2DRUA

Crystal structure and binding properties of the cd2 and cd244 (2b4) binding protein, cd48
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
180
structure length
180
Chain Sequence
FQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYEMVSKPMIYWECSNATLTCEVLEGTDVELKLYQGKEHLRSLRQKTMSYQWTNLRAPFKCKAVNRVSQESEMEVVNCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Binding Properties of the CD2 and CD244 (2B4)-binding Protein, CD48
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Immune system
molecule keywords chimera of CD48 antigen and T-cell surface antigen CD2
total genus 38
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2006-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2druA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2druA02
3BKMH 3M1BA 35C8H 8FABA 3LHPH 1I8IB 1UFUA 2I5YH 2VNCA 2PXYB 3KPQA 4HIJA 1NGZA 5IHZA 1T5WA 5JXEA 5HYQA 5KSAB 3CSGA 3GMLB 1E6JL 2ZWLT 3OHXA 3Q1SL 2DIBA 5C0ND 3DARA 1U8JA 5EIIA 5EO0B 3R06B 5HHOA 4JDTH 5I6XB 2OK0L 4Y1AB 5F72S 1HHJA 2YBRA 4YQXH 1U8JB 2VLKD 4WHDA 1YEEL 1QLEL 4PJ8B 4H20L 1OAXL 4CU8A 5D1ZA 2A77L 4G8EB 3VG9C 1CFTA 1MPAL 1YMMD 5DVKA 5GSRB 5J06A 5FCSH 1JGEB 1AQDA 4P57B 5H37H 4CKVX 1JPGA 4IDLA 1VFOA 5CWSB 3NZHL 4YO0A 5FGSA 4PJCB 3UAJC 5CKAA 2MKWA 1FBIH 5D72L 3MUZ1 4L3EA 2D9CA 3MREA 2EH8L 3FT3B 1A7NH 4E5XB 4EOWH 3W5NA 4RFNB 3IAPA 2AK1H 4GKZB 2DICA 5T1KB 5F7FA 5JIIA 4CDGC 1H0DB 2P5WD 3V6OA 1NGQL 1IEBA 4OCLC 4YDVB 3RQ3A 1RURL 4ZFFB 3RHWF 4G9DB 1NCWL 2BNQE 4AG4H 4OCWL 5C0CA 3AMKA 2IANA 4PRPD 3U0TB 4JO3L 4DVRL 2VXTH 2EH8H 4M8VA 3ZTNH 4PGBA 1KLGB 2PTVA 3BUYB 4XXCA 4XPHH 5KSVA 2IAMA 3P11H 2AKRA 2LFGA 5B3JF 3IRPX 4LCWB 3VI4E 1CWVA 3S35L 4J8RB 3TPKA 3UCRA 1DUYA 2CXGA 3RJQB 2HFFA 1V3KA 5D7JC 3SJVE 4GW4B 3EIFA 5IMMB 4HT1H 5KTEH 1N8ZA 3W9DB 3W0WB 2VABA 5E6ZA 3NCCB 1JWSB 1PKQA 1T1ZB 4M1CC 3SDDB 1P6FA 1QOKA 4PGCB 4J3XA 3STLA 4YEFA 4XI5D 2F8XC 3H9SB 3W5MA 5ALCL 3C5JB 4HZLA 4HLZH 4HC1L 4LCUA 4R96A 2NNAB 3OAZH 1JWUA 5JTWA 1W0YT 5HY9B 5C6WH 1CU4H 5F3BB 2RR3A 5J0BA 4Y5VC 4DN4H 4GRWE 1QBAA 3AXLB 4QTIL 4UU9A 3RBSA 3BKJH 5K93A 1XGUA 5KVDL 2V6HA 4HFWB 3X3GH 3C09C 3SY0A 3VXSB 3WHXB 1H3PH 2VIRB 4YDKH 1OSZB 2WW8A 1ULVA 3BVNB 4G80A 4QNPE 4HUWB 2L0DA 3A6BH 5FKPA 1KG0B 4OCSH 3KYOB 3RZWA 1X5ZA 4LDLB 3RVXD 5E24E 4PB9H 4C4KO 3LCYA 5CMAA 2MJWA 1DEEB 2EKSB 3WEXB 4EIGB 1EAPB 1QLFB 3LOWA 5DLML 4ZSOB 3BZDA 4XNUH 4WI3A 3PGDA 1CDGA 4OZHE 2NW2B 4PR5B 1HQRA 2WINA 3U4EB 3BN3B 4PY8J 2CKBA 4EKXA 4KKCD 2UZIH 2A9ML 5IQ9B 4PRPA 4DGVL 2FGWL 4XCNA 1UEMA 1N3NA 1DBBL 3I50H 4HIEA 4XNMA 4ZNCD 4YHML 1J0HA 1EEYB 4XVJL 4G9FE 4POZC 4DOHB 2AK4E 5EU5B 2VL5B 4FQXA 5TFSL 1JYWA 4FQLL 3QUZA 1T2JA 4KDTA 3AM8A 3T2NL 4M5ZH 3I6LD 1LDPH 1Q9KA 4XCCL 4C57C 3DECA 4RDQG 1JNHA 4RMUA 3IETB 5H35B 4DUXA 1KN2L 3F8UB 3C60A 1A2YB 1FIEA 4KMTH 1QTYT 4FP8L 4PJAB 4XXDB 5TDNA 3U4BH 5IFAL 5T5NF 3CZJA 3RNKA 1JNNH 3MYJB 4P49A 5DJAB 5IW6A 3HZYB 3GSQA 3G04A 4P2OC 4N8VB 4NHUA 4BK5A 5GGUA 2NXZD 3KYKL 4X9BA 5IHBA 1NH6A 2YEZA 1N6QL 2X70A 3FAWA 1IAMA 3KYNA 1HI6A 2OTUB 4JY6A 5IHUL 2V7HA 1TNNA 3FHQA 1J0YA 4KKLC 4F2MB 3SO5A 3VW3H 4LCIL 2PYEE 4MD4B 4LKXA 5HGDA 4LPTA 4GUPB 2Y07L 5C0FA 2XICA 4G6FD 4PRPE 1AXTH 1IQWH 1CXFA 2DQCL 1GJIA 1PVHA 4P4KB 3SDXE 1NUFA 2X4RB 1SYVB 1SEBB 4EVNB 1W0WB 4PD4K 1KFAL 1OGAA 4OZFH 3K74B 3QHZL 4YIQA 1LO5B 5F7DB 5IVXB 2VDPL 5LAXB 4TUOB 5CSBA 2QSCH 4HG4J 2XFXA 2E9JA 3FO2A 1O7SA 3DSFL 1XCQA 3RTQD 4JFOB 3SKMA 5E8PB 3SO3C 4J3TA 4DAGH 4GRLB 2I9LA 3QYCA 4BFIB 3B5HA 5DHXB 3DSFH 4MXVE 1GGBL 4JB9H 4MAYA 3UPRA 4BKLB 2FBJL 3MBEB 1GZQA 2W0KA 3OKYA 3A0OA 1NFKA 1F02I 5LJYH 2CXKA 4LIQH 4JM4L 4L9LC 1P4LB 2OQJB 3MLVL 4KQ3L 5LCVL 4TVPL 2AXGB 1UJ3B 5BCAA 1CYGA 1EHLL 4EQ3A 3E6FA 5EFIB 1FNAA 4JFZH 3TA3C 4GXVL 1QFWL 1RZIB 3P73B 4X7TB 1A3RH 3H9ZA 5C0BB 1OHQA 2VH5H 2J12B 5FUZH 1MF2H 1H3UA 4APQD 2J8OA 5DD5H 4LCYB 3NCYS 4FFWD 1T7YA 1F4YL 4X6EA 4WUUB 4M5YL 5HYJD 3WNOA 3T0EE 4NP4L 4YDKL 4YHLL 4O4YH 5KVEL 4X0KA 1VFBA 2ICCA 3NMEA 2YSSA 5GSVB 1J5OH 4ZFOA 1NCCH 1UQSA 3UYRL 2M26A 1A6AA 4UT9L 5EPMA 2AV7A 2ZNWA 3OB0K 2EIEA 4YZFF 3U0WL 3WL9A 2XRAL 4GAYA 2V9QA 3DO7A 3S3JA 5BRZB 1WUNT 5DFTA 4ZD3L 2AK4D 1TDQA 4GS7C 3D85A 2QKIB 3PGFL 1A7QH 4HX1A 3SDAA 2CGRL 1ADQL 3GEWB 1UJTA 1XF5A 4P48A 5IGXH 4I2XB 2BRRL 1PDKA 1TVDA 5ID0A 1KBGH 1INDH 1OP5K 1I9RH 1HILA 3MOAL 4LLWB 3VWKA 2JJUA 3QCVL 4J3SA 3NPZB 4UNTA 2X4QB 4XCFL 4PP1D 4XP1L 5I1LB 1OY3B 1Q9OA 1ZLSL 5DK3A 1LEGB 1FBIL 5D72H 4YUEH 4PJCF 2ZP0T 4G42A 3OPZH 3ULUC 1SJHA 2XTJE 4GKNB 2G60L 3DYOA 3T4AA 3TZVD 4DW2L 4M6OL 2O5ZH 3NABL 4LCCB 2BFVH 2KZ1B 3ULVE 1ZSDA 4NRYB 2VDMH 1OW0A 3BP4B 4ONHA 4OF5A 5T3ZE 5E2TL 1ZSDB 1T0PB 1QQDA 2EO9A 1JCKA 2GSIB 4DUWA 1UACH 3EOBB 1T4KB 5IWLA 1YEIL 4IHOA 4Z7WF 1A7NL 3QDJE 1YN7A 3GBML 3C60D 4HKZB 3ULSB 1Q9OB 3HE6D 4TRPH 1VADB 1YNTB 5EU3B 3KJ4B 2XZAL 4OLVL 2VDNH 5IB1A 5FYLH 1U8MA 4NO0D 3VXMD 3SE3A 2X05A 4YNYA 2VDQL 4Q6IC 2X4UB 5DJDB 2CUIA 4K3JL 1S7QA 4FZ8L 4YNYB 1G7MA 4LVOC 1MIEH 1HXYB 4Y5VA 1YNTA 1JPFB 3GSNL 4HX1B 4IMLA 1HKLL 4FZEH 4CW1B 3GDBA 3SPVA 5DMJB 1MWAL 1MIMH 4QTHB 5BO1H 3LQZA 1VKXB 1LWRA 1HH9A 2A2QT 4OM0L 1JNLL 2RIKA 