 5IR1A 4FQHA 12E8L 2YUXA 3GDBA 2EKSB 3OKDB 5D1QD 1P1ZB 2NY0C 2BNQD 4MJ2A 5KSAA 1DUZB 1WBYA 2EICA 2PR4H 2V2XA 5LGHH 3EO1B 1KGCD 5E8DL 3CZFB 2XTJB 1DANT 4U2YA 5E6IA 3HR5A 2I5YH 3H9SA 1ODAA 1MFBL 1NAKL 4YE4L 2YUZA 1EA9C 3AY4C 3RFZC 3DARA 2BMKA 4DOHB 2EDTA 1QSVA 1KENL 2VABB 4OB5H 1YDPB 5JR1L 4ZSOB 5C09D 4FN0A 4LCCA 3VFPB 3RIFF 1LEGB 3HZVA 3P4MA 5DK0A 3HNTH 4OD2A 3DVFA 3GJEA 1TENA 5D6CB 4XPTH 5CP7A 4OV5B 3F8UB 2DWEB 3ZDYE 1OQOA 3S4SB 5D2LA 3ZHLA 3TBWA 2NYYC 1WT5A 6FABL 2CDFA 1JF1A 1VFAA 4CU6A 1TCRA 1CE1L 2DQUL 2KPNA 3MUGB 5ETUA 3OKLB 3UC0H 2JJTC 4HLZG 3S97C 1V3LA 1T80A 2VNCA 3AXLB 3WDIA 4XWGL 1ZT4A 3TO4B 5I9QB 4C83B 1OD9A 4G42A 3O3DA 1NC4A 1CG9B 1ZLWH 3RWFB 2F9BT 2ICWJ 2VQTA 2DQIH 4P3DA 1OLZA 2RGSA 4FNLH 5IBTL 1AC0A 2DIAA 3TA3D 3QDAA 3SO3B 3QA3B 1NDGB 4IOSD 3O3AA 5EFIA 3N06B 4OLXL 1JBJA 4EDWH 1T1ZA 5DO2D 4KV5E 3BMWA 1K5NA 4NM4L 3SJVD 2VN7A 4XMKL 1KB9K 4WHCA 2LABA 2DQTL 3MQIA 2VLLB 3QDHA 3DPBA 3RAJH 5C0IB 2DOCA 3MRBA 3P11H 1KNOB 3EOAA 1CTNA 1U36A 3CFEA 1CT8A 2HLFC 4IRZH 5GS0L 1DUYA 1JTOA 2NMSA 4AIXA 5DQ9B 1QOKA 4JFDB 4ZUUB 1IM3B 5C0RL 1KTDB 4CN4A 3QDJB 4HJJH 4QTIH 1MLCB 3PL6C 2J4WH 2YXFA 2WIMA 5EA0L 4FFZL 3L3GB 2AXGB 4K3HA 3QNYB 1QLRB 4H20L 4Y1AA 4MLSA 1ZKAA 3KYMA 3MXVL 4NQXB 5FYKH 1BQLL 5IBUG 4JFQB 1U2CA 2CJUH 5ITFA 3CDGA 1IARB 4PJFB 2VN4A 2R29L 5E8PA 5A40E 1X5HA 5EU6E 5EC1A 4WHTA 1C5BL 2BC4A 2VDLL 4YO0B 4Y89A 4N0CC 3Q6GH 3INUL 5F1IA 1YEIL 3DUSB 2ICEA 3LMJL 4OTXH 4L3EE 1BLNB 1HWGB 2HJFB 3LH2L 2Z31B 1IGCL 4XNQB 3WIHL 2A9ML 1FJ1B 5FFLA 1M7XA 3LQMA 1MNUL 3IJHA 4KH2A 5DD3L 2OZ4L 1DBAL 3VFNA 5GGQH 5SWSD 4YX2H 3OKKA 3MUHL 5DJYB 3IFPA 4WWID 4D9RE 3ARFD 2APFA 4Y4FC 2GJ6E 4HC1L 1XF4B 1CFTA 1H0DA 4JHWH 1J0IA 5FYJU 3MLPA 4FFVC 3GNMH 4ERSH 5I1HH 2EYRB 3O9WB 3PGDA 1AO7D 3SGJC 3VXQA 2Y25A 3KPQA 1T1XA 1FIGH 2GFBB 1GC1L 1D6EB 4WU7A 5C9JB 2EDWA 4JG0H 3KGRA 5EU6B 5E8NB 1JMXA 5MHSD 4YPGB 4MNQA 4HK0A 3WEXA 3QO0A 1VGEH 3V9FA 3D39E 5HI3D 4JHAH 5HDOA 2F15A 5JW5A 2FYYB 3EGSB 4KQ3H 4PJBB 1IGYB 3BT2H 2WV3A 1T5WB 2FJHB 5FOBA 4KI1A 3EDEA 4IM8A 5CZVH 4ZYKA 2AJVH 1KJ2B 2X2YA 4ONOA 2ZZUT 2ADGA 2PTUA 4AQ1B 4TNWF 4LP5A 2WBKA 3SDYH 3PDOB 3HE6B 2GJ6B 5C0FB 3MREB 4ODTH 3IDNB 4HXAL 1J0JA 1QFOA 3C09C 2XTJD 3G6AA 4KTDH 3ZYZA 5J1SC 3MLZH 1JVKA 1FH5L 3UBXI 4ZPTB 3TBYB 4PJGE 2ZJSH 1YPZA 1RU9H 3CH1A 3UTTA 1A3LL 5JORB 4RISH 4GKZA 3N0PB 3VXOA 1ZANL 4FABH 1L7IL 3ZE2F 2KQNA 1FAIL 1NGZA 2N56A 4AT6B 2WWKO 1JFQL 3T3PF 1HOCA 3SEPA 2X4QB 3QIWC 4X4XB 1RSFA 4DFHA 4XNXL 4GQ9L 5ACZB 5E9DE 5KVFL 1YNKH 5IHUL 3PG2A 2X89A 3CMOH 2F54A 4CVXB 4FMFA 2HFEB 1AGCB 3OXSB 1NEUA 4XWOC 2P8LA 1FORH 1VADB 4LLVA 4DAGH 5HBBA 3W39A 3SKNA 4KXZI 4I48A 1CFVH 4JZNB 1DSFH 1EVUA 1ZHBA 3WLBB 1HNGA 3A6OA 4PRPA 5AD0B 4LARH 4D3CL 4ODXB 5IMMB 3TO4D 3LPGA 3IGAB 5F71A 3P0YL 3QG7H 3TBSA 5HHMB 4HT1H 5CLWA 3ZTJH 1XGRA 5I8KH 2FEEL 4PG9A 3IRPX 3O3BB 4G9FA 4LLMA 5BO1L 3ZT6A 1IGIL 1YC8A 3GSQB 3MUZ1 1H15B 4YDKL 1JZ5A 4JLRB 1UXWB 3IYLW 1RFDL 2JJVA 1UM4L 4PJDE 1EO7A 3RJQB 2YKLH 4HMCA 4AM0B 4U1MA 4Y16C 4NZRH 4OZHF 5I0DA 1M7IB 3M8OL 3A6CL 2OLDA 2CSPA 4WTXA 1BGXL 5GISH 5B8CC 2YWYA 3GGWA 2X44D 2AK1L 4OF7A 1U93B 5IVXB 1B9ZA 4JFDD 4AQOA 4CW1A 3QUXA 1X5YA 1MLBB 5D7LA 5DJ0A 5FEBA 3QDJD 2MCG1 4H1LH 4XRCB 4PLJC 4O9HL 5IHZB 1E28A 3SY0A 4WEUD 1CQYA 4JFEA 4Q2ZB 4X6CF 4NDMB 2OMNA 1T20B 2AEPH 4TVPL 3DVNA 3CFJB 3G9AB 1XIWA 4X6DB 3CSBA 1GGCH 1BFTA 4NUGH 4POZC 2Y5EA 4KJQC 4RGNE 2AQ1A 1TJGL 3SE9L 1CFSB 1JZ6A 1CXEA 5TH2B 1JN6A 1I8IA 1JRHI 2HKFH 3BPLB 4M1GH 3SDAB 2DWDA 4P2RB 1YEFH 1C7TA 4LK4A 2K7QA 4XHJD 3V4UH 3BE1H 2Z31D 3L3JB 4WFGD 5I74C 5DJAA 4P59H 4GS7B 4MAUH 1V8HA 3GSVB 2LTQC 3HAEB 5DYOB 4U1GC 1AHWA 3N9GL 5I30L 4JO4L 3PWJB 1IAII 3IETB 2AAVA 4DGIL 2Z93A 3WFHA 4C58B 4WI9A 4YEEA 3EFFA 4PJAB 1KJ3L 1IC5H 1KB5A 2OMBA 4F58H 2Q7YA 1I3GL 2BVEA 3HE7B 1OTSD 1SM3L 3EDKA 4GG6E 2EIZA 1UQSB 1K4DB 1FC2D 5EZLB 5KTEL 4I3RL 5D72L 4AZ8A 4GAFB 