2DDQL

Crystal structure of the fab fragment of a r310 antibody complexed with (r)-hne-histidine adduct
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
218
structure length
218
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords R310 antibody heavy chain
publication title Bispecific abs against modified protein and DNA with oxidized lipids
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 49
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2006-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ddqL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ddqL01
1SJHB 5C08E 1F3DJ 2DQFB 5IG7A 4HS3B 5E8NB 2NY3D 5DRXA 5T1DH 4BJLA 4DW2H 3IDJA 3K4ZA 4X7SH 4ZFFB 4ZMAT 4R4BA 3SDAA 1IM9B 2P47B 3O0RL 3LQMA 5JHDB 1ZLUH 4K8RD 5C9JA 2DQJH 3GHEL 5IBLD 2FJHB 3TN0B 3ES6B 4GKOA 3TJEH 3MLSL 5I18H 1MRDH 4HC1H 2VDPL 2W9EH 1BEYL 5E2TH 1HQRB 5FV1L 5F1OB 4F7CA 3RWFB 3L3KB 4NZJA 4OZGA 5F7MC 4LHUD 4DKEL 5EH1A 2HRPL 2R69L 5K9QI 1MLBA 1L0XA 1T66C 1ZT7B 2HT3D 3SGDH 1ADQL 5I76B 1DQJA 3VG9C 1K8IA 1JYXA 3ZHKA 3AXLA 3ULUF 3AB0C 4ZFGL 3KLSA 3QNZB 1MCPH 1TJIL 3LQZB 5JXEC 4LDEB 1I8KA 3O45B 3KS0H 4IEFB 2UWEE 3EDDA 4W81A 3BUYA 1T22B 2FDBP 3MV8D 3GGWA 4QRRA 1A7NL 3JXAA 4L5FL 2QQKL 3F62A 1RJLB 1TCRB 2J12B 3PGFH 1G9MC 1K8DA 1PKQB 1OSPH 4LU5H 1I9EA 2CMRH 5I1EL 1JPTL 4JFOA 2CIIA 2DM3A 3H3PH 3VFVA 5E5MB 3TA3D 3O3EA 3MA9H 4NQCD 1G7QB 4PJ7A 4UINH 5HI5D 1YPZA 4UBDD 2AK1H 2FSEB 3EGSB 1YNLH 3L95B 4Z7WF 4H8WC 1V3LA 1JZ2A 2AABH 3RZCB 2X4NB 1QA9A 3DROA 4KROD 3NPSB 4IIQA 5EU7E 1AQDA 3A67H 4LLWA 4X6CF 3LS5H 5D7LD 5FYLH 5KSUB 4LPWA 1S78C 2Q20A 1R0AL 1U8PB 2AXGB 2RGSA 4B5EA 2QADC 4O9HL 4LASL 2Z93B 3HRPA 5JUEH 2AXFA 3WIIH 5D9SA 4WFGD 1KLUB 5HI4D 3RY4A 5C3LD 4WUUE 3VXTA 3WUWG 4OF0A 1PBYA 5T1LB 2H2SD 1NGQL 4JHAL 4YQXH 4I1NB 1BOGA 4PRIB 3F7YA 3AM8A 4EDWL 5KZCB 1GGCH 3OB8A 3QUXD 3SDYL 3GI8L 4O2EA 3EHBC 3H9SB 4NZTL 4B41A 8FABB 3V9FA 4JEGB 1JGUH 3CDCA 4I3SL 3QXVA 3T08A 4FA8A 4XP9L 3T0AA 5ITBL 3CX2A 4P57B 5F7KC 2FH8A 4I77L 1N3NA 1CE6A 1QRNA 3R1GL 4X9BA 4CVZB 4Y1AA 3RA7H 1F6LL 4E41B 1J0HA 5I1KH 3CDFA 1CE1L 1I8LC 2JJTC 2QEJA 4I48B 3TZVD 3KWWA 1N0XH 4DKFH 4X6FB 2YRLA 1NAML 5H35B 1FZMA 1CGXA 1U8JA 4PLKD 1SYSB 3MFFA 3QISA 5C0DB 1FLRL 2VSCA 3VRIA 1HHJA 4Y4KB 4NQXB 1QD0A 2BXZA 1JGVH 1AP2A 5IMOA 5HYIA 4ODTL 5FYJL 5KOVC 4J2XA 1FFRA 4PJEA 1FL6B 1ES0A 4PJGA 3T2NH 3B9KD 3AGVA 3A6CL 2K9UA 4YHYB 3V7AE 5B4MD 2ICWB 5CGTA 1HHIA 4HWEL 2F19L 5IEHB 1KC5L 5E00B 1S7RB 1NBVH 1S7UA 1AQKH 1U8QA 1RUMH 1QFPA 5KS9E 5IVXF 4J4PD 1P84K 4JG1H 4NJ9L 4MA7H 4DZ8A 4D0CA 4GW4B 4UTBL 3VA2C 1YZZA 3GRWL 3MA7A 4FXKA 3WDIA 1JTOA 3PNWB 5CEXA 3TGXA 1TVBA 2DBLL 3BKCH 3U46B 5B3JF 1JF6A 1JFQH 4L8BA 3CMGA 5TQ2L 2EECA 1NGWB 5CGYD 2ORBH 5J6HA 2Y36L 1M05B 3HE6D 3I6GB 1F6AA 4UAOB 4M62L 5JDJA 2I5YL 4N0FA 5FYJE 1G84A 4A6YA 1DUZA 4OTXL 3LHPH 1G7PB 5E03A 4G5ZH 2R9HD 5GRUL 3O81A 4C58B 4K7PY 4LHUG 5HVFB 2FHFA 4XVTL 4QXUL 4S11A 2YXFA 3OAUL 1D6VL 2DD8H 3Q5YA 4EI5C 1WBZA 2XRAH 4HG4J 1CK0L 1EPFA 3LSOB 3PJSA 2R0ZL 4TSAL 3DGGB 1VESA 3TPUB 3VFTA 5HHQA 4I0PB 2BOCB 1T0PB 3B2VL 4L8SB 5MHSE 3BZDA 4WW2A 2Z9TA 2DQEL 4MQXD 4JFEA 4JRYB 1FN4A 2A6IA 2BSTA 4MCZA 3ZE2F 3P0VH 2MCPL 5CZVH 3QO1A 4KTEH 5DT1H 4CAGA 4E0RB 4MNHA 3UPRA 5EU6B 3EYFA 2VDLH 1NFDB 3MGOB 1IMHC 3HE7B 4U0QB 2FX8L 3L5HA 4ODXA 1CI5A 1B2WL 2DKSA 3CU1A 4P4RB 5D7JC 1N7ML 4XCNA 4J3TA 4N0YH 4JPIA 1J11A 3V6BR 2HT4C 1IT9H 3P9LA 4UQ3B 1W72H 5TDNB 3U30B 3U0WH 1RZKC 3DX7B 4UNVA 4M5YL 5JOPE 1JNLL 4X98A 1CGTA 5CEYB 4JR9H 4YWGH 3NACH 1BD2D 5JMOC 1ZA6A 1D5ZB 4WUUB 4PJFE 3D87B 1OAZL 3UYPA 1BFVH 4YDVA 2GSIB 4UV4H 1MJ7H 5MERB 5EO1A 4K71B 4NC2B 3SO3B 5J4MA 1Z0MA 5CKGA 2IPTH 2VL4A 3HMWL 4LHQB 4HWUA 1YEDB 3QXWA 5EZIH 1NC4B 5LXGL 4OUUA 3BWUC 2DTML 4DUVA 3FMGL 1IFHL 1U0QA 1EFQA 2C3GA 3BEVA 5ITFA 2YRZA 2NNAB 4LCCC 4P46A 3GMQB 3ARBB 1KYOJ 1HKLH 1INEL 1J18A 3WO3B 3KLAB 3QIUC 5HI3D 3HR5A 4YDKH 1QBAA 1UWXH 4G7YH 2A77H 2VAAA 4ODUA 5JR1H 5K9JH 1IKNA 3GKZA 3L3JA 2DAVA 5T5NF 1LP9A 5EBLB 3Q3GA 1KG0B 1TJHL 3FB6B 3CFDB 4Q9CA 3UTTA 2F74A 2VERN 2H9GA 3T0EB 5DDHA 1N8ZB 4C54A 2GJ6D 1IQDB 3IF1B 4DEPB 1EX0A 1Q38A 4FQHB 3BH9B 3ALPA 4DGYL 5JLZB 5GRVK 1G9MH 3KPNB 4P2QA 1KFAH 4OZGF 5AWNL 3SKUD 2W60A 1TMCB 2BVOA 1GPOL 5KS9B 1NLDL 4WNQB 3HCVA 5HHOE 3T65A 2CLVA 2VH5L 4QRTB 5D1XB 3ARYA 4PGCA 2NX5E 3QG7L 2R4SH 4FFYH 1YQVH 4AENA 3TT3L 3RL2A 3TBSB 3IFOA 3C8KB 3S4SB 4AL8L 1X5GA 1AD9A 3O2WL 2NY0D 4CVXB 1DSFH 4GT7A 3QIBB 3ZKXB 5DMGD 4HV8A 4XMPH 5JIIA 5E8DL 3EFFA 4M03A 3V6FB 4YBLB 4HS8H 2MTPA 3M17B 5FYKL 3BXNB 4XCCH 3F5WA 4KK9C 4M48H 4C56E 3U0TB 3SKJL 3MV7D 1PJ9A 3FT4A 1I8IA 3MRRA 1CD1A 3BPCB 4NHCH 2NXYB 4HJJL 1G1CA 4PJ7F 3NFSL 3R0MA 1YPZF 3I9GH 3SDDC 3TESA 3WL9A 1FPTL 2IANE 2KQMA 1LEIB 1G7IB 2MKLC 4PG9A 4P2RD 4ZUTA 3MMEB 1P4IL 3T04D 4X4YB 3KPOB 4HK3J 4YHIB 3LV3B 3IFPA 1PG7H 3NFNB 4JLRB 3IVKA 4NWUL 4LDLB 3DXAD 1J8HD 5ACZA 4V1DB 3DVNA 1BM3L 3HS0B 3WFCL 1AHWA 1HNGA 2DQIL 5F88A 4NNYB 1PW3A 2ESVE 1O7VA 2XTLA 2RB8A 3UEZA 4MMXC 4U3HA 1YA5A 4HGMA 4QHLB 5IB4B 1MPAL 2WBKA 4B7IA 1P2CA 4DOHE 2BNRD 3PP4H 4UQ2B 3WUWA 4YLQT 1SMOA 1A6PA 4JPVH 2EEAA 2C1OB 