2DDQL

Crystal structure of the fab fragment of a r310 antibody complexed with (r)-hne-histidine adduct
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
218
structure length
218
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords R310 antibody heavy chain
publication title Bispecific abs against modified protein and DNA with oxidized lipids
pubmed doi rcsb
source organism Mus musculus
total genus 49
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2006-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ddqL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ddqL01
1UM6L 2VDOH 2E6JA 3AS0A 5IUSA 2L7UA 1JPGA 3VXMD 1LWRA 1BREA 2QJDA 5EO1A 1MUJB 1CT8A 3TGXA 4JPIB 4JFQA 3GGWB 2Z8WC 2FIKB 5EU6B 3T77B 5F96L 5GSRB 3ZHLA 4JFFA 3T0EC 4Z7UF 4HUUA 5EBWA 5DHXB 5DJDB 1IILE 2H6PA 2P7TA 3MXWH 3TWCL 5IW1A 3VXTB 3DUUA 4PJBE 3B6SA 1OGAE 3BHBA 3CVHB 1GCFA 2AXGB 2WBKA 4U1JB 5INDA 1KIQB 3QUML 4LU5H 2FH8A 1DEEB 1E4XH 2A83B 2ZWLT 3D6GA 5F89B 4NJAL 3L3GA 1OM3L 3SOBL 1DBAL 1NGQH 1CXHA 1LO3H 3V7AG 5T5FL 1TNMA 4M93C 5DTFB 1ODAA 5EU7E 1KOAA 3KG5A 3DVNB 4I9WD 1A6TB 4HUKB 4JREB 5JHDB 4G5ZH 3TV3L 4HW6A 4XHJD 1ZS8B 1FFRA 4RQQA 1B88A 3KS0J 5DD6A 3T0XA 5D6CA 5F6IC 1FDLL 1NGXB 3VXME 3BUYA 3QISA 3NN8A 4OLYH 5L9DL 2XG4A 5CEZL 4FQJH 2R39A 3QT2A 3ROLB 5IWLC 1KCVL 1ZT4A 5JDSB 3ARQA 5FYKL 2EYTB 4R4ND 3ME0A 4G6AC 3SGKC 3DHJA 4YH6A 1YJDC 4PJEE 3KR3H 1KNOB 3F12A 1JUFA 3K8KA 4RNRB 1MAJA 4R97B 4Z7WF 1FVEA 3FONB 3VXNA 4NO3B 4TRPH 5E03A 4ZTPL 1P4BL 5T1DH 3FB5B 1HIMH 4N0YL 1WIOA 3BH8A 4OLWH 1TZIA 3I3BA 1SJVA 4HIEA 4R26L 4PRNB 5DGQA 1FNGA 4I9WE 1KPUB 4MNHB 1JPSL 3C5ZC 4I3SH 3WL9A 1YNTA 4K23L 1BZ7B 2FCBA 1NBYA 2XQYG 1FVCA 4MNGE 3LHPL 3O3AA 3C60C 2X4RB 1RULL 2BC4B 2QL1A 4E41E 2H26A 3U9PH 5GS0L 3A6BH 5DFWH 3FT2B 1CDCA 3VXRA 4CUCA 1QYGL 1MVUB 5C0GA 3RWCA 4OZGE 4PJXE 2UZYB 4X6EA 1EIBA 5JNYB 1FV1B 2H32B 2PW1A 4LAJH 4QTHA 4KKAD 3V6BR 3D69A 1CXIA 1ZHKB 3DRTA 3O41A 2FX7H 5F7YC 4LIQL 2G2RB 1CFQB 3CLEH 3FAXA 3IKCB 1A3LL 4PP1D 3NFSH 4NKOB 1T7YA 4PREB 3J8F7 3SO3B 3RTQC 5K9OB 3TO4B 2B1AL 3PQYB 3ESUF 3OGCA 3BP7A 4NQCA 1JWMA 3WV0A 2K7PA 5KZCD 3GJFH 1CWVA 1QR1A 5I73C 2IQAB 4H8WH 3BH9B 1JHTB 1YPZA 2YPVL 1HHJB 4J3XA 1NFDE 5ICXB 4KHXH 2OTWB 1WC7B 3LKRA 2IEPA 3ZO0A 4D0CA 2XY1A 2VLRA 3ARFD 5C6TL 2NTFB 5D1QD 1CTOA 3ARBC 5LCVL 1BBDL 4K7PH 3CK0H 4YHZL 3F58L 1FFNB 3QIBC 4ODTH 1T0NB 5KBNC 2Z91B 2P5WA 3WFHA 5FM5O 5F7LB 2QEJA 4P9ML 1SJHB 2X9XA 4JLRA 1E4KC 5GGRA 3ARZA 4DZ8A 2WBJB 4OFYD 2FYYB 1NBZB 2IBZX 4HKJB 1FN4A 3S3PA 5H2BA 3OKKB 1ADQH 2A6IA 1ND0B 3HZKB 2AJSH 5ACMA 4WTZG 4N0UE 4Q74A 3MBXL 2HT3C 4DKEH 4H1LA 4EI5B 3H0TB 2BY3A 3BD4A 4ZFGL 1I8MA 5IESH 3TN0D 3QDHA 5I1GL 5I1DB 1ZT7A 2PO6B 4N8VA 4S1DC 4X6BB 3MRNA 4YXHL 3FFCD 3CVIH 3L5XL 3RP1A 5T1MA 1Z9OA 4KROD 3KPSA 4OUUB 4KTEL 5HI3D 1X4XA 1ZGLM 1AHWB 3MV7D 4PBXA 4JO4H 3W39A 3QUXA 4H5SA 5IG7A 4I3RH 5TE4H 3TPUA 2FO1A 1I9EA 1LK2B 2A73A 2C4FT 2MSPA 3AU1A 1DL7H 2B5IC 4JO3H 5GS1A 1BZ9B 3X13A 3ZHDA 4DZBA 2VERN 2IH3A 1INQB 1FL5B 4LL9A 4GW4B 3BKMH 4P2RD 4HJ0D 3QI9B 2HFEA 3BPCB 4IOSD 8CGTA 1JNHA 3HCVA 4ERSL 1F00I 2AEPL 2NY2D 4MJIE 3MXWL 4Z5RA 1RJYB 3EIFA 1G84A 3HMXA 2OBGA 4HLZG 4ZXBD 4XNUL 4K8RL 2ORBH 3RL2A 3DV6A 3SKOA 1OARL 1OAUH 1V8HA 4OQ1A 3QIUA 2Z93B 3SDDC 2GFBA 2Z4QA 1E4XL 1EPFA 5EG6C 2VWEC 4M61B 4P2OC 3KPPA 3VGAB 1ZHBA 3U0WH 5BXFA 3N9GL 3B2VH 3BISA 1IGJB 1GYAA 5JUEL 4E42A 4FQ2H 3FFCE 5HHQB 2XKSA 2XICA 2KQNA 3L3DB 5I1KL 5DURB 5A2IH 4OF0A 2YBRA 5D6DC 3STBA 2HFGL 5K9QI 4Y1AE 3IDNA 4JQIH 2DLGA 1I1FB 1NEZG 3UPAA 4EOWH 3F7VA 3T8XB 4FP8H 3NPSC 1RHHA 2YZ8A 4R3SA 3TBYA 3F7YA 4LLVB 4OD2A 4U3CA 1H3GA 1KJMB 1JRHL 4PTUB 1DQJB 4IMLB 3QDGD 2LABA 3WNNA 4P2RE 4HUMB 1P9MA 3HE7B 5CGTA 2ESVB 1GC1H 2DQUL 1A6AA 1IC5L 2DDQH 4LVNC 4WW2A 3O6FC 2IG2L 3CFDB 5IQ9A 3T0WA 2JJWA 5HDLA 3QWQB 1NCTA 3MGAA 1NMBH 1RZKL 3LKOA 3ZTJH 1IBGL 4XCFH 4YFLI 1N2RB 4CN6A 1F58H 4HUXB 1XIWA 1NMCC 1HCVA 3O4LB 5GZND 5BVJA 3EYQD 4FTVE 4QXTB 3DHMA 5JXAH 2W9DH 1HIML 4TSAH 5HGHB 2BNQA 4Z7NE 3EOAB 1JGVH 3VGEA 4JG1H 3LKPA 2XXCB 4OGAD 1MWAH 2FR4B 4HUWA 3OKMA 2GTWA 3OHXB 2FBJL 3DX7A 3C9NB 1MCHA 4IJ3B 2VL5B 4Q6IB 3V5HB 1BF8A 5C0CA 3C6LA 7FABL 4U2YA 4ZUSB 5KVFL 4K71C 4MQXC 4JQXC 1YEGH 1LP9A 4TSBH 3T0ED 5DC4B 2AJVL 3QDGE 1UZ6F 1XGUA 3DXAA 2HLFC 4NZTL 3U30C 4TTDC 4U2ZA 4OM0L 1LDPH 4P2QA 3C8HA 1UM4H 3F7QA 2QR0B 4KQ4L 3L5HA 3M8OH 3AB0C 4Y19A 4MD4B 2AJUL 1TQBB 5KSVB 4MJ2A 5DQJA 5JDJA 3O2WH 4J3OC 3OX8B 5C1MB 5TE7L 2X70A 4FOMA 1ZWIA 3BIKA 5HTSA 2F53A 2BXZA 3V4PH 3L5JA 2VQ1A 2R2EA 1EZVX 1G7LB 2E7HA 2H3NB 4OF8A 2IAMC 2AABL 3JWOL 3MCLL 3D3VB 3TZVB 2R0KL 2DL2A 2V5SA 5GRVK 3WNPA 3WN5C 2X4OB 1U93B 5IBLD 5MEOA 5FHBL 1QZ1A 5CD3B 3CDGA 3EOYG 4OSUH 3MLXH 2P47B 1SY6H 1BJ1H 1EFXD 3DMMA 4UILL 1S9VB 4GXUM 5I1JH 2WIIA 4JKMA 4P9HC 5T3XD 3T0EE 3SJVD 5C7XL 4CMMA 4EEEA 1R3LA 5FFLA 2Y25A 3QDJB 3QEGH 2XZQH 4WGVB 3CDYA 2BVQB 4HX1A 1PLGL 1AD9A 5CP7B 2AXFA 3SO5A 3VXQA 1OTUC 4KI5F 4MNQE 3HC4L 5GGUB 1DFBH 4PB0H 3TNNA 3CVIL 3IJSA 3BP4A 2V5MA 2JJSC 1KB9K 5DUML 5EC1A 1NLBH 2D03L 4FRWA 2PYEB 4Y4HA 5CIPH 3EYSL 4MAYA 3C5ZD 3DVIA 5E2JA 4O2CB 5DA0B 