1OAZH 4L4VA 1JRHH 1FVDA 1P5VA 5H94B 4HBCH 5J1TC 2VDPH 4NKMA 3O9WD 2VH5L 1QACA 3RZWA 3HC3H 4YHYC 2XNAB 4OF5A 4GMSL 4P46A 1VFMA 3T2OA 5B4MD 5KVDH 5HYSA 2E27L 4O2CA 4UNTA 4G9DA 5EU6D 3VFUA 4F57H 2X09A 1IAIH 3L3IA 4ZO9A 2H26B 4WI8A 2X7LA 1KFAL 3DXAE 1S3KL 4HEME 4UDTB 1CXLA 4Q0XL 2DDQH 4XPFL 5KS9E 1S7RA 5LQBL 3HS0A 1TZHB 1MHCB 1P4IL 5IP4A 5KN5B 3SE8L 5I8CA 3IFOB 2ZUYA 5IW1B 5LXGH 4UV7L 1HYSD 3SQBA 1U3ZA 1QRNE 3PF2A 3NA4A 3CU7A 3QXDB 1IEBA 1T5XB 4GBXC 1S9XB 4LGSB 3MV9A 4RFEB 5LAXA 4MJIE 4GG6B 2FX7H 3EBAA 4WJ5A 1ED3A 3HE6D 2X10A 2ZCLH 3HFML 1Y6MR 3C6LA 4FFWC 4XPHL 1FNEB 1YEDA 4UU9B 3OKOB 2Y23A 3MV8E 4D9LH 4CMHB 1G7LB 2EE3A 3GMRA 1GPOL 2ZNXA 4JPVH 5KVMC 5FYLL 2N7AA 1A21A 5F1SA 3RU8L 4Z7WF 1INDL 3RPIB 1ZA3A 3ULUE 2CLRB 3WFCL 4FXLA 4FXGA 2CRMA 1MPAL 5E8DH 3VI3E 1WTLA 3DXAB 4Q9QL 4X8XA 1N5AB 3GBNL 1MFBH 1NAKH 3MLSL 3FB7A 1KXTB 3RQ3A 2Z35A 1AGEB 2R2HB 3JVGC 3HLAB 1FV1B 1N3NA 3HC0B 4MNHA 4G9FD 3TIDB 5JHDA 1A4JA 1AXTH 2IH3A 3QPQC 2A6JB 3DURA 1KENH 1K8IA 3AREA 4X5WA 1HHKA 3GMOB 4U3CA 1OL0A 1X4XA 5JIPA 1F6LL 4M5ZL 5ENWB 3S7GA 2O93L 4MJIB 1D5MB 2ZKHH 4CADA 2VL5A 4LLQA 1UJ3A 4LVOB 3AS3A 4WHYH 1HXMB 5FM5O 4Y5VB 4EIGB 3ARDC 1RUQL 4OLUL 4PP1C 3MO1A 2GYSA 5F72S 4F9LC 6FABH 5CILL 5C0JA 3BZFB 3T0EA 1CE1H 4PGCA 4Z7QE 4LKCB 1HEZA 2H1PL 2VQ1B 3G6JF 5JXAH 1CGSL 2VLME 5DEGB 2YZ8A 3LV3A 5HHMD 1B4JL 1S7WB 3ARGC 3MRNB 4JVUA 1PY9A 2R1YA 3P2TA 1HYRC 4EZMA 2C9AA 4XWGH 3BP5B 3SKJL 1HHHB 1CYGA 2A6KB 3B5TA 3CUPB 4KHTL 2WLZA 4WW1A 4TOYL 3V2AR 5C08E 4BZ2L 4MYWB 4IRJC 3QFDB 2HH0L 5TE4L 1KPRB 4YHOH 1R3LA 2JK5A 5F89B 4PTUA 5LBSH 4KAQH 5CKGA 4NM4H 5F3HA 3TZVA 5ICYB 1HSBA 2A74B 2OM5A 4XMKH 2X4PA 4RSVA 1EPFA 4YWGL 5D6DA 4RGMC 4YQXL 1OW0C 1UWXK 2DQTH 4KROC 1QA9A 2F8VA 2RFXA 3U79A 1P6AB 1NEZA 3IFLL 2MWCA 7CGTA 4KK6D 4U3XA 1TQCB 1G9NC 3OB0H 4PRIE 5GS0H 1I85A 3ARRA 2EIDA 1E6JH 1PAMA 4PB0L 5KSVA 5C0RH 3I6LE 5EU7E 3SGKC 3I84A 1UCTA 2FR4A 5ITBL 2EDRA 2X1XR 4JVPA 5EA0H 4FFZH 4V2BA 5FCSH 5GSVA 4Y4KB 1AGDB 2MOVA 3BPCB 3L3DB 5DQDH 3SDAD 5F1NB 3MXVH 4D0DA 1BQLH 1BX2A 4P2RD 5D7IF 3CDYA 3CMGA 4L8DA 1AD0B 2R29H 2YWZA 4WFHD 2V9QA 4PV9A 5HD8C 3BSZH 3CXDL 3VXRE 2VDLH 3JV6B 1QRKA 4B50A 3QO1B 3TN0B 1YEIH 3MR9A 1FYTA 4MD5A 1AC6A 1IGCH 1M05A 2MQ3A 3QUZB 4PFEA 4NO2A 3HE7D 2A9MH 1MNUH 5FO7A 4XCYA 3T77B 3NCMA 1OD7A 2OZ4H 4HIIA 4PRIB 5KSBE 3GRWH 4MAYC 1YN7B 4KI5F 4Z7OE 3G5ZA 3T2QA 4OQTL 1IAKB 4L9LA 3IKCA 2UZXB 2R9HC 3BGMA 4PPTA 4OI8A 2NLJB 3HI1B 1G6RA 5C0BD 4PJCF 2MFNA 1T83C 4JB9L 4M43L 2YD2A 2FDBP 5C8JA 1F4WL 2OJEA 4OZHA 3DGCR 2Y1VA 5I1JH 3VD5A 3ZHKA 2APTA 1HZHL 5BS0E 3ARZA 1NDMA 2GAZA 2CUHA 1GC1H 3FFDA 4CJ1A 1ZTXL 3MRDA 3SQOL 4QYOB 1V3MA 4PJ8A 1SY6L 4P5MA 2IH1B 3P30L 4JFYA 5IB2B 1MUJA 1SMOA 4X8JA 4X6CA 4U1IA 2R1WA 4OD1L 5HGBB 3UMTA 4KMLB 3WHE1 4P49A 3WFBH 2CIIB 3TH2T 3F12A 5I1KL 1JIBA 2VIRB 3DBXB 4OQ1A 3S3PA 1JPSL 4M62L 3QXAA 5IT2L 1RZ8A 1CICC 2W92A 5C0CB 3CFDA 4ETQA 3OX8A 4NQCE 3B9KA 5L9DL 4ETYA 2DBLL 2HJKA 2DMKA 4Y5XB 2V17H 3FN9A 5IBUB 2EXYC 3DX6B 2NW3A 3IDJB 4I3GA 5CHNA 4HHAB 1C5DA 4EI5C 2PUQT 4WEMB 3REVA 5DJDB 1FO0H 1FH5H 3PUCA 5I2IA 3EYSL 4JFFE 3SDXF 3VXTB 5B3JE 1A14L 1JYVA 1WUNT 3KS0J 1XF2B 1H3PH 1QQDA 4K7PL 2XQBH 2XYCA 1HE7A 1A3LH 1A6ZB 1WAAE 4OZIE 1R3HB 1S9VA 4MD0A 2ZSWA 4PRAB 3V6OC 1L7IH 2C1OB 2EE2A 1FAIH 2AJUL 4O51B 3S37X 4L4TE 3V6ZA 3QBTB 1JFQH 1FLTX 2JKXA 1INQB 1JHLL 1LEKB 2ZG1A 5T1MB 3MMEB 3BP6A 3D87B 4IRSB 4UT7L 1R3KA 3DI2B 4XNXH 3G04B 2R2EB 4F9PC 4NP4L 5LCVH 3D5OF 3STLA 3T3MF 3VFOA 3ULVF 1Z9OA 4Y19E 3QIBB 5TDNB 1CL7L 3MJ8B 4HWNA 4PG2C 3GBLA 3I3EA 4OGXL 5HYQA 3WL9B 1FZJB 5CEZD 1U91B 4GW5B 2OL3A 4J3XA 3BH9B 3F65A 3C5JB 1GOGA 4JFFB 3RVUC 3V4PL 3HI6H 3EAKA 2YRPA 1W0WB 2Y7QB 1A6WL 3D85A 3ZYJA 3VE0B 4MGXA 2NY4B 4OLZL 1A7QH 4WI2A 3P0YH 1X4ZA 4HBQA 2IBGA 3OB8A 3SDDC 5L8LB 3MRKA 3FRUA 2FD6H 2DM7A 3C8KA 2AJYH 2XN9B 4HJ0C 3UP1A 5BO1H 1IL1B 35C8H 4ODSL 3VGBA 1IGIH 