5DJCB 2F53D 2V5SA 4Z6AT 2CH8A 2CDGB 2JJWA 5F9WB 3WFEL 5A40E 5K9QG 2CO6B 2FEEI 3S5LB 2D7OA 3DHJA 4JM2F 1J1OL 1UXWA 1BX2A 5EOQL 3LQAH 4F9PC 2YRPA 4RBPK 4IRJA 1YYLL 2FJFB 1P9MC 3K2MC 5EA0H 3BP7B 2P8LA 4NDMB 5KG9A 4OLXL 5D5MB 1HYSC 2AK4D 4ONFL 1IEBB 2X42A 4X6DA 3BDXA 1T66D 4Y5XB 3CLFH 2Z31B 2VXSH 4XAKE 1PG7W 3X3GH 3TVMC 1ORQB 4PJEF 4PJGF 3WHXA 4EOWL 2AJUH 4LFHD 1HXMA 5DS8B 5K9KA 3MQIA 5I16A 5JORA 5JXED 3BKJL 2OSLB 3MYZA 4Y5VC 3LN5B 2Y7QB 2NY6B 1PX3A 5GSRA 4QYOB 1E28B 1F2XK 2HAZA 3DBXA 1YUHB 3GMOA 4FFWC 1FL3A 3HFML 4MJ2A 3U36B 2ZCHH 1GIGL 4MDIB 4PV9A 4AG4H 4RISL 1FGNH 5L2KB 1FZKB 1OSZB 2DICA 3ROLA 2XWJA 4S0SD 1ZOXA 1NFIA 5I1DA 1GZQB 1S78D 4MD5A 3GSNH 1A4JA 3N06B 2QADD 1EHXA 1DLHA 4NNXA 1KPUB 1K4DB 1TZGL 2Q86B 4PJIB 3DRQB 5E6IC 2LFGA 2AEPL 4K94C 2KQNA 4XHQA 3SKMA 4PTUB 4XNUL 4IMLB 3OJDB 2FJGB 4U1LB 3QEGH 4YHMH 1U2HA 4LHUA 1S5HA 5DA0B 2GT9A 2DN7A 3PHOA 3QDJE 1DUYB 1Q1JH 1VFBB 4J3UA 3EHBD 2JB5L 4WW2F 4XBPB 5GS1A 1UZ8B 5CS7A 1TJGH 5DUBA 1T80A 3VXRB 1SHMA 1IKFL 4P23D 1RUPL 3VXMB 3H42L 2VDKH 5DJAA 3U83A 2BRRL 1WBXA 1DDHA 5DC4B 3RX7A 2DB8A 4HXAH 2ZUTA 1GYAA 1IGTB 4MQTB 4E9LA 3HZKB 1GOHA 2IANB 2V17H 3C2AL 2HTKC 5FCSH 3MUJA 4HHAB 2UYLA 3QXDA 3MV8A 3FB5B 3O6LL 1X3DA 3TNNA 3QUMH 1DANT 2LVEA 1KCVL 4S1RL 4YX2L 1Q9LA 2IFFH 3TA3A 3WNNA 4NQCA 3MRCB 2WINB 2O5ZH 3WIHH 2PW1A 2P42B 3TN0C 1XT5A 2X4PB 3HC0A 1T0NA 4P9HC 4L4TE 4NYLB 1KCSL 4XPGL 1AJ7L 2VQTA 1A14H 4NQDB 1EO8H 5D7LA 4DOHB 4AEIL 4A2MA 1RURH 4LCYB 1T5XA 3S96B 4BQ9A 5HJ3A 2ZSWB 4X4XA 1A6WL 2HMIC 4ODWB 1F58H 1EMTH 1NGZB 1ONQB 3U79A 3DUUA 2GKIA 3O3BA 2ZSVB 2D7NA 3VRLF 4EIZC 3QRFM 5TQ0L 2VXQH 1A2YB 5FO9A 3CH1A 3VGFA 5I17B 2HFFA 1JZ4A 1IGJB 4DTGL 5C0RL 2M1KA 4RSVA 3SE9H 4YPGA 1BZ9B 2FYYB 4JZNB 2FBJH 3ZE1F 2FZ3A 1YN6A 3QUXA 5IMMA 1JWUA 4Z78B 2P5WD 3MR9A 1QFOA 1LP9F 1UGNA 1FVEA 1WZ1L 4J23A 2MHAA 3CSYB 5GRWA 1UXSA 2R1YB 2ZOLB 1SYVA 1A1NB 3EO9H 4X6EB 2PN5A 3UC0L 4N5EC 3QI9B 3PXHA 3N0PB 3D18B 4TVPL 4EI5D 2GTWA 2K7PA 5J1AA 2E27L 3LIZH 5TE6L 5E8PB 4NM8L 3TZVA 1H9VA 1NKRA 2WAHA 4NZRH 4ZQKB 4HWZA 4X6CE 5C7XL 1XH3B 3DTXB 4L29B 5F6HI 4MD0A 4LFHG 3VJ6A 4WTZG 3MZGB 2W38A 4DVRL 4PJ5B 2ZCLH 4WFFD 4G6JL 4F3FA 1QFUH 4WWID 5TF1L 2SEBB 4N8CH 4P3CL 2VKXA 2XQBL 3U4BH 3VFUA 3B9KA 4XNZB 5J3HC 4WV1A 4D0DB 3DSFL 3BVNA 4KV5F 4GRWF 1NL0H 1T0MA 3TIDB 4QTIL 3VI4E 5GJTL 4Y4FB 5BS0E 4Z7VB 1PX4A 5D7JD 1XGRA 4IOIA 4WI6A 4H1LG 4LSQH 5AUMA 2HT4D 2N7AA 2QHLA 3OAYH 4J4PA 2ATPB 4L1HA 3UTPD 2AEIT 3BZ4B 3LH2H 4TVPE 1OTUC 3MRQB 3CVHH 3RUGE 1RVFH 1MCLA 1WBYA 4WCYL 3ZDXE 5HHNA 4XCFL 1DBKL 3QNXA 4M4RA 1T04A 4OD3H 5DUML 4GG6B 5IEKA 3I6KA 3FQRA 3HE6A 4JFYA 2GUOA 1G9NL 4PRPD 4U1JB 4F7MB 3D69A 5E6YA 5B39G 1D6EB 5HYQB 4OLVL 2UY7A 4KZDH 1XZ0A 5KSBE 1S7QB 1NBYA 3MLVL 3H0TB 4YZFE 1CFVH 3LPGA 4FXGB 1AGEB 3QIUD 1CICB 5BJTB 5C0NC 4YHYC 2UUDH 4Z18A 3VXPB 1I3RA 1T2XA 1IVLA 1XGYL 4XB7A 2X4TB 4K9EC 4BKLB 5T3ZD 4F8TA 3LMJH 5J13B 2Z91B 5IVXE 3STLB 2UZYB 4TUOA 3CC5A 4M7KH 4HGKC 3VGGA 1HHHA 5EOCL 2EYTA 3B6SB 3O11A 4Z7UA 2PNDA 4FQJL 4GMSL 5DFWH 4MNGE 4ODSL 3QQ4A 3TC9A 5DURB 4GAYA 5IBUB 1B0RA 2OQJA 1N6UA 4R0LB 5J0BA 4TSCL 4PYGA 4NZDA 5HHPB 1HQ4B 1A9EA 2HG5B 3DHMA 1ND0A 5TE7L 4KI1A 1WC7B 1MAJA 1V05A 1JWSA 4L3EB 3H9HB 4X6DF 1MSPA 3KR3H 4TQEH 3RPIB 3VXNB 5C09B 3QDGB 1Z9OA 2X70B 4P5MB 5IVOA 1BD2A 4OGXL 5JZ7C 2XOTA 1MCKA 1R5WB 1S9VB 3CD4A 4G7VH 2FX7L 1VFAB 2BNQE 5F7DB 5F7NC 2UZIL 2ZG1A 4TUJB 1FZOB 1A3LH 3LKPA 1RZGB 4NQVA 3RWJA 2HFEA 1H8NA 5CJBA 5BV7L 5HPOA 4PR5A 3S88H 3MNWB 4KK9D 4MJ6B 2GTZA 3JTSA 3C60B 3ZKQD 4MJIB 2A9ML 3QJFA 4MA1B 4X6BA 3ZE2E 3NH7H 4KGLA 2IC2A 3KLHC 2R8SH 3QUZC 4ELMA 3TYGL 4RGNE 1K4CA 4DK6A 1G7MA 4OF8A 3PV6B 1B0GA 3B5GA 3TLRA 2WSKA 5IWLA 4LPCA 5LCVL 1INQA 4HWBA 3HE7C 4RCAA 2BOBA 1NMCB 1PY4A 5JW4R 2MQCA 5EU7C 3P0GB 2AXHA 3MV9B 3KNBB 5GGUA 1PFCA 2B2XH 5BVPL 1HZHL 3SDCB 2GJ6A 2J88L 2NW2B 4XP6L 4B0MM 2YD9A 2ZOKB 3LB6C 5D72H 4JKPL 3HNSH 5BS0B 3JV0A 2B4CH 3SO3C 4FMFA 1VGEL 1KN2L 3T3MF 3RNKA 4IMKA 4Q97A 3CVHB 3FN3A 4N9GB 4X9HA 3W81A 4QHKI 4FQXB 5I19L 4U1GB 2X4SB 5IFHH 2OJZH 2NTFB 4PJDB 1S7SA 1A6UH 4MB5A 5EUKA 4ZYKA 1DVFC 3RUGB 1DLFH 1JHTB 4ZDHA 4FTVE 1OP3H 4OM1L 1U3HA 4XXCC 5IFAL 4K2UL 1BVKA 5DSCB 1JPSH 5CJOH 1QYGH 4BZ2H 5HHVL 5T5FH 1C5CH 4XAWH 3RI5F 3D48R 1MVUB 1I3GL 3NOIA 1FH5L 4G8GE 5CINL 2HN7A 1HYSD 3GB7A 5EFIA 2D9QB 4D2NA 5I1JH 2DDQH 1ZGLA 1KTKE 2ENSA 4WO4B 1EIBA 4WEBL 1T20B 4K7PX 4HULB 1WFNA 3MBXL 3MV7A 2UY6A 3W9EB 1D5IH 4KK5C 4KKAC 3TVMD 4XGZA 1FNGA 1RUQH 1VEOA 5DR5H 2XWBA 5E2VH 1S7VA 5KSBB 3T0EC 1JN6B 2YPLE 3EOBA 4LSDA 3FHQA 4PJ9C 4DEPC 4JQVA 2A6KB 4L8DA 4NUGL 1ZA3A 2FH6A 2ADGB 2Y07H 1UWXK 4PJAB 5LGHL 3QFJE 2XZAL 4YUEH 1CF8L 3FT2A 3X13B 2E6JA 4LLQB 5ILTH 4L8CB 5EU4A 3U2SA 3WXVL 4P3DA 1SJVA 4FFWD 2YUXA 4KVNH 2EDJA 1J8HA 3DXAA 5F1IB 3JVGA 4XZUB 4FQCL 4JDVA 4XCEA 1C7TA 3GIVB 4BH7B 1CL7L 5ISZB 2XY2A 4G43A 4MNGB 5I1HL 1MCWM 1KTLB 4XNQB 1XIWB 1UQSB 4HGWA 2UVFA 3SY0A 5F3HB 1FG2A 5DRNB 3GUTA 4MSWA 1KEGH 4F57L 3PF2A 4NNPH 1F4XL 2BNRA 3QIBC 1ZEAH 5E99L 1GAFH 4AMKL 3HZVA 3JWNC 3P4NA 2W91A 2F53A 3DETC 2DMKA 1UYWL 5I1AA 1MVFA 4Z0BL 4S1QH 1YEGH 5E6ID 3IS1X 2E7LC 