2DRUA

Crystal structure and binding properties of the cd2 and cd244 (2b4) binding protein, cd48
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
180
structure length
180
Chain Sequence
FQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYEMVSKPMIYWECSNATLTCEVLEGTDVELKLYQGKEHLRSLRQKTMSYQWTNLRAPFKCKAVNRVSQESEMEVVNCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Binding Properties of the CD2 and CD244 (2B4)-binding Protein, CD48
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Immune system
molecule keywords chimera of CD48 antigen and T-cell surface antigen CD2
total genus 38
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2006-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2druA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2druA02
2AI0H 2NW3B 4E5XB 4B41A 3REVA 1TTUA 3CFJB 5DWUL 2DQGL 4S1QH 3TVMB 4QRPE 2Q6WB 3S9DB 2HLFC 2KUTA 1H3XA 4OSUH 1W72L 1JNHA 5EO9B 4YH6A 3B8YA 4HXAL 1Q8MA 3OAYK 3RVTC 4WI5A 4MA8L 2VB5A 2OL3L 3ROOB 2WWMC 1HHHB 1G0XA 1E4XH 4M1CC 4HK0A 1OTSD 1UYWL 4L4JA 2YPVL 3UYRL 1AP2A 5GS0C 4MSWA 2ID5A 4UT7H 5F21B 5FYLL 4JFED 4B5EA 5JW5B 1ADQL 2XTJD 1S5IH 4EXKA 1AD9B 4QXUL 2C4FU 3T1FB 3RY5A 1I7ZA 4YE4H 3GSOA 2X4PA 3I50L 3DJ9A 2MKWA 3D18B 5I18H 3MYJA 4AJ0A 4MNHA 4XMKH 3MRJB 3JWOH 5DJ6A 5BCAA 4RBPK 1FHGA 1JGUH 1YNKH 3O9WB 2AJVH 2E27L 3M8OH 4ZO6A 2FL5A 1YMHA 3BKMH 2IBGA 3V6FA 5I66A 5C0GB 1SYSA 2ZCLL 4J8RB 2R23B 5T3ZE 2RQ8A 3U36B 3LPFA 5BW7A 4WV1B 3E6HB 4M1GH 3ARGB 4LHUB 1CICD 2AJ3B 1MCKA 3QEGH 5C0CB 1YUHA 2FO4A 2BNUA 5HYJA 4Z7OE 3DX6A 1XAUA 4LPXA 3AC0A 3KPPB 4DGVH 3JVGA 3WFEL 2NX5B 4A6YL 4DKFL 2B0SH 4XVUC 2LU3A 1PY9A 4O2EA 3O8XA 3EYUH 1MSPA 2JJVA 3ZYJA 4Y4KD 1I75A 12E8H 1IGIL 4M1DH 4KK6D 4Y1AD 4FQLL 2CIIA 2BSTA 3J7HA 3HC0B 2APXA 3KDMA 3T3PE 4LU5H 1IARB 1G0DA 5DDHA 4JANA 4KQ3L 2HTLC 4WNQB 2ARJQ 3LEXB 3FL7A 3Q1SL 1T03L 4U6XA 3LIZH 1A7OH 2KDGA 2MCPH 5BW7C 3OV6A 7FABH 5J9PB 4QF1A 1JI2A 4NQDB 1MI5A 2GK2A 2ZUTA 2IGFL 4HJJL 4XMPL 1YY9C 3GMMB 3O6KL 1NLBL 3O2DL 1A3LL 2HVKB 5IV2A 1JF5A 2YBRB 5MEQB 3MODL 4XPTL 5DJ2B 3QIUC 1KIQA 4XP1H 5SWZA 3G6DH 5T33H 4GKZA 3GSXA 2XQBH 3QISA 2W38A 4JDTL 3LEXA 1DTUA 2GAZA 1A7PL 2IEPA 1E6JH 2VKXA 2J88H 1F3DJ 5C71A 3KYMA 3CH1A 5ACZA 1WT5C 4Q0XL 4TOYH 4Y1AE 2GW5A 4EDXA 2GQHA 1T1ZA 3B5GA 4YDLB 4N8CH 4U3HA 1ZVSA 1F6AB 5D6DC 2J8UA 1XGTA 4KKBD 2N56A 3IF1A 3HE7D 1Q94A 3S4SB 3A67L 1KJ2B 1XZ0A 5ISZB 1MCOL 1B90A 3IU3A 4LCWB 2EEDA 3CVHA 3VFMB 3WL9A 1AGBA 4X9IA 5C0EA 3E2HB 5E4IA 1BX2A 4GAGH 5HPMA 2FYYB 4NKQB 3HC3L 1TPXB 3HFML 5D7IE 2DQTL 3MACL 4I2XE 3A6OA 2MOVA 1A3RL 1MIEL 2AJZA 4ISVA 4XPBH 1UWGH 3SCMA 3ZYOA 3Q3GB 3GDBA 3LY6A 4G9FA 5IVOA 3QBTB 4X9FA 4MA1B 4L4VB 5GRYA 1QFHA 3KJ4B 4LSVH 1R3IH 1KCKA 3HUJE 4PB0L 2WBJD 5DURD 1MFDH 1ORQA 1UZ8A 1FZMB 4G7VL 1XH3B 4HLJA 4RFNC 4XPFH 4GRLA 2R9HD 3C09C 1K3ZA 5HVHC 3KPNB 2IPKA 3LD8B 2XQYG 2ZG1A 5EZJA 3LH2H 2ZNXA 4PLNC 1KNOB 4M62L 4Y0GA 1F2QA 1FZJA 4AEFA 4KQ3H 1A9BA 1P84J 3AS0A 4A2LA 5AUMA 3VFGL 5GGQL 5FV1L 4YWGH 3FT2B 3QPXH 3N1QC 4YGVB 1EZVY 1PG7W 4MNQB 5TGBA 4M6AA 4HW6A 4NBYB 4BZ2H 1OOAA 1AD9A 3QDMB 2F58L 4PY8I 5KOVC 4CN1A 2WUBH 1I3UA 4HV8B 3CMOL 3KYAA 1JV5B 1OTSC 4P2OA 5EU6D 4OZGF 2ADIA 3GBNL 4JRYA 5F9DC 5GJSH 4AG4H 2QQNH 4LLDA 1KT2B 4HFUL 1KIRA 2OZ4A 4R9HA 1EDQA 3U0TB 3LN4B 5JW4M 1I1AB 1T5XA 5F70A 1TZHA 1G6RH 1IQWL 4Y5XA 4HBQA 5DJZB 1RIUH 4KKAC 5D1XB 3MLZH 1RZKL 1MRDH 4NM8H 3O6MH 4EDXB 1S7XA 1YMMD 4JRWA 3BFOA 3F62A 1CG9A 4IRJA 4N8CL 5T3ZH 4HMDA 1KCVL 4EIZC 4H1LB 3G6JA 5IIEA 2ZG3A 3OXSA 4JFXB 3M45A 2QSVA 3VCLA 1ZK9A 5FUZL 5SWQB 3SKNB 5DVKA 4UQ2B 4E42A 1VPOH 5DMKB 1IGIH 3NFNA 2HWZH 4U7KA 4MMZC 1FO0H 3MBED 3HC3H 4N0CD 5F9OH 1RZGB 2P5EB 4X99A 2HKFL 1UM4L 5SX4I 2FWOA 1CGVA 4XCFL 1CD9B 4Z95H 5M7QA 1F02I 4L9LC 4HIXH 4OCSL 5IMLA 2VR9A 4IRJB 4KMTL 1M6OB 3BN9C 5D1QD 3V5HB 5FGRA 1NANH 1YMMB 4RX4D 3BEVA 5E94A 1DQDH 1U8PA 1DBAH 2DL9A 4M8VA 3RGVB 1ADQH 4OM1H 3CK0H 4JFFD 3W5MA 5CINL 5L2KB 1AFVH 4XH2B 1KNOA 5IB3B 2EECA 2VZTA 1X5XA 5C07D 4HUUB 3VFGH 4PRPA 1MY5A 4G3YH 3A6BH 5GGTA 4Q7DA 3MX0A 4UNTA 1HQRB 2CK2A 4QHLB 1YJDC 3BQUA 3MRIA 3RWCA 5F3HB 3HI5L 5F71A 3SGEI 3UJJL 4WI9A 1CTOA 4K9EH 3GRWL 5C1MB 2G5BB 2VC2H 1NBYA 4U1IA 4K3JH 2EYTB 2FATH 2OL3H 1R5IB 4U6YA 3L7FB 1XF1A 3ULSA 5IHUL 5F7EL 5F6HJ 2CD0A 2VJXA 4YXHH 1MFEH 1LE5A 1MAJA 1NAML 1PYWA 2ICES 2R56L 1PW3A 1MPAL 5GGRA 2MPAL 4M6MH 1JNLL 2AGJL 3A6CH 4Z7UB 1A6UH 4U6VL 5E6IA 3GRWH 5HYSB 4RFEB 5ALBH 3C5JB 4G9FB 3RNKB 5IVXF 3U30B 1I3RB 3HNSL 4LGRB 2BX5A 3BDYL 4DZ8A 3RJQB 2YD7A 3VH8B 5HHOB 3MLYL 2YPLD 3HPLB 3PDOA 4WEBL 4M93B 1KB9K 4QTHA 1TENA 4NKDA 3W2DH 3MBXH 4JFPA 2YK1L 4X6CA 2VAJA 1E0OB 4XPFL 3RTQC 5E6YA 4HWBL 1GGYA 2XWTB 5A16B 4P9HL 5IKCA 4F33A 4LVNC 1FO0L 4P9HC 1D3CA 2APBA 5J06A 5JHLH 2NTFA 3MRGA 3CFIC 3MV7D 3GGWA 1CFNA 4WU5B 5IEKA 5GGUB 2MHAA 4RMQA 5E8NB 4KAQL 4JB9H 5GRJH 1R0AH 2ZUWA 5DD5H 3S4SG 4QHMA 3G5YA 5GXBB 1IGML 1RZFH 5HVWA 4KPHH 1BFOB 4XWOC 2VITB 5FCUH 2DQCH 4BFEA 1Q38A 3S7GA 5DC4B 4LU5L 5C2BH 5C7XL 4WWKC 5JHLL 4UINL 2G60H 2QJDA 1YN6A 4KDVA 2EYSB 1GIGL 3MCKB 1M1SA 5FOBA 3FO0L 2K1MA 2KQNA 4PRHD 3WNLA 5GS1A 5I16A 5ANME 1T7VA 