2DDQL

Crystal structure of the fab fragment of a r310 antibody complexed with (r)-hne-histidine adduct
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
218
structure length
218
Chain Sequence
b'DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords R310 antibody heavy chain
molecule tags Immune system
source organism Mus musculus
publication title Bispecific abs against modified protein and DNA with oxidized lipids
pubmed doi rcsb
total genus 49
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2006-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ddqL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ddqL01
1LO3H 3LS5H 2PW1B 4QTIL 1MHEB 2JELL 3RWGB 3KHOA 4JFDB 4L8DA 3BYTA 4POYA 4OZ4A 2VH5L 2I9LA 3DXAD 4TVPL 4YFEA 1GGIH 1R5IA 4YDJA 1WZLA 3NN8B 4PGEA 4AEIH 4WI7A 3OHXA 3O6ML 1GVIA 3NA4A 3D9AH 1IGJB 2HVJA 5BMFL 4JM2A 4AL8L 5F7EL 3BKCH 3HHRB 1CFTA 2CIIA 1P7QB 4EN3D 2C1OA 4ODVH 1KJ2A 2E7HA 3QNYA 1WFOA 3MUGA 4G43A 3WJJC 2V7HB 1T5WA 3ULUC 3FB5B 3TIDB 3UPAA 3X12B 3SKJL 2A73A 4OFDA 2Q1EA 3PWNA 5D93C 5T1LD 1MJ7L 3QDJD 1RU9L 1MY5A 1W8NA 2WIMA 2ZKHH 4UNVA 1CTOA 3P30H 4LASH 4D9RD 5FF6B 1CFNA 1OPGL 1H5BC 4AMKL 3MOBL 3IDYC 4Y0GA 5C71A 5HY9B 1GZQB 2EKJA 4QRPE 4ZUSA 1YYLL 1CFNB 3TV3L 4P2QA 3LRSA 2WIIA 2NTFB 5F7HA 4CL7A 1IGIL 3SY0A 3VXSE 4UV7L 1AHWB 5E2JA 5FA4A 1UA6L 4HHAA 5CIPB 1S5IH 3RVWC 4MDJA 1MI5B 2OJEB 3D69B 3IDGA 1V3LA 5GJSH 4D9QD 2GY5A 1J05A 2FJHA 2BVQB 2P5WB 3WNOA 5DO2C 3O6FB 2R0ZH 3K2MC 3GSXA 2XQBH 4YO0A 4LHJB 1WAAE 3HC4H 3ESVF 5HDOA 3L3GA 2BNRA 2W38A 4NO5A 4POZC 4Z7WE 5ENWB 3ISWA 4HLJA 1T6VN 5JOPE 4B0MM 4TOYL 2X4NB 4OZIE 4KPHH 3VDCA 1A3RH 3EYOB 4QHKI 3C5ZB 4V1DB 5IVZA 2OP4L 1JYWA 4XB7A 3OHXB 4NQXA 3NTCH 4GKSA 1G84A 2H3NA 2JJUA 5EFIB 3MA7A 4F7CB 4FTVB 4BSVB 2HH0L 3GUTA 2H3NB 3MODH 1EHXA 1U9KA 4NIKB 4FQHA 4OZGF 1NUGA 1PY4A 4APQC 3K8MA 1MRCL 4LCYA 3VJ6B 3FB8B 4KUZL 1Q0XH 3G6JF 1RJZA 1WUNT 2A9NH 5J9PB 1D9KC 4YR6A 5C0BA 4P46C 1B3JA 3AVEA 4XMLL 2YXMA 2YRPA 3RQ3A 4R2GC 3AB0B 1P4IH 5ICXB 2F8XC 5GJTL 1R5WB 4JZOB 4MD0B 3ARFA 1YN6B 2DQIL 4LRNH 3RVWD 3LEYL 5HHMD 5FCUH 1QSFB 4JCMA 1U93B 4M6AA 1G7JB 2B1AL 1KLGA 4XPFH 3GK8L 1JWSA 1E27A 2AV7B 5F6IB 2VXUH 5BRZE 2XICA 3ELAT 2GITB 2VLRD 1MRDL 1P9MA 2VXSH 3QA3B 3KNBB 4HFUH 1QR1A 3UBXG 4TVSa 4HMCA 2WIIB 4KY1H 5E1AB 4MQ7A 3GSUB 1IGFH 3N9GL 3DPBA 1JNNL 3MMEB 4TSCL 1PDKA 3DV4A 1KPRB 1HI6A 3KLHC 3MV9E 5BS0A 1R5WA 2YPLB 3DX9B 4JZOA 4MD0A 5SV3A 2RCSL 1TLKA 3SKOA 5MI0B 3IVKA 1BM3H 1C7TA 4F7PA 1NEZG 1QFHA 2R0LH 1ZOXA 3DI2B 5H37G 1J1XL 3TBVA 1BEYH 4APQD 3TIDA 2VO5A 1IC7L 1A9BB 1S9XA 2KH2B 1TJHH 4TULH 2ADFH 5IJKC 1VGKB 2R2EB 2AEPH 3ZKQD 4DWHA 3QUMA 4N1HB 1N2RA 4S11A 4K23L 3I3DA 4GXUM 1TNMA 3MGAA 2YN3A 3EW3B 4KAQL 2FYYB 3MLYH 2HFFA 5B3JE 1MCDA 2CDFA 1C08B 1Z9OA 2C3VB 3L3OB 3V5HA 1BPVA 3UZEA 3CH1A 5L2KD 4LSPL 1UZ6F 2WWMD 2K7PA 3D6GA 4Z0BL 3CK0L 2WINA 3D5OF 1HILB 1OY3B 3REWB 1NCBL 5C07D 3JVGC 1RURL 2IEPA 3RDTB 3P4MA 3SDCA 3CD4A 3N50A 4JHBA 5F7EH 4HWZB 4G6ML 2C1PB 3L1OL 1XIWC 1QPXA 2NX5B 3CXDH 2ZG2A 2OZ4H 1I75A 2VDKL 4OLZH 1UXSA 1VA9A 3AM8C 4X4YB 5C3TA 3KYNA 3NPSC 5DJDA 1M71B 1I7TB 3OAZH 2PXYB 5CGMA 1INEH 3MLZH 1F4WL 4R90H 3P40A 3VXRE 2YD5A 5DHVB 4CJ0A 1LO4L 1SJVA 2V5YA 3QHZH 2X1QA 5FO7A 3F8UB 3MV8E 5DYOA 4NKIH 2KKQA 1KGCE 1GGCL 2DTSA 3OSKA 1RJLA 4GQ9L 4CMHC 5DEGA 1UH3A 2VYRE 4Y1AE 2EIEA 4JHAH 4BSVA 2EYTA 2CRMA 4ONGL 3I6KA 1QLFA 1A2YA 1HSAB 4G8IA 1SBSL 2KDGA 4GRWB 1RUPL 1URLA 2D4FA 3MRKA 2XFXB 5IOPB 1FVEB 2IMMA 4WUUD 4OCXH 1PX4A 1P7QA 2VKXA 2WUCH 2CIIB 2XZAL 4TYUA 4EUPG 1K8IA 4PREA 1I1FB 3VMPA 4WCYL 1YMHB 3ZHLA 5DUML 4GRWF 5D7IB 3KYOB 3IKCA 2B0SL 1ZMYA 5I15H 2HJKA 1NC2B 3EBAA 2WAHA 1EZVY 3CZFB 3CX2A 5EO1B 3PHSA 5ERWA 5HJ3B 1KPUB 4B5EA 1FG2A 2EIBA 1S7UA 5FKAA 1QO3B 1OGTA 2YBRA 3H2WA 4PRHA 3BT2H 1R3KB 4QHLA 3DRQA 3OAYH 5CZXD 1PKQB 1CGVA 3QHFH 2E6JA 4HXAH 3L7EB 4LAQL 5MEQA 3G5ZA 4NO2A 4OGAD 1EVTC 1I1YA 1YY9C 1M7DB 4PJGF 4K8RC 4X80L 1R3IL 2VDOH 3HS0B 4XNMA 2ZWLT 4U0RB 5KSVA 2GJ6B 5IBLC 3DHMA 5DQ9A 3F7VA 5HHXH 4P9MH 2BRRH 2F8OA 4I0KA 4GLRI 4J23A 4P46A 4MCZB 3RX8A 4PBVC 4M03A 4BJLA 5EC2A 4G6FD 4XAKE 5K9KB 4OUOA 1G7JA 6FABL 2YMXH 3RL2A 4OLWL 4I1NB 4RMUA 2EC8A 1CDJA 3WN5B 2J8UA 1JP5A 3QFDA 4N0FB 4LHUD 4UAOB 3S35X 1FSKC 4NHCL 3MJ9H 2A83A 1RVFL 4PRPD 1TPXB 5E24E 4S10A 1DTUA 2VABA 3MTRA 3L6FB 2IPUK 5DD3L 2RAMA 1WTGT 1G9MC 2FGZA 4HBCH 3AMLA 1OB1B 3CPLB 5I71C 1ZHNA 5ADOH 1E4XI 1AD0B 1MQKL 1QBLL 3ZKNC 4WTZA 1MCOL 1PSKH 4PG2C 4WU5A 4PY8I 5DHVH 4F2MB 3ARDC 3MJ7A 5EBWA 2CUHA 2W07A 4X7EC 2HFTA 2CRYA 3GSNB 5GS1A 3DROB 3FAWA 3J7HA 4I3SL 3SGKA 1LE9B 1F58H 5B8CC 4I5BB 3ZE1E 4L3CB 4XAKD 2KL6A 3GRWH 2A77H 2DJSA 3ARPA 3KPSB 3LDBB 3WNLA 3BMWA 4U7KA 4KTEH 1KIRA 4P4KA 2GFBA 3DVFA 4CMMA 2B4CL 4GRLD 4GS7B 4RAVA 2IAMB 1ZVHA 4ZOCA 5AEAA 3ROLA 4NQVA 3HG1E 2DDQL 5K59F 2VWEC 3G6JA 2P43B 4OLUL 4HEME 1MFAH 4PJIA 3QRGL 2K3TA 2P46B 2X4PB 5A2KH 4NRZA 5D6CA 2ID5A 4FQCL 3UC0H 3IT8D 4KUZH 4HHAB 2YPKB 4Q9CA 1T7YA 4M6OL 1RUMH 5ITFA 2HTKD 3ECBA 5E6IC 1E4KC 4NGHL 3LEYH 3S7GA 3QUZA 2DQHL 3NIGE 4MJIA 1QSEE 4WWKD 1BFTA 4IRJB 1IM9A 4U1LA 5I9QB 1A7RL 1QQDA 4DCQB 