3T4YB 3M8OH 5JOFA 4PJ7E 1UM5L 4X83A 3TT1H 1BVLA 3VXQA 3CX5K 3OGOE 4XH2A 2NXYC 3CNKA 3FFCB 5E4EB 5ID0B 3HUJB 5E2UH 5GGTL 3RY5A 1F90H 2F58H 3NN8B 1D5XB 2Z8VC 5FYJU 2AK4A 2OL3A 1JIBA 3GMMA 2YK1L 1I3UA 3AS0A 1CG9A 3KPPB 5BOZG 4M7ZB 3WJJC 1DBBL 1UACL 1HDMB 4LLVB 1OT2A 1FSKB 2IWGA 4H20H 4XBEH 4K7PL 4X99A 3THMH 2BCKA 1ZGLP 4UT7H 1A4KA 1URLA 4HBCL 4WTZA 3GMNB 5JXEA 3F58L 2L0DA 4LP4A 5EUOE 2ICEA 1LDPL 4F7TB 2HTKD 1DN0A 3M07A 1YC7A 4Q74A 2YSSA 3QHTC 4KMTL 4HCRL 3G08A 4YH6A 4UTAH 4QO1A 4R8WL 4NCC2 2B1AL 4H1LA 4YIQB 3O4LE 4URTB 1JHLH 1IM9D 4GUPA 2BY1A 1QRNE 5F9WC 2A0LC 4Y1AE 2XNAB 4W6YB 3QCUL 5DLMH 2VDNH 2D7TH 2PKDA 3TN0D 4I9WD 2CUHA 5AAWA 1MAMH 4HIHA 1NQBA 5SWSB 2J4WL 3O6KH 1KJVA 4NUJA 5CLTA 5C6WH 1QP1A 5DXWA 3MO1B 2R1XB 3MRMA 2HMID 1TQCB 3DO3A 2IMMA 1W0VB 4Y2OA 5EZJB 5HHMB 5J89A 2BVTA 5SWZD 2IAMC 4Y0GA 3MRBA 4PBXA 1MFAH 1NCAL 3SJVB 5ALBL 2L7JA 3I75B 4FTVB 4LKXA 3LD8C 5MP6H 4QGYA 4Q6IB 4NKIL 2ZCKH 4QGTA 1V7NH 3MXVH 4MQ7B 1LK2A 5EN2A 2A6DB 4Q0XH 1E6OH 4LF3A 2F54E 4GBXB 3G5YB 4PRDB 5F8RC 4A2LA 5AYQA 3RTQB 1OL0A 4EVNB 4OLYL 4OCYL 4O51B 5DRZB 4D0BB 4Z7UF 1X9QA 4JAMA 2ADJB 4M61A 4N5ED 4L9LB 4HIXH 5E95B 3I6LE 1OARL 1I8LA 2JJTA 4U1NA 4ZO6A 1UA6H 2VXUL 1KTDA 1TPXB 5FO8B 2ADIA 5I8EB 5IR1A 1M7IB 3OKDB 5HDLA 4NGHL 1VFOA 3QFJB 2F5AH 2K1MA 3WFHA 1PZ5A 1FO0L 1J1PH 1K3IA 1PGRB 2A6JB 2BMKA 3MREB 3V4PL 3D25B 3RWGA 4LCWD 1GGBL 5J3HD 4MX7B 2OJEB 2R69H 3VXUE 4PV8A 5JO5B 1IE5A 2DOCA 1U58A 1IRAY 3BO8A 5DD6A 3ULSA 1KIPB 4LAQL 4E42A 3ZLQC 3W5MA 2ZJSH 4KXZI 4U6XA 4X8JA 1GC1L 3CK0H 1G7JB 3QH3A 3ARWA 2QSQA 4PRID 3C6SB 5HY9A 1RK0B 4YGVA 3OXSA 2VIRB 3SN6N 2UV3A 5KZCD 1TJIH 1QFWL 2VB5A 1SJEB 3MRNA 3H9SD 4TVSa 4PRAA 1OTUD 4WDIB 2W0FB 4ELMF 5BQ7A 2JLLA 2QL1A 3VXSD 3BH8B 4G9FB 5C0BA 3OR6B 4XPTH 2GY5A 3DURB 2EXYC 5IHZA 2DQUL 1CDJA 5IGXL 3HZYB 2LU7A 2P5WA 3VD5A 4JREB 4N8PA 5DEFB 3G6JB 1TLKA 5JW4M 2XKNB 3ZT6A 3HHRB 3KPRD 3FQWA 2D03H 2N56A 4CU6A 3MRIA 1QVOB 2AGJH 4EI5A 2GAZA 2AKRB 2RJMA 5C0ND 5L0QB 1IQWH 3I2CL 1G9EA 1YEJL 1VADA 4MB3A 1Q72L 4RRPG 5C08D 1T03H 4S2SB 1MQKH 4KXZH 2Z8SA 5ESQB 3C5ZB 1M6OA 4EBQH 4JHAH 1MUJB 2BSED 3O4LB 5KVGL 1UJTA 4EDWH 1QBLL 4ZFZA 3DSNA 5F6HJ 1QEWB 2L4OA 4JKWA 4UILL 3SDYH 3GI8H 1J0ZA 4DN4L 4NWTL 3PHQA 4NZTH 5FYKU 3NIGE 4G6FB 5HDQH 5D7JA 5FOJA 5ECJE 3BISA 3S7GA 3N1QC 4X7TA 4OFVA 3LKOB 1BOYA 1XEDA 4APQB 1JGLL 1OWWA 4OZFH 3DMMB 1JGDA 3BIKA 4FOMA 4QTHB 2FNBA 3P4OB 5C0FB 3AU1B 3UTTE 1L7TH 8CGTA 1FJ1B 1KTRL 1KIUA 4OLZH 1RZIB 5JZ7D 3DUHA 3QXAA 3I02B 5E9DB 3F7QA 4OCXH 2EZ0C 3L3GB 2KPNA 1CDHA 3WLWC 2NY7L 1FLRH 4Z7OE 4ORZC 4P2QE 1XF5B 5GRJH 4ODTH 5FA3A 4PRPA 2EYSA 3QDMA 3U4AA 1OLLA 2PYFA 4TTDD 3RHWK 4HSQA 4X80L 4POUB 7FABH 3RY6A 5F1NB 2X05A 3G5ZB 2XN9E 5B8CB 1KC5H 2XA8H 5CCKH 4JFFE 3KLHD 1AR1C 3EAKA 3FFDA 3QUZD 4LEOA 3MOAL 3VH8B 1ZVSA 3P0YL 2VXVH 3Q0HA 5GRYA 4LCCA 5D2NB 1T1ZB 2EDTA 2FD6L 5ENWB 5ADOL 4DUWA 4PBWD 1KSRA 3QIUA 2COQA 1U91A 4UUJB 3MJ9L 2J8OA 4ZPTA 3NCJL 4FP8L 3TM6A 1WAAE 3CVIL 2HJKB 1RZJL 4YDIL 1LILA 3IGAA 4M6OL 5E7BA 1BVZA 3S3SA 5IHUL 2IALB 4Q2ZA 4XCYB 5DJ0A 1G6RL 4GMTL 5TQ2H 5EBMA 5CLWA 5T1MA 3FB7A 5AYUL 43CAA 4DZBB 4YFDB 3WFDH 2DLIA 1KBGH 1FCGA 2BJMH 4KQ3L 5EORL 2Z35A 4J6RL 3EYSH 4P2OB 3GHBL 1AY1L 3VXUB 5H2BB 3GMLB 3LB6D 3VFMB 3QRGL 4OTXH 1LO0L 4WUUD 3N1MC 4P59H 1K5NA 4LLYA 5IHLB 1A3RL 2OR8A 3FN0L 3MUHL 3W39A 3OAYK 3U1SL 1FYTE 2H26B 5IUSA 1L4IA 2QQNL 1S7WB 3HC3H 4KY1H 1EFXB 1NC4D 2R0ZH 4OLWH 1ZHNA 4TSAH 2AJXL 3JWOC 1MHEA 4HEME 1DVFD 3GSWB 4NCDA 4ONHB 1H15B 5FUOL 3QAZC 3QSKB 3VGAC 2YKLH 1HYRC 4IOFC 4WWKB 3FOLB 4HX1B 1LO4L 3BN3B 1BHGA 1HH9A 5MEOB 1FFQA 1GVIA 4IRSC 2YUWA 1Y6KR 1CN4A 4CNIA 5I75B 1D9KC 4HIEA 1OGAE 2YBRB 3ZDYE 5D2LE 2EC9U 3LEXA 1NEZG 3QA3A 3ZYIA 1ZLVH 4KMLB 5GS2D 5DQJA 4ZOBA 2Z92B 4OGZA 4KK5D 4KKAD 4OD1L 4R26H 3O8XD 2NTSP 4XB8A 3SDDA 3OKOA 5IBTL 2WLZA 3UAJC 4M5YH 2X44D 4PJ9D 2QSCH 3QCTH 4LCUA 4P5KA 4I13B 4GKNA 4NHUA 4G8IB 3WCYA 5DVOA 4DJMA 5DWUL 1I1AB 1OAKL 5IW1B 4LRNH 4RAVB 4NC1E 1KJMA 5CMAB 2ITDB 4NM4H 4UB0H 4PYHA 1M71B 3OG6B 3GBNL 4K8RL 3T0VA 5DA4A 3HMWH 4MAYC 3PWNA 3CUPA 4CN4A 4RWYL 5LXGH 1BLNA 1LNUA 4G80A 4P9ML 1IL1B 4OZFB 3WHE0 2AS5M 4OAWB 4BQCA 3RVWC 1I7RB 2CXKA 1KIRA 4Y19E 1TTFA 1INEH 3O2VH 4MA8L 3K46A 2R2CA 4LLUA 4G6AC 3WD5L 5FYJD 5KN5B 3D5OF 4F9PA 4LSTL 5B38B 5K33A 4CMMA 1P9MA 2FATL 4HXBH 2X2YA 3O6FB 2DQHH 3C9NA 4PB0H 1U8HA 5D71H 1IAKA 1AGDB 1HNFA 1TJHH 2NXYD 3CFIC 4QHKJ 3D85D 1C7SA 4PJCA 2PO6C 5DJZB 4G6ML 3LAFA 2HWZL 1KT2B 1M7DB 3IJSB 6CGTA 4U7SA 2WV3A 3J8F7 1FP5A 1A9BB 1MNUL 1NMCC 5KVEH 2GHWB 3IXAA 1AGCA 2XN9B 4LLMB 3RKDD 2BSSA 1R3KB 1Q9WA 4U1MA 3VD4A 2V9QA 5MHSD 1IC1A 3TVMA 2JE8A 2YOCA 1LO5B 4OI9A 3BW9A 2VH5H 5F89B 4ZAKC 4BQBA 1RJYA 3QG6B 3QCVL 4GG8A 4WTXA 5FHAH 4Y5VA 2JKXA 3OR7A 1MWAH 5DK2A 3TT3H 4WENB 5KAQG 2AJZA 3PABB 4AL8H 3DI3B 1RUAH 3EO1A 4HLZG 4WIQA 1ETZA 3FT3B 5TDPB 3X3FL 4R96B 5DC0A 3Q5TA 5JOPD 2A0LD 3BRFA 3TV3H 2I07A 2WWMC 3KPTA 1IC7H 3GO1L 2X7LA 2P24A 4FQLL 4AT6A 5FYKH 1FFPA 3X12A 4LL9A 2P7TA 4KK6C 2BVQB 3L7FA 3OB0K 3RVXC 3PWVA 5EU5B 4JFDE 4RNRA 1OF2B 2P44B 2WBJB 3DGCR 4XI5C 3NFSH 3KJ6H 1FYTB 1FPTH 1K2DB 1KB5H 3MLXL 