1G6RB

A functional hot spot for antigen recognition in a superagonist tcr/mhc complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
237
structure length
237
Chain Sequence
b'EAAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGGGGTLYFGAGTRLSVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA T CELL RECEPTOR
molecule tags Immune system
source organism Mus musculus
publication title A functional hot spot for antigen recognition in a superagonist TCR/MHC complex.
pubmed doi rcsb
total genus 40
structure length 237
sequence length 237
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1g6rB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1g6rB02
4LRNH 2VDQH 3RPKA 2AV7A 1B0RA 4LGRB 4ALAL 3F7PC 3TT3H 4IRZH 1XEDA 2EYTB 4NM4H 2DDQH 4P4KD 3DBXA 3QP3A 1F4WH 2YPLB 3PL6B 5I1IH 4N1CA 4GO6B 1H3GA 1YEKH 4N0CC 4HS3A 1ZT7B 1G6RH 2PTUA 1H3TA 3KAAA 5D7KD 5EORH 1YZZA 4X7SH 1LDSA 2P8LB 5GGQH 2FGWH 3DRQA 3L5WA 1BVLA 3QDAA 3VWKA 3CH8A 3RY5A 4XC3L 3VFPA 1NC2A 2NY3D 5F9AC 1G7IA 1EFQA 4KDWA 4XCYB 3D39B 2YEZB 4WEUD 3PGDB 4X7FC 4L3CA 1ZT4A 1IAOB 5DJ0B 5J0BA 4EI6A 5DEGB 2OZ4H 5IB3B 4U1IB 4MYWB 2NY7H 4NO3B 1VADA 3TWCL 1TJHH 2YD5A 1IKNA 3QXWA 2NY5H 2NTFA 1ROWA 4ONFL 1ZHKA 2IFGA 5E9DA 3VH8G 5FO9B 4K7FB 1IC7H 1PGRB 2BHYA 5ACZB 1P4IL 5EORL 2GTZA 4JN2B 4G3YH 3VXSE 4J7RA 5KTEL 2XTLA 5BJTB 5JOPD 2BSED 3O8XC 2BOBB 1YC8A 3RPIB 4PJ5E 1A2YB 3IKCA 2FDBP 3EYOA 1N8ZA 3LQAC 3QUYD 2Y06L 4YHPB 3C2AL 1H9VA 5HYJD 3HI6L 4J4PA 2PYEB 2NY7L 1AGDB 5H37G 3ZE1F 3C08H 3EDEA 4FZEL 3WUZA 1NGQH 1Q38A 3UJJH 3TZVA 4WFEE 4HWUA 4X9HA 3GMPB 2CLRB 1KBGL 4PJ8A 3HUJF 1TPXC 2AKRB 5IB4A 3CXHK 5D2LA 1DBMH 2R0WL 3QEHB 1IT9L 2O5ZL 3H9HA 4ZSOA 3MCKA 2GKIA 3WIFB 2CDFA 3L9RA 3BD4A 2RIKA 4LPUA 5LCVL 3F62A 5DJ2A 2LTQB 1G9MH 3MJ7A 4UQ2B 3GGWA 4KPHH 2F15A 1IQWH 1MFDH 2QTEA 4DW2H 3Q1SL 2XT1B 4OUUA 1RZIB 3ZKQD 4HXBH 3TIDA 2WUCL 3MV7E 1B4JL 1BJ8A 3D18A 4YIQB 2VDKH 4YDKH 3BGFC 1MFEL 4O9HH 2DQFA 5EWIL 1TVHB 3WFEL 4JRYB 2J4WL 2VXUH 3QWQB 4EN3A 4Q6YA 2P5WA 1CD9B 3SE8H 1HXMA 4HZAA 1KC5H 2G2RB 1TMCB 4WHDA 4P2RB 3UBXB 4Q2ZB 2QBWA 3TBYA 4IOIA 3BGAA 3MLSH 1DBAH 1KLGA 2DKSA 5E6IC 3TIDB 3T8XA 2R0WH 2KL6A 2E5EA 2VLRB 2NZ9D 4ZNEA 3B9KD 1MIML 1JGEB 3ARFD 4LSSL 1YMHB 4Y4KA 4JFEE 2EYRA 1ZK9A 4HIJA 4P2QE 1ZHNA 4BK5A 3HE7A 4X5WB 3QIUB 5KOVC 5KN5B 4YO0B 1F6AB 1AR2A 4X6DB 3VXME 1NGYB 4BUGA 1VFAB 1HH6B 1I3GH 2R0ZL 5E4EB 4U2YA 3NN8B 2A0LD 3GM0A 2E7LA 2APXA 4XPFH 3RVXC 5K33A 1A7RL 2XY1A 4ELMF 3HC4L 1CXHA 5BO1H 5FB8A 1X5FA 3L95A 4LEXH 3Q6GL 5I1HH 5I1DA 1QSFB 2PYFB 2WWMD 2A9MH 5IMOB 3RNKB 2YC1B 4CJ0A 2R1XA 2QKIA 4K3DH 4F9PC 1KCSL 2DRUA 2D7QA 1WC7A 1R3LB 4NQUA 5TDNA 2DYPB 3FOMA 3DMMC 5HDBF 4E41A 3V5KB 3VGBA 1JGDA 5HSFA 1YDPB 4OD1H 4KAQH 5CJ5A 4RNRB 3U7WH 4JDZA 4MS8D 5DUBA 5SWSB 1DN0A 2P8MB 2VR5A 3IDJB 4K8RC 1WIUA 3OAZK 4ELME 1UH3A 1OW0C 1FVCA 1Y18A 2X5PA 4NQXA 1JYXA 2NXYD 3G5ZA 4CMMA 5DJAA 1I7RA 3KXFA 4G9FE 1JMZA 1RUKH 3MV7A 4RGNE 5CJOL 3DO7B 1F3JA 2HWZL 5DEGA 1T20A 4EI6B 1HSAB 3UJIH 5J1SC 5KSVA 2XZCH 1AGCA 3ILPB 3A67L 4MQ7A 5FM5O 3C6SA 2DQUH 5D1ZB 4KDTA 3BT2H 3MFFB 4QRQB 1JTTA 1HOCA 4OD1L 4DVRL 5ID1A 1J8HB 1HHHB 1C5DB 2H8PB 4U3HA 5KSBB 4JO3H 3L3JB 4FQJH 1FNSH 5A2IH 4D9QE 2P8LA 1P7KB 1HDMA 4X7TB 3UCRA 4G9FA 4L9LC 4DGYH 1RK0B 2AGJH 2VDMH 3UBXG 2F58L 3KDMA 1KG0A 5SWQB 3MRKA 1N26A 4HCRA 5BRZE 4MNHA 3BW9A 1Q9KB 4IBLT 3MV9D 4OZ4A 3FQWB 3BYYA 1MI5D 1A21A 2XTJE 1B0RB 5I15H 2ADIB 3T0VA 3DX6B 2Z91A 4JB9L 1BWMA 2VO5A 4LAJH 1I1YA 5GHWH 2ED7A 2FO1A 2EDEA 4N0RA 5CD5C 2VAAA 5JPNA 1CDBA 4PJCE 3QHTC 3UTOA 1XGYL 2PYEE 3GHEL 1NAMB 3QXAB 2FIKA 3KS0J 1T1YA 1FFOA 2AJ3B 4TNVF 3RWEA 5ICYA 3IXAB 3GB7B 3R1GL 4WWID 1HYRC 1I4FA 4ETQB 1F4WL 2XNAB 1DQDH 3QO0B 1BJMA 4OBRA 1LEIA 3E2HB 3ES6B 2GCYA 4HKBA 3MUZ1 2Q1EA 5ENWA 2NR6D 3GHBL 3RWIB 4EVNB 3O4LB 1KT2A 4FQXC 5MEND 3TYFA 4OZHB 1CFSA 3VXPA 1YEHL 1E4WL 2EIDA 4P2OB 1QRNA 3DV4A 4R2GB 5EBGA 4PJIA 1T3FB 4UT9H 1FZJB 4JPIB 5L9DH 2WNGA 2CDGA 3KHOA 1OL0A 3T2OA 3V0VB 2PR4L 5CJXC 2Q86B 2VUOA 3WDHA 1A7NH 1LDPH 4JFQA 4XPHL 3SOBL 3TYGL 4OD3H 3H42L 1HHGA 3HHRB 4FQHA 5SX5K 2W59A 4OLWH 2CJUH 1XF1A 1Z0MA 3QQ9D 5JIHA 5CZXD 4OZGF 3HAEB 1T7YA 3IRZA 1MIEL 3V2AR 4PGEB 3IB4A 3L3HA 2DWDA 3RVTD 5HD8C 5JOFB 4UI2A 5C2UB 3JTTB 3ARVA 5EC1A 3AVEA 3QIUC 3I6GB 4ZAKA 3KLAB 4NUJB 5EZLA 3B9DA 3GSRA 2M2DA 5LAXA 2Y06H 2LAAA 2V7NB 1F13A 1QSED 4M7JL 4F37K 4MA1C 4HJJL 3ZL4L 1V7ML 1IVLA 1ED3A 2VXTL 4YXLH 4P4RB 1X4YA 3K74B 2EDKA 1UXSB 1VPOL 4YGAB 5IG7A 1TQCC 4RZCA 1E6OH 4PG9B 5IVZB 2ERJB 4PGZA 1IAIL 2PTTB 2EECA 2EDYA 5DD1L 5D1QC 4GMTL 1A22B 2J2ZA 2XA8H 3HPLB 1A9EA 1P7QD 4K3JH 1BQSA 2Y72A 4UIKH 5E7FA 5DVOA 2EDQA 4JQIL 4XNQB 5DO2D 3TV3H 4M5YL 1W0YT 1K9TA 3KPRA 4M6ML 5HHOE 3JV4A 1I1RA 4S1SH 2JELH 4WI3A 5DURD 5D72H 5I17A 3CFBA 3DTXB 2HMIC 3S98A 1F4XH 1WFUA 2E7LC 1OP3K 2OS7A 3LMJL 2ICEB 3QR2A 1JUFB 2B0SH 1OY3B 3CK0L 4DK6A 4OTXH 1E6OL 3QDJE 4UDUA 3OXSB 4O4YH 3GBMH 5GSVB 5EZOH 3GSNA 2FX7H 3ALWA 3WO4B 3VDCA 2HAZA 4FHBD 1DR9A 2O61B 1KPVB 1S5IH 3HS0B 1MJ7L 3O0RH 3EYSL 3EJZD 3LPWA 3TN0B 5FF6A 4JO4H 3KLDA 4OZFA 4MDJA 3KPRB 4H5SA 1SBBA 5GGVY 5C9KA 2Q8AL 1G0DA 