4K2UH 4G8EB 1NDMB 3MV7D 4G6MH 3GMLB 3BWAB 3KPSE 3GSWA 3O2WL 4YWGH 2V2XA 1ORQA 3NACL 2UWEE 1X9QA 4TVPE 4KI5F 1RFDL 3QWRA 2EDNA 4HFWA 4P3WA 4PJAE 3C08L 4UB0H 1ZSDA 1WT5A 1PEZA 4LCCC 1DN0B 5LAXA 4H20L 2HVKA 3WHE1 4RNRA 5KG9A 2YS4A 4LVNB 2XWBB 3FB5A 3MBEB 4I2XB 4P2RA 4N5ED 3G6AA 1GGBL 2FD6H 5DURD 5FKPB 1SYSB 2GT9B 5B4MD 5EU4A 3ARBD 4DUWA 4RMVA 3D85D 3RHWK 1AD9A 1QHOA 4YJZL 2MSPA 5IB5B 4JPVL 1B4JL 3P0YH 4PUBH 1ZVSB 2EDJA 1UKTA 4HUXB 5EIIA 1P5UA 3BRGC 4FQLL 1OTUD 3E8UH 5CINL 5LGHH 3VW3L 2J4WH 4PJAF 3Q6FB 5H2BB 2ESVB 3STBA 1WIOA 2VZVA 5T33H 3QJHA 2QHLA 4KKLD 2Y36H 5D72H 5B39B 5DQDH 4QXTB 1S7VB 1JZ8A 1HHHA 4X0KB 1IAOB 2GJ6E 4WWKB 2WZPD 4JQXA 1NKOA 5IROA 3QFJD 3NFNA 1KCVH 4XCCH 43CAA 1Y0LA 1FN4B 1X6LA 2YD7A 4PTUA 4JRYA 1X5FA 4TUOA 4OSUH 1GC1C 3MOBH 3WNPA 3IU3B 4MXVF 1MSPA 1IEAA 3GIZL 3MNWA 4OM1L 1M6OB 3IJSA 2YRZA 1AC6A 1IKNA 1T22B 3IF1B 3QEHB 2B5IC 2NY3D 4H1LH 1GAFH 4XPTL 4LPWA 4NJ9L 3Q5OA 4GRLB 1FZOB 2X4QB 5D93B 5GS0D 3AM8A 3CSGA 3QG7H 1N0XL 2P8LB 4M7KL 3HC3L 5AG8A 2QR0A 2DICA 4Q74A 4Z0XB 1INEL 1RK0A 3VFSA 2YPVL 1ODAA 3UO1H 3V0WL 1F90H 3MRLB 2JB5L 1G9EA 5FB8A 5KVEH 4TQEL 1XH3B 4PJ9A 3MRQB 2VH5H 2I26N 1MUJA 3M17B 1U3HD 1NPUA 2FR4B 1AHWC 4AL8H 3MRIA 1YEGH 4PRNB 3JWOC 2LABA 1H3TA 1NANH 1NEUA 2AXFB 3N1GC 5JNYB 1KYOK 2HYMA 1G7IA 5EH1A 4JR9L 4S1SL 1AO7B 3QCUH 4K71C 2R39A 4I2XE 1Z9MA 1FC1A 5HHOE 5FFLA 1KV3A 3IU4H 3BP7A 5DUBB 1LNUA 3L3IB 4L1HA 2W59A 1KOAA 1LP9A 4HUWB 2IPKB 4A2MA 2FATL 4JPKH 5DD6B 2YD3A 3TPUB 2EDRA 1I8IA 4XNZC 3I6GA 5C1MB 5E2WH 2VLLA 4N0CD 2D31A 3GJEB 2DKUA 5BRZD 3R06A 4GRMB 2ADJB 2WNGA 2FECI 3WCYA 4P3DA 5L6YL 3ILPB 3QCVL 3BKJL 1RUPH 5EU7E 4ODTL 3FONA 1CD8A 2OMNA 3MMEA 4JN1H 1MFBL 1BQHG 2GTWB 2APBA 2NX5E 3B2VH 4DUVA 4WO4B 1MJJA 1IGIH 3BSZH 1NGWA 3SDAB 5DJ8A 5GGTL 4UQ3B 3TBTB 5L2JB 4Y5VC 5HGDB 1W2KT 4ZFGL 4M5YH 4NO3A 3SPVA 4R96B 3D85A 3IU3A 3IYLW 4V2CB 3QQ4A 5ALCL 1BWWA 4QHNA 5A43C 1JL8A 5F8QC 4FHBD 4IRZL 1F6AA 4EBQH 3NA9L 1JGUH 3BKYH 4YBQD 4BFBD 2LU3A 4M02A 1Q94B 2X44D 3GMOA 5C0AA 4OFVA 4JCLA 3FO9A 4WFEE 3OX8B 2A9MH 2QQKH 4R90L 3G6JB 4B7LA 5DQJB 4PJIF 4QRRE 4CW1B 2X40A 2V5MA 1E6JH 4C58B 1NAMA 4Q9RH 5CSZB 3QG6A 1HQ4A 3GHEL 3FB7B 5LCVH 2ICWI 1KT2B 2VDKH 4Y19B 1CGYA 1YY9D 3WFDL 3VXSA 2GAZB 2CH8A 1T7XA 2Z92A 4Y19D 3MLVH 2PUQT 3CSYB 4M1CD 5CJ8A 5IBLD 5H8DA 3MYJB 1EAPB 2NY2B 3GJFA 4QWWC 3UJTL 2IH1A 4K7PH 4GKNB 1FCCA 4KHXL 4U1HB 5F70A 2BDNL 2JCCA 4KTDH 4JQVC 6FABH 1Q38A 2GJZA 3QO1A 4NQDA 2JB6B 3P73B 5KG9B 2DQCL 1VPOH 3GHBL 4DVRL 2FX9L 2NLJB 3TBSA 2IG2H 3BQUD 4GW5A 1OM3L 1MCLA 2ARJA 5BO1L 1MPAL 2Q86B 3UZVB 3S88H 2NY6D 3IDNA 4MX7A 3RVXD 1FNEA 1FAIH 3BI9X 1XGQA 3SDAD 2CD0A 3RGVC 4AEIL 1WF5A 1XF2B 3OKYA 4U1SB 5AWNL 2N4IA 3TNMA 4OCNC 4JM2F 1KB5B 1FNAA 3MLVL 5EOCJ 4P2OC 5HPMB 1LO3L 3ARDD 2BNQD 3BE1H 4UIKH 1VGEH 2YSSA 4YXLH 5IIEB 3RZCD 4LIQL 2VC2H 4FQPA 1FZKB 5BV7C 2EO9A 2AP2A 2EYSB 1UADC 3CFJA 2D7TL 2VNCA 2P24B 4J3WA 1YEDB 5AUMA 5JPMA 35C8H 4PPTA 5FO9A 2XQBL 2AJYH 2J88H 4P23D 3O0RL 2EH7H 3KPRD 2BVTA 3D39E 4OZIF 3X3GH 3UDWC 1B0RA 5C6TL 5ISZA 4V1DD 4PLNC 1I3GL 3AY4A 1VFBB 4DN4H 1FBIL 5EUOB 4ETYA 3FQTB 1WT5C 4OD2A 1AC0A 5JW5B 5E2WL 3SCMA 3WMSA 2PTTB 3KDMA 4JKWA 3QEQE 2XG5A 3WIIL 4YBLB 4NC2B 2IAMD 3I02A 4X6BA 4BH7A 4I4WB 3SJVB 1KTLB 4UT7H 1DSFH 1FVDB 4M7ZC 4XP5H 4PJDA 3HPLA 2UYLA 2J7LA 1Q9OB 5B38B 3PV7A 4Y4FC 4I4WA 4NC1C 5GS2H 5CD3A 2OTWA 1KTRL 2FJFB 2YN5A 1QUNA 3VH8G 3D3VE 3HUJE 2VDMH 3HNSL 4FQIH 1SY6H 2VR4A 3FOMA 4KK8D 4S1DD 4XVSH 1S9VB 1FO0B 1T3FA 5BZWB 4YPGA 3RVUD 2VXQL 1QFOA 3KPMB 1WZ1H 4JE4B 4XCNA 4HIEB 4Y4HC 5DA4A 5A16B 2XTLA 4BK4A 4BUHA 1MVUB 5MP6H 3RTQC 5JOPD 1NFDF 5F7FA 3D0LB 3CXDL 5EU6B 3NZHH 4P23A 1N5YL 2ZSVB 3BGMA 1RZ7L 3O3BB 2OR8A 2KZ1B 3QDJA 1PZ5A 1UQSB 5HGBA 5I9QC 1A8JH 4KVNH 4Y5XA 1EO8L 3AS0A 4NKOA 4ZUWB 3VH8A 4ZNCD 2XN9B 3UJJL 2ATPA 3BDYH 4EI5B 4Z8FH 3TT1H 4PJEE 2R2CA 2BSRA 1DANU 1LK3H 5DRZB 4M6ML 4JFOA 3BPLC 2VLMD 1DQTA 2VITA 4X4ZA 5DC9B 5DJYA 4GW1A 4GKOA 1QBMH 1PD6A 4OSUL 4LGSB 3MV9A 5BS0E 1UWEH 2A6JB 3KGRA 2Q7YB 3ARBB 4M7KH 2FX7L 3VDAA 5F6IC 4JM2D 5HVFB 4UMGA 1VACA 1DVFA 3DGGA 4AZ8A 2GTZB 1UACH 3BDBA 4RMRA 1TVDA 5F71A 5JUEL 5FHBL 4JG0H 3NCCB 4EXKA 1JYXA 4K3DH 1FBIH 1EK3A 4LLWA 4YDIL 4PJ5E 3BHBA 2KQNA 2MKLC 2X5PA 2A9ML 2QQKL 4R26H 4MA8H 2VXUL 4XRCA 4GAYB 3BISA 1NDGB 1XZ0A 2QADC 5GRUH 2LU7A 3PGDB 4KMTL 3QDGB 3EO1B 1QRND 3VGGA 3KR3H 3W9DB 3AY4C 4PJCB 5TPWL 4UV4H 1HXMA 3BH8B 4GBXC 4G8IB 3PGCA 1DL7H 3NAAL 5I1CL 4CVXB 4NKMA 5FOBB 5KS9E 2P8PB 3BH9B 1DFBH 3BIKB 1T1YA 1B0GB 5C9JA 1MCPL 5I19L 1MRFL 4XPGH 1LO2L 3BE1L 3V4UL 2E9JA 3MRLA 4I13B 2ADGA 2J6EA 2QKIA 1UWEL 1FAKT 4WU7A 1P5VA 4YFDB 1N4XH 1X7QB 2G60H 3I9GL 4ODUB 5JPMB 1E4WL 5IK3A 1BVLA 4Q6IB 3LB6D 4G8GA 5IB2A 5JHLL 4JKKA 4HWNA 4X6EB 5A1AA 4HPYH 2QSTA 5IK3B 5CGYD 3KPPB 1UWGH 4Z78A 3V6BR 5CKAA 2UZYB 1MCSA 2BP3A 2C9AA 3NZ8A 4NZDA 3B2UD 4D8PB 2XWTB 3IXAA 3O45A 3FO9B 4OZFA 5C0AB 3O3AB 5CIPH 4KK5D 4FQ1H 1A3RL 3LKPB 3A0OA 3U0TB 3D25B 4PRDA 4YHPB 1JF1A 1O7VA 3RNQA 2PTVA 5GIRB 2X7LA 1JV5B 1MCIA 3Q3GA 1UEMA 4ODSL 1DUZA 2AJUH 4X5XA 4LCIL 3NFPB 2A6IA 5EORL 3REWA 3CAFA 1AQDB 4N5UA 1NDGA 1XZ0B 2DQEL 