5DHVH 4N0UA 1MCBA 4KRLB 3QI9B 3S35H 2YWYA 1QBLL 1HDMB 3VFSB 5BVJB 5L6YL 3FB5B 4XNZC 5CZKA 3BEWA 4P46A 5D2NB 1K6QL 3B8YA 5CJOL 2VXTL 1CXIA 4NIKB 1S7VA 4OCRL 4MNHB 4RGNE 1AY1H 2AGJL 2PTTB 1LEGA 5I74C 2ARWA 3K2UH 5ESVB 2FBOJ 4XGZA 3K2MC 2COQA 2EZ0C 2QQLH 3MLPA 2N1KA 2CKNA 3T0ED 5J6GB 3BPOC 4J3UA 1Y6NR 3N06B 3RVWC 2EXYD 3KXFB 3OKNA 4LSDA 3BUTA 2EC8A 3QIBC 4X4XB 1AD9B 5DFVD 3D18A 5DTFA 1F42A 3FN3A 3B8SA 3VMPA 3VXNB 3P3YA 4RMQA 3DX9A 4JZNA 2IAMD 1K4DB 2VR5A 3QI9D 5HI3C 1IQDB 1BJ1H 3UYRH 1F90H 1P9MA 5FDYA 1OM3H 2FHBA 2DWDA 3CJJA 4JPVL 5D7LE 1S8DB 3C60C 5L9DL 4ZQKA 2CIKB 3DO7B 4MJIA 3LEXB 3IU3A 4U3CA 1B6DA 4JJ5B 2FIKB 3NFSL 3UPRB 4HWBH 4PJHA 5CEZE 3SCMB 5MENA 5SV4A 1V7ML 5I1CL 2X4PB 4BFIA 1WC7B 3TBVB 4APQA 4ISVA 4OQTH 1I85A 1QLEH 4M6NL 2P47B 3C08H 1UVQB 2W9DL 5CP7A 5DQ9B 3RWEB 4PJDB 4XWGH 1KJMB 3QIWB 1Y0LA 5E2JA 1S9VB 2NY0C 5IVXA 2YUZA 2B4CH 4I77H 3MA7A 2F53D 4Y7MA 4PLJD 1MHEA 1P53A 4EVNA 1LHZA 2HVKA 3RTQB 3BD5A 3DURB 4F37F 1SYVA 4QRUA 3BX7C 3MRQB 3VCLB 3ZDYE 4X7TA 1V7MH 4M1DH 5I1CH 1HZHL 1I3GL 3D69B 2XTJD 3QBTB 4YWGH 1UJ3A 2CLZB 1PLGH 4LKXB 5HGDB 2A6JB 2E7LA 4WI8A 2V7HB 1SYSB 3ECBB 3FRUB 2X70B 4JFQB 4BQ9A 4PGDB 5DDHA 2Q87A 2QADC 5TGBB 1BX2B 1GZQB 1JE6A 1NMAL 3P40A 4NQXB 3MACL 3G04B 4J1UA 5LKNA 1HCFX 1J88A 4H5SA 1BWMA 2QLVB 2AW2A 3MUY1 2XN9D 5ISZA 3BSZL 5JZ7D 3VXME 4I5BA 4R90H 4TUOA 2DQEL 4OZIE 3MJ8A 3A67H 3QUMB 3T4YB 4G7YH 4UILL 1FGVH 4XMPH 4CADB 1CXKA 3BT2H 1TQCC 4ZS7L 2B1AH 4OF7A 1EIBA 3QUZB 2VC2H 3VXUA 2D2OA 2GSGA 4NN6C 3WFHA 1OWWA 3CMOH 5AD0A 1D5MA 2VL5A 2HH0L 3N0PB 3AGVA 1YMMB 3C6SB 2LQRA 4JFPB 4HJGA 3JV4B 1ZLVK 5GRVK 5C07E 5AG8A 3FQTA 4ONGL 4JDZA 4MNQE 4F33A 3IAGC 4MD4A 3EUUA 4G9FB 4O51B 1MLCA 4OFYD 4X99A 5IQ9A 4DOHE 4M62L 5CZVL 4L4TB 1DSFL 4WFED 2ATPA 4OBSA 3WDHA 5J11C 3OG4B 2I07A 2SEBB 3JTTB 3O3UN 3B9KD 3P9LA 4Y8AA 1J9CT 5KSBA 5D9SA 2GJ6D 2KL6A 1ACYL 3KVQA 1YNLL 1TJGH 5GGTA 4RGND 3UTQA 4Y4HC 4Z8FL 3B2UC 4KZEH 5FYKH 4KZEL 2D0GA 2ZCLL 4HS6B 3QUYB 1AY1L 2AJVH 3QUXA 2V7NA 1GCFA 1DBBH 1A21A 5I8KL 4KI5E 3TA3B 1YJDL 4XMLL 1G9ML 2F58L 5L7XH 1VGKB 5D7KD 2H1PL 2BHYA 2DIJA 3QQ9C 3PNWA 2ATKB 3SDAC 3AXLA 4UU9B 3MRCA 2NTFB 4V1DB 2YPLB 5EU7E 1HYRC 5D7LD 2WANA 5HPOA 3FQXA 1F3JA 3S5LG 3HLAA 4HIEB 5KVFH 1MCRA 4NSKA 5T1LA 3ULVH 4XCNB 5I71C 1WTLA 2ZSVB 4HFUL 2VLME 4UB0L 4WCYH 1WAAA 5FA3B 1UT9A 1FL6A 2KPNA 1HQRB 1YEEH 1KIQB 2RCSH 5IOPA 1IT9H 1DBKL 4XZUB 2JKXA 2K9UA 1JI1A 4Y4FC 4JRWA 3LH2H 3UTPE 1VEPA 2EKSA 3WEXA 2XWTA 2HVJA 2NXZC 3N1GC 1IGMH 3BIKB 1KBGL 3TH2T 1RSFA 4NKMA 5SX5H 5JUEL 3BVNA 2W38A 4FA8A 5C09B 3AAZB 2PYEA 3GRWL 1A7QL 3BGMA 4DGIH 1FIGL 1UXSB 1IKFH 1QSZA 1XGRB 5DC0A 1RIHH 2AQ1A 3MFFA 4LVNC 4HV8A 1AR1D 4G43A 1AFVH 1KPRB 3SGKA 5D71L 1JWUB 5D1QD 1NPUA 1IEBB 5I16A 1WAAE 4S0TD 3DX6A 4JY5H 4X9IA 5DS8A 5EG6C 2FWOB 4W6YB 3BH8B 4N0YH 4YHPB 2VJXA 1YEGH 3G6JA 3RDTA 2P4AB 1YMHA 4HPOL 3B9AA 3K1KC 1IGFL 2WLYA 3LAFA 4NQCE 1NC4A 4HKXB 2E7BA 3F5WB 1RD6A 5EN2B 3LQAC 4OZIA 2ITCA 4HHAA 4WO4A 4PRID 1CDIA 2YKLL 4NC0B 2W65B 4YLQT 3RHWK 4JKKA 3MZGB 1MH5B 5E8DL 4PRNB 3MJ9H 2A6IA 3MOQA 1CGSH 1F8TL 5EIIB 3EOAA 4S2SA 1UJ3C 3QNZA 4NT6B 4JO1H 4LSSL 5EBMB 4JB9L 5ESQB 3QUML 1GAFH 4WFEE 4OSUH 2WV3A 4XP4L 2AVGA 4XH2A 5KN5B 1V7NH 4HDIB 2DS4A 1ES0B 5I1KL 1UM5H 4TNWF 2K3TA 3GSXB 4I2XE 5TQ0L 1ORQB 1E27B 4TTDC 5DRNA 3FT3A 1LNUB 3RIAF 4OIIH 1K2DA 1R5IA 5E6ID 1G84A 1UKSA 3OB8A 5CWSA 4FQCH 4WU5A 4LEOA 43CAB 5DMIH 3RKDD 2M8XA 2NY1B 3CH1B 5GRWA 4WEMB 1MRCL 4P57A 1HK6A 3PE9A 5D7KE 3UTSB 1A6ZA 1IE5A 1JWMA 4NQSB 4G8EA 5A2JH 3JTSA 4F7TA 4NOFA 3HTLX 5F9JA 1U2CA 4RMTA 4D9LL 3V52L 5I9QB 3OKMA 2R0KH 1X5XA 1RQ5A 4L8SA 5IESL 3MCG1 5ETUA 3VI4F 5ADPL 4LBEA 5HHPA 5I1EH 3UDWC 2JB6B 2G75B 3Q2CA 5IMKB 2AJVL 4KRPC 1X5LA 3WHE0 4MQXD 3ME0A 2ARJA 5EUOF 5BJTB 2F5BL 1OQOA 1FQ9C 4KJQC 1ZHKB 5IHZB 1OD9A 4Y1AD 3BHBA 4HSQA 3NN8B 1I8IA 4HGKC 4X9FA 3PV6B 5HHNB 5FYJL 3ILQD 4PJEB 1B0RB 3MOBH 5J3HD 1VFAA 3L3GA 4RFOL 5LQBL 5HHOE 3V2AR 1A4KB 3L9RA 2PXYD 2OTWB 4U2ZA 4K23L 5F1SA 5GS2H 1U93A 2YA0A 1YUHB 5BZWB 1CDBA 2C4FT 4HUKB 4QRSB 3ZKQD 2Y07H 4UQ2B 4ZOAA 1AD0B 1JZ7A 3GI9H 4DTGH 1D9KB 4PJGB 3QWQB 4M6OH 2NMSA 4UT7L 5KSAD 2BK8A 2AXHA 3D2UD 5DRXA 3IVKA 1KIPA 1SEQL 4LLQA 3N50A 4O58L 4R90L 1FV1B 3ZE2E 4OKVA 1JIBA 5ADOH 2J8UF 1WIUA 1IVLA 2H2PC 3O2DA 2KUTA 4N68A 4XMKH 4R4ND 2VDOL 1J05B 3VFMA 4AM0B 4MJIE 3MLUH 3ARWA 3GMMB 3MR9B 1T7VA 4TPRL 2YA2A 1NUGA 4KROC 5DHYA 5E2WL 5KVGH 3BQUA 2YMXH 1FYHB 4O2EB 3TBWB 1QSFE 4XAKD 5MEND 1F4YH 4QRPA 1UWXK 1T66C 3AB0B 1B4JH 5BRZD 5IJVB 5M95B 4QRPB 2XZAH 4OLVH 4K7FA 3X3FL 4XHQA 5B38B 5HXMA 2Q6WA 4QTIH 1CLCA 3F6LA 3MV8E 3EAKA 1IL1B 4A2LA 5IIEA 3M45A 4HJ0D 3LKRA 4HQQL 1J05A 1I1YA 3VFMB 3EYQC 4OIIL 1WZMA 1KJVB 1K4CB 2VLJE 4HIXH 3WN5B 3QDAA 1FNSL 1UADC 3ARBC 3I84A 2NY0B 2R2BB 2BHUA 4PJFB 4YR6A 5I1KH 2OJEB 4JGJA 4DAGL 4TQEH 1FJ1A 5IVNA 1CQYA 3HI1A 2QSCL 4I9WE 2X4TA 2IH3B 1U8KA 3IFOB 5DD5L 4U0QB 5MEPB 1AR2A 5T3XD 1AGFB 2R0LH 3JWNC 3QEQE 1A3QA 2ED8A 1KC5H 4WI6A 4JO1L 4LSSH 2C4FU 5DQJA 1X9QA 3DRQB 3P4NA 4WFHD 12E8L 2UWEE 5I30H 4U1JA 1HXMA 3OR6B 1UZ6F 3TT3H 3NN8A 4GQ9L 3O2VL 4G6JH 3CFCL 2Y06L 3QNZB 3MV9E 1K3ZA 2CK0H 3FT2A 