1SMAA 4YC2C 4Z7WA 3WUWA 1DE4B 5DUPL 5ABDE 5JW3L 2QSQA 3E8UL 2C1PA 5E2UL 2IQAA 5IROC 5J1AB 1UACL 1T4KA 4Q9CA 4NQSA 1RFDH 1CU4L 4U7KA 2VZSA 3K2UL 3O41A 4ZOCA 2FSEB 4U1HB 1BQHB 2WM0A 4PBXA 4N8CL 1NFDE 4NJAL 4ZFFA 1OAXL 4JFHD 3M8OH 1Q0XL 3A6CH 1EXUA 3H9HB 3RGHA 4MCZB 5EO0B 4P23B 1BGXH 1QP1A 4X99B 3MZTA 2BY3A 4P2CG 2LFGA 2AK1H 2FLRT 2RCSL 2YSSA 3RWCA 3BN9D 4YK4B 1FG2B 4P5KB 5TGBB 5FYJE 4I9WE 5D5MB 4O9HH 1QKZL 2V7NA 4ODUA 4XXDA 4ZNCD 4LVEA 4W68A 4Y4KD 4XCEB 1P4LB 5E95B 2PW2A 1QFHA 1LE9A 3MGOB 4TVPH 4BH7A 3WO4C 2J7LA 4WV1A 3BPNC 1TJGH 3O8XB 4OM0L 3RBGA 2B1HL 3L95B 2P48B 5ESQB 4HZLA 4P2OC 5IMKA 2CGRL 4NGHH 5EDXA 5TJWK 3QUMA 3TN0D 1QFWM 3G6JA 4FXKA 1NGQL 1NFKA 5F9OH 4ZXBA 2EDEA 3LDBB 5J0BA 2HWZH 4NPYB 5C71A 3ZDYF 1T2QL 3N9GH 5I30H 3IXTB 3ZO0A 2C7UB 3MGTB 5I8EB 3A6BL 3U1SH 4DGIH 1I3RA 2QHRL 1MJ8L 3WLWD 1U58A 1I3GH 4MA8H 1SM3H 5HHQB 1CIUA 2YPVL 3WS3B 4RMRA 1U8JA 4IDJL 2CK0L 1IT9L 1KIRA 3TYFB 4R4NC 5KTEH 4ESKA 4BFGA 5D72H 5EBMA 4HWZA 5CJXA 2D0HA 2B2XL 1IGTB 1YC7A 3HPJA 4NT6B 1CD9B 5IEHA 5CAYB 2VH5H 3NIFE 3ARVA 2GCYA 1GHFH 1MEXH 4LPVA 5DMIL 4FQ2L 4QCIA 4GMSH 4HMEA 5T1KB 3F5WB 3ZE0E 3CSPA 2E27H 1W0YT 4QOKA 4S2SB 5D1QC 5JDSA 4FP8L 3BH8A 4P2QA 2FJFA 4DWHA 1S3KH 4XPFH 2W60B 4Q0XH 3PV6A 3S36L 5LQBH 4NKOA 4R0LB 3TJEL 2KDGA 5H35B 1P4IH 4KV5F 3SE8H 3M17B 2C26A 4UV7H 1GGTA 1PJ9A 1BWMA 5C0EA 1F4AA 4LRIA 5ILTL 4FMKA 4DK3A 2ESVB 5C0CD 1MCQA 5D7IA 5MEPB 1DEEB 3VFMB 2R4SL 4LSUL 3HFMH 5TDOB 5DHXB 3DMMA 4N90D 1CLOL 5D2NC 5IW6B 1FDLL 2X05A 1IM9A 1GPOH 4HAFA 3OKEB 2BVYA 1YMHA 4WW2F 1QBLH 4LGRB 3CGTA 3S37H 2A38A 2OTWA 4K7PY 2R0WH 2X1PA 2FBOJ 5GRJH 1RAMA 1F97A 3MRPA 2H6PA 5I71B 2EC9U 1YMMA 4MB5A 2AP2A 1E4KC 2Q1EA 3MLSH 3M45A 1OAQH 4NN5C 2QQKH 3EYFB 4PJCA 1SJHB 5DD0H 4U4BA 3RVXD 5DVNA 3O6FA 4IRSD 4F8QA 4M5ZH 1X9QA 3X12B 4WTZA 3HRZB 1LD9B 2YK1L 4ZUTA 4NCC2 3B9VA 1JGLL 1KJ2L 5ADOL 3TA3C 5LJYH 1MCNA 2DQDL 1WIPA 3OMZA 3QIBD 5DO2C 1CXIA 4YHZL 3UJIL 4LSRL 1MAML 1U8IA 4AY0A 4YIQB 1XFPA 4OKDA 3PWLB 4UOW1 1WITA 3Q3GA 5CILH 4MXWL 1BF2A 3D3VB 2COQA 2DLHA 4I0PA 1JGVL 1RZGA 4X0KA 3ARBA 5HJ3B 2UY6A 2H1PH 1MWAH 1CGSH 2NY4D 2NW2B 4LLWA 1B4JH 3F7VA 2CLVA 1F2XK 4IOIA 1SEQL 3WDJA 3ECBB 2XN9D 3GSUB 5JMOC 3BVNB 3SKJH 4KHTH 4Y2DA 4M6ML 1WC7A 3EYOB 5DJCB 4GW4A 3PXHA 2HH0H 5TE4H 4HGWB 3VJ6B 4ALAH 2P5WA 3DIFA 2X41A 2OXHA 1WEJL 1JYNA 4EXPX 1W0VB 4JANB 3SDXA 4F15B 2CLZB 2Y36L 1A2YB 4P23D 4RWYL 3QAZB 4KK5D 4YWGH 4YQXH 2FRGP 2BVPB 5J7CC 4IMKC 5T3ZD 4JREB 1UKSA 1CD0A 3IFLH 5I1AB 2VXQH 4FQIH 4MQXD 5E08H 1D9KB 3KDMA 4MS8D 2DKMA 1KYOJ 4LLUB 1JF5A 5FO8A 3LN4A 4IBLT 4BA8A 3IS0X 4I18B 4L1HA 15C8L 5IG7A 4PJGF 1KBGL 2D4FA 5ITBH 1WFUA 2CD0A 3MJ7A 5EZIL 1A1NA 2HYMA 3BXNB 1P4BH 3ARFC 3M07A 1KV3A 3O8XD 1G7PA 4LIQL 4AENA 4JPWL 3VWKD 3D18A 4YBLC 1UM5L 2ZCKL 4ZMAT 3BYYA 1I1RA 2P42B 1FNGB 5CBAB 1KTKE 3B3IA 5MP6H 4PJ9B 4X83A 1N7ML 4EXKA 3MRHB 1NL0H 1PX4A 4JEGB 2BVQA 3EO1A 5J6HB 2XWJA 1EJOL 3U9UB 1WIOA 1KT2A 3VXNB 4NN7C 5DC9B 2FECI 5FV1L 5DUBB 1MCFA 2BXYA 3PQYA 1YJDH 2C5DC 5HI3C 4I9WD 3QEQB 3V5KB 3UBXG 3WD5H 1ZLVK 2VUYA 3THML 1RJZB 3QWRD 4JR9L 3R0MA 5HVHC 5IB1A 4D0BA 4ZSOA 3O2VL 4OQTH 4PGBB 1KB5L 2EYTB 3DTXA 3G5YA 9CGTA 1XMWA 2H9GB 2EEDA 3QCUL 1MFCL 4JB9H 3MRJA 4M43H 5T1KD 2HMID 4M3KB 1G7JB 1MVUB 5INCB 5FGCE 4NQUA 4ZTOL 4MB4A 2J6EA 3WFEL 3SCMA 4L9DA 2CPCA 2XTJC 1OM3L 2DM3A 5MEOB 1RJYB 1T22B 1YECL 1ZTXH 4W4NA 4ZOAA 4OZGB 1U8PB 4PJ5B 3ZTJG 3MXWL 4P48A 3P30H 3NIDE 3MUGA 1OB1B 4BFIB 4PJDF 2DTML 1A1MB 1WZLA 4EN3A 1PKOA 3BZ4B 5DRWB 2ESVD 2O26U 4OD1H 1C1EL 4R7NB 5E70A 1T1YB 4WWKA 2O5XL 3S8WA 1RD6A 5GS2D 1MI5E 4C83A 3BUYB 5D7JA 1QYGL 3B9AA 5IOPB 4M62H 1QSZA 1CG9A 3V6BR 4YGVB 4NHUB 5AWNL 1PYWB 4LPUA 2Z9TA 2DBLH 4IOFD 3FT4A 5TDPB 5E5MB 4EVNB 4GKSB 4BUHA 2GJJA 4H1LG 4WDIB 5FGCB 2JIXA 4M00A 1ADQA 3PHSA 1KTLA 4JGUA 1VEMA 4JFOA 2AGJL 2CQVA 4FS0A 1EBAA 1OSPL 3DX8A 3EYSH 4EDXA 1QSEE 2QR0A 1KCRH 1A14H 