2QKIB 4Z76A 5E6IA 2R15A 3GMRA 4Y2DB 4F7PA 4JPWH 2IAMD 2YN5A 2DM4A 4LSPH 4PRNA 4UT9H 1OP3K 2GW5A 5LJYH 1RZ8A 3IAPA 1VERA 3GBML 3Q1SL 2CLZB 4LPUA 2HFGH 4NWUH 1MEXL 5DGQA 1G6RB 2DQIH 4GKSB 1H3VA 2NY5H 1ODAA 5C0AB 4C55A 2HLAA 5D6CA 5D2LB 5DJYA 3UCRA 4KPHH 2NW3A 1CFQB 1YN7A 4PREA 4RRPA 4Z0XA 1ZVYA 3PHSA 3IDGB 3MLYL 1ZT4A 2V5RA 4M7LT 3BE1L 1ZGLM 3ECBB 1H3XA 1A0QL 4DUXA 4U6YB 4RFNB 5D8JH 1OGTB 1SJHA 4JCLA 5DK0B 4Y16B 3EO0B 4HS3A 5ID1B 5EOQH 1FLTX 3CDYA 2AJYL 4KZEH 4GAJH 1YYLH 1JPST 4Y88A 4PB9H 3CFEB 5HHOD 4YEEA 4BSWA 2V7NB 1IM9A 1A5FL 3V7AG 2C4XA 1REIA 3LZFL 5SV3A 2NX5D 3MJGX 2P8PA 2QR0A 4ONFH 2FJHA 3TN0A 4LEXH 3W9DB 4M00A 5DVLA 5DHVB 1WCBB 2GCYA 5JHLH 2RCSH 3REWB 1HI6B 5E4EC 3ZKMC 4XC1H 4G9DB 4HUMB 3RWFA 3X11A 3L3KA 1WTGT 1CZ8L 2PYEE 5TFSH 1OCWH 5GISL 5DVMA 4S10A 4GAGL 4JCMA 1ITCA 4HKXB 3KPSB 1ZT7A 5I66B 3TF7C 3Q5OA 3STZA 5I76A 3RJQB 3S98A 4C56D 1FSKC 1O5DT 4KRPC 1OM3L 2ARWA 1MRCL 2E7HA 4PLJC 5LBSL 1BECA 4RGNC 2EXYD 1JZ6A 3AVEA 4GRMA 5T33L 4OZ4A 4HW6A 35C8L 1A7OH 2H32H 2VRAA 2IAND 1PD6A 2HKHH 3QHFH 5DMYA 4R90L 2DLHA 3KYMB 1P4BH 3U9PL 1KV3A 4KI5E 1UM4H 3U7WL 3WFBH 5C86A 3AMKA 4GAFB 3S36L 2YWYA 3EYUL 5CD3A 1M7XA 3QQ3A 3FKUS 4NSKA 1BQHG 1TQBB 5E5MA 1S9KC 4Z77B 1G7QA 2BXYA 2ESVD 3MRPB 5IB5B 2FSEA 3EGSA 2C4FU 1TZGH 1AI1L 4GW5A 2X4NA 1EEYB 3PWJB 4LCIH 5BV7C 4G42A 5KSUA 1I4FB 5GS0L 1DTUA 1JHKL 1NMBH 1WGOA 1U8PA 1IAOB 5F9AC 4RMSA 4LCWA 1QQDB 1TQCC 3QPXL 3U9UB 4MJ4A 5DMIL 5BZDA 2HKFH 4ZD3H 3M1BB 1C8PA 4I0KA 4S1SL 2V9TA 2VLJB 4WI4A 4CADB 1GGUA 4PS4L 1Q94B 4Q6IC 2VC2L 2FL5B 4WI3A 1JUFB 1KB5B 1P6AB 4PRIA 2YPKA 3H42H 2GK2A 4FG6C 1YDPA 1X5HA 4GBXC 1X7QB 4UIMA 2XA3A 1CR9H 1D7FA 2DI8A 3H9SA 1IM3A 3ULUH 2CDEB 4FNLL 5IP4A 3C2AH 3VXSA 4XAKD 3VI3F 1T6VN 1T21A 4E5XB 2EZ0D 4P57A 5L6YL 4L9LC 2AV7B 3WLWD 4TSBL 2BHZA 3RWCA 3S37X 3EZ8A 2VLME 2A74B 4HUVB 4YX2H 1VDGA 3TYFB 4HJ0C 3IU4L 1TPXC 4I48A 3C09B 1EJOL 5EIQA 2EICA 4HWBL 1BWMA 3WSQH 2OTUA 4HK3N 1HSBB 3V52L 3CSPA 1QHOA 1KCSH 2A9NH 5H35A 2R1WB 1SYSA 3KPRA 3MJ6A 5ANMB 5F7YC 1AR1D 3HMXA 4F9LC 3FONB 4AEIH 3WS6C 2MPAH 4NQXA 5J1TC 3WLBB 1KEMH 1FL6A 5BRZB 3WN5B 5C6TL 1KXVC 1FG9C 3BGFC 2ICWA 4KMQA 3HTLX 5E00A 1A6TA 1MFEL 1U6AH 3IRZA 5JQ6H 3T2PA 3N85L 1T89C 4ZFOL 3QIWC 5ACMA 2B39A 2GSGB 3MTRA 1W8NA 2Q3ZA 2EE2A 5CUSL 1UCBH 2VITB 3LDBC 3L1OL 4PJCF 4OM0H 2CGRH 1ZAGA 1DEEB 1NGWA 2E9JA 4JANA 1UB5B 3VFWB 3UC0H 1RY7B 3PP3H 3IU3B 5CP7B 4O00A 4EI6B 4TUKH 2PYEB 3L3HB 4PRHE 4HJGA 25C8L 5CJ8A 3QDJD 5F21B 4NM8H 4JREC 1S5IL 3O3AB 3ARFD 3ARXA 4NKOB 2GK0A 1N5AB 5KW9H 4HZAA 1IAIH 2H32B 1AGBB 3NCFB 1MHPL 4JFPB 4WGVB 1N5YL 3DI2B 4IOFD 1F3JB 2E9IA 3HRZB 4DVRH 5ALCL 2LAAA 1YYMH 5TF1H 3MRJA 4IRSD 3T3PE 2V2TB 1X5KA 4DFIA 3LSOA 4OQTH 4JO4H 4P3CH 2A83B 5L0QC 4YHLH 3AM8C 3DGGA 3TPUA 1D9KD 3L6FA 2NY1B 4XVSL 5HVHB 3BSZH 3RGVB 3IFLL 2ARJA 5ICZB 4XNXH 5GJTH 4HQQL 4FQ2L 3QUZA 2D4DA 2VLLB 2VL5A 3UROR 4JRYA 3VFRA 4JM2C 5F8QC 1A1MB 1W2KT 3UAJD 5JW5A 4E0RA 5EU6A 3MGOA 5CJQL 3HE7A 3HAEH 3G5XB 4YXLH 4QRQB 4Y7MA 1BBDL 1OY3B 1RZFL 4L4TD 3SE8H 4QHNA 1IAMA 1HH6B 4WCYH 1EH9A 2ZKHL 4NO2B 4XCFH 2V2XB 4WU7B 4X5XB 2R23B 3TBVB 5TDNA 1ADQA 1NDGB 5DUMH 2H8PB 3NA9H 3BDYH 1T83C 3DX7A 3IFNL 5IW3A 5HHXL 2YD1A 1NGXB 2AJVL 5ADPH 4Y4HC 1G9NH 1K6QL 4MAYD 3MXWL 3B5TA 2VSDA 5FCUL 4WUUA 2WUBL 3TBTB 4D9QE 1JF1A 1YJDH 1RIUH 2GSIA 1MJ8L 3JTTA 4C4KO 3RVWD 4BFBD 2P8MB 1HHKB 1JMXA 1U93A 2H6PA 5KSAB 1YEDA 1F4WL 4KVCL 5GGVH 1NC4A 4G6AD 3VFOA 2DYPB 6FABH 1D3CA 4J3SA 4OFKA 1DVFA 2V2WB 4LSSH 1XGYH 2XZQL 5CSBA 4AM0B 2HVKB 1XAUA 3BZFA 5IB2B 4DN3H 4XXCA 1FAKT 5INDB 3MCLH 3WYRA 4MJ5B 4HS6B 1ZT1B 3DX8B 2NNAA 1YEFL 2ED9A 2PO6D 4G6KL 5EOCH 3KLAA 2NXZC 1XF3B 43C9A 1S9WB 4ODSH 2BY2A 4KJYB 1EGJL 3NMEA 5GZNC 3QWRD 4Z7WB 1R3HA 4H26B 4J8RA 4LIQH 3JWDH 3L7EB 3MV9D 3FB6A 4HDIB 3CFDA 1IGFH 3RWIA 1RUKL 3LKSB 1MFDH 4L4VE 3T0EA 2W1NA 5FO7A 1JJUA 4ZAKD 3IF1A 1EHLL 2BY0A 4DWHA 4CBPA 5JLZA 1O0VA 1MHCA 3KG5A 3K7UA 2RAMA 1PSKH 1HEZB 4M7JH 3MNZB 3KPNA 5BS0D 4TTGA 1FV1B 2EIZB 3D39E 1ZHBB 5KS9A 1A1OA 4WNQA 3VE0B 1LE9B 5GIRB 4F58L 4EZMA 2XFXB 3CFBB 4QRTA 4YK4C 5CZXC 1ZV5A 3IB4A 3UYOD 3IRPX 1I9RL 1F11B 1NAKH 4UDUA 1KOAA 2WWMD 4TVPD 4XMKH 5IKCA 4N0UB 5E2WL 1TXKA 1ZANL 5EC2B 3BZEA 4KK6D 3QIBA 3RVXD 1GSMA 4PGBA 1JNJA 2R56L 1NAMA 4XI5D 4PLOB 4OIIH 3RP1A 3V6FA 4M9PA 3SGKC 5E8EB 2IF7A 2E7LA 3NZ8B 4Z95H 4U1HB 1QG3A 3U0TA 3TBYA 5CJXC 2CLRB 3BPCA 3D85A 5A16A 4PRBB 1X4YA 3SQOH 1LO3L 4JDZB 5I1GL 4ERSH 1GC1C 1G7IA 1HZHH 3RVVC 2ZNWA 2P5EB 4XP6H 4GQ9L 1YY8B 4YHIA 2ZUQC 3LV3A 4N90E 3WJJA 3ZT5A 4Z5RB 5FA4B 3NFNA 4JFZH 4JKPH 5DGRA 4JLRA 4JHWH 3GRWA 1EK3A 4NRXA 1FIGL 3VGBA 4JY4B 4XVJL 4LARL 3P77A 4K23H 3OGCB 4JFXB 4V1DA 3HS0A 4EUPG 4D9LL 3MX0A 1KN2H 1CL7I 5I19H 3U0PB 3KYNA 4QHLA 5IB4A 1QLRB 3CJJA 1HSAB 4HH9B 2CIKB 1I1YB 5HPMA 1R3IL 3P2TA 1NGPH 2C1OA 5DJCA 3BPOB 2AI0L 3CFJA 4HMCA 3D0LB 3EOTL 3A6BH 1K85A 3L5JA 4UNUA 2CDGA 3W11C 2EDNA 4MWFA 4QT5A 3FCTB 3UTSB 4WFHE 3A0OA 3OAZH 3TCLB 2WUCH 4LNRB 2FJFA 1ZTXH 3BP7A 4PJFA 5I73C 3O6FC 4JHZA 4NDMA 2C1PB 3ZKMD 3HG1E 2BNQD 4XHJD 4LRIC 3MLUL 3C5SA 2FWOB 2Y23A 1QLFA 3QYCA 2AEQH 5GSVB 3GSXB 2IAMA 