4LKCA 5ID0A 3ABZA 5FO8B 5JW4M 2HG5B 3TA3A 4XBGB 1XGRB 3L7FA 3C60D 3B9EA 1P1ZB 1A02N 1CFBA 3R1GH 3BKML 3HUJE 2VLKB 4PGEB 3GMPA 2BVUA 4YFEA 4GH7B 3VXOB 1OGTA 1A7NL 1R5VB 5T3XE 5GGVY 3SJVE 1H5BC 4HD9A 1S7VB 3EYUH 4PJ7B 4QNPF 2YD5A 3LV3B 5HVHC 4P46A 3CGTA 5SV4A 1WK0A 5F7DA 2JELH 3ZE1F 4RAVA 1J9CT 4ELKB 1OAUL 4XAWL 3VFSB 1EHNA 5HYFA 4UV4L 5GGVL 4X8JB 3FN0L 3C8KB 3RTQD 5T5NG 4JPWH 3GJEA 5EB9A 3SGEH 3OG6B 1R5WB 1RURL 2LFGA 4HLJA 3PG2A 1J0YA 1S7SA 3IDYB 5FA3B 5B4MC 4LP4A 5B3NA 5ENWB 2W9EH 5I16A 3GSWB 4NKIH 1SM3H 4JY6A 1G7QB 4NUJA 4FXGA 3QQ4B 5FCUL 3NTCL 4EOWL 3NIFF 2R23A 2R56H 2F8VA 4WUUD 2NY6C 3ARBD 4FP8L 2VDPL 1T1YA 1T5WB 1WJ3A 3HNTL 2MWCA 3VA6A 3QIBD 5IROA 1E6JL 2DQFB 2ICWJ 3RWDA 1N7ML 2YPKA 1J8HA 3FHQA 4WV1C 4X99B 4JM2B 5CSZA 1DSFL 3HN3A 4RDQF 1N0XL 3LQAL 1K2DB 4S1SL 4F33A 1V3KA 3B5GA 2O5YH 4HZAA 1A1OB 4GBXD 1IT9H 4EUPG 4HEPG 2N7AA 4A2MA 5HHVH 4M43L 5BZDB 3KPMB 1Q72L 5A43C 4OZIA 2R2BB 4ZUTA 3GMQA 4LVOC 4J7RA 1WAAE 3BAEH 4RMTA 4DK6A 3HC0B 2BNRA 3D0LB 2HT3D 1MLBA 3BZEA 1YNKL 5DLMH 5CFHA 4ZFOA 4LLQA 2EC8A 5BS0D 2RIKA 1A7OH 4KQ3H 5J7CC 3VFVA 4URTB 5ELIA 3IU4L 4YBQC 4XNZC 3LEXB 2HMID 2CO7B 5JXAL 4I5BB 2UUDK 3CU1A 1CZ8H 1P5VA 5IB5A 4WWID 1ZLUK 1JHLL 2X1OA 4ZG1A 4Y4FD 4L4TD 5I15L 1TFHA 1F2XK 2YKLL 4LVHC 1MCDA 3WNMA 4U1KB 4U1SB 3W2DH 5D9SA 4NM4H 1XGTB 3FT4A 4WUUE 3RUGF 3GSNB 2KQMA 3N50A 4HG4K 5MEQA 1GGTA 3L9RB 3BYTA 3OR6A 2VXUH 3EFDL 4JVUA 4X7FC 4TSBL 4KJYA 3U0PB 4L3CA 1U92B 4YHKL 5HYJD 3R8BB 5HHOD 3GIVA 3B9DA 2DQHH 4LCUA 3UTOA 5F3BB 2O61B 4CAGA 4WUKL 1FFQA 5IEHB 3ZE2F 5J89A 4R4FL 3PUCA 4R96B 1B4JH 1Q9KA 1YPZF 1CR9H 2EKSB 3OZ9H 1BIIB 1Z0NA 1ZT1A 4NHCH 3L3OB 3SDDD 2APFA 4BH8B 1HNGA 4MXVF 3WE6B 4ETQA 4LNRA 4P2OD 2FBOJ 5FYLL 4UDUB 4KU1A 5DMIH 5BS0E 3PGCA 4XNYH 3S88H 3SDYH 1J10A 1X5YA 1CFVL 3R06B 3HG1E 1KN2H 3D25B 1CE1H 3HNSL 4GKNB 4PJEA 4WFFD 3GBLA 3MRJA 2OJEB 1FSKC 3WLBB 2DYPA 1MH5A 3MO1B 5E2TL 3RNQA 3RU8H 1HHGB 3WKML 4L4TE 1Z6JT 1YY9C 4LAQH 1NEZB 1EUUA 5EZIH 5F7FA 3TJEH 1REIA 3ARUA 4DKFH 3K80A 3QFJB 3O9WC 4YHYC 5SWSE 5D7IF 3FMGH 4X6CA 4LKXA 5MP6H 2BP3A 3VRLE 3KNBA 1AGFB 2VLMD 4L8SA 3ULSB 3P0GB 2C1PA 4FXKA 4IM8A 5HYJE 4EXKA 4GKZA 5L7XH 3O6FD 5HHOE 4XH2A 3S5LA 1CTNA 1DBML 4M8QB 2VR9A 5FKAB 2R1WA 1D9KA 1XF4B 1RVFL 2VSDA 5DJ0B 3BIBX 5I8OL 4W81A 1YECH 1EMTH 3QFDA 2VWEE 1GGBL 1RUKH 4WCYL 4JFEA 2KKQA 3WUZA 1A6WH 1R5IA 3IDIA 3RPIB 3DYOA 5IB2A 1A64A 1DUYA 2EIZA 4H1LH 4XCCH 5D72L 4WFFE 3Q1SL 4I0PB 5J06A 5K9KA 5KS9E 1MCCA 5JW3L 1GOGA 4HGWA 3UP1A 2FO4A 4U1GC 1FH5H 3L3HA 5JMOC 4O51B 3DVGB 2SEBA 2EIBA 3P4NA 4CN4A 2O5XL 4WTWA 2NX5D 4TYUA 2P44B 5C07A 2AI0H 5IIEB 1NCNA 3T2QA 4Y16A 1R0AH 5DEGA 1EH9A 5I8KL 1T20B 3SKJL 5B38B 2HLFD 2VLME 4ODXA 1KFAL 4TTDD 3BN9C 3OWEA 3IAPA 2EDNA 1K5NA 3EYUL 2A74A 4YUEL 5J6GA 4KZEL 1LQSR 1MAML 5IMLB 3AVEA 4QWWC 1OPGH 4C83A 3IKKA 1AGDA 1U8QB 4OLXH 5KW9H 3QCTL 3O3EA 1OL0A 5FOJA 1JPTH 4UTBH 4QRRB 1CU4H 4F8TA 4JPWL 3Q6FA 3V5DB 1UCBL 4IDJH 4XP6L 5IB4B 4BZ1L 5DFVD 4J4PD 1I3RB 4BUGA 4MDJA 3BT2L 4X5WB 1TQCB 4HS8H 4X6DE 1JWSB 3M1BB 4UDTA 1LEGA 2YA2A 2BCKB 2IADB 1CQYA 5IK3B 1XGQA 3FO2A 5D1ZB 5BRZA 4WWKB 5I6XB 3UTTB 1NGWB 3KPRA 5DUBA 3MLWL 3CFBB 2ICEB 1NANI 1A8JH 1I7RB 3MJ9H 3MJ8A 2W60A 1FGNH 4NQSA 2NX5E 3JWDC 1U8LA 3QXAA 4KK9C 5DZLA 3U46B 3AAZA 2X4UA 2X7LA 1TJIH 4HIIA 4NJ9H 4CW1A 1RZGA 2VN4A 5ANMB 1P7QB 1BQLH 3MGTB 5I30L 3U9UA 5EU6A 1FFOB 2ZPKH 1JGEB 1TPXC 5J56B 1AGEB 3MBEA 4NQXB 3ARXA 4Y4KA 2LTQB 5I75B 1U8OB 2M8XA 1P4LA 1FO0B 5JPNB 4MVBC 1I85C 4FQIL 1WWCA 1BECA 1C1EH 1T21B 1A4JB 4BM7A 1N6QL 1J86A 1OTUD 2CIKB 3MUY1 2JJTA 1A7OL 2OZ4A 1YEHL 1U8NB 5L2KD 2A83A 5F89A 3MUGB 3ARRA 4YJZL 4XPBH 2GJZA 2YRLA 1LP9F 2ITCB 1HHKB 1FNHA 3GMRB 4HIJA 4BSWB 2VZ3A 3BUTA 3X17A 1S9XA 5B8CC 2BSTB 4WFHD 4YDVA 5JHDA 2O93L 1MI5B 4APQB 2NXZB 3HRZB 3BFOA 3PWNB 1YMMD 3U6RA 2OTUB 4Z18A 4PJBB 1OGAB 1FJ1B 3RL1A 3D87B 1DQDH 5LBSH 1UB6B 4M48L 3VXSD 2D4FA 3QAZB 2R4RH 5JHLH 3FTGB 4ZD3H 1JGLL 1Z2KA 4JO2H 5IVXA 1Q9OB 5JDSA 2ICCA 4XMLH 1B4JL 3HKFA 5CEYB 3FQWB 1JMXA 3QG6A 2XT1B 5F7UA 1N26A 2APWA 2R4SL 4NP4H 5GJSL 3ZL4H 1KNOA 4RAUB 5FDWA 1KCKA 1S7RA 1TIUA 4HIXH 1J1PH 5GRWA 1E4WH 2HP4A 5L2KE 1AJ7H 3G5XB 2VXQL 1PKQE 3VCLA 1KN2L 1S5HB 1CE1L 4NO3A 3VXMB 1FYTD 3IGAB 1GHFL 1YEKH 3ES6B 4MCYB 1MCPL 3RZCC 3QYCA 3BXNA 3IETB 3PWPD 5CILH 4YGVB 4GMTL 4NKDA 2AJZA 2NY6D 4WFHE 2H45A 5DO2C 2GAZB 3P30L 4JANB 3WIIH 3ZKMC 4NRZB 1UA6L 3HE6A 4G8IB 2PXYC 3CU7A 4K2UH 1FIGL 1YMME 2VKWA 4F15B 4BQ9A 2Q86B 5I9QC 2EIDA 2NY5L 1DR9A 1F5WA 4KUZH 2X4RA 2GKIA 3VXSE 3OAYK 1JNLL 1DBKH 4EUPB 4Z7OF 1UXSB 3FT2A 2E9BA 3HMWH 4TQEL 1KT2A 1NGZA 1ZHLA 1G9ML 5HGDB 1O5DT 1LE9A 2BSRA 4AH2A 5DXWA 1FV1A 4M00A 3GHBL 4B7IA 1ORSB 5K9JL 1DVFA 4NUGL 3THML 4GW5B 4Y2DC 2Y5TA 5LKNA 3RX5A 1ROWA 4GKSB 3QXUA 4KVCL 4J23A 4YBQD 2VYRE 3IKCA 3PP3K 1DQMH 2DMKA 4XP5H 4NKOA 1BLNB 2ZP0T 2Q7NA 1KCRH 4MNGB 4QGYA 4XCCL 1T22B 3PQYA 1FYTE 1T6VN 1W0WB 5JO5B 1KEMH 2OL3H 3PWPE 1OP5H 2ATKA 2HJLB 1WZMA 3BH9A 1EK3A 2AV1B 3B83A 4OZGB 2E27H 5ICXA 5CLTA 4Y5VA 4M5ZL 1UJ3B 1R3JB 2OTWA 3WFBL 1UB5B 4LFHD 4PJAB 4PRPD 1FG2A 3QWRD 2XOTA 2NTFA 5DZOA 3TYGH 4HKBB 4FABL 1D5ZB 