1CDHA 3KPLA 5BW7A 3MV7E 1TZGH 1K85A 1J88A 1P7KB 4S1QL 1RZIB 4IS6B 5EO9A 3TO4C 1C16B 4ZUUA 1KTDA 1OF2A 1S7XB 4F3FB 5L0QB 2IPTL 3RTQD 5GRVL 5IHLB 1VKXB 5I1EH 1MI5B 4S1DD 1T04B 3BX7C 3LKOB 2FWOA 1FNSH 5KAQG 1T3FB 4NQXA 2AKRB 4DZ8B 4U1JB 3HZKB 3HG1E 4GG6F 5B39A 3BESR 1FPTH 3GSRB 1IGML 4BUGA 5FM5M 4NP4H 3FQTB 3D3VD 2X1OA 4WTWA 1T7WA 2I25N 3L3KB 5D1ZA 1CL7H 3K1DA 5KANG 5DT1H 1ITCA 1J05A 1QVOB 2Y06L 3EYQD 3MYJB 5GJSL 4PIRF 3MA7A 1EO5A 1RURL 3DROB 3V4PH 4GJTB 1ROWA 3QEUA 5DZLA 1A6WH 4MNGE 3GHBL 5KSUB 4H0HB 4YFLF 4OLZH 5KS9F 5DJYA 1A9BA 3P3YA 4PRHB 2QKIB 2XZAL 3K4ZA 4Z78A 3U7YH 3SDCB 3U46B 2ICWB 4ODSH 1MCIA 4WW2A 5DUPH 5JW3H 3T65B 3B5GA 3E8UH 1J7VR 4LQFL 3QT2A 1UACH 1RUKL 4H26B 3UO1H 4M9PA 1CU4H 25C8L 3EOBB 1RHHA 3K2UH 2PCPA 5IVOA 5J9PA 2GFBA 1ZLUK 5DI8A 1XGQA 4JRXB 1FLRH 4N8CH 1CFQB 3BPOC 3SE4A 4XHJC 5ADPL 1G1CA 2XI9A 4WFFE 4POYA 1MJ7L 5SWZB 1Y6KR 2Z31C 1PG7W 3S5LA 3VRIA 1D9KD 1NJ9A 2E9WA 4NWTL 3MLUL 2GK0B 2RCSH 4NYLB 1CK0L 3FO2B 4L3EA 3ULUF 3S88L 1SQ2N 1BD2E 1AXSA 5IM7A 1QKZH 3DX9A 4J4PD 5CEZL 1OTSC 1T5WA 3WKML 1KIQB 4XAKE 3VI3F 5JHLH 4R4BB 2GT9A 3RA7L 3PGFL 2GY5A 2XWTB 1CCZA 3HUJB 3O9WC 3MNVB 1M4KA 2GJ6A 5EO1B 5GPRA 1RZFL 5HDLA 2GITB 2G75B 1MCHA 3QQNA 4OM0H 2B1HH 4HQQL 4N1EA 2ADJA 4PJ9D 3WJJA 2G5BB 3LRHA 5B4MC 2CGRH 3B6SA 1PZ5B 1LEIA 1NGQH 3RUGB 3VFVA 4JZOA 5J8OA 1TIUA 4ZPTA 1HKLH 3TBYA 4NO5A 4N0RA 4LSTL 4YHIA 1IKFL 3T2NL 4NQDB 1RZKL 3FRPA 5F1KC 3QEQD 4OF3A 4WWKD 1T2QH 1HYSC 1AJ7L 1MSPA 1J10A 1MJ8H 3D39A 4K23L 4WHYG 2H32H 4Z7QF 2YPVH 1YA5A 5JTWA 3JWOH 3ROOB 3CDFA 4IDJH 3PP3H 1IT9H 1MFAL 8FABA 1HHIA 4U6VH 3HE6C 4X4XA 3DUUA 2X4OB 2B2XH 2XA3A 3QH3B 5CS7A 3DO7B 4BZYA 2HP4A 3FO9B 4IIQB 3MBED 4UB0L 4ENED 2AEWA 4FQ2H 3N1MC 2AXFA 4P5TA 4LDLB 4L29B 3S9DB 3P4NA 4PJ5D 3IFNH 5IJVA 4V1DE 5GS1A 3QFJE 2VLJB 3BHBB 3KG5A 4FP8H 5HPMB 1A7PL 5EOCL 3JV5A 2X4RB 4X9BA 4JZNA 4NUJA 3TJEH 5ANME 1RULL 4PJGA 4RFNC 4OBSA 2QLVB 4ELME 2VISA 2ZUVA 1QSFD 3KWWB 4HUXB 2VAJA 2BSTB 2ERJB 3NCJL 5ILTH 1HHJB 2PYEE 4QRPB 4UQ2B 3MOQA 2VXSL 2R4SH 2X4UB 4R3SB 3BI9X 4XP6H 5T1LB 2D9CA 5BV7L 1YY8B 5B21A 2ZSVB 2VXTL 3OAZH 2XWBA 5ECJE 1CLOH 3GO1L 3MBXL 4JLRA 2UZYB 1UXWA 5KZCB 2APWA 3LHPH 1DQML 4LMQI 4JQXC 5JQ6H 5E9DA 1P84J 3MLTB 4BFBD 4G8EA 3P9LB 4HXBH 3NBNA 4UI2A 5CWSA 1QFWL 4WIQA 1JL8A 3C60A 4DZBB 4CVWA 1IAOB 4XVJH 1M6OB 2C3GA 4ELKA 4YXLL 1I8KB 2OXGA 2PXYB 4XRCA 1KPUB 4HPYL 1DBJL 5FA4B 4ELMB 2UWEE 5K9KA 2UV3A 4HFWB 5IVZA 2UUDH 2IJ0C 3K8MA 5H37H 3IDIA 5ISZE 3TT3H 1IGJB 4Z7VB 1U8KB 3NCBB 1NGYB 2CR6A 1KCUL 4GFTB 3KYKL 2AXHA 4N8VG 4PV8B 2IFFL 2YK1H 4XP1H 1A6VL 4E41A 5KSBF 1JGLH 5ADOH 1KN4L 3WV0A 4Z77A 4Z7OF 2DQDH 1MRDH 3CVHB 4LGPB 1JNNL 1RZJL 3CVIH 3UJIH 4LSRH 1JZ3A 1LE5A 2ITCA 4PJDA 4G8FB 2HVKA 1SBBA 1MAMH 1JNJA 4ORZC 1L6ZA 4K8RD 3HAEA 4YNYA 1T2JA 2C4XA 1N59A 4YXHL 4R8WH 4M7JH 3ZLQC 2E6JA 4KK6C 4HIXL 5FV2A 4KJYB 5GRYA 3IETA 5FYKE 4PRHD 3I50L 4RRPG 2R0LH 3T0XA 1SEQH 3SDCD 3UTSA 1DBBL 4JN2B 1K4DA 4K55A 4FQLL 4NWUH 2UWEB 4F33A 2DIBA 4LEOA 4S10A 5ISZB 3C08H 1U8QB 3X11B 3UROR 4J23A 3FAXA 4PP2A 4X9HA 5E99L 3SDAC 2AK4E 3G08B 1NUDA 3TPUA 3BZEB 2HLAB 3RY4A 4JRXD 4MQTB 5ICXA 3W81A 1S8DB 5AAMA 1WEJH 1R5WB 3QEHB 1F11B 4WGWB 1JZ2A 5CCKL 2APBA 5SWZD 5HHVL 5T3XE 2Y36H 2AV1A 4GS7C 4UILH 4DVBB 4RWYH 2H26A 2PO6A 4Y2OA 1I1FA 5CINH 1A7NH 5M7QA 1I7TA 1MHCA 2XIDA 2J8UB 4G6KL 5FM4A 4P4RB 5IW1A 2AI0H 1JNHA 3HE7C 4CU7A 3KPSE 3H6JA 4M7ZB 4R26L 2FEDD 3ILPB 3QQ4A 2ZUXA 4OI7A 1RPQA 3MROA 4KZDL 3CC5B 5B3JF 1U3HA 5EZIH 4GG6A 3E6HA 2VWEC 2XQYK 4GSDL 4JRYB 5E03A 4GRWH 4LPTA 4NBYB 1WAAF 3UYPA 4LIQH 3RZCB 4OZIF 4HUKB 4UU9A 1UYWL 3M1BA 4Z5RB 4PB9L 4J2XA 2FCBA 5T5NG 3BEWB 4G7VL 3L3OB 1DFBL 2IPUG 4UQ3A 5DD6B 2CLRA 5JLZA 4NQDD 1EEYB 2K3TA 5JNYA 1N7MH 4WFFD 1P2CA 3KPTA 3H0TA 1AQDB 1EJOH 3T0DA 3DXAA 5KS9A 1N5AA 1XGYL 3GSXB 1A6PA 1A6TA 1AGEA 3IF1A 2MQ0A 2R2HA 4ZO6A 3HLAA 1FV1A 3HB3D 1FZMA 2OP4H 5T3ZL 