3IDMA 5E2VH 3VGBA 4GOSA 4NZTL 4FQIL 3DVFA 1JVKA 3C2SA 3AFLA 4JM2B 4AYFA 3EFFB 1JN6B 1KELH 2CDEB 1M6OB 1ZA3A 3AY4C 5EA0H 2MPAL 1JHTA 4YE4H 2H26B 3G5VB 4DGYL 1J1OH 4OZIB 4DGYH 1A6ZB 1I9RL 3MOAH 5F3HB 4D3CL 2CLVB 5D2NE 1ZT1A 5C0EA 1I9JH 2V5TA 2DQFB 3LEVH 3MRIB 1T7WA 1H3XA 5TQ2H 1KN4L 3WCYA 5GGSA 3U9UB 1IAOB 2YPKA 5K59F 1RFDH 2R1WA 3OX8B 4NZTH 1FLRL 3A6OA 4K3DH 3H6JA 4PG2C 4YHPA 4O2FB 2I9TA 1R3LB 2GK0B 2IQ9L 3PWNB 4ODVH 5DJCB 4RFEB 1A1OA 5JHDA 1A14L 4OB5H 4YPJA 1YYML 3BZFB 1PY9A 3RDTC 5IQ7L 1EAJA 2DQEH 1C5BH 1LEIB 4XC1L 4GRMA 2HWZL 5I66A 2VDNL 2X4NA 5DK2B 5C9JB 3WIFB 2PETA 3MROB 1A7RH 4WO4C 3CXDH 4UQ3A 1PY4A 3GHEH 3LY6A 4PRNA 4Z7VF 1NMAH 4U1NA 1I3RA 5F7LB 1YEIH 3DUUB 5EC1A 3X14A 1CLOL 4Z6AT 5F71A 2CDGB 4Z7WA 3GNMH 4YFLF 2D7MA 2ITCB 2X9XA 1I1AC 4PLNC 3GFUA 4BH7B 2FB4H 4UV4L 5CJBA 3F5WA 4MB3A 1U8LB 5A1AA 1Z0NA 4KROB 5IK3B 4G6MH 3VI3F 1ZT7A 3DMMC 5KVDH 4V1DE 1I4FA 1A6VL 4I0PB 2C9AA 5HDOA 4D9QD 4I3SH 2EEBA 3RGHA 4AEFA 3T3PF 3QIWD 3I2CH 3QJHB 1S7TA 1AO7B 5L2JA 4NN5C 4WTZA 5DS8B 3MA9H 3FFCB 3SGJC 4LAJH 5ALCH 1D6EA 1JK8B 5FYKL 2WSKA 1ZT4B 5EDXA 2G9HB 4ORGA 1DP0A 2J88H 3FQXB 2HLFD 3C6LA 1T1XA 1H15B 2HFGL 5INCB 2Z31B 3TIDA 3TN0A 5IF0B 5I74B 3U7WL 1S78D 1P9MC 4I9WD 5IROC 5E2UH 3PNWB 5BV7B 3SDDC 2PYEB 2F5AH 2VRAA 5LQBH 3VGAC 2ADGB 2FR4B 5DI8B 2FJGA 3T77B 3GO1H 3VFRA 4PG9B 3GO1L 1ED3B 3DMMB 3QEUB 4LGPB 4P2QD 4PJ8C 4TTGA 5FM5O 2GQHA 3MMEA 3DGGB 4K8RC 4PJ7A 3S88L 3WIHL 3FJTA 3RWGB 4ODWB 1WWCA 5C1MB 1HSAA 3VXMB 1JGUL 3QH3B 3H7BA 2X9WA 4R0LB 1ZVHA 1FCCA 1NANI 2VZ3A 4QHLB 3CSYA 4KKNA 5IKCA 4UT7H 2HFEB 1KIQA 3ARDD 3EDKA 4JO2L 1EH9A 1WZ1L 4ENEC 4Z7QF 4G9FA 4O51A 1IC5L 2D3VA 1YA5A 2VXQH 4RIRA 1GOHA 5K9QI 5C09D 4E42B 3B4NA 2D4DA 1WICA 4KUCF 5H94B 5B39B 4ZAKD 2I24N 2DKMA 3CVHA 1D5MB 1K5NB 1TJIL 5ENWA 1FZKB 3L1OL 3L3JA 1TQCB 1X4ZA 12E8H 1GOFA 1I7ZB 3EDDA 1WWAX 2YD5A 3OZ9H 1EZVY 3BKYH 3G9VA 5ID1A 3B83A 2VKWA 3VXRA 3ULUE 2KKQA 3T4YA 1VGKA 1MI5B 1ZHNA 2P5ED 4I18A 1URLA 5FGBC 4HEPG 4PJ7E 3RX7A 4ODXB 4H0IA 1G6RA 3IT8D 3U82B 3MRFB 3BJLA 5KG9A 5I18H 1MCOL 4J4PC 5HHXH 2ZOKA 3UC0L 3QHTC 3VFNB 3P2TA 5I1GH 1MRDH 2EIZB 5C0BE 4LLAA 3HA0A 4Z9KB 1BZ7A 1G6RH 4I8DA 1IEAB 1TITA 1BVKA 2CR6A 5E70A 2GUOB 3QWRD 5FYLL 2QQQA 2JCCB 5JOPD 4JFDE 1P7QA 3IDIB 1NGYB 3DROA 1R5WA 4JHAH 4XWGL 5DD0L 1S7XA 3LIZH 4HKBA 3SDCB 3QDMA 4HJGB 1BQSA 4OJFL 5F96H 5B3NA 4AMKH 5DC9B 3TYGL 4DKFL 3GKWH 3UMTA 1SM3H 3RTQA 3C2AL 1Q0XL 4P2CG 5I9QC 3AY4A 1EEQA 4MGXA 5I76A 3Q5TA 3VWJB 2MCPH 1UB5A 4U1KB 5BV7C 3MV7B 4BSJA 5IB4B 4DVBB 5LGJA 1CICC 3GMQB 2DMKA 1AGCA 5K9JL 1B0GA 5LXGL 4IRSA 4ZNEA 4TSBH 5DJ2B 2GIYA 3EYSL 3MNZB 3VFUB 1J8HD 3V8OA 4FXKA 2N7AA 4AENB 1UB6B 4HIHB 3DVGB 1SEQH 3QUXC 1SBBA 5F93C 5DMKA 4JFDA 5FXCH 5C70A 1S8DA 4Y2OA 2N7BA 1CE1H 2QQLL 2J2ZA 3MFGB 4YHYB 5DJXB 1YNKL 2E27L 3J8F7 1D5IH 2UV3A 3HAEG 3ZKND 1K4DA 2I27N 1JGUH 2C1PB 3QXUA 4DCQB 3EOYG 1I8MB 1PKQE 4BFGA 3EO1B 4CJ1A 3MV11 5DTFB 2ADJA 3D1MC 4QCIA 5GHWL 4JO4H 4MA3A 4H1LB 4EDXB 3KXFA 3CGTA 3G5ZA 3MA9L 4EIZC 4LPXA 2IADA 2ESVB 3T65B 1KPUA 1N64L 1LO2H 3OB0H 4WENB 3K8KA 4NQEE 2E7CA 25C8L 1T04B 3BN9D 1KJMA 1JRHI 5CP3A 3RWEA 3SGEH 3DYPA 4FOMA 5DLMH 3NFNB 3RAJL 1RU9L 3P30H 3GIZH 4JGMA 4U1SA 5CFHA 4M00A 1HHHA 3FT4A 4WGVB 4AENA 1DVFD 3F58L 1W72H 2N56A 1RIHL 1YY9C 2HT2C 3L7FA 3PDOB 3KLHD 3CFJB 4JDVA 2OZ4A 4P2RA 3GSRA 1LD9B 3CUPB 4X9HA 3D6GA 3U7AA 4Y4HA 5IB4A 3FAXA 5I1DB 1L7IL 3CU7A 3LQAH 4KFZC 4PG2A 4HF5L 3SPVB 2VWEC 3MCLH 1LK2A 1B88A 5DJYA 2YD3A 3NZHH 1IQDA 7FABH 1L0QA 3NCFB 1HHIA 2FYYB 3I3EA 1K8DA 1NFIB 5HGHB 1UYWH 4HUNB 1WF5A 3IAQA 5D1XD 2F8OA 2QSTA 2P5EE 3DJ9A 4H26B 1C5BL 3QUYC 1FNEB 3LKQA 4HWZB 5HI5C 2O5ZL 1IZKA 1QRND 3NABH 1MFDL 2W91A 3CCHA 1RI8A 4ZPTA 1Z5LA 2GTWB 2DQDH 3QG7L 3ISWA 4KK8C 2AJSL 4TPRH 1QHOA 3AMLA 3BFOA 4ZG1A 4HKJB 3UO1L 4YHKL 4TNVK 3EOBA 1JTPA 3HHRB 1TFHA 1IC7H 1QQDB 3U46A 3QWOA 3HCVA 3MRLB 2XY2A 4O58H 2FEEI 5FOBB 2NY1D 4PRHB 2EIZA 3O11B 3QWOB 3O2WH 1FSKB 5IWLC 4N0UB 2F54A 3FFCD 1YNKH 3WUWG 5FHBH 1TMCB 2QHLA 1I7TA 1FGVL 1BFVL 5GZOC 4LF3A 2XZCH 4LPCA 2R23A 3VG0H 1QFPA 3EHBD 5DT1H 4ZPTB 4Q6IA 1TJGL 1JGVL 2FX9L 3S9DB 1XEDA 1XH3A 4XRCA 1I7ZA 3WUWB 1LO4L 2X7LA 3Q6GL 2JCCF 5FGBA 1DN2A 1UWEH 3HG1B 4Y2DC 5HGHA 2QBWA 2MHAB 3LEYL 3STBA 3GI8H 1VDGA 4MB4A 4HKZA 2JK5A 4IOFC 3LVEA 3KPOA 1J1XH 1MCFA 1DQTA 3RUGF 3WO3B 5I1DA 3NAAH 3KPSD 3HUJE 4K7PY 1KC5L 2AEPH 3QXAB 3QNXB 3ULVL 1IARB 3GK8H 3QH3A 3RY5A 4ALAL 3VRJB 2NZ9C 2WBJB 4X7EC 2OJZL 4LNRB 3WFBL 4C83A 2OZ4H 4TVPH 4N5UA 3V7MA 4XVJH 4MNGA 2FJGB 1EHLH 1TZGL 2R69L 3GBNL 3UDWA 2VUOA 3QO0B 4RBPH 4JLRB 2X4QA 3L5HA 3MLTB 4NQCB 3MOBL 1GGBH 3GUTB 2BVPB 3UZVB 2FX8H 2NTSP 4LCYA 3P77B 1FO0A 2ZKHH 3OV6A 2H3NA 4S1DC 3WS3B 2CKBH 4OAWB 3PDDA 4H0GA 2GJ6A 2ZKHL 4YGVB 2CMRH 1U41A 5C0RL 3TO4A 5C0GB 4XNYH 4Z77B 5A40E 5GISL 5EUKA 4M7KH 4U33A 2VQ1A 1DE4B 3K7UA 4L5FL 1WT5C 4RGOH 4MWFB 4RMWA 4TOYL 5CEZH 1UB6A 4HIHA 2YD8A 1J86A 2AV7B 3P0VL 4MNGE 4BSWA 4KHXL 1OTUD 4WWKD 1MRCH 4HK3J 1LO0L 4MD0A 4H1LG 1DQJB 4PTUA 2DQJH 1IQWL 4C4KT 5ICXA 3PWPD 4MJ5A 4DWHA 1EEZB 3V0WH 5CBEB 3QB7C 2BHZA 4XHJD 1JZ5A 2EDLA 3GHBL 4PV9A 1V3MA 5F7EH 4LCIH 2ICWI 4F15B 