3VI3F 4KKCC 2BY0A 3Q6GL 1GL4B 2NZ9C 4Z95H 4OCYL 1J8HB 4NUJB 1EFXA 1I9RL 4DKEH 3CSBA 2UYLB 3S5LB 2ORBH 3RWEA 1YEFH 3VA2C 4UTAH 2F9BT 3KYMB 3QISA 1CIDA 4LSRH 4PP2A 5JO5B 5KVEL 3Q48A 1UZ8A 3GIZH 4JJ5B 2COQA 3DGGB 3OR6B 4NWUL 2IH1B 1DQQA 2FHBA 1J1XH 4PRPB 4ZFGH 1OGAD 1U92B 5DUMH 4DGVL 1K8DA 1A1OB 3MRCA 1MF2H 1VFAB 2B0SH 2HFEB 1F58L 1W0WA 5ISZE 4HQQH 5ADPL 3GRWL 3E6HB 3FJTA 2LV4A 4D0BB 1AO7E 2M1KA 4JFDD 1ACZA 3GKWH 4I77H 3LRGA 3W9DA 5TDNB 4BFEA 5INDA 1HYRC 3NGBB 4ERSH 1EMTL 1IEBB 1WLHA 5FCUL 3CFKA 1XT5A 3CUPA 3DX6A 5ID1A 4Y5XB 5BJTA 3B5HA 4KJYA 3DO7A 2EDOA 3INUL 3QDMB 1G7HA 4PIRF 1MNUL 3QQNA 4U6VH 3M17A 5FYLL 4WO4C 4HUNB 4PJDF 1NL0L 2YSSB 3WIHH 1PG7H 3ES6B 1JE6A 5TE4H 1GC1H 4FABL 4MA7L 1KELL 5F9AC 1T03L 5KANG 4XBPA 4KROC 4MAUH 2W9EL 5M94B 1S9VA 3KPPA 4K7FB 1X4XA 4ZNEA 1NBVH 3A6CH 4NT6A 4XVSL 3ZZ1A 5ESVA 3KLAA 1A6AB 3P0VH 3T77B 1MCWW 4YHZL 1A7QH 3B5GA 4RISL 3ARFB 2WWMC 1MFCH 5C0ND 4HX1A 1S5HB 4KZEH 3HI5L 5E8EA 5KSAD 5D1ZC 2AXGA 1A6WH 2DQTL 3HZYB 3MCKA 2FH8A 5KOVC 4DAGH 3V0WH 2NY6C 3NVQA 1PKOA 5DD1L 4F8QA 5F89B 2E27H 5LVEA 3PV6A 1U36A 1CFSB 3QHFL 4JFXB 4UILH 4XP6H 3K0WA 2XG4A 5I6XC 4GG6A 1FL6B 4AH2A 4OT1L 3SQBA 5BW7C 5DRNB 1XGRB 5B39A 1PG7L 2MCG1 4F2MA 4MA1B 3GSRA 5MEOB 1AFVL 1ZANH 1MFDH 4HS6B 1MHHA 2OTWB 2CKBH 1MCEA 1A1MA 1XCQB 4OKDA 1IKFH 3DV6A 4PV8A 4KHTL 1HSBB 5JORA 3M8OL 4K8RL 1QFWM 2BNRB 3CFJB 4KTEL 4FA8A 2P4AB 3PWPA 3V6OE 2AK4E 4M48L 1F11B 1ZT1B 2ICEA 1SY6A 4JM4H 1EEZB 2YEZB 3FRUB 3PE9A 5SWZB 1TIUA 2A1WL 2V9RA 3RL2B 5KTEL 5T33L 2XI9A 3CFBB 5D1XD 1PVHA 3V52H 4O2EB 4YHIA 3MRHA 1G7PB 2AJSL 4NYLA 1B6DA 3INUH 5CKGA 3UJIH 2HMIC 1FCGA 2Z8SA 5E00B 3CCHB 3HAEB 5D7SH 1JPTH 2ATPB 5DJXB 3VD7A 3NBNA 3FO2A 5I8EB 1NBQA 3JTTB 3DTXB 1RZIA 3HZYA 1EEYA 4QCIB 2LAGB 3ZKMC 2R2HA 4YGAB 3V6FA 2DMCA 1CXLA 4PJFB 1ZAGA 3FO2B 4CMHB 5CZKA 1VCAA 3H0TA 5C0FB 4OQTA 3HE6B 3HZVA 1OWWA 1I3UA 2D0GA 2V2XB 2WP3T 1IM9D 2NXZB 3DETC 3FTGB 1KN2H 2BNUB 1QSEB 3VWJC 4FXLA 5L2KB 4Y4FD 3LKQB 1NEZB 4PV9A 5ACMA 4XWOC 2HP4A 2VLJA 4DGVH 4LEOA 4NQEB 4RDQF 5HPMA 5CHNB 4ZTPL 2X4SA 2NXYB 1EDQA 5KVFH 1W0WB 2Q20A 2Q7NA 3MJ8A 5IMLB 3QIUC 1KFAH 5CMAB 1ZE3C 2XWJA 3U7WL 1A22B 3GNMH 4MA3A 4X8XA 2NY4D 1FL3A 5F3HB 3NTCL 3X3FH 4Y4HD 4LARL 3FHQA 4IMLB 4Z7UE 2QQNH 5FUOL 3O4OC 3FQXA 5DMYA 1FRGH 2APVA 4L8SA 4HC1L 1S9WB 1ORSA 1RUML 5KSBA 1RIHH 5T1LB 5E9DD 1DBKH 1DQMH 5DI8B 1IGJA 2VLKB 4HWBL 4NJAL 4CBPA 4PLJC 4YHYC 2DLFH 4OI8A 4NN6C 5DJAA 3OG4B 2XA8H 5IEKB 4PJ9B 4KRNA 2B2XL 1WIPA 2A2QT 5F97E 2AERT 4D0CB 3RIFK 5I8CB 1MELA 4K8RH 1B0WA 3PABA 3TP4A 3VG9C 4Q9QL 4XAWH 1BQLH 4AENA 5GISH 5DEFA 1KIPA 1UVQB 5FUZL 2Z92B 4F7MA 1W72A 4GAGL 4WI8A 1K2DB 5T1DH 1JMXA 1T0NB 3QUZC 4QHMB 3QWOB 4HZLB 4KZEL 3Q2CA 5B21A 3O6KH 5FDWA 5I73B 4Y1AA 4OCWH 4M43H 4FFWD 5CSZA 2R8SL 3OKNA 1T2QH 3TA3B 3SE4A 2E6PA 3NIFF 5IF0B 5BQ7A 2QADD 2Y23A 4HEPG 3BGFC 2BNRD 3GSVA 1ADQH 2BXZA 2ZCHH 2Y5EA 3O3EB 4UV4L 5DMKA 1G7LA 3F5WB 2NY4C 5FEBA 4FQ2H 4ZAKD 3QYCA 1J88A 4HS8H 1GIGL 3L7FB 1XIWA 2EIDA 3O3DA 5HYJD 5IMMB 1HXMB 3BH8A 3MV11 5IUSA 3C8HA 3VXTB 2GSGB 4QHKJ 1A4JB 5GGVH 1QTYT 1ZT4B 3S5LG 1S7XB 3TH3T 3VD5A 5K9OB 5GS0L 4QLRA 5GGSY 4JG1H 4IOFC 3T4AB 1MCHA 5JR1H 4JFYA 4BM7A 1D5BB 4PLJD 3CU1A 2R1XA 4YHKH 1BD2D 4NQDB 3HB3C 4KRPB 3VFTA 5DJCB 5FYKU 3VDBA 1M7IA 1YMMD 1YEJH 2P5EE 3UX9B 1PKQA 1GGTA 3DMMA 1GZPB 4IEFB 5JW4Q 4JZJB 3CFEA 1N2RB 4XPBH 3K4DA 4PR5A 2K7QA 2ZUTA 5L7XH 4PJXA 4ZS6C 4CN1A 2F53D 4BFIB 1A7NL 3D39B 1JGDB 2CPCA 5F88B 3TPUA 3DURA 3TN0A 4N68A 4F57H 4UINH 1TETH 3UJIL 3S97C 2X89D 1OSZA 3RAJL 3ZO0A 1NC2A 1U58B 4PRHE 3HMWH 1FFPA 4MSWA 4ESKA 4F37K 4PS4L 3F65A 2JJTC 1OAZH 5C7XH 4NCDA 4JY6B 4UI2A 4GAYA 1NCWH 3L3HB 5E99L 1YEHL 4NKOB 4ZUWA 3VH8B 4X5XB 1KG0A 1RMFH 1A14L 4JFZL 3ALXA 3MRBA 2XXMB 1UWXH 1G0XA 4H1LB 4DFIA 2I5YL 5DMJB 1MUJB 1U8OB 4N5EC 4RFEA 5HDLA 3RWCA 3VWKD 3OJ2C 4PJIE 5HVHC 3O9WA 4H1LA 3MX0A 3MJ8B 2A6JA 3IFNL 4U1KB 1LDPL 2CR6A 2VAJA 4U1JB 1NMAL 2YOCA 4HMEA 1JWSB 2BVPA 3MFFA 2BVEA 5D70L 3TA3A 3QEGH 3OKNB 4D2NA 1F8TL 4XPAH 4DZ8A 3VXRB 2BC4B 5T1MB 1J7VR 4YX2L 3S36L 5JHDD 5EZIL 25C8L 3Q5TA 1SQ2N 4PJGB 5TE6L 3UAJC 3DMMD 5DD0L 4HUVB 2DWEA 1CG9B 4I3RL 5MERA 1A7OL 1KIQB 1OGAB 3DTXA 1YDPB 1NAML 1EGJH 1AKJB 5IR1A 3ULVF 4P5TB 2QQLH 4Q9BA 1TZGH 3TFKC 1TXKA 1V3JA 3PWLB 2X4UA 1A4KB 3FO1A 4PJHA 1YNLH 3UYRL 4OM0L 4YFLI 5D8JH 5I1LB 4F7EA 4NZTL 1WC7A 1GSMA 1K8IB 4O9HL 2GK0A 1X44A 4P57B 2IPTH 4XMPH 1FNHA 3VW3H 4WW1B 1LHZA 4ZAKA 4PRAA 2NY3C 5FGCE 2DQIH 3PWPB 5T3XE 3DBXB 1T21B 2AABL 4MA8L 4OTXH 5JORB 2ZZUT 2D2OA 5ACLA 1RY7B 4L4TE 3QQ9D 2BHZA 4JVPA 1MFEL 4R7DA 1NBZA 1IC4H 5E6ZA 2VXSL 4Z7OE 4EOWH 2P48B 4KJWD 4KRLB 3GSVB 3RIFF 3D18A 4MB4A 1U8KA 4HXBL 2ZOKA 4YC2C 5D7KD 1WZ1L 4H0GA 5JLZB 1VERA 3X17A 2UY6A 3WEXB 5TFSH 4ZUVB 1QFUH 3GGWB 5C0DB 1U8LB 1TTFA 4TNVK 3NPSB 3ARGC 1HXYB 2Y07L 4A6YA 1P84K 3SQOH 4YHLL 5LAXB 2F54D 2ARJQ 2EXYD 5GSVA 4J3OC 1K4DB 1LE5B 3TT1L 1UJ3C 2OTPA 5JDJA 4XHJC 3DV4B 5L88L 5FK9A 4UDTB 1NCAL 2B4CH 5I8CA 1NGQH 2WBJA 3JSSA 1Z5LA 4H1LG 3ZMRA 1RZFH 3TNNB 4L4TD 5CEYB 4WFHE 3MV8A 3SO3B 4RMWA 5CEZD 3C5ZC 3T0WA 3LD8B 1FORH 2VWEE 4X6DE 5DLMH 4AT6B 5D1QD 1JWUA 