2CMRL 3TIDA 3THMH 5FB8B 4JR9H 1ZGLB 1NGWA 1QRNA 2FLBT 3O2VH 3IJYB 3CNKA 5I16B 5JOPE 1KB5H 3QPXL 2EO1A 3LY6A 1E0OB 1MHHB 4KU1A 1C12A 4MJIA 4CMHC 1I3UA 4RCAA 1Q9LA 3MRCA 4AJ0A 5C7XL 1MFCH 3EJJX 5DGQA 3BDYL 4X7SH 3LD8C 5IMLA 2VLJD 1BVKB 2FL5B 3MV8A 4D9QD 4ZTOH 2BSED 2F53B 4KUZL 3WFEH 3B9EA 1U2HA 1JZ4A 4LSVL 1OM3H 4GAYB 1YECH 3OF6A 5EU4A 3PJSA 2Q6WB 1OCWH 4DKDC 3F6LA 2H2PD 2IPKB 5F93C 2ITDA 4LKCA 1J0YA 1A5FL 3QCVH 5DEFB 4DCQB 3CCHA 3F7YB 2DTMH 1JWUB 2V2TA 2P46B 5DEGA 1QBBA 4QRPD 1RJLB 4G7YL 5E2TH 3MRNA 1NFDF 3O11A 3MRGB 4MD4B 2O5XH 1R6VA 1T0PB 3GFUA 4WENB 1M7DB 5T1LD 1AH1A 1HHHA 5IUSA 2A6KA 5C86A 1QYGH 3DRQA 1GGIH 3BWAB 5EULV 4E41D 1XGPA 2ENYA 4LVOC 5KZCD 2EE9A 1T6WA 5HY9B 5AWNH 4O4YH 3FMGL 4Y5VC 1DDHA 2WUCL 4GUPB 3DGGA 5C0GB 1QHOA 4JAMA 4NO3A 3ZYIA 1HHGB 4MMXC 4APQD 4QRTA 4N5ED 4G8GD 4U1NB 2AGJH 3GSNA 5BRZE 1OSPH 3U7WH 3QZWA 2H3NB 2PXYD 5F70A 3WKNA 1NQBA 2X4NA 3BKMH 4I3SL 4JZJB 3VD7A 2FIRT 5IBLD 3VGEA 2VZ1A 3MOBL 2ARWA 3GMMB 2CRZA 5I1LB 4GG8A 5GGSA 2A6IA 1CR9L 5DD1L 3UBXB 4E42A 2FATL 5D93C 4F7PB 2BNRE 3BPCA 1UWGL 1DVFD 1EV2E 3OKMA 5C07E 1GGUA 5C08A 4DGVL 3BKYH 5EZOH 1EAPA 1I4FA 1N26A 3DJ9A 3GIVA 1Z9MA 1RZKC 1J1XL 3NCYS 1OY3B 2AJ3A 3NIFF 1AGBA 4RA3A 1ZT7A 3WIFB 3MACL 3NPZB 1R5IB 1VFBB 3QUZA 4ONFH 1MRFH 3ZE0F 3SN6N 1MCPL 1RURH 2AV7B 4MZ2A 2X1QA 1BIIA 4QGTA 4PRIA 5D9SA 5E6ZA 3GHBH 3H3PL 4XPBH 5CBEB 1Q94B 3WSQL 5ISZD 4Y4KC 4PREB 3GI8L 5EIIB 3DV4A 1BVZA 5ALBL 3WHXA 3IU3A 3QNZA 1YEEL 3MV11 2ZUQB 1VDGA 3GZKA 3O45B 3RGVB 4BM7A 2C3VA 5C07B 2ZWLT 2PTTB 4XVTL 3OHXB 4LQFH 1RUKH 4AIOA 5SX4H 4NO0B 1F3DJ 2ED8A 4JO1H 3TN0C 1UM6H 3P77B 4YDIL 1F3JB 3PWPE 4H1LB 2YXMA 5ADPH 1LNUB 4B7LA 4TTGA 1MJ7H 4KDWA 2WBJD 2IH1A 1CE6B 3VXRA 2I26N 2P5EE 4HZAA 5F96L 2EDKA 4NWTH 3MLUH 5F88B 4K9EL 4S0TD 1CK0H 3ZKXB 1FCCA 3ALXA 2Z8RA 4GLRI 4XB8A 1U8OB 5BV7C 3S88H 2R23B 2CIIA 3GMLB 3PNWA 1R0AL 1EZVY 2JJSA 2VIRA 1BMGA 4Q6YA 5CEZH 3WKMH 3DBXA 4JRYD 4PGDB 5DFVD 5KSBA 3P9MA 4X7DC 4LAQL 3RZCD 4YHPB 4OUOA 2AW2A 2I60L 4OCXL 3H7BA 3RA7H 3W9EB 3PGFH 5DS8B 1OAYH 1RHFA 3QIWB 4K3DL 1NMAH 1ZVSA 4XXCA 3GMPB 1H3UA 1RZFH 1XCTA 5IWLA 4NQEE 2A0LD 4HQQH 1KYOK 1A6UL 3MFFA 3V0VB 4BQBA 1Y18B 4GLRH 5BS0A 2ARJB 3IDXL 1X5XA 2E7CA 1JYXA 3CSYB 3RL2B 4LSTH 3QUKA 5TPWH 2YPLE 3PWPB 2OCFD 5IGXL 3E6FB 2OR8A 4UTBL 1EZVX 3W0WB 3MRIA 3UYRL 2BXZA 3I02B 4DW2L 1AJ7H 1BQUA 2EH8L 4JQVA 2BHYA 3O3EB 1R3HA 4MHHI 4QY8A 1ZHNA 3CFKA 4CN6A 1I8LC 2WINB 1K3IA 3KLAB 3AAZA 1KCSL 3KJ6L 4XT1C 1INQA 3RIAF 1RZJC 4OGYL 3OKYA 1CWVA 1HCFX 5T1MA 3TBVA 3DVGB 4Y5XC 2F53D 2LU7A 4NQCA 3QJHA 4ZUWA 4FQXA 4UB0H 5EC2A 1G6RH 4F37K 2OR9L 5L7XL 3DO3A 1JPTL 4NQEB 5HDQL 1A8JH 3NAAL 4ZFOL 5IB5A 2ADIA 2J6EL 3QIUB 3R8QA 1GZPA 1A7PH 5EOCH 4UT6L 5GZOD 1U91A 4GW5A 4RWHA 5B8CB 1OWRM 2N4IA 3BH9A 3RWDB 1HXYA 4MA3A 4JFFA 3NZ8A 1RULH 1KJVA 5D7KE 4UMGA 4ZODA 1I7UB 1UEMA 4J3OC 1PG7L 1FL6A 1VGKA 1B6DA 2V5MA 3NCJH 4O2FB 4OZIA 2P24A 1SBSL 3NFSH 5HYJE 1YUHB 1KXVC 5I66B 3U30C 1KELH 3RVXC 4QXUL 2WK2A 1S7VA 3CFCL 3F58H 5BV7H 4IRSC 4L4TA 3EYVA 3W82A 2X6MA 5J13B 3MBXH 3O3UN 2UZIL 4ORGB 2V5TA 1AGFA 2WWMD 5FM8A 3QIBC 2FSEA 3RY6A 4OSUL 4EI6A 1N2RB 5JIKA 2JB5H 4KRPD 3WCYA 4ZAKB 2FH6A 3C5ZA 4MCZA 4Y19A 5J6GB 1ADQL 1U8LA 1T0NB 3VG0H 2IFGA 1FG9C 4JY5H 3V79C 4FA8A 2CDEB 1FG2A 2HTLD 2NY4C 4D2NA 4P5KA 2PF6A 1LO2L 4HPYH 4B5EA 1DLHA 1CD8A 3LIZH 5CMAB 3LPFA 1SHMA 1QPPA 1ZAGA 3QQ3B 4Y5YA 4XI5D 2VO5A 4YGAB 4TQEL 2IFFH 1DR9A 2R15A 4XP4H 2XICA 3LEXA 1KN4H 5DMYA 1HNFA 4L4JA 3FO1A 2VDNH 1RZJH 4MQ7A 3B8YA 4HW6A 3OJDA 4LHQB 4P23C 1U8NA 4KK5C 3CZJA 1BBJB 1NFDA 4XC1L 1JHTB 3E3QC 1PD6A 4YXHH 5L2KB 3O0RL 3LEVH 2C7UA 3GB7A 4JPIA 4MQXC 2P7TB 4MS8C 1GGBL 5F9WB 3PHQB 2P43B 4X4YB 3I50H 1CLYL 7FABL 5H2BA 1JHKL 2IALB 1WWAX 3RI5K 3PP4L 1YNLL 3NIDF 1CFNB 1HH6B 4UDUA 4FQLH 2JLLA 4XPGL 4JM2D 3Q5YA 3R06B 3R4DA 3RGVD 4HWUA 4NT6A 3OAUL 1HILB 3O8XC 4O00A 5SV4A 2DYPB 1HQRA 3VWKC 