4U6XA 3O8XA 2M2DA 4P5TA 1I9RH 5FHAL 4M9PA 1KJ3H 5C0NC 1RK1B 1CLOH 3U4EA 1SJHA 4FQQA 1D5BA 2MMXA 4LPYA 4I18B 4HQQH 5EC2B 4YHIB 3NIDE 1L7TL 3IAQA 4WO4C 1NFDB 3RNKA 3HMXL 4IIQB 1G9NL 3NZHH 5HGAB 4XHQA 1ND0A 4IDJL 3S3JA 1YNLL 2EO1A 4ONFH 3O6KL 4OZFB 5CSGA 3C2AH 3O6MH 3IDJA 4HS8L 5KVGL 2EE9A 1WCBB 4XPTH 1T5XB 5EU5B 3UXFA 5B39B 2YUWA 2PO6A 4RMRA 1YY9D 1TJGH 4LSQH 4G43B 3V6ZB 5IQ7H 1RUQL 4LRNH 3MA9H 3O9WD 5GISL 2XRAL 3CPLB 1NAMA 2FSEB 2RBLA 4JDZB 4TUOB 1FGNL 4YXKL 3TIDB 4PRPE 5DDHB 3MFFA 3QNZA 2GJ6E 3WEXA 1A7QL 1JGDB 4FZ8L 3LKNB 2XACC 1BQLL 5GJTL 3S35L 4NN5C 3PL6C 4N0UB 2ZPKL 5HHNB 1D5MB 3DETC 4YBHA 3RWEB 2X4NA 4YNYB 1WIUA 3ZTNH 3NBNA 2DKMA 4NSKA 5KZCB 1RJYA 3T1FA 3OAZH 3QXTA 2XA3A 3PWLB 4I3GA 4MQ7B 3TFKC 4I4WB 1F13A 2CUHA 2DQDL 3UZEA 3TCXA 4ELMF 3IJYA 5C9JA 1MY7A 5SWZA 3U1SH 5GS3A 3MRDB 4LEOA 5IHBA 4M62L 2XV6B 1RZJH 3CH1B 1CE6B 2FEEI 3DX9A 5ISZD 3ARFB 5D1QB 1QSVA 5TQ2H 3WHE0 1MCFA 2BOCA 2P8LA 4X7EC 3EO9H 3QG7L 1PAMA 4P4RA 5I1AB 1MNUH 1MF2H 1Q0XL 3UTQA 4M7LT 4OF6A 5GS0C 5J6HB 5D2NA 1L4IA 1F6FB 3PE9A 2YMXH 4GAJH 5IB1A 1Q94A 4IHOB 3FB7B 3T8XA 3PIQB 1P4IH 3STLA 3IAGC 3BN9D 4C56D 1IGYB 4GRWE 5LBSL 3QNYA 4LLVA 1GZPB 2UVEA 2AV7B 4R6UA 1KJVB 1OQOA 2H2SC 5K33A 4D9LL 1JN6B 3ULVF 4DCQB 4QWWD 4Q6YA 4JO2L 4XVJL 3TN0B 4QRPB 2EDQA 5E8OB 2B0SL 4LVEA 5ILTH 4PD4J 5E24E 4D9RE 4Y5YB 3CFDA 3FFCB 4NZRH 1EVTC 4KROB 4J8RA 3BW9B 3PABA 3V0VB 1N3NB 4KHTH 1F4YH 1N0LA 3MV7B 4HIXL 1VADB 2DQIH 3NCCB 1J1PL 3MA7B 4X6CF 1H15B 1IGML 3HAEG 5ISZE 4UOJA 3SGDH 4HKXA 1A7PL 2PTVA 3KWWB 1KJ2A 3ARGC 1WWBX 3ULVH 5CILL 2PNDA 5EUOF 3OKNA 5JLZA 2MHAA 5E99L 1JYVA 2FJHA 1MRDL 3D2UA 5F6HI 2FR4A 2YD7A 4KK9D 2NY2B 5TF1H 1SHMA 1CDYA 3WCYA 3RA7H 4Q6IA 4JJHA 3LS4H 1JNNL 1QR4A 2C3VB 4ZXBB 3T4AB 2ATPA 4C56E 2X4QA 2NYYC 4DTGL 3MV9E 3BRGC 4Y7MA 3U2SA 4ENED 5DJZA 4JHAH 1GPOL 1ERNA 1AD0B 2FX8H 4PGBB 4XPHL 3S3SA 3CUPA 1T80A 5E8EA 3V5KB 4F8QA 3EFFA 5HYSB 3QO0A 4QHNA 2FJGA 4X4XB 4TOYH 3OKDB 1FNEB 1CYGA 2PTTA 3SDCA 2W9LA 1MFEH 1TZHB 2HKHH 1L0YA 2X1WL 4JCLA 1UVQA 5DK0B 5BO1L 1LO4L 2N7BA 4LF3A 4TPRH 2DQGH 2NXYC 4NPYA 3SKNA 3GBNL 1KEML 3QDGB 2O5ZH 1G7PB 1RJLB 2EECA 3D3VA 3HS0A 3QH3B 2BY0A 4Z7QF 2EXYD 1QBML 3IJHA 4W6XB 5F7EH 1BD2D 1VKXA 1MREH 1O0VA 3TYGL 4LRIC 2X9YA 4HXBH 5D7JC 5J13C 4JFDD 1MHCA 4K8RC 5JOEA 1A7RH 1DQLL 2R2HB 2JCCE 2NW2A 1I9RL 2NNAB 3HC3H 4RISH 5I1IH 1CL7H 1CFNB 2DBLH 2ZUQB 3O2VL 4PTTA 4U33A 1XH3A 2OR9L 3QDJA 1J8KA 3SCMC 1K4CB 4ZTOH 1IL1B 1MELA 4J6RL 2CLRB 1KELL 4I1NB 3K4ZA 4YO0B 5LG1A 1HSBA 1MPAH 2JF1A 2BVQA 2RCSH 3OL2A 4IOFC 5B21A 2J88H 4LSSH 4PJ9C 3O6ML 1WV7T 3ALPA 1C16A 4XPTL 2R0LH 3UJIL 3RZCD 3LRSB 4PBWD 1CF8L 5FV2A 5DI8B 4H25B 5DO2D 3T0EB 4YDIH 3ZKMD 4G6MH 4LRNL 4O9HL 2PXYD 4L9DA 5FO9B 2PYEA 2CDEB 4JFHD 4YHPB 2LAGB 4O2CA 5H94A 1NDMB 5ADOH 1H3XA 5FO8A 1BD2E 1XGRA 4GUPA 3RJDA 4MDIA 3BP6B 4JFDE 4X9HA 5B22A 5MEND 1DN0A 2DQTL 4OIBA 4K3HA 1R5VA 3GBML 1MY5A 4WI5A 3DX6B 4M93B 4G8EA 4HDIA 5C92A 1FYHB 2GEEA 5D93C 4C58B 2X41A 2XFXB 4MD0B 3QUZC 4Y2DD 1QFWI 1NUDA 1N59A 2CR3A 1AR2A 2FDBP 2ZUSA 4FQXC 3ZYOA 1QEWB 4JHBA 1WBYB 2CD0A 1CLZH 4O00A 1MFNA 1QNZH 2EEDA 5FYJH 5F6IB 2JIXA 4YHLH 3CVHH 1OQXA 5EZOH 2ZCHH 1Z5LB 5J11B 5B3JF 1WEJH 1NBVL 2R15A 1EFXB 2OZ4H 3PHOB 2ARJA 1MF2L 4YGAB 4LHUG 1D6EB 5TPWH 1J7VR 3SJVB 1M05B 4KJWC 3GSWA 1G7QA 4Z9KB 4JFHE 2IFFL 3SDAA 4TVSa 2L4OA 4X6DA 1I8LA 4ZAKC 1CD0A 3INUH 3MNZB 3DTXA 5KN5B 4HK3J 1JZ4A 1I8IB 2DQFA 4PLOB 3TT1L 4G6KL 4XXDA 5JW5A 5MENE 1FNSH 4F7EB 3O81A 5C0ND 3H9SD 1K2DA 3GMOA 4NZUL 4RA3A 1KLGA 1JYNA 1RZFH 1QLRA 4FHBD 4LASH 3CFIC 4JQXA 1WQVT 3KPMA 3DBXB 4WO4D 4J3SA 5I0ZA 4WEBL 1JYXA 3F7RA 5AEAA 1RZ8B 2E9IA 2ZUYA 4H8WC 4XI5C 1GVIA 3G5VB 2J5LC 1FZJA 4XCYB 1F4YL 2D0HA 3D0LA 2VXVH 3C5ZB 3KYOA 4WTZA 3GMLA 4JQVA 5BZWB 2JK5B 5CSBA 2YSSB 1W72A 3O4OC 3C60B 3E6HB 1CLCA 1AE6L 4HPOL 4OKVA 4I5BA 4OGZA 5CEZD 2ZNWA 3D39D 2R2CA 4XRCB 5D7KD 4ZOEA 1S7TB 4RGOH 5FYKD 4GAGL 1XCQA 3V6OA 2VRAA 3TVMA 3B4NA 4QHKI 3LS4L 2HJFA 1A14L 4GMSH 4CDGC 3O3DA 3GSNA 4XZUB 2XZCH 3BKCL 1ZLWH 3PL6D 1QLEH 3IF1B 4Z77A 3D9AL 5HYIA 3DETD 2OQJB 1U92A 3RTQB 3GK8L 3H9SE 5DA4A 3TBSA 2P5ED 4B7LA 1MRCL 3PXJA 4P23A 5I73B 5F3BA 1I9JH 4L4VA 3F6LA 4D0BA 3DLQR 1UACH 1P7HL 2B39A 5GRJL 5IEHA 2BVOB 3QHZH 4R96A 3HNVL 2EKSA 5CEXB 1BIIA 3G6AA 2BVPB 15C8L 3WE6A 1SYVA 2H32H 2AAVA 4G7VH 1IGTB 3U0TB 2P8PB 2OP4L 3FQNB 4WUUB 3ARBB 1IGFL 2DM7A 2WV3A 5INCA 3QZWB 3QIBB 2EH8H 5DQDL 2W0LA 2DQGL 4U7SA 5GS0D 1GXEA 3W0WD 5CEZE 3H6JA 2IALA 2V5TA 4XVSH 3D39E 2BOBB 4PLJD 4GBXB 4NC0B 1UWEL 3VXPA 4OV5B 3WS3A 3I50H 5FYKE 2F19L 2R8SH 1Z9SA 4LHJB 5ERWB 5H37G 4PJ8C 3H9HB 2H2SD 2XY2A 1A7RL 32C2B 3HFMH 2F54D 1AGFA 3KXFD 3ZSSA 3ZT7A 1D5XB 1B0GA 3V8CA 1MFAL 2P5EE 3WJLA 1UM5H 3RAJH 4O2EA 3MOBH 1CBVL 1WT5C 3EDDA 4ZTOL 5DJXA 4N0FB 1LGVA 2DKSA 2FHFA 4BK4A 4Y4FB 4L4TB 5IMOA 5DJ0A 2VNCA 2YHGA 5HY9B 2YUZA 3B9KC 4YHOL 2BRRL 5I0DA 4NN6B 4CADB 3KVQA 3HAEB 1XR8B 5ACZB 2R0LL 3ARGD 2DIBA 2K1MA 2CK0H 1MCQA 3EGSB 3UBXB 1SBSL 1A6PA 3W0WE 3L1OH 2Z31A 4PJDB 1JFQH 4Q0XL 1A7BA 2IPUG 5HYJB 1UADC 5I71C 5C0EB 3LQAC 5HHOB 3SE9L 3MV01 4I2XE 2VITB 1GC1C 1H0DB 4O51A 1RMFL 