5I76B 3HUJA 4NDMA 3UJJH 4X6EB 1QLRA 3D39D 4B0MM 3MCKA 3WIHH 1SEBA 3MROA 2DJSA 2MMXA 5JORB 3KS0J 3TH4T 3AUVA 4P4KA 43C9A 5C6PB 2HG5A 5IM7B 4U0RB 4G6KH 2YS4A 4P9ML 2BDNL 1YEHL 2UWEB 2RFXA 2GT9B 5EULV 2P43B 2AXGA 2YC1A 5SV3A 3DYMA 1EHNA 5EO1B 2WK2A 1HWGB 1F11B 2DLIA 5FHAH 1KXQE 3O81A 3KYAA 4TVSa 4G9FD 4QXWA 2EDRA 4WHYG 3JWDH 1S7WA 4Y19E 4NHUB 4ZS7H 4K94L 5T33H 2XG4A 1LVEA 1X5IA 1I1FA 5L88L 5F21B 5FUOL 5IW6B 5I73B 3RZCD 1CFSB 2AGJH 3SQOL 3LV3A 5TDNB 2FD6H 5D7IE 5E94A 1INQA 1NCAL 1ZA3B 6FABH 4YIQB 2GAZB 5EBLB 5H35A 5JXED 5T5FL 2A38A 4K3EH 4Y0GA 3CD4A 5DUBA 3DETD 3LPFA 1MLBB 1FL3A 1J7VR 2X4RA 5D6CA 4FQXB 1A0QL 2OL3L 3IKKA 2R9HC 3QA3B 4U6YA 4XXCC 2MQCA 5ALBH 5FO9B 2VN4A 1NSNL 4MZ2A 4ZXBD 4UIKH 4OTXL 4MAUH 2FJFA 2XWBB 1MUJA 1CQKA 2OTUA 4JY6B 1XGTB 5I1IH 5DJ0B 4OM1H 3VA6A 1ZS8A 3Q0HA 3OAYH 3QPXL 3OMZA 1LO2L 3H7BB 5E08L 4WVRA 4FTVD 4DN4L 4PJHF 3U7YL 1CL7I 5CGYD 2KZWA 5MEPA 4QYOB 4UZGA 2JIXB 1W72L 3WLWD 2R69H 5GRZA 1KACB 5GS2D 5A2FA 1ED3A 3QDMD 4HCRL 3TN0D 3VU2A 5I19H 4M93C 5JDSB 4LQ1A 1NFDB 4XPGH 3T77A 5J7CC 3QXDA 4R4FH 1QVOB 5DD3H 2GW5A 4PJFA 1CGWA 2C3VA 4JFFB 1YYLH 5TF0A 4OD1H 4HFWA 3ARTA 4U6HB 3BDYH 1G7PA 3BZEA 4RISH 1G7JB 3S7GA 3O3BA 2AI0H 3C5SA 1FLRH 2AJUH 4KVNL 1NAMH 5INCA 1NLBH 1ZTXH 4UDUB 5HPMB 3HE7D 3OPZL 3VD9A 3GMNB 4XNMB 3HNSH 1OTSC 1BQLH 1PZ5A 1U42A 2Z91B 3P11L 3QJHA 4F58L 1YEFH 2CSPA 3EO0B 5EU7C 4E0RA 4PR5A 5L2KD 4I0PA 3EGSA 1JPTH 4AG4L 1CIUA 3TNMA 4NN7B 2OSLB 1OQXA 5EZJB 1BJ8A 1QLFA 1JGVH 5C0JB 5C0IB 2XPGA 2EIDA 4EI6A 5C0DA 3D0LB 2FHFA 1OD7A 4LCWA 1HH6B 1NMBH 1CGYA 4MHHG 1NC2B 3THMH 4G80B 4HULB 4N9GB 2AJZB 1KLGA 2Q1EA 1R0AL 3H3BC 3PG2A 4MYWB 2R2HA 1I3RB 3RIFK 4LLQB 2IANB 3DGCR 3AM8C 3T1FB 1NJ9B 4K2UL 5KAQF 1DCLA 5IP4A 2H6PA 1DLFH 3PHOA 4NQEA 1BVLB 4OCYL 3TO4C 4OZHB 5DO2D 5HGAA 1W8OA 2HH0H 3C2AH 3VFOA 2EYSB 2WBJD 4WUKH 2ZG3A 3AREC 4OFKA 3ARVA 5I1JL 3FQRB 1YUHA 5BZWA 4PGCA 4GKZA 3DRTB 4ZUVA 1AHWB 1JF1B 1U3HB 1PKQB 3B6SA 3FO0L 4Y5YC 2P8MA 5IW1B 4P46D 5LBSH 4ZFOL 1NKRA 4W68A 3O2DH 4Q2ZB 1D7FA 5FDWB 3ZDZE 3H42H 1C7SA 1DUYB 5T1KD 1CICB 4S0SD 4YBQD 1JGEA 1HHKB 1DL7H 5CSZB 3T8XA 4P5KB 5EUOB 1MI5E 2OZ4L 1ZVSA 4OI8A 1Y18A 5DEZA 1U8HB 2XQYG 3W39A 2R56H 4XMLH 4BUGA 4YK4C 4D0BA 2Q86B 1BOGB 1CDYA 4UTAL 3UBXA 3BYYA 3RY6A 3D3VE 3FB8B 3QNYA 4ZYKA 3O8XB 4G9DA 5DUML 5KVFL 3OHXB 1I9IL 3O4OB 3B2VL 4LMQI 2NY5L 3C8KB 5HYQB 1T1WA 5IB2A 1S7SA 4Y5XC 1C12A 4LCWD 2BVQB 3QDJD 1SMAA 3E8UL 5DSCA 5JDJA 5TJWK 3QFDA 4BQ6A 1JNNL 3QUKA 4BJLA 1CE6A 1ZANL 5EB9A 4ZO6A 5DJ8B 1NANH 1CL7H 4K8RH 3UTZA 5ACMA 3QDME 3NFPA 4FN0A 3ZKMD 1LDPL 1X44A 5JW4R 2R4RL 2Q20A 1DBJL 3WIIL 2JLLA 3OTTA 2ESVD 3WFBH 1Y6KR 3WDIA 1U8KB 3DOSA 1Q9WB 3FQNA 4UINL 1FL5A 1ZKAA 1LO0H 3SKJH 4CVWA 1LE5B 3EOAB 3MV7E 4FFYH 3BQUC 4L3ED 2R2BA 3EYVB 1K8IA 5ISZE 3C6LD 3F12A 5BXFA 5JHDE 4PJHE 1JGLH 3WN5A 3TFKC 1KCUH 4FQJL 4IOSD 4KUZH 5DYOB 5T1LD 4XCYB 2PW2B 1GHFL 1IGYA 1SJEB 4K9EH 5GQBA 2PR4L 1IGJA 3MV8B 1RUQH 1ZHLA 2DBJA 1RULH 2DM4A 2VAAB 2CIIA 2ZOLB 5DR5H 1UM4L 2A1WH 3O6KH 4X7SL 1U3HD 2D7QA 1DDHA 4NWTL 1DQDH 2YRPA 2Q6WB 2DWEB 2KBGA 4TUJA 3VXRE 4OFDA 3CIQA 2P8MB 2HTLC 4HUUA 3V6OC 3GMOA 2Z35B 3EO0A 3GZKA 4UAOB 1N5YL 1U8IB 5C86A 5I8OL 1KLFA 2FWOA 2EO1A 1D5BA 4GBXB 3BQUB 3MJ9A 3GBMH 2K1MA 2PN5A 1OB1B 2XWJA 3MACH 4O5LH 4G8GD 3ZHKA 4O2CB 5DA0B 5EU4B 3TCLA 5I17A 5IBTL 3MLSL 4NQEB 3O9WD 5EOQL 1PG7H 1KTLA 3EDEA 1KB5H 1F4XH 2ICWJ 1G7PB 4QXTA 3JSSA 4F7MA 1TETL 3IB4A 3BGMB 4LLVA 4QRTB 5TH2B 5HYJB 1EUTA 1C5CH 1WBYA 4PV8B 4ZFZA 1RZFH 3S5LB 1YPZF 1T0MA 1MRDL 2JB5H 3EJZC 1B9ZA 5HHVL 1CG9A 1GAFL 5D7JA 5E00B 2XZQH 3VXUE 1LO3L 4NJ9H 2DQUL 3FN0L 4RDQF 1H3PL 4D0DA 3VGGA 1T0NA 3HFML 5I6XC 4XC1H 5D8JH 3DI3B 2WBWB 4GRLD 4Y16C 3O6ML 1QO3B 4FFVD 1ZMYA 1C16A 2ZNXA 5DJ0A 5DRWB 3HI6L 4U49A 2IWGA 5K59E 3OQ3B 1MI5D 4XWOD 4HC1H 3OKOA 2HFGH 2Y5TB 3D3VD 4X5XA 2FNBA 5BJTA 2E6JA 4P4KD 1BOYA 4WW2A 2YPLA 1E4XL 1RU9H 1MHPL 2BXYA 3SJVB 5FGCE 3VXPA 1N7MH 5DUBB 4ZO8A 3MNWB 4HPOH 2UZIL 4F58H 1QBBA 4OZGF 5GZNC 2O26U 3E8UH 4ETYA 4KI1A 3CX5K 4YGAB 4G5ZH 5HJ3A 3VWKD 2DD8L 5F88A 2NY6D 3F7VA 3ZHDA 4Z5RB 3ZKSD 2C1OB 4KWUA 3HAEH 5F9JB 1IAIM 2P24A 3QDJB 5HSFA 1CFSA 3V4PH 4JO4L 1NLBL 1I1FB 3MRNA 5F8QC 3QO1B 1Q94A 1H8OA 3VWJC 4ZUWB 3NTCL 4MMZC 5D7IF 2J4WH 3JV5A 4P2QB 4CN6A 4WHTA 4NZRL 2ZCHL 1KGCE 3NA9H 3QIBB 4PJBB 3CDYA 3BXNA 4BQCA 1E27A 5DRNB 1PX4A 1OAQL 1IKFL 1MLCB 4X99B 3ARRA 4Z7UB 4KHTL 3CVIL 1U95B 3DO3A 1BFOB 3B3IB 4DGIL 2J8HA 3MCLL 1R3HB 4JY4A 3U7YH 4L3EE 3IXTA 4CMHB 1KJ2L 2A74A 2VDRH 4LP5A 4UDTA 3LD8B 3RU8H 4B7IA 4MNQD 4UOJA 4Z0XB 3QFJD 1FL3B 2X44D 5JORA 3BWAB 4CRPA 5EH1A 3KR3L 4KJPD 2IQ9H 2GJ6E 4LAQH 1SVCP 4HLZG 4KJYA 4I5BB 2VLRA 4F9PA 1EXUB 4I1NB 4AEIL 2AXJA 5ITBL 3DVNB 5DEFB 4OCYH 3ET9F 4ZS6D 3I85A 5KVGL 4AT6B 3WO4B 5GIRB 1EV2E 5IJKA 1WFTA 4R7NB 1JHKH 2WUBH 2D7OA 2E7HA 5TGBA 1F4WH 5DF0A 5DURD 1LK3H 3ARFC 3GM0A 3KPMB 1VSCA 1XF1A 2P7TA 1D5XB 5LCVH 2WLZA 3BH8A 5B8CA 3L5XL 4G8GE 4XCFH 2A0LC 4RX4D 4F7EB 3O3EA 3MLWL 2Y6SC 4Z7QE 3AVEA 2PO6B 2JTDA 3R8BB 3ZL4H 3WS3A 4WY7L 1KPRA 4IDJH 3WE6A 1QLRB 1BF8A 1E28B 3HI5H 4OV6F 3VXUD 3VXSD 5DMGD 1QUNA 3WXVL 2V5MA 4MNGB 1U3ZA 4I48B 3MBXL 