1HI6B 3QJHA 4LGSB 5ALBL 4J1UB 4W4OC 3JV6B 3RJQB 2ZUQC 4XT1C 4MNGB 3SDAC 4XCEB 3QIBD 3B5HA 5DFVD 1IQDB 1UWEL 2FGWL 2VLLB 1U8HB 4Z77B 3HAEG 5HGBA 4Y4FA 1JHLH 4PJ5B 4Y88A 2E7MA 5TE7H 4NWTH 3GKWH 5KSUB 3CIQA 4KK9C 1RZGB 4MQTB 3BH8B 3HI5L 3AY4C 3LQAL 2V2TB 1QACA 4URTB 4RA0C 3KYKH 5LVEA 2JIXD 1BD2D 1M7DB 1MJ7H 5H94B 2QSVA 1Q0XL 3VXSD 1YNKL 4ZOAA 3RY4A 5CBAA 1QNZL 1Y6KR 4Y5VB 3BKYL 2NY4B 2YRPA 4X9FA 4QHMA 4ALAH 2Y9RT 4JFFE 5E7BA 5JORA 2DDQL 1INDH 2CPCA 3BKJL 4JGJA 5TFSL 3GJEA 5I1IL 4KV5F 1FFQA 3IU3A 3G5VB 3U46B 1FNGB 2X4OA 2HFTA 3FHQA 1IGCL 4OSUH 3MCLH 1JMXA 5T1MA 4I0PC 4BA8A 2E6PA 3VFOB 4X4XA 1NCUA 2HYMA 3QDMD 3VMOA 3CXDL 1JRHH 3MRDA 3VFTB 2ZCHL 1MY5A 1FLTX 4G7YL 4JFQB 5J12C 4U05A 5EU5B 4GRLC 4ELKA 3T0DA 2EXYC 5TGBB 1IAIM 3W9EB 1AJ7L 2ZWLT 4M5ZH 3PV6A 4LRIC 1QKZH 2O5ZH 4TOYH 1KB5A 1AI1L 1XCQA 5SWZA 4MQXD 4LGPB 1R5IB 1NMCC 5C3LD 2NY5L 2FJHA 4MXVF 1HEZB 4YNYB 2D31B 3P30L 3PIQB 4HK0B 3PHSA 4WV1C 4RBPK 3UC0H 1OCWL 2Y23A 4MCYB 3IDIB 1MREL 2P4AB 2ZNXA 2H41A 3QO0A 4OLEA 4RDQF 2WUCH 1I4FB 1TJIL 3CFDB 1DQQB 1U8QA 5DHYB 5GGSB 4HIHB 3I84A 3FB5B 5CEYA 7FABL 2RGSA 3NABL 4MSWB 3H9SB 2MJWA 3QXAA 4KH2A 3VFVA 3G5XA 1RJLA 4JKMA 5ELIA 4H0GA 4Q9RL 1CIDA 4OGZA 3WKNA 4Z0BH 4OCYL 5D1ZD 4NKIL 5ESAB 1IZKA 3F7YA 4QNPF 4I4WB 5GS0L 3EO0B 4OM0L 4WHYH 3HC0B 2IAMC 5ID0B 1H3XA 1CE6A 5A16A 4P46C 1JJUA 1K4DB 3NIDF 4GW5A 2A73B 4MCZA 4D9LH 3BSZL 4BH8B 4NKMB 1BJ1H 3R8QA 4BFIA 5F44A 4N0UE 1E4WH 3KPQA 3LEVH 1PKOA 1TVBB 3TO4C 2A6IA 1ZLWK 3CSBA 3MV9B 5CILH 1KIQB 2EXWD 2YXMA 3I50H 4AEFA 2AW2A 5BW7C 3KYAA 4PRAA 1FYTB 3S6CA 1LD9A 4AMKH 2G60L 3SKJL 4NUGL 5EIIA 5DHVA 3SPVA 4PB9L 5BXFA 3N50A 2BY3A 2RHEA 1KIQA 1S7XB 1QSFD 2CDEB 4IIQC 3HRZB 1SEQH 5MEQB 1N0LA 4NFCA 3IT8D 5DZOA 1U3JA 1MHEB 1NFIA 1T6WA 3CZJA 4HHAA 4KK8C 4R7NA 3LN5B 1A1OB 1W8NA 4PV9B 3U1SH 1CGWA 4UINH 4FFVC 4BSVB 1K4DA 4ISVA 3KJ4B 2I07A 4Z18A 3VG0L 3T1WA 2HT2D 5C0FA 3QISA 3D1MC 1ZGLP 3GSUB 3RL2B 5HDQL 3QEGL 4FQXA 5ESQB 1HNGA 1NJ9A 5BV7B 4GQ9H 5E2WL 4OZIE 1CDGA 4RAUB 1CD1B 5CJOH 1RJLB 4C4KO 3VD5A 2HKHL 1NBVL 2B2XL 5CP7B 3O6FC 4J8RA 3O6MH 1P7QB 3ARGD 3X13B 3U7YH 1J86A 4HD9A 3C6LA 2C4FU 2WIIA 3ZKMC 5GRJL 3CDFA 3WDIA 3L95B 4IDLA 1FVDA 4PB0H 3IDYC 3KVQA 1DFBL 4IRZL 4KHXH 1AO7E 1Q9OA 2W07A 4G6AC 1DBJL 3FB7A 2HJFA 3KR3H 3QQ4A 3H0TB 1YEJH 5DYOA 4PRID 4OLYH 2BRQA 3QI9B 1TDQA 2ZUVA 5KN5A 2GEEA 4XB8A 5LWYL 1MCNA 3VGFA 3LQZA 5C6PB 3LRHA 3BZEB 1WSST 5GJTL 5JW4M 4U1NA 4Z7VB 5ERWB 1VACA 3ARXA 4NRZA 2ZG2A 1GZPA 5F7YC 3VFOA 3VFMA 3P9MB 5EU3A 1IM9A 4NPYB 3BESR 2DBLL 1T0NB 5E1AA 4QXUH 1RUKL 5HYSG 1JZ2A 3L3KB 1JWUB 3SDDC 4JRWA 2CKBB 1JK8B 5EZOL 4OLUH 3MV8E 3NH7H 1KEMH 2ZUUA 4DOHB 2B39A 1LVEA 4IRJA 1T03L 3DURA 5GGTA 2ZSVA 4X6CA 4XWGL 1WFNA 4HPOH 1BECA 3GEWB 4JFDA 5GGVL 5IOPA 1MJJB 4JO4L 1RZIA 5BMFL 4PJ7A 2KUTA 4NZTH 4OJFL 1CDUA 3DLQR 4XB7A 4NQEB 5GJSH 3WKML 3NCFB 4QF1A 2XKUA 1H5BC 5D70L 4ZO6A 5DS8B 1G7QB 3LN9A 4LFHG 4LHJB 1TTUA 2YA1A 1Z6JT 2AP2A 2EH7H 2YUVA 2X6MA 3H9HB 3OKNA 1GH7A 1W0WA 3QEHA 5DC4B 3BKMH 4QRRB 1M1SA 4QXUL 2AEWA 4DGIH 4N0YH 5CIPB 5KSUA 1SBSL 4KK5C 2NCMA 4YDVB 4ZUWA 4I3SL 2ZOLB 4QRSB 5CD3A 3WFBL 4HIEA 4WFFE 3T2NH 4PLJD 4UQ3A 4RX4D 3QIWC 3T0ED 4RMSA 4OFVA 1QLRA 4NZUH 1BVZA 4ZO9A 1UXWA 4X6BA 2DWEA 4MGXA 1KJVB 1YY8A 4Q97A 5A2JH 1J1XH 4DAGL 4XX1E 1JGUL 5F7HA 3X3FH 5FA3A 5DMYA 4PGCA 3VGAC 1EEZA 3HUJA 5FO9A 4KTYA 3PG2A 5D7SH 4JZJA 1R3KA 3DMMD 2H1PH 3NFPB 1KTRL 1MWAH 4RWYH 4N8CH 4FMKA 5FHAL 4HMEA 2VDLH 3E6HA 1FGVL 3TGXA 5CUSH 5FXCH 3VFGL 1JVKA 4K8RD 4U3CA 1VGEH 2WSKA 4LVHC 3HZVA 4U1IA 4OZIB 1MF2L 5I17B 3NZ8B 3F5WB 4XI5D 1I3VA 3LEYH 1N5AA 3LEXB 1D7FA 4JHAH 3ZKND 4LARH 4L3EB 4P5MB 1AJ7H 1SHMA 3AFLA 4WIQA 5KVGH 3HG1D 5AYUL 8FABA 4U1HA 2F19L 4PRNB 4JR9L 5IVXB 4U1LA 5HVGB 4A2MA 5IB2A 1BVLB 1HXYA 1I1CA 3LH2H 3UJJL 3WO4C 1GPOL 1YN7A 1ORQA 4G8EA 4QXGL 2AJZA 4RGMC 2ICES 2HVJA 3Q3GA 3QDMA 2IAMA 2VLJE 4QHUA 1D6EB 3PWPA 1RZ8A 4PRHB 3VXUE 2F74B 4WUUE 3CFKA 1NCTA 3QT2A 3HZKB 3EZ8A 3MLXL 2IQAA 3MRBB 5D1XD 5FHAH 5LCVH 4DVBB 5BS0B 5HYSB 4ZPVB 4ZUSA 1FORH 1NBZB 2X4UB 2YS4A 1P4LA 2V5RA 1GRWA 5LAXB 3MNVA 2VDKL 4YDKL 4KHTH 1KCKA 4ZAKB 4Y4HA 3PP3K 2AEPL 4PJCB 5GGTL 4CVZB 1CK0H 1WT5A 3QUMH 5FDWA 5L2JA 3UTTA 2FSEA 1VGKB 1HHIB 1CLOH 1ZMYA 3GMQB 1BGXH 1S9YA 3TA3D 3RGVD 3HAEA 5DJDB 4XP6H 3RAJH 2WW8A 4D9RE 2GUOB 5J57B 5DD0H 4FP8L 1DUYA 2IQ9H 5A40E 1XZ0A 3O2WL 4M61A 5E2UL 3MA9L 4FNLL 5I1EL 2GSGA 2Q3ZA 4UIKL 2WLYA 4PY8J 1VFBA 4LVOB 1FE8H 4QHKJ 3K8KA 3L7FB 3U0PB 1FLRL 1S9WB 4XGZA 5DQJA 4ODWA 1HQRB 1U6AL 4QOKA 4ZODA 3QAZC 5I75B 5GRVL 3WXVH 1D5XB 3RVVD 1XAUA 1FBIH 1IM3B 2P1YA 5EPMB 3SDXA 3GSNL 3WUWG 4XVTH 4HWBA 3N0PB 4ODWB 5GISL 4KVCH 5KG9A 5IMKB 4XGZB 2DMCA 2Z8VC 4TRPH 2X1WL 4DVRH 5H37H 1EUUA 3Q6GH 2RB8A 2E7CA 2F9BT 1MCEA 1YNKH 3HNSH 3S36L 2VIRB 1CL7H 4M8QB 1OQXA 2X4NB 1T1XA 1OOAA 3MLTB 4L29A 2H3NB 1CDCA 5FYJD 2GUOA 1RHHA 4LCIL 3IFPB 1A7QH 1CT8B 4Z78A 1LK2B 4JRXB 2VLJB 1UA6H 3K4DA 3BUYA 4GAGH 3DROB 1L7IL 1LMKA 4UU9A 4WI8A 3MREA 3QXTA 4E9LA 2UUDH 4G80B 2VLRE 2BFVL 3SGKA 3G6JB 1F5WA 5KTEH 1I1YB 2X4UA 3MRJB 2QSTA 1KJMA 3WNOA 4NKDA 5HGHB 2ZOKB 4MZ2A 3HMXA 4JJHA 2RFXA 2Q6WB 