3PWJB 3VXRD 2UZIH 4N0CC 3U0WH 2YD9A 4MJ2A 4JJHA 5TQ0L 1GJIA 2FZ3A 3D39A 4ODSH 3ZSSA 5FKAB 3X12A 2VDLL 5EOQL 4KGLA 1FV1A 3FOLB 1BZ9A 2B20A 1J1OH 4WDIB 1I8MA 4K07A 2EDFA 3I02B 4X6BB 2LFGA 3WIIH 4CVZB 4D9RE 1AP2B 3KG5A 5IJKA 1HEZA 2QKIB 3QUYC 3FB7A 3DX6B 1EPFA 3OF6D 5ID1B 4FQXD 3RHWF 1Y18A 1AGCA 5E08L 3P11H 1A6UH 1J5OL 4L9DA 5I1HH 2AQ2A 3EOAB 3UTOA 3W0WB 1DUZB 1QKZL 5EPMA 4ZXBC 4YHZH 1OT2A 4HF5H 3CVHA 2BSED 4TNVF 1ZK9A 2YMXL 3W5MA 4EI5D 1QSEA 1RUAH 3IFNH 5HYEA 3B8YA 6CGTA 2DL9A 3DYPA 5IHUL 1X5GA 1WWBX 3JV5A 1IAKB 5FYLE 4NNXB 5HGDA 3IDUA 5EZLA 5HGAB 4W6YB 4FMFA 4F7TB 1MJ8L 3H8NA 2E7LA 2ATKA 5IB1A 4MJIB 1CU4H 1AQDA 1DLFH 1NCCL 4I48A 2P5WE 3UJJH 1L7TL 3SKJH 3KXFA 1RIVL 1KACB 2F5BH 5DQJA 1TZGL 3MA9H 3MLXH 2ZP0T 4QGYA 2O93L 4FQQB 1R3JA 1OP5K 5C0IB 2OMBA 1V7NL 3GMRA 3RVTD 3GBMH 1IILE 4WTWA 2P1YA 4P49A 1HH6A 4D0DA 2R2HB 3AXLA 5IFAL 3WKML 5TF1H 3SE3C 4W4OA 1BBJA 1KTDB 3UTQB 1OAQL 4IJ3C 4UTAL 3FQXB 1RQ5A 3SDYL 4LMQE 3RIAK 4ODHH 1T7WA 1TTGA 3MRHB 4P2RD 5FF6A 4JGMA 2H32A 4PY8J 4EI5C 1W72H 3VXOA 1T1ZB 2XRAL 2ZOKB 3MA7B 2X9WA 5E5MB 5F88A 4G8GD 2JCCF 1YDPA 1CGSL 1S7UB 4UDUB 3X11B 3DX7B 5DGRA 3RI5K 4U6XB 5MERB 3TVMA 4YDKH 3W9EA 4ZOBA 5C0CA 5D5MA 2UWEB 3PP4H 4G80A 4K8RD 2OL3H 4RBPK 5CWSB 1O0VA 3S5LA 4JFOB 4NWTH 2D0FA 3J8F7 4XCYB 1NLBH 4PJHF 1IBGH 3KPNB 5D7JD 3UTTE 1J10A 2CK0H 1OT1A 2DM7A 5IV2B 3MGOB 3OF6A 3O6FA 5I1LA 1B9ZA 4S2SA 3IS0X 4ZSOB 4Q0XH 1QRNA 2PETA 2C3WA 4HIHB 1BFOA 4F3FA 2BSTB 1IQDB 3MCLH 2IBGA 4FMKA 3UBXA 3P77B 4ZO8A 4XAWL 3KPOA 4LNVA 4DVBA 2BZDA 4ZFOB 4DOHB 4F3FB 1MCWM 5CSGA 2M8XA 4JPKL 1B2WH 4DKFH 3PWUA 4G8GE 1G9NL 2XWTA 3IXAB 4JFDA 4LHUG 2IAMC 4RGND 1BP3B 1DVFD 3LSOB 5B3JF 4JDVA 5LGHL 1MCKA 3JV6B 3F62A 2CLVA 2DKSA 2XA3A 3BUTA 4LSSH 5T1KA 4MAYD 5GRJH 2PYFB 3CFIC 4H88H 1NGYB 2V2WB 3Q5YA 5FGRA 3LPWA 3C6LA 1MHHB 5HD8C 3FMGH 3QNZB 2DBJA 5DJDB 1EFXD 2W0PA 3PF2A 3FFDA 2YWZA 1X5JA 1ZWIB 3QIWA 3GI9L 4JZJA 5EC1A 4HIEA 2WLZA 2E9BA 3MUGB 4C4KO 3V5DA 3FFCB 3O8XA 5KANI 5HBBA 2C1PA 4M43L 2O5YL 5DK0A 5HDQL 4GW4B 4PY7B 5EIVA 4OZHF 1W72L 5K9QI 1SMAA 5I1EH 3EYUH 3S36X 4XPAL 3BEWB 4PY7A 3UXFA 1KPVA 1L6ZA 4FXGA 4S0SD 1T1XB 2BCKB 1RUKH 3TVMB 1HSAA 5F6HI 2MTPA 2XKNB 2M26A 5IB5A 3L95A 5I1IH 4WDIA 1AD9B 2I9LB 1I85C 1FQ9C 3TYFA 4QF1B 4WWKC 5DEGB 1NFDB 3BO8B 5DF0A 1ZT7A 1YPZA 4ZFFB 4ZMAT 3MUJA 2VLJB 3VFTB 3HZMA 2DDQH 2VZSA 3RBGA 3TNMB 5E99H 2BSRB 1J8HA 4NUJA 5L0QC 3DSFL 2IQAB 1KC5H 4S1RL 4P2OB 4XB8A 1N0LA 3MV01 1QLEL 4JHWL 2AGJL 5FK9B 1AGFB 1H5BB 2FX7H 4WGVB 1FDLH 1OGAE 3KWWB 1IC5L 1MREH 1LO0H 4GW5B 5T5FH 2HWZL 3X13B 4XHQA 4L3AA 1TPXC 1JPGB 2VXVL 3DVGB 4LIQE 3TO2A 3RL1A 1V7ML 5BXFA 5HHPA 4RSVA 3F5WA 3IU4L 3EYSH 5ID0B 4E41A 3H3PH 4YHIB 4DKEL 5GSRB 5SWSD 3BW9A 2V5TA 4NRYB 1OTTD 2O5XL 2OQJA 1IGML 3C2SA 3GMPA 2WINB 5D8JL 4UILL 2NY5L 4XP6L 3OZ9H 2IPUG 3L3KA 3C2AL 3RZCA 1FLRL 4PJIB 1WJ3A 3MNZB 5T3ZL 5E7FA 1AR1C 3PHQA 5FYLH 1ZVSA 1DANT 3JWDH 1CYGA 5D2NB 5C8JB 1R3LB 4AIXA 5DEFB 4EI6A 2EXYC 5GGTH 4LSUH 3SKNB 4WFFE 2CXKA 3O0RH 1T1YB 2E7CA 2EDDA 4MNQD 1JZ6A 5DUPH 3G5XA 3WJLA 4WIQA 4ALAH 4PJ8B 3BUYA 2DTML 3GMOB 4LVNC 3MV8B 3QDGA 1F6AB 4X99A 5I1AA 2HLAB 3RKDD 4LVEA 3MLYL 3IDJB 3UTSB 1OAUL 4OLXL 3T8XA 3JWOL 4XXCC 3TO4B 2HFGL 4GS7C 5I8EA 2P45B 1I8LC 3HS0A 2R29L 3HRZB 4XNMB 1R5VB 3S6CA 1I8MB 2FO4A 1NCAH 1XMWA 4NQDE 2OYPA 5E8OB 5L9DL 4WHTB 3GSOB 4JZNA 1X3DA 4FZEL 4ODUA 1J8HD 4OGXL 4YHNA 5C0BE 1ACYH 4P3DB 4ZD3H 3ULSB 1X4ZA 2PO6A 4WI4A 2OLDA 4BQ6A 4AT6A 2QSCH 2AJUL 3FOMB 4M7LT 5JZ7C 1HHJA 3KAAA 1U3HC 4MA7H 3MRRB 3PQYB 4U0QB 1NGPL 5TQ2H 1QR4A 3K1KC 4PV8B 5L8JB 2AVGA 3D85B 4HW6A 3RZWA 4C83A 5C0AD 2K1MA 5JW3L 3MLTA 4M7LH 1JHLL 1Y6NR 4K9EC 4MX7B 5EBMA 3UO1L 5HVHB 1RZ8A 2NLJA 3TBSB 4M93B 3WDHA 3QI9D 1JWMA 3MR9A 3ZDZE 2MFNA 4WI3A 4WTZG 2EE9A 3FB8A 1M4KA 3V8CA 1YMME 3MCG1 5F7YC 3GGWA 5JQ6L 1NGXB 4UT6H 3L7EA 3KPRA 5AWNH 1T66D 5DT1H 5HXMA 5IMKB 1MWAL 4M9PA 1YECL 5EPMB 1T7VA 2BJMH 2ZCKH 4RMTA 1O5DT 5EFIA 3WKNA 2KZWA 4OM0H 3DX7A 3FT4B 5GZNC 5FIEA 1JRHL 4HKJB 1I8IB 3EIFA 5ANMB 5SWSE 3MV9B 5JXAL 5A2LH 2W9LA 4KMQA 2V7HA 4EQ2A 3A6BL 3BXNB 3H7BA 3MRPB 4N1EA 2PYEB 1D9KB 3DX8A 5J1AB 4G8FB 1C16B 3N1PC 4S1QL 2C7UB 2EEDA 3ABZA 5GZOC 1FHGA 4UU9A 1F4AA 4JEGB 2EDYA 4OKVB 3EZ8A 4JREC 4R0LC 4Z7WF 5H35A 3BJ91 1IAMA 5DHYB 4G7YL 4XVJL 1HCVA 4JO1H 4YBQC 3NIFE 1FH5L 1PLGH 2NY0B 5HHOD 4FQQA 1G7HB 3MQIA 3TJHD 1AR2A 1FYTD 1FPTL 3LMJL 3MUZ1 3ORJA 1CICD 3TBTA 5L2JA 3KVQA 3VG9B 1PX3A 1U6AL 4X98B 4YC2B 5DSCB 3QULB 2ZG3A 3QH3A 5KJRL 1G0DA 1T66C 1RZFL 1JGUL 3BKYL 3D2UB 3SDYH 5LGKA 4ZUVA 5GGVY 3E6HA 4WJ5A 3C5SB 1JNNH 2Z31A 1UVQA 1EAPA 3GJFB 4XX1E 3V6ZB 5TE7L 4X83A 3PABB 3AU1B 1KJMA 2HJLA 5CUSL 5E5MA 1CT8A 1AGDB 1CLZH 1MIMH 1RZKH 1T04A 4J3UA 1MCFA 1VEPA 4R7DB 5DUBA 1S9XB 4Y2DB 5IEHB 5KAQG 5MP6L 1MCJA 2EECA 5KZCB 3EYSL 2FNBA 1A7NH 3P4MB 1QP1A 2R0KL 2WV3A 3MLUH 3IDXH 3RX5A 2ARJB 2E8YA 3QQ3A 3RP1A 3ZKMD 1MHPL 1Q1JL 3ARED 5MENE 1QEWB 2H26B 4U1MB 1IAII 4MJ6A 1D5XB 2NY5H 3V5HB 3OX8A 1VB9A 4MD5A 4ZQKA 3O3DB 4NOFA 4X5LA 5DGQA 1MI5E 5HYIA 1LILA 3I6KB 3QFJE 3IFLH 1UXWB 1CE1L 2HKHH 1H15B 1BZ9B 5IW1A 1KJMB 2HJLB 1QBML 5KVMC 3GZKA 4JLRA 