1UVQA 2MSPA 4G6AD 1RV6X 1WFOA 5GS3A 1NL0L 1IM9D 4LNRA 4C83B 1MFCH 4PJ9B 1WC7A 5CP3H 1Q72H 1L0YA 3WFEH 1VEOA 1HQ4A 4BSWB 2Y5EA 1BEYL 2EE2A 4C56B 4L9LA 5HHVH 1KEMH 3KPRA 1T03L 3TYGH 4DKFH 4Y16B 1DJSA 5F9DC 5JLZA 2VQ1B 4OZ4B 3WJLC 3ZHLA 5EUKB 4HBCH 3KPPA 1GZPA 2HJLA 4JG1H 3W2DH 4JCMA 4PTTA 3ZMRA 5C0GA 1Q38A 4G8IA 3I2CL 3HLAB 4QRPE 3HNVH 1RPQA 3S88H 1R3IH 3IDYC 5FIEA 5D4QA 4TOYH 3ZE1E 1BHGA 5LXGH 5I30L 5F6HI 2X7LB 5SWQB 2HTKD 1TENA 1Q0YH 1WZLA 3GUTA 3BKML 4NNXA 4PLKC 4FG6C 1LEKA 2Z8RA 4M93B 3WFCH 2AJ3B 5GISH 3QRFM 5ADPH 1PLGL 3WFCL 4ZUUB 1YEJH 1KENH 5GS0C 1WJ3A 2P5WA 4RZCA 3BEWB 4NWTH 4P46B 4XAWH 5T1DH 5D2LB 1OGAD 1MWAA 5DR5L 3KPSA 3H9SD 3C5ZA 1ZA6B 2PR4H 2YPLD 5F9WC 1A9BB 3SEPA 1NBZB 3G5YA 3VXTA 4G5ZL 5AYUL 4JANA 1FNHA 4HKJA 3LQZB 4GMSH 2OXHA 2FL5B 4P2RE 5D96C 3MRPA 3VRLF 4LRIA 4LPWA 4EI5A 3U0PA 3ZKXC 2PW1A 4JDZB 3ROLB 1JPFA 4L8BB 5F1IA 4H8WC 2WAHA 1Z9MA 4UINH 3D25B 1FVDA 3JWDL 5HYSB 4PJAF 4QHMA 4ZUSA 3FO9B 4QF1A 1NFIA 2W0LA 2DQHL 4GAGL 2APXA 3SHSA 4PRHD 4YXLL 3TF7C 3U9PH 3B9KB 5DJYB 4K2UH 4M7JL 4LARL 4PJDF 4XPFH 1OW0C 1TZIB 3TJHD 4ACPA 1ZGLB 4NO0A 2DQUH 3L7FB 5EOTA 3QQ4B 4MAYC 2YN3A 1DTUA 2XZQL 5FOBA 3IKCB 3MYZA 3GSVB 3ZTJH 5FKAB 4NRYA 4AEEA 1BX2A 4OV5A 3REVA 1RK1B 2ZPKL 1HHGB 4CN4A 3NFNA 1UH4A 5CD5C 1XF4A 2QQKH 1NGQH 4HG4K 3HB3C 2NX5A 3UBXG 4XCEA 1CDUA 4U3XA 1NBYA 4L8DB 5IEHA 4G3YH 3RGVC 3SE8H 4Z7OE 4PBVC 4MSWB 4YPGB 4FQHB 5A3ID 3QIUC 3EYOA 4JJHA 5IB5B 3V4VH 4LLWA 2C26A 4H26A 4X6CF 5CZXD 3QIUD 5CJXA 3MBXH 2A6KB 4L4JA 2C1PA 3OKKA 5EO9B 3QG6A 3BZ4B 3SDAB 5HHOD 2WWMC 3E2HB 3H0TA 3T0EA 1DVFB 2YD4A 2LU3A 3HPJA 2IPTH 3N1PC 1GGIL 1FGNL 2DLFL 2ZUWA 2R8SH 4S1QL 3O45B 1T3FB 1MEXH 4EI5D 4JFDB 4W6XB 3PP3K 4HPYH 4WCYL 3VRIA 2LTQB 3TBVA 4APQB 1ZLWK 4N90D 1FE8L 5K9QG 3GHEL 2B5IC 4UBDC 4R9HA 4A6YL 3VFUA 4F7PA 4U3HA 3LDBC 4JEGB 3TT1L 2XI9A 4G6FB 1CFNB 3TJHC 2HAZA 3LH2L 2CIKA 3QZWA 4QRPD 2XXMB 4EN3D 3O45A 1H8SA 4HWEL 3KLDA 2DBLH 4HJJH 2NLJB 1G9MH 4MJID 2X09A 4TYUA 2ENSA 4U1KA 1DFBL 4HAGA 1A3LH 3MBED 1WBXA 3BJ91 4JPWH 1FG9C 5C0BA 4AL8H 1XIWB 2OMBA 4G7VH 4RMSA 1T5XB 3GGWA 4NQDA 5F6IB 3E6FB 3X17A 4D3CH 3QULB 1CL7L 4KRMB 4NGHH 4RAHA 1AKJA 5ESVA 3V0VB 1OGAE 4OLWH 1FH5L 1NBVL 1FO0H 1HYSC 2APBA 1XF4B 2GJZA 2H1PH 2BCKB 3BWUC 5L7XL 5E5MA 3QZWB 4CMMA 5D2NA 3VGEA 3MO1B 4GRWB 3KNBA 1REIA 4MAYB 1G1YA 1IEAA 2CO6B 4L3CB 5E7BA 1JV5A 5IGXL 1ZOXA 4M7LT 5GS0D 3GJEB 4K55A 1TVBA 1YC7A 2HLAB 5IQ7H 1WVZA 1INDL 5BS0A 3MRBB 1D9KC 1FAIL 2BOCA 3GMQA 2XFXB 3JXAA 3FO2B 4N5EC 1VKXA 4WNQA 4PJGF 3THML 1JTTA 4NKDB 1LP9F 4JFED 1DVFA 1LO5A 1FIGH 4M61A 4PLKD 1N5AA 4OF3A 2OLDA 1RFDL 4LOUC 1PFCA 4N8VG 5CILH 4GLRI 4LDEB 4Q9RH 3WS6C 2HTKC 4X7CC 4Y5VB 3WDJA 5MHSD 3CMGA 3FO9A 4PRIB 2V2WB 1X6NA 4QGTA 4PJ9D 5ENWB 4Q6YA 1FVEA 1MFNA 4PD4J 3D25A 2EKJA 2NY4D 4OZHF 4XX1E 4AIZA 1VERA 3QQ3B 4HKBB 2IPUG 4LRNL 3ESUF 2VC2L 4L8CB 2NX5B 1I1AB 3HZVB 2VL4A 5J1AB 3I6GA 1BVKB 3GKWL 2P45B 3GSVA 1JZ8A 4NQTA 4KI5F 3TBSA 1HSAB 3VXMA 3RWDA 2H8PB 2ZUTA 3ROOB 1FDLH 4P5TC 1KB5L 3EOTL 4FQQB 5KW9L 4RZCB 3IDGB 3CLFH 1ORSB 4KDVA 4NO0B 2QQNH 3MYJA 5C3LD 2X40A 3WXWH 3QUZC 3NBNA 2X2YA 3HRZA 5I8CA 3QDGB 1N0XL 2IPKA 1XGPB 4OLZL 4UT6L 5JW4Q 1JNHB 2VE6A 3ZYOA 2DLEA 3UX9B 4YHYC 1Q9KB 1NCUA 5IT2L 1G6RL 3DUSA 5FECA 3IDJB 1NDGB 4GT7A 1IKNC 1U3JA 3FN0H 3O8XD 4Y89A 2ZCLH 2VYRE 3VFWB 4MQ7B 5CSGA 2C7UB 3ZSSA 1PSKH 4D8PA 1CFQA 5F1KC 3AS2A 5GRUL 3CSPA 25C8H 5H94A 5BS0D 1CD1A 2Y72A 3L3OB 1IM9B 3CDGA 2DN7A 4JZJB 1XR9A 2IC2A 1H3VA 2XQYK 1TZGH 4CVXB 1ZWIA 1CGSL 1F8TH 3KPLA 3BPOB 3I6KA 4FABH 3KPRB 5EZOH 5IK3A 2R0WL 3RA7H 5ILTL 4PJ9A 4R2GC 1EZVX 3L1OH 2P5WB 1BQHB 4QXUL 4BH7A 3LS4L 5IBLD 2E27H 5D7IA 1QR4A 3IGAA 2O61A 2HMID 1GGCH 3AU1B 4HBCL 1OPGL 1T89C 3MXVL 2BNRA 1VFBB 5DI8A 2ZUUA 1OAKL 5FB8B 5JIHA 2VISA 7CGTA 3ZT5A 1KULA 1NEZB 3BKCL 1M4KA 4LEXH 1FZMA 4LRIC 3L3KB 1QSVA 3Q3GA 5IHUH 4K8RL 5HI4D 1WZ1H 3OKEB 4UQ3B 5E9DE 4DUVA 5F3BA 1RUAH 5DK2A 5C9JA 3RA7L 4V1DD 1CR9L 1BQLL 2VDOH 1UZ8B 4E41D 5EFIA 4XMKL 5KS9B 2VLRE 3LKOA 1S5IH 1U58A 4NC1E 4U6TA 3CX2A 5GS1C 3VD4A 4YXLH 1FP5A 1OARL 4BSVA 5L8KB 5D71H 4QHUA 5DJ6B 3GSUA 3O6FC 1R3LA 2GK0A 2BNQA 1G0XA 4RAUB 1AFVL 4Y5XA 4XPTL 3VWJD 4YWGL 5IMMA 2YPKB 1YYLL 5DD1H 5F96L 1MIEL 2ZCKH 2NY2D 5JUEH 4WGWB 2QEJA 1X7QB 5KANG 4NNPL 4YFEA 3LRSA 2D4FA 3FMGH 2O5YL 5E0QA 4PREA 3QCTL 3QCTH 3ZDXF 1RJLB 2FZ3B 3ARGC 4YFDB 1K3IA 4P4KC 3ORJA 1Z6JT 4S1RH 3IDMB 3PWPA 2DQDL 3QG7H 2XA3A 2X4NB 3FO1B 4JFEB 2ZCKL 2J3SA 3L3HA 5F89B 2D7PA 1F6AB 2CH8A 3KAAA 1LEIA 1R24B 1UH2A 2RB8A 2VUYA 4PJBE 4I4WB 1CLOH 2FDBP 3E3QC 5JHDB 4LLDA 1VACA 5C09E 3GNML 4TNVF 4JQXA 5JW4N 4FFVC 3ULVF 4QHKJ 2ZSWA 4R8WL 3W81A 4EXPX 4GRLC 5AZ2L 3MJ9L 2OR7A 2BNRD 3MRGB 5GRYA 5I71B 1IAOA 5T5FH 5A43C 2FLRT 4N8VA 3F7QA 1MHHA 5TDPB 3GSQB 1ZT1B 5C0EB 1ZLUH 3RX5A 2H9GA 4GS7B 4YAQB 4A6YH 1M7IA 3GBNH 3SQOH 3EJZD 2ZZUT 1BLNB 2R2CA 4WV1B 1WCBA 2WQRA 5EOCH 1QSFA 5MEOB 4FNLH 4ODUB 4MCZB 4HBQA 4F80A 4KJWC 2B7DT 3NTCH 3O9WC 4HWBL 3E6HB 1Q72L 2EDDA 1DN0A 1MVUB 4QXUH 4I0PC 4RWHA 4M9PA 1KB9J 1AQKH 3G5XB 3LKRB 3H8NA 2NR6D 5EU5A 3BO8A 3LZFH 4ERSH 3MODH 3FL7A 1J1XL 1T7ZA 2VZOA 3ABZA 1PW3A 4UOW1 1S9KC 