3AS3A 2JLLA 3UCRA 1G6RB 4QT5B 5C9JB 4LKXA 3GM8A 1MVFA 1BFVL 3LKQA 4LSQL 5GS2D 3FN0H 3DUSB 3OAUL 5IF0B 3V0WL 4G8EB 3MYJB 1BJ8A 1QO3A 2NYYD 3QCTL 3R06B 4HS8H 4IHOB 4PGDA 4UINH 2OXGA 3V4UL 1LK2A 1CICC 4NPYA 1MWAA 1AR1C 1FG2A 4QGYA 1LEKB 3FQTB 4P49A 4NQEA 2YN3A 4ONFH 1C08A 1V7MH 3IXTA 4OV5B 3P0GB 4H25B 5EFIA 3ULVH 1KTLA 2Z31D 4XHQA 1IQDB 5I71B 1X5JA 3QDGB 3LKQB 2VWEE 1JWSA 3CPLB 3AY4C 4OIIH 1S7QA 1T04B 4BH8B 5C6PB 3KR3L 4XNQA 3LKOB 4ZQKA 3ZZ1A 5DHXB 4PG2A 4DZ8B 4BYHA 4KRLB 5A2JH 2A9ML 3LN9A 3DXAB 5EO0A 1JGVH 1YA5A 5IWLA 3PQYD 4LCYB 2BJMH 2D4FA 3FB7B 2IPTL 3ESVF 1NGWB 2NW3A 4E5XA 5E2VH 4R26H 4X9BA 4UV4H 5E7FA 4K9EC 4OZFB 4Z78A 3GMOB 1SYVA 3DIFB 2XWJB 3RZCB 12E8L 5BVJA 3VW3H 3QCVH 3TP4A 3BWAA 3ULUH 4I0KA 4PJFA 3NACL 5DD6A 2XWBA 1G7LA 3MOAL 4OD2B 3BPLB 1UJTA 3UEZA 5KZCD 1EO7A 1KFAL 3CXDL 4OI8A 1GJIA 2I9TB 2Z31C 2PW2A 1CLYL 5ESVB 2E5EA 2PTVA 3Q2CA 4HFWB 2HFEA 4IRZL 4JCMA 5BS0B 1H8NA 1N0XH 2Q7NA 5JA8B 3MLZL 3VI4E 5EH1A 5E1HB 5I1AA 1RFDL 3X12B 5FM8A 2G75B 5CLWA 5T33L 3BKCL 4JFYA 5DFTA 1GGCH 2VXVH 3JTSA 5DSCB 3EYSL 1FNAA 5IK3B 3L95B 1U93A 3RA7H 4OLUH 4Z8FH 2AQ2A 3SDXB 3SKJH 3V5DA 4DKDC 3C08H 5HHMB 1MAMH 2A9NL 4NKOB 4H26B 3ZTNH 4Z76B 5T3ZD 2E8YA 3M07A 1HN1A 4N0UA 5FYLD 4MJ4A 2X89A 1TVBB 3S35H 2PYEA 4MMXC 3PGCB 1YPZF 5LGHH 4FG6C 5D2LB 4UTBL 3NPSB 2GI7A 1SJVA 3MGTB 2RCSL 3MLXL 4I0PB 4Y4HD 4PJ7E 1EPFA 5M95B 1CLOH 4HCRL 3MXVH 1G7HB 2H8PA 1LDPH 3D2UA 2Y07L 3G5ZB 1I1RA 3ZDZE 4EXPX 2CIIB 1TNMA 3JV4A 5D96C 2BSSA 1LD9A 4YDVA 3VG9B 3VXUE 1E6OH 3L1OL 2X05A 3FHQA 3QNYB 4MAYA 4UT6L 1HDMB 1P9MA 4KV5E 1WT5A 5CEYA 4X4YA 2QBWA 7FABL 4G9DA 2CH8A 2XTLA 2HH0L 5A1AA 2JCCA 4FQ1L 4XGZA 4P2QB 5J13C 3UTTE 3K1DA 5MENE 3UJJH 2IALA 1HWGB 1VGKA 3VFTA 3QIUA 5I75C 4GAJH 2EXWD 1JI1A 1CDHA 1NCCH 4X7SH 4PB9L 3BZFA 2YEZB 3ZYZA 4X7CC 1K85A 5FGBC 3TIDA 3FQNB 3GSQB 1NCDL 1R24A 3KPSD 3PIQB 5HTSA 3IDMA 3RHWF 1EMTL 1WFUA 4HIJA 4P23D 4MB5A 5JXAL 3NA9L 1NCAL 4NP4H 2H2SC 1EJ6A 2P5WB 2UYLA 4YBQC 1UWEL 1DQLH 2IPUK 1X5KA 2W0PA 4MGXA 2Z93A 3IGAA 1T83A 3MROA 3IDGB 1LE9A 1KLGB 3DI2B 3M1BA 3TT3H 1RURH 3QFDB 1G9MC 1T2JA 1IC4L 5I1HH 1T22B 3EUUA 2DICA 3UO1L 5HVHB 5D1QA 5I6XC 5A2KH 3VMNA 3C2AH 5D1XA 4YDIH 4JGJA 4PYGA 3WIIL 1MI5E 5GRWA 3K74B 3KR3H 2YN5A 4N8VA 5C6TH 2FHFA 1XGYH 4AT6B 1KXQE 1DFBL 1JGEA 4Y19B 4ZOCA 1T89A 5E8NA 1BM3L 3VD5A 2ZUXA 3QDJB 1R3IL 5C0DA 1U8MA 3QXAA 2FHCA 5FYJU 2YKLL 5E8EA 1B6DA 5IOPA 1MFDL 2W0KA 3EFFA 3QHTC 1FVDB 3TZVD 4HIEA 4HG4K 5HGDA 2C3VA 1FG2B 2YWYA 5AG8A 1MJ8L 3ARWA 3WL9B 2A77L 2XWBB 1UM6L 2VN4A 4G7YL 4XB8A 5HSFA 1T0MB 4N8VB 4UTAL 1JWUA 3CSPA 1UKTA 5LKNA 3MFFA 1UJ3A 2HMID 2HT3D 4O2EB 2JJTA 1AXTL 5FGSA 1IT9H 4RMUA 5C9JA 4ZXBA 1EEZA 4P48A 1UB6A 5HGGS 2Q86B 2C4FT 3LOWA 2J4WH 4YHKH 2FB4L 3SO3C 4XPGH 5MP6H 4YQXL 1C12A 4PG9B 5BXFA 3BVNA 5CEZE 2DQJH 4P5KB 3NIDF 4O2CA 3VXNB 1NC4D 4WWKD 1HH6B 4AG4L 1A14L 3OMZA 3VA6A 1N8ZB 1RHHB 3CSYA 3E8UH 4ZYKB 2P5ED 4OB5L 5CBEB 5CJ5A 3OAZK 3ZL4L 4NQEB 4XNMA 1EA9C 3IRZA 5CSGA 4QHKI 3RKDD 2AEIT 1KJ3L 2O93L 5EOQL 1U2HA 3V95A 1NCAH 3VXOA 4KGLA 4R97B 5BS0A 3FONB 5LCVH 5L9DH 1ED3B 4NO3B 1U95A 1UKSA 5IHZB 4KQ4H 4LASL 1F13A 3TBWB 4ODUB 4RFOL 3H3PL 1KG0A 1RUKL 2JCCE 4YC2B 2VUYA 5IHUH 4Y4HA 4JFYB 2ZCLH 2H3NA 2X4QA 3BJLA 4ZUUB 3ORJA 1ITCA 4ZS6D 4XAKE 1WZ1L 3SPVA 5D7JB 2LFGA 3SDYH 4PRNA 4HJGA 4JFQA 4Q6YA 3NFPA 4K94H 1X5YA 5F9WB 3C5JA 3VRIB 3FQUB 3MXWH 5D2LE 2OZ4L 2YD4A 3RPIA 1ORSB 5E4EC 5JOEA 4YDKH 2GTZA 5J13B 4NOBA 3IS1X 3VI3F 2F54B 1Z3GL 1NJ9A 1G7QA 4GW4B 3TVMD 2P1YA 5ITBH 1DEEB 3F7RA 2ICCA 3TNMA 5KAQF 1EO5A 4NO5A 2PO6C 3OQ3B 3VXQB 5IT2L 2F58H 3INUL 3WIFB 1VDGA 1GAFH 2BCKA 3IDIA 5LAXA 1OSPL 3O4OC 2IQAA 4ZPTB 3MLWH 4JANB 3IVKA 1C7TA 2HT2C 3PWUA 1MQKH 2D31A 4PJ9C 4F8QA 1VFOA 1BLNA 4Q6IA 2RR3A 3FT4A 4XXCA 3WUZA 1OSZA 1IJ9A 5TPWL 1IQWH 4OCLC 3QZWA 3FOLB 1RZFL 3BH8B 3BUTA 1U2CA 1SVZA 2EIZB 3BPCB 4QEGA 3DO3A 1DL7L 3I50H 2EYRB 4PLKC 5ADOL 5DMIH 3FN9A 4XC3H 1I8MA 4PRHE 3T65A 3U4BL 4YHZH 1CDUA 5BVPL 2UZIH 4NRYA 3MBEC 1WZMA 2EE3A 2XG4A 2ZSWA 1T1XA 4YHYC 4MJIA 2VABA 3PGFH 5H37H 4WO4D 1KJVA 1NSNH 2IADA 4YHNA 5DRWB 4I5BB 1S7SA 1LO4L 5F8RC 3ALPA 3FB6A 4IMLB 2R1XA 1EHXA 1OAYH 2BFVH 3DARA 4L4TE 4JRXA 2I24N 3NMEA 5TE4L 3UTSB 5ALBL 2ATPB 3CVHL 5DC0A 3AMLA 2UWEB 3IFLH 2GFBA 4G6MH 2BSRB 4YDJB 5IFAH 3OKKA 2GYSA 1KXVC 2NY2C 4K2UH 4Z7NF 4ODBD 3EYUL 3MR9B 2DTSA 5L0QC 3IS0X 4XNUL 1JMXA 2DOCA 1LILA 5D2LF 4Z76A 5HYQB 5JXEA 3UTTA 1TJIH 2C1PB 5EBMB 2WWKO 4I9WD 2EO1A 2I9LA 2IH1B 1XF5A 3OG6B 4LGPB 4ODWB 1OF2A 5AZ2H 1O0VA 2BFVL 4NGHH 2EDQA 3I9GL 4JREC 5JQ6H 2R29L 4P2RD 5LGHL 4HUXB 2Z9TA 4K7PH 1W0WB 5EOCJ 4PJ5A 3VFVB 5IMOA 3TBTA 3ROLA 4NM4L 3MMEB 4UDTB 5KVDH 4L8BB 4NRZB 4DUXA 2FB4H 3OZ9L 1XF2A 1JCKA 3EOAB 3RVTD 3WIFA 4ZFFB 5KAQG 4PD4K 3MRCA 4RISL 1UWEH 1JZ2A 4X6CB 1RJLA 4G8FA 4AIZB 4Z7WA 4JFEB 3ZKMD 3FAWA 1FNLA 1JGUL 1YNKL 4FZEL 2IJ0C 4HIHA 4V1DB 5B39A 5FECB 4K8RD 2A6KB 3MRKB 1K3IA 4PBWD 4U6XB 1S3KL 1N0XL 3U46A 3HZYA 4OM0L 2EDTA 1I1AA 4ELKB 3K81A 3SE4C 4DAGL 2C5DC 3GMPB 3PWVB 4NFCA 4GG6E 3MJ7A 5J8OA 3IDXL 4ONHB 3QUYA 2R0LL 1J1XL 4OLVL 2YS4A 4LSTH 3THMH 2A74A 3BKCH 3QDGD 2IANA 5B4MC 4Q2ZB 1WBYA 3Q48A 3QUMB 