5ESVA 3QZWB 1UH4A 3MLWL 4G6ML 2F8XC 1RIHL 1JGLL 1LWRA 3CFCH 4MNQB 3C9NA 4MAYC 1GOGA 3ESVF 1RZ8B 4BQCA 1RHFA 4YBQC 1A7QL 3TH3T 2D7TL 3ZSSA 5IIEA 1MHPH 1SJEB 4OF5A 2W60B 1L7IH 1KPRA 1M7IA 3WO3B 1YY9C 2B20A 5F7KC 4YX2H 1J8HA 1J12A 1KTDA 4LCCB 2V2WB 1XGTA 4L4VA 3EOBA 4RA3A 4H1LG 4AIZB 2AQ2A 4O2FB 4WWKD 4ZDHA 1IL1A 1X5YA 2PR4H 5E9DD 1MELA 5HHPB 3EKCA 4YK4C 3WNMA 3RTQB 4Z0BL 3PL6C 3HB3D 4PFEA 2X89A 1NANI 1ITBB 4FXKA 1K4CB 4Z7UB 1CGVA 1QP1A 5HHME 4GXVH 3RU8L 4J3SA 4GBXD 3MO1A 4XRCA 2HMID 4J3OC 4JFPA 4D0CA 2CXKA 1FNHA 2WV3A 1OP5K 4JDZB 1LP9A 1KJVA 3MZGB 1ZA6A 2I24N 1K6QL 3F7QA 4F7PA 4NQDE 1BFOB 3IS0X 4CBPA 1BIIB 4YWGL 5D7IF 3QPXL 4M3JA 3WN5B 5IWLA 1SBSH 5F1IB 4AYFA 4ZG1A 5E5UB 1RUPH 4HLZG 5C07B 4G6FD 4FQIH 2NX5E 4M93C 5C0BA 3RVWD 2XWTB 4BH7B 1VPOH 4YPJA 3VXOA 2AJSH 4CUCA 2D4DA 4XNXL 3QIBC 5CP3A 2F54D 4WUUA 4PTTA 5JDJA 5F7FA 2IH3A 3PWPE 2BNRD 5EU6A 2M1KA 3RWFB 5GS0H 3H42H 5IMMA 4K8RL 3C5JA 3TN0D 2N4IA 2I9LA 2ATKA 1CFQA 5F7UA 2Z92B 3L5HA 2OK0H 1KLGB 3QH3A 2FR4A 1MLCB 4MVBD 3UBXA 2C26A 3STLA 2ZSVB 2JJWA 4UILL 4WU7B 5L7XL 1JFQL 4ORZC 1EFXB 1CLCA 2AK4D 4X9GA 4HT1H 2D9QB 4TUOB 3L6FA 4JY4B 1R3IL 1UM5H 4ZTPL 5CSBA 1KULA 3UAJD 1Q0YH 2X42A 1A6ZA 1V05A 5FUZL 1FZKA 4XNXH 1MNUL 1PG7W 2O93L 4X6DF 1Z5LA 4MWFB 2FX7L 2FBOJ 1C5CH 3ZO0A 4PRHE 4NO0A 3BEVA 2LVEA 1DP0A 3ARBB 3V0AC 4XVJH 1FSKB 1DQJB 1GPOH 1OGTB 4IRSD 3CH1B 3SDXE 1XF4A 2NY2C 4WI9A 4U7SA 1MI5A 5IJVA 1ZLUK 4N0UB 4HGMA 1MCKA 2LABA 5IMLB 4NQTA 4XWOC 5DMIH 3U1SL 5KS9F 3DV6B 5JLZA 3DJ9A 2XA8L 3IFNL 4K94H 3QI9D 5CLTA 5AWNH 3TZVB 3MX0A 2GJZA 5GS1B 1JFQH 4EN3D 3WN5A 4IMKA 3ZYZA 5GS0D 1ZT1A 3MOBH 1U42A 1UM6L 5I2IA 4FQCL 4F8TA 4JHBA 3S96A 2H45A 4PY8I 4YGVB 3UXFA 4IJ3C 2VLKA 4PRIA 1I1AC 3KYKL 2PN5A 4NO2B 1GSMA 1OTTC 3WS3A 3ARFA 2QQKH 5GGVH 4OFIA 5F88B 3MV7D 5I66B 4KQ3L 5MENA 4AEIL 4RMTA 5D8JL 3ULUF 1NCBL 3GHEH 3KYNA 3HRPA 3WKMH 4BUHA 1I3RB 3JWDH 4GAJL 4LLDA 5ISZA 1KCRL 3O2WH 3QPQD 5DJCB 5E2UH 3EDJA 2FYYA 4LLQA 3GMMA 5TE4L 5I8KH 4Q6IB 4PJ9A 5FA4A 5HY9A 4ZFZA 4MJ4A 5KVDL 2YA2A 1MQ8A 3FL7A 4HUMB 3HRZA 4LKXA 2ITDB 3N85L 2CK2A 2XN9A 1IAOA 3QG7L 3IKKA 4LCWE 3B9VA 4JZOB 1T5XB 1KTDB 4UMGA 1NC2B 1D9KD 1I8LC 3W5MA 2Y5TA 4P46D 5AD0A 5EIIB 4EQ3A 1F58L 4I13B 1F4YH 4PRAB 4PJGA 3QDGA 4QHLA 5IIEB 1M71B 4YHKL 3BHBB 4QHNB 3HNSL 3VRLE 3MV9A 5D71H 5IW1B 3LRSB 4ONOA 1JPTH 5L8LB 5HYJE 4JQXC 4XPHH 3WS6C 5I8CA 4MNQA 5HYQA 4PGDB 1T4KA 4P57A 2DQIH 4R90L 5E0QA 3QZWA 3PABA 4YHOH 5F7MC 1NMBL 2HLAB 2EDWA 4KQ4H 3VWJC 1HINL 1XF5B 2X1PA 3BHBA 2CH8A 1TETH 4D8PA 3QDGB 4QHLB 1EH9A 5CWSA 3LDBC 5D7LB 5F9OL 43CAA 4U7MA 3BIAX 4DKFL 1R0AL 3O8XA 1OAYL 1PLGL 3U6RB 4UBDC 4F8QA 3MC0A 1DN2A 3IRPX 5CINL 4GBXB 4NP4L 3AROA 3VFVB 4A6YA 1H5BB 4MSWA 1EFXD 1MPAL 2OLDA 4UU9B 5IVXF 4YHZL 2VJXA 4J23A 4JG1H 4OCWL 5I71B 3IJYA 2R0LH 1P1ZB 4JHAL 4U1GC 4B41A 1GL4B 2GK0B 1JPFB 1JGLH 4LLQB 1UZ8A 4FMFA 5DJCA 5MP6L 4BQ9A 4KK6C 1JNLH 3WD5L 5KW9H 3QJFB 5GSRB 4CU7A 4PP2B 3V95A 1N5YL 5EN2B 3ARRA 4WWKB 2W0LA 2XRAH 3EIFA 4XMPL 1MAMH 4LOUC 1NMBH 3NIGE 1EA9C 3S34H 3F12A 5EA0H 4XAWH 3VFWB 4AM0B 3VE0B 1RZ7H 4R4BB 5MHSD 2VC2L 4XP1H 1EMTH 3UZQA 3MUY1 3CU7A 1P53A 1OP9A 4NQSA 5IBUG 4NQVB 5F9JA 4JDTL 3HNVH 3ALXA 4L8DA 5FKAA 2EEBA 1OGAA 5I76B 5I2IB 4OCXL 3MRDB 4OF6A 1RZJL 1KCVH 4OCWH 2XQBL 3LKOA 1S7SA 2JELL 4LHUG 5IWLC 4QRTB 4QWWC 4OZGA 4P4KB 1RY7B 4ODTL 3WLWC 4K7PX 4D3CH 1IMHC 3MRFB 3SKNA 5L0QC 1VEOA 4J3TA 4N0UA 3BMWA 3PWJA 5IJVB 1DUZA 2IBZY 4XP6L 1R24A 1FJ1A 4RFNB 4EI5C 4I2XA 5BQ7A 3JTSA 4KTDH 3Q2CA 2RAMA 1UCBH 5T3XE 3MGTB 5GGRB 1BM3L 2OL3A 4WTZG 4LCWA 5FK9B 5B21A 1A6VL 1YC7A 2BDNL 4P2RE 5EG6C 3HNVL 1N3NB 3V4UH 2GQHA 1KFAH 1PSKL 1A6PA 4O58H 1GGUA 2P49B 2EC8A 3IDXL 1SMAA 5IW3A 4LDOB 4O2EA 4CN1A 2HFGH 2XZQH 4X6EA 3NCEB 4XVTL 4KZEL 1NUNB 1U95B 2LU7A 2HVJB 3Q3GB 4JFXA 5HBBA 2WQRA 3WYRA 4AEEA 5IB2B 1BQLL 1WGOA 5GIRB 1S9XB 3BP6B 3RWFA 3E6FB 4F33B 1DBJH 2LTQC 4YDJB 3QJHB 3P3YA 1GOFA 3RUGE 4EKXA 1SEBA 4OZFB 3LKSB 1BGXL 1QOKA 3LB6D 4QOKD 2YRLA 1RQ5A 5INDA 4LLWA 4X6CF 5BRZB 1RUMH 1WK0A 5F9WC 4OZIA 5DD6A 1PSKH 2VERN 1NEZA 3P11L 4ZXBC 4PLJC 2PCPB 5I6XC 4M7KL 4WUUD 1GGCH 2ZG1A 5L7XH 3MXWH 4HWEL 4PD4K 1KELH 1U92A 3CUPB 4XXDA 2WK2A 4HT1L 4KC3B 3FQNA 1FFNA 1A47A 3MUGB 4IHOA 5KZCB 3OJDB 2P48B 2ILLA 1BEYH 4HJ0D 1NEZB 1U6AH 3BWUC 2QHRL 5F9WB 5J6HA 1VKXB 3BDBA 1N64L 4XNUL 3MNZB 1CLYL 1EEYB 2NXYC 2ADJA 1RULL 5SV3A 3V52H 2Y1VA 1MCPH 1AH1A 2Y7QA 1S7WA 5GIRA 5IK3A 2OZ4A 4M43H 2EE6A 3HPLA 1OAZH 4XCNB 1K4CA 4PBXA 1ZSDB 3C09B 4FXKB 2MOVA 1GIGH 5HYJB 2SEBA 3FCTA 4V1DE 2XWJA 4OFPA 4OLYL 5IESL 2FZ3A 3BKML 2F53D 3PNWB 4BM7A 4PJDF 3PHQB 1IL1B 3UTSA 4AG4H 4AIZA 15C8L 4UDTB 2EC9T 3GJFA 4L5FH 4P23D 4HCRL 5F6IB 1N3NA 1AE6L 3KWWB 2WBJB 5GZOD 4AJ0A 4LCWB 2EDLA 1AXIB 5J6GB 1X7QA 2UWEE 3WIHL 4KKNA 3DYPA 3E0GA 1I7TB 1VA9A 5CFHA 5JXEC 3KPMA 1HH9A 1U3HB 1J11A 2XV6B 4M7LT 2YRZA 3MACH 5C2BH 1V3JA 4UTBL 1AKJD 4X6CB 2NY6C 4EDXA 4Y1AB 1KIUA 2EIZB 3O9WB 3L3KA 1WCBB 3OXRA 1NDGB 3WE6A 2LU4A 2FLBT 5EU3B 3N85H 3RWHA 1AP2B 4AIXA 1R5VB 5M7QA 2WANA 3B5GA 4DN3H 2V6HA 4K2UH 2I27N 4PJCF 3K80A 3OL2A 25C8L 2VLRD 1VGEL 4PRBA 3V0VA 4OLZH 2ZKHH 4N90E 