1AC6A 2VR9A 4M3KB 2QHRL 5EZLB 2J2ZA 2JELL 4ZUWA 4KRPD 2VISA 1ORQA 4PLJD 2CXGA 4RFEA 5BO1L 3WXVH 4RGND 4B50A 4YDLB 4U2YA 4KQ4L 3ROOA 3BPLB 2OSLA 4PLNC 2Y7QA 2EH8H 4OT1H 2IBGA 5I9QC 2NLJB 4QYOA 2DRUA 3T0WA 4QLRA 5IROC 1YNTA 4JY5H 2F8XC 4FZEH 2J8UB 3ZO0A 5C0BE 3U36A 4L4VB 3O9WB 3K80A 1WFOA 3VW3H 4ZS7H 1NCDL 1JVKA 2EDYA 5H37H 1N4XL 2X40A 3N1GC 5L88L 3GIZL 5GPRA 3K1DA 1UVQA 3RU8H 5HDBF 1YEHL 3LS4L 1GZQA 2BNUA 3DVGB 3HI6L 4D3CH 3PIQB 5HHOA 1NMAL 2WBJC 2WWKO 4HPYL 3VFGH 1QNZH 4NJAH 5I1IH 2HFTA 4NN5B 1RZKL 3MBEC 4KAQH 1KPUA 2NX5A 2VZTA 3NCCB 1DL7L 1MRFL 3DRQA 4OI8A 1MCFA 1S8DA 4XWGL 1B4JL 4Y2DC 4AH2B 3DV6B 3C6LC 3SJVD 2R4RL 3B83A 5IFJB 1DBBH 4PTUA 4FTVD 1UACH 2BFVL 1UZ6E 3OJDA 1RZJC 3JUYA 5SWQA 3RL1B 3BN9C 5D1QB 3RPKA 4QCIB 1EBAA 3PWPB 1WFTA 4FG6D 4PJ8B 4GBXD 4G8GD 1VFBA 1A6VL 3OZ9L 4JZJC 5IG7B 3BT2L 1LDPH 4XBPA 5KAQF 2FO1A 2I60L 2PTTB 4LLDB 4AEHH 4C56A 1JRHL 5JW4Q 3OXRA 4XPBH 3SDAB 3SKNB 3VXMA 1ORSB 1OAXL 4RGMB 1MFCL 3QUYB 4J1UA 4BFIB 4GOSA 4JN1H 2G9HB 3N1PC 1YECH 5J8OA 5C9JB 2B1AH 2R0LH 4CVUA 1IGTA 5IQ7H 5ETUB 2YPLD 4JM4L 2IANA 4RFNC 5E1AB 4HJ0D 4YXKL 4CDHA 3H3KA 4JVPA 4NN6B 4N5UA 3QCUH 1LEKB 2LAGB 4I3RL 2Q3AA 3FB5A 5C07E 5E8OA 3QFJD 3Q6GH 4DFHA 4F7CB 2YUVA 1CBVH 1EAJA 2J4WH 1XCQA 4M4PA 4NC1C 4N0CC 2Z4QB 1DE4A 1F13A 3K2UH 2N1KA 2XG5A 2YD7A 4LOUC 4MB4A 1BBJA 1Y18A 1V3KA 2ESVA 5CIPA 1DQJB 2X4PA 2VLKE 2R0WL 2DJ4A 1B6UA 1K8IB 3OSKA 3AXLB 3QDME 2X4OA 4A6YH 1GH7A 4NQDA 1OWRM 5EZOL 3QIWD 3S96A 3WE6A 2ZSWA 1I8KB 4YHOH 1J0KA 1NGYA 5LQBH 2K3TA 3FO1B 4J3OC 3KVQA 1MHHA 4GSDL 1U2CA 1NGZA 1ONQA 1QFWI 3GGWB 2ZSVA 4QRRB 3BDBA 3NGBC 2HA1A 4FS0A 1A2YA 5I17A 3AY4C 2DQCH 5FV2A 1IGJA 1OAYL 1K8DB 2CK0L 1T7ZA 5DJXA 2YMXL 1BGXL 2ZG2A 3WXWH 2CIIB 3LEYH 5F9OH 2FYYA 3O3EB 2DI7A 3HG1B 4RGOL 3VGHA 1EEQA 1YPZB 2GEEA 3ETBF 2I25N 3DROB 4IIQB 1AQDB 4LLWB 2R1YA 3DRTA 5K9OB 1J10A 4TNWK 3V5KA 1VPOL 4BFGA 1U8NB 5A2FA 3TCXA 2ATKA 3V4PH 4ZSOE 4UU9B 2G2RB 1SM3H 2JK5A 1QSEE 3AREC 1AFVL 3UBXI 4HT1L 5AD0A 4ZQKA 2FGZA 5DC9B 2LQRA 3DTXA 5KS9F 1JF5A 2EEBA 3VWJB 2CKBB 1GGIL 5DF0A 1BOGB 1N6VA 3ALXA 3F7YB 1DQDL 4JO3L 1X6NA 2SEBA 2ZG3A 4O2EB 4JM2D 3O4LD 1T7VA 3IKCB 1I7UB 2OR9H 4UV7L 4I4WB 4D0DA 3ZL4L 1A6ZA 2XZCL 4Y4FA 5CILH 3V4VL 3BKYL 3NABH 4KWUA 1GXEA 3UTOA 1VFUA 2W92A 1H3PL 1HE7A 1JNNH 1E4XL 3LVEA 4X7CC 2ATPA 2VZUA 4WVRA 4JQXC 2DQUH 2AJSH 4XT1C 3BZ4A 1ZLSH 4Y4HD 3MRQA 1TTUA 2IG2H 5ESVA 1U8JB 4JO1H 1V7ML 5E9DD 3HZMA 3GJFB 3VRIB 1TNNA 1HHJB 5F70A 1AP2B 5IMOB 1NSNH 1ES0B 2PTVA 2BC4B 3GSUA 3QQNA 1A7QH 2F54D 2G75B 4HFUL 3BYYA 4UIKH 5IT2L 3C09C 3QDJA 5GJSL 3KPMA 4F7MA 4OIAA 1B88A 3PL6B 1N59A 5HYQA 4J12A 5D7IE 5CEZE 4CRPA 4MYWB 4HKBA 1QLEL 4NZUL 2X6MA 4DZ8B 1SMAA 3UXFA 3H0TA 3V4UL 4GXUN 1XGTB 3I6LD 4LPTA 4IRSA 5GRVL 4Y89A 5T5NG 1AGEA 2C5DC 3MA7B 3S3JA 3WN5C 2NXZD 4EUPA 5CEXB 1A7PL 3V2AR 3VXPA 1D9KA 4L8BB 5GZND 2X4TA 4BKLA 4N0RA 4NWTH 5C07B 4RZCB 2Z91A 3FHAA 5E1HB 3STLA 4JE4B 5J6HB 3OKMB 2YC1B 2VXTH 4GRWH 1F8TH 3B6SA 1LHZA 3CCHB 1F6AB 4O2FA 1PY9A 1BP3B 2CDFB 4GO6B 4N0FB 1NUDA 4QRUB 5T1KD 4R7NB 1KIQB 2A1WH 4R0LA 4PJFF 1CT8B 1DQQB 3VXUD 4L4TA 1DCLA 5DVKA 1HQ4A 1X5LA 2HG5A 5D5MF 3MODL 5F9JB 3OKKA 5EOCJ 1WBZB 3ESUF 4XP4L 4CMHC 3H9HA 2Y06H 3RPIA 1U42A 2FEDC 1T4KA 1Q0XL 4LVNB 5CZXD 5HHQB 2X70A 4P5MA 4MAYA 2B7DT 3INUH 1S9VA 2H45A 4K94L 4JQIH 4JFEB 1FN4B 2BSTB 2VZSA 4TULL 1DBML 1G1YA 5TPWL 5IW6A 5F7DA 2IQAB 1UWGL 1WEJL 4TUJA 1FZOA 4PJHE 3S8WA 1MCDA 1RZGA 2VLRB 3P11L 5BMFL 4XCNB 4S1DC 4CDGC 2R0KL 3T0BA 1T5WA 3QWOB 4KI5C 2E6QA 5D7SL 4F37K 3P9LB 4LK4A 3CVIH 2VMFA 3O4OB 4NN7B 1Z9LA 2PO6A 4X98B 1KELH 4Y8AA 1SBSL 3G6AA 4RQQA 2KH2B 5I30L 3EYVA 4WHTA 3VFSA 4KC3B 1OAUL 1ZA6B 4KQ3H 4JO2L 4WFEE 3RVVD 3LN4A 2AXJA 3QWRA 2DL2A 3MLWL 4K3GA 3PGCB 2ZPKH 3NAAL 3VG0L 2F9BT 3MV9A 5EO1B 2IH3B 3KNBA 4DKDC 3QJHB 2FHBA 3O6ML 4K55A 2EO9A 4PJIF 1A3RH 2DTSA 3G04A 4X7FC 4ZAKA 4OF5A 2NW2A 3CLEL 2DIJA 3TJHC 3SOBH 2ZOKA 3PQYE 1G7HB 2BVPA 2WQ8A 3BEVB 5ITFB 5BS0A 4P46B 3TFKC 3CMOH 5LAXB 4UT6L 4OKVA 1MREL 1WWAX 3HR5B 5DD3L 5DQ9B 3TO4C 1LO4H 5L9DH 4N9GA 1HIMH 3KYAA 3LKRB 1XGPB 2DQTH 2X4SA 2VAAB 4ZUVB 3W11D 2BERA 3L3JB 2PR4L 2NTFA 4PJDA 3FO0H 5E08H 3G6DL 4LMQE 3UTTD 2ITCB 1LP9B 3RUGA 1JHTA 4C83B 5DD5L 3R8QA 3O6FD 2F74B 5ELIA 3DECA 4NT6B 3LCYA 1MVUA 4P2QD 5GGQH 1NANI 1YMME 5GS0C 3BEWB 4U7KA 2MNUA 3HLAA 4FABH 4WO4A 1G7LB 5JHDE 1NH6A 1NC2B 2W60B 2BVOB 2XN9D 1VHPA 4O58H 5D7IB 2CLVB 4JFFD 1A7RL 5DWUH 4PGCB 1BIIB 2N4IA 2IBZY 4YXHH 5DHYA 5KSBA 5DEGB 1JN6A 1UJ3C 3E6HB 1IC4H 1IGCL 2A6KA 4K8RH 2YD8A 3HI5H 1RULL 5DJDB 5EU3B 1AD9B 1W0YT 2ADGA 4M1GL 3WKMH 4PJAA 1DBJH 2ED8A 2XPGB 5FUZH 3X13A 1KJ2L 4LLQA 4L8CA 4P9MH 4XPHH 4BZYA 5CBEB 1A6AA 1AXSB 4NOBA 4K3DL 5F1IA 1MFBL 1LWRA 3GIVA 3CZFB 4GLRH 4MNGA 4YGAB 1P7HL 3F5WB 2NY4C 1EERB 1DBAH 4XNQA 1NUFA 5HYSB 4QNPE 4MA8H 4TRPH 5F3HA 1NJ9B 3L5WB 5CWSB 5DRNA 3FT4B 1I8IB 3MRRB 2BX5A 5GQBA 5F44A 2RQ8A 1CD1B 1C16A 1H5BB 4NQEE 3MRGB 1CGSH 3HI1B 2DLFH 2FATH 2VDOL 1YY9C 3N1FC 3IETA 2EH7H 3C5JA 1FYTD 4ONOA 5KVDL 3MBED 3WNLA 1MCOL 1BQLH 1PKQE 3GJEB 3ZZ1A 5ABDE 3BI9X 1CDCA 3O41B 4Y2DD 1E4WL 3Q2CA 3T4YA 3UTQB 3IVKB 3C6LD 