2J7LA 5HHVL 3KYOA 3HAEA 4P9MH 3A67H 1RZJH 4CVZB 5LWYL 3OAYH 1R3HA 5I8KH 4Q74A 4GMTL 3EDJA 4JFFE 1FC2D 2H9GA 3F5WB 4FTVE 3RX8A 3VGFA 4KKAD 2KQMA 4QNPF 1MHPL 3VRJA 4P9HH 3QG6B 5BQ7B 3NA9H 5F44A 2WIIB 4NJAL 4U4BA 1U8QA 3O2WL 3Q6FA 3OR6A 4CNIA 1OTTD 3WJJC 1IKNC 4LSTL 1FH5H 5DUBB 1RSFA 4M4PA 3RRQA 5ILTL 1OARL 1NMCB 2VZSA 3MGTA 1Q9WB 2LTQB 1RURL 2BNQE 1YMHB 32C2A 4HCRH 2NY5H 1M7IB 3TNMB 4H0GA 4OFIA 4YBHA 1L6XA 2CUIA 1EO8L 3S4SA 4X98A 2EC8A 2H32H 4HHAB 4LCUB 2X4OA 3MNVA 5EBLB 4YHPA 4BSWA 1WWCA 3EO0B 4Z7UF 2D03L 2VXQL 1RMFL 5F88A 1P6AB 4XTRD 2LU7A 1R6VA 1QBMH 4CADB 4M7ZB 3HE6B 1NBZA 4R96A 4YNYB 1R3KA 4YR6B 4FTVA 5CLTA 4NQED 4NUGL 3TV3L 4AENB 5I1LA 5CINH 1JNHB 3L9RB 5INDB 1A1OB 5K59E 3GGWB 4LSDA 3ARBD 2X4RA 3LB6D 1RMFH 3GIVB 4RRPA 2VDLH 1AGDB 1U58A 4GMSL 4POZC 4WI7A 3EDKA 5MEOA 3RIAF 4P4KA 3LEVH 4CU6A 3ZDZF 1IT9L 43C9A 3ULVL 2LQRA 1EMTH 1DQQB 3TBSA 2E7MA 5DRZA 1X4ZA 1WEJH 4X0KB 3CC5A 3T0BA 2R4SH 3PABB 3TV3H 4P5TB 3OL2A 1V7NH 1BGXH 2DQEH 5D7LA 5E24E 1A1OA 5CIPH 5ANMA 4UMGA 3S88H 1CZ8H 4N9GB 2W9EL 4P57A 1MFCH 3OPZL 4RFNB 2OTWB 4TRPL 5EO0B 1A14H 5DRNA 3VWJD 1IBGH 5D1ZC 2AJXL 3QUYD 5HHOA 4FXGA 4NDMA 1NEUA 5KN5B 2XT1B 4GRLB 2FGWH 1U3HC 5EU7E 5DZOA 4AZ8A 4NQTA 3WIIH 1MREL 1UH3A 2NZIA 4CL7A 3DX6B 3VXPB 3GIZL 3PP4L 4FQ2L 4NO0D 5DJYA 1XCQB 1QSVA 5HYIA 5FCSH 4NO2A 2NXYC 2ARWA 2ED9A 2R2EA 2H45A 1NKRA 2B20A 3GMRA 3QO1B 1GCFA 2AJYH 5FA4B 2AEPH 1IBGL 4A6YB 1JF1B 4K71C 2CPCA 3O81A 2IAMD 1TZIA 4OF5A 5ALCL 4NQXB 1MJ8H 1QSFA 1T4KB 2DIJA 2E6QA 1A1NA 5EC2B 1HXMA 3FFDB 5DLML 3PWPA 4J4PC 4BSWB 3JUZA 5EIQA 5SX5H 3O3EA 1SM3L 3DRQB 3QHZL 3L3GA 1UB5A 1BQHA 1YY8B 2CO6B 4YO0A 2P5WD 1AGCB 3GZKA 1Y6MR 1NCDH 5JDJA 3MJGX 4U0RB 5EN2B 4JHWL 5F8QC 1XF3A 1A1MB 1EHLL 1YEIL 3KYMB 3RTQB 4M7LH 3VI3E 4ONHA 1CFVL 5JPNA 2XQBL 1WJ3A 4YDJA 3G6AA 4JPIA 5JNYB 3PWNA 2XI9A 4YFLI 4U1SA 4HS6A 4OGXL 5MERB 4HFWA 1HQ4B 4JKWA 3LEVL 1G9NH 5CBAB 4MNQA 3NFNB 5HI4C 2WINA 3K4ZA 1IKNA 3QDJD 4LSQH 3JZ7A 4IOFC 3V8OA 3DSNA 4M7KH 4X7EC 3TF7C 2RFXA 4XVTL 4KJPC 2DTML 4ZDHA 4DGYL 5E9DE 5HHOD 1QVOB 2N7AA 4PJ8B 4KMTH 2CXGA 5F7KC 4PPTA 1K4DB 1QSED 4LBEA 3PWNB 4XVJH 3MBEA 1H3PL 3WFBH 5DD3H 3JVGC 3MBXL 4U3CA 4OLYH 4LHQB 2H32A 3FMGH 1JGLL 3QEQD 3SE8H 3DGCR 1J0YA 1LEGB 4D8PB 3OKOB 3QWOB 2DKMA 1V3JA 4NQDD 1YDPB 3EHBC 3EYVB 4HZLA 4RGOL 3GUTA 3S97C 5J12C 4NQUA 1HHGA 5FA4A 4ZUTB 1J1PH 3IDJA 5JLZA 4XXDA 4LDLB 3HI6L 4FTVD 2QTEA 3KNBA 3GHEH 3E0GA 4TUOA 4BQBA 1KCUH 1FVCA 4PJIE 2R0LH 5H94B 1I9JL 4FFYH 4PRHB 2JCCF 3RX7A 1DBBL 1A2YA 2BNRB 3G6JE 1AE6H 4D0DA 2IBZY 4Q9QH 4OZIE 5J6HB 2R0WL 5J1TC 4UILH 1J9CT 1NAMH 1AHWB 1IM3A 3N9GL 1Q9LA 5F7MC 5IFHH 2GJJA 1A0QL 1KJMA 4QRUB 3ZTJH 4M6ML 2NW2A 1PG7L 1NDMB 3ZE0F 4OGZA 3D85D 5ID0B 1MAKA 2GSIB 3EYQC 3GI8H 3U2SB 2FO1A 1MCQA 5ICZA 2FJHA 5DXWA 1LP9E 1UXSB 1U3HB 4G8GD 5DZNA 3VGAB 3H2WA 4JFHD 4RZCA 4PRIA 3ULUC 1BHGA 1FVDA 3GB7A 4KHXH 2NZ9C 1WTLA 1Q0YH 3IFOB 5ERWA 1P53A 3P4MB 2Z8VC 2NMSA 4RGND 4OIIL 2YWZA 4FZ8H 3S8WA 2A1WH 3AM8C 5CKGA 1TVDA 4JQXC 4NO0A 2Z4QB 4BKLB 2YUWA 2IANB 5FUCE 4UU9A 2Z91B 4G6KL 2BERA 4JVUA 4PJDE 1DANT 1NJ9B 1C5CH 4DKAA 3IRPX 1ZA3A 3BGFC 2A83B 1A6TB 4QHUA 1QFWL 1XF4B 1NLDH 1QEWA 3WO4C 2V5SA 3EYOB 3MJ8A 3OJMB 5DK0A 4WW2B 2D4DA 5E2TL 3PQYE 1JF6A 4ZXBD 3PWPD 1U8KA 5MHSE 3KPMA 3L3IB 3U1SL 4UT6H 3L3OB 4TULH 4FP8H 4JE4B 1FIEA 5L8JB 3OGCA 5I2IB 1BEYL 5C08E 1TITA 3P9MA 3VD4A 1QR1A 1WISA 3GSVB 4CMHC 1RPQA 4MLSA 2QR0A 2FCBA 4GRWH 5DA0B 1HK6A 5D7IF 1JYXA 3EO9H 4PRIE 2Y9RT 4EQ3A 4D0CA 1HI6A 1HYRC 1TJGL 1KN4H 3FQWA 4KKNA 5DMJB 4I48A 3L3KB 1AE6L 3QEQA 2ZPKH 1N59A 3HLAA 3MV8D 4WDIA 4CW1A 3RL1B 2ITCB 1A9EA 1QBML 4GXUM 4HEME 4G42A 3BAEL 5I1IL 4NCDA 4YHIA 4D3CH 4DK3A 1I7UA 1ROWA 3QIWC 1A4JA 4NP4L 3EO9L 4FTVB 3MRDA 4KI5D 5D1QC 3VJ6A 3B9AA 1OQXA 3GRWA 3BP6B 3EO1A 5DS8B 5IEHB 3OF6A 1HYSC 1MCHA 3B3IB 5CUSL 5HDQL 4KK5C 1WBYB 1MFAH 4MDIB 3SDAB 1ZTXL 4C56D 3JWNC 5C0GA 4KZDH 4EBQL 2A6JA 4Y4HC 5ITBL 3R8BB 1KELH 5MENA 5IVZA 4EI5A 2M1KA 4NZUL 4BH7B 3WKML 4QHNB 1OL0A 1DQTA 2EKSB 4U6VH 3I02B 1JUFA 1ZLVH 4UQ3A 3W9EA 1YQ2A 1OAUL 4PS4L 5AUMB 5JZ7D 4X5XA 1EFXA 2VDRL 5LXGH 1RJZB 1GOHA 2EXYC 5GZOC 1JNNH 1FZOB 5J1AA 1OP5K 4S11A 1RZ8A 1UH2A 1JRHI 4WI8A 2EIEA 3G6JB 4MD4B 5IIEB 4V1DD 3O3BB 3BPCA 3H7LA 1DL7H 1BWMA 1T80A 2BVPB 4KTDH 1N5YH 3R1GL 4LCCA 3TESA 3E1F1 3SOBL 5CD5C 1FBIH 4TNVF 3WN5B 4FQ2H 2CUHA 2GSGA 3SJVB 2FR4A 3K8KA 3EOTL 4R4BA 5HYSG 4M1CD 4R7DB 1NMAH 1GGBH 1UJ3C 5DEGB 2XNAB 1SVCP 1FYTE 5HHQA 5TQ2L 3BGMB 1VCAA 1HINL 1T2QL 4N8PA 2FLRT 3ARUA 2ATPA 2QHRH 3D2UD 1JTOA 5FIEA 4HMEA 1CXFA 2GK0A 3H3KA 2YD1A 4L8BA 4NRZA 3TVMA 3WFCH 1D5ZA 3T77A 4OJFH 1ED3A 2HYMA 3EOTH 1KTKE 4GMSH 5HI4D 1NGQH 5I1CL 4PRAA 1D9KC 4QRRD 1VEOA 1K4CA 4R7DA 1LQSR 3QNXB 5IESL 3VXRD 5C08A 1YYMH 1KCRH 2H3NB 3OKDA 4X5WA 3S96A 4RFEA 4Z95L 4WUKH 1MCJA 4P3DA 1OB1B 3OPZH 1MFCL 1GZQB 1MVUB 5DSCA 5A3ID 1KT2A 1ZTXH 3OJVC 3WO4B 3MROB 5FHBH 4DEPB 3RUGE 3QXTA 5F1IB 1P7QB 1Q0XL 4WUUA 4XP6H 4C54A 1KEGH 1K6QH 4M7JH 4BSVA 3KXFB 5ETUA 2VXQH 3DROA 2VOTA 4C55A 3A6BL 1RZGA 2VR5A 3MLTA 3QPQD 1JZ7A 4XVJL 5KW9L 3WLWC 1HQRA 4QHLA 3U4EA 3F6LA 2X4SA 3OXRA 3CDGB 4PJBF 1J8HD 4OUUB 