2DDQL

Crystal structure of the fab fragment of a r310 antibody complexed with (r)-hne-histidine adduct
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
218
structure length
218
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bispecific abs against modified protein and DNA with oxidized lipids
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords R310 antibody heavy chain
total genus 49
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2006-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ddqL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ddqL01
3X3FL 5I17B 2C3XA 5J9PA 4EI6A 3ECBA 1UG9A 4LSSL 2I07A 4KVCL 3WLBB 4BFBD 2LU3A 5JA8B 4JRYE 5F7MC 1JE6A 4JB9L 1DUZB 4QRRD 4EQ3A 2CKNA 4MMXC 4YDJB 1BLNB 2X2YA 1AQKH 1E27A 3KXFE 4FQJL 4GG6F 2X1WL 2R1YB 3DV6A 4OLVH 2D3VA 1BFTA 2WLYA 5D2LE 5D7IE 3WUZA 4PJHA 4ZOAA 3MXVH 4LVEA 2HT3C 3AVEA 1RJYB 3FFCE 3HE7A 1WICA 5EU6D 3P0GB 2EE2A 2FO4A 3DIFA 4RAUB 3S4SB 5C6WH 4R90L 3ILPA 4PB9L 1MJJA 2OSLA 3GBLA 1XIWC 1B4JL 4HUNB 2CDEB 1T1XB 4LLMB 4JHAH 2Z4QA 2Q8BH 3RNQB 3P4OA 2BC4A 4OBSA 4TVPL 3G5YA 3SY0A 3KLSA 1CCZA 4UV4H 1ZV5A 1P4LA 1DUYB 3SDAD 3U7WH 3E6FA 1EGJH 3QUXA 4K3EH 1AFVH 1DE4B 4XBEH 3H3PL 5CINH 1FG9C 3D1MC 3UPCA 1MCPL 3FMGL 5D2NE 5IMKA 4HIXH 3LEXA 4PREB 5F1KC 4XVUD 5I15L 1HN1A 3CVHB 3VRIA 1CQYA 1AXTL 4XTRC 5C0AD 4YX2L 3QRGH 3QH3A 4X4XB 1F11A 3MSPA 2VXTH 1BZ7B 4P4KB 4XGZB 5HDOA 4L9DA 1U8NB 2XZAH 3BHBA 4LCWA 4OZFB 1KF9B 1MEXL 5CINL 1D5ZB 4CAGA 1YEDB 4I3GA 4LIQL 3GSWA 3S4SG 4KK9D 4YFLI 4RQQB 3C8KA 3ARBA 2W65B 4YHZH 5E2TL 2PYFA 4FQ1L 1ZVSB 3BP6A 4TVPH 3V9FA 1SYSB 1S9WA 4RGNE 3SDAC 4P9HL 4HLZH 4Y88A 1G7HA 5KSVA 3VXSB 4OCMC 1QTYT 4H8WH 2X4RA 4JHAL 3W39B 2GJ6D 4ZPTA 1IGJA 1F4YL 3MYZA 4GRLC 4OV5A 5K9OB 1N4XL 4EN3A 2HLAB 5HYIA 1OCWH 1FZMA 3W11D 1FC2D 3R8BB 1I1FB 3PGCB 2NY6D 1XCTB 4PJAA 2ZG2A 4CDHA 3P0YL 1UWGH 1L7TL 1XGTB 2NY5C 4TQEH 4PB0H 1TPXB 1I1AC 4HIEA 5JZ7C 