5GGSY 5C8JA 4MLSA 1XGUA 5IR1B 1Y6NR 2PXYC 5SWSD 1EUTA 4GKSA 4L8CB 4FFZH 4NYLA 2X7LA 5DFWH 4Y16D 3BI9X 3TYFB 1N2RA 1H8NA 5DZLA 1CT8A 4Z78B 2DQIL 5CZVH 3EUUA 2C7UB 3QCUH 3QHFH 3LS4L 2W9EL 4PPTA 5GS2D 1MHCB 5EOCH 4KU1A 1A6UL 4H8WL 1CCZA 1G7PA 3IU4L 3SE3C 3D0VB 5TQ2H 2EDBA 4PJ9C 1YYLH 3GB7A 4U1GB 3RA7L 4MX7A 1OGAE 2X7LB 4NCDA 1ZA3B 1BOGA 1PLGH 1H5BA 2HTLD 2WWKT 2W92A 3HMWH 1XGUB 4RAUA 4NCC2 4KKBD 1MRFH 4OLZL 4YHZH 1OWRM 1CIUA 4YJZL 2CSPA 3U0PA 5K59E 3QULB 2NYYD 3DUHA 4M62H 2BY0A 5I1KL 3HR5B 3QNYA 5I30H 2BC4A 3RVTC 1WCBA 1CDHA 3KLHC 4OIIL 4F15B 4BQ6A 3T1FB 3QXUA 1KCUH 1QRND 1PEZA 1S9YB 1M4KA 1KTLA 1U8MB 3LKPB 3QDME 4WUKH 4X98B 3HC3L 3ULSB 3B9KB 1NSNH 4OGYH 2NY1C 4PLKC 4KVNH 5K59F 1EMTL 3L3JA 1DSFL 4JE4B 5T3ZH 4JM4H 1CXIA 3ARYA 4W70A 1U8LA 3IDMA 5T3XL 2HN7B 5F96L 2H2PD 4TUJB 2CR6A 2WBJA 4NQDD 1YMMB 1T83C 3I3BA 1U8KA 1Q72H 3ELAT 3RDTD 3U7AA 2YN5A 1BOYA 3KPQB 5A2FA 3OQ3B 2IQAB 5BZWA 4Z7QE 4P5TA 5I1CL 3A6CL 1IGFL 1IGTB 5ID0A 1U8JB 1I3RA 3PP3H 3BFOA 2XICA 3QO1A 3O45B 1YEIH 4DTGH 4WI6A 4GH7B 1JF1A 2ICCA 5DTFA 1DQLL 2J7LA 3EDKA 1KFAL 4LLYA 3RAJL 3FB5A 3IJSA 5HYEA 3OJVC 4KKLC 3BKYH 4XHQA 3V5KA 3AS3A 5F3HA 2RCSL 4P2YA 1INDL 5AWNL 1ZT1B 4ZSOE 3TH4T 5I1DB 3PHOA 1S8DB 2AJVL 2GJZB 1Z9LA 3PWVB 3VFNB 1U92B 3CUPA 2A38A 1TTFA 3PJSA 1FL3A 4PREB 5I1HL 5IF0A 2PCPA 3BISA 4TVPE 1XIWD 3CSGA 3FO1B 1GCFA 4G6MH 5K9KA 3GFUA 2BCKB 3O2DA 4NQDA 1TVDA 2FH8A 3DSFL 4OCSL 3RDTA 2ZCHH 3LKSA 4PP1C 4G9DA 3B8SA 1K8DA 2XTJC 4W6WB 1SMOA 1Z9OA 4Y4KB 2L7JA 1KYOK 3OV6A 3WNKA 1ZWIA 1TLKA 1D9KA 3BO8A 3U9PL 1C12A 5CEZD 1A6ZB 3MLUH 4NSKB 1YEFL 4NNXB 2NLJB 1DDHB 4KRMB 4IMLB 1UJ3C 2IBGA 1PY4A 1NGXB 1J87A 5JIKA 3AB0B 3C6LD 4L4TB 4K55A 2BNUB 1DE4A 5D7JA 2FR4B 4OB5H 5JORB 4QYOB 5T1KD 4P3DB 3DXAB 2PUQT 2WZPD 1FGVH 3KXFE 5CEZL 3DX7A 3PGCB 4MVBC 1BZ9A 1PD6A 3TCLA 4NZJA 2HP4A 4NQEA 4Y8AA 3UPAA 3QFJD 3JWNC 4PTTB 1FNSL 3DXAA 2IG2H 4QYOA 3ULVF 1FO0L 3BPNB 5FGCB 3JZ7A 5DC0A 4MXQD 4AQ1B 1DE4B 4LF3A 5D7JB 5EOQL 1NCCH 3RGHA 3EBAA 3HA0A 3V6ZA 2FCBA 2PKDA 1WWWX 1EHAA 4KRPB 1CICD 5C0BB 1NGXA 5ETUA 4XVSH 3VMNA 4QTHA 3UDWA 2BVQA 4YWGH 5IQ9B 4LNVA 1HINH 2BERA 4A6YL 3IDGB 3P2TA 4GRLD 4KY1H 2JB5L 3PGFL 4TUKL 5DJZB 1GZPB 4IRSC 4Z7OE 2NY0D 3OKLA 1UG9A 4DKFH 1EBAA 4H26A 4Z7WF 4TULL 7CGTA 1FFRA 5JZ7D 3LQZB 5CEZH 4NP4H 1WISA 2NX5B 1MCBA 4G9DB 3IFOA 3PWNB 3NCBB 1T7ZA 2YD2A 3QI9C 2PXYA 2EO1A 3FT2B 2IGFL 5BJTA 5TPWL 2QR0B 2VN7A 5EU4A 3SQBA 5FAAA 2Q7YB 4MJIE 5GS0C 3VFWA 4KHTL 1FO0H 3PE9A 5KAQF 1XF2A 1S7RA 3CVHH 5MP6H 2GY7B 4LMQI 5F93C 5EO1B 2PF6A 3D3VB 3ZDYF 3OG4B 2OK0L 1RSFA 4UINL 5C7XL 3MRCA 2HG5A 1VADB 1JGVL 4OI9A 2ORBL 5F3HB 2GJ6D 1MCOL 2HJKB 3JUZA 4J8RB 3FN0L 3TJEH 2FB4H 5I9QB 5DTFB 5ANMA 3EOBB 2DQTH 4H20L 2FD6L 1IFHL 4UAOC 5F6IC 1K85A 1C1EL 4N68A 3MRIB 2OXHA 1GGBL 4X4MA 4U1KB 1CGYA 3ZTJG 1LDPL 1KCVL 5ADPH 2C1PA 1M7IB 1C5CL 3QO1B 4XXCA 2CUMA 3WIIH 4X6CE 2Q76B 2UUDK 3PP4H 5JTWA 2Q7NA 1IGTA 3TNNB 4D3CL 5LKNA 2UY6A 1DBKL 2DLFL 4HS3B 1EV2E 1A6UH 4QRRD 4OD2A 4Y2OA 1CFBA 3DUUA 1KEGL 4ZUTB 2L4OA 5C7XH 2JJUA 2J5LB 4TVPD 1JGVH 1TITA 4ZMAT 1KB5H 3MLZH 4P0DA 5C0ND 1E28B 2R2EA 1T2JA 2IF7A 4PJ8D 3CMOL 3SDAA 4POUB 4YAQB 4K7PL 1N4XL 4W4NA 4NHCL 1QRKA 2VN4A 2HT2C 2ITDA 1FFPB 3MRLA 3SBWC 3TLRA 3DVIA 1XF3A 4WW1A 2IC2A 3RP1A 4ZFZB 1TJGH 3I02A 1UM4H 1U8OB 1U8NB 4WFHD 2BC4B 3VI3E 1T1XB 5D8JH 5HI3D 3SKUD 4BK4A 4AENB 2BHZA 5CKGA 2OXGA 4U6HA 3BP7A 4F7EB 1KCRH 3JV0A 5L88H 3SCMA 3VRJB 2F54E 3LKRB 4G5ZH 5T3ZL 2X4SA 2NY3B 3WS3B 1RAMA 2YSSB 5K9JH 3ZTJH 2XPGB 12E8H 1FG2B 4JEGB 1Q72L 2CRMA 4OKVB 4Y8DC 2E9IA 5DHYA 2LU3A 3ROLA 5KVFH 3SJVE 4TN9A 1G6RA 4LOUD 5C0AD 5JHDA 1T21B 4HIIB 2W0FA 1N0XH 5J8OA 2UZYB 1KELL 4PRDB 4OI8A 4JPKH 5F7LB 2B4CC 1F4YL 2DLGA 4HWBH 2J6EH 3PXJA 3DXAE 4U6XA 2CRYA 3NGBB 5FO7B 1N2RB 1FIGH 4OF0A 4TSBH 4YDLC 3ZKXC 2DM2A 2O5YL 1ZLSL 3TWCH 1OP5H 3T0EB 3KYOA 3WHE0 3MA7B 4DZ8B 5JOEA 1PKQE 1GGTA 2ID5A 4GXVL 3LD8C 4KDVA 4ELKB 4U1JB 3ZMRA 1PX3A 4P23A 4ZTOL 3BXNB 3FB8A 4HZLA 4R4FH 5EU5A 4FA8A 2ED8A 3BH9B 3H9SD 1KUMA 1MJ8H 5F9OH 5I1AB 5DMGC 4GAJH 5EBLA 3HE6D 3VFTA 43C9A 2V5TA 1Q94B 5E5MA 5E2TH 2GJ6B 5CHNA 5E8OA 3ZE0F 4GW4B 5I8EA 4HKXA 4UOW0 4N0FA 1Q9KA 5AG8A 4B0MM 4JM2A 4ONGH 2P5EB 1JNHA 3B2UC 1SJHA 1RZKC 1RIUH 3FRUA 3VFRB 1MLCA 4Z7VE 3QDMB 2FJGB 3QNXB 1WITA 4C83A 1A3LL 3UTTE 1I9EA 3O2VH 3NA4A 1K5NB 35C8H 2OYPA 1Q0XH 2H8PA 4YHKH 4Y5VA 3O6LL 5J6GA 1Y0LA 3OR7A 1RIVL 3FMGH 5FYLD 3TCXA 2IH3B 4HWNA 3VD3A 3D0LB 3QBTB 3MRGB 3OHXB 1S7QA 3OAYH 4WTZA 3WFZA 3MQIA 2WBJD 2Y4SA 3LH2L 4B7LA 4W4OA 3NFNB 5EC2A 3P0YH 2V2TA 5JNYB 32C2A 2WMPA 5B8CA 1AHWB 2XWJB 4OKDA 2JIXA 1BD2A 1EGJA 3QDJA 3RY6C 3GSOA 4HUUA 1U3HD 5DJAB 3BN9C 2X9YA 3P0VH 1NLDL 4HGKC 1Y18B 4DN3L 1QFWM 1QLFA 4HJJH 4HFUL 4XCEA 4B53A 5CJBA 4GRMB 1S7WB 3DGCR 3ULUD 1QFWI 1DN0B 2ADJB 4KDTC 4H5SB 5GZNC 2ARJQ 1EEYA 4KJYB 5TDPB 3HTLX 1Y6MR 3MLSL 3O3AB 1UXWB 1A1MA 1CS6A 2AEPH 5GGTH 1X44A 3W9DB 5EOQH 1NCAH 3JV5A 1QSEE 5IROC 1QFHA 3RIAK 1S7TA 2G5BA 5FM4A 2R69H 3RWDA 1MAML 3SKOB 3TPKA 1IC4H 5IW6B 3IVKB 2BJML 2ESVE 4M00A 5FOJA 2Z93B 2C9AA 2CRIA 3V6OE 4YFDB 3VWJA 3H7BB 3V5HA 4FNLH 1G7JB 4MQSB 5DD6B 3LPGA 