2QR0B 2B0SL 4CKVX 3GMOA 5BVJB 2PTTA 5IVXA 1J18A 2FIRT 3K8LA 1WTGT 4ACPA 3ESUF 5ID0A 4XBPB 43CAB 3QR2A 5LBSH 1ZLSH 4KTDL 3UPAA 1OP9A 5AAWA 3MUGB 1J05B 1KV3A 5C0CE 3O2VH 2X4OB 4CVXA 1LGVA 1AY1H 1LO5B 1ZHKA 3N06B 3FT4B 1ZLWK 5C09A 2E6PA 2SEBA 1FVEB 1N5AA 1S7WA 3WNOA 5BJTA 3MV7A 1XIWD 1P9MC 4KVCH 2C1OB 4U1LA 5IVXB 3HC4H 4MHHG 2G5RA 2A38A 1TZGL 4KK9C 4QO1A 4ZODA 2CDFB 5I1DA 1AC0A 3HPJA 2BXYA 4NO0B 2CSPA 2F74A 1JGEB 4HZAA 4Y19A 4DKFH 2DBLL 1S7UA 3U6RB 3D18A 3LS4H 1AY1L 1N3NA 1GZPB 3BHBB 1FNSL 3LRGA 2V9RA 4PJ9D 1WSST 1NGZB 5EIVA 3IDMB 2FIKA 3ZT7A 2R2HB 1FV1B 1MHCA 4UUJB 4Y2DA 4F33B 1R5WA 3ARRA 2FNBA 3WNMA 1G6RA 1INEL 3ZDXE 2NZ9D 4JO1H 4PJEA 1BQUA 3QUZD 4K94C 1BWWA 2JELL 4XAWH 2ESVA 1MJ7H 4HH8A 3O2DA 3C09B 4H8WH 4MDJB 5CD3A 5L0QB 1ZWIA 3MV9E 3IJSB 4CBPA 2VH5L 1W2KT 5DUMH 5FHBL 3BIAX 1REIA 1YNTA 2AQ3A 2HVKA 1WBZA 2JIXB 2L7UA 5IV2B 5MEQA 3DX8A 4HIIB 3TZVC 3ILPB 3EOYG 1KEGL 4X6FB 4HGKC 4KI5F 3UROR 4MAYB 2ADJB 3WFHA 3QHZH 5D9SB 3ZMRA 2Z4QA 5E0QA 1WC7B 2DQIL 1U8HA 3PWLA 3UZEA 2BY1A 4KC3B 4WW2F 4YHMH 3P77A 4J23A 1UWGL 3B9KC 3QUZB 4FQPA 1NMAL 4J1UA 4TVPE 3SE3C 2Z31A 5HD8D 3TLRA 4F3FA 5E8OA 1T21A 3IDJB 4CN4A 2X9WA 4H1LH 5EU3B 1QFWH 1IVLA 2HA1A 3SGDI 4XZUB 4IIQC 5ITFB 2RB8A 1ZA6B 2AP2A 3GEWB 3GNMH 5CWSA 3LDBB 4KQ4L 4LASH 4OZFA 1ZVSB 4JJHA 2GUOA 4QOKB 1YEFH 4W70A 1N2RB 3QFJB 4TULL 5DC9B 4F15C 2B5IB 3UPRA 2X9YA 2DM3A 2R8SL 1XMWA 5F9WC 1ACYL 2V5MA 3MA7A 3QFDA 3VD7A 1LO4H 1AI1L 1WBXB 4FQHA 2OBGA 3HC4L 3O8XD 1NCBH 4AQ1B 1HI6B 3E6HA 3EW3B 4PJBA 4X8XA 3CFDB 2VLJD 2HJKB 4Z0BH 1EJOH 3WIHL 4G6ML 1WAAF 2X5PA 2HG5A 4Z7WE 2ZPKL 3UDWC 3SBWA 3OR7B 4P4KB 1H3VA 4O5LH 1RUPL 5J1SC 5F1IA 5GJSL 2ICEB 4L8SC 4ZUSA 3VRJB 3KPRB 2MPAH 2Q76B 1MHEB 5MERA 1OSPH 2K7QA 1A6UL 3I84A 5EU5B 4ZFOL 3VJ6B 3IXAA 2X10A 4NNPH 3SGEH 4JDZB 2RHEA 5IKCB 1I8LA 2V9TA 1S7XB 3O6FC 4X5WB 5GPRA 5F72S 3V6BR 1AXSB 1HHHA 4NKDB 3TYFA 1DEDA 2HRLA 1LO3L 4LVOC 1XF3B 5T5NG 3S5LB 5BO1H 2UUDH 2QEJA 3RVXC 2X1XR 5JOPD 4PJXB 4WY7L 5KANG 5DJ0A 5KBNC 1YEKH 4JG1H 2E9IA 4Y19E 5B8CB 5EZLA 4ELME 5HYQA 4YPGA 5SWSE 2UZIL 3ARDC 3JV4B 5FM5M 2D03H 5FECA 1QLRB 3LKSA 3RDTC 5T1KA 1U3JA 3LKRA 3EFDH 3LZFH 4C58B 1OP5H 4Z0XB 5IBLC 1A7BA 1X5GA 1A7RH 3CZJA 3VXUB 3NABL 5FEBA 5T5FL 4FABL 1SJHB 4OCYH 3RVUC 4IBLT 4MXWL 5K93A 3KWWB 1CI5A 1OGAD 4FQXA 4RNRB 1A6WL 3MMEA 3VXSE 1NBYB 4M43H 4X8JB 2MMXA 3HRZA 4Z9KB 1YC7A 4HDIB 3MFGB 1WFTA 1FZJB 2FX8L 4WJ5B 1W72H 3GJEA 1WZLA 5CEXB 2I27N 2O5XH 2DAVA 4R0LB 4MLIA 2WBWB 4HK3N 1J86A 5EU6B 1QRND 1VEPA 5CS7A 5GISL 2DF3A 4J4PD 4HUWA 5E08H 4I3GA 1G9EA 5EOQH 2Z92A 3G04B 4I18B 4ZTOH 5F7NC 2OR9L 3UTSE 4OLWH 4MQSB 4PJCF 2B7DT 2XFXB 1RHFA 5IHZA 3MGOA 4P57B 4ELKA 3KYNA 4KUCF 1N6QH 5FK9B 3FTGB 1OLZA 1Q9OA 2VC2L 3S3PA 4M6OL 1UVQA 5KVEL 4XMKL 5T3XD 4WHDA 1NKOA 1OP3H 4PJGF 2YA0A 2C3VB 5TE6H 4OSUL 4XMLH 1IL1A 4JDVB 1JF1A 1TVHA 2YUXA 4G8FB 4ODTL 4PJEE 1CFNB 4NNPL 4WU5A 4FZEH 1NUNB 3A6CL 3T0EA 4OCMC 4XBGA 4OD2A 2EDXA 1M7XA 4PJ8D 2WQRA 5SWQA 5I9QB 3UTQB 4NQCE 1RULL 1AQKH 4OM0H 3LDBC 4FFVD 5C9KA 3ILQD 3NZHL 4JZJA 3GMPA 4ZPVA 2BK8A 4RA0C 1PZ5A 3MLWL 3LEYL 3L3KA 5EORH 1ZS8B 4S1DC 2CLRA 3ABZA 2C3HA 2D31B 3W11D 1CE6A 3VFUA 1YMMA 1IC4H 4NOFA 5TE7H 2NTFB 2RJMA 4XBGB 3PL6B 2W59A 2V5YA 1CGWA 2FBJL 2FGZA 1KEML 3SGJC 3ZKQD 1O7SA 3FRUB 5MI0B 3C2AL 5C09E 3RNQB 5C07B 4K71B 4AM0B 1HINH 3PIQA 4F7EA 4F9LC 3DI3B 4AT6A 2JB6B 3O4LA 3MLPA 3BWUC 1DFBH 3O3AB 1XGTB 2EE6A 4AENA 4G5ZL 2DI7A 3CXHJ 4AEHL 1A6VL 3PGDA 4KRPC 4HS6B 4GBXD 3F8UB 3OWEA 2IH3A 2BOCA 3C08L 3IDNB 1P2CB 1KELL 1TZHB 4PTTA 3ISWA 3MRIB 4RBPH 4MD0B 3P0VH 1O7VA 3QIWA 1OWWA 4KJPD 2VDOL 4NKIL 4QT5A 2UZXB 3WN5C 3PWJA 3KPNA 1PAMA 3SJVE 1RZ7L 3UBXB 1JN6A 5F88B 3SJVD 5IGXH 2PYED 5BV7B 2O5ZL 2ZUYA 1A4KA 3RZCC 3GI9L 5ICXB 3FOMA 2YD6A 4LVHC 5K9JH 2B4CH 1CD1B 3TCLA 4PJEF 5FB8B 1Z9LA 5L2KD 3Q5YA 1UA6H 4YGVA 2VITA 1Q72H 3WHXB 2AV1B 5EZOH 1A1NB 1KYOJ 3NIFE 3VXTA 3OR6B 3I9GH 2Y7QB 4YXKH 2LU4A 4Z7QF 1DVFB 2ZJSL 3FO1B 2DLHA 3P9LA 2YXFA 3BRDA 3FT2A 5TFSL 4AH2B 5IBUG 5TDNA 3FOMB 4QOKD 3VFPB 3GMQA 5JMRA 1F97A 2PN5A 1AHWA 5J0BA 4FXLA 3AU1A 1MELA 5B38A 3QCTH 4HS8L 3DUHA 2ORBL 1T66D 4MZ2A 3L3IA 3CU7A 1WFOA 2OSLA 5FF6B 4M8QA 2Q87A 3LQZB 5E6ID 2AK4D 4TVPL 4EBQH 2XN9B 1FL5B 1I9IL 5HHPA 3PWUB 4JZNA 3ULSB 2YHGA 5DJXA 3RY6A 1ACZA 2CRMA 1K2DB 4S1SL 4JHBA 4LVEA 3BEWA 4X6DE 3IFOA 1IEBB 3GI8L 1ZV5A 1IGFH 2YA2A 1BOGB 3GMLA 3STLA 2AABL 5D5MA 2J1KA 1YY9D 4HV8A 1FSKC 2E7LA 4S1DD 1UXSA 4JY6B 3VU2A 1HSBA 1FFRA 2I5YH 1AGEB 3PV6B 3SDDD 1F4WH 3TFKD 4PJHE 2BRQA 4Y8AA 4KDTC 4OF0A 4JKPH 2QV2A 2XN9D 3JWDH 1T5XB 3WD5H 1X5ZA 2VZOA 1G6RL 2AV7B 4M62H 3EGSA 5IW6A 2DYPB 5JOFB 2H2PC 4P0DA 5DD0L 5ACMA 1JWSB 4UU9B 3LN5A 3CDFA 3WIHA 2BSED 1U8PB 4Q9RL 1HHJB 4R4FH 4APQB 2FD6L 5C0AB 4LKCA 4O5LL 1W8OA 4W4NA 3WS3B 4QF1B 3F6IA 5C3TA 5BZDA 3KPRA 2Y23A 1I3GH 1JPFB 2DJUA 4OD3L 1KOAA 2HTLD 3ARFD 3G5ZA 4HQQL 3WFCL 1DBBH 4U1JA 4Q9BA 5GSRA 5DYOB 4OIAA 2R2BB 4ZSOB 4HZLB 1U8LA 3MYZA 1PJ9A 5EUOE 4LSRL 2Q8AH 1AKJA 2PYEB 5J7CC 3QRFM 1HHGB 3QH3A 4ETQA 5KSAB 2CKBB 5I17A 2YSSA 3W0WB 3MCKA 2VLRD 3LS4L 4NQCA 4KKCD 3ZT6A 3AVEA 1MCWM 1S7TB 2JIXD 3RWJA 4KHTH 4MWFB 3QIWB 4XNYL 