4EQ3A 3OKLA 4G6KL 4R96A 1DQQB 2FSEB 3PL6D 3QNZA 3VFSB 1GPOH 2NY0D 1CLOH 2A77L 3BD4A 4JY5L 4Z77A 1FJ1A 3ILQD 4X6EA 1L7IH 1RZKL 1AIFB 2X09A 3QH3B 5IVXB 4KWUA 4LLDA 2A6KB 4K3DL 3AREA 2FBJL 4JFQA 5CCKH 1CGWA 3ARWA 1RZJL 1NC4D 4D9LH 1WK0A 3JBG7 3IJYA 2H2SC 4NDMB 2A6KA 4H26A 4V2BA 3BP6B 4HC1A 4XT1C 4WGWB 1P7KA 4P23B 2G9HA 4RRPG 3I75B 3D25A 4CJ1A 1A7PH 4BKLB 4HUKB 4URTB 5DK2B 4O51A 5JMOC 5HI4D 4DCQA 1JUFA 1N7ML 4JFFB 5JIHA 5D71H 1Z3GL 2OJZL 1QA9B 3N1FC 4WENB 5A3ID 1MJJB 1DCLA 1C12B 3MSPA 2DLFL 3U0WL 1U8MA 1DQDL 1OF2B 4IS6B 4JDZB 3B6SA 2QJDA 4G8FA 5CLTA 4Q6IA 4CAGA 1DQML 4PRNA 5LWYL 3MRDB 5CJOH 3MRFA 4HWBH 4PTTB 4UINL 4S1QH 4FFWC 2UZXB 2B1HL 2CKBA 2HN7A 4HS3B 4N9GB 4U6YB 4E41D 2R2BB 4PBWD 3TYGH 4P9HL 4IDJH 1KIRB 1LO5A 4CN6A 3JTSB 4R2GB 2NY6B 1I8LA 5BV7H 2GI7A 5E2TH 1IM3B 1OPGH 1PJ9A 4LCWA 3KDMB 1NCWL 1FL5B 4XXCA 3OXRB 3T04D 1FFRA 3DUHA 5DVMA 4BSWB 1ZLUH 4Q97A 5F3BA 4Q2ZA 4ZNEE 3JUYA 5T1DL 2QBWA 5F9JA 4L4TA 1CL7L 1S7WA 3QJFB 3ZDYF 2BJML 4IOFD 3SDXA 4D3CL 2Q76B 1JF6A 1QFPA 3AB0C 3AS1A 3HB3D 2O61B 1JPFB 1T4KA 3LRHA 1GIGH 4HS8L 4RZCB 2WUBL 4Z7VB 5DSCA 1YA5A 1IC5H 1ZGLB 3BN9D 5E00A 5AUMB 1ORQB 5HI4C 4X8JA 2XWJB 4U2ZA 1INDL 1LEIA 4X6DF 2BVYA 1VPOL 4DVRH 2NY7L 1CQYA 4S1SH 1DBBH 4HJGB 1ND0B 3VGAC 1XGTB 3PDGA 5KVDL 5IFJA 3WXVL 5K59E 1QD0A 3HG1A 4QT5A 3C8KB 2BNUA 4NBZB 1FAIL 4EDXA 1AGEB 2D03L 2X6MA 2HJKB 1KUMA 4DK3A 2Z35B 5I74C 5C0JB 2PXYA 3DXAE 5E9DE 5JDSB 1BX2A 2X1OA 3GO1L 1FYTE 5E03A 2OJZH 1HQRA 4X5WA 1MVUA 1ZLSL 3VJ6A 1H8SA 1WSST 5EG6C 3MRKB 3VRLF 4X4XB 4M6NL 1RVFH 1GOHA 2NY1B 2VDQL 4Y4KA 3I6LE 3ULVD 4NO0D 4LKCA 4QO1A 3QPQC 1RMFL 4GKNA 5CJ5A 1NAKL 4G6JH 2XZZA 3QJHB 2ZJSL 5SWSB 4M1DL 4QRTB 3WFDH 3NFSH 3LOWA 3MRMB 1G9NC 2DIJA 4LPXA 1GZPA 4HWEH 2ADFL 5HHVH 1UZ8B 4JJ5A 4IRSC 1NSNL 3CU7A 1RZ7H 3R8BB 3MREB 5CEXB 5ESVB 1K85A 2M2DA 3QDGE 5CBEA 4MB3A 1IJ9A 1BF2A 2J6EL 3CGTA 5FA3B 1JNHB 1N6VA 3FKUS 3FQRA 5KSUA 4OTXL 4OJFL 1V05A 4C83B 4KTDL 2C3HA 1UKSA 1T22A 3IF1A 4LSTH 1JNLH 1J0ZA 2CUMA 3MLPA 3U6RA 4P2RB 5JQ6H 4JFFA 4E41B 2X4PA 1SYVA 2BFVL 4G6AC 3AS3A 4PGEB 3PV6B 1B2WL 2DN7A 1QRKA 1S9YB 3LKPA 4LEXH 1QFWI 5BV7B 2L0DA 3PGFH 4OB5H 3D2UD 3H0TB 1INQB 3NCFB 4NQCD 1HI6B 5GZND 3HCVA 3LN5A 1WBXB 3KPLB 4U6HA 1MCBA 1A6UL 4UQ3A 4J3SA 5IM7A 2FO4B 4MXQD 5ABDE 5EOCL 1D6VH 1DR9A 5AAWA 1CICB 2YC1B 5EULV 3TM6A 1AIFA 2I60L 4WY7H 3ULVC 2F58L 3VMOA 2V5SA 1UKQA 3FQWB 1S7SA 2YUVA 4PRHB 5TGBA 3NA9H 3SDDA 4U3XA 1OGTB 2R8SH 3H3BC 3DRQB 1BLNA 4OCRL 3T65B 4PRPA 1TVBB 3QEUA 2V9QA 1FIEA 5DJ0A 1YYML 3C6SA 3N1MC 3OKDB 3VXNB 5ADPH 2WBKA 3MBEA 1JF5A 3BSZL 3BKCL 1RIUL 4EDWH 1KT2A 4KJQC 4MXWL 1IAIM 3PL6A 3RDTA 4ONHB 4JFPA 3EO1A 3CFKB 2H26A 4L5FH 1HILA 3D0VB 4ELKB 2R69H 3PP4L 4NKQB 1J12A 1F00I 3RWIB 2DYPB 1XGRA 3C60A 3MOAL 1JV5A 5DR5L 5KJRH 3ZT5A 5LXGH 1Q8MA 2XQYK 5KS9A 4U1HA 3GSWB 4FQLH 5EBLA 5I8KH 1I9JL 5D1QC 5EC1B 5FXCH 1XEDA 2CUIA 4OFKA 4OZ4B 2BDNH 1YJDC 5IFAH 4KH2A 1A6WL 3RTQB 1ZA3B 4E41E 4TVPH 2P7TB 1A9BA 4OCSL 3KYMA 4MXQC 5DA0B 3QDAA 3X3FL 4NRZB 3NCJL 1T2JA 5BO1H 4H25B 3JZ7A 4OQ1A 4HWBA 3LZFH 3NH7H 3ETBF 5DFVC 5AZ2H 1I4FA 5KZCD 3CJJA 3CFCH 2YA1A 5EORH 3QUYD 1OAZL 5ISZD 4FQXC 4EI5A 4M5ZL 5D7JB 4CW1A 3WLBA 2Z31D 4GG8B 2VDML 15C8H 4U0RC 1G7MB 4FABH 3AREC 3QEHA 4KQ3H 3WJLC 5IFHL 1UEYA 4PJ7F 4XP1L 5ITBL 1D6EB 2J12B 4P48A 1MHCB 3SDAC 4GG6F 1MOEA 3JWNC 3HRPA 4JN2A 2A38A 1P7QD 5CSBA 4I5BA 1NCNA 2D0HA 5DJAB 4P59H 1JGVH 3WFHA 4XNQB 3QUXC 4PG9B 1V3MA 1FGNH 3PDDA 4R6UA 3W81A 4MAYA 5GRVL 5DJ2B 2Q6WA 1YN7B 1W8OA 1FVCB 3P4OB 4LLWB 1Q1JH 1DEDA 5J1AA 2JJTA 3TCLA 3G04B 3DHJA 2GHWB 3DXAB 2VSCA 3DYMA 1CD9B 5AAMA 5T3ZD 2VL5A 3S3PA 4U1GB 4G3YL 3OAZK 3B83A 1EUUA 3TGXA 4NWTL 3CLFL 3GBNH 2ZCHL 3BJLA 4OZFH 1KCSL 5CFHA 4QXUL 5F96L 2B1HH 2IADB 4WEUD 4TN9A 5D7SL 2GSIB 3SCMB 3KPSD 4P9HH 3KLSA 5LGJA 2YK1L 2NY2C 3O11A 4WHYH 1QHPA 1G7QB 1LEGB 1NH6A 3C60C 3S37L 2B5IB 1PEWA 2HAZA 3JWOH 3TZVD 1PBYA 4PRIA 5EZJA 4MMZC 3OQ3B 4YXHL 2Z31C 5I18H 1MFAL 1JZ2A 3U2SB 1OAYH 2FGWH 2APXA 2IGFH 1JPST 1NGYA 2V2WA 3BKJH 1ZSDB 1TENA 3DX9A 7FABH 1XF1A 3LPGA 2CIKB 2FLBT 5DMIH 3STLB 5JW4N 4TUOB 1Q9LB 3H9YA 5ENWA 2P24A 3AFLA 1W0VB 3Q1SL 3RUGA 3VMNA 3T09A 5C0IA 3MOQA 4X7TB 3KPMA 4OLVL 2OCFD 5CJQL 43C9B 3KNBA 4LSVH 1DQLL 3AAZA 1XR8A 5F1SA 1FFQA 9CGTA 2DBLH 1HHIA 1MHEA 1BJMA 2ZUQB 2W0FA 3QR2A 4RQQA 1TCMA 5IB4A 3P9MB 1HHKB 3O4LD 4OZGB 5D6CB 5TFSL 5C7XL 1E4WH 3G6DL 4RFNC 1D6EA 5IESL 5B22A 2NW2A 1C08A 4W6XB 3SY0B 3TBYB 3KPQA 1IL1B 5I2IA 4UT9H 4TSBH 4IHOA 3LKNB 3O8XC 1F3RB 5E4EC 1I7TA 1KELH 4NQCE 1LVEA 1I1AB 1MH5B 4RGOL 3VXUD 1T5XA 2EE6A 5D5ME 2OI9C 3RWHB 3JWDL 2H6PB 43CAB 1M7XA 1IE5A 3NCEB 3P0VL 3MRMA 4NKIL 1I9EA 5FGBA 2CGRH 5DTFA 2FEEL 4UT6L 2Q8BL 1LEKB 2J1KA 1FGVL 1I3RB 3B9KB 1QLEH 5GGTA 1EO8H 4QNPF 4C56B 2A73B 4RGNC 1WEJH 3DNKA 2LQRA 1U95B 3WNNA 4L8SB 2AXGB 3C5ZA 4AEEA 5DMGD 3LEXB 1HZHL 1EHLH 2AS5M 5EDXA 1WV7T 5L8LB 4DKDC 1C1EL 1S8DA 1XF3B 1U42A 1KXTB 1TZHB 2IQ9L 3EUUA 4I0PD 3O9WD 3O2VH 4OZFG 5TE6H 3V7AG 1HN1A 2A83B 1NCDL 5C2BL 1MJUH 2Z4QA 3T1WA 2JLLA 1X5HA 1BAFL 2F54B 1F4YL 2XT1B 3NFPA 3VFVA 1KNOA 3FT2A 2JJSC 1FIGL 4OD2B 5LWYH 4KFZC 4HH8A 3O6FC 