4RFOL 4M93B 4OCSL 4ZG1A 1CD0A 5ACZB 5IMLB 4RMUA 4X7DC 5F88B 5ID0A 2NQCA 1R24A 2BNQA 3HUJA 5H8DA 2I9LA 3BN9D 3W82A 3NN8A 4TPRH 4PJHB 3ZTJG 3Q6FB 1X4XA 1J0YA 4ONGL 4HBQA 1P2CB 2C7UB 4PGEA 4QY8A 1OGAD 1YEIL 1HDMA 2EDXA 4LLVA 4OFDA 2PXYC 3NBNA 1AO7E 1NUGA 1EXUB 1VKXB 3FB8A 3HMXL 3ARGC 3SCMB 4JB9L 1U3HC 1AE6H 1EHNA 2XXCB 1I3VA 2YEZA 3UO1L 1UXWB 2XQYK 3QNYA 3VFPB 1MLCA 2NY2B 2Y5EA 4IRJB 3ILPA 4DW2L 4X7SL 2P8LB 3GO1H 3DO7B 4K9EL 5KG9B 1E4KC 3H9SE 5CKAA 2P49B 5GHWH 3MNVA 3U7AA 4CU8A 1JZ5A 2W59A 4HMEA 2DQJL 2Y1VA 4L3CA 4YIQA 4N0CD 2DQGH 3QO0B 4X6DB 3TJEL 4O5LH 4LOUD 1Q9KB 4KKCC 5DJ6A 1MRDL 4E41E 4HC1L 4NC0B 3RJDA 1TIUA 3PQYB 2W9EL 5E2TL 4NP4H 1YMHA 3WHXB 1Q8MA 2DKUA 5SWSA 1HXMB 3MC0A 4JG0H 4LHJB 5ERWB 3B9AA 2R1XA 3H7LA 3B4NA 5CJ5A 1W0VA 4Y19D 3MACL 3SJVA 1MCPL 3I75A 4FTVA 4Q6IA 1FL3B 3QT2A 3W2DH 2YA1A 4CW1B 3CSBA 3VWKC 4GBXA 3G5YA 4G8GA 2YD3A 2YD6A 1YMMB 3BPLC 4OJFH 3UBXG 4U7MA 4PRDA 4DAGL 1F45A 3ROLB 2NY3B 2VQ1B 4EVNA 1NFIB 2IH1B 3GSQB 5I1DB 4D0BA 1OSPL 4NOFA 1RMFL 3H3PL 3FQNB 3MA9L 4L9LA 5GGSB 1DLHB 4NNXB 4UINL 2AK1L 1YNLL 2YPLA 2AQ1A 2WIIA 3DIFA 2AABL 3ARDC 3IJYA 4HWNA 3ARED 5DI8A 1Q0YH 5HGBB 3A67L 2G60H 5I8EA 3LS5L 5FYLL 3SKMB 3JV6A 4GXVH 5HDBE 3OKDA 3QFJA 1NCBH 5D1ZB 4PG2C 1KB9J 2A6JA 3MREA 4F9LA 3QFDB 4LHUB 3D25A 3MLRH 4XNYH 5JUEL 3WIIL 3WS6A 4OB5H 3OBAA 3PHOB 4NN5C 1N64H 2IADB 4MX7A 5DUBB 2OJEA 4JKMA 2KDGA 3B9DA 5GISH 3RNQA 3U6RA 3CXDH 4YQXL 1GGTA 1KIPA 2VLJD 3OPZH 4BK4A 1WBXB 1ACYL 1DDHB 4NQEB 4RA0C 1GGCL 1T89A 2C3WA 3QIWA 5FDYA 3TP4A 4JFDD 3C6SA 4JY6B 3LKNA 5LBSH 4LSUH 1JGUL 1CLOH 5T33H 2DLEA 1UH4A 2UYLB 3QXDB 4JRYE 3MLZH 4WDIA 4HUKB 4R90H 1X5ZA 15C8L 2GJZB 3SO5A 5EU6E 2VN7A 1NFDE 3RA7L 1MJUH 5FYLE 4JRXB 1L7IH 3OR6A 2C3HA 4RGMC 3DURA 3QUYC 4K3JH 5HVWA 1N0XL 1QUNA 4DKFL 4Q6YA 4N1CA 4IS6A 2PW1B 1KJ2B 3GJFK 3IDIB 3HPJB 5F96H 5DD1L 2HH0H 3RAJL 4WY7H 5DEFA 5D7LB 3I50L 3CIQA 4PGJA 1JGVL 2XKNA 1T5XB 1AO7B 4WEUD 1CU4H 3T2NL 2JJSC 4OCWH 1JHKH 2RBLA 3JV5A 1T1YA 2E7CA 3V5HA 3O3BB 5BRZD 3VI4F 1NBVL 5EUOA 5I6XB 3CH1B 3QPXH 3VFNA 1HILB 4EXKA 5DMIH 4XP5H 3MRFA 2IQ9H 2X1QA 1CGVA 1DQTA 4S2SA 2J7LA 1U92B 2FR4B 5FIEA 5ESQA 4JG1L 4XRCB 2VC2H 1YN6B 3QUXB 1MUJA 1JWUB 1FORH 4PJDF 5HXMA 4KDWA 3MR9B 4JM2A 3O4LA 3ISWA 5I71B 4OSUL 1FVEB 1C1EH 3RUGF 1QEWA 1EUTA 3BKCL 4M1DH 3ULVC 2YPVL 3ZDXF 5GGTA 4TOYL 5DYOB 1SYVB 2LABA 4FNLH 2ORBL 4K3EH 32C2B 2FX9H 5EPMB 5J1AB 1VB9A 1IGMH 4NPYB 1GHFH 2PYED 4POZC 5JTWA 1T83A 4QTHA 2FEDD 3LHPL 3P4OA 4HWZB 3BD3A 1A8JH 5C0FA 4G5ZL 4WTWA 4Y4HA 4F33B 1YNKH 3H3BC 4MD0B 1FJ1A 3T0EE 1EJOH 3BJLA 3BP5A 4FFZH 3BP4A 1RZIA 4HWBH 4LAJH 4N1EA 4XBGB 4XP1H 1NCCH 3I02A 3VJ6B 5E9DA 4JGJA 3L3GA 2DD8L 4WJ5B 5KSBF 5MEQB 1KGCE 2NMSA 1F4HA 4YZFF 3PXJA 3MLTA 1A3QA 3B9KB 5CGMA 2F54A 4WV1B 5JDSB 4HCRA 1LD9B 4PJAF 1T0MB 1AGFA 4S1DD 3T8XA 5F1NA 4IOIB 3VWJC 4H88H 4KI5D 4OGAC 1DZBA 3BPNC 3IYLW 3VMPA 3QP3A 4KTEL 5DT1L 3IT8D 4GRLC 4DVBB 4R2GB 1SBBA 2VDLL 1T1ZA 1S7XA 3VU2A 3PWLB 4UUJA 3HC4L 3A6OA 2BHYA 1J7VR 5C2UB 3EYOB 5HHNB 3TNMA 3QZWG 1JGEB 1IT9L 5I8KH 2HJKA 3L1OH 1W72L 3S6CA 3DV4A 3U0WL 3L3OA 4XCYA 3FQRB 2OI9C 3QUKB 4JR9L 4YWGL 3NACL 2VZ1A 1FVDB 4PP1C 5T1KA 3SDXE 1V3MA 3D69B 1NDMB 5K59E 1NCNA 1CFTB 3VXUA 3GMLA 1BFVL 5LGKA 1MJ7L 1S5IH 1RIVH 4PTTA 3HUJF 3RWDB 1HWHB 5EOTB 5AZEH 3WKNA 3FZUC 3GMPB 1HOCB 3B2UC 3TFKD 1MHPH 5EZIL 3U4EA 3PWUB 2H26A 3TO4D 4RMTA 3KPQB 5ALCH 1WWWX 1SEQH 1EFXA 4V1DE 1EZVX 3S37H 4YAQA 1ZSDB 2DYPD 3CC5B 3PL6C 2IBBA 4XVSH 1HHHB 1HKLL 5CSGA 2EYTB 3OJMB 4YDKL 2ZUXA 3BFOA 2EDHA 2VLMD 1KACB 2RFXB 3HNTL 4G7YL 1FO0A 5JR1L 1UB6A 5K9JL 5GS0D 2EYRB 2C3VA 1C08B 3SGKA 1BFOA 1S9YB 2CQVA 1QOKA 5JXAH 2YBRA 1CGYA 2XKUA 1UC6A 1JWSB 5CJXA 5DD0H 2OXHA 1EJ6A 3K4AA 3TH3T 2AV1A 4Z8FL 1P7QD 2ZUWA 1T3FA 3V5DB 2AEWA 1KFAL 3CFKB 5D5ME 3F7RA 5KOMC 2OMNA 4G8IA 3MXWH 3RBSA 2EE9A 3RY6C 2R4SL 3LKPB 4RAVA 4FFYL 3RWJB 3E2HB 1YQVL 3E6FA 1NLBH 4QKXB 5CMAA 2HFEB 3E1F1 4AZ8A 1R5VB 5FM5M 2NY4D 2GTZB 1FVCB 2OL3H 1DSFL 4Q58C 2B0SH 4X6BB 3QPQC 1CGUA 4XMPL 1IL1A 5EO0B 1K4CB 2Q6WB 5ICYB 4OAWA 3RVTC 3S3PA 1WTLA 1B0GB 4HS8L 1MF2H 1C5BH 4XCCL 3NVQA 1INQB 4M48L 1GJIA 3OF6D 1GRWA 4PRHD 2BOBB 5ESAB 4LSRH 4IDLA 3UBXA 1PYWB 1V5JA 2B5IC 4NHCL 5KN5A 5GGUB 3CDGB 3O6FA 5L2KE 4NN7C 4ETYA 4LRIA 5DJZA 3FOMB 4H1LH 1M7DA 3IJSA 4U6HB 2P5ED 5IF0A 2WW8A 1A9BA 3GKWH 1I7ZB 3D9AL 5C0IB 2XN9A 4OV6F 4H8WH 4PJIE 2XICA 1R3KA 2PXYD 3CH8A 2BRQA 2DF3A 4JFFA 1LO5A 3QEUB 5I8OH 4HG4K 3RNKB 3ARGD 1R5IA 1U3HD 4F58H 4L4JA 3BAEL 1S7SB 2GJJA 3MCKA 1P5VA 4ZYKB 3UJIH 4Q9QH 1CXHA 4ZDHB 3PP4L 2NY0B 5HGAA 1WAAA 4JPVL 3MOQA 2OXGA 5IJVA 1E6JH 3JZ7A 1EAPB 1WQVT 5IROA 4YHZH 3SE3C 3VXRE 2HN7B 3FT3A 1MCJA 1JCKA 5TDPA 2ZUUA 3IXTB 2R56H 3MZTA 1Y6NR 4R96A 3VXME 1ZGLB 4XC3L 1RHFA 3LQAL 1DQLH 3SDXB 4KKCD 1TZHA 4FXLA 4X0KB 3UTSD 3KPLB 5I8CA 2LTQB 3WMSA 2JTDA 5C0EA 1S7VB 3DX9A 4D9QD 1LDSA 2W9DH 4LGSB 2Q8AH 3H9ZA 4Q7DA 3NCYP 3VCLA 2WBJA 3K1KC 1MCSA 3TBWB 5TE4L 4P2RB 1FYTA 3CLFL 4L8DB 3MBEA 2VXSL 5TDOA 1K2DA 2QKIA 5AAMA 1VFMA 4Y2DA 3FT2B 3C6LA 1U8KB 2QLVB 5EU4B 3MJ9A 2AJUL 3DVIA 4G8EB 3SGJC 4JDVB 2CLZA 3WJLC 1W72B 1L6ZA 5EUOF 3VWKD 