3P0YL 5IB1A 3Q6GL 2AEWA 4OKVB 1UM4H 2ZP0T 1RK0A 4K7FB 4TSAL 2IAND 3QDHA 4U33A 5ANMB 2ZOLA 4ZFZA 3MRQA 3DXAD 4QRPB 1CXEA 1QO3B 4FQCL 4IHOA 4PGDB 3PQYA 4ODUA 3F7YB 1QPXA 1MFAL 3OKLB 1QBBA 1I1AD 5HJ3A 4EDWH 1QP1A 1AO7B 3O4LB 5L88H 1JTTA 2X70B 1RULH 4PGJA 5C0JB 1Y18B 1DDHB 2WINB 4RQQA 2FGWL 1B2WH 3OTTA 4I2XB 1WZ1H 5JW4R 1IGCH 4JQIL 5IMKA 35C8L 4X7TB 4JJ5B 1GC1L 2RAMA 3EGSB 1HIMH 3MRQB 4GUPA 4PB9H 4PJGA 4I4WB 1MCPH 1CE6B 2ZNWA 4PV9B 2B1AL 1IZKA 2FX7H 4GKZB 4XBEL 1BBDL 3KPOB 5KVFL 4QRPD 1FLRL 3CDCA 3VE0A 4KK5D 2VLLB 3LSOA 4YO0B 3BOVA 2Z8SA 4X4YB 1DDHA 3JTTA 2HRPH 3O8XB 4ODWA 3AU1B 4FFVC 4YJZL 1CXKA 5F7DB 5DURB 2WW8A 1FGNH 3S36X 3DRQA 1LDSA 4IDJH 2I9TA 2A77H 4MD5B 1QOKA 2FX7L 2W9DH 4OF3A 4Z7WB 2VZUA 3QAZC 3Q1SH 1LK2B 4JPKH 2YR3A 3QI9A 4RMSA 1P5UA 5DT1H 4ZSOA 5LQBL 1Q94B 1PZUB 2NCMA 3L3DA 1YJDH 2CRIA 3WLBA 4CADA 1INEH 2M26A 4W6YB 1BVLA 1X9QA 4HJJH 3VFOA 3SDAD 1BBJA 4ELMA 3O6ML 1P4BL 4LIQL 3T2PA 1OAZH 4H88L 4R0LA 4WO4C 4XP1L 3LKOA 2BOBA 4ZQKB 5CP7B 1BFTA 3CH8A 3VFWA 3TJHD 1SEQH 2Z0BA 4OBSA 4QOKE 1Q9LB 4JN1H 4X7FC 4OT1H 3MJ9A 4LIQE 2VLRA 5JUEH 4LP4A 2J88L 3WLBB 2UWEE 3RGHA 2HFFB 3NAAH 2X41A 1FYTB 3UXFA 4CMHB 4I13B 2M2DA 3ARBC 2HKHL 2Z8WC 2F9BT 2VDKL 3MFFB 5IB5A 1JPTL 4WFHD 3LMJH 4G8EA 1H3PH 4GXVH 2KKQA 2VL5A 4NRXA 3C5ZA 1VA9A 2PW2B 4P59H 4TSCL 5ESVA 3WS3A 1RY7B 3GMNA 1WWWX 1J0ZA 5C0DB 4I77H 3WS6C 5IR1B 3CCHA 3DO7A 5INDA 4PJ9B 2PF6A 1CK0H 2R4RL 4MCZA 3UTOA 5AZ2L 1DSFL 3ZE1F 2XIDA 3GBML 3MV9B 5FOBB 3HFMH 3LKRB 4M8QB 4LOUD 2OYPA 4WNQA 3U4AA 4YXLL 4ZOAA 1ORSA 1GGBL 1SEBA 1J1PL 1EHAA 3FO2B 5E2JA 4Y2DD 3DXAA 2HT2D 4X0KA 1DQJB 5ISZE 1WV7T 3FN0L 1EXUB 1NEZA 3X3FL 5D7KD 2G2RB 4Y16A 4NN7C 1QRNB 1BZ7B 3C6LA 4O2FA 4Z0BL 3WIHH 1AC6A 2E6JA 4R2GC 3VXSA 4K3EL 1T4KA 2NR6D 2UY7A 2VDPH 3H9SE 2HTKD 5KTEL 1B3JA 2IMMA 1IC7L 1UACH 4PY7B 1CICB 1UKQA 4DQOH 3N9GH 4Y5VA 3VFPA 2PUQT 3N0PB 3HNTL 3SKNA 1FJ1B 4KMLB 2Q76A 2ICWJ 2ZUQB 3NIGF 4GT7A 4U1GB 1ONQA 4AY0A 3MXWL 1VADB 4HWUA 5GGSY 1WVZA 3E6FB 4R90L 3MCLH 1CDCA 1P7HL 1MRCL 4TTGA 3FO9B 4PJFE 4Z6AT 4XC1H 3U82B 3LD8C 1KGCD 2XXMB 1IC1A 4QWWC 3MZGB 2NY4B 2NX5A 4KJQC 2DLFL 2EICA 2Z8RA 1L0YA 2BY3A 3WE6A 4DK6A 1CDBA 4KRMB 3VDBA 1EGJL 1HSAB 1HXMB 2MJWA 3P11H 2X4QB 3MOAH 1F4XL 5K9OA 3NN8B 3HCVB 5JZ7C 5CIPB 4LCWD 3GSNB 1VERA 4NN6C 4HXBL 3TA3C 3S35L 2VQ1B 3OKDB 4F80A 5J11B 3QXAB 4NZRL 5T3ZL 5MI0C 3T0EC 4GAYA 2ICEA 4K23L 1YEIH 1RFDH 1IGMH 3RWCB 5C0BD 5CGMA 3O3DB 4XMPH 1CFVH 3MC0A 4D9RE 2HP4A 3MNWB 2PTUA 1JIBA 4XTRC 4D9QE 3CFCL 2VAAA 3D39E 4OLUL 2G60L 1NGXB 1NMBH 1KENL 1JBJA 4Y88A 1DR9A 4NKOA 4P2OD 5EU6A 4KJQD 3SHSA 2VWEC 1FYTD 4LLAA 1CU4L 5C6WH 5FFLA 4PV9A 1F2XK 2W0FB 2VZVA 1XIWC 4ZFOA 1U9KA 5ACZB 3ROLB 1H3TA 5JXEC 4FQ1H 3GNML 4Z18A 3MRNA 4PRDA 5DRZB 5IVNA 2GT9B 5EC1A 4YX2H 4LP5A 1BMGA 3OAUH 5C0IA 4XWGH 4G5ZH 4WEMB 1N59B 2CMRL 2NXYD 3UC0H 4OZFG 2G75A 1PLGH 5DFVD 3P73B 4JFEA 2R8SH 3VRLE 1LEIA 5F93C 2Q7YB 1F8TH 3GK8H 3UTTB 4RQQB 2IG2H 3I6GB 1RUQH 3LQAL 5FO7B 1JNJA 4HJ0C 3ELAT 4M03A 1N5AB 2XWTA 1N26A 1UADC 2GJZA 3FFCA 4KZEH 4IOIA 3LS5H 4YX2L 3BE1L 4UIKL 5GZNC 3OR7A 5I8CB 3WSQL 5T1MB 4POYA 3VFNB 3M1BB 2EC9T 4OFYA 1DUYB 1I1FA 3RTQD 4OQTL 1E4WH 1OD7A 1QSFE 5ENWA 1TQBC 3WEXA 4UOJA 2OCFD 1BIIA 15C8L 4M7ZC 3BPNB 3FRPG 3BDXA 1C12B 5DJCB 5DJ2A 3AREA 4G9FE 1LO5A 3OKKB 2OL3B 3IT8D 3O3EB 3QG7L 1F6LL 3ZSTA 2P8MB 3LHPH 3QDMD 2CLVA 3WFEH 5DUBA 3BW9B 2YPLA 3VH8G 5E94B 3HE7B 3QULB 4XCNA 5EUKB 4YGAB 3GKWL 5LAXB 3DX9A 3C5ZC 5DWUH 1MCDA 4FQQB 1KTRL 1YEGH 3DUSA 2NX5E 4GG6A 2MKLC 5C0ND 1GXEA 4MB3A 3GBNH 4QXGL 2P8MA 1MCWW 4HUUA 2QQNL 4XX1E 3DMMA 2BY0A 2HN7A 5GRJL 3BRGC 1R0AL 3EOBA 3T0DA 3IKCB 1CBVH 1AP2B 1J87A 4NKIH 5HYJD 3TC9A 2IGFH 1RIVL 1IAKA 4HUMB 4L4VD 4OD1L 4ODHH 3S96B 4EKXA 4R0LC 5EZIL 1XGQA 4GFTB 3BQUD 2PR4L 5C0AE 1GHFH 4JPKL 1H3GA 3V4VL 3ARED 1PG7X 3HG1A 1I85A 3V6FB 5I66B 5GRXG 3I85A 1LE5B 1JFQH 3N50A 4NO5B 4E41A 4KROB 3DXAE 3MRGB 2NY7L 4JM2C 5HHMD 3RPKA 1BFVH 5DJYB 1NC2A 3O9WD 3GSUA 4AL8L 2D3VA 3EJJX 1BECA 5TFSH 3NGBB 4NO3A 1XGQB 1SHMA 3T2OA 2HJKA 2X4UA 5L88L 3H9YA 1W0WA 3MA9H 4DN3H 1MIMH 4NKMA 1P7QA 1OGTB 3BSZL 1NCNA 4HF5H 3TBTB 3OKOA 4F15B 2P42B 2G2RA 3TYGL 3U9PL 1QA9A 1OF2B 2DDQL 5JO5B 5CJXC 35C8H 4GBXC 4JO3H 1BPVA 3ES6A 3VA2C 5HI5C 3SO3B 4XPAL 5I1AB 2IBZX 3ARGD 3MLUL 1E4KC 3OKMB 2HKHH 4O58L 3VXMA 1K8IB 2QKIA 5CJ8A 1S9YB 2JKXA 1G6VK 3OB8A 4MX7B 3BIBX 3ZKMC 5C0RH 1JZ6A 3REVB 4OCRH 4Y4FC 4NN5C 5D1XD 2W0FA 4MJIE 1NAKL 3VXOB 4JO2L 3ZKXB 4X98B 4GS7C 3KPQB 2DS4A 4XNZC 4UT7L 1IAOA 4LPYA 1FN4B 3LV3B 4R90H 1IEBA 3AFLA 4PRHA 4S10A 3QT2A 1OCWL 5LJYH 4JHAH 1QZ1A 1KCSL 2CRZA 1R3LB 2BCKB 3IDIB 4BK4A 1EEYB 3EHBD 1WC7A 3FQTA 3NPSC 4U1IB 1ZHBA 2V6HA 2EDWA 2VABB 2Y5TB 5HGAA 4JVWA 4O51A 1EGJA 3ZE1E 2SEBB 1CXIA 1YEHL 4GOSA 4YXLH 3T4AA 1A7PH 5B4MD 4CDHA 1MCRA 2FLBT 2NLJA 1J0KA 3RWJB 1CLYH 1PG7H 4WIQA 4Y5YA 4E42B 1KF9B 4PJAE 1I7ZB 3GSNA 5EN2A 3PGCA 3FQUA 1FN4A 3LV3A 4TSBH 2EIZA 2FX9H 2VQUA 5K33A 3UTZB 3LS5L 5F1KC 1U3YA 4HAFA 3KPRD 2D7QA 2WP3T 1N4XH 1E4XI 2F5BH 4KRPD 5FYJE 4WDIB 5DJDA 1RUMH 1TFHA 4WI2A 3TYFB 4MJ5A 1NAMB 1MLCB 2ERJB 4FFZH 4H5SA 4G42B 3T4AB 4JO4L 4MVBC 4K23H 4NPYB 