4NKQB 4KWUA 5EC2B 1TTGA 3P9LB 5E8DL 4G8IB 5F9DC 4R2GD 2X10A 1IEHA 5ACLA 4GG6A 3UO1H 3TBSB 4D0DB 2X05A 2GITA 1S9XA 3BP6A 3MJ9H 3RIAF 4M62L 1X5JA 4LPYA 4FFWC 1KPUB 2DKMA 1OAXH 3GSQB 1CI5A 4LRIA 5SX4H 5EUOE 3MRHA 1MH5A 4IRJB 3OKDA 4O2EB 3M1BB 4JM2B 2C3VB 4HKJA 5FYJE 4XMKL 3ISWA 5JHLL 3RTQD 5ESVB 3DOSA 1MUJA 1WZ1L 5L8JB 4BFEA 2H26B 1UCBL 4JFYB 2DTMH 5DK3A 3R06B 3R4DA 5CHNB 3MR9A 5TE4H 2YPKA 4KMTL 4Y19B 2BDNH 3LCYA 1C1EH 2NY6D 3GGWB 5TE7L 3TO2B 3GDBA 1X6NA 3FQTB 3GSRB 4FABH 3B6SB 1II4E 4P23B 3I6GA 2FX9L 2GY5A 3HI5H 4NQED 4NQCA 4Y2DC 1R24B 3MXVL 3DVGB 4M7ZC 2XXCB 3KYOB 2X1XR 2DMKA 3H0TA 3QQ4B 4XHJD 5EOTB 4KZEH 3DSFH 1MCPL 3KJ6H 4HMCA 5IB4B 5EZIL 3PQYB 1RHHB 4K3EL 2NXZB 5BV7L 1K2DA 4L29B 3G9VA 4GJTB 4FQHB 4G43A 5DHXB 5SX4I 5EO9B 3LKOB 3DVNA 4OM1L 3RVVC 3TT1H 1CYGA 4R90H 1V8HA 5C6TH 5I76A 3ARPA 3BE1H 2VDNL 2QSCL 3AGVA 2Q86A 3CMOH 3GRWL 5GRUH 4YQXL 4CW1A 4TTDD 4FABL 1IC5L 4R4BA 2FO4A 5CLWA 3RZCD 5IM7A 1EVTC 1HQRA 1NBVH 2RCSH 4YHNA 1E0OB 4AM0A 4M6OL 2GTZB 3SEPA 1NGPH 1TZGL 3MRQB 5BOZG 1S9WA 4OZHA 4U2ZA 1M05A 5ESQA 4PJ9D 2XXMB 4OGAC 4YE4H 3M17B 1JRHL 1VFBB 3BJ91 5FYJU 5HHQB 2BVPB 5EN2A 5F8RC 2M26A 2I07B 3GSVA 4LL9A 4EJ1C 2AJUL 5LGHL 5KS9A 4KHXL 5IEHA 3JSSA 1DL7H 5IB3A 3BVNB 1XF3B 4HK3N 4IOFC 1KTKE 4HUXB 5DRXA 2EYSB 4OQ1A 5EUOB 1I85A 1NGQL 4O2CA 3EFFA 3SDCA 1MCSA 1S7XA 1UEMA 2RJMA 1R3JB 2APBA 3ARGA 1P5VA 4FQJL 3RWCB 3VRIA 1W72L 5KVEH 1PQZA 4XAWL 4Z6AT 3ZDZE 5C6WH 4WHCA 2E27L 43CAB 5IB5B 2VAJA 2BSRB 2VC2H 4XP1L 3WHXB 3MNWA 3MZTA 3CDGA 3PXHA 4YBQD 3B43A 5L6YH 3OJ2C 2NY1D 4PLKD 4BFIB 4BZ2H 4B7IA 2X70B 2A73A 4PGDA 3IXTA 4MHHI 4OB5L 5AAWA 2DLEA 3L5XH 2OM5A 3KPSE 3CDGB 1ZOXA 3RL1A 5D7IE 4C55A 4HULB 1HDMB 3PQYE 2APTA 2AXHA 2VLKD 3O3EB 2C1PB 2HJLA 4LU5L 1C5DA 3EOAB 3BDXA 5BS0E 5C0EA 2ITCB 1T5XA 5BVJB 2YD6A 2I5YL 2YK1H 1CE1H 4H1LH 5B39G 2YPLD 3PL6D 1A9BA 5LXGL 1MLBA 4LKXB 1MIMH 5EUOA 1ES0A 3HMWL 4R7DB 3IAQA 3MROB 3HZVB 3CLFL 3KPLA 4GS7C 1IFHH 3MV7B 1RVFL 3QEQD 1BZ7B 4A6YH 2A1WH 3NFSL 4BZ2L 1I7RB 2FATL 1P69B 2X9XA 3G5ZB 1HEZA 5FKPA 4DWHA 4L4JA 2VXQH 3FRPA 3AY4A 1R3KB 3VFSB 1XF2B 2MKWA 3AAZA 4OLVL 4P9HH 3MOQA 2FX8H 2MKLC 4L3ED 3JWDC 2DM3A 5EFIA 3V6OA 3I6KB 4WUKL 5EOCJ 3CSYA 4JHWL 1IEAA 5T1KA 1T0PB 4NOFA 5DT1H 1AIFB 4OUOA 4H8WH 4F3FB 4HH9A 2HTKD 4L1DA 5DJZA 3HE6B 4QEGA 1U8IB 3NACH 1EPFA 5DJXB 4PJXA 5A43C 2L0DA 1MIEH 2E7HA 4PP1D 4WGWB 3MV9E 4N5EC 3O41A 4E5XA 2XTJD 2AS5M 5D2LF 3RHWK 2PO6B 2ICWA 3BPCA 4KUZL 4Y5XA 5B39B 2VXSL 5EOTA 4EDWL 1MI5B 4N8VG 1HK6A 4HS6A 2FD6H 5I18L 2A6JA 1UM4L 4QHMB 4I2XE 2B4CL 1ZHNB 2NY4C 2FJFA 3LVEA 3FQTA 3U0WL 1CBVH 3CZFB 1JGEA 4M7JH 1BZ9B 3LHPH 4KKAC 4PY7A 1AD0A 1AY1H 3V6FA 2VXTH 4I5BB 5E95B 1U93B 2IANA 4BYHA 3U4AA 3M07A 3O3DB 1J1PL 4WCYH 4IOIB 1A7OH 1ZTXL 4NKOA 1IC4L 1UYWL 2OL3H 2BNUA 1KEGH 4K71B 4LNRA 3TVMB 1I7ZB 3S5LA 5J9PA 3OKDB 2R2HB 1NSNL 2BSSB 1IILE 3AREB 1MH5B 2DQFB 4RGND 5EIQA 4DGYL 4X6FA 1DDHA 2DF3A 4Y4FB 4JM4L 1U2HA 3D18B 4YIQA 3MRRB 4NPYA 4WY7H 3P9MA 1MHHB 4J3XA 5E8DH 2P5WD 1LNUB 3P40A 5FOBB 4KJQC 4LPWA 3OGOE 1D9KB 3QAZB 4F9LA 5CIPH 1FYTD 1ZWIB 4TVPH 3K46A 4UQ2A 3TH2T 5AG9A 2EE3A 3QQ3A 3V7MA 3ZYIA 5HGAB 4OIAA 4JLRA 1ETZA 3H9SE 2BOCB 2AABL 5DJ8B 1BVKB 4BELD 4ZSOB 5C0RL 5GHWL 3SGDI 1EO7A 1TJGL 3C5SA 4EN3C 4UTAL 4NT6A 3TBTA 3V5HB 1AGFA 2NY0C 3SGDH 4U7KA 5D1XA 5I74B 4D2NA 1FL3B 4Z7QF 4EOWH 1M6OB 4HPYL 2OZ4L 1FVDB 2X40A 1PYWA 1WZ1H 4POYA 4JKPL 5D70H 3PHOB 5CGMA 5TFSH 1I75A 4Z95H 2V17H 4PJXF 3VXMA 4PJAE 2ZUTA 2VR9A 5JR1L 1A1MB 3TZVD 5ALBH 4MB4A 2BOBA 2CMRL 2EIEA 1I9RL 5JXAL 4RMVA 3VWKC 2HFEA 3OZ9L 4S1QL 4LPCA 2AABH 1JHLL 4BQBA 3SO3B 3KJ6L 1UC6A 2G5RA 1J0YA 3MJ6A 2DQEH 2J5LC 1DEEB 3S36H 4EXPX 1YMME 5LGJA 3MYZA 4YXHL 1BD2B 4BSVA 3KPPB 4DZBB 3C08L 4FZEH 4R7NB 4K71C 5JNYA 5B3JE 3GSXA 4K9EC 1B2WL 2PW1A 4UT7H 4ZDHB 2HLFC 3CC5B 2CDEA 4MXWH 4LCUB 3IU4H 5D96C 5JR1H 1X9QA 5D5MA 3GIVA 5BXFB 1XH3B 5JOPE 3WJLC 5IB1A 2HT3C 1DLHA 3STBA 1I9RH 4MLIA 5JXAH 4JAMA 3UROR 3T0AA 3S36X 1KPRB 3OZ9H 4QCIB 4BFGA 3JTTA 1RMFL 4ODVL 1IAKB 1U8MA 4X98A 2A6IB 1G1CA 3C60D 2PO6C 4DW2L 3VWJD 2IGFH 2P5EA 3GI8H 1RIUL 2DICA 3X11B 5C0NC 1IAII 3P9WB 2DI9A 3FOLA 4Y7MA 4GW4A 3WL9B 3VXQA 3ZSTA 4YUEL 3T08A 4MA3B 3NOIA 1IBGL 4M1DL 1EXUB 3MFGB 1GGIH 4NZRH 5ESAA 4M5ZL 4DN4L 1CDIA 1XGRA 1VEPA 4L8BA 5FO8A 2ORBH 5F72S 5E4IA 4DZ8A 3IDNA 1IC1A 4PUBL 4X5XA 4ODXA 4ZYKB 3ARBD 5HI4C 2MNUA 1RMFH 3P30H 1WF5A 2HA1A 4JFDD 2BY2A 3ULVE 1RZJC 1CFSB 3TV3L 4IRSB 5T3XH 1NUFA 1AXTH 4NGHH 4CVWA 1OVZA 3BP5B 4C56B 5C07D 2H3NA 2J3SA 4XBPA 2BVYA 5DRNB 1OLLA 3RIFF 1PKQA 2E9BA 3G6DH 3PIQA 4F7MB 4WO4A 2C3WA 2CLVB 5EU7C 4RMRA 1NPUA 1O7SA 1T21A 4X83A 2DIBA 4LVNC 4NYLB 3O8XD 4L8CA 5E6IA 1KIPB 1FG2A 4GKSB 1ZVHA 1A5FH 2DD8L 4RSVA 1NAMA 1ACYL 3W39B 1IM3A 4K3DL 2BNRB 1I8MB 1CFVH 3D85B 3QUYC 1OT2A 4OZFH 1C7SA 4XNMB 1B0GB 1N59B 3WLWD 3I2CL 1AGEA 5I1EH 4M1CC 1G7LB 5B38G 1KOAA 4HKZB 1CDJA 3R8BB 3LRGA 5E08H 1H0DA 1XIWA 1LO3H 2OR8A 2IPTH 2NY5C 2H9GA 3WUWA 3NFSH 4AEHH 1WBXA 2ICWJ 5ACMA 1Z2KA 3CCHA 3DX8A 3BW9B 5KSAB 2WLZA 4CVXB 3X11A 5KZCD 3T3PE 2XWBB 2JJTC 4IMKC 4Y1AA 3W82A 3EOYG 2DQTL 4H20H 4ZUVB 1FFPA 3MRLB 2AVGA 