4OM0H 5B38A 3GB7B 4LCCC 4M7KL 1KEGH 1J0KA 3QIBA 4YBLB 2XN9B 4Y4FA 3RWHA 4P2QA 4YC2B 2G5BB 3JWDC 1ZGLP 5GJSL 1DEEA 1MELA 1U3HC 1J12A 3IJYA 4XPAH 4LASH 4LASL 1CZ8L 1ONQB 1QD0A 4RNRB 2VXVH 5I19L 1IFHH 1UYWL 1CVRA 4IRJD 3O9WB 4JN2B 1OSZA 1IGCL 2FHCA 4ZFZB 3I75B 4PJIB 1IKNA 3C6LC 3UJIL 3AREA 2EE3A 2ICEA 2WIIB 3N85H 1UXWA 3DHMA 5HGGS 1FO0L 3OBAA 3VXPB 3PL6B 1XZ0A 3DXAD 1U8NA 3MV01 4WW2B 3LB6C 4U7MA 5IMOA 3NIGE 4ELME 5IIEB 3G08A 1MAJA 1ZE3C 1QFUL 1XR8A 5FGCB 4NBXB 1AO7E 2BP3A 1LP9B 3V4UL 2R1XA 1FFOB 3K8MA 1MPAH 5HHMD 2E9IA 3G9AB 2B2XL 5DEGA 1G9NH 1XCTB 4MX7A 3WNMA 4HUUB 1F3RB 4M6ML 3N9GH 1IC4L 1XGQB 4K3JH 3L3GB 1XCTA 4MX7B 4O02H 4F8QA 3VH8B 1PAMA 4WU7B 5IFJA 4JM4H 4YHNB 4J6RH 4JFFE 4NJAL 2ICWB 3SDCC 5MEQA 2F9BT 4JZOB 3PV6A 3O6LL 1RK0B 1FFOA 4J8RA 3ULUL 4WI7A 5D1QA 1Z9OA 5D7JB 4AQ1B 3P9MB 2IGFH 4NQED 1B3JA 2ARJB 3KJ6L 1T0MB 2VDLH 3GJFB 2ADFL 1B4JL 2GCYA 5CS7A 5TH2A 5HYJA 1JYXA 4K3HA 1CF8L 1BFVH 1GH7A 4K7PX 2JB6A 1FFNB 5T5NG 3U0TA 3ZO0A 3AREB 3FOLA 3OG6B 2AEPL 2CK2A 3I75A 4PJ5E 4HUMB 4PJIA 3OKMB 5HVWA 3VXQB 4U05A 4PRAB 1FL5B 2D0HA 2V5YA 4ZSOE 2OL3H 5I0ZA 1MCWW 4Q0XL 4N9OB 3UYPA 1R3IL 5J8OA 2HJKB 1MCIA 2DYPB 5K9JH 5T1KA 1BQHG 4HMDA 3ZE1F 1IAKB 4C56D 2Q7NA 3UTZB 3GMOB 3RWHB 2EDYA 4LSQL 3S4SB 4CBPA 1R3KB 1J8HA 5BVPL 3P4OB 1YDPB 2E6QA 1GPOH 2D03H 1B0RA 2BVYA 4JO2H 3ARED 4G6JL 1NC2D 4X98A 5DK0B 4R0LC 4FQLH 1SM3L 3WN5C 5EBWA 2RHEA 2VH5L 1BEYH 3C8KA 4JG0L 4LSVH 1JP5A 4PYHA 1IGYB 1SJEA 2VZUA 3S96B 1AIFA 4KU1A 3HN3A 2FGWH 4XP5H 5E8OB 3U4BL 2ZG2A 3VG9B 5ESAB 3F12B 1IILE 5BXFB 2A73A 2Q86A 3WNLA 2P8LA 1NCDH 2PO6D 2BVTA 4MCZA 4UT9H 4BYHA 4WDIB 4U1GC 5T3ZL 2WBKA 1NCCL 1TCRB 5KSAA 1JZ2A 1A6TB 5HVGB 1DUZA 3K1DA 2V17L 3PWVB 2DL2A 4QT5B 1CICA 5EBWB 2BOBA 3RAJH 2IF7A 4J12A 1R3KA 4LIQE 1ZAGA 3LKNB 2ZSWB 5IVOA 1LNUA 1JTOA 3O4LA 4N1EA 1J11A 3MGTB 4OGAD 4DFHA 1O7VA 1KFAH 2J5LC 4HS3B 3SKNB 3TEUA 3ARBA 4QHNB 1B2WL 3JV0A 3GSXA 3O4OC 4XC3L 3FQRA 4ZFGH 3K81A 4OZGB 4LSRL 3LQAL 2ED9A 3LIZL 3VFOB 4KGJA 1F6AA 3LB6D 3CC5A 3MV9A 2JE8A 2DAVA 4GW5B 1V05A 3UTOA 3QEQB 3I02A 3OSKA 3CFBA 4MA7H 3WLBB 3O8XA 2XKNA 4AEIH 3KPSE 4BQ8A 4D0BB 3GIZL 5E8OA 4A2MA 3AAZA 3GJFA 4DW2H 5FV1L 4N9GA 3HS0A 1A6WH 5HHME 4OSUL 1RULL 1MCOH 3P9MA 4RQQA 1X7QA 1HHKA 1HH6A 4Z7OF 4XP1H 1KCKA 4JFYB 1WZKA 1RMFH 4HKXA 1ITBB 4NWUH 4JFFD 4X4YA 4Q2ZA 1KJ2H 2IFFL 2VDRL 5C3TA 1MCPH 3RDTB 1YDPA 1P2CA 4LQFH 4RAVB 1QKZH 1TTFA 5KANI 4RFNC 2FX9H 4EJ1C 3RVTC 5I8EA 5DJ6A 1JF1A 3D5OF 3C5ZD 5FYKE 2YK1H 3QZWG 1DQLL 4ZXBC 3FCTB 1NGPH 1VGEH 1NGPL 5DMGC 1CE1L 2BY1A 2FO4A 2NR6C 1N0LA 1DQLH 4I3RL 5I1HL 4ETQB 2R2EA 4V1DA 1MJUL 3RIFF 4N0YL 3MFFB 2LV4A 4LQFL 1X4YA 4WEBL 4L4TD 4ZXBB 2YZ1A 4NCDA 1P4IL 1IC7L 1UXSA 5C8JA 1OM3L 3PUCA 5ACLA 3RVUD 5BMFH 3GI8L 4BUHA 3OKLA 4QXGH 4POYA 3O9WA 2O61B 1T83A 5KVEH 5JNYB 5KAQG 2IG2L 4U1IB 3GSNH 3D0LA 1MSPA 2L4OA 2F5AL 3PWPE 3BEVB 1MHCA 1RUML 4KV5E 2GEEA 4MXQD 1H3GA 5E2UL 1GVIA 2G5BA 2WUCL 3LRGA 5I1EL 5FUZL 4CVXA 4Y4FB 5JO5A 1FVCA 3K0WA 1E6OH 1QNZL 5CIPH 3B9EA 2CD0A 4XTRD 4KKAD 1F6LL 3D2UB 1DL7L 1U8PA 4TULH 1Z9LA 2BRQA 4FQPA 1CFQB 2EDJA 3TJEL 1ZHBB 3G5XA 1UENA 3M8OH 2ARJQ 3MRCB 3O3BB 5FECB 4NO2B 4U6HA 3CFKA 3RNQB 4O00A 1YY8A 1IGTB 3SCMC 2VE6B 4HD9A 4G8GB 4XVUD 4NOBA 4F7CB 1I1CA 2GAZA 4NGHL 3BP5A 2FATH 3UC0H 5LWYH 4KTDH 3HRZB 3MRRA 5I8CB 5JQ6L 1UWGH 5E03A 3PWUA 4H88H 2JIXA 3MUGB 2NY2C 2EC9U 3IU4L 1EK3A 1L6XA 1A4JB 3SGJA 3DV4A 1MHHB 5TDPA 3UTQB 1UKTA 4PRBB 2P8PB 3TVMA 1U0QA 4UI2A 4XPBH 2EDWA 2DI7A 5BOPA 1ZS8B 2JJSC 5C92A 1K9TA 1MFBH 3P9LB 5IEKB 1CLYH 2ATPB 5J1AA 1FG2B 1GXEA 2FJFB 4IRZL 4XNQB 4FQIH 1UACL 2ZCHH 3NA9L 1FFRA 4CDHA 5E2VL 1U3YA 1CZ8H 5E2TH 2UWEA 5D5MA 5DWUL 4UOW0 4U6YB 3SCMD 4MCYB 43C9B 2YMXL 4ODVL 2GSGB 4ZTPL 2FECI 4PRIA 3J7HA 1RUQL 5FV2A 3O0RL 5D2LF 3D9AH 4WWKB 4J4PA 3L5XH 3L95A 3U1SL 4WV1A 1MCJA 4FTVE 5FF6B 5ISZB 5CP7B 2ED7A 3CH8A 5HTSA 2Z31C 1F5WA 5C6TL 4MD0B 3SKJL 1II4E 2R0LL 4WFFD 4ISVB 2HLAA 4RWYL 1VB9A 3GRWA 4KKAC 2DQCH 5SWZB 1OAYL 5FYLD 1YECH 3VD5A 4Y16D 1Z2KA 4G3YL 1VGEL 3I3DA 2E6PA 5J6HA 3EW3B 3FN9A 1VFUA 3CFIC 3LEXA 1P1ZA 2VDLL 3K3QA 5CHNB 1F11A 4KK6C 1JFQH 3MNVB 4JFZL 4JFHD 4BSVB 4LSQH 1CXEA 2AQ2A 1UM6H 4GQ9H 3ULUH 3SGDH 5EOQH 5CJQH 5D8JL 3RWFB 4Y2DD 3L3HB 1MCKA 4ODSH 4PP2A 3L5IA 3U6RB 4NZJA 3HMXA 2UYLB 1G9NL 3OR7A 4NQCA 2R4SL 4V2CB 2JB5L 4P9HC 3IXAA 4KUCD 4OCMC 2VISB 1WEJH 5CBEA 1YN6B 2CMRL 3PHQB 2D31A 4MNHA 1A1MA 3L3DA 4IS6B 4NM4L 2A77H 2BZDA 2BJMH 1SVZA 4LSUH 3E0GA 4PY7B 1WV7T 1PG7L 1KXTB 3WYRA 5EZLA 4ZOEA 2WBJA 4BM7A 1OOAA 2DLHA 2P5EA 1OF2A 4QY8A 2DYPD 1ZWIB 4MWFA 5IV2B 1DE4A 2BNQB 1IM9A 3S3PA 1T2QH 1PKOA 4JM2F 2X4SB 1ROWA 3S34L 2YXFA 4FFYL 3SDXA 1RAMA 2X10A 5EO9A 2NY4C 4GG6B 2MHAA 1NKOA 3VXOA 4U6XA 3MLRH 5HI5D 3QUYD 1PG7X 2HT3D 4OAWA 3WSQH 3RGVB 1J18A 2H3NB 1AD9A 4PJXB 2ORBH 5JXAL 1YEJL 2JF1A 4JQVA 2ZJSL 4RGMC 3NACH 4KQ4L 3Q3GB 1YZZA 2VLKB 3LEVL 5EU3A 3L3KA 1CLZH 4Y4KC 1CXLA 5IEHB 3MJ6A 3IFNL 2FECL 3V5KB 5L8JB 4LF3B 5DJZA 2H32H 5CINL 5EA0L 2AEQL 2R29H 3ZKMC 1T4KA 3ZTNL 5D7IB 3RFZC 2F53E 4X7DC 3RY4A 5DA4A 3IYLW 4K7PL 5D96B 1BF2A 3RWDB 1A9EB 1CD0A 1WGOA 4D2NA 5ABDE 2HYMA 3QQ4A 4MJ4A 1DANT 1JF6A 