1NJ9A 2OI9C 1JHKL 3QUYA 1MLCB 2LVCA 1U8HA 4QTIH 4DGIL 2NYYD 1FLTX 5KVDH 1NAMH 1FZOB 2YRPA 5D71H 5F9JA 3U7WL 1T20A 4LIQE 2FEEL 4HJGB 4NQVA 4P2OB 3RGVC 3REWB 2F54E 2I9LB 2ZCKH 4MWFB 5TDOB 1AQKL 3TBVB 3VXUD 5JXEA 2OX5A 2VDKH 1CK0H 1FVDB 3X3FH 5E94B 4WI8A 3FCTB 3NA4A 1FL6A 5IMLA 5JA8B 5DJ6A 2MNUA 5L2JA 5HJ3B 1OW0A 5KS9B 5EU4A 4UV7L 2DLFH 4Z0BL 1NUFA 4H26A 2GUOB 2RFXA 3CNKA 1GGIL 1X5LA 2D3VA 3NPSB 3V5DA 1DLFL 1NCCH 4WDIB 4U1IA 4YHLL 5EZOL 1I3RA 2YS4A 3NMEA 3ILPA 2NXYD 2IQ9L 4GXVL 2OTPA 4G3YL 1UEYA 3EJJX 2PR4H 2N56A 2G9HB 2OR8A 4KUCF 3WHE1 4L9LA 1Y0LA 2BCKA 1KTLA 2OK0L 1PDKA 5D1ZA 4WWKA 4MA7L 3O6FB 3I6KB 4AEFA 5DHVB 1X7QB 1I1AC 5TFSL 4OQTA 2EDKA 5D7JD 3INUL 2HFFB 4PJHE 3ZKND 4K8RD 2UZXB 3RVTC 4NHUB 3U46A 4OLZL 4OM1H 1G6RB 1RIUH 5FCSH 1B6UA 1FNSL 4DN4L 1RUML 5I66B 1NMCB 4I0CC 3VXUE 3MGTA 1YEDA 1FFOA 3SCMD 1JWUB 4X9IA 4MCZB 2GTZA 2XPGB 1JGEA 2YXMA 3MOAH 2GSIB 4NT6A 1GZQB 4NQXA 3P11H 4G8GD 4Y2OA 5JPNA 2Y36H 2OMNA 4ZMAT 1WTLA 4P5MA 4PJ9D 3QCVH 1T21A 2M26A 1A4JA 2MPAL 2XWBA 3KYKH 2CIKA 5FK9B 3V6FB 4RDQG 3VH8G 5EBMB 5EH1A 4LCCC 1BGXL 3TYFA 3ZDYF 5ICYB 5F93C 4BSWA 2CXKA 5BMFL 2VSCA 4IRSA 4TUJB 3VFPA 1KJ2H 2NY0C 1B3JA 3SY0B 4OLVH 3AB0B 5BV7H 1CGYA 1MI5A 3VMNA 1BOYA 5CZVL 3QQ3B 4K3EH 5IM7A 1FJ1A 3KJ6L 5CJXA 5DWUH 1UB6A 2Y4SA 3FTGA 2I9TB 1AP2A 1I1YB 3VFMA 3BP5A 3QUZD 3GI8L 1C7SA 2I27N 1UACL 1J1OL 2X1XR 3ARYA 4AEIL 5IT2L 1NC4D 4FQXD 3MLVH 5C0IB 5C08E 4GW1B 1MRFH 5F9AC 5K59F 4WI3A 2GT9B 4Z7UE 2V9RA 3K8MA 4G8GE 5DT1H 1KIPA 2EH7H 1OWRM 1ETZB 3FQRB 4RFNC 1ZAGA 5AUMB 4ODSH 4UNUA 4G7VL 4XPAL 3P0YH 2W65B 2PCPB 4K55A 1JPFA 3OF6A 3RY4A 3JV4A 4JY5H 2X42A 4G8FB 4HPYH 4UI2A 2Z35B 2VZ1A 1P6FA 4KJWD 4NO0D 1BVKB 4ZYKB 2YOCA 1F6LL 1U8IB 5SX5H 3IETA 3ZDZF 3UYRH 1M71B 1NFIB 1RY7B 4KI5C 3NZ8B 4ZAKD 4G9FD 3I50L 3VFWA 3LZFH 1Z9MA 3MLPA 3SGJA 4E5XB 2V2XA 5I2IA 4CVZB 3QJFA 4ZO9A 5FYKU 1AXSA 5DVOA 4X5LA 1X5KA 3KPLB 5T33L 3V8OA 4TVPH 4HH9A 1S7XB 5DYOB 1A9BA 3QWOB 5DR5L 3MR9B 4EUPA 5L2KB 4LSTL 4U6YB 1PKQB 3MYJB 1PEWA 3OJMB 1YN6A 5HGDA 1PFCA 3MCKA 4FQHB 1YN7A 2C9AA 4XI5D 1MCLA 2ZCLL 3H8NA 4ODWA 5GHWL 2HVKA 4BELD 4WGWB 1ORSA 2NY7H 1FZKA 4XBEL 4G80A 2FEDC 5IVZB 4ESKA 2MFNA 3BZ4B 4PV8A 1KIUA 4LSPL 2QQLL 4WENB 4LBEA 1TVBB 4HAFA 4BFBD 2CK0L 2ADJB 3EOTL 1T22A 3L1OL 4Z7WE 1H5BB 4DAGH 1ZA6B 4XC3H 3VXSB 1RUPH 4RIRB 1FZMA 3CFJA 5HVHB 1KC5H 4XWGL 1UWGH 1UCTA 4G9FE 1QFWL 4X5XB 5F7MC 1IQWL 5A3IC 4QRUB 2DI9A 2YK1L 1NKRA 5DRNB 4F7PA 4PJAA 5KVDL 5CBAB 1JF5A 3GSOA 1A2YB 5EUKB 4QO1A 3I6GA 3RVXC 5FF6A 1T4KA 3BN3B 1CIUA 2ZCKL 1X5JA 1ZXQA 4YPGB 4ZPVB 4C59B 4IS6A 3BGMB 1HYRC 3RKDC 1OVZA 4UUJB 1BBJA 4M3JA 1FYTB 1AR1C 4U7KA 5IFJA 4JRYA 1QO3B 5DEFB 4PRDB 5EC2A 3PWPB 1NGPL 3IU3B 4CKVX 5MERA 3ZKXC 4MA1B 5HGAA 1GH7A 5FB8A 3V0WH 3KYNB 5HI4D 6CGTA 1KYOJ 3CSPA 3ULUF 3WHXA 3IRZA 1T5XA 3WIHA 3FB8B 3IFPB 2P45B 2XIDA 5C0BE 4R8WH 5CMAA 4G43A 1T3FB 4PJFA 5EORH 1IJ9A 4HS6B 3A6OA 4PJ8D 2IWGA 3CPLA 4LLMB 1E4JA 2FSEA 4TUOA 2NW3A 3U7YH 4HKZB 4LVOB 4MA8L 5EZLA 5EBLB 5GIRA 1M4KA 4P4KA 5DDHA 5DC0A 1XF3B 3T3MF 3DV4A 1RIUL 2ICWA 3P73B 3WJJA 4QLRA 2E5EA 1JGDA 3NA9L 1TVDA 2VDRH 3FT3B 5CINH 4PD4K 4YWGH 4XNZB 3ULUH 2DTMH 1A4KB 3AS3A 3ZT6A 4JZNB 1B90A 3B9AA 1HHHA 1ZMYA 2B4CH 2CO6B 4LQFH 1J88A 4LVHB 2Q76B 1Q8MA 2R69L 3B9KD 4OCXH 3FHAA 1EXUA 1X5GA 4ODBD 1A0QH 3HA0A 2ADIB 1NEUA 5E08H 4PRPB 5GRUH 3N85H 3LQZB 4MB4A 5C0DB 1K4DA 2MTPA 4KY1L 4XGZA 4OCRL 1AO7B 2X4TB 4LQ1A 3VFGH 3RWGA 2NY5C 5I1AA 1QD0A 5KSBE 1HN1A 3BVNA 1UC6A 4FG6D 1KJ2L 2FHBA 3EZJB 1CLYH 1ZOXA 1VGKB 5BV7L 2UYLA 5JORB 1KB5A 3T2OA 4KH2A 1QBBA 1G9MC 2HT2C 3FB7A 1QBLL 2V17L 4M7LH 3RGVD 3PIQA 2VB5A 4L8BB 1QSED 1G7HA 1IGYA 4X80L 2ZSWB 3NACL 1TJHL 1GZPA 1YEEL 3DVFA 3GSNH 3LSOA 1AKJD 4KTYA 2C1OB 5K93A 2AEQH 3VI3E 5ITBH 3VDBA 5DS8B 1NAKL 4CNIB 3I2CL 1FSKB 2C3XA 4CU7A 3TN0A 4YDLC 4QRPA 1M6OB 3X14B 4LEXH 4EXPX 5DT1L 3GRWH 3QJHB 5IHLB 3BW9A 3O9WB 1N3NA 4GRMB 2BJMH 2PW2B 4HLZH 3CXHJ 3MV7A 3SE4A 5A16A 1VADA 5CJOL 4AENB 1GSMA 1T66C 4HCRA 5HPOA 4PB9H 4G42A 2V9QA 1BOGB 4GRWB 4XXCA 3QUXC 5GGTH 3KWWA 3ELAT 3UYRL 4Z95L 2JB6A 1I1AD 4QKXB 1QRKA 4H0HB 5GS1C 4V1DD 1IEBA 3S96B 2WQ8A 4TNVF 3RVTD 3V4VL 2XKNB 1C8PA 3RI5F 3S8WA 1MHHB 5J57B 5L8KB 4LSVH 1LILA 1UH3A 4ZXBA 5HGGS 1YEJH 4NO2A 1ES0B 5FYLD 2ILLA 1QSEE 3ROOB 5D96C 1P2CB 3PWVB 4EI6B 5IV2A 1A5FL 1OLZA 1F3JB 2Y06H 2XZZA 1HHIA 3KHOA 2ZZUT 3JSSA 5ISZB 2QKIB 3QIUC 4S1RH 4F58H 4I77H 2E7CA 1B6DA 5CWSB 2NY7L 4OIIH 1MJUH 2GITA 1XGYL 3D18B 5CJ5A 3OAYH 3WDJA 5D2LB 4LOUC 2YRZA 3ZT5A 4Z78B 1GGCH 1HNFA 3FB6A 1HWGB 4TNWK 4JHWL 3CH8A 1KEGL 3JV0A 2ZG1A 1JZ5A 2QHLA 4C56B 5JW4R 1JI1A 4XAKD 2NY0D 3SDXA 4DEPC 1II4E 3SPVA 3G08B 4C4KT 4OT1L 3WS6A 2LAAA 1OLLA 1BPVA 1TZGH 4V1DE 5DJ2A 1MJJA 4LPCA 5F1KC 5EPMB 5I8CA 3N1PC 2QLVB 2UY7A 4QHLB 4XC1L 1IAMA 2COQA 1JZ8A 3WFZA 1P9MC 4P57B 1BAFH 3L5IA 1VENA 4WW2C 1UFUA 5FYLE 4PJ5D 5A2KH 3HHRB 4PP2B 2D9CA 4YK4C 4JRWA 1CXFA 1OY3B 1CFNA 4UT7H 4RCAA 4JZOB 5TDNB 3D85B 4HWBL 1OSPH 4QXUH 3RDTA 1UZ6E 5AZEH 1N5AB 1K4CA 1BFOB 3AXLB 3L95B 1E27B 4X4ZA 1XIWC 1TTGA 4FQPA 1ZEAH 3WYRA 4YO0A 3O3BB 2VDQH 3WKNA 5E9DA 4U1MA 1S7WA 4PY8J 2XN9A 3IDUA 