5DJYB 3MJGX 4K7PY 1F3JA 1WISA 4MDJB 1XGUB 4P9ML 2FIRT 2JK5A 3TYGL 3V4PL 5KS9F 4Z5RA 3ULSA 4UDTA 2VISA 4KVCH 2ZSWA 3PHOB 5D2LA 3I50H 3BKMH 2PTUA 1H9VA 4P4KB 4CUCA 3WHXA 1CDBA 3ROOB 3O6LH 2N56A 3WV0A 3T0BA 4K94C 3BEVB 1OVZA 4QRRA 2N7BA 4NNPL 4HXAL 4MGXA 5EZLB 4ZODA 4Q7DA 5C0EA 1XGPB 4RMSA 3WHXB 2DTMH 4QOKE 3IS1X 3FCTB 4U2YA 2L4OA 1QR1B 5CGYC 3RI5F 3T0EE 3LPFA 5J1SC 1RURH 1BBDL 2VJXA 3EYUL 3VRIA 4JRYE 4LLQA 4X99B 5I1AB 5IJVA 2D31B 3GJEA 2VLLB 1UM4L 3QUMB 2I60H 4NN5C 4X7SL 2GSIA 2ENSA 1PQZB 3QXWA 4JPWL 1C5CL 2F74A 3F7YB 3WIHL 1U91A 3QFJA 4Z76A 1S7QB 2CXGA 3O9WC 4UBDD 1YEHH 4K94L 2AI0H 4ETQB 1OAXH 1EA9C 5J11C 2DIBA 1IAIH 4PREB 2HJFB 2CRZA 1V8HA 4WUKL 2NY5C 1LO4H 2E5EA 4IRSB 3OR7A 1QLRA 5E5UB 3EGSA 4GW4A 1KFAL 3QO1B 1CXFA 1WEJL 1FVEA 3NCMA 4L3CA 5TDPA 3VWKC 3JV4B 3BT2L 2G75A 3CVHL 4G6KH 4RX4A 1B4RA 4FFYH 3KJ6L 3TEUA 3UTPE 5IJVB 3ARBA 1LO0L 3O45B 2EYTB 2BMKA 2AK1L 2DMKA 4GKSB 5T3ZE 1MRFH 4XPGL 1ZA6B 4JHWH 1X5LA 2GJJA 2ZUVA 4L29A 4Y4HB 4L3EB 5DK2A 3TN0C 4AIZA 3N9GH 5LCVL 3FFCE 4JM4L 5E4IA 1JFQH 1R3HA 1A7OH 2BC4A 4OFPA 3D87B 5T1MA 2YHGA 3PWVA 4KJQD 4YE4H 3VWJB 3LKNA 5CEZH 4NFDA 1J5OH 3MACH 1X4YA 4LLYB 2CKBL 4BYHA 1CN4A 3QNXB 4ZXBA 3HUJA 4GSDH 3CFCL 3N85L 5LXGL 4X4YA 2AQ1A 4HJJL 1YQVH 3KS0J 2ICWB 3MV7A 3ULUD 1FN4A 2BSTA 3U0PA 4MCZA 3LV3B 1YC7A 1JI1A 3ZDXF 4MJID 4WWKA 5F1IA 1VHPA 3AAZB 4OCWL 4RCAA 1JNHA 1AO7A 1JPSL 1OM3H 1A3LL 1FFNB 4LCWD 4Z7WA 2XKNA 1YMMB 4ZYKB 1UB6B 2EDEA 3G5ZB 4NO2B 1OCWH 4G7YH 1QFUL 5JIIA 2ZUYA 1T80A 1R3IH 2VDOL 3NPZB 2C3VA 1G6RH 2CDFB 4OCRH 2LE9A 1FVDA 4Y5YA 3U82B 4HKBA 4U6XA 4IMKC 3DURB 5SWZD 3TN0B 4UOJA 2WM0A 2D3VA 3UTTB 3BMVA 2FATH 5E2UL 3HLAA 3FMGL 2GT9A 1P1ZB 1EH9A 1JHTB 4GSDL 2H6PA 4DZBA 2JE8A 1DFBL 1AXTL 2NTSP 1UJ3A 3ARGD 3STZB 3TO4C 1N59A 3QIWB 1A9EB 3EJZC 4JVUA 3QDJE 2NNAA 1BVKB 3SE4C 1P6FA 2AJXL 5D7LD 3UTQA 4PYHA 3BOVA 2GY7B 1WQVT 4LLYA 1B0RB 4I9WD 3SGJC 2HLFC 4NRXB 1FGVH 3T0EC 3UTPD 4HFWB 3BGMB 1AGEA 1X6NA 3OKMB 3UTZB 1JK8A 2Y25A 2VZTA 2JIXB 5EZOH 1H8OA 3D0LA 2MWCA 2R23A 3C5ZD 3NN8A 3VCLA 3TC9A 1T20B 5IB4B 1L0QA 4LBEA 1AY1H 4XBGA 3I2CL 4LHUA 4RBPH 1T89C 3L9RA 2VDNH 4LBEB 2GW5A 4X7SH 1NUDA 3PGFL 4OB5L 4EUPB 5EU5A 1CDHA 4WCYH 4BZ1H 5KAQF 5IB1B 1NFIB 2DM3A 1HHGA 3PXHA 3LIZL 8FABA 2CDGA 1BD2A 1T4KB 3HUJB 2VLKD 4OCXL 1Q9OA 5B38A 1QRNE 4E42A 4UIKL 2L7JA 3ILPA 4KRPC 4N8CH 3ULVH 5GZOD 1CDYA 5A40E 32C2A 1IEAB 3QIBC 2V2TA 3EAKA 4MJIE 4HUUB 4NZRH 4OD3H 4MDIA 2APWA 4NWUH 4YXKL 3DUUA 1ADQL 3ZHKA 3WFCH 4W4NA 1ZLSH 5BVPL 4LCCB 3ZTJH 1JGDA 3SO3C 3GUTB 4L4VD 3PGDA 3L3JA 1G6RL 2RBLA 2FX8L 4NQED 4BA8A 3M1BB 3QHTC 2X4OA 4XVJH 2BY2A 2FEEI 1OB1A 3QB7C 3C60B 3HE6D 1N8ZA 1NBYB 1CCZA 3V79C 3QCTL 5J6GB 3GBML 5GGSA 2DF3A 2FDBP 1QSZA 2EKSA 2EDLA 3VGDA 2HTLD 2LVEA 4UB0L 3KLHD 1KCSH 4U6HB 4XP5L 1WBXA 2ADIA 3MLXL 3QEQA 2EZ0D 2H32H 2ICCA 3H9SD 3ZTNL 4Z6AT 2C5DC 1CXHA 4Y2DA 5IEHA 3IRPX 4HH9A 4PV9B 2APTA 4TTDD 1XF4A 4LVOC 2CGRL 3ZT7A 5EUKA 5IG7A 4HC1H 4LF3B 5E9DA 4E0RA 3BZEA 1DZBA 2FWOB 1XR9A 4NKDB 4ZTOL 5E1HB 4Y1AB 1RJYA 3ZYJA 1A7QL 4ODVL 4RA3A 2AK4D 3LRSB 1XGPA 1EHLL 4NZUL 4ZUSB 1UENA 4MCYB 4HK0A 4Y5VA 3IB4A 3KYAA 4H5SA 3FONB 3VXUE 2OL3L 5MEQB 3S4SG 3FAXA 4KI5E 3V2AR 5FV2A 4I0PC 1UACL 5ETUB 1S9KC 3QJFA 1BIHA 1F42A 3MBXL 3U79A 1JGEB 3CFBA 3VRLE 4H0IA 4ODWB 1S7VA 1NCUA 4FS0A 5EWIL 1QKZH 2ED9A 2B4CC 4OFYA 5J6HA 4GFTB 3WFZA 3VFWA 1NGZA 4JKPL 5BZDB 4P4RA 3RDTC 4Y19A 4KJPD 3OAUL 2NQCA 2HJFA 3VXSD 3HC0B 3SKNA 3GMMB 1YMHA 1I1AA 4HGWA 5EBGA 5KSAB 2BXYA 5CEXA 2YD2A 2KPNA 1NUFA 1OW0C 3HC0A 1OP9A 3H7LA 5AD0B 5F44A 1CGSH 2P5WA 5I8KL 1OAXL 25C8H 4Z7UB 1CT8B 1OCWL 2D03H 1A6TA 3WYRA 3PWPE 1BBDH 4J1UB 4C56A 4IM8A 2W0FB 4HLZG 2NTFA 3MCKB 3PWPD 4L8CB 4NN7B 4PJ9C 3EYOA 3NACH 2EXWD 4OCYH 1N7MH 3B4NA 1PAMA 2UUDK 5EO9A 1UM5H 4X9BA 5C70A 4K2UL 3TJEH 3GMLA 4WFGD 2PCPA 3T0XA 4NNPH 4EIGB 5HD8D 5HI5D 4JO4L 1UB5B 3SBWA 3OAYK 3GJFK 3GB7A 5IG7B 4KZDL 4P2OA 4P5TD 3ARGB 5SX5H 1TITA 2IQAA 4O5LH 1PZUB 5BVJA 5I30L 5C92A 5DDHA 3LQZB 1FO0H 1MFEH 4HUWA 3WD5H 1X5YA 2EDTA 3BP7B 4KJPC 3TA3D 5GJSL 1NCDH 4Z7QF 3L9RB 1CL7I 3ZE2F 4OF0A 1IFHH 5KSAA 5F1OB 3CUPB 3EZJB 4K94H 5J6GA 1KGCD 1ZGLA 1R5VA 1FNGB 1TCRB 2YD6A 3WIFB 2QSVA 1YEIH 4IJ3B 4M9OA 3TF7C 4Q58C 4CGTA 3WUWA 3VD4A 2J2ZA 5D4QA 4HPOL 3V4UH 3IETA 4HKJA 3HNVH 3FHAA 5D72L 2HTKC 3UEZA 3QQ3B 1GC1L 3BD5A 3GSNA 1J1OL 4LLVB 4OLYH 4N8CL 3MJ7B 1U2CA 1U3JA 2VRAA 4FFZH 4N8VG 3X3GL 5H94A 2XTJD 3NCYS 4LCUA 5C0CE 2FEDC 3TFKD 1BJ8A 4ISVB 1XFPA 3U46A 1PYWB 2RGSA 3A67H 3TBWA 4Z18A 2WANA 4PLKC 4RNRB 4F37F 4D94A 1N6UA 3QG6B 4HS3A 4L4VE 1PSKL 1WCBB 3MZTA 4TUJA 2XKUA 5KVGL 1MEXL 2P5EB 2DLHA 3QAZB 3EFDH 2R1YA 5GIRA 5J12C 3U9UB 4YDJB 5GRVK 3TA3C 1HKFA 1C12A 4LGRB 5F7LB 2NX5A 3QPQD 2O5ZL 1RIUH 1HNFA 2B7DT 5HHNA 1IAIL 3MLWL 3OKKB 5EU5B 5E7BA 1HNGA 1KB5H 4HV8B 2OBGA 5JPNB 3NZHL 2XZQH 3RWDB 3OMZA 4JLRB 1WZKA 5IW1B 2ORBL 4NM4L 2DBLL 4MWFA 4J3VA 1EO7A 2DQFA 4IRSD 1IQDA 4PB9L 1RV6X 2O61A 1QRNB 1SEQL 4QXGH 3SGDH 3WSQH 4MXVE 1KJVA 2WWKT 3ARDB 3GHBH 1KG0B 5I75C 4K3JH 2X1XR 4K71B 3QO0A 4PGCB 4KKLC 3MYZA 1BVKA 3QP3A 2NNAB 3DRTA 3P9WB 3S98A 4PGDA 3HZKB 4Y1AD 1R3KA 4QHLB 4ELMF 