3T04D 4D8PB 1YMHA 1TCMA 3EJYC 4LHUG 2C5DC 5E70A 2FO4B 3DIFB 2XFXA 1RAMA 2DI8A 4PRHE 5DQ9A 2VERN 1UVQB 4HWZA 4L8SB 5E94B 5JW4N 1AI1H 2ITCB 3B9DA 1UGNA 5B21A 1HZHH 1KNOA 4J3WA 2BX5A 4PV8B 1C16A 3DX7A 5AYUL 3VI4F 4NBYB 4WFFE 2COQA 2XRAL 5HGHB 1BEYH 1D6EA 4XNUL 4UTAH 3BGMA 1FGNL 4MXWH 5F6HI 1A0QH 2HFEB 2AXJA 4LSUL 1OLZA 1P2CB 4I5BB 3SGEI 3VFNA 1BHGA 2F74A 5J13C 4ZD3L 1BPVA 3EYQD 2JB6A 1FE8H 2GAZB 3UTTA 2PXYD 2EKSA 4AZ8A 1Q72H 4R2GB 5DK0A 5HYJB 5EFIB 4FQQA 4EDWH 4XB8A 2EDHA 2K3TA 4BELD 1GL4B 1QFWI 2DICA 3ARFB 1IAKB 5I16B 1N26A 3LEVH 1YECL 5HYEA 3OKMB 3FQNB 2UUDH 3IRZA 4XPAH 3W81A 1S3KL 5C92A 5K9OA 1GIGH 4PRBA 1V7MH 4HUKB 4PJ8D 3TBTA 4F7PA 4LLDA 1BZ9B 4PRDA 3HLAB 1ROWA 3BE1H 1GZQA 2DB8A 2DQCH 4YQXH 2DQTL 2HA1A 2BVUA 4LCIH 1VKXA 4TTGA 5DK2A 1R3KB 4YBQD 4UQ2B 2QHRH 1A1OA 5DD5H 5HVWA 2FZ3A 2FGWH 1N0LA 1F6LL 2HFFB 4YHKH 3SCMC 1AO7B 4Z76B 3WFCH 4G6MH 4FQLH 3VGDA 3EDFA 5I9QB 1OPGL 2I27N 1OAZL 4N9GB 4P3WA 3BHBB 2HMIC 4Q0XH 4NP4H 3QJHA 1OTTD 4XCFH 5DUPH 4F58L 3NACH 3ZT5A 2Z31C 1F8TH 2IANB 4PV9B 5IBTL 5IVXA 4G6ML 4Q7DA 1F4AA 3KS0H 3OB0K 4PBVC 3IJSB 4KKLC 1ZS8A 1EAPB 4F15C 1V7NL 3MRCB 3NIGE 5EUKA 5TE6L 2YD6A 3BYYA 4LSRL 3C6SA 1TJHH 3MRFA 4ZSOA 2DQCL 2K9UA 4RGNB 5MEND 2LTQC 1FRGH 4UB0H 4HS6A 4UT9L 2C26A 3O2VL 5C07E 4XPAL 1PY4A 4BKLB 1R3JA 1FC1A 2VYRE 1UB6B 5F70A 1MLBB 4PJDB 4AQOA 2X4UB 2UWEB 2P5WD 1IAOA 1FDLH 3P30H 2WMPA 1R3IL 3IDIB 4WO4A 1BVZA 4M6MH 1LWRA 2DTMH 2ESVD 1R5VB 4JFHD 2NY3D 2P24A 2ZG3A 1RZ7H 3NCYS 1MSPA 4GMSH 1UJ3C 4Z76A 4LGRB 5HGGS 2BZDA 2EDNA 1J8HA 2YD3A 2EYTA 3D3VE 4XNUH 3QFJE 1QSFA 2O61B 4H26A 4Z7WB 2B0SL 3OPZL 1X5LA 4M8QB 1K4CA 5EC1B 5AYUH 1ES0A 2DMCA 2VDPH 1K85A 3AS2A 1BZ9A 4O2EA 3VRLF 1JGUH 3MRJB 5KS9B 1NC4D 1IC5H 2EYTB 2EKSB 5EOQH 3C5ZB 3ROLA 2D4FA 1A4KA 4I18A 2MHAB 3ECBB 4HPYL 2UY7A 3C5JB 3PL6A 1QLRA 5MEQB 1INDH 2VABA 4GQ9H 1JI2A 2F15A 1L7TH 4MCYA 5DFTA 3UPRB 3MJ9L 1Q9LA 4U0RC 3QDMA 5FYKU 1N3NB 2AJZB 