4P5KB 1H8OA 3OB0H 3KPMB 4JY6A 5D7LE 2YUZA 4PJCA 3O2DL 1KIRB 4GXUM 3SDCD 1CL7L 4JFHD 1DFBH 3SN6N 1DLHB 1E28A 2R2EB 1QLEL 2N56A 3A67H 4KJWC 1QTYT 2FIRT 4LAQL 4G5ZL 2OR9H 4LSQL 4QRUB 1QVOB 2E9JA 5TF1L 3VJ6B 4MQ7B 5JIPA 1NQBA 1T20B 2AXJA 3EO1A 1D5ZA 2SEBB 4ZPTA 5ALCH 1GIGL 4R6UA 2VXSH 2NZ9C 1ZGLA 4KMTH 3BPLB 2R4SH 2DIJA 3BN3B 2DBLH 4MDIA 4V2CB 2WM0A 4AG4L 2K7QA 3NVQA 5HGDB 4U1LB 4HG4K 5I15L 1W8OA 3PWPD 2V5SA 4LCWD 3DUSA 2DQJL 4R97C 2P8MA 3MLYH 4R3SB 2AJUH 2O5YH 1T66D 2AJYH 4PJDE 4D94A 1OTSC 3K1KC 1F3DH 4F2MB 5H35B 4E41B 3DMMB 1R3LA 3KJ4C 1NFDA 1AR1C 2O61A 3BPLC 4PB0L 2X1OA 2CK0L 4YBHA 5IMOA 4HJ0C 2IG2L 1CXFA 4ZNCD 2BRRL 3ULUC 4FXLA 3QEQA 4UDUB 3CJJA 5BRZD 2DQGL 5GZND 4JPWL 1KN4H 1YEJL 4OLXL 1L0QA 3FHAA 2J12B 3GMRA 1MRDL 1OF2B 2AXFA 4HUKB 4UOJA 5E4EC 5FA3B 4G6JH 12E8L 1EEQA 2GTWB 3CFBB 3DTXA 3EGSA 4OAWB 4HC1H 4RRPG 5KVFL 3QUXD 1ETZB 5F7DA 3IFLL 1YY8B 5E00B 4V2BA 1T22B 2NY1B 5KJRL 4YDJA 2P42B 3BIBX 3P4MB 3NZHH 4ORGA 1S9VA 1H3PL 2BY1A 2CRZA 4NM8L 5DK2A 4TSAH 4NWUH 2YD7A 4LLVB 4JFFB 4LU5H 2E8YA 5C08A 1IEBA 4TSBL 1NAML 5FGBA 4P2RA 3MRNB 5D6DA 5M95B 3ARZA 4JJ5B 4JY5H 2YK1L 4KKCD 4GMSH 4YFEA 1HNFA 4HBCH 3V6ZB 3ULVC 3TIEA 4KRPD 4EUPG 1CZ8L 4NKOB 1ED3B 2QSQA 1G84A 2AXGA 2VKXA 4K94C 5FIEA 1ZEAH 2X89D 1MCIA 3QPXH 4D9LL 4I5BA 3ZHDA 3GBLA 1QFUL 1WZMA 2V7NA 1T1WB 1G9MC 3TPUB 4WGVB 2OL3B 1D5MA 3DIFB 3KLAA 4PJ5D 2BNQA 2AXGB 3P4NB 5C0AE 4Z0XA 3T0BA 5B3NA 3TIEB 3ZE0E 5F3BB 5D2LB 2ICWB 3BPCB 2W91A 4R0LB 2NPLX 3CDCA 4WDIA 3U0TA 2F19H 3ZE2F 3B9AA 4IMLA 3GMPA 1G9NC 1OWWA 1FPTH 5DJXA 4TNVK 4Y89A 2FECL 4JFFA 3WV0A 4FQPA 3RX8A 4JO2H 2G75B 3K2MC 4LFHD 5EIVA 3F58L 3MSPA 1IAIH 3ALPA 2X41A 1PBYA 4XHJC 5FGRA 1T2QL 3KYMA 2UVEA 1P7HL 1YJDC 3NPSC 3EJYC 5E5RB 5GS3A 2DL9A 5CMAB 4NQSB 3QUKB 3RPIA 3CX5J 5HDQH 4IS6B 4NQDB 2HKFL 4JPIA 1BREA 3AM8A 1QEWA 4P2RD 2HJFB 4Q0XL 1R3IH 1UM5L 1FORL 2EDDA 3F12B 4ZTPH 3UTPD 5DI8B 3QNZB 4F57H 3BQUA 3AS2A 2JJTA 4EVNA 3WFHB 4F37F 2NTFB 2NR6C 4UV4H 3OAZH 5MI0B 2HT4C 4WEMB 3RZWA 5KS9E 1N5YH 2BVOA 2KDGA 1P6FA 2EZ0D 3LMJH 3RZCC 4JO2L 2F53B 1NCNA 1RJYA 4WW2B 2OJZL 3RWEB 3S34L 1MLBB 1JYVA 1FYTE 5DWUL 1FQ9C 3HAEH 4KRLB 3TVMD 4FN0A 4XNYL 3OJMB 1W0VA 4PUBH 1KJ3H 2R29L 3FN9A 5F89A 4F7CA 4JDTH 5CWSB 5GXBB 2IPKB 2WBKA 3DX6A 3NGBC 4IOFD 5E9DE 1RZJH 1AO7B 2X4TB 5LWYH 3HCVA 4PR5B 2FX9H 1ZT7A 3QQ9C 3RY6A 2EEAA 5CZXC 1A1OA 4PV9A 1D3CA 3QDJD 4HBQA 5I8CB 5KANI 4Y19E 2VDRL 1JL8A 3QIUD 3LRSA 1AXSA 1YMMA 4ZFOB 1A64A 1CFNA 2BSRA 2YWZA 1P7KA 3WHXA 1MFCH 5HYFA 2NXYB 5C0CA 3T3ME 5GGUA 3FT3B 4XNZC 5DHVB 5HVFB 4QGYA 1SJVA 4F80A 1FYTA 1GC1L 2DBJA 5D1ZA 3BE1L 1UFUA 4PJEA 4WFGD 3K7UA 2WP3O 3O3BA 4FG6D 1E4XI 5I0DA 4LBEA 1R6VA 4HUXA 5DRXB 1DBBH 1F3JB 2YHGA 1YEFH 5HY9B 3U36A 1JZ6A 4HLJA 4JCLA 3VRLF 3DX8B 5KSAA 4OT1H 2Z35A 3GSVB 4PLNC 1T7WA 4EQ2A 4HAFA 1CE6B 5A16B 4LVEA 1LO4H 1RZKL 1G7MA 3M17A 2IPKA 4NQXB 5B3JF 5I1GH 3V0WL 1FVCB 3U82B 5DUML 1RFDL 4DGIL 4P2CG 3WJJC 5AUMB 4YPGB 2JTDA 3SE4C 5IM7B 3MJ9A 3HMXH 2DN7A 3D85A 3CXDH 5IHBA 5DUBB 5HYIA 4CW1B 4KXZH 3H9SA 1NGWB 4UV7L 1BBJA 1JI1A 2P8PB 1MEXH 4YGVA 3OPZH 4JN1L 4X4YA 1DQQA 2P43B 1VDGA 4MXWL 3STZA 4AH2A 4ONFH 2QKIB 4YX2L 1ZANH 3UPRA 1XIWC 4OM1H 1UQSA 5C0IB 1MVUA 4F15C 1Q9LA 3DX9B 1GGCL 5B4MC 3WFDH 5IT2H 5F1NB 2C7UA 3OKOA 3WFHA 3KHQA 5FYKL 1R5IA 3MYJB 3BOVA 4FOMA 1INQA 1MWAA 4KI1A 3FO9A 3EYVB 2JB5H 3PGFH 1QEWB 4NN7C 3PV6B 3RX7A 3DI3B 3OKKB 5IR1A 4IS6A 5TGBA 3W9EA 3NIGF 2DTSA 3SDAD 3QUYB 3ZHLA 3ARBA 5D93C 5JHDE 3NABH 3AU1B 5J1AB 4LSDA 1A3RL 1KN2H 1IRAY 4UNUA 3K81A 4Z7WE 3C6LC 1FZKB 3S5LG 2DYPD 1IBGH 2G75A 2Z8RA 1DBML 1JNJA 1XFPA 3O11B 5FGBC 5IVNA 1A0QH 4JR9H 5D6DC 2G2RA 5DUPL 4JPWH 1M7XA 1IARB 3G5VA 5EU6E 1DVFB 4RQQA 2VSDA 1YUHA 2WINB 3W5NA 4QNPE 5JQ6H 1S3KL 1UKSA 1IQWL 3P4NA 4NGHL 4NN6C 2DQDL 3UJTL 5JMRA 4N8VA 2ATPA 1L7TL 5CBAB 1UB6B 3TBSA 1MFEH 1AD9A 4JZNB 3I50L 5MERB 3ZDZF 1J18A 4R8WL 2EDFA 3RBSA 5AAMA 1GGBH 1QR1A 3CC5A 3SJVD 1I1FA 4RGNC 1Q8MA 1E4XH 5ADPL 1BFVL 4HV8A 4QXWA 2FZ3B 4EBQH 4MJIB 4P2OD 1FDLL 1CK0L 3EDFA 4PV8A 1I8IA 4XZUA 3LIZH 3I2CH 3IVKA 1G0XA 3DVFA 5C07A 1ZSDA 4LSSH 3SKOA 5F1IA 4HQQH 3CPLB 3ARED 3L7EB 5C0BD 1GGIL 4NZRL 4HWZA 2MWCA 4PLOB 4HDIB 4F7PB 3P4MA 3T77A 3MLZL 2CR3A 2IADA 4MDJB 5IHZA 4MQXC 1A7RH 1FLRH 4DUWA 4QXTB 1H8SA 4LEXL 4HWZB 4KROB 2IWGA 5FYLH 3L7EA 1QLFB 1VB9A 2YPVH 4Y5YC 4M6AA 4P5TC 2VXQL 1ZHKB 1KCSH 4WJ5B 5GSVA 3TP4A 5GISH 1J1PH 1QO3B 5JW4Q 4PV8B 2JIXB 4LQFH 3O4OB 2R23B 2R15A 5LJYH 2FL5B 4AIOA 5D1XB 1A6WL 4C59B 3FZUC 2H32B 1H3WM 4KMQA 3UYRH 1KB9J 3DMMA 3Q0HA 2B8OT 1BVKA 1RJZB 4M8VA 1YA5A 4Z7NF 4L3CB 5JW4R 5KSBF 5D1ZC 3D39A 3TT1L 2Z9TA 5IKCB 1UB6A 2P24A 2ATPB 3O4LD 1UA6L 5IV2B 2R4SL 4ZXBA 3HZYB 5E08L 5F21B 1CGSH 1K5NA 3GJFH 3WEXB 1A9EB 5IJKC 1UB5A 1J0ZA 1IC5H 4U6TA 3QNXA 4NN7B 4HX1B 5D6CB 4GKNB 4HUVB 3RUGA 1DVFA 1PZUB 1N64H 5ABDE 1U58A 4YDLB 4RZCB 1I7ZA 3S5LB 4JKWA 1RULH 3ZYOA 4HWBL 1Q0YL 1FNFA 4Z7NE 4Z8FL 3O11A 5JA8B 4X8XA 1B0WA 4PJ8C 4OLUL 4JHZA 1OGAD 3LKQA 3O2DH 3RI5K 1G7HA 4PJHE 4LRNL 1T03H 1KJMB 1QVOA 2NY0B 2CLZB 4PY7B 4XWGH 4MA8L 3C8KB 5IHUH 1YPZB 4IJ3B 5J1AA 4P48A 4Y4KC 5GGRA 2VZ1A 5K93A 4ZO8A 