1VA9A 4NQDE 4LVEA 1G6RA 1MCBA 1QKZH 4GKSA 1FG2B 2G5RA 1CFNB 4JZJA 3H9YA 2BNRB 1OGAA 1S9XB 5D2LA 1UG9A 1IAIM 2HVJB 5FECB 2R2HA 3P4NB 1KYOK 1I9JL 2ZCHL 1CFQA 1WZLA 3OKYA 3IDGA 3I85A 1R3IH 5I1AB 3ECBA 5J6GB 1FGNL 4L4VD 5TH2A 3QQ9C 2H2PC 4U6YA 5DRWA 3ARDD 4PBVC 1OGTA 2ICCA 2DQDH 3DUSA 4GKZA 2F5BH 2YD5A 3VXQB 3EO0A 3GSNL 4XH2B 2GYSA 5ID1A 1H5BC 1JPGB 4U1SA 3D39D 5J56B 2AK4B 2OL3B 2WMPA 4BSVA 3GMMB 5FHBH 1CG9B 4XMLH 3E8UH 1RIHL 4XXDB 3W9DA 3VG9B 1QPPA 5DTFA 3B3IA 4M93C 5DHVA 1GOFA 1WCBA 4X99B 2BCKB 3AB0B 4YHML 4WW1A 3K74B 3REWA 1HI6A 5AZ2H 5A1AA 2AP2A 4G9DA 1Q1JL 2X9XA 2EDQA 4KRMB 2DMCA 4H25B 1TJGL 4Y19A 4PJ5E 4YR6B 3BHBA 1OAQH 2YSSB 2VDKL 3AY4A 3JWOL 3G08B 3GEWB 5GGRB 4LQFH 1MY5A 2DM7A 1JNHB 3D0VB 4H1LB 2A2QT 1JRHI 4R97C 3QUYD 3MGTB 4Z7VE 5F7EH 1NBZA 1I1CA 1HN1A 3QUML 5E4IA 2CKNA 3RZWA 2NY2C 3KYMA 4N90D 5IM7B 1KJVB 5L88H 3QZWA 2IFFL 3L3IA 4MXWH 2IBZX 3WNOA 1PQZA 2OP4H 4QHUA 2O5ZL 1MELA 3H8NA 1KPRB 3LS4H 4M5ZH 2FLRT 1IJ9A 1E27B 2G5BA 2MJWA 2GFBA 4QXGH 1RZKH 3AREA 3MRBB 4GG6E 5IB5A 1A14L 2OMBA 1EO8L 3Q48A 4LKXB 2DWEA 4FQ1H 5C1MB 1B4JH 5B39B 3K81A 1EEYA 3T2OA 2EIDA 4NQSB 1H3UA 3T77A 1LK2B 1PDKA 4LDOB 4LF3B 1I4FA 2BFVH 2D0GA 1F58L 4NO0B 4FRWA 1KUMA 1RU9H 1QQDA 2VXQL 3U9UA 3ULVD 4OV5A 2CJUL 3M1BA 1A6VH 4EQ3A 3OZ9H 4WFHD 3BT2H 4L1DA 4P23B 1FNEB 2VLJA 2I60H 4H5SB 1Q94A 3DVFA 2FL5A 3OJ2C 2D7MA 4LVOB 3RWHB 3SBWC 4JFDA 3HG1D 5A2KH 1KTDB 1ZE3C 4KJWC 1X7QA 4JQXA 4POZD 2FRGP 4JJHA 3KGRA 1YEKH 1PZ5B 4JGMA 2BMKB 4LPXA 4E5XA 5T3ZH 4OFYD 2OM5A 2X89D 4IDJH 3LIZL 3EZJB 3RWGB 5F7WC 3FTGB 4D9RE 4NZRL 1IC5H 1LO2L 1TVHA 3RX5A 2A74A 2DWDB 4HUVA 4BUGA 4PV8B 4L3EE 3L5XH 3ABZA 1TETH 1U58B 4HIJA 2O61A 3BO8B 3OL2A 5C09E 4UNTA 3EDJA 3PV7A 1SEBB 3QDGE 2ZCLL 3VWJD 1QFUL 1TZIB 2Q8BL 4HF5H 4OGAD 4U6XB 4X8JB 5D1ZC 1ZLUK 3QH3B 4N8CL 2GQHA 4GRLD 4YGVB 4ENEC 3WNKA 1UWEL 4FQQB 5EZOH 5IVZA 3WLBA 1XF4B 1HINH 1T2QH 1QR4A 5I74B 1UADC 1NL0L 3MRNB 5C0BD 3BKML 1WZMA 4QXWA 4PRAB 2XG4A 5BRZA 5BQ7B 3WN5A 3QEHA 3NIGF 5B21A 2RIKA 3BP6A 4LSQL 1WV7T 4ZO7A 1BPVA 2WIMA 5IHZB 5IK3B 2DIAA 4NO5A 2A38A 3BESR 3LH2L 2GSGA 5C0GA 4MJIE 1FE8H 2HJFA 2P5WB 4OCLC 2PCPA 4ZTPL 3OX8A 1E4XI 3X14B 3CVHL 4MQSB 1RVFL 4PP1D 2V7HB 1FRGH 4M8QA 4ACPA 1PEZA 1BF2A 1R3LB 3MRIB 4HZLB 4Z7OF 3FRPG 3VRJA 3FZUD 1U95A 3VD7A 5KSVB 1UB5A 4EI5B 4QRPE 2GAZB 1VPOH 3B2UD 3RZCC 3IU3A 5CP7A 5I1CL 3NPSC 4HK0A 4M3JA 1ZHLB 2PYEA 3L3HA 3MV9E 1HWGB 4NBYB 1VADB 3S35H 1FNLA 4RAUA 4ELKB 1AFVH 4O4YH 1MCNA 4JGUA 4KZDL 4NKOA 1N5AA 3ZMRA 3PL6D 1EHAA 2I9TA 1AGBA 1CFVL 4JFPA 1F3JA 3HRZA 4ZFZB 3GSNB 4RMVA 4JO3H 3OHXB 5KVMC 1BJMA 1WAAF 1OOAA 5I6XC 3OMZA 4AQ1B 4IHOB 4PJXE 5D7JB 1CLYL 3P30L 3QHZH 2W65A 4M7KL 3C08H 1DANU 5C07D 2XZCH 4PJDE 5ICZA 3ME0A 5BCAA 3BKYH 4GQPH 1H3PH 4NKQB 3GSVB 3BGMA 4N8VB 5I71C 4KTDL 1CIUA 5MEPA 2CR6A 4FQIH 4YNYB 3QXAB 3ZTNH 1KENH 3F7PC 5KBNC 2VLKD 3I3DA 4K07A 5HVGB 4TQEL 3QDMD 1MIMH 4NO2A 4Z7QF 2R23A 4XPFH 4OZIE 2VDML 1NDGA 5FA3B 4PRPB 3WNPA 2H8PA 4IM8A 9CGTA 1I85C 4FN0A 1YQ2A 1RZ7H 3C2SA 1NGXA 4FFVC 1U8MB 4Y4KC 4M43H 4PUBL 3ARUA 5GJSH 3QPQD 4LEOB 3QUMB 3FQUA 1ZVSB 1A3LL 3TBTA 4LCCB 4JVWA 4OQ1A 3UZVB 4ZPVA 1IGYB 2BDNL 1QR1A 5LWYL 4PJAE 4RMWA 3RVTD 2EIEA 1RHHB 3QIUB 1U91B 3MJ8B 1QLEH 5FKPA 3TO4A 3V4UH 3O3DB 4ZPTB 3ZDYF 5D2LF 1JYVA 1TTGA 3NH7L 4YO0A 2DYPA 3IGAB 1W0WA 2K7QA 2R8SL 1A7PH 1RK1A 5ISZE 1Z3GH 2APXA 2V2WA 4AM0A 2HVKA 5EBMB 2H3NB 5T1MB 1DFBH 3FB7B 5INDA 3LOWA 4R2GC 4MJ5A 4HS6A 1ZT1A 3DX8A 3RIAK 4HUNB 5D93B 1CYGA 2Z35B 1S9WA 3G5VB 1QSED 1CIDA 2GI7A 4LMQI 2OTWB 1FNSH 1A64A 3KYKH 1BAFH 3UTZB 2FGWH 2EDKA 2NZ9C 3OKEB 1K5NB 4XWOC 2B2XL 4LLYB 4UAOC 4BM7A 4H26A 1LEGB 5IMKA 1EO7A 4AEFA 4F7EA 4NQUA 3W39B 4YC2B 4YHKH 4U6VH 2FIKA 4BSJA 4IRZL 1GZPA 1P7QA 3LKSA 1HHGB 4WI5A 2KL6A 4X5WA 5DJ2A 5D72L 1X4ZA 1UJ3A 3FFCE 1ZHNB 3HUJE 4ZUSA 2B4CL 4JKKA 1C5DB 12E8H 2C3XA 2GITA 1HEZA 4BZ1H 1FV1A 4HKJA 2EIZA 3NZHL 4K94H 4M7LL 4XNMB 4QWWC 1HH9B 3VE0A 5TJWK 4KU1A 4TULH 5IFHL 2OJZL 3MOBL 4I0PC 1XF2A 1N26A 5TPWH 4HMDA 4L8SC 1A6UL 4CNIB 2EC8A 1DLFL 4HIEB 1XFPA 5C2BH 4ZOCA 4NCC1 3QEQE 3QA3B 5DJ8A 4PGZA 3SDDD 5BVJA 1JPSL 5CJOL 4X4ZA 5EC2A 1QYGL 2R0KH 5T5FL 1C5CL 4XAWL 3K3QA 1F4YL 5EWIH 1PLGH 4QRPB 1MJJB 4PJBE 5E94A 4PD4J 1IILE 2DDQL 3QDHA 4Q9BA 5D6DC 3OF6A 1NCWL 4FQPA 4ZNEE 4PRHA 1SBSH 2KKQA 4LCUB 5E8EA 3U30C 4L9DA 4NHUB 1D5IL 3AAZA 4MZ2A 1J5OL 1QHPA 3NZ8A 4U1HA 1NC2D 4JPKH 5DR5L 4DGVH 3B9EA 5E2VL 5CEZD 4F2MA 2CLRA 2P46B 5BZWB 3MRDB 1J12A 5JPNB 3MSPA 2R29L 5SWSE 3PWNB 4ZFOA 2Y07L 3CUPB 3RWEB 5FKAA 4RBPH 4YUEL 4K71C 4PJXB 5ILTL 2P5EA 4MLIA 1X5JA 1ZS8A 3PDOB 5HHME 4P9HH 4NIKB 3EOAB 2PXYA 4MD4B 3JUZA 4JY4A 3AROA 3VD9A 3SJVE 4YFLI 3RIFF 4D8PB 3ARGA 3RQ3A 4JFXA 5GZOC 2Q7YB 2OX5A 4DQOL 1KEGL 3R4DA 3QQ9D 2H2PD 2VQUA 3U7YH 4PGDB 1XR8A 3ARBC 1CXEA 3U0PA 1ZEAL 2ZUYA 4CMMB 1GAFL 1OPGH 4I2XB 2DLGA 1QLRA 3C9NB 4BK5A 1IAKB 1E4KA 4QXTB 4OKDA 4HH9A 2QQQA 5DD5H 3F6IA 2CIKA 5KVFH 1IBGH 1D5MB 2VDQH 4OZIB 4S1QL 1YEGL 5CHNB 5HSFA 2X4QA 2MMXA 3M8OL 3F65A 3PGDB 4QOKE 4JHBA 3TT1L 1AGCB 3UTSA 4ALAH 2BSSB 1Q9WB 5E2UL 4LNRA 2VKWA 2O5YH 1F90L 2F58L 1J05A 2LU3A 5H94B 5HGHB 