5SX5K 1N6VA 3P30H 1KPRB 1URLA 3LN4A 3MJ9L 2IQAB 4MJ2A 3JSSA 3PABA 5TF1H 2C7UB 4JVPA 4HQQH 4BSVB 3VI4F 4WHYH 2F5BL 3CSGA 3FCTB 2P48B 3F7VA 4QTHB 2GY7B 3VXPA 4XB7A 1X44A 4LF3A 5EO1B 3TCLB 4MZ3A 1RUAH 4NRXB 4BFIB 3EOAA 4LCIL 3W81A 4EUPA 3MJ8B 4EI5C 1FCGA 2ZSVB 1QYGL 4MSWB 5DVLA 3QZWG 3B9KD 4JQVC 3QDGE 4JR9H 4L9DA 2Y07H 3RWEB 1DSFH 4YHZL 4FFWD 5I1EH 2O61B 3JTSB 3CLFH 3ES6B 1YEGL 5AWNL 1DUYA 4R7NA 2MNUA 2R0KH 2EDRA 2DQJL 4LPWA 4XCFH 2HLAB 4QHMB 4OZHE 5FYKU 4ZXBB 4AMKH 5I19L 1QSZA 3QPXL 2GJ6E 4JFOA 2UWEF 2M8XA 3LVEA 3O45B 2YBRA 3KS0J 5D5MF 5D93C 4LLMA 5GGRB 3OHXA 3GHBL 5C70A 5TF0A 4XHJD 2E7LC 1PKQB 1DBMH 3RWGB 3U7WL 4OLXL 2VSDA 4QRSA 2V2WB 3GB7B 4F57L 5JW4Q 5I74C 3L6FA 1LEKA 5A40E 4L5FH 3RWFA 3V2AR 3P4MA 1V8HA 2QADB 5IFJA 1RIHH 1FYTA 4GAGL 5ICYB 3WNPA 3KXFA 3T1FA 3D69A 1E4KA 5EWIL 2IAMB 4JREB 3EO0A 4MDJA 5CD3B 1PQZB 1XGPA 1QD0A 1OB1A 4QY8B 5CJXA 3KJ6L 3BKJH 3DYPA 2PTTB 1R5IA 4IM8A 4U6YB 1RJZA 1JZ5A 1Z3GH 4JLRB 5I73B 4KK6C 5LWYH 4ZTPH 3ALWA 5C08B 1ORQB 3JWDL 3MQIA 2HFGL 4HGWB 4XP5H 5JIIA 1A2YB 3TT1L 4PS4H 4N90E 2DIBA 4MD5A 5FUOL 3EJYC 3PWLB 3IDUA 5IJVA 3ARPA 3WV0A 1RJYB 4PUBH 5C6TL 5HGBA 4M5YL 4HIXL 4OCSH 5HI3D 5JDSA 1KACB 3BDYH 4A6YH 1QTYT 4XP9H 4LGSB 4NSKA 4TQEH 4GRMA 1MWAH 2LVEA 2YD3A 4GSDH 3QWOA 2AI0L 4Y16B 3KLDA 1TCRB 3N1PC 2F54D 1B0RA 4ZO8A 5ESQB 2NXZB 1EO8H 1BVKB 5E99H 1BIIB 5ICZB 4RIRB 5HHME 3S35X 5I6XB 5ABDE 4LSPH 3HAEB 5K9QI 1NMBL 1QSFD 5D5ME 2P7TA 3V6ZA 3EYSH 4QXTB 5AYUH 3VE0B 1T03H 3U1SH 3QYCA 5IJKA 5D1QB 3K4AA 4CVXB 4OT1L 4KGJA 5CMAA 3AS2A 1H0DB 4OFVA 2BHUA 1HXYB 1A7QL 5J3HD 2QQLL 5D7LB 1J0HA 2R69L 3FO2A 2X4TB 4Y5YC 3BP5A 4HMCA 4QXUH 1JPGB 5KSAA 4NHUA 4XP4L 5BMFH 1N4XL 3ETBF 3OKYA 3ARFC 4RAVA 1J10A 1VB9A 2C3WA 4LQ1A 4GQ9L 2NY5C 3MO1B 4QRPA 4OF8A 2NY5L 2PW1A 2F74B 4L3CA 4PV8B 1NMCC 3OKLA 5GISH 5ACLA 2YD5A 4E9LA 4ZTOL 4HUVA 3CU1A 3U9PH 5GZND 1GSMA 2PO6B 1GGIH 3BXNB 3QA3B 4S0TD 2YPLE 1W8NA 3RVWC 3W82A 3QUMH 4F37K 1V7NL 5IUSA 3QIBB 1U8IB 4HSQA 2LABA 4DGVL 4YBLB 2XA3A 1I4FB 1R3JB 1CFQA 4H8WC 5DUPH 5E1AB 3NH7L 1ZOXA 1ZHNB 4JLRA 5DJDB 4ZNEE 5D2NB 3AB0B 1BOYA 1LD9B 4YDVB 3IXTB 1TJGH 4OV5A 4G9FD 5GRZA 4GKOA 1H5BC 4ODTH 1D5BB 4P2RE 4WUUD 2PETA 2FJFB 3NZ8B 2FEDD 2OP4L 4HPOH 4GAJL 4NQSA 2Y5TA 1UACL 1OSZB 2EE2A 3QIBA 4X7SL 4MNQE 2GITA 5I19H 4L4VA 5FKPA 3R0MA 2FJGA 4M9OA 1BFSA 3JBG7 1FPTL 5DD5L 1V05A 3Q5OA 4KUZL 1BQLL 4YHLL 2AV1A 4L29B 1S3KH 3DTXB 1TMCB 4HX1B 3L3DB 4X6FA 1KJ2H 4GJTB 4XRCA 3ZDXF 2W9EH 4P23C 4FQJL 2R1WB 4AIZA 4DVRL 3OJ2C 3ZO0A 5JORA 1EK3A 5KVGL 2X4PB 5BZDB 2ADJA 3WFHB 4PJFB 4PJCA 4OZIB 4X80L 5ISZA 4F9PC 1A47A 4MNHB 4PLKD 3THML 2FH6A 3PL6A 4BZ1H 1U36A 2I60L 1MY7A 3NCYP 3G04A 1XR8B 5D1ZB 4LLYA 3NFPB 5KSBB 2ZCHH 3FOLA 3QZWB 4N8VG 3PJSB 4YDIL 4OZ4A 1SQ2N 3BP7A 4ODHL 3LPWA 4U31A 2FWOB 1T0NA 4RGNC 4UIKH 2QHRL 5GHWH 2AXGA 5GSVB 4RGNE 4N9GA 4TVSa 5FYKL 1D5ZB 2OJZH 3HE7C 1J5OH 1PBYA 2MQ3A 4U3XA 4WHTA 1CICA 1TZIB 2CJUH 5IM7A 3MZTA 1YECL 1BJMA 3RWGA 4NZDA 5A2LH 2NY1B 4HWBH 4GW1B 1S7TA 4BQ9A 4RX4A 2VO5A 3LKSB 3VH8A 2Y1VA 1AGFB 1U8KB 2B4CC 5IMOB 3ARDA 4LPVA 4J6RH 3SY0A 3T8XB 5TGBB 4WHYG 4PRPB 4P2YA 3X13B 1CWVA 4HWEH 4Y2OA 3MA9L 4MQ7A 3F12A 1SY6H 1NBVL 3MBEB 1FORH 3BQUB 5DFVC 4LARL 3VXMD 1A6WH 1OGAA 3G9VA 4FQXD 1DANU 1HSAA 1VPOL 2J3SA 2OR8A 3MV11 3M17A 3CIQA 4ZS7L 2X7LA 1JK8B 1UG9A 3F58L 4EI5D 1HOCB 1QBLL 5E9DD 5EBMA 5HHOE 4V2BA 1W72B 1QPPA 2IPKB 3FO1A 2XOTA 3PNWB 4PJ7A 3BRFA 1WGOA 2H6PA 1G9NC 3CX5J 3QNYA 5TDOA 2Q1EA 2O5YH 3GFUA 4IS6A 5C0RL 5EUOF 3BZ4A 1A6ZA 2V9QA 5TH2A 5CJQH 4PRIB 1FORL 3HNVL 3UTSA 1RK0B 2W07A 4N1CA 4TOYL 1FJ1A 3RX5A 3RZCD 2X1OA 4ODVL 5IF0A 3HMWL 3CSYB 4Y4KC 1UVQB 4HWZA 1MCNA 4HXAH 1CZ8L 1PX3A 3RIFK 1WF5A 3VG0L 4HUNB 1KLUA 4WUUB 4BFGA 1NPUA 5C0BA 4PJ5D 5I76B 1F90H 3O4LD 1BAFH 1BZ9A 4L8CA 2I26N 5FA3B 4HUWB 2LV4A 2AXHA 3PV7A 2P8LB 1A22B 2W0LA 5K59F 3FKUS 1BVLB 4YHPB 3SEPA 1U8IA 3CFEB 2VISB 3LSOB 5JIPA 5JXED 1UEYA 2X4SB 4P23A 1X5HA 2DWDB 5IHBA 1J5OL 4P4RB 2D7TH 4N0CC 2BNQA 5GGSB 3BKML 4ZFFA 1UM5H 4YDLC 1G7PA 2BOCB 1I1YB 3RZWA 3DURB 3GKZA 2FIKB 3I75B 1ETZB 2H1PL 1X5IA 4JPVL 3TA3D 1LO0H 5ERWB 1CN4A 3LH2L 3QEGL 1CGYA 3MLVH 2A6KA 5DLMH 1D5MA 4KU1A 1UQSA 1P6FA 3IDYC 1DLHB 1X5LA 4IOFD 5CSZB 4J6RL 1AO7A 1D7FA 3V6OC 3UTTD 4H0IA 5CMAB 3TPKA 4NQVB 1OARH 4P4RA 4ZAKB 4ZFGH 4XNMB 4D0BA 1WZKA 2EDDA 5DD1H 2X6MA 1II4E 3X3GH 3UYPA 1G7PB 3IAGC 2HFGH 2B8OT 1G0YR 1TTGA 4DVRH 4HGWA 3RL2B 2IALB 2K3TA 1U92A 4JZJB 4WI4A 2DKSA 5L2KA 6FABL 4FHBD 5DQDL 5ISZD 4HT1H 1HEZB 5T1LA 1A21A 2F8VA 3NCEB 43C9B 5CSZA 1I7TA 1DVFA 4O00A 3O11A 2F53A 1KBGL 1IE5A 4UUJA 4YIQB 3FQXB 4H1LG 2OXHA 1JHTA 2VLKD 3SGKA 4FZ8L 5EFIB 3BEWB 2LE9A 1VADA 1Q9KB 5IGXL 5TQ0L 3G6AB 4JPIB 4S1RL 3ARXA 4Y5VC 5DQJA 3IETB 3LMJL 5D71L 5HY9B 3ARFA 2CDFA 3B9EA 2BVQB 1G7IA 5E95B 1RVFL 2IADB 3TT3L 5IVZB 4EI5B 4LQFL 2Z92B 4I18A 2R2CA 1NGWA 4GW5B 1I8IA 3IFPA 5CHNA 4C83A 4PJ7F 2CDEB 4MD0A 5ESAB 1A4JB 2JK5A 3OB0H 1E6OL 8FABB 2XN9E 2XYCA 1YUHB 2FO4B 5HYJB 2A6IB 3K4DA 3K1KC 2QKIB 4NFDA 2DL2A 3VGDA 4LFHD 3K80A 3TJEL 3UBXA 1A3QA 3FO9A 3MV9D 3F12B 4KK8D 5IP4A 4LSSL 4R2GB 1Q9WA 3GJFH 4XCEB 4KZDL 5C8JA 5CZXC 3BH8A 3C8HA 5E2WH 