3BZDA 5BMFH 4X7EC 1W72A 3EO9L 5KOMC 4QO1A 4I2XB 4JY6B 3AM8C 2K3TA 2JK5A 4PGEA 2GAZA 3T0EA 5B39A 4U1MA 4E5XB 5I1LA 1JN6A 2Q87A 2XWBA 1LO2H 2YD8A 1QA9B 5GS1C 3OF6A 4U6XB 2R1WA 4IRJD 3SDDA 1YYMH 4QRTA 4PBWD 4FQQB 1QSEB 4M8QA 4HH9B 3TA3A 1T5WA 2QLVB 4WHTA 4UT6H 2W0FB 3CU1A 3JWOH 1G6RB 1WIOA 5JHDB 4XP9H 1EO8H 1AGEB 3MACL 3L5XL 3ARBC 3CSYB 3QQNA 2F5BH 5F9JB 1XCTA 2I26N 1WAAE 5IHUL 3G04A 1SVCP 2ZPKL 4EIZC 1JHTA 5FCUL 1HHJA 1BZQK 4AEIH 5E6IB 2X4SB 3QRGH 4J12A 3SCMB 3ZKMD 3HE7C 1ZEAL 5DF0A 3SDYL 4L4VE 3RWIA 4WHTB 2A6DB 2J8UB 5ENWB 5LXGH 3X3FL 1OAQH 4HG4J 4LMQE 1T0MB 4FQ2H 25C8H 4G6AD 4ODVH 1NMAH 1BZ7A 1U8OA 4KI5F 2GK0A 2DLIA 3I02B 3ZE2E 4RIRB 5I1GL 1FVEA 5GGRY 3I85A 3P0VL 3C2AH 5IVOA 5IEKA 1NL0L 4ODXB 3O3BB 1BQHB 2EE2A 2KKQA 3HE6C 3SOBH 2AI0L 5HHMB 2VDLL 1VGKA 3IDNB 4GBXA 5H2BA 5IP4A 3QIWA 5CP3H 4YAQA 2VAAB 5JPNB 2OP4H 2W9LA 4P2QD 4MAUL 3JXAA 4NM8H 1AC6A 5K9QI 3MNVB 5D7LA 4ZS7L 4LLMA 4GAYB 5EA0L 4DGVH 1ZANL 3QUMB 4XBEL 3SDDD 3RA7H 3O4OC 1RZ7L 1X4XA 1TPXB 2V2XA 2XZAH 4Y1AE 4ZFFB 4RGOL 2F5AH 1EHLH 1CICB 5D9SB 1X5GA 1B2WH 4UT7L 4ZUTA 2QV2A 1OAQL 1T4KB 1OSPL 1V3LA 1CZ8H 4PRHA 3DHJA 1AXTL 4GKNA 4JFEA 3HCVB 3INUL 4PR5A 3Q1SH 1QFUH 3MNWB 4G8FA 1B3JA 1B4JH 5IB5A 5HDOA 3RIFK 3WEXA 4YZFE 5FFLA 3NBNA 2YKLH 1ADQA 2GT9A 4PRNA 4CU6A 4PS4L 3ARGB 4P5MA 3GIVB 1A4KA 5C0CE 5JA9A 4JG1L 1FCGA 5IGXH 3SDCB 2UYLA 3QWOB 4KMLB 2HJKA 1RJYB 4PJGE 5IEHB 3RBGA 5IUSA 5JW3H 5CEXA 5DD1H 5DWUH 1ZVSB 1FPTL 5JW5A 3KPNB 4WCYL 5ISZB 1JP5A 5HPOA 4LK4A 1J05B 4OV6F 4CMMB 5JQ6L 4WJ5A 4KI5C 3KPOA 2AK1H 1M05B 3MV11 4Y19D 1EEZB 5HI5C 1MJUH 2MCPL 1EHXA 5D72L 1WWAX 2HFGL 2XZQL 3M45A 2PXYB 2IALA 3BEWA 3NMEA 2FGZA 2NX5A 3GMOA 3U4EB 2B0SL 2A9ML 3W0WD 2VZ3A 1WC7B 4HDIA 3SBWA 5H8DA 1FBIL 3DVNB 4KGLA 1VFMA 3MJGX 1A7PH 3IDGA 1KLUA 3EYQD 5EZIH 1OPGL 5EBMA 3DV6A 5JLZB 2EDRA 1RUML 3MUJA 3NN8A 1GVIA 2MPAL 4RAVA 1FH5L 1PG7L 4EOWL 1S7VB 3OKNB 1WBZA 1FNLA 2IBZX 2OSLB 3SCMC 3ZKNC 1VFAA 5FCSH 3VXSA 4RMQA 2P46B 4JLRB 1EO5A 4KFZC 4XNYH 3QIUA 4YBLC 3TBWA 1UWEH 4WO4D 1GOHA 4P9ML 1KENL 4JO1H 5EO0A 1HIMH 2FWOA 1YMHA 1LO4L 4QF1B 5TQ0L 3TPUA 4NWTL 1T1ZA 4RDQG 5FYLL 5DHVH 3AC0A 2C1OB 2CMRH 5FUOH 2Y6SD 3ULVD 3MRRA 4Q9QH 1LILA 1FP5A 3L6FB 3ABZA 3QXVA 3HMXL 4DK3A 4FXGA 1W2KT 2DQUL 3CD4A 3T4YB 5DLMH 2VMFA 4JRYA 3T3PF 2VDRH 4EN3B 3U48A 3MRHB 1JWUA 3GM8A 2ZG3A 4JO3L 2CK0H 4N0CD 3GSQA 3SE3A 4XX1G 1FC2D 3VFMB 2Z92A 4OUUB 1E27A 5DURB 4NRZB 1U93A 2IANB 4Y2DD 5DK2B 3V6FB 5FHBH 4QRPB 2DQCH 3REWA 3VDAA 5CD5D 4OV5B 1NKOA 5HTSA 5IESH 4ZOBA 1HWHB 1T22A 5DJYB 5EULV 4WUUB 2NY3C 5F7DB 4ZO7A 4I18A 1IGCH 5ALCL 1HWGB 3EYVA 1UJ3A 5JO5B 5T1LD 5CEZE 3H9ZA 4FQ1H 5LQBL 5T1DL 5CINH 1LEGB 5L6YL 4Z76A 4RCAA 5HHNA 3PJSB 5EBMB 5MEPB 3WIHH 3NA9L 4FQXD 2GIYA 2OI9C 2PYEA 1Q9LB 3DX9A 5BVPH 3HE6A 2G5BB 3LY6A 3RWDB 4W6YB 5C0IA 1BFOA 4MA8H 4YHPA 1S5HB 1VCAA 4LEOA 5H35A 3ZZ1A 4X4YB 2BX5A 3IJSB 3GMOB 5KW9L 2LV4A 4CDGC 5TDPA 1NGWA 5K9JL 1A6AB 4I9WE 4K23H 2A77L 4M6NH 4XRCB 3GHBH 4JN2A 4DN4H 4DJMA 2Y36H 3N1GC 4K7FA 2MHAA 4ZUUA 1KN4L 2V7HB 4FQ1L 1GZQA 3AMKA 2ZKHL 3CLFH 3QEQE 1AGBB 1N7MH 2DLTA 3SO5A 1R5WB 2C3HA 3LN5A 3TVMC 4P5TB 5E2VL 3U36B 4AL8H 1QFPA 4LSTH 3JWOL 1BFVH 3NFNA 4KROC 5KJRH 4R7DA 4O2FA 2EKSA 4BQ8A 4MJ2A 3NZHL 5CCKH 5I8OH 3D0LA 2YEZA 3IJHA 2E6QA 1EX0A 4PJEB 2EH8H 5EOCL 3SPVB 5KBNC 2BMKA 1QBMH 3RX5A 5DC9B 1FL6A 3ME0A 3N9GH 1YYLL 4LVHB 3WHE1 2CQVA 5C0CB 1SJEA 2CUHA 2FJGA 4UIMB 1F90H 4KGJA 1J8KA 3MMEA 4O51A 4HBCL 1J1OL 3B83A 4NO0D 1VFUA 4YHMH 1YNTB 4GQPH 3H3BC 4J3VA 1LO3L 3TNMA 2G60H 3SKJH 1I3GL 1GAFL 1Q94A 5T3ZD 1YY9D 3MRJA 4I4WA 4POZD 3V6OC 5T3XD 2B4CH 3T0WA 3W11D 1BIHA 4ZS7H 4MZ3A 3MA7A 5DJ6B 4O2CB 2QADC 2X4QA 4XPGL 1JNNH 4JQXA 5E56A 2VLJA 1UZ6F 4LKCB 3P0YL 3HB3C 5KS9B 1J0HA 4MCYA 1OSPH 3BP4A 1SQ2N 4X7CC 3RVXD 4XBPB 1B9ZA 5DQ9B 1EDQA 4PRDA 3C8HA 4C4KT 4YHIB 1ZS8A 3IFNH 4H0IA 3QRFM 3HG1B 1YJDH 3AMLA 3QHZL 4PGBB 1AFVL 4M1GL 2XPGA 3I3EA 1JHTB 4X80L 5D93B 1BAFH 3VXRB 3D25B 5B4MD 3LS5H 4R9HA 4MS8C 1MCWM 4RISL 4NQEE 1A1NB 3C60A 4FTVB 4JFOB 4LDLB 3CFJB 4AENA 2GSGB 3RWHB 4UTAH 2HRLA 4OIIH 1OHQA 3HI1B 4DQOH 3SDDB 4LIQL 1A6WH 2OJZH 5TH2A 2JCCE 1GGYA 3UYRL 4LSUH 2NY4D 3ULVH 4WW1B 5I1LB 3V9FA 3CNKA 3MLPA 3NIFF 4PYGA 3S88L 1QBAA 1JZ7A 1QFWL 3GJEB 2V17L 3NCCB 5DSCA 2R29H 1YEKL 1LEKA 3ULUE 1KXVC 2D0FA 3P4LA 5E2JA 2XTJB 3IGAA 1YNLH 5DVNA 4UNTA 1UCTA 2ADFL 3C8KA 1T7VA 3UYPA 1CN4A 4UT6L 2CLZA 1AQKL 1TZIA 3ZHKA 4PTUB 4PJAF 4UDTA 4HF5H 2K9UA 2CO7B 2PW1B 3HNTH 4JGUA 1MEXL 2C3VA 3NIFE 2W9DL 4TSAL 4LIQH 3CFKB 4KJQD 1JZ3A 4OJFH 1QNZH 3OWEA 4I0PD 3TM6A 4HX1A 1IEBB 4PJ5A 4DTGL 5KVMC 2GJ6E 1TNNA 2XACC 1U8HA 4Z77A 5L2KE 1YN7B 2BNQD 3BGMB 3O6FB 4G8EB 3S88H 3PWLA 5E8NB 4Z5RA 1KENH 4JO1L 5IVXA 1JZ4A 2Y07L 1RUQH 4D0DA 2HFEB 1TETL 3NTCL 3SE9H 3JVGC 4S2SA 5FF6B 1R0AH 4KTEH 4OT1L 4I3SH 1YN6A 2WBWB 4BFBD 5ICZA 1PG7X 4JM2C 3GMLA 5AEAA 4HF5L 3GMRB 4UT9L 3OJDA 2XG5A 5DD3L 1UEYA 2DQHL 3O6LH 3TZVC 2DOCA 1JYNA 2IH1B 4G8GB 4PJXE 1T7XA 2MSPA 3TEUA 4OCRH 5CZVL 1CU4L 1YN6B 5C6TL 3ARSA 5EU4B 1F4HA 4QXTA 3QHFL 5ADOL 4XPTH 1A6TB 2YD1A 2ZUSA 3S35X 1ITCA 4R3SA 3DGGB 4L9LA 4Z7UE 2YR3A 5GS2H 1NLDH 2DJUA 