3MLYL 4OZFA 1CFBA 4JZJA 1EO7A 4HK0A 5C2BH 5K9OB 1WQVT 3O2VH 2X4OA 3HZKA 1SJXA 4ZTOH 4F9LA 3FHAA 3CVHH 5IUSA 1JF5A 3FQWB 2HKHH 1B4RA 1MQKH 4S1SH 2Z8WC 1CLYL 4JY5L 1AGDA 9CGTA 2OMNA 3G6JF 4HWZA 2PO6C 4R8WH 3FB6B 3MBEC 5T1MB 5AWNH 4Q6IB 3ES6B 4R7DA 2R23B 4Z7VB 2XN9E 5FM8A 2PW1B 4M61B 1FC2D 4JAMB 4LSUL 4Z0BH 5ITBH 3HZKB 4R4BB 1YN7B 2DQGL 1BD2E 1MWAH 3ZKXB 2AJYL 4DJMA 1ORSA 2XIDA 4FZ8H 4OZFB 4P46C 3G5YB 3VXTB 3BH9B 4WUKL 4PRHA 4JRXB 4NCC1 3ULVC 1ZA6A 3V5HB 4ONHB 3PQYA 1SBSH 3M8OL 1PQZA 3TM6A 3OXSB 2EDKA 3H42L 5DGRA 1KIUA 3SGDI 3OJMB 3SKOB 1GC1H 3VJ6B 3U79A 3GSOA 4DKEH 3FMGL 1I1AA 3HZVA 4ORZC 5DO2C 2FX7H 1QSEA 3IXAB 5DVLA 5CEYB 1VPOL 1Q1JL 1JFQL 2QV2A 1XIWA 3VWKB 5IFHH 5SWQA 4JKLA 4YDIH 1M71A 1NCBL 3S36X 2ADJB 4C55A 2Y4SA 4PP2B 3U6RA 3FOMA 3V9FA 3VXOB 1RUMH 4H20H 3OJDA 4GG6A 1EEUA 2C3WA 4AZ8A 1S9XA 5DD6A 2G60H 1I9EA 4X6FB 2HJLB 4NKDA 1KPVA 1OAUH 3BESR 3STZA 5L8LB 4NRXB 1MY5A 3QAZC 1V3LA 2DD8H 1FYTE 3MSPA 3Q1SH 5B38G 2AEWA 1NGWB 3DVGA 1TVHB 3GJEA 3SDCD 1U6AL 4YDLC 3MNZA 4DKDC 3FT4B 1A6AB 5L2KA 3KNBB 3VFTB 3BKCH 4LEXL 1NGWA 4GRLA 4WW2F 1WWBX 1YQVH 1FZJB 3FRPG 3LSOB 3NOIA 3VRIB 2HKFH 3SKMB 5E5MB 1MCEA 3CFCH 5GSVA 4CMMB 3RUGA 5LGJB 3E2HC 4R26H 2MWCA 4QOKE 3MGOA 3HPJB 4M4RA 1YN6A 2W0FA 4OD2A 3S35X 1RIVH 1PD6A 3L95B 2J4WL 3QG6B 4TN9A 4IRZH 1AGBA 1E28A 1T5XA 3GGWB 4Y4KD 1BBJA 4L4VB 2W9EL 4MA8H 2XRAH 2BDNH 4B7LA 3CFEA 4NPYB 4HWNA 4ZAKC 1NEZG 1CIDA 2NYYD 5FYJH 3BPLB 2IBGA 1QFHA 4J2XA 2EE6A 2HT4C 5DJXA 2FSEB 3JUZA 4E9LA 1UWGL 2XA8L 3TBYA 2VMFA 4B53A 4OCWH 1PQZB 5GRJH 4LK4A 4MJ2A 3RKPA 4AMKL 1QFUH 3KGRA 3TC9A 4R3SA 1AKJD 4KI5D 4WI9A 1QBMH 1QYGH 4YHOH 2Z92B 2R9HD 3SDDD 1EMTL 4EDWL 1OGTB 2UVEA 3ALPA 1RZ8B 1A2YA 1ZHNB 4I0PD 4M43H 2K7PA 4F7CA 4JQVC 5K33A 1N5YH 1OGAB 2QSVA 1IGTA 4MA1B 3RWCA 4NBYB 4KJWD 2H45A 5JXEC 2HLFC 1NSNH 5ICYA 2JJTC 2X1OA 1TNMA 5HVHC 3UTTA 1JPSH 1T2XA 2GY5A 2YXMA 4OD3H 4EUPH 4LLYA 3OAUL 1WK0A 5JW5A 3PF2A 1U95A 3X13A 4K3EL 2NXYC 4PB0H 4YBLC 3TV3L 2CRIA 1FG2A 1F4HA 4PFEA 5DC4B 3UTSD 4TUKH 2WINB 2GUOA 3GBLA 1U91B 3NCEB 3PP3H 4OZGE 4PBWD 3HKFA 5JO5B 3CSYB 3VFGL 5TE6H 4NNYA 4R0LA 3QFJE 4P59L 4PJAE 4YX2L 1LP9E 3MRMA 4QRQA 2MTPA 5CMAB 3EOTH 4PJ7B 3M17A 3LHPL 4IIQB 3QEGL 4JHWH 3V5DB 5D1XB 3CDCA 1A8JH 3GMRA 4M48L 5DHVB 3X3FH 5H2BB 4PG9A 2AJ3A 3ARFB 5F88B 5DJZB 4JVUA 3DV6B 3WFDH 1RHFA 3C60B 4F8TA 5C8JB 5IVXF 3WHXA 3VFVA 2D03L 3ZE2F 1A7OL 1PYWA 3V6FB 2F74B 3T09A 4CU7A 3TN0B 1IM3A 4ETQA 3GMPB 1H15A 3E1F1 3RBGA 1CGVA 2WM0A 4UV7L 3C5JA 4L8BA 3JWOC 4LSTL 3SDXB 3TZVB 2AV1A 4CAGA 4WWKC 1S7TB 4BQBA 4DEPC 3CZFB 5GS0H 1CLZL 4EEEA 2HJFB 3QDHA 5JPMA 5LG1A 2CUHA 3T1WA 2DM7A 5DRWA 4JPKL 4Y16A 3UP1A 1OAKH 2B39A 3R4DA 4ZO7A 4N8PA 1A9BA 1BAFL 4QY8B 1A3RL 2IALB 4C56A 3H9HB 5CJ5A 4M5ZL 1I3GH 2W60A 4PRIE 4QOKD 1T0NB 5C71A 1BJ1J 3A6CH 4EUPG 4ZS6C 4D0DB 4JFYA 3MMEB 4U1IA 4QRRD 3BRGC 4BFEA 1ITCA 3KYOA 4RA3A 4RQQB 4X9GA 3VXSE 4OUOA 5FKPB 3VFRB 2CDGA 4Z7WB 3PHQA 1ZEAH 4H8WH 4PV8A 1OAZL 1ZANH 1XGUB 4XVUC 1DBKH 4NQDD 4X6CA 3DXAB 3GSWA 3WLBA 2R2EB 1KTLB 2NY7H 1JMZA 3QEQA 4NYLB 5HI4C 2XACC 5I1AA 2P48B 5HHXL 2APTA 5ICZB 2PO6A 2HMIC 5IBLC 2ITDB 4HK3N 2JJVA 2GKIA 5KJRH 3HC4L 2FGZA 3DPBA 2VITB 2XNAB 3OF6A 3TIEA 1BFTA 4D9RD 4U31A 4LVOB 4DQOL 2Z35A 4WUUE 4FXGB 2VABB 4XTRC 5FK9B 3KPMA 1Z3GH 3H9YA 1N8ZB 1R6VA 5IW3A 2MQ0A 4R7NA 2YD2A 3N85L 4X5WB 3UJTL 2X89A 3N1MC 4MXQC 2BSTA 1DDHB 1N6UA 3DBXA 4F3FA 3O4LD 3Q6FB 2AKRB 5MI0C 5T3XL 1ZHLB 4YC2C 3VWKC 3MRDA 5KSVB 3HS0B 4NUGH 1CD8A 1G9EA 1JL8A 3G6DL 4HH9A 5MENE 3ARGA 4ELKB 3CFDB 1GPOL 4NUGL 4JN1H 1YECL 2EYTA 5BRZE 2E9WA 3EYQD 4KAQL 3O8XC 5C0CB 3HPLB 3MQIA 4M62H 1GGUA 5FYJE 5GZOD 3DHJA 3QUMH 4GXUN 1Q9WA 3VGHA 5E4IA 3QUZD 3ZDXE 5I2IB 1R3HA 4MLSA 1L9NA 3U48A 1BFOA 3B3IA 4M3KB 1F13A 3T2PA 4HS3A 4Q9RL 2OYPA 1VENA 2NY1C 3CMOL 4LP4A 3BXNB 2X1WL 3O4LB 2J5LB 1LE9B 1BWWA 3ZT7A 1A7PH 2V5SA 4JKMA 3UYOD 2R4SH 4ZUWA 1JPSL 1Q94B 4PJFF 2J8UE 3DV4B 2XTJB 4AT6A 3ELAT 2NY3D 1QR1B 3IFLH 3QDJA 2XKSA 5E5RB 3PWUB 5FCUL 4R4NC 2IBZY 5D1ZB 5BV7L 2NXYD 5T3XE 2H2PD 1TCRA 3QEQD 4NUJA 2VLRB 3F7VB 1RUKH 4WDIA 3VDAA 1AP2B 3NCJH 4KZDL 4JM2A 2JJTA 4WFHE 2A73B 4A6YA 5LGHL 1FRGL 2FO1A 4NO2A 1JRHL 4CUCA 4LOUD 4OM1L 1VFMA 4Z0XA 2Y5TA 5D7SH 4GKSB 1QSFD 4XAKE 2A74B 1NAML 5ACZA 1NGZB 1BAFH 5FYJU 3DUHA 4JPKH 2ICWA 4OZFG 2VLJB 2EEDA 1OAXH 1D9KD 2EICA 1MCNA 3RZCB 5E1HB 1J8HB 4OGAC 1UA6H 3MV8D 1A7RL 3P4NB 2Z4QB 3X11B 4PJ5B 5CEXA 1U3HA 4HCRH 3IJSA 4O2EA 1HYSD 2VZTA 3PIQA 3SN6N 1FORH 4MA8L 1YYMH 4YEEA 4OB5L 4RSVA 5FA4B 3GMMA 3SBWC 1CG9B 2RAMA 4R97C 3RUGE 4L9DA 4KRPD 3QJFA 1RZJC 4GMTH 2B0SH 2RCSL 3O41A 3S5LA 4AIXA 2OJEA 1XF3A 1DZBA 3ZE0E 2FJHA 2NYYC 2M2DA 3BQUD 2R2HB 2ICEB 2YR3A 1KIPB 2P1YA 2GCYB 3EYUL 5EZIL 5AZEH 4YH6A 3V79C 4D9RE 5D93C 1UCBL 4P59H 4YX2H 3G6AA 4EN3C 4KVCL 2DL9A 4KVCH 4TSBL 4QRSA 3ZYZA 4UAOC 1JNLH 1UCBH 3PWLA 3UO1H 4S1SL 2CRYA 2DJUA 3CSBA 3O0RH 2Z4QA 3LN5B 1XGQA 2Q7YB 5ANMA 2B1AL 4O4YL 4E0RB 1N2RB 1QG3A 4LU5H 3AB0C 3KPRD 4UILH 2V2TA 5DWUH 1PZ5B 2QSQA 2JJSA 3P4MA 5SWSE 4EI5C 1CK0L 1XR8B 3IS1X 3S37H 1MCLA 2DDQL 1YNLH 2MOVA 3IDNB 5AG9A 4GFTB 5IB2B 3KS0H 5IMOB 2WWMD 1KJ2A 1MVUA 3U30B 