3UC0L 3MODL 1OD7A 1FRGL 1NCDH 4UU9A 5DF0A 5AG8A 4MAUL 4PRIA 1MJ8H 2ITDA 3BKJH 1MCSA 2NY4C 4AK1A 1JV5B 4OLUH 1WZKA 4XAKE 2JCCB 3L3IB 5EZJA 3C6LC 1KCLA 4X7TB 1C12B 2V7NB 3VFNA 3U7YL 4JFFD 1IC7H 3HI1B 5FECB 1NDMA 4ZUWA 5F21B 5IHZB 1WISA 3L3KB 4YHML 3MRLA 2X09A 5L88L 4NWUL 1MHPL 4PJ5E 4GLRH 3TBWA 2J8UA 4P2CG 5GXBB 3FZUC 2CH8A 1IAII 5EN2A 4JM4L 2B4CL 4NNPH 3RX8A 4LQFL 3TLRA 4ALAH 2FEDD 2X6MA 4D9QD 1G7JA 3HR5B 1RIHL 4HC1A 3T65A 4XPGH 2J12B 1WBYA 2P42B 4NQDA 5BVPL 1JE6A 3CLFL 4HEME 4XP9H 3N85L 1RI8A 4HK0B 1BD2B 3CXDH 3QULB 1VFBB 1KGCD 3HLAB 4JFDB 3QO1A 4O2FA 4B50A 1W72L 1K8IB 1T2XA 1ZSDA 3VRIA 5AAWA 3VG0H 4KI5E 1HI6B 2ZOKA 1PKOA 3H2WA 1BMGA 1M05A 4I0KA 1JK8A 2W91A 2WANA 1F8TH 3Q5OA 4HBCL 2BSSA 1OP3K 4L3EA 1U8MA 2CDFB 3MRIB 3DMMC 4L8CA 4NCC1 2UWEB 4WY7H 4E0RB 4JFFE 5ETUB 3RVXD 3LEVL 1U8JB 3MNZA 4C54A 1YEIL 1T2JA 3UPCA 4NQED 5T5NF 1UWXK 5DMGC 5TGBB 2H9GA 4JDVA 1H3PL 1LE5B 4YZFF 1UEMA 5F1IA 3RKDD 1G7IA 2DF3A 2OSLA 3K74B 2BY2A 4L8DB 2VDNH 4J3TA 4PJCA 1GL4B 4N8CL 1AR1D 1F6AA 1UH4A 1F90H 3RZCB 3WIFB 5E6ZA 4KRPC 3MSPA 4UB0H 1JIBA 5BQ7B 4PR5A 5D8JH 1E28B 4D9QE 4QNPE 4M7JH 3G5VA 4AT6B 2BJML 2DD8L 3TBTA 2PXYB 4WI7A 2VXSH 2PYFA 4O5LL 2I60H 1AIFB 4FFZH 2V9TA 1VPOL 4S10A 1CG9B 3TT3H 4Y4HC 4MAYC 1LO5B 3GMMB 3LKQB 5F1SA 1KGCE 3EYOB 5MENB 1RZIA 3TA3C 3JV6B 3C6SA 1MIEH 1EVUA 4PRAB 2VISB 1MIMH 4XRCA 3NOIA 1S8DB 1A6VH 5KANG 4EDWH 1JZ3A 3VXRD 5EU3B 4S0SD 4HULB 5IVOA 4Y2DB 1CGUA 3L3JB 3ET9F 3Q0HA 2PTUA 4ETYA 4ZNEA 5E5UB 3NIFE 4OCSH 2H41A 4P46C 3P9LA 1CFTA 2BZDA 5F1NB 2AJYH 1JTOA 2VKXA 2HWZH 4YXLL 3EO1B 1LMKA 5HHXH 5MHSE 4MXWH 4K7FB 1T1XB 3PHQB 4J3UA 2QSQA 2H1PH 1UXWB 4LLWB 4EUPH 3GSXA 1IAOB 4P5KB 4OIIL 1MJUL 4NQCD 3KPNB 4NZJA 3U36A 4AIZA 4F57H 4JGJA 4OZGF 5GGSB 3JBG7 1HOCA 5CAYB 4PJAF 2YPLE 1JF1B 4WU5A 1Z3GH 4XNXL 5ABDE 3IDGB 1NUGA 3C5JA 4BKLA 2Z8SA 3C09C 2VLRD 5BJTB 5SWQA 3BO8A 3QUMB 1TITA 4HIHB 3UZVB 4HUVB 3H9SB 3H3PH 1MCOH 4M6ML 4MSWB 5IROC 2WBWB 1JZ2A 2HT2D 1A3RL 2P5WD 4GBXA 3VXRE 1ACYL 4ORGB 1DUZA 3O45B 4KZDH 2X5PA 4WO4B 2IANA 3OKLA 4G7YH 3NH7L 1SMOA 3QEQD 3QHFH 4QXGH 3FRUA 3KLAA 4PJIA 1D5XA 3TIEA 4JPKH 3I6LD 3I3EA 3GSVA 2FWOB 2G75A 1F11B 5JOFA 1OSPL 3EDKA 5AZEL 3FN9A 1KPRB 3PGDA 3TNMA 3AY4A 5DD5H 1M1SA 4FQLL 4N0FA 4N8PA 4PJFF 3WFCH 4NQCE 1I9IH 3D39B 1RD6A 4BQBA 4Y4FA 2WINB 4PS4H 1OAKH 3KPSD 3ZE2E 3LN9A 1PBYA 1U8KB 1X5FA 1T66D 3REVA 3LPGA 1YPZE 1NCDL 4R4BB 4ONHB 5LVEA 2ED7A 4A2LA 5GS2D 5EWIH 1XR8A 3QUXD 2LU3A 4MXVE 2CLZB 2DICA 4MD5B 1NCWH 4NN5B 2VLRE 3PL6B 3EGSA 4ZUUA 4JB9L 4JR9H 5CHNB 4OZFH 2FECI 4HWNA 1GAFH 4PJDA 4YEEA 2P5EB 5C0EA 5E2VH 1KENH 2UV3A 5ESAA 3GIZL 5DJCB 2DIAA 2P5WE 4GT7A 4WHTB 1EGJH 3QEHB 3VFTB 1DQQA 5C09A 2KUTA 3M17B 4JJ5B 4OQTL 4WTXA 4FMFA 2I5YL 3ZKSD 3GMNA 4P59L 3BD3A 5I76B 4OD1H 2MJWA 5D7IE 3REWA 1NDGA 2G5RA 2MKLC 2P8MB 3TBVA 3QIUD 1HDMB 3HPLA 4Q9QH 2DWEA 1XR9A 1M7DA 4ZQKB 5DRWB 1ONQA 3T04D 3QPXL 4AG4H 1G7MB 1YC7A 3W0WB 1RUAH 25C8H 5HJ3A 5JPMB 1MCWM 1NKOA 1TNNA 4LOUD 5C0FB 3ULVC 4E9LA 5HYQB 3PWUB 1BEYL 3O2DH 4I2XB 1N64L 1N5YL 4HWEL 3HZVB 3KPSE 1RFDH 3MLYL 4XP9L 4EBQL 2CDGA 3QDMA 4WU7B 2ZUTA 2V2WB 3LCYA 4WDIA 4O02H 1YY8A 4HWZB 2DAVA 2F54B 2YUXA 4GRLA 4DVBB 1CGSH 3KXFB 3IXTB 3MLZH 5F88B 1LO2H 4R0LB 2CLVB 1F8TL 2LV4A 3RWHB 4YE4H 2HH0H 3I6KA 5DHVA 3QPQC 4L8SC 3NCEB 2R29H 1VFAB 4MQTB 2HFFA 2ZOLA 3G9AB 1VB9A 1AGBA 1JTTA 2Q7YB 4RZCA 2ZKHH 3L5WA 1MJ7L 5I66A 1D9KC 2VDNL 4OI9A 1QLFB 3ARGB 1F90L 3B8YA 2WP3T 4AMKL 1BJ1J 4MCZA 1XIWD 3Q48A 1JJUA 1ADQA 2F74B 2GSIA 3WD5H 3BKYH 5HGBB 1EO8H 2QHRL 1O7SA 5D8JL 4DWHA 4CMHB 1ZTXH 2BNQD 4PGDA 3D0VA 4MJ6B 4YAQB 5DK3A 4M5YH 4NIKB 2A77H 4ZO7A 4HZLB 2GCYA 3MTRA 3WFDH 2NY4D 4PJHB 4FQCH 3V6FA 2DMCA 4M6OL 3TT3L 4KKLC 4XB8A 5C0CD 4M9OA 1G1CA 1C5DA 1T2QH 4FQ1H 1MIEL 4YQXH 1MIML 3VXUB 4Y16C 4BQCA 3GO1H 2CGRH 3MPCA 4TUJA 3DXAD 2PF6A 1IGCL 5M95B 3QR2A 4Z7NF 3DRQA 1KB9J 4P2QD 5EA0H 1KF9B 4KMLB 4NBZB 2P1YA 3MLSH 3GSQA 3P9MA 4Y19D 4MZ2A 1C5BL 3QQ3A 1ZKAA 3MRHB 3FZUD 2Y72A 4IRJA 2F5AL 5ALBH 2FRGP 3BEVB 1UQSA 4HMDA 4MXWL 1QQDB 4J4PA 4ODVH 2NXYB 3QA3B 4GG6B 3OKEB 3WUWB 2F53D 3BYYA 1HXYA 3MJGX 3MRRB 1T03H 1OF2B 5C8JA 5C3LD 5JR1L 1R3KB 3GUTA 3BESR 2BNQE 2GK0A 2VLJB 1I8KB 4NGHH 2YD1A 3S37H 4UBDC 5J0BA 4L5FL 2W65A 2IPTL 4EQ3A 3NAAH 4ZO8A 5HD8C 1F42A 5D7JB 5J13B 1VEOA 4POZC 4LARH 3GSRB 3MQIA 4N5EC 1FAIL 4PRHA 4U05A 3P9WB 1Q1JL 2X4PA 2Z35A 5C0CE 4IRZL 3QNXB 2FL5B 2EXWC 3MXVL 4IOIB 4X9GA 4LHUA 1QACA 1EEYA 1MCKA 4PJGB 3RIFK 1LP9E 1OB1A 1HK6A 4Z76B 3DXAE 4WRLA 3PDOB 3Q3GA 4D0DB 2DTSA 4L29B 2R1YA 3FOMA 1A47A 1YMHB 4QF1A 3VRJA 4P2QE 5DMGD 3H3KA 3MROA 4Z7UB 3VD5A 4G8GB 3ETBF 3NGBB 1EHAA 1E4XI 4KAQH 4X98B 3W81A 3O0RL 3MBEC 2EC9U 4Y19E 2ADGA 3UJJL 1VGEH 4PJ9B 4Y4KC 3JTSB 5EOTB 1DLHB 3OJDB 1UKTA 3H7BA 3RFZC 4KRPD 1PX4A 2V6HA 1P6AB 4U6YA 2DRUA 3DO7A 2JJTC 2F53E 3A6CL 4F37K 1VFUA 2NQCA 4Y5XA 4P3WA 3W9DB 3WFCL 1I9IL 5ALCH 4QRSB 4RX4D 1F4AA 2A6DA 2XZAH 4F2MB 1A9EB 4AEHH 3MRCA 3BZ4A 4Y4HD 5A2LH 1I3GH 3FQUB 4MAYD 4HT1L 3BGFC 2XA8H 5EWIL 4RRPG 3JVGA 4YLQT 2W38A 1D5IL 4XP1L 2NR6D 3OPZL 4JR9L 1MWAA 4GXUN 1IAIL 3FQXB 1L6XA 2EDOA 3E2HC 2UZIL 4RIRA 