3VFWB 1TVHB 5E99H 3A67L 3MV01 4CNIA 4QHLB 3CK0L 1OPGL 4J1UA 3ALPA 5CCKH 3LDBC 4S2SA 5HHVH 5IQ9B 4YFEA 1DP0A 4R4FL 3WNKA 4XNMB 4QXTA 1JGUH 3X13B 3RJDA 1T7VA 4GRMB 3U82B 3KLDA 4G6KH 1MF2L 3KPPB 4FTVB 1TTGA 2GSIB 2AEIT 1A3RL 3LS4H 3FB6B 4K94L 1AR1D 1OT2A 1IZJA 4K8RL 3RX5A 2EIBA 1OGAE 3UTZB 3MJ9A 3U2SB 4NCDA 3NN8B 2R69L 2RQ8A 4KZDH 3VFMA 1MVFA 5C3TA 1BEYL 4XVUD 4YXKL 5HGDA 4GSDH 4OBRA 1IAIM 1I8MB 4K3JL 1GZQB 1UKQA 2HMIC 3VG9B 3VWJA 1AI1L 4N8VB 3BQUA 4G7VH 2R0KL 2FGZA 5AUMB 4HX1B 4OIIL 3VXPB 1FGNH 3JWDL 4XWOD 4LVNB 2LAGB 1FZKB 1B0RB 3V0WL 3PWPD 5EIQA 1LP9E 3QDGE 2V5YA 4P4KA 4R0LC 1CGVA 3QUYB 3W0WD 4M1CD 3QUMH 4R6UA 2I07A 4X7FC 3T0AA 3S35L 4XBGA 3VXUE 1XGYH 2GUOB 2CIKA 3G5XA 4H8WL 1GSMA 2V9RA 1TVBB 3ARGB 4LOUD 1CXFA 3EYFA 5MENB 2CKNA 2CMRH 4QRRE 3I6KA 4MWFB 5EUKA 1OGAB 5EU5B 3FQNB 3MGAA 4LPXA 2OR7A 5GIRA 1VESA 1Y0LA 3QPXH 1F4XL 1WBZA 5I15L 5JIHA 5C7XH 1WF5A 1BREA 3BDYH 5F7EL 4IOFC 1MQ8A 1FVEA 4MDJA 3U6RA 4L8SA 3PWUA 4K7FA 2YBRB 4KUZH 2XRAH 3QIUD 2X70A 2APVA 5FDWB 4LSVH 1KIPB 4YR6B 4OZ4B 5I71C 3JXAA 3CFIC 3GMNB 4LF3A 4OCYL 3ARBC 2XA8L 4ZS6D 1KG0A 3ZL4L 4K3GA 5L88L 2D7TL 4MDIB 3WN5A 3QHZL 4U2ZA 4KMQA 5GJTL 4G8IB 1CIDA 1MJUL 3UJJL 3VXUB 5F3BB 3ECBA 4IDLA 5ID0A 4M03A 3HZYB 4KFZC 3QI9B 1R3JB 3RTQC 3U83A 4QRRB 3PE9A 1BZ9B 3EYOA 4CVUA 4S1DC 4PYGA 3GSWB 3MA9L 4I13B 5BZWB 5FKAB 2BVOB 1YYLL 4XVSL 2KQMA 4PRBA 5LWYH 3QDME 1BFOB 1FO0B 1C08A 4MJ5A 2E9IA 2WUCH 1TITA 4O02H 4ZAKD 4JANA 5BOPA 4OJFH 2X4TA 2DQEL 1WSST 4K9EC 5DSCB 1PG7X 1UVQB 2VDQH 3U36B 3RI5F 1FVCB 1J86A 1X5ZA 2YRZA 3O6KL 1OHQA 5I1AA 3FONA 1MOEA 4GAGL 3V5DA 3EYQC 3AFLA 1NBYB 5EZJA 1XH3B 2AEQH 2E8YA 5I1GL 3UCRA 1EAJA 2AJSL 2ARJQ 2F74B 3VXME 4I5BA 4TN9A 4U1SB 5DD1H 4JDVA 2BCKB 2FATH 1P84K 3ROLB 3D25B 1ZSDB 4KDTC 2VDKL 1BM3L 1I3VA 5GS2H 4OKVB 4DGVH 1XAUA 4DUVA 1HDMA 3Q1SL 4F15C 3U0PB 3EHBD 3QAZC 4RIRB 1FNGA 2VLKA 3CPLB 3T4AA 1R5VB 5I76B 1BOGB 2PYFB 3CFBB 2DM2A 4JREC 2IADB 3MLVL 5L2KD 1DZBA 2I5YL 3O4LE 1J1XH 4LCUB 4PJXB 2NX5E 1D9KC 3B2VH 4U0RB 4Z76B 4TUOA 5BZDA 1F8TH 3MACH 3KXFE 5BXFB 4OF8A 3TYGL 4Z7NE 4C54A 1JE6A 1LK2B 5AZEL 4J3UA 4I18C 3Q0HA 2V7HB 3MRQB 3T4YA 3V6OE 3I9GL 5AAWA 2BSSA 3MRFA 3CX5J 4P9HC 3H3PH 4J4PC 4M8QA 3VD4A 1DQQA 2J5LB 3GI8H 5ALBH 3HNTL 1UC6A 1YEEH 4ELMF 3PHOB 5CD5D 1ORQA 1ONQA 5HSFA 3ESVF 1UT9A 3TNNB 4X6FA 5GS0D 4PJ9C 1IILE 1J1PH 3ILQD 3TF7C 4EI5B 3MNWB 5MEOA 3CVHL 2HG5B 4X6BA 1U8PA 2LV4A 4FTVD 1JGDB 4QHUA 4DTGL 5DZNA 3O4LB 4Z6AT 1A1MA 5F96H 3BW9B 3QXUA 4U33A 4GW1B 4G3YH 3T8XB 4WWKC 2BSRB 5IFJA 4MA1B 3KXFB 1UENA 3SPVB 3AM8A 1SYVB 4RZCA 1UKTA 3D0VB 1BJ1H 1ZT1B 2FJGB 3ARTA 1UWXH 3DV6B 3FT2B 2DN7A 5CSBA 1Z9SA 4FNLL 2J8HA 1H3GA 2I60H 4CN1A 4HH9B 4OCXH 2G9HA 4M7LL 4NHUA 4RFOL 2M8XA 2C3XA 2P49B 3L6FB 4EDWL 5EU3B 3OTTA 3JTTB 2UWEF 3MBEC 4W4OC 2Q8BL 4ENEC 5TDPA 5E5MA 4GKSA 3ULVH 4X7TB 1B0GA 4FOMA 3QUYD 1A6UH 2VLRE 5IK3A 1YNTA 5E8OA 1F4HA 3IDXH 3FL7A 4E0RB 1ZGLP 2XPGA 5H37G 2HN7A 5IGXH 5SWQB 1JPGB 3ARGD 5IJKA 1J8HE 3JV4B 5MEND 3OXRB 1MFDH 3UYRH 4XGZA 1N4XH 4QTIL 4HJJL 4DW2H 2EH8H 3KAAA 5L2JA 5HDBE 1UZ6E 2J4WL 1PLGL 2VL4A 2N7BA 1MIML 4NFCA 5JPNB 3IDMA 4F3FA 4H5SA 3Q6FB 3FQUB 5FYLE 1G7MA 5GGRB 1MI5A 1F58L 3FN3A 1I1AA 4U1JA 1C5CH 4KTEH 1S7UB 1RUPL 4RGOL 2IANE 3GSRA 4LHUA 2VR5A 2NY2B 2XG5A 2OR9H 5L7XH 5D1ZC 4Y4HA 3P0VL 3Q6GL 3WXWL 2V2WA 5HDQH 3RL1B 1JWSB 3MODL 3NAAH 3ZKMD 2J6EH 2VLRB 4I8DA 4F7EB 4FQCL 4NHCL 1AIFA 2BOBB 4UT6H 4Q6IB 4E5XB 1CDBA 3ULUL 4U6XA 5LGJB 1JTPA 4UINL 5C92A 1QSEA 1JWMB 2NXYB 3WHE0 5F6HJ 3GSOA 3QI9D 5BQ7A 5L0QC 3MV7A 2W38A 1DLFL 1U95B 4M7KH 3B8SA 4RX4A 4G6MH 1PG7H 1VA9A 1SBSH 4PJHB 3RNKB 3TNMB 1BVLB 2AVGA 4JHWL 4UIKL 1WQVT 2OTUA 1AXIB 3GNML 1EFXA 5FK9A 1HKFA 3GJFA 3MCKB 4PUBL 5HI5C 2A83A 3BPNB 2VLKD 3UZVB 5KW9L 1N6UA 3L7FA 1FIGL 2YZ1A 4H26A 3HG1A 2UY7A 4JKLA 3I6GB 1QG3A 2BNQE 1AQKL 4OSUH 2Q76B 1CFQA 1XR8A 5C0AB 1KGCE 4LCYB 2MCPL 3P73A 