1G1YA 3BO8A 4UBDC 3TT1H 3WHXA 2GAZB 5DHVH 3WNNA 5IHLB 4JRXE 1CDYA 3UBXG 3SKMA 3DX9B 2ZUSA 4AK1A 2K7PA 2R0ZH 5EU5A 5L8LB 5D9SA 4DCQA 4F7PB 3IKKA 4U1SB 4OLEA 1TIUA 1AQKL 4LHUD 3FCTA 5GRVL 3RVUD 4TQEL 4DFIA 1JNNL 4Z5RB 5C0CD 1YYLH 4JRYE 1AXIB 1D5IL 5E2UL 3RNQA 5DS8A 5IEHA 4B0MM 2OTWA 4GRLC 4PJXA 4NHCH 4HD9A 6FABH 4GG8B 1QKZH 5KSBF 2W9DL 1L7IL 4H5SB 5CAYB 1I8KB 1NFIA 2BOBB 4G6JH 1TDQA 3WKMH 5I15L 1OTUD 1L7TL 2ITCA 3JWDC 1YPZA 3K2UH 3SE4A 4YHYB 5B38B 4Q0XH 3ARGA 3VFOB 2I9LB 3QUXD 5HDOA 1QLFA 4ORZC 4LIQH 5B3JE 5H8DA 4EQ2A 3G6JF 3ZSSA 1B4JH 2H26A 2GK0B 3U4BH 1J88A 1EX0A 1FFPB 5IB5B 3QIUD 4WEBH 4MYWB 4OF7A 1NBVH 4JN1L 3BWAB 2QSCH 3P73A 3FZUD 1ZT1B 5A2FA 2MSPA 3TNNB 4FQLH 5MENB 2I07A 1VGKB 1CD0A 4EUPG 2VLME 5D2NE 5HYJE 3UTZA 4XVUD 3I2CL 1EEUA 3MLVL 5CEZL 2YRZA 1AGCA 3CFBA 2VYRE 1G7MB 3O6LH 3NCJH 3LIZL 2V7HB 3MGOB 2V7NA 3P3YA 5F6IC 3RFZC 1I4FA 1R3JA 1K8IA 3D1MC 1EFQA 3WE6B 4EVNA 1IM3B 1RZ8B 1UXWB 2DDQH 1FNEA 4D9RD 3O4LE 1T3FA 4DVBB 4RGMC 5I1KH 4Z7VB 1BVZA 4L8DB 4X6DF 3HMWH 5C7XH 2V17L 4NGHL 2QQKL 4M7JL 1JGDA 5IB2B 1U6AH 5EOTB 1KBGH 4OB5H 4Y4FB 5FDWB 2DI8A 1BP3B 4MVBD 3LQAH 5AYQA 1U8JA 1AIFB 4Y5VB 4BA8A 2CLVB 4ZFZB 4UDTA 5DJXB 2X4NA 4FQJH 3CZFA 4O2CB 3VXNA 4GBXB 1S9KC 5EA0H 4XC3L 4EDWL 3UJIL 2VISA 1GHFL 2N1KA 3B2UC 3DRTA 5KSVA 5C0AD 5CP3A 2GCYA 1JL8A 3D3VB 4PTTB 4XX1G 3NCBB 1WIUA 2AJSH 4IIQB 1WAAA 4JFOB 3PGFL 1H8SA 3MRHA 5C09B 3CC5B 3WBDA 2FEDC 1K6QL 2GKIA 1CLCA 1XF4A 4GS7B 2P24B 4DUVA 3C5SB 1T2XA 1LO0L 1H0DA 1M6OA 4LCUA 3GSUB 3T4YA 4JM2D 2V2XA 1OAYL 3AAZB 3V0AC 1NH6A 5D5MB 4NNXA 2P5WA 5BRZD 3ZHKA 1B4JL 1FLTX 4L9LB 5GGUA 2EKJA 2VKWA 4X4ME 1PGRB 1FFPA 2BVOB 3V7AE 5T3XE 3DUUB 2ZZUT 4X6CF 4HF5L 4PJDA 5IR1A 2FL5B 3ZKSD 2VERN 1YECH 3VFTB 3I6GA 4GSDL 4JKPL 1MHEA 1K9TA 1S9WB 4OKVA 3WD5L 3D3VD 4UQ3B 1OTUC 5E8DH 4FQQA 2AXFB 5EDXA 1ZS8A 4XPAH 1QSEA 2WLYA 3ARGC 3KYNB 1T89C 3HUJA 1MFNA 3UTSD 3PG2A 4JO1L 1AXSA 2BRRH 3RNKA 3WN5A 2L7JA 1YEJL 4L8SB 1YPZE 4W6XB 3DX7B 3WXVH 1XGRA 4HH9B 1VFUA 2NPLX 3QEUB 3WFDL 1YYLL 4WFFE 5D7SL 3QUYB 4JR9L 1R5VA 5C0NC 1MCIA 1QBLH 5ADOH 1EHNA 4CMMA 3FONA 1T2QH 4ZO7A 3C5ZD 3CX2A 3VWKA 1ZT7B 4Q6IB 3VWJB 5CKAA 3C8KA 4CN6A 2VR4A 4MA8H 4K3DL 3UYOD 3EKCA 3AM8A 4FP8L 1L7TH 2NY6D 4N1HB 2NY1C 4LSUL 1MNUL 1NUFA 1ONQB 2EDJA 4NC1E 1BX2B 4PJBB 2X2YA 3JV6A 5F3HA 2BZDA 1TPXC 3HRZB 4LNRB 3GBLA 1T21B 4JFDB 3KLAB 4PTUA 3SDCB 4NT6A 4G80B 4JZOA 3ZT5A 2WQ8A 4L4TD 3IDXH 5LG1A 3IFLL 4QRQB 3RPIB 5HI3C 4DN3L 3MJ6A 3VXSB 1JRHH 5IW3A 4IOSD 2F53B 3O11B 4F58H 3SDDC 4Z7OF 2Y6SD 4OAWA 4XPHH 2AAVA 5KG9B 5FO9B 1I9IH 3ULVF 4Z7NE 4EN3A 1X3DA 4DUWA 5I1GL 1BQSA 1C16B 1FV1A 1MHCB 4OI7A 1DE4B 2IH1A 1XR8A 3TWCL 2AGJH 1GZQA 1JYNA 2HKFH 3GSRA 1AGFA 3I3EA 3NVQA 1OP3K 2JJTC 3G5YB 4KKLC 3QUZA 4LPCA 4PBVC 4I18C 4BFIA 5DRXB 2ZOKB 3HZKA 4H20L 3VXUA 2C26A 3AXLB 4TPRH 2VDQH 4AQOA 1RU9L 5FYJH 3QNZA 3T09A 1S9XB 2ILLA 3C87A 3F58H 4F8TA 1J1OH 5KS9F 3CK0L 4RAUA 4HGMA 15C8H 1YNTB 2JIXA 3MRMB 3JWOC 2GSGB 4MAUH 3KPSA 1JTPA 1KB5B 4PD4J 3I02A 2WBJB 4U05A 3SGKC 1GGCL 2HT4C 2WBKA 4S2SB 3DGGA 3L3OA 1CD1A 1FYHB 1T1XB 4P46A 1S5HA 2DQHH 2ZOKA 3HZKB 5LXGL 1S78C 2P5WE 3B43A 5CJQL 4QXTA 1N7ML 3DHMA 4LAJH 4HULB 1T1YB 1HKFA 1RU9H 3DMMB 1SEBB 1CE1L 5E2WL 1IGFL 3B3IA 4XPGL 4YQXH 5MP6L 2OM5A 4EUPB 1KPVB 4LSPL 4PG9A 3C8DA 5C2BL 3H42H 1EBAA 4O4YL 4QRTA 2FBOJ 3MUJA 3QIWD 3HI1A 3RY4A 3U6RA 1WIPA 3DVNB 1QRNE 1BLNB 3R4DA 1YN7B 3D39B 3MV8B 4LMQI 3OF6D 4WV1A 4Y1AB 1INDH 5FDWA 5HDBE 3D6GA 2E7HA 2F54E 3FTGA 2MQ0A 4S1RH 4TNWF 2XRAL 3IETA 2PCPB 3BP6A 3EO1B 2A0LD 4GW4A 1G7QB 2C9AA 5MEND 3P4NA 3PE9A 3E3QE 3F65A 2Y72A 4DZBA 1EVUA 1P1ZB 1RUAL 3DUUA 2KZ1B 3O9WC 4G6KH 4ZMAT 2XWJA 5JHDD 1JE6A 1MCOH 1INQA 4P5TD 1YN7A 2DQDH 2X7LB 4M48H 4JZJC 5KN5A 2PXYB 2F8XC 3RVWD 4ZAKD 3QXUA 4N0UB 1F4HA 3SQOH 5E2TH 3MNVB 4YBQD 3MACH 1NFDE 4NQDE 4X9HA 5JA9A 2HFTA 3ARSA 3H3BC 5FKAA 1KPUA 3BPLC 4RRPG 4HWBA 1MFBH 3D9AH 1CU4H 4Q58C 4U1KA 3MLSH 1EERB 1F42A 4LLUA 2IANE 2D0FA 3VFNA 2J4WL 4AM0A 4APQD 4D0CB 3FB8A 2ITDB 3ULUF 2UYLB 3ULVC 4NQEE 4MAUL 1IGCL 4Z7VE 5D70H 1U3HD 4G8GB 2BHZA 5J6GB 1YEFL 4G8IA 5E7BA 4TVPD 3P4LA 3CX5K 3NCJL 4ZO9A 5IBTL 3LKNA 5CBEA 4ZYKA 5E9DA 1A7NL 3U9UB 1MFEL 3H9SB 4EI6A 1NFKA 4OV6F 4WFHE 1DVFC 1DLFH 1JK8A 4R2GD 2VE6A 3RWIA 3MTRA 1CGTA 2D7MA 4ZPVB 2FRGP 1AFVL 5JOPE 4KK8C 3VXUD 2IMNA 1ZLWH 4KROD 1XGPB 4MQXD 2CO7B 4U1HA 1QR4A 4DQOL 5KS9A 2C1PA 1LP9F 2R0WH 3MRKA 1OY3B 4JM4L 5TE7L 4OAWB 1KN2H 3GSQA 4FQXC 1ODAA 3SE3A 1VSCA 1ZGLP 1TCMA 3U7YH 2R1XB 2D0HA 3DV4A 4CRPA 1BBDH 5CFHA 4PP1D 4JAMA 4EEEA 2R1YA 4LRIC 1J1XH 4OLVH 4LDEB 2W9LA 3DMMD 4R4NC 4XI5C 4XXDB 5DJ8A 4JB9L 1NCTA 2R2EB 3UJTL 4LCYA 2WMPA 3EYFB 1YEDB 3NZHH 2AEPL 4K3HA 4RZCB 4DGIH 4B53A 1A5FL 2VLKE 3O6KH 3SKUD 4JKLA 4I8DA 4YHOL 2ENSA 1GAFL 4WCYL 5DJ0B 3WKNA 2VQ1A 5DEFA 3C8KB 1C5DA 1KTDB 5HYSA 3BN9D 3W9DA 3EYQD 3PWJB 3L3GB 4JG0L 3QEQB 3PXJA 4MNGE 1OAKH 3C9NA 3VRLF 3MLYH 2NW2B 2ZKHH 5D7JC 2WK2A 5BZWA 3BP4A 3PL6C 3SCMB 4YHLH 4N9OB 1QSFB 1C5CL 3JV6B 2NX5D 2R69H 2VXUL 4YHIB 4PGCB 4ZS7H 1QFOA 5AZEL 4OCWL 5E56A 4M1DL 4OD1H 1NLDL 4X7TA 2Q6WA 5TQ0H 1Q72L 2W92A 3CLFL 2EH8H 1GPOL 2HJFB 4X8JA 3X12A 