3WIHL 4OCMC 5I74C 5D93B 2M1KA 3OAUL 3HR6A 3QUZB 5ICZB 3S36L 5IEKA 5DD3H 1NC4B 4FQXB 2DIJA 3FOLA 4YBLC 2A9NH 4P46D 1FG9C 4RFEA 1A2YA 1NL0H 3P4MA 2BMKA 1V7MH 3BPOC 3PP4L 1W8NA 4HG4J 4Q9QL 3BZFA 3CC5B 4MJ4A 4NYLA 3C08H 2LQRA 4BSVA 4K3DH 4O4YH 3AREA 4NO0B 4Z7OE 1QO3A 1OHQA 2XTJC 5J1TC 3LIZL 3IU3A 4ZAKB 4G9FB 3W9EB 2FB4L 5JW4N 1YYMH 5FV1L 1T1ZB 1X44A 1IM9A 5K9QG 4HC1H 3KYNA 4RMQA 1QRNA 1PQZB 1FE8L 3G6JA 4X9FA 1W0VA 3HE6C 5KSAD 2YA0A 1A6ZB 4PJCF 1S9WB 3STZB 1CGSL 1J8HD 5FM4A 3F62A 2FHCA 1LO2L 2JJVA 3EJYC 4FZEH 5KG9B 1QPPA 4GG8A 3GJFB 1SY6A 3WXVH 5D7LA 2J5LB 4HKZA 5FOBA 5C9KA 3BX7C 3EZ8A 5I17A 1URLA 1V05A 4YR6B 1KB5L 1CDBA 1WTGT 4CVXB 1J05B 5F9OH 4V2CB 1HINL 1YJDH 1U95B 1QPXA 2BNRD 5IF0A 2FATL 1N8ZA 1DVFC 2LU7A 3LOWA 2Q3AA 3AUVA 4PPTA 4RFOH 5JQ6L 3IXAB 1PYWB 3CZFB 3WSQL 5HVFB 3BKYL 3UJTH 4KC3B 2W92A 2XWTA 5DMYA 3HPJB 2Q76A 4BFIB 3G6DL 4JFOA 4PGJA 4LLDB 4YIQB 5JW4Q 3H3BC 2VDML 2KZWA 3ESVF 5FGCE 5IHUL 2F8OA 3CDFA 4OZHA 1WAAF 4EDXB 1A1NA 1D6VL 3QWRA 5C0DA 1CI5A 4Y5VC 3ARDA 1AO7A 2X4TA 1NLDH 1AI1H 4HCRL 3DURB 1C5CH 1J8HE 2FZ3B 4ZOAA 5MEPB 5HPMB 3K7UA 1TETH 5J1AB 2P4AB 1YUHA 1KIRA 4M7ZB 1YQ2A 3F65A 3ZDXF 1ZHNA 2X10A 3O8XC 4P5TC 3MNWB 3IRPX 4DGVH 4W6WB 3C5SA 5DJ8B 4F7CA 4OFVA 3L6FB 2I25N 4OZIE 3K2MC 3F6IA 3OXRB 1I7TA 3QUKA 2BNRE 4EVNB 3BQUA 1JI2A 5IGXL 35C8L 2QQKH 1ITBB 5GPRA 5LGHH 3RGHA 1QHPA 3VGFA 1RK0A 1OTTD 4MX7B 1T03L 2F5BH 4R9HA 2VLLA 3CFCH 3ECBA 4TSCH 5KSBB 4X4MA 2MCG1 4UIKL 2AJXH 2IGFL 2WSKA 2DYPD 2OCFD 2WW8A 5E8NB 4NKMA 3S37L 4PJ8B 4MMZC 2PO6C 2HJKB 1HH9A 2I07A 4NBYB 5JOPD 4ZS7H 4BYHA 2UVFA 4AENA 4R7DB 1J0ZA 4HF5L 5C70A 3LRGA 3RY5A 1BOGA 4YX2L 2X4SB 5SV3A 4PJIF 4PRBB 4UQ3B 3KPOA 3O6LL 3TP4A 1V3LA 3QPQD 5CCKH 3DGGB 3BDBA 1JBJA 5IMMA 4ZFFB 4PUBH 5F44A 1LO0H 3S96A 1FBIH 1T0PB 5J9PB 4TTGA 4HJJH 2AQ2A 3X3GH 1HYSC 1DBBL 1P84K 4UTAL 1YDPA 1V7NL 1MHHA 5F9DC 3DROB 3B9KB 1NCAH 1D9KD 5C2UB 1QSFA 2B8OT 1PZ5A 4F3FB 1ES0A 4E41D 1S5IL 4LCYB 2IMMA 3BI9X 4J12A 5DRZB 1HEZA 5I1CL 1IQDB 2X89A 3Q6GL 5CJQL 4HFWA 2FECL 1B0RA 4JFED 4JN1H 2IMNA 4XNQB 5I71B 3ULVE 4PJDF 5ALCL 1PG7L 2G60H 1H8NA 2VTFA 1KTDB 1PJ9A 5H8DA 3CMOH 2W0KA 2OI9B 4S1QH 4OFIA 3FRPG 1ZVYA 4JE4B 1HQ4B 5D2LA 4KKLD 1XF5B 5JOPE 1J0KA 5D2NC 3W11C 3VH8A 3DNKA 4X4YB 2YD4A 1FLRH 3RGVB 4OD3L 1MAKA 3FQTB 5IW6B 4JKLA 4Y16D 1QSEB 4X6CE 4UINH 3HAEH 1TCRA 4XVUC 1AKJB 1ZE3C 1MFDH 2R0WH 2YC1B 5E2UH 1AY1H 1JGUH 2YPLA 1A1MA 2NY1C 3G04B 1F4XL 4JKPH 3PDGA 5FUOL 1YYLL 4QHLA 2IH1A 5H35B 5CD5D 1IEAB 3QIWA 3DUSA 4I8DA 2QSCH 4BQ8A 4A6YA 1H8SA 2CJUL 1HSAB 1JPST 3VW3L 4OAWB 4OGXH 1ZVSB 3RVUC 1WWAX 3ILQD 1WFTA 2CRYA 2ZUUA 3P0VH 5L8LB 2GW5A 1A6UH 1VSCA 5ESVB 4QY8B 4XCEA 1IFHL 5IMKB 3D85A 2HRLA 4JFEE 1T04B 2A1WH 5DSCA 3MGOA 5BOZG 3K4AA 2HRPH 3AXLA 3BEWB 3L95A 3OG4B 4LHQB 4UBDD 3WXWL 3RUGA 5HD8D 1IKFH 1EJOL 5D5MA 4BZ2L 4LSRH 4V1DB 5BRZD 2Q8BH 5E8PA 1FPTL 4N5ED 3KPRD 3UO1L 2Y9RT 5BV7C 3S4SB 3MRGB 4ZSOB 5HBBA 2EXWD 1BFVH 5D1XA 5C07E 3VFUB 2W0FA 5FO7B 4OCWH 4OLEA 3GJFK 2GY5A 4Q6IC 4P3DB 2NZ9C 4N90D 4KPHL 3QXDB 5KVEH 1Q9LA 2ZUWA 4X7TA 2VDLL 3P2TA 1C12A 2CRZA 2V7NA 3IFNH 2YEZB 5EU6D 5EULV 3OGOE 4GQ9L 1IC4L 2D7TH 2C7UB 1S7UB 3GNML 3HI1A 4YDKL 4I48B 3MBED 1X5ZA 4MYWB 1HZHH 4ZPTB 5E2WH 4Y4KD 5DHVH 5F72S 2OM5A 1KLUA 4Z7QE 1M7XA 4JGUA 5FYJD 5IJVB 1J0JA 5I1LB 3LN5B 2AK1H 5CP3H 1UYWH 4HFUH 3EYVA 1G6RH 5AWNL 4P3CL 4JO1L 4XCNA 4JFZL 4AQ1B 4MJID 3SDCC 1Z0MA 4M1DH 2DI8A 3UJTL 4Q9RL 2DQEH 3BZDA 1MQ8A 3T4YB 3G5ZA 3P4OB 4ONGL 2FX9H 5EO9B 3B3IB 2NY0B 1IM3B 3NFPB 1FQ9C 3OMZA 2A9MH 5D7IA 5JMRA 4KDWA 5BRZE 3KPRE 1LD9B 4DW2H 5HXMA 5I19L 3EO0A 4QYOB 1U58A 1AXTH 1QFOA 3CX5K 5EIIA 3QSKB 3CSYB 4PJ5B 1WZ1L 1HI6A 4N90E 3UX9B 3JTTB 43CAA 2CQVA 4Y1AD 4JDTL 3SQOH 4XPFL 4CJ1A 3L7EA 5EU6E 2ICES 2OR7A 3HZMB 2UWEA 1RIVH 5DQ9B 4NNYB 6FABH 3WNLA 2VDOL 4PGZA 3C2SA 3HI5H 4N1EA 4UOW1 4YC2B 5EDXA 2ENSA 1OAYH 5FYJE 4XNMA 2HAZA 3AM8A 2HTLC 3W82A 3SE8H 5L6YH 2XNAA 2QQKL 3MRQB 5EIQA 5TE6H 1RZ7H 4GSDH 4RMUA 1HQRB 1CDIA 3F5WB 5DD1H 1EAPB 4BH7A 3KPQA 2XTJD 1OTSC 4TSCL 1JPGB 5ESQB 2AJXL 1CT8B 4S2SA 3IDMA 5GZOC 2EYSA 2XXMB 1FORH 5F97E 4LU5L 4JFFB 4HUUB 4ZUVB 5JHDE 3HE6D 2H6PB 2P7TB 1NGQL 4FTVD 4ZODA 4QXWA 4K9EH 1LO5A 1LO3L 3LKQA 1ORQA 4NRXA 1PG7W 2WUCH 4WI4A 3DUUB 3EJYD 2VUYA 3MJ9A 3JV6A 3WDIA 4PRAA 5FA4A 5SX4H 4G5ZL 2DM2A 1VA9A 2HTKC 4KMTH 3L3GB 2JLLA 3CIQA 1UKSA 4X6FA 3QHTC 5IVXE 3L3JA 3UTPE 1SJEA 1NCAL 2KBGA 3SGEI 4M03A 1DVFD 4OLYL 5E70A 4JHZA 5E0QA 4FQJL 3P40A 3LKSA 5F1NA 2OS7A 5J12B 3EO1A 4RQQB 2AK4A 5DD6B 1CXLA 1U91B 5D6CB 1KG0A 1H9VA 3GFUA 2XTJE 4LCWA 4HS3A 4NWTH 3ZE0F 1MCJA 4P5KA 5BW7A 3BUYB 1BM3H 3CMOL 3NN8B 3KR3L 2AERT 4Q2ZA 2VAAA 2E7MA 2PKDA 1ZT4B 5CJBA 3IDGA 1DBJH 1J0IA 4BJLA 4TRPL 5T1DL 3TC9A 4NQEB 3SDAC 1Q0YH 3NCJH 4YDJA 1IMHC 1I8LC 1P7KA 5DK2A 3ZSTA 1BP3B 4RWYH 3F12B 4OLWL 2R0WL 3O8XD 1JUFB 4P5TD 2APBA 4AEEA 3CJJA 1FVEB 4ORGA 4I3SL 2B4CC 3VXNB 3ZKXB 3QCUH 3GSUB 1TZIB 3U9PL 5B38G 1CICA 3A6BL 4HIEB 3GKWH 1FNGB 3OXSA 3G9VA 3P0VL 1J11A 3JWNC 2MQ0A 5E6IA 3G6JF 3WL9B 1YNTB 5I18H 2C26A 1NBYB 3MRFA 4JQVC 3V52H 3O3AB 3PQYE 5LJYH 2PO6D 4BK5A 4R7NA 1CVRA 2H26B 2FX7L 2Q8BL 