1Q9KA 1VEOA 2WUBL 4K8RC 1A7OL 4AMKL 4KKAD 3CSGA 1ADQH 4DGYL 1GXEA 1HI6A 2GK0A 3VFRA 2O5YH 4JHAL 2GSGA 5JO5B 1QLFA 3P4OB 1JV5B 2R2BB 3BT2L 4JY6A 1S5HB 4HIJB 1KC5L 1LO2H 4DVRH 2IC2A 4U3HA 4X7CC 2W0FB 3KHQA 2WAHA 4HJGA 5C09E 3SKMB 4MNGA 2A73A 3SDCC 4AIZA 2DQCH 5LKNA 5EWIL 4R4BA 4EKXA 5ESVB 2ADFH 5L6YH 3WO3B 3WS6C 5HHPB 4TUKL 2YS4A 1LO3L 5D2NE 3JWDC 3RNQB 4TQEH 4C56B 1N8ZB 4MXQD 1EGJA 1FFOB 3LRSA 1X7QA 4KTDL 4HGKC 3C2AL 3TVMB 1PZ5A 1KCVH 2JB6A 1MWAB 3S96A 5D1QB 1UGNA 3EO0A 5BMFL 2GJZB 3EZJB 1PQZB 4H8WC 1GJIA 2LAAA 1RU9L 3ES6B 4XC1H 1RIUL 4KVCL 1NLDL 3FOLB 3IDYB 4RISL 5CD3B 1JK8A 4CKVX 5DHYA 5JOFB 3O0RH 1GGBH 3FFCB 2Z92A 4HCRL 5I18L 1ND0A 2FEDC 4TSCL 1NC2B 1CLYH 4MCYB 7FABH 3ZDXE 1S7TA 1JHKH 1BD2A 3PP4H 3T08A 1YNLH 3HN3A 4IMLB 4XPGH 4F7MA 3RRQA 5D1XA 4Z95H 3O6LL 1UZ8B 5BJTB 1P9MC 3MOAH 5HYSG 2BOCA 1OTUD 3E0GA 1ZA6A 5HGAB 4WUUD 4Z7UA 3CMOL 2H45A 2VAAA 3SJVE 5DVMA 1OGTA 2BERA 4F7CB 1OARL 1OPGH 1DQJB 5FO9A 4L5FL 4M5YH 2ATPB 4PTTA 1BZQK 3TO2A 4R4FH 1RK1A 5ALCL 2Y9RT 3NFNA 3KPNA 3AU1B 2X4RA 4TVPD 4LARL 1MF2H 3SGEH 2D9QB 1XCQA 3SE3C 3HZMB 1TZIB 4HUXA 4K94H 3ZMRA 4K8RH 5E8EB 3HB3C 5DMKB 1I9IH 1RUAH 4EUPA 2VITB 1T03L 4FQ1L 2YOCA 4XZUB 2L7UA 3LN5A 1BEYH 4IIQC 3OR7B 4YXKH 1ORSB 3H7LA 4KGJA 4LHUD 2YKLL 4LPWA 3TA3B 4ZD3H 2RAMA 5T33L 4NZRL 2PTVA 4NQVA 1QO3B 4RQQB 1CS6A 5ESAB 1MJJA 3U0TB 4V1DA 3QFJA 2B1AH 3WJLC 4RAUB 4F7TB 3RP1A 2H2PC 3UTPD 4DZBA 1WWCA 3DYMA 3DSFH 1MCWM 4R9HA 5CSGA 5D70H 2ERJC 4OIAA 5K33A 4QRSB 2BK8A 1KPUA 5SWSE 5DK2B 5ANMA 3MRMB 4ELMA 2AEPL 4AYFA 1RY7B 4HFWA 1KULA 4QF1B 1ZHKB 4A6YA 1SEBB 1ZMYA 3LB6D 2PYEA 2LQRA 4I77H 5DRNB 2EDHA 2BY0A 5HHOB 5JXED 2WWKT 1F4XH 4KVNH 5I15H 2CDGB 5TQ2H 2ZOLB 1S7SA 2NY2D 1AO7E 1ACZA 2HKFL 5F7EH 4M1GL 1TTUA 4FRWA 4RNRA 1G9ML 3V4UL 1MY7A 4APQC 4MAUL 2QHLA 4N5EC 5FAAA 5MHSE 3RDTB 2NXYD 2XA8H 2D7TH 2PXYC 4M1DL 3BD3A 4JFXA 5CLTA 5TF1H 3OKNA 2IAMA 3DX7A 3QHZH 1JGEB 5KG9B 4JKWA 2HJLB 5GJTH 1KLFA 5JZ7C 5IBLC 2QQLL 1E27A 1MJUH 4NOBA 3UJJH 4WO4B 1F6AB 4G43A 3H9ZA 3PWNB 1JRHL 2XV6B 4HD9A 4K71C 4KKNA 1H5BA 2VDPL 4PBVC 1U0QA 1FFNB 2ZOKA 1J8KA 5C6TL 4YBHA 1KLGA 2YD6A 4LLYA 1N0XL 3K80A 2FZ3B 1DVFC 3L3HA 3FTGA 4JPKH 3MA9H 3KPMB 4NZTL 4OFYD 2DI9A 4DN3H 3TH4T 5IR1B 4FQHB 4HIHA 4YBLB 4M61B 4F57L 1IAIL 5C0AD 3QEHA 1R5WA 5DJXB 2EDNA 1NEZG 2XTJE 3TPKA 4NRYA 5KSAB 1JPFB 1WBYB 2DQEH 2V2XB 4BQCA 5F9DC 3HR5B 4CU8A 3UDWC 3FZUD 3H9SB 4ZFZA 2NY3D 1NANI 1TJHH 1L9MA 2E7LC 4NN7B 4P4RA 4GAGH 3VDAA 4DOHE 3O2DL 2O61A 3V0AC 4H88L 3RWJA 2BMKB 5FKPB 5TE7L 5GGSY 3EYUL 1U42A 3AY4A 1TLKA 4O2EA 1CTOA 4BSVB 2XT1B 4LCCB 5HVHB 2PW1A 4C56D 3HZVB 5DK0B 2DQFB 3GJEB 4AG4L 1J18A 1BM3H 5JPMA 4JPVL 5CP7B 1ZV5A 2E9BA 1T21A 3TVMD 1IVLA 4RBPK 1EDQA 3Q1SH 2F8XC 3L3OA 3UEZA 5D2LB 2AK4A 4RAVA 3TBWB 4X9GA 4OAWB 4UOW0 1JF1B 1EEYA 1VFAB 3MLVH 4ZQKA 4CAGA 1XR9A 3KLHD 4BKLA 1X5LA 5E4EB 5ETUB 2JELH 5GHWL 2WBJC 4F8TA 3FFCD 4PGEA 1CGYA 4M7ZC 2JJTA 3MCG1 3TYGH 2EECA 1NC2D 5AZEH 4DQOH 1AXTL 5FGBC 3I9GH 4LVHC 3VCLB 1DN2A 3TESA 1ZT4B 1DJSA 3KPSA 4G42B 3O3DB 3V6FA 1WICA 5DFVC 3DYPA 4ZTPH 2ZKHL 3RZCC 3V5HA 3OR6A 4P3DB 5FYJL 1GIGL 3O3AB 3I3DA 4NKDB 1INEL 4NZUH 1T1ZB 4RAHA 4YDLB 1K5NB 2I9TA 4LU5H 2A0LC 3TEUA 5DA0B 3ZZ1A 4FQQA 1PBYA 1OSZA 4GAYA 3WUZA 3CVHH 4TNWK 3VFTA 1D5BA 4PRNA 2Q6WA 2FHBA 2J2ZA 1K4CA 3MRBB 5JXAL 3EOAB 4JFDE 3UTOA 3CFEB 4DTGH 5DEFA 3VXSA 3JZ7A 4DCQA 1DUYB 3F7YA 1UA6L 1UWEH 2OSLB 3QDJE 4NNXB 4ZUSA 1X5JA 3EDDA 2IEPA 1NCCH 2W0PA 5IEKA 2PKDA 4JO3L 3PL6A 4NNPL 2LE9A 4PJFE 4Y1AB 4YHOL 3KYMB 4M7LH 4YFLI 4RFOH 2R1XB 5K9QG 5D96B 5ITFB 5LBSL 4KAQL 3CDGB 5DJ8A 4QHNB 4GUPA 5E8PB 2Q8BH 4X7EC 2G2RB 5EC1B 4WHTB 5CJ8A 2BC4B 1AD9A 4WFGE 2K1MA 4U1NA 5F1IB 1T1WA 2ICEB 4MXVE 4XNUL 4LSPH 1FCGA 4XCNA 5GZOC 2H32B 3LSOB 1E6JL 3IJHB 4XH2A 3ULSA 1CVRA 3OKKB 3GMMA 5ERWA 1NUGA 4ZUVA 3IFPB 1CDJA 5C3LD 1PLGH 1MIMH 5HHOD 3EO9L 3JTSA 1F58H 1H0DB 5DQDL 5IF0A 4Y4FA 