5ICXA 1LP9F 2UY7A 3BMVA 4WW2C 4HIEB 1MHHA 3IETB 4PRPA 3QPQC 5CUSL 2ZOLA 4JFXB 2IPUG 1MF2H 2HLFD 4OCXH 4YDVA 4XCFH 5I1JH 4ZPTB 4LHUD 3FONB 3BRGC 2XQBH 4Y5YB 3GUTA 3TJHD 4YFLF 4KJPD 3TVMA 1CTNA 5INCA 1NL0H 1U8PB 3EO1B 3G6JF 3F8UB 4ODTH 3WJJA 3S35H 3RJDA 3ZL4H 4V1DA 5ILTH 1CU4H 3O3DA 4DKAA 3T04D 1QR1B 3OGCA 1VSCA 1NDMA 1G7QA 1BF8A 3PWUA 1RD6A 2FECI 4DFHA 3OR7B 3B2VL 2IBBA 2YD3A 3IGAB 5D2NA 2Y36L 3TF7C 1KIRA 3VGGA 1JRHI 1E6JH 5EZJA 1CLZH 3LEVL 3NPSB 1YEDA 4TQEH 1JCKA 1OB1A 5I19H 2EDTA 3MLXH 3NPZB 3PDOB 3QWRA 4E41D 2IFFH 4PD4J 1FG9C 4FFVD 4AMKL 5KANG 3CCHB 1A02N 3OMZA 2R2BB 4L8SC 4PJ7E 4EUPA 3MJ9L 2VE6B 1T0NA 2DJ4A 1C7TA 1IM9B 4HXAL 1NMCB 1QRNE 3BPNC 3CFJA 1AIFA 43C9B 2IJ0C 1VACB 3BO8B 4RAHA 5CAYB 4WEBL 1U3YA 3Q5YA 1B0GA 4BKLB 3AS0A 2BNRE 3VXRA 3RDTB 3GBML 4MJ6A 4JDVB 3OKKA 3ARGC 4XMKH 1F90L 4PGBA 3AAZB 5TF1H 4TQEL 1INQB 5C70A 1F00I 2J8HA 2NMSA 1HQ4B 2CLVA 3AXLA 1WICA 4MNGE 1RVFH 5E2WH 1LEIB 3BP4B 2ADGA 3C6LB 5E8PB 1LE9A 3BP5A 3WXVL 4C56A 3MXWL 4HIIA 5HHXL 4KUCF 4LKCA 4IRSA 1WFOA 3STZB 4MMZC 4WTWA 2XA3A 2CIKB 4ZYKA 2AJVH 4M1CD 5E70A 4OKVA 5CP7A 1BBJB 2P8PA 3S7GA 4M9PA 5D96B 3GMNA 4Y5VC 4PRHD 2DQJH 1X5LA 5CJXA 3QCTH 2A74A 3UJIL 3O3EA 1J8HD 1REIA 1QBBA 4MA3A 4M3KB 5FHBL 1HZHH 5DT1L 5DFVC 4YR6A 1FNEB 2Z31A 3LV3A 3E3QE 4HIXH 4D0BA 3IF1A 5CJQH 2X70A 1A3QA 5HYQB 1KG0B 1NH6A 5SWQA 1Z3GL 3LKNB 3SO3C 1XMWA 4QTIL 1PJ9A 4NNPL 1X5XA 4FTVD 4OLXH 5C09B 4KJWD 3MMEB 5GRXG 3VXTB 1AFVH 5HHXH 1RK0A 2D03H 3SY0B 4H25B 3RWJA 1OP3H 4F58L 4QCIA 5C1MB 1P9MA 1C08B 5T5NF 1P6AB 4NHCH 3NH7L 4L5FL 3FT3A 4XP9L 5GGUB 2VB5A 4LPTA 3B8YA 3C6SB 2F5BL 3K4AA 1AY1L 1F2XK 3PDGA 4I8DA 5C0GB 4HPOL 4R97B 3EFFB 1PFCA 1TVBA 1U9KA 2EKSB 2EYSA 1ZTXH 3GSXB 1KN2L 2N1KA 5C0AA 4Q6IA 8CGTA 1P2CB 2NNAA 4MCZB 2H6PB 1NAMH 3GMMB 4P3CL 1SYVB 3TNNA 3VDBA 2D3VA 4HK3J 3HR5A 1T66C 1L0YA 1DEEA 4WY7L 3I3DA 3M8OH 2MHAB 3H3PL 4NC1C 2VWEC 4ETYA 1T04A 3EYFB 2A74B 4CN6A 1W0VB 4WI2A 3E3QC 4NO2A 3GMNB 3UC0L 4ONHA 3JVGA 4MMXC 2F54A 4HLZH 4XPAL 5T5FH 2DYPA 3FOMB 3O2VL 2F53A 2J8UE 3I6LD 5D1QB 2VLJD 4LPVA 1JWSB 1RUAH 4N8PA 4G43B 4HK0A 5TPWH 1QBML 3J8F7 2E9WA 5DK0A 2QQNH 1ZLUH 5EO1A 5MEPA 1M6OA 2FJHB 4M02A 3QCUL 5DI8A 4Z95L 2KBGA 5HHOB 5IMLA 5CSZB 4C54A 4NT6B 1TENA 2Q7YA 2Y07H 3DVGA 1UT9A 1HH6A 4OLWL 5DJ8A 2Z4QA 3IAGC 4YXKH 2BOCA 4UOW1 3CH1A 4N5UA 5C8JB 1PAMA 5HGAA 4PRBB 1YQVL 4G8GD 4HIJB 4ZAKC 3QQ3B 1F45A 1DLFL 3TO2A 1MCOH 3KYMB 3UZVB 3RZCB 5JPMA 4FQIL 3FN0H 3TJEL 3D85D 5J11C 5FOBA 1U91B 3MR9B 4PS4H 4OF8A 2H26A 1MUJB 4LVNB 4Q2ZA 2BVQB 3O9WA 4WHYG 2B5IC 4YXHH 3T2PA 5AZEL 5J4MA 3RKPA 2BSSA 5EU7E 2YZ8A 4I48B 4NC0B 4OBSA 4P4KC 4KI5E 5D1XC 3T4YA 1G9NL 1PVHA 1ULVA 3FO2A 2YXFA 2JJVA 1NCAL 2BK8A 4S10A 3NCYS 3QG6B 1FRGL 1A4JA 1U3HA 3QH3B 4LSRH 4ODBD 4JVUA 5L2KA 1PX4A 5D2LE 1JHKH 5TDOB 1AD0B 5F6HI 3OTTA 5DVMA 4DUXA 3FQXB 1F6LL 4OGYL 4CKVX 5J12B 3G08B 3JUYA 3MODH 1KB5L 2G9HB 3TBWB 2D0GA 4V1DB 1CR9H 2CKBH 1J8HE 4XMLL 3WSQH 3GI9H 4HS6B 4MNQD 5FYJH 3PHQA 1TIUA 3R0MA 4GW1A 4XCFL 1UKQA 5INCB 4L4TA 1ND0A 2B7DT 3O41B 3PUCA 1J5OL 2AK4B 3FONA 3DXAD 4KK8D 5D7JC 3SQOL 4RISH 1WJ3A 5IW6A 1OAXL 4NNXA 2N7BA 3EHBC 4NSKA 1IQDA 4XVJL 4F3FA 1BIIA 1ADQL 1QZ1A 1C12B 3VI4E 1WFTA 4G42B 1EEUA 4MD4A 3LZFL 1CG9B 1N8ZB 4O4YL 3W81A 2D7MA 2UV3A 3MGAA 1S5IL 2DTML 4Y16C 2MMXA 2J88L 3KPRD 5FEBA 1CD0A 3CLEH 3FO1A 3ZKXB 5I0ZA 4DFIA 5TQ0H 4Z7UA 1OT1A 5FKPB 1YNLL 3QEQB 4HUUB 1JUFA 4NBXB 4DCQB 1S8DA 3EDDA 4WV1A 1UVQA 1EAPB 5JW5B 3RGVA 3GMLB 1LO2L 2WP3T 2HTLC 2YBRB 1ADQH 4LLWB 3UX9B 2VYRE 3ILQD 4K3EH 4S2SB 3QWOA 1KF9B 1SEBB 3G9AB 1F4AA 4BSJA 1XGTB 4PJAA 5FYLE 1Y0LB 1RK1A 1ZLSH 2LFGA 4QKXB 2HJLB 2K1MA 4Z5RB 2YPLE 5D2NC 5E8NA 4C83B 2AEIT 1EBPA 2PTTA 4MB3A 4J2XA 3IDUA 4KROD 3DI2B 1ZV5A 3CDYA 1X5AA 4NZTL 1IKNC 3GRWH 5GRUL 3QCVH 2DKUA 1MQKH 1G6RL 4PG9A 5IVZA 3ZT6A 5C0JB 4PJFF 4X9BA 1EZVY 2FEDD 1AO7D 2VDPL 4CN4A 4P9MH 1BFSA 3X14A 4L8SA 4JGMA 5I8EB 5C0BE 3T3MF 5DMKB 2AV7B 2GJ6A 1Z0NA 3D9AH 3DSNA 3CVIL 3ARDA 2HN7A 1JPGA 2DQHH 2A83B 2OTUB 5BVPL 5FK9A 5FUOL 2VL4A 5F1OB 2H2PC 1AQKH 1S7UA 3OSKA 4KV5E 5JHDD 4GSDL 1N6QH 4U1JA 3MREB 5DSCB 1TJHL 3IAPA 2W0PA 4P5KA 3LKPA 1A3RH 1KNOB 2P5EE 3U2SA 1VEMA 2JJSA 1LP9E 3WS6A 4PJIF 4KQ4L 1W72H 1KXTB 4TVSa 3ORJA 4XCCH 5L8KB 2VITB 1A0QL 1O0VA 1OLZA 3V8OA 2XKNB 5IBUB 1EGJH 3QDGD 1D6VH 4PJFB 5EB9A 1C16A 2YOCA 1IZJA 3EYUH 4XH2A 1NC4A 1OGAB 3FTGB 1FSKC 1F11A 5D7SL 3QFDB 1S3KH 5CJ8A 5KG9B 3QIWD 4IDJH 3X12B 2FO4B 4O5LL 2DMBA 1NGPL 1TZGH 4LHUB 2EDJA 1N6QL 4YE4L 1BOGB 4UUJB 4Y2DA 4X9IA 1FGNH 2X1QA 5BZDB 3BUTA 2GJJA 3FTGA 4YBLB 2QJDA 2XRAL 4XMPH 3D0VA 3H7LA 1C16B 4RFNC 1H15B 1I9IL 2OQJB 1T5WB 3ROOB 2BVEA 1QHOA 2XKNA 1FAIH 1GYAA 2ZCKH 4OIBA 4U1SB 2I5YH 2NW3A 1U8NA 2BZDA 3BGFB 4LLUA 1NCWL 1ZHLA 1QQDB 1OAUH 4FZ8H 4QGTA 4XVUD 3FRPG 4X8JB 4W68A 2AJ3A 3U2SB 2XFXB 1F8TH 2JK5B 3EYUL 4HGWB 2X4QB 4ZOEA 3GMQA 4OQTL 1X5IA 2KH2B 3F65A 1JPSL 2JLLA 3HLAB 3UTTB 1MFDL 1VHPA 1P9MC 2VISB 3IFLH 1I8LA 2Z8SA 1I9JH 3FQUA 1S7UB 1KXQE 1YPZA 1P4LB 4E42A 1Q9WA 1QR4A 1R5VA 1CVSC 3UTPE 4JPVH 4ZPVA 1DEDA 1KC5L 3R06A 2DM7A 4L8SB 3OR6A 3OF6D 3PABB 4ODUB 2DD8H 1L9MA 1TCRB 5FYKD