3UEZA 3MX0A 3VXRB 3CLEL 2HFTA 5C0GB 3NFSL 3H9ZA 4ONHA 3RWCB 2VABB 1N6VA 3VWKA 4MNQD 1KCSH 4X6EB 2X05A 4FFYH 2CLZA 3VGDA 4LPWA 4MD5A 3V6OC 4QTHB 3TVMC 1AQDA 5HDBF 4H8WL 4K7PY 3V9FA 5CHNA 1QA9A 4TULH 1QFHA 3O41B 4W4NA 2WWKO 1HYSD 4OJFH 4KHXL 2EDYA 1PSKH 3VI4E 4PLKC 3PWJA 4LLYA 5E2WL 3OGCB 5KSUA 3BP7B 4NQCB 1JWMB 3QEHA 4P23C 1QR1B 4K7PL 3CK0L 4JN2A 5TDPB 5H37H 4OUOA 4ODTL 4U6TA 4NQTA 4OZHF 4EJ1C 2LVEA 1H3WM 3MACH 1UYWL 3ZYZA 5SWZD 3UTSA 3LKRB 1HKLH 1MEXH 5IBTH 1HDMA 1YEFH 4RGMC 2DQEL 2VLRB 3FFDB 4G6AD 3PGFH 5AZ2H 4ZDHA 1XZ0B 3MMEA 3IVKA 3VFOB 5JPMA 5DRXA 1ADQL 5HYQA 3PWUA 4WNQA 4JVPA 5C2BH 2CKBA 2P5WB 4XX1E 3HZVA 2AJSL 5GRXG 3RWFB 3W11D 1OT1A 3WFHB 4DKEL 2JB5H 5IESL 1KV3A 4JLRB 1EERB 2HN7B 4DZ8B 2OL3A 3UPRA 2GI7A 4XVUD 1DZBA 2JJUA 1FN4B 5H2BB 3QEQB 2A6IB 3RY6A 2ARJQ 2NY1D 3KXFA 5F88A 4R0LA 3SQOL 4JO4L 4KUCD 4U6HB 5FM8A 7CGTA 1I8MB 3KJ4C 4I3RL 5IKCA 1SYSA 5TE4L 1R24B 3SE3A 1DL7L 1ZT7B 4WW1B 3P4LA 4JO3L 1CFSA 3MRNB 3WJLC 2OYPA 5I8EA 5T1MB 5E8DH 1FCGA 3KPSB 4EN3A 5E4EC 4MA3A 1DJSA 4Y0GA 1QG3A 1RZ7L 5SWZE 4XP4H 3QUXB 5FYJU 4H5SB 3U7AA 4GRWF 4JPVH 3TPUB 2A73B 2QQNH 2NCMA 4AL8H 2V5YA 3X13B 1U3ZA 2V7HA 4DZBB 5ITFA 2IH3B 2ORBL 2AKRA 3LB6C 4POYA 2HFEB 2D0GA 1Y18A 2MCPH 5D2NE 2Z31C 3D2UD 5C0AA 3U0WL 4Z5RB 5DEZA 5FUZH 1FC2D 3QXVA 5D96B 4K9EL 5F7WC 3B2VL 2NZ9D 3QUYC 4FQ2L 3LRHA 3RL2B 3DV6B 3SKOB 2FD6H 3QIUB 4H88H 5GSVA 2AGJH 4GRWH 4JQIL 1IKNA 2Z4QB 5DD0H 3BIAX 3KPPB 3H42H 1ZHBB 1LVEA 1DEDA 5JXEC 5E4IA 1EHLH 4HXAH 2WK2A 2WUBH 5BXFB 4UZGA 4E42B 1K6QH 4NCDA 5D2LF 2AS5M 3MRHA 2YBRB 2VH5H 1OW0C 3SDCD 2EEBA 2RGSA 5ADPH 3FJTA 1GC1L 5EOCH 4D3CH 1F3DJ 2DDQL 4OKDA 1ZGLA 4GG6A 3OKEA 2WAHA 4JFXB 4NDMA 1RHHB 1LEIA 2DOCA 1HH6A 3DX8A 2XQBH 4R3SB 3F7YB 3TBYB 4OD2B 1CD1A 1R3KA 2A6JB 4MLSA 3O11B 2VXTH 1NMBL 1IEHA 3VWJA 3A0OA 3K2UH 2VLJA 3BPLB 4QOKA 2VZTA 3BDYH 1TMCB 4XCFL 2IBZY 4L9LC 1LK3H 2APVA 3D3VD 1F58L 2I26N 5D1ZC 4S1DD 4WW2B 4WWKC 3HG1D 5CBEA 4Z7VB 4HWUA 3K3QA 1R6VA 3FN3A 2W9DL 4TSAL 4J3VA 4YK4B 5HHPA 4UNTA 1JGVL 1MCIA 3QNXA 3TCLA 4XMPH 4JG1L 1MWAL 1NBQA 3ZDYE 4PJGA 4N9GA 2CIIA 1ED3A 1XIWB 1AC6A 1WBZA 5E5MA 4D0DA 4ELMA 4UQ2B 5SWSD 3SKUD 5BVJB 1M7IA 3IFOB 1VERA 5D5MF 2A6KA 2E7BA 3PV7A 2HTLD 2BNQB 4X98A 3G5YA 2BDNH 1W2KT 1YEGL 3LKPB 4NN7B 2P24B 4HUWB 2GTWB 2NY4B 4A6YH 3OJDA 4OCLC 3OB0K 1OTSD 2N1KA 2ERJC 4Q9CA 5T1KA 1LDPL 1DP0A 2G5BA 5C0CB 2JCCF 3RRQA 3RWJA 5GZOD 2BNUA 1UM4L 1GRWA 4HSQA 3M8OL 3MLTA 4GO6B 3V7AE 2E8ZA 4XBPA 1LP9B 2F9BT 3O2WL 5E7FA 4Z0XA 1XGUB 3DXAB 3T09A 5KTEH 1A9EA 5C6PB 5K59E 1OCWH 2EDEA 3D3VE 3FQUA 5F6HJ 2Y07H 4IRSC 4P2QB 3V4PL 3WDHA 3SBWA 4OZFG 3CFKA 2HYMA 3JWDH 4TVPE 4JRXA 3T0BA 4Y19B 1YZZA 5GGQH 2NXZC 1XFPA 5B39G 3MV8A 1NUNB 4Q7DA 3FQXA 1UH2A 2HTKD 4GJTB 2EKJA 5CJXC 5ICZA 1MQKH 2F53B 3LDBB 1KPVA 3ZDZE 3RHWF 4OSUL 3MLXL 2VQ1B 2DJUA 2R2EB 3QDJE 4QHUB 5EFIA 4UIMB 1SY6L 1WBXA 3RIAF 4NC2B 5I1JL 4L1DA 1I3VA 1VACA 4WVRA 4PG2A 3MREA 1FFPA 3E8UH 5EUOA 4RBPH 2JIXD 4JFYA 5MEOB 3CDGB 2AQ3A 3QEGL 4PG9A 1JMZA 2FJFA 4OI8A 1KCUH 2XZQL 43C9A 2Q6WA 2WIIB 3OB8A 2UWEF 1AFVH 4X0KB 4JY4A 1R3LB 1HXMA 8FABA 2HVJB 2PYEE 2CSPA 3SDAD 2BHUA 4KVNH 4OZ4A 5F9WC 3PV6B 1DFBL 4PB0L 1PQZA 3SGJC 4K94H 2DWDA 4HX1B 4ZOCA 5FIEA 4WJ5A 1AD9B 1I7UA 1NLBL 5MI0C 2VE6A 2AXFB 2NY3C 2WMPA 1DN2A 4KRPB 1TVHA 3VXQB 5IBUB 1J5OH 4LLUA 1IAKA 1ZLVH 4MQXD 4XMKH 5LAXB 3VGHA 3TNNB 3MUHL 3NIGF 4YR6A 3IJSB 2AJ3A 3R1GL 2WQRA 5EC1B 1F4WH 3MRPA 2D7NA 3GKZA 4Y4HB 2AP2A 4NM8H 1U3JA 1QKZH 2DL9A 4LKCB 1BZQK 4AM0A 5ACLA 3L7FB 2QQNL 3VE0A 3NVQA 3VGGA 2JELL 5C0RH 4F7MA 3GMPB 3P77A 4GOSA 1DTUA 3DSNA 3E1F1 1SVZA 2CMRH 3RQ3A 3CCHB 3NFNA 2RQ8A 5T1LA 3TVMD 4P46B 2IAMD 1U3HA 4DFHA 5F7DB 2QADC 1OOAA 4X7SH 4QT5A 2VZUA 2W9EL 4R90H 3IDXH 2VR5A 4NKIL 4S0TD 1J87A 1SM3L 2FZ3A 2ZG3A 1EZVY 5HPMA 1LEKB 4PLKD 3GJEB 4WIQA 2VC2H 2XWJA 3H42L 1VEMA 4OGYH 2R56L 3BSZH 2DM3A 4P23D 1PX3A 2OJZH 3MNWA 4L4VD 3KDMB 4Z8FH 3PNWB 4FXLA 1WWWX 2BX5A 3VU2A 1U6AH 5FGCB 3TH4T 5I16B 1MUJA 4JPIA 2FH6A 3QBTB 4FXGB 4NUJB 4O58H 3T3ME 2O5YL 3GGWA 3LMJH 3C09B 5EOCL 2FIKA 5AYUH 1IT9L 3T77A 2R23B 4U6VH 5GSRA 5HHVL 1T1YB 1UM6H 5KSAB 5DJDA 1FC1A 2XQBL 5HYSG 3RWDB 1YQVH 2YPKB 1J8HB 1JL8A 3BAEL 5CSZB 4RMVA 3VXTA 4EQ2A 3QQNA 4F33B 5E8NA 3CVHA 5DLML 2AXGA 4U1JA 5A40E 4KK6C 1KIQA 1ZV5A 2E7LA 4KQ3L 1MSPA 3EDJA 1DEEA 3V6OE 4OZIB 4ZUTB 3GMQB 2DMBA 3EDFA 1CZ8L 3TWCH 4P4KC 5DTFA 4PRBA 1UENA 3WJJC 3DVNA 3QUMH 1U8PB 1A6TA 1YA5A 3VFVB 2MQ3A 3W2DL 4NM4L 1ZS8A 4NJAH 4L4VE 1OM3H 3SOBH 4ONOA 2VXUL 3DROA 5IB5B 3KLSA 1L0QA 1NGXA 3K1DA 3OV6A 3U82B 5DRZA 1CGVA 2DQHL 1OSZB 5D9SB 3ROLA 3TV3H 1IQDA 3FT4B 4GS7C 5MEQB 2ZNXA 2EYTA 3LB6D 3OZ9L 1CR9L 3EOBB 3OR6B 4XNQA 2P46B 5J4MA 4NHCL 4DK3A 1FDLH 4WHCA 2Z31D 2Z9TA 4KJYB 5L9DH 4JFPB 2EC9T 3GIVB 5DMIL 4RNRA 1H3UA 3FO0H 4XNYL 3S88L 2YWZA 3SDYL 5DMKB 5FM5M 3FONA 5DHYB 3QUYD 5B4MD 1T7VA 2AVGA 5FYKH 2GY7B 1Q9KB 3CSBA 4QHKJ 5GGQL 5E1AB 5L0QB 1FNLA 1ZT1B 3FB5A 1S9YB 3RU8L 3QRGH 4BZYA 4LNRB 3KLHC 3E3QC 4LAQL 5EZIL 3D5OF 3TJEL 3PGCB 4PRNA 4DKFL 4WHDA 5E00B 1KPUA 4MNHA 1K3ZA 1VFOA 3FMGL 1BZ7A 4PJEB 5MP6L 3MRJB 4ZTPH 1P4BH 1TDQA 2DYPB 1MH5B 