4I3GA 1CD9B 2FX7L 4UNVA 5FYJD 2WUBL 4OUUB 5HD8C 4F7MB 4OKVB 5FUCC 4JHAL 4D9QE 1KUMA 3R8QA 3BW9A 3QPXH 2XKNB 5HD8D 3O41B 5HGBA 3HC3H 1WCBB 5I17B 5JDSA 4GW5A 1Q0XH 5FA4A 3RGVD 1JWMB 1OB1A 3QEHA 2XWJB 1BM3H 2B5IB 2H9GB 3ALWA 3HB3D 1Q9LB 4LPYA 4M4PA 1O5DT 3FRPA 4JFEE 1DQQB 2YD1A 4PJ5A 1GGIH 2DLFH 4GH7B 1A4KA 1TZHB 5AAMA 3T2QA 1XGYH 4PPTA 1EGJL 5JIPA 3BRFA 3VDCA 5MHSE 3BIAX 3WHE1 4N0FA 3RL1A 2XWBA 3QUKB 4MAYD 4LLDB 3GJFK 1YEDB 3QFDB 1IBGL 5AYUH 2BOBB 4GXVH 4KZDH 4P5TB 2QHRH 1S7SB 4MDIA 1R24A 5GHWH 5ACZB 5I2IA 2E8YA 35C8L 2VAAA 1DLHA 1H3TA 1OAQH 1RHHB 1SY6L 4Q9QL 1AR1C 4JGUA 2AXFB 4RGOL 3G6JE 1F45A 2X5PA 4ZUTB 4QLRA 5I18L 3VGFA 2G75A 3QISA 3HG1D 5ESAA 2APVA 5EBLA 5E5UB 4L8SB 4XPTH 4JRXE 2DLTA 4KRNA 3P0GB 1N6QH 3MLYH 2F19L 1GGTA 4N0RA 2Y23A 2VSDA 4JPVH 4IRJC 1QR1A 2LVEA 3V95A 1GHFH 3UTSA 3DBXB 4F3FB 4ENED 5T3ZH 2BSTB 5HHQB 4Y4FD 5DK0A 2JCCE 4JZJC 1C1EL 2B4CL 1HOCB 1L7TH 1WTGT 5FK9A 3IFNH 1CE6B 5C2BL 1IAII 1QFOA 3L7EB 2HJKA 5KSBF 2ITDA 2RFXB 3HE7C 4XH2B 2ORBL 3JVGA 4HAFA 5EIVA 5KN5A 1KN4H 1IGFH 1FAIH 4K7PH 4NQUA 4OZHA 3I50L 2J8UA 1OLLA 4P3DB 3HPLA 3SDAD 4ZPVA 3GSWB 3FOLB 3QFJB 4MHHI 2FZ3A 1MNUH 3BP6A 4M1GL 4P2QE 2LAGB 2VTFA 4WW1B 3CFDA 2IFFH 1IEHA 5A16B 1DEDA 4PJCE 5KOMC 1EEZA 4JO3H 4LPUA 5CGYC 1U8OB 3B9VA 4LHUG 4IDJL 5M7QA 1X5FA 2NY3C 2VLKE 5E6YA 1NC4B 3ZL4L 4BZ1L 2XPGB 4HPYL 5I1GL 4JZOA 3WBDA 2LABA 2BVEA 3I6KB 2N4IA 1G7QA 3B6SB 4ODBD 2HJFA 5JPMB 4LHUB 1M7XA 2IMNA 2XNAA 5E95B 2AV1B 3LKOB 1NDMA 3DX6B 1KJ3L 1ND0A 1PGRB 4MDJA 5KSUB 4E41E 5ICZA 1F3JB 1GC1C 4X6DA 3UZEA 3S8WA 1XAUA 1CBVL 1OVZA 3F7RA 4MQ7A 1LO3H 3C8DA 3SE9H 5A2KH 1NDGA 3IDJA 3FO0H 3CPLA 3F58H 3W2DL 1XGRA 2ATKA 5TQ0H 5E1AA 1NEZA 2J6EL 1AE6L 2JELL 3DV6A 5C0BD 5AUMB 3ARFA 2AJZA 4MNQA 4LLUB 1QZ1A 2CRZA 3QT2A 5B8CC 4Z7WE 3IGAB 5DHVA 2Y25A 4K9EC 1X3DA 3L5JA 4FQQA 4IOIB 4U1LA 2HVJB 4JPIB 4HXAH 4PS4H 5C0IA 1UH3A 2W60B 2IANE 4KK6D 4ONOA 2IALA 2I5YL 4P2OB 1A14H 1U91A 2I07B 1XR9B 2YD7A 3CDGB 1MUJB 4HZAA 3O6FD 4F33B 5C08D 1RIVL 1KCRL 3JV6B 4LLYB 1YMME 5JXAH 1QP1A 5HDBF 2YPVL 4P2YA 3C6SA 4UDUA 5D6CB 1FORL 4JRXD 2BFVL 5DRZB 5ICYB 2EDNA 3V4PL 1JPTL 3T3PE 3WUWA 1MLBA 1IJ9A 4QRRB 1J1OL 1PYWB 1RUPL 1MCQA 3RWCB 4CADA 1P6AB 2A83B 1TXKA 3MJ8B 1RZGA 4M6MH 2YOCA 3OL2A 4MQTB 2PF6A 5GRVL 1M7IB 3GMRB 4HS6A 4P3WA 3V5DA 1TJHL 4GAGH 2DQHH 3S4SG 2BNQD 4AL8L 2B4CC 3MRGA 4NKIH 1KTDB 4NNYB 2Q76A 3DIFA 3ECBA 1RURH 5HYIA 5F7YC 2A6JA 4EZMA 2YC1B 4PIRF 4MLIA 3CXDL 3V0VA 3MTRA 1AI1H 2VR9A 1C1EH 1L7IH 2QR0A 1CU4L 1RZJH 1BBDL 3O6LH 1CXHA 1GC1L 1YMMA 3BGFC 2HG5B 4OGXH 4OF8A 3FO1A 3NPSB 4EOWL 2VQTA 1FNEA 3PWPB 3R0NA 5GZND 4LDOB 2ERJB 3HR6A 2HVKB 4L4VA 4QOKB 5EORL 1HHIB 2FYYA 3HUJB 4HXBL 3EKCA 4JREC 1AGBB 5CBAB 3QUMA 4Z7NF 4RMRA 1TETH 4MJ6B 5D7LA 3EYFB 1OGTA 1S9WA 1YPZB 4WNQB 5KTEL 2Z92A 4PJDA 1NGXA 3LV3B 1AGEA 1GIGL 5C08A 1DQJA 4PTUB 3MRBA 4DEPB 3PDOA 4RWYH 4XWOC 3AS3A 4NM8H 2MFNA 2QTEA 4PJHB 1S7WB 2Q8BL 4TSAH 1HHHB 3IDXL 3WMSA 4JE4B 5BMFL 3MO1A 5DMIL 5JMOC 3W0WD 4KROD 5ADOL 2GJZB 3GSUB 4IOFD 4NRXA 4LIQL 4PJEE 1E6JH 3DXAE 3SE8L 1RIUH 1OP9A 1XGYL 5DD6B 3H3PL 4G8FB 1AKJB 1QRNE 2GT9A 2F53B 4YGVA 4X6DE 1WBZB 5JW4M 1F00I 2ESVA 2Z9TA 5I75C 3FFDA 3KPNB 3RVUC 2PYED 3RX8A 3BPLC 3VCLA 1YQVL 3CFEB 1G7HA 4NPYA 4QCIB 5CLTA 5L0QB 5J11B 3D48R 4N0UE 3EYOB 4DCQA 5AYQA 1WBXB 5CEYA 3IS0X 4PV9B 4L8DA 1QSEB 2DKSA 2CJUL 1MCSA 5FB8A 1S9VA 1HN1A 2DTML 2OR9H 3LDBB 3RUGB 4HWUA 2CJUH 4Z76B 1JGDA 3BPNB 3DX8A 3REVB 4JQXC 4XBEH 5BW7C 2X4PA 5TDOB 3C5ZC 3IKCA 5DMYA 3FB5A 2EIBA 4FXKB 3VRJA 3ARYA 1DBAL 4MD5B 4KI5C 2J6EA 2HTLD 3KPLB 5DURB 3GHBH 3WO4C 4KTDL 3I6LE 3WSQL 4Q9QH 3IU3B 4Z7VE 1HH9B 4HGMA 2E7MA 1JYNA 4QTHA 5CJXC 1CI5A 1OPGH 4QKXB 4YHMH 3T0VA 1DQML 4KJQD 2DQJL 3MLWH 4ZDHA 3H0TB 3S34H 3T0EB 1S9XB 1OAZH 4OKDA 1G7LB 2BVOB 2HT4D 4X5LA 1T2QL 4GKOA 1EO5A 3VXNA 1RJYA 3TCXA 3FOMB 4FABL 2BSSA 4Q97A 1SJVA 1M71B 2X4UA 3KJ4C 4OLYH 5IB1B 3DUSB 4MSWA 3QDMB 4YPGA 5EZIH 1K85A 5F1IB 3FQWA 1XGPA 4HUXB 3P0YL 2AI0L 2NY3B 4XCEB 3ULSA 1QFWM 4WJ5B 4OD1L 4QEGA 3IDIA 4XNZB 2F54D 4H0HB 3T2NH 3CLEL 1FSKC 1W2KT 1WIOA 2B0SL 3OXSA 1RK1A 1OCWH 3IDGA 1S9YB 3RI5F 5K9KA 4X8XA 3GM8A 2VDQH 1S7RB 1FZOA 1WLHA 3PQYB 3S6CA 3O3DA 3HCVB 4JRXA 1H9VA 5D2LA 3QI9A 5K9KB 2UUDK 2NW3A 3QXAA 2V2XB 1EFXD 1SJHB 3FQUB 4GKNA 4JR9H 4F9LC 5KG9B 1TZIA 1CK0H 3S37L 4WEBH 1J1PH 3KPOB 4M1GH 4I3SL 1G6RB 3N9GL 4XT1C 5KW9H 1T80A 1I7UA 3QQ3A 3GI9L 4DTGL 1Z5LB 3RWIB 5ID1B 1UZ6E 1FVEB 5I1JH 3LRHA 3HG1A 3LKQB 4M7LH 2BSSB 4PJXA 5HYSA 2V2WA 4YXKL 1XH3B 4I2XA 3NIDE 3WFEL 3HC3L 1F3DH 4OI9A 1N5AB 2VB5A 1YEHH 4IM8A 3MRPB 3KPPB 4P9HH 4WFGE 5J13C 4OZ4A 5IMLB 4YBQC 2V2XA 3FQUA 3GSRB 4LKCB 1HCVA 5CD5D 5IV2A 3RPIB 3O11A 4PJIE 2CR3A 3C5ZB 3ARDA 1NAKH 1OF2B 3HI5L 1A9EA 1IGIL 4ODWA 3U7WH 4PJGE 3RRQA 4GAJH 2ZJSH 2F5BH 1JPST 3F6IA 4C59B 3TLRA 4Z95L 1DBML 5HYJE 4DZBB 3ULVD 2WIMA 5GJSH 3T4AB 1RIUL 3QEUA 2BCKA 4ZAKA 3D39E 2UZXB 2Y7QA 2WWKO 5D1QC 4UTAH 1W72A 4NCC2 1G0YR 5T3ZD 2GTZA 4HUXA 3IDXH 2DQTL 3HNTH 1KPUB 2R0WH 4NQDB 5TE4L 2X9YA 5FM4A 2KH2B 3TO4D 3HMXL 3ZLQC 3CCHB 4Y19B 3WE6B 3VI3E 5I75B 3LPGA 1JBJA 3C6LB 2AABL 3OAYK 3PP4H 3KPNA 1J5OL 4U6XB 2LE9A