5F3BB 2H8PB 4R7NA 3TWCL 2DQGL 1AQKH 3G6AB 4YGVA 2YRLA 5CJXC 3G5XB 1PQZA 3EFFB 1DQJA 2WLYA 4LNRB 5D1ZA 1FPTH 3LKSB 2KQMA 2YD8A 1UYWH 2W60A 4HPOH 3MGTA 1VESA 1NGXA 1IMHC 4XP1H 1N8ZB 5FOJA 2BNQA 4HJJH 4JANA 4ZQKB 3ARDA 3DUSB 3RIAF 2VDPL 3GMQA 3VI4E 5FO8B 2VZUA 3B6SB 4IS6A 3KR3L 4JDZA 1XGYL 4LK4A 5C08D 2GTZA 2N7AA 1N6QH 4J2XA 1BAFH 2I9TB 5B38G 3TVMC 1I9IL 1I7ZB 2Y7QA 4JDTH 3MXVL 4U1LB 3E2HC 3WFHB 4FXKA 1GH7A 1AXSB 1MQKH 2EC9T 5JPNA 5GGUA 5DK0B 2IH3A 5ELIA 2CO7B 3DYOA 4LF3A 3Q1SH 5E9DB 2ZOLA 5E56A 3C6SB 1Z0MA 1KLGB 5FYKL 1A64A 3OXSA 4WI2A 1JYNA 1I3VA 4FZ8H 1XF5B 4DUXA 4NNYB 4OF6A 2R1YB 5FO7B 2W91A 4HFUL 4NDMA 2ZNWA 1E0OB 5GS2D 5FGSA 2B1AH 5H35B 3S34L 3T0VA 4NRXA 2AEWA 5B4MC 2AEQL 1QVOA 2VZ1A 3WN5C 4R4BB 3GSOA 4M6MH 1IKNC 5CZXC 4OGXH 1U3ZA 3FQRB 2GJ6A 2LVCA 3QWOA 4HZLA 2VQUA 4Y4FA 5L2KE 3FT3B 5L88H 2A74A 2EEAA 1OTUC 4R3SB 2VDRH 4AEFA 2A6DB 2Y06L 3HE6C 1UJ3B 3WXWH 3KPLA 2WW8A 2QSQA 4L3EA 5FYJE 1KN4L 4PJFE 3OKLB 4HWZA 3QUKB 2GYSA 1T3FB 5BZWA 1UWGL 1H15A 3EDDA 5GPRA 3T0AA 4K3EL 3HMXA 1FRGL 5FHAH 5DVLA 2MJWA 4L3ED 5FCSH 5I1KH 8CGTA 4PJ8A 4ZTPH 1E4XH 4NP4H 5EA0H 3STLA 3RVTC 5EB9A 1I9JH 2DYPA 3CZFA 3NOIA 4FQCH 3UC0L 2QLVB 1OL0A 3HPLB 3OB0H 5C09A 2VABB 3GNML 5I1JH 1N5YH 3UDWA 1ZHBB 2DRUA 2E3VA 1S3KH 4NSKB 1IT9L 4QOKB 2DQCH 5CD5D 3L5JA 4PB0H 3PXJA 1TZHA 1BX2B 4PJEF 1JZ5A 1DL7L 3IDIA 5D7LB 3THMH 3BP5B 4YHML 1JRHH 3A6OA 1KEGL 1HINL 1SVCP 4U7SA 4LDOB 3S4SA 2CDGB 3RZCB 3D69A 3IDGB 3MZGB 2MOVA 2R1WB 2I27N 2AJSH 4YQXH 1FC2D 1U8HA 4ZXBB 1ETZA 1HOCA 3LAFA 4LKCB 3PDOA 4CDGC 4ODWA 3F7VB 4QGTA 1AGBA 1S7TB 5BS0B 1I3GH 3RJQB 1RZGB 4Y16D 1U3HB 5J7CC 5C08A 3QT2A 3BWUC 4OZHE 3CXHJ 3VFNB 3OAUH 2EYSA 1BGXL 4WNQA 1N3NB 2J4WL 2V17L 3FN0H 5D7IF 2CIKA 1KTDA 5FM8A 4PJEB 2UUDH 5JA9A 2BVUA 4QWWD 3AXLB 1B4JH 4R26L 3I2CH 3OB8A 4PJBA 1EVUA 3SCMD 3VRJA 4OLXH 1PKQE 3F58H 1DJSA 2R4RL 5EU3B 1P53A 2E6QA 4MJ5A 5CEZE 3NIDE 4JQVA 5EU6E 1S78D 2J8HA 3T0EB 2OSLB 5AYQA 4O2EA 4I0PB 4Z7UA 5C0RL 4KKNA 2WQRA 3HKFA 1MCQA 3BQUC 4KY1L 1DP0A 4ONGH 4DQOL 5I30H 2LAAA 1YUHB 1H3VA 3FN9A 4NJAH 5TH2A 3RVXC 3ZTNH 5D2NC 3LS4L 1DVFC 4R8WH 4AMKH 4ETQA 4IDLA 2FB4L 4MVBD 1Q9LA 2R0ZL 2Y6SC 2PYEA 5IOPA 5K9JH 5C0CB 2EXWC 1CGXA 3QFJB 5EOQH 1ONQA 3O2DA 3DBXA 2VZ3A 4OV5A 1MLBA 1MPAH 5GS1C 3L5HA 4GUPA 5MEOA 4MB5A 3SJVE 4LLMB 3HI1A 5J8OA 4JREB 3NABL 2RHEA 4O5LL 4QTHB 4XNQA 5GXBB 3PWLA 5MI0C 3OR6A 1XCTA 2Y72A 1CFSA 3O4LE 1FL5A 1MAMH 4HWUA 5T3ZH 1KENH 1F90L 4P2YA 3TO2B 2W0LA 1I8KA 5ISZB 5EUOE 4LOUC 3QZWA 3BZFA 1RJYB 2YWYA 1CXIA 3DOSA 2HT2D 1FLRH 1QPPA 4HCRL 3SEPA 4KXZH 1R3HB 3MNZA 1HHKA 4XVUD 4PP1C 2Y9RT 2DQDL 5ILTH 1YJDL 4MQ7B 4OZHA 4OZGA 5C86A 1FJ1B 4GRWH 4ZFFA 1JN6B 2VN4A 3MRNA 4OF7A 1NFDA 1AXSA 3BFOA 5K93A 5C9KA 4NN7C 3FRPA 3ARZA 4PJEA 1IGCH 4AIZB 3WNMA 1HYSD 1ZVYA 2VIRB 1DBJL 3VG0L 2G75B 3BPOC 5KN5A 3V0VB 4G42B 1P7KB 2DI8A 4CNIA 2JIXA 3PHOA 1N64L 5AZEH 3B2VL 4FRWA 3CSPA 1BMGA 3QHZL 1F02I 4OF3A 3QPXH 5DWUL 4ACPA 4AYFA 2W65B 1RHFA 4OJFH 1JZ3A 3BRFA 2EE2A 4BFGA 4ZD3L 1LEKA 3O11B 2DQUL 1J11A 5IVXA 5DZOA 3V6OC 3MPCA 4JN1L 5D1ZB 5HTSA 2XPGB 4JHAL 3S4SB 3WEXA 1QBLH 3BP4A 3T3MF 1E6OH 3K7UA 4PJCA 1UM6L 2PO6D 3FZUC 5HI3D 1AI1H 4APQA 3SDXE 4N9GA 1P2CA 4U6YA 4F15C 7CGTA 1Z6JT 4LPCA 4PP2B 4GUPB 1KSRA 5LQBL 5KS9B 2FL5A 1U2HA 4MJ4A 5JW4R 3GEWB 3GSQB 1FVCA 2GCYB 3P4OA 5I1KL 2ITCB 3H9HA 2Q6WB 1QNZL 1D5BA 2VERN 4QY8B 1TFHA 5GISL 5I73C 3T4AA 1L9MA 1LDPH 1U8PA 5BRZA 1IGYB 1WBZB 5HYFA 5JTWA 1XH3A 2PR4H 4YLQT 3VU2A 1JWUB 2V6HA 4KKAC 1ZTXL 3U7YH 3QDGD 5D9SA 4XXDA 5HHNB 5DD1H 4C56D 2ZCLL 3FFCA 2E9WA 1DDHB 3V5KA 3CMGA 2XZQL 4OUUB 4DVBB 2H8PA 4R7NB 3DVGA 1Z3GH 4O4YL 1TJHL 4TULL 2DJ4A 3K2UH 3UBXB 2OR7A 3SE8L 3BYYA 2FO1A 3IJYB 4GMTH 1KNOB 3FT2B 4FQJL 5FECA 4KKBC 3ARVA 4GG8A 5HGHB 2C4FU 1J0YA 1KB9J 2DWEB 3WLWC 1BFVL 5HYSB 2BRQA 1C5BH 1JFQL 1KJVB 1I1AD 4PRIB 5EZJB 5HGHA 1X5ZA 4ELME 3CLEH 4YR6B 5C0BB 3PWVB 4KRMB 5DR5H 3LS5L 3T08A 5E6YA 3PNWA 4YE4L 1D7FA 1RJZB 4BH8A 3FO0H 5HYJE 2IC2A 1YY8B 4NJ9H 1G9ML 3MXWH 2AEPL 2BSSA 2UWEA 3K1DA 3GKWL 1I1CA 3LN5B 5EN2B 3VG0H 1TJIL 1OLZA 2R9HC 3WS3A 4QF1A 3N1QC 3QUYB 4RAUA 2UVEA 5D9SB 1E28A 4TSAH 4S1DC 5SWSA 3S34H 1NJ9B 3HI6L 3MJ9A 2Q3AA 5CP7B 3TN0D 4PRBB 2G2RB 1QOKA 2VKWA 2XZCL 5DVKA 4HG4K 2Z91B 1E4KA 2JJWA 1BFOB 3OL2A 3AC0A 4FFYL 1TQCC 2GCYA 3RY4A 4WI6A 3V6OA 5DRXB 2X4NA 3RTQD 4YDVA 3RPIB 2DI9A 4FZEH 4MNGA 4M1GH 3OPZH 1YMMA 4V1DE 5CP3H 4BH7B 1F2QA 2C4FT 3WDJA 3QXDA 3E8UL 5CINH 5EU4B 3KPQB 5LGJB 4G80B 3T2QA 1FFPB 4MSWB 3EDKA 4WEBL 3U4EA 2Y1VA 3EFFA 5CUSH 35C8L 1DBAL 3C6LC 1MI5A 2OJEA 5IR1B 5CIPA 4CADA 2OZ4L 1RZJC 1RU9H 4M1CC 5DD5H 4H8WH 4LRNL 3SGKC 3QUKA 5J57B 1Z9SA 3BPLB 2RIKA 1OAKH 2VITB 3C5JB 2E27L 1LP9F 3ME0A 3HNSH 3VFNA 1KJ2L 2QQQA 4HMDA 5C0FA 4PRHD 5JW4M 3QI9B 4NPYB 4O4YH 4NNXA 4P4KC 2R4SH 4G5ZH 3LV3A 5CD5C 3CDYA 1P9MC 3QA3A 4L4VA 2GITA 1G1YA 4B50A 5BOZG 2FHFA 2HLAA 3CDFA 5A16A 5IT2H 3PQYD 3CC5A 1XF5A 2ERJB 3QXUA 2VLME 4ZPTA 2X41A 4OAWA 1L7IL 3QNXA 1G7MA 3B8SA 1WBYA 4XVTH 4XCYA 4JY6A 4FXKB 4KDVA 3CIQA 1DLHB 3LHPL 1D5ZA 1WGOA 4F9LA 5IB3A 1T0MB 3BN3B 4XX1G 2FJGA 3KXFE 1PYWA 5K33A 1BGXH 4J7RA 5J3HD 2I25N 