3TN0C 3RNQB 4N0YH 1HSAA 4U1HB 3SGDI 3NPZB 2BC4A 5GGRY 5L7XL 2WZPD 1MVUA 1I1RA 5ESVA 2QBWA 2ZJSH 2HA1A 2EEAA 3B2UC 5FGBA 3SE4C 1JPSH 4X6CB 5IMKA 5JNYA 1T04A 2H32A 3U4BH 3BOVA 3KNBB 4M7KH 3BRFA 4L8SB 5KANI 1QBAA 3LHPH 3RVVC 1AFVL 1NH6A 1YECL 1EMTL 4XXCC 1ZHKA 4FXKB 1RUKL 4GKZB 5GS0H 4WWKD 1BVLB 4D8PB 2G2RA 1CFQA 4XH2B 1QYGH 4X7DC 5F71A 1A6WL 3MRGA 4PREA 4ZSOA 2CKBH 5K9OA 3ZLQC 3TO4A 1D9KB 3UTZB 3OKOB 1EBPA 5FO7A 1EAJA 4E41B 5E56A 1CVSC 2IQAA 4RMWA 3QFDB 4ZXBC 1FH5L 1OP5K 1JHTA 4AZ8A 1HHJA 4LIQH 1T83A 1INDH 5KJRH 1SEBB 4PJXB 1J5OL 4XVTH 1WC7A 4JFEB 2AI0L 1R5IB 3IDIB 1S7UA 4IDLA 5IB2B 2RB8A 1R0AL 2GJ6D 2EIZB 2DLIA 2X40A 1X4YA 3Q5TA 1EUTA 4PJHF 2XTLA 4W6YB 1FFNA 1T0NA 3P4NB 2Z91A 4BFGA 1OPGL 2J3SA 4Y16B 3VMPA 2GJJA 5C6TH 4OLXL 2WBJA 1PEZA 5KW9L 2FYYA 5LCVH 1IM3A 1BBDH 1IZKA 1NBZA 4HKJA 4YHZH 3F58H 3OKKA 1JPTL 2UY6A 4UTBL 3TO2B 1CU4L 4IRSD 2C3HA 1K5NB 1TLKA 3HZKA 5J6GB 4RRPA 3SEPA 4EI5A 1MI5D 1SEQH 3H0TA 4P9MH 3WS6C 4KJQC 4QYOA 1CL7I 4PY7B 5I1DA 1V5JA 4X6BA 3R8QA 1BWWA 4F9LA 4OUUA 4GG6F 2GYSA 1UKQA 1AHWA 3MJ9L 3ZYIA 3MBXH 4JZJB 4KXZH 2OJZL 4DUVA 4Z8FL 4UDTB 5I1GH 1LK2A 1V3JA 2NMSA 1LEGB 1TJIL 4NJ9L 5DJAB 3BMVA 1BZ9A 3RDTC 4YXHH 3FO2B 3L5XH 1INQA 1FL5A 3PJSB 3O3UN 4GW4A 3KPRB 5DUBB 4KTEH 1LNUB 3QI9A 3BPCA 4U6VL 4M4RA 2W60B 1HQRA 4OGAC 3QXAB 1EAPA 3OF6D 1DDHB 2E8YA 3AAZB 1KBGH 4D9RD 1B9ZA 1L7IH 2X4UB 1YQVL 1U2CA 3U48A 2X7LB 4HIIB 4CW1B 3OAZK 4PJGF 5ESQA 5KVMC 1RZGB 1EA9C 1C1EL 3U9UB 5JZ7C 2Z93A 4ERSH 3MBEB 4M61A 4ZUVA 2AEPH 4XPBL 1MI5E 4Y4KB 3T3PF 3QZWG 1P4LB 3E0GA 1IGJA 2NY3D 2GIYA 4XNUH 4K8RH 5HHQA 1OARH 1R3HB 3L3DA 4MJIB 3AS1A 1I1FA 1WUNT 4K7PX 3K0WA 2GJZB 4OF5A 4HIJB 3ZMRA 3N9GH 3VFRB 5JUEH 1DQDL 3BGFB 1S9XB 1KJMA 2GSGB 2R4RL 1DQJA 3MV9D 4PTUA 5JHLL 5I1KH 1HWHB 4YDVB 4IMLA 5I1EH 4ZD3L 2HFGH 2DQCH 3HE7A 1QFUH 2ESVA 3U6RB 4XMLL 3E2HB 4YZFE 1U91A 5I74B 1HE7A 3RL1B 5IBLC 1RU9H 4NP4L 2P49B 4NC1C 2E6QA 4ZO6A 2X44D 5J11C 3ZL4L 4Y1AB 1JRHH 4OV6F 4YBLB 1PVHA 3FO0L 3U79A 1E4WL 2WWKT 1N2RA 5IVXB 2QADD 1AJ7L 2DQUH 4HUXA 5FKPB 2WNGA 1IC5H 3BPOB 3O4LA 1YEKL 2IG2H 4QXTA 3DYMA 3QG6B 4NQEA 4HAGA 3UBXG 3QRGL 1I75A 5HGHA 4P2RB 3EOAA 2MQCA 5FDWB 1RZKH 1S7RB 3WIIL 1INEH 1IBGH 3OHXA 2AEIT 3C9NA 2XTJB 2VL5A 4K2UL 3VCLB 4QHMB 3EDEA 3V5HA 4MXQC 5JA9A 4JRYD 1PY4A 2Y23A 4ZUSA 5FAAA 3BXNB 3QEUB 4KUZL 1N4XH 3GSUA 4WHYH 2CUMA 1U3YA 4NKDB 4KGJA 2AJZB 4XWOC 5E95B 1DBKL 4G9DB 2DS4A 3HMWL 2Q20A 4H20H 3HE6B 2FBJH 2ZJSL 4FTVB 4NO5B 4MVBD 3U4BL 4KTDH 7FABH 4M7KL 2QR0A 5IFHH 5I1HH 5KVFH 4MD4A 4KK6D 5KSVA 2AEWA 3ZYJA 2EDBA 2AJVH 2X1PA 3OX8A 4KV5F 1KT2B 1DQML 3K8LA 4NZTH 1NGZB 1ZHLB 4XP5L 3WFEH 5IJKA 2VABA 2CKBL 1LE9B 4OM0H 3V79C 2BSRB 1KCRL 4P4KD 4AH2B 2Q3ZA 4PJAE 1DVFB 4KQ4H 2Y5TB 1G7LA 2H3NA 1JTPA 2AJUH 2YN5A 2OL3L 1INDL 2E27L 5KJRL 4XVTL 3TZVA 4LCIH 5TE7H 4HHAB 2X4OA 1U93A 1CQKA 5CD3A 4JRYE 2PN5A 1ACZA 5TDPA 2AABH 3JWOH 2D7OA 2ATKB 4DKDC 3MCLH 1S9VA 4Y5VB 4PV9B 1KJ3L 1WFOA 2R0KH 1CLOL 1FG2B 2NZIA 3FFDA 1QSZA 3LY6A 4HQQL 5FHBH 1XZ0A 2FGWH 3BPNC 3VFOA 4U6XB 2VQTA 3O8XB 4B41A 1NC2D 4P5TB 3NZHL 1NCUA 3FRPA 3BDXA 4UILH 5C7XH 5CP7A 3RWFA 4PJFE 4ONFL 3U4EB 1SEQL 3C2AL 4HMCA 4FQQB 3CSGA 1D5BB 2HN7A 5F70A 4GBXC 5GGUA 1LDSA 3KLHD 1TJGL 4LSQL 5IQ7L 3RNKB 3EUUA 3QEQA 3MA9L 2R1XB 1PLGH 4U0RC 3EW3B 3WO4C 1GJIA 4U6HA 5HDOA 3IDJB 5KSBF 2HG5A 4QRPD 5TQ0H 4XBGA 1R24A 3HC4H 4WW1A 2ZSVB 1BIHA 1MFCH 1P1ZA 2HMIC 1J12A 3AY4C 4PGEA 2VLKA 5DUMH 3VXOA 1NAMB 2D03H 4FS0A 1WF5A 3B2UD 4MNQB 3EYSH 1BJ8A 4Y4FC 1HCFX 1S7VA 3ZTNL 4PJ7A 2C4XA 1FHGA 1KBGL 3LV3A 3A67H 1L7IL 3MFFB 3QNZB 2APTA 3RVVD 4QRQB 3WEXB 4NN6C 3VI3F 5EBGA 4ELKA 3VFSA 3U1SL 1A7NH 4X8JA 3I75B 3C8KA 1RZJL 2X4NB 1EFQA 1R5WA 4ZFOL 4NSKB 5M94B 5TQ2L 1D7FA 3T1FB 3EO9L 3RBSA 3HUJB 1MNUL 4QGTA 3E3QE 5FA3A 4C55A 2F58H 5ENWA 4NCC2 4XAWH 2GK2A 3IJYB 5C9JB 5SWZB 4UV4H 4NKQB 4LEOB 5GGVH 3FN0H 2YMXL 3QQ4A 4GAJL 4AQOA 3DX9B 5LGKA 3VMOA 2J6EA 1RURH 3BJ91 4U1LB 1P4IL 1EX0A 2BOCB 2P8LB 1T5WA 4QRPE 1NGYB 2DJ4A 5HVGB 4P4RB 3DSFH 1HILB 1EO7A 3V2AR 2XG5A 3UTQB 4X99A 4AY0A 5D2NB 4JM2A 5I1EL 3J7HA 3MV7E 2DQCL 1T89A 5IB1B 1Q94B 1QFUL 3B5HA 5FCUH 3NTCH 1A1OA 2K7QA 5ILTL 3LN4B 1IVLA 3STLB 2VDPH 4JFXA 5BZDA 4NZRL 3HNTH 1RU9L 3QNYB 1E6JH 2R2BA 1N7MH 2A6JA 1P53A 2NY1B 3V95A 3O11A 4KHTL 5LQBH 4NZDA 3HC0A 1DSFH 1G6VK 1N0XH 2DQIL 3PF2A 4RSVA 3LQAH 4S1SH 4GRLC 4KJQD 2BXYA 2IC2A 3MUJA 4M43H 4NFDA 3LEXA 4Z7VA 1Q72H 4EZMA 4J8RB 3PABB 3ULVL 1QP1A 1INEL 4P99A 1YNKH 5KAQF 1CXKA 5TF1L 4U1KA 3RA7L 4U1SA 4HKXB 1XGTA 3IU4H 4UQ2A 2YZ1A 3UAJC 3RDTD 3IFOA 5CUSH 1KJ2B 1S9KC 1ZLWK 5HVWA 3L9RA 1N4XL 5BV7B 3OKNB 5JLZB 4KGLA 5E9DD 2MHAB 1JHLH 3U0PA 2XN9D 2FJHB 3D2UB 5I15H 2P24A 4JHAL 4U3XA 4H20L 2YKLH 3JUYA 2FX8L 4D2NA 3GRWA 4PRID 2O61A 1KULA 2ATPB 4KTDL 3TFKD 5IFHL 5I1HL 1KN4H 2X4QB 4FA8A 5JZ7D 2VQUA 3EFDH 3L3OA 4TOYL 4BH8A 3SDXE 3U2SB 5DJZB 4YHKH 1MFEL 2HKHL 3R0NA 3WFEL 4UDUA 3GM8A 5GGTA 3CUPB 5E8EB 3EFFB 3DYPA 1XMWA 3QO0B 4TPRL 3R06A 4WUKH 1CS6A 4R4FH 4QHNB 4GKNA 3D25A 2FJGB 2VOTA 2OJEA 2O5ZL 3WLBA 3MO1A 2PTTB 3SDCB 1HHGA 3UDWC 2BERA 4LCIL 5FYLH 2NPLX 1NEZA 4IRJC 1UVQB 5F7EL 3QFJA 2N4IA