5JHDB 4XVSL 5C2UB 2BVTA 4LVNB 1N3NB 5FV2A 4G8GA 4O4YH 4Z0XA 1T1WA 1KXTB 3SGDH 1CQYA 5JW3L 1HCVA 1L7IH 5H37G 2AK4E 4NC2B 1SJHA 2PXYD 1EUTA 4G3YL 3QG6A 5BQ7A 3BZ4B 1WCQA 5J9PA 4HKBB 4PRBB 1A6PA 1C5BH 4PRPE 3QIBC 4L4VE 4POZD 5DJZA 5JW5A 3QWRA 3ZKND 5JPNB 2XRAH 1S7VA 2NY0B 2DRUA 2XICA 4PJ8A 2AS5M 4MJ5B 2YOCA 3HZVA 1W0VB 2BNRD 5JIKA 2ADGA 1G9MH 4M9PA 1OGTA 3M8OL 2N7BA 1JV5A 3ARZA 3E8UL 4GRWE 5F7WC 4HBCL 3CCHB 1C8PA 4WW2A 1I1AC 1WFNA 1JZ3A 5FYJL 1UEMA 4LRNH 1NGZA 2XA8L 5IVXE 4PR5A 1V5JA 2Q20A 3IJHA 3ZLQC 2BVPA 3PQYB 3PHOA 1I1YA 4LPUA 3P9WB 2R0ZL 2X1PA 3MRRB 3B9KA 1U95B 2DM4A 3BIKB 5HJ3B 4L9LA 5F1SA 3OKEB 2FEEI 4OGAD 4P23B 3S37H 1G7IB 4U1NB 5JDSB 4MA1C 1F3JA 2RIKA 3GM0A 5K9KB 3BW9A 3BVNB 4ODXA 4WUUE 3TZVA 1QQDA 3OXSB 3HI6H 4JHAL 4NZUH 2VXSH 3RTQA 1HH6A 3KYKL 4QHNA 3DX8B 5LBSL 1ZLSL 5FF6A 3QH3B 3S3SA 1MH5B 4ETQB 1I9JH 5CCKL 5K9OB 1VENA 25C8L 4XNQB 5HGHA 1XIWB 2LVCA 2J12B 4BJLA 2HLFD 1JP5A 4KAQH 3RWHA 1I7UB 1IC5H 3T3MF 5IJKC 1LNUB 4L3EB 3UAJD 1UENA 3BZEA 1FZMA 4QRUA 1MUJA 4W68A 3CGTA 2H2PD 3CDYA 4J3XA 3GSWA 5SWZE 2DQCL 5F6HI 3UTPE 3L3HB 2QADD 4U6HA 2J5LB 4IEFB 2H26B 3TH3T 5J6HA 1CGXA 3R1GH 3PWPB 2YMXH 5DR5L 4FFZL 3KPLA 3N85H 2RCSH 4GKNA 4K07A 4YC2C 4LLWB 4JGMA 5GGQH 4CW1B 2QSCL 2H2SD 3I6KB 1KENH 4IRZH 3SCMD 1OLLA 1BAFL 1CGUA 3MV7E 4FNLL 4G6FB 2X1QA 1U8NB 1BD2E 2VDOH 3A0OA 4FG6D 1GRWA 4DN4L 5JMOC 4ZD3H 1MJJA 1SMOA 1KGCE 1TQCC 4RDQG 2V2TA 1FC1A 2ED7A 1SY6L 4LEOB 3V0VA 5I9QC 1DQDL 4NM4H 4CDGC 5KG9A 1ZA3B 5KSVB 4NKMB 2BMKA 4G6AC 3BD5A 1M4KA 3RWDA 1ZLVK 3U0PB 3KNBB 1RZIA 3QQ4B 3O41B 2C3XA 2XZQL 5EU7C 1WWBX 1ZGLM 3HN3A 4RWHA 2XZCL 4KI1A 3U30C 3P4NB 1WK0A 4I0CC 4FXKB 3LQAC 1IFHH 3WHE0 3C5ZB 1LK3H 3QUXC 4NQDA 4GRMB 3BKYL 2IPTH 2VL4A 3ZHDA 3L5HA 3QFJE 3X3GL 4KH2A 3BYTA 3UBXI 1T7ZA 2KL6A 3MRLA 2HJFA 3SQOL 2G5BA 2CDGA 1SMAA 3VWKC 1DN2A 5I18L 3TJHC 5B8CA 1DQLL 5FDYA 3U2SA 2XPGA 1MLBB 5D6DA 5KSAC 2JB5L 4XAKD 3GSNH 5J57B 1L4IA 3MV01 4Y7MA 5CEYB 4HC1A 4X6DA 2VLMD 4N0YL 1RUQL 2CIKB 2VN7A 4NC1C 5BRZE 3VGHA 3QG7H 3MLRH 3BKYH 3VGGA 1T7YA 3STZB 3W39A 3MA7B 2RFXB 2VDML 2ATKB 1U8LB 4EOWH 2LAAA 1VGEH 4XRCB 1F58L 5TQ2H 4OZHB 2HRPL 1LP9B 4JCLA 4P4KD 3V79C 3NTCH 4PJCB 1QHOA 3KPPA 5HGAB 3H9HB 4W4OA 3UJTH 2NLJB 2B39A 3EYFA 3OBAA 2Q8BH 1ITBB 1UWXH 2J8OA 1VKXA 4I3SH 4RMTA 4ORGA 5HGDB 4E41D 4Y19D 1T0PB 1HYSD 3BD4A 5ETUB 3KLSA 1QLFB 4M7KL 5DZLA 1JHTB 2OL3A 4XBEH 5CIPA 1FSKB 4K3GA 3ARVA 4UDUA 1XCQA 2GHWB 4PJIB 2FATL 4NUJA 3UTPD 3FQRA 3KYOB 5SWZD 3K8MA 3O6FD 1WIOA 3B8SA 1FFOA 3MXVL 4QY8A 3X13A 3MRHB 1G7JA 1QQDB 5MEPA 2E7BA 3AROA 1IKFL 3RL2A 3RWDB 3W5NA 4U1MB 3O8XC 3HHRB 1E28A 2EH8L 5E6ZA 3RU8H 1AH1A 5ID1B 1HEZA 1IAIL 1XCTB 3SOBH 1HH9A 3ALXA 2X4RB 4YZFE 3VGEA 3D9AL 1FGVL 2V5RA 4APQC 2VAAB 4I4WA 5F6IB 5DTFB 4FXKA 4MS8D 1A7RL 4M61A 4HUKB 4XCCH 3QAZB 1MCLA 3W2DL 3TBVA 3BI9X 1ZANH 4U6TA 3BP5B 5HHQB 4OM1L 4LSRH 2Q8AL 4XP4H 1DUZB 4WCYH 1S7UB 4UZGA 3S98A 5F7LB 3MO1A 3ILPA 1MI5D 1PZ5B 3OHXB 3DLQR 1Y6NR 1RJLB 1BOGA 3GMLB 2YMXL 4MXVE 5DR5H 3STLB 1W0VA 4UTAH 4QKXB 1U6AL 1E4XL 3SDXA 1MCCA 1NGQL 1QLEH 3QXDA 4NQCB 4KRNA 1ZGLA 4ZFOB 5IW1B 3STZA 1F11B 3NAAL 1R5VB 1DE4A 2XG5A 3PWPE 4OLWL 3BP7B 4FN0A 5FCUL 5IB4B 2Z91A 4GBXA 1ZMYA 1YMME 2AK1H 3JUYA 4HWZB 2JJSC 5D8JH 4N68A 1T83C 1EFXB 1N2RA 3QFJA 3U0WH 2X1WL 3GMNB 4D9LH 2OI9B 3K0WA 4Z7WF 2D0GA 4JM4H 3QRGL 4GMTH 3ARDD 3SGJA 3VW3L 4KHXL 2IF7A 1IL1B 3O4OB 4X6BA 4JFDA 4D3CL 5HYFA 5BV7H 3ECBB 5DD6B 2R4SL 5FGBA 4KUCD 1NCBL 4PLJD 4ZPTA 4BELD 1IGYA 1MCBA 1BGXL 2DQEL 2HFFA 1ULVA 3QHFH 4LAQH 1QFPA 3V4UH 1JPST 4TRPH 3C60C 5GGTL 1RUKH 3KJ6H 3TM6A 5FUCC 3H9SD 2E9WA 1KJ2A 1XZ0B 2NY6C 3MUZ1 1OGAB 4P2QA 4TUKH 4PJ8C 4LRNL 1E27B 3O0RL 3OZ9H 4YHOH 3VFRB 1Z9MA 4JPVH 5EPMA 4HAGA 5CJOL 3LAFA 4LVOB 2CRYA 5D70L 4GG8A 5E5MA 4WFEE 4BQ6A 1OAUH 3WJLC 2R2BA 4V1DA 3GO1L 4B50A 1CFTA 1P4IH 4X4XB 3CDGA 5JQHC 2MCPL 3DETC 1DN0B 2NTSP 5HHNA 1YQVH 2BY2A 4P3CL 5I0ZA 5LQBH 4R26L 3FRUA 1QUNA 2Z31B 3KXFE 4EOWL 4F3FB 1A0QH 1TTFA 3CUPB 3HRPA 1NUGA 4KPHL 3TO2A 3STBA 1BVKA 3GJFK 2I25N 1A3LH 2JF1A 3H9ZA 5DO2C 4DN4H 4OD3H 3L5XL 4WI6A 1PEZA 2AXGB 2X4TA 3UJIH 4JY6A 1S9VA 3UPCA 1EAPB 2W60A 4A2MA 3OG4B 3MRPB 3BT2H 1TLKA 3CFCH 3RBGA 3OB0K 3QO0A 5DK2A 2ADFL 3T1WA 2DWEA 4I3SL 4MS8C 4LOUC 4V2CB 2AK4B 2ARJB 5IW6B 4LMQE 4KWUA 5SWSB 2FECL 4GH7B 5B3JF 4Z7UA 2VLJE 4NHUB 2JE8A 4LLYB 1XT5A 4M7LL 4P5TA 4JJ5A 4W81A 4QRRA 4OZIA 1LWRA 2CKBH 3SY0B 3T8XA 3WYRA 5CP7A 2V7HA 5CGTA 4RFOH 2DQFA 5H35B 3VXRB 5ILTH 1BM3H 5FYKD 4PGBB 3E3QC 4N0FA 4M00A 4JY5H 4GXVL 1TETH 4LRIA 2AJXH 3LB6C 2YC1B 1A5FH 1FL6A 1DVFD 3C6LD 1UA6L 3ZTNL 1KTLB 2E8ZA 1S7SB 4ZUSB 4URTB 3ARBB 1Z2KA 1SYSB 4XNYH 3QNZB 1IAIH 5IFJB 3T0XA 4IRSB 4K94L 4PP2B 3BIKA 2YUVA 5GSVA 4LAQL 1X5FA 4F9LA 1VHPA 5EOTA 3P9LB 4Q9QL 1QNZH 3VG9C 5F7UA 5FAAA 5FB8A 2RBLA 1JGVL 4JPWH 5EUKA 5KS9E 3OX8A 5CD5D 5D2NA 1UB6B 4R3SA 5C0AA 2FJGB 4CNIB 1JZ4A 1NDMA 3IU4H 1D5BA 4I3RL 4MJID 2YSSB 3W0WA 1DP0A 1GYAA 2X9XA 5EA0L 1MHHA 5CWSB 2HT4D 2WNGA 5F89B 2CR3A 2YD9A 4JY4A 3Q0HA 5L6YH 2FZ3A 4AIXA 1XIWA 1H9VA 2P46B 4KMQA 2BNQD 1QNZL 2VDPL 4OZHF 3RI5F 4ERSL 3RWFB 3Q5TA 4YWGL 1MCFA 3AY4A 3HKFA 3QXDB 4GAFB 5KW9H