4U6YA 3D0LA 4J3SA 4PJIE 4X4MA 3MRLA 3PGDB 3OAYK 3VXQB 3T0WA 1FBIL 3QYCA 3KPQB 1RUPH 1T1XB 1SJEA 2WWMC 3I75A 4RGOH 3SGJA 1ZLVH 4WU7B 3BSZL 3RDTD 5EORH 5F8QC 3P0VH 1D5XA 3WXWH 4KRPC 3KYOA 3BPOB 3V4VH 4MNQB 3MODH 2G60L 4KRMB 4FQCH 4NHCH 4HKZA 1JZ8A 4JZJC 1R5IA 4PJBE 5BRZA 3ULUH 3BD4A 4UINH 4WO4D 2XZQL 3GRWL 5JW5B 2HTLC 1WBXA 3FHQA 3SKOB 1KCLA 1DLFH 3NCFB 5EPMA 4QXWA 1FRGL 3WUWG 4ZYKB 4E9LA 1U8MA 4CBPA 1P7QA 2ADGB 4GRLD 4TVSa 4UIKH 3C6SA 5J06A 3VH8A 1DL7H 2DQJH 4XI5C 3MRRA 2F5BL 5DHVA 2BNRA 4EBQL 4PUBH 1I9JL 4KJPD 5I1JL 5C07A 4PJIB 2PTTA 5KW9H 5KSAD 3UTQA 1X4YA 2ORBH 4NO0A 4HUVA 5E6ID 3G6AB 1AQKH 1M71B 1BZ7A 3H9SD 1B90A 5E56A 2MCPH 3CU1A 2WUBH 5DJ6B 1DANU 1A7OH 1YPZB 3U4EA 4AMKH 3C5SA 4HF5H 3CH1B 4DGYH 3UTTB 4WVRA 4GKZB 3WFBL 3VXOB 1XF3A 3GSNH 3TFKD 2JJSC 4G9FE 5JA9A 1KC5H 1LP9F 1IE5A 2ZNWA 1NGZB 1VERA 4PGDA 5K59E 1HOCB 5EWIH 2ZUQC 4U7SA 4JY4A 2EDOA 4JM2C 3W9EA 3RGVC 4TUKH 3QIWA 4U1KA 1LO3H 3VFGL 4OLVL 1BQHG 4R7DA 2V17L 1YEHH 5I17A 1WK0A 1WIUA 2OJZH 1KPVB 3NMEA 2F54B 3K4DA 5CEXA 1FO0L 3C2AH 3NGBC 3V0VA 5HYEA 2XY1A 4ONGH 3BFOA 2P8LB 5DFTA 1ERNA 3QG6A 5DFWH 4L8CA 3VXSD 5BMFH 4I48B 1H3PL 1RIUH 1TMCB 4N0UE 1CVSC 1FFPA 2XQBL 4KVCH 1ZHBB 1NLDH 4JQIL 4NKIH 4PRPB 5T5NF 3ZKXC 1FZOA 5HHME 2P5EA 4GRWE 4RFNB 2HFFA 1NC4D 5FECA 1AR1C 3TBSB 4MX7B 4HCRH 5I18H 1SVZA 3LKQA 1XGRB 1XGTA 4PG9B 4OFKA 2WINA 4TSCH 4G9FB 4LLMB 4KDVA 3ZSSA 5F7WC 5EBLA 3JV0A 2P8MA 3REWB 3V7AE 2H8PA 1GAFH 4XVUC 4YHNA 3O6LH 1QLEL 1G7QA 5LCVL 5A2JH 3QISA 5F7HA 2HT3D 4U1MB 1OARH 2YMXL 4L5FH 5IVXE 4NQEA 4Y16A 2B5IB 3CX5K 2DLEA 3GGWB 5ALCH 1QD0A 1V3JA 5E1HB 1OAUL 4CW1B 3QUXB 32C2A 4M1CC 1TVDA 5B8CA 5D7LB 3GUTA 3HI6L 4U6TA 2YPLA 3OGCA 4N0UB 3PWVA 1A7QL 1I7RB 1E28B 3SY0B 1DTUA 3DECA 1G9EA 4X6DE 4GRWB 5JW4N 1Q9WA 4LOUC 1ZLUH 2FD6L 4O2FA 2AJYL 3QWOA 2QTEA 4L3AA 3DVNB 2KH2B 4Y1AD 35C8L 1XIWB 2ZCHL 2Z0BA 5CKAA 3QRGL 1T03H 4FQ1H 1D7FA 1S9WA 2FGWL 3OG4B 4LQ1A 5J11B 5DMGD 4P2RE 4KXZH 4KKBD 1SJVA 2BNUA 1UADC 1I8IB 2BY2A 2DWDB 5IESH 5T33H 4WFHE 2V6HA 1MCOH 3W9DA 1N2RA 3QIUC 5DJAB 3F6IA 2FIKB 2V5SA 3RWIA 4OCNC 1AHWB 3MC0A 4ZS6C 4PJAE 3HCVA 43CAA 1OAKL 1NMBL 3WE6A 2Z93B 3MJGX 3WFHB 1K6QL 1KB5B 5GRUH 2Q7YB 3RX8A 1A4KA 3R1GL 4LLDA 2EIZB 4L1DA 3HMXA 3CIQA 5D7SL 4WTZG 1CD1A 4GT7A 2IGFL 1JNLL 2VWEE 4L4VB 3BN3B 5CMAA 1FVDB 4P57A 4LCWA 4S11A 5IB3A 4NKMB 1DBMH 1NBVH 4OUUB 5C0BE 5J13C 4HEPG 3QQ3A 4Z7NF 5HYJA 1IC7L 3WYRA 3LN9A 1IEHA 3D69A 2AJXL 4NGHL 3L9RB 5HYSB 2QEJA 4O2CB 4UBDD 1NCTA 4G9DB 3VFUB 5F9OL 3L3IB 1EUTA 1MRCH 4ZAKC 1G9MH 2FB4L 1FL3A 4MNQD 3BD5A 2X7LB 5SX5K 2HWZL 1CFBA 1S7RB 2Q86A 5C6PB 1MHEA 1MCLA 3HS0B 5I1DA 5I8CB 4GXUN 3CD4A 3U1SL 4M1DH 4F2MB 3RHWK 4MA8L 2BRRH 4X4YA 2QQLH 1EEZA 1IEBB 1Q0YL 5LAXB 1WVZA 4GBXA 2IG2L 1GHFL 1MEXL 1YEDB 5C6TH 5T5FH 5IKCA 5JIIA 1HILA 1N0XH 5C0BB 4NZTH 3LEYL 2DYPA 4TNVF 4H25A 1Z6JT 4YPJA 1ZA3B 4FZ8L 3EHBC 4HUUA 2I27N 1A1OA 2OI9B 4HKJA 3UTTD 2WIIA 4YBQD 2YN3A 3FQRA 4QHMA 2EDDA 3P9WB 4QLRA 5FUZL 4KUCD 5F9WC 1UB5B 3FB7B 1MHPH 1N64H 1OOAA 3O2DH 5D4QA 2Z35B 4YDVA 4L8BA 4MNHB 2YD1A 4H88H 3KYNA 2SEBA 3JVGA 5TE7H 1A4JB 2IH3B 3EYUH 3UJTL 2VXUL 3DURB 3NIGE 1O5DT 3QP3A 3AREB 4X5WB 4RMVA 2Z8WC 1IAMA 2VYRE 2VL5B 4LLQB 4D8PA 2UVFA 1CQKA 1UJ3B 2ATKB 2X89D 2F54D 4AG4H 5HDBF 1UZ6F 2XKNA 5DJ2A 1BECA 5CD5C 5IV2A 3LD8B 1QBLL 3SOBL 3S37L 5GS0C 1P7HL 2R0WL 3QNXA 3ARDA 5GRJL 5GRXG 3ILQC 3WIHA 5HI4D 1EGJL 1J1OL 5C0JB 3WFZA 4PRPD 4PGCB 4F9LA 5JMRA 5CEZE 2OZ4A 1HEZB 5GHWH 4Z0XA 1QPXA 4XX1E 2CXGA 1OAQL 3LV3B 2QQKL 1CGTA 1LVEA 4HS6A 2R1YB 3KS0H 4HC1A 5DD0L 4G6FD 1G0YR 1U3JA 3BDXA 1G1YA 1U92B 4HIEB 1B4RA 1JUFA 1F13A 1OGAA 5EG6C 1YEKH 4X4ZA 3VG9C 5FYJH 1FNHA 4IRJA 3MLXH 1GIGH 1R3LB 2JK5B 1INEH 4PTUB 4LVNC 2BP3A 1HH9A 5F3HB 1HSBB 2X4PB 1NSNH 1O0VA 5FDWA 1U8HA 3QUYC 4JFHE 2QQQA 4LKXA 4PGZA 4D0CB 1QA9B 3DHJA 2RFXB 1UXSA 3QUXD 4ZPVA 5D7LD 1NEZB 5DVKA 5IFHL 1OW0A 1FL5A 4ODVH