3MRJA 1A21A 2ZNXA 3T8XB 5C0RH 1YN7A 3UTSD 1UH2A 4CVUA 5C07B 4K3HA 1T2QL 4HIXH 2GK0B 4TRPL 3BQUA 4YXLL 2W60B 15C8L 4IIQB 4XTRC 3SCMC 2H32B 2F15A 4P3CH 2IFFL 3HR5A 5KTEH 5F21B 3ALPA 4L9LB 2XWBA 5IVZB 3VGBA 5I0DA 3SE3A 12E8L 4MCYA 4MJ6B 5IP4A 2IWGA 3U36A 5BXFB 3WIFA 1NC4B 1BWMA 4LPTA 1HDMB 4UT9L 4AQ1B 1MFNA 2EDQA 2AJ3B 4YDKL 4P4KD 3THML 2V2TB 2DYPD 3QIBD 2NY1D 1VFUA 4HUVA 1YUHA 3CH8A 4JDTL 1IL1A 5I2IB 4JQXC 3V4VH 4WHCA 2I07A 1GHFL 4OGYL 1S9YA 3GK8H 4ZTOH 3IXTB 4RGMB 1DN2A 4MNHA 5K9KA 5ITBH 1BOGA 3V7MA 5C0DA 4Z77B 1ND0A 4KZDH 4JGUA 1OSPH 4ONOA 4DN3H 5MHSD 5J13B 5F7WC 5IFJB 2E7LC 4KK8C 1QBAA 4WJ5B 3QBTB 2AV1A 1L0YA 3LKOB 2NY0C 4PJCE 2DMBA 5C0EB 3DVNB 4PS4H 5EBLB 5CEYA 5DRWA 3O3UN 4F33A 1F3DH 2N1KA 4FXGB 3QZWG 1EBAA 3IDNB 4PD4J 5FAAA 1INQA 1C8PA 4ZUUA 1UT9A 5E5RB 2HT3C 3GKZA 2DQJL 3B9KD 4RIRA 4KI5D 1SVZA 1HCFX 4NC1E 4CADB 4OLUH 5HHMB 4O9HH 1YPZB 2XOTA 5JMRA 2VB5A 4HT1L 4WO4D 3K8LA 1ZGLP 5JOEA 1F4HA 4LVHC 4P5MB 3RWHA 3TZVC 4CVWA 4HIJA 4MDIB 1OQOA 4J12A 5IHBA 1N5AB 1I1FA 4OM1H 5K9JL 1HEZB 3SDDB 4DJMA 4NSKA 5I15L 2A0LD 3O6LL 1A6VL 2R2BA 3I50L 4JM2C 3P3YA 3GM0A 3MRDA 3DETD 4ENEC 3L3DA 1EO5A 3BXNA 1YYLH 3TV3H 2NMSA 5AZEL 4ZO9A 3C8KA 3O4LB 5D96C 3WN5A 4MMXC 2H9GA 4MYWB 1HE7A 3P4NA 2EO1A 2OQJB 4M1GL 5ACZA 4R4NC 3T4YB 5GS0H 5DRNA 1CFVL 4U1KA 4WHYG 3SHSA 4OAWB 4PD4K 1T1WB 4C54A 3VFOA 2APFA 5F6HJ 4MQSB 1JUFB 2NZIA 2V5RA 2G9HB 4NO0B 4JY5H 1FLTX 4GBXD 4BKLA 4DGYH 2DI7A 4PJ7A 1ZLVH 2PNDA 3D3VB 3GSNH 1EEYB 3D1MC 3MRBB 2Q87A 4IHOB 5E8DL 3JTTA 1ES0A 5KSVB 4WUUA 1CGTA 4NBYB 5EO0A 2OS7A 4M8QA 3WS6C 2PCPB 3QULA 5F72S 1MI5D 4LVHB 4OCSH 4K9EH 3BN9C 4Z8FL 4U3CA 3MFFB 2A9NL 4HJGA 4WWID 4WW2A 3D18B 4X6FA 4U49A 5FHAL 4GMTL 4U1IA 4F57L 2AJVL 3TWCH 1QO3A 1OAUH 3QUXB 3L5IA 4OLWH 3EYVA 1MFCL 3E0GA 1MRCH 5I16A 5L7XL 4NCC1 4C59B 4I18C 4TPRL 3HE7C 3G04A 3EO9H 4NFBA 1KCRH 4RDQG 4XMLH 5E2UH 5F9WC 1SJEB 3OJMB 3VXPB 1ORSB 1F6LL 3W0WE 4U7MA 5F9JB 7FABL 1EEUA 1J8HE 3P4LA 3RNKB 5K9OA 4KDWA 2VDQH 3DVIA 1WZMA 2Y4SA 1CE1H 4KK6D 3VXQA 1OTSC 3WE6A 3ZDYE 4GBXA 3W9EB 1AI1L 3DUUB 3FFDB 1NQBA 4XWOD 1R3JB 3F7RA 2R0WH 1LQSR 2UVFA 3GO1H 1BJ1H 3NAAH 3RPKA 4XI5C 3CMOL 2VOTA 1GAFL 1XGTA 4RAUB 1IQWH 5D7LE 2Z31B 3G5YB 5MENB 2P47B 4BQCA 4PJ5D 4HUMB 5L2KA 4FNLL 4CNIB 4LVOB 4LGPB 2X4QA 4DZ8B 5DHVA 5LBSL 1M1SA 3ARFC 5DJ2A 1U8QB 4WEBH 4MXWH 3KS0H 2VXVH 3QIUB 4IRZH 2YK1H 4L29B 3F12B 1C7SA 3OG6B 3BW9B 2XZAH 3Q3GB 3QWRD 3ES6A 5M95B 3OKOA 2BFVH 1PY9A 3K74B 1L9NA 4DGIH 1G9NH 3ALWA 1A5FH 5IMMA 1J1PH 4JN2B 3E3QC 4Q0XL 3A6BH 5AYUH 4I77L 5ICZA 1KF9B 3IXTA 5I6XB 4MNQB 4G6AD 4MD5B 4HH9B 2OK0L 4FTVD 1KEML 1D9KD 1C5BL 3BRDA 3S8WA 1N6QL 2PO6B 3QDHA 1ZS8A 3KYKH 5A2FA 2C7UA 2OM5A 4YHYB 4W6WB 3OJVC 1MWAH 2JJSA 2GFBB 4JFED 4A6YH 5GS3A 5JHDA 1FE8H 3ULUE 4KK6C 1QACA 4U1GC 5E8PA 4F7TA 1VADB 3MREA 4QNPE 3S96A 4WW2C 1J18A 3W39A 1Q9KA 4QRSB 3NMEA 4LCWE 2FH6A 4J6RH 5BV7L 2HG5A 5KSAC 3VXME 4U1NA 3T65A 3V6ZA 1BFVH 2CSPA 5IW3A 3U4BL 3CVHH 3BGAA 1DEEB 2P5WD 3CK0H 1JGEA 2GIYA 5A2JH 1QA9A 5IEKA 1FL6A 4G6JL 3PGCB 1YEKL 3WFBL 2QQNL 1NGQL 3FCTA 4HIIA 4OGAC 1EXUA 3OV6A 1T0PB 1KLUA 4ZOAA 3OR7B 2R1XB 1CGUA 4NUGL 5HSFA 2OL3B 1FNGA 1TCRA 2JELH 3GMNA 3UPRA 3H9SE 3WNKA 3KJ4C 5BMFH 2J8UF 3HCVB 1KENL 5C0BD 4P5KB 5C8JA 3EOTL 3T3PF 3MLWH 4HKZB 3V0VA 5FYJH 4HSQA 4WV1A 1XGUA 3MODL 1FE8L 1HHJB 1AGDA 3C09C 5IWLC 3UP1A 1LGVA 5ICYA 1QBBA 1CVSC 4MQXC 5EU3A 4I9WE 2F53A 3EO0B 1OAKL 1BM3L 3BZDA 3NZ8B 5TGBB 3V4VL 4J6RL 5MEND 3FQWA 2W0KA 2XNAB 3GIVB 4Z78B 1OARH 4OGYH 4ZS6D 3PWJA 1FFOA 3TYFB 2ATKB 4LHUB 5I75B 5DFWH 4UT7L 3HN3A 5MEPB 5ESAB 4DGIL 2JF1A 3HRZA 5DFVD 4UV7H 1QSFE 4PJFA 5E94B 3EDEA 1A6ZA 2GUOA 3HI5H 2D9CA 2JK5B 1MWAA 1S7WB 1U8HB 5FOBA 3P30L 2ZUXA 4LASL 3PJSB 2G5BB 1XIWD 2XXCB 4W70A 1SYVB 1CDCA 4LSQL 1JBJA 1H3WM 2C26A 5E8NA 5B8CA 3TO4D 2VQ1B 1WICA 3JV4A 4LSDA 3STZA 1YEEL 5FUCC 5C6TH 2XZCH 4G43B 1CQKA 4ZFOL 1JHTA 1IEHA 1HKLL 1IQWL 1VFAA 2HFEA 1ZWIA 4HQQL 3FN0L 1IRAY 2VE6A 3P0YL 3FRUA 2IFGA 1IM3A 4AIOA 3IFPB 3QUXD 3CSYA 2CKNA 3CX5J 3O4OB 3QSKB 3T0ED 1REIA 4BSJA 4PJBF 4DTGL 1KIQA 2NR6D 5I1GL 4V1DA 3VFRA 1JTOA 1S8DB 1EHNA 4R97C 1L4IA 1MLCB 4O02L 1DVFB 5J06A 4PJ8C 5D7IE 4PB0L 3X11A 1X5IA 3U7YL 5IMLA 2F5BL 1A2YB 4X7CC 5HPOA 4Z7WB 1F4WH 5D7KE 4NBXB 3IAGC 2Z8RA 4ERSL 3HMWL 1WC7B 3LH2L 2EDBA 4LSUL 3D3VD 5BOPA 4AH2B 1FYHB 1GGIL 1TZIA 4ZDHB 3O2VL 2BK8A 1BQHA 3U30C 4X8JB 3SKUD 3EOTH 2ICWA 5EC2B 1BIIB 1T5XB 5FA4B 1KN4H 4UQ2A 5E0QA 1JK8B 4PGZA 1I7UA 3O41A 1VKXA 4F9LC 5J4MA 4GXUN 2YR3A 4OGZA 1NBVL 2ESVE 3A6CL 5D2LB 1ED3A 2HA1A 1MCPH 3SDAA 4D0DB 1HH6B 1G6RA 1I7UB 3QG7L 3OKEA 4QRPA 2YXFA 3EYFB 2A0LC 4QHUA 1E4XL 4NP4L 3BZEB 4ZS7L 4HPYL 5EUKB 1X5XA 1A7BA 1A9EA 3BGFB 4P2RE 3BDXA 1OWRM 5INCA 2BOCB 4WFHD 4M8VA 3P9MA 5MENA 1ADQA 4P0DA 1H3GA 2FB4H 3LIZH 4DW2L 2IALB 3P11L 1HOCB 4KJWC 4OF5A 4UUJA 4LLUB 1DUYA 4NQUA 3SDDD 2Z4QB 4YDIH 2NR6C 1F3DJ 5ESQA 3MLRL 2H45A 1JHKL 1ZLWH 3TPKA 5F1NA 3VI3E 5JO5A 1KCVL 3WBDA 4TUKH 1HWHB 3IDIB 1JPFA 1NBYA 3F7QA 5D7LA 4PJAB 1RJCA 2FL5B 4AEHL 3IFOB 3VFGH 4GXVL 3MGTB 4LQ1A 3G5VA 2UZIL 1U8IB 2ZCKL 1IZJA 4RWHA 4NQCA 1UCBL 3ARUA 3MRIB 4OQTH 4PYGA 1CL7H