4KHTH 7CGTA 2IPKB 1RJYB 1FDLH 1O7SA 4GG8B 4Y5VB 3OKNA 3OR7B 3HKFA 2FWOA 1WT5C 2RR3A 3EJYC 3GSXA 4XBEL 4JZOB 5D1XC 4HEPG 3THML 2H1PH 5KTEH 3R06B 3EO1B 3MUGA 1ETZB 1FNHA 3UMTA 4WI9A 5DZLA 2Z0BA 3VWKA 1ZWIA 4MS8C 3ZKXC 4AT6B 4F15B 2NY2D 4WFED 2NY0C 1FCCA 4UTAL 2ICWI 4R7DA 4I0CC 3MJ7B 4JFHE 4YBLC 4RNRB 1JHLL 4I18B 4ZXBB 2B20A 1ZHKA 2EDWA 3PDGA 4R4FH 3MV01 2VDNL 4G9FE 2VDOH 4Z76B 2DS4A 4L4VA 5E6IB 3O9WA 4CKVX 3GMRB 4MCYA 1HXYB 3ARDA 2QQLL 1MCOH 3C8HA 2M2DA 4U2ZA 2J5LB 4LKCA 3PQYD 1LE5B 5FFLA 4I5BA 1JE6A 1UT9A 2Q7NA 1RZ8B 1UM6H 2LTQC 4PG2A 3GSOB 3G6JE 3D39A 3RRQA 4TNWF 3DVGA 1UH3A 4W6WB 3PIQA 3FRPA 1N6QL 3N9GH 5EBGA 4HFWA 4LP5A 1I7TB 1MFAL 5HYJE 3PUCA 3KLDA 2HYMA 2HLAB 3SGDI 2AJ3A 4LSVL 5D6CB 4IBLT 3QEQB 4AH2A 2ZCKL 4PY7A 3DV6A 1V7NL 4QHMA 3F6LA 3MXVL 4Z0XB 5IFJA 4Q0XL 1E6OL 1EGJA 4XPAL 4KUZH 4HH8A 3MGAA 4QCIA 3PWPA 3HMXH 4PJBB 5C0JA 1ROWA 4KJWD 1NFKA 3V6ZA 1YMMD 4KI5F 1WVZA 1RPQA 2FECI 4QF1B 3UO1H 2BVEA 3P73A 1RJZA 1LMKA 2WP3O 4NO3B 2Y6SC 1AXTH 4HIXL 2PTTA 5JHDD 4LLDA 4WUKH 2VABB 4K9EH 3SKNA 4P0DA 4BSWB 1ORSA 1UA6L 4WU5B 3QUYA 2CRIA 1Y0LA 1A02N 3ZDZF 1VACA 4BFIA 2G9HA 2IMNA 2P8PB 2QR0B 5ETUA 5E1AA 2F5AL 2LV4A 1LEKA 4YHNB 1J1PL 2GCYB 1P7KB 5J9PA 1D5BB 3VDAA 5D1ZD 3C87A 3UX9B 3X11B 4Y5XC 2Z31C 4ENED 2JJSA 2X09A 5E9DE 2Z4QA 5FGBC 1LK3H 2V5YA 5SWZB 4DGIH 4UMGA 3STZB 1ED3A 2MSPA 2ZJSL 3F7VA 2N7BA 3CK0L 1P84J 4OF7A 3MACH 1MIEH 4NQED 1OVZA 1DQMH 4GRMB 4OZ4B 3BWAB 3MRHA 1C12B 2NY6C 1IEHA 3KYOA 4KGJA 4NKMA 5HYSG 3GSRA 3FO1A 4X5LA 4DCQB 2VE6A 4MDJA 5D2NE 4QOKB 4LPVA 3QULA 4XPTL 4DAGH 5CD3B 3O0RH 4M6AA 5D70L 3QQ3B 5J11B 1RMFH 4JRXD 3IDXL 4NSKB 3GHEH 5HGDB 3HG1A 3RZCD 3MLSH 2XTJE 4J3XA 4NFDA 3O3UN 2VDPH 1BEYH 4HLZH 4GW5B 4ORGA 1I1FA 2D03L 4G42B 5K9OA 3ZSTA 3BMWA 2AGJL 4OFYA 4DKEH 2HRPH 2X89A 1AO7D 4EDXB 1BWWA 4O02L 4L3AA 4LCWB 1U8NA 1IQWL 4K7FB 5T1LD 3HR6A 5BZDB 4WHYG 1ADQH 4UU9A 2G2RA 2CRZA 4R6UA 1T03L 4EKXA 1KJ3L 1MQKL 3OTTA 4ZFGH 4EBQL 3VWJA 4HKZA 1CLZL 2CKBA 1CLCA 2YPKB 1YDPB 4GRLA 1ACYH 3IKKA 4UIMB 5DFTA 3B5HA 5I0ZA 3V0WL 1IM3B 3IKCA 1A7NH 4OCMC 4L5FH 1I7UA 2QQKH 5HDQL 1U8LA 4I4WA 3J7HA 3VXSB 2CPCA 2OR7A 3IS0X 4R3SA 4E41D 4F80A 4Z7NE 1T21B 5I1EH 1JPTH 4P23C 5DMKA 15C8H 1NEZB 3V95A 3X17A 2DL9A 2EKSB 3RWCB 1OTTC 1KCRL 3TPKA 4F37F 4LVOC 1NBQA 1L7TL 3KJ4B 1KCLA 4ZS6C 3FO9A 3H6JA 4OLZL 5HYJB 4FFVD 1E4JA 2OTUB 1T1XA 4Y4KD 4OCXL 5IIEB 1ITBB 1CQKA 5DD1H 1LQSR 4KKNA 3RAJH 1R0AH 3KPRB 1VEMA 1IARB 4O9HH 4LASH 3GJFA 3DPBA 3I50H 2B1HL 2GIYA 3N50A 4KHXL 5GRJL 5GS2H 3T3PF 3NCMA 4ODHL 2BC4A 4HAGA 7FABL 2G75A 1CCZA 1NGQH 1UEMA 1MAKA 3K4DA 5C08B 1A6TB 2XA8L 5KJRL 5CCKL 2Y4SA 3LQAC 4JFQB 1X6LA 2VXVL 3PL6A 1Z2KA 5C8JA 1P6FA 1F00I 2E9WA 4R2GD 2D7PA 4I3SH 5I74C 1VCAA 1XGTA 4XP9H 5GRXG 5ITBH 1Q9OB 4OSUH 4I77H 4PPTA 4RX4D 3R1GH 2Q87A 2YPVH 2JCCE 4TOYH 2NZ9D 1CE1H 4JANB 5C07A 4RZCA 1JV5B 4WI8A 4XWOD 3WFDL 1NKOA 1KBGL 2ZZUT 3OKMA 2WP3T 2BJML 2YC1A 4D94A 5JA8B 5F7HA 1X5FA 3OV6A 4HJGB 3EYSL 3CCHA 4HUXB 2CDFA 1NAMH 3QI9C 4W68A 4QRUA 4R7NA 1BREA 1KIQA 4AK1A 2GK0B 1XGUA 2APTA 4P59L 5DFVC 1CT8A 1DQQA 3D3VE 2VLKA 1G0YR 2YS4A 3CFCL 4O2CB 5FYJH 3QB7C 4RIRB 5F9JA 2EDLA 3A6CH 4QWWD 4XX1G 3MRJB 3HC3L 1AD0B 4KY1L 4HWEH 2F19H 4I0PD 2APFA 5EO9B 4OLWL 2UWEB 3L6FB 5A43C 4JRYD 4P4KB 2ARJB 2V9RA 2YKLL 4RWHA 3QUZB 5DQDL 4XNZC 5I1LB 4NJ9H 5EU6D 3IAQA 2VL5B 5F3BB 4UTBH 2BSRB 1P1ZA 3HE7D 5FYLD 3VFRB 4YHPB 2X1XR 1MCCA 3GRWH 4Y4FC 2IQAA 5JW5B 2DBLH 2XTJB 2VLRA 3NIDE 5TGBA 3OKLB 3HC4H 5F93C 4QHNB 3QWOA 3T1FB 2Y36H 4R26L 2J8UF 3SQBA 1FHGA 4M62H 2P48B 4BH8A 2I5YH 1OP9A 5FB8B 1OB1A 3T4AA 1JK8A 4YJZL 2QSCL 4ZSOA 3QCTL 4ZTOL 1L0YA 2NCMA 5GRUH 1QSEA 4XVTH 1GOGA 4QXUH 4Z7QE 3OAUH 1D6VH 4LRNL 1JF1B 3ELAT 3PGCA 3ZHDA 3JTTB 3KXFE 1CK0H 3JV4A 4NM4L 4UB0L 5K93A 2IH3A 1U93B 1UENA 1Z9MA 3QJHA 1JZ7A 3BRDA 2H6PB 1TFHA 5GZOD 2OK0L 3VFOB 3DNKA 3B2VH 1EVTC 1GGYA 3P4MA 1X5YA 1DVFB 2DQEH 3ARBD 2HTLC 3BZFB 1G7HA 2R2BA 2MCPH 5JNYA 1CICC 2KUTA 3EJJX 5A2JH 5C0AE 1KCUL 3O2VL 5LAXA 3SE3A 2FX8H 5J13C 5DQ9A 4PIRF 5A2IH 1B2WH 43C9B 1N7MH 3GNML 3FQTB 3LKRA 1XGPA 3HNTH 3U48A 4ZUVA 3T0DA 1R3HB 4HXBL 5CSZA 2ITCA 2DQHL 4J8RB 4PB0L 5D71L 3T0ED 2VAJA 4C83A 1XCTB 1JNLH 3EOYG 3O8XB 4NQTA 3RWIB 4R0LC 1MH5B 3LEVL 1KGCD 2UUDK 3WS3A 5FO7B 5D93C 4NT6A 3HB3C 1M1SA 3MRLA 4Z8FH 4PJ9B 5FDWB 3BEWA 5KVEL 4JN2B 1WJ3A 3NCBB 1OAZH 1CDBA 1MHCB 1S7TB 3EJYD 1CVSC 5D1XD 1G7LA 5J7CC 1NC2A 2X4RA 1BJ1J 1A1OB 1Z0NA 3SGJA 1EEZB 5D7IA 3WIFA 4YC2C 3DARA 1BFTA 5EBWA 1H3GA 3WJLA 1BIIA 5FHAL 2OCFD 2DTMH 2CSPA 4MS8D 5DEGA 1MWAL 5FK9B 3QIBD 4UDUB 3E6HA 1R3JA 3FMGH 5IKCB 1IFHH 1CDUA 3ILQC 3BIAX 3BZEB 5DJDA 5EU3A 3DETD 2JCCB 4ODBD 1RUAL 1S3KL 4PGBB 3V6OE 3EDEA 1X5XA 2X9WA 2XPGA 3D2UB 3V0VB 3KPSE 1NAMB 3KAAA 3K8MA 1X5IA 3C60C 3RKPA 5CBEA 3ULVF 1AXSA 4AQOA 3TV3L 3SPVA 1IC7L 4MA1C 3L3DA 2FO4B 2OLDA 1QBML 1MI5E 5ICXB 5CZKA 3CZFA 3CSGA 2O26U 3WEXB 5EIIB 5HYSA 4U0RB 3TBYB 1NJ9A 3L5WA 5CWSA 3D3VB 1H5BA 3D85B 5A16B 3MRGA 3KJ6L 3HI1A 4U1KA 4WRLA 1KB5L 4OZHE 4NRZB 4DGYH 3B8SA 4JPWL 1BQHB 1J86A 5EC1A 1P4LA 5AWNH 3GJEA 4LSPL 1GPOH 2IGFL 1NLDH 3O41A 4V1DD 4UT9L 3UTQA 3SDCC 5DEZA