1K4DA 4Y4FC 1OCWL 2EC8A 1TTUA 4P46D 3FB6B 1T1WA 2ZUVA 3EOTH 4OCNC 3MGTA 3EYFB 2R8SH 5TDPB 2BVQA 4PY7A 3ORJA 3T3PE 4C59B 4W6YB 2PTTA 1W72B 5JLZA 2EZ0C 3Q5TA 4P5MB 1EMTH 2P8LB 2AEQL 5D7LD 2H41A 2ICWA 3QI9B 5FYLH 1TCRB 5DRNA 5ICYA 3S5LG 4IIQB 3LAFA 2QBWA 1QFHA 4UU9B 4L1HA 1KXTB 1LQSR 5CS7A 3U4BL 1KJ3L 4PJBB 3RJQB 3L9RA 4HUUA 3E3QC 3ZTNL 3BZEA 2NY2B 3FRPA 1OAYL 3QDGB 3VMNA 2FLRT 4KJWD 1NMAL 4L4TE 3QRGL 5I1DB 4O02L 2EDLA 2D7TL 4ZXBD 2VDLH 1LE9A 3V4PH 4MAYA 3FMGH 4XNXL 1G9MC 1GHFL 2ADGA 4KXZI 4ELME 2RFXA 2DLFL 4OI7A 2H32H 1YN6A 3WJJA 3VXME 1U8NA 3MRDA 1KFAL 1TZHA 2NX5B 5FYJD 5D7KE 2X9XA 1CG9B 2E7BA 4J23A 5A1AA 1XR9B 4GAFB 2V9QA 4LQFL 1JZ3A 4Q6IB 4GBXA 2ZKHL 4H88H 4F2MB 1MFCL 5DHYB 2VC2L 3ZDYE 1EFQA 3GHBH 5AAWA 2VDRH 3G5ZB 4FFYH 4NKIL 1CLOL 4LK4A 5KW9H 3LIZH 4ZODA 2YPVH 3ZYZA 1BVKA 1XF5A 5C0CB 1LK3H 4NM8H 5IFAH 1I4FB 4UINH 4X6DB 1SYSA 3K2UH 1TFHA 2QSCL 4I4WB 5EU5B 5DD5L 4Q97A 3AM8A 4ZPTB 3RZCB 4PD4K 5JHDD 1Z5LA 4HJGA 5L6YH 1OGTA 4HKXB 3AB0B 4YGVA 3HNVH 4X5WB 4IOSD 1FZKB 4GKOA 2W0FA 4X6DF 4FQJH 4D0CB 1I8KB 2XG4A 4NJAH 3NN8B 3WDJA 4XPGL 5I1EH 2FLBT 3ABZA 3TO2B 3O8XC 3C9NA 3G9VA 5EIQA 5MHSE 2XKSA 1HCFX 4AT6B 2AAVA 5D6DA 1QNZL 3AS0A 5LKNA 3CVHH 4RZCB 3RVUC 2YC1B 2VLKB 4QWWD 4KVCH 1GAFL 1JTOA 5JLZB 3LEVL 1KIQA 2BXZA 2OCFD 1UC6A 3WNKA 2D7QA 2GQHA 3X13A 5LGJB 3LN4B 5C0GA 4L3EE 1EEZB 4NHUA 3HI6L 4Z7UB 3JTTA 4RAVB 2PXYA 3ZDXE 3RPIB 5I1CH 2X9WA 5C0DA 4EI5B 3CUPB 1FE8L 2ARJA 4MQ7A 3SDCB 1AR1D 3X14B 5L9DH 1S7UB 4OI9A 3ROOB 1AD9A 4K3GA 2XT1B 1KCSL 5DRZA 4G6AC 1JFQH 3O2DH 4I0CC 5GGUB 4U49A 2V9RA 2W59A 4GBXB 2OMBA 1FGNH 4MXWL 4U1SB 5D7KD 5DURB 5KZCD 4XHQA 4NYLB 5EC2A 4E41A 3S35X 4GAGL 4PG2A 4GMTL 4Y4HA 3VRLE 2ICWB 5EFIA 4XPGH 1BBDL 4ODHH 3NMEA 5C9JB 1CFNB 1IARB 2B1AH 1YEDA 1INEH 5E8PA 1WEJL 4X7DC 1KPVA 1S7QB 5KVEH 5LBSH 2BNQA 2EH7H 4P23B 2AQ2A 3RY4A 2EE6A 2OMNA 1ORQA 5JOPE 4C55A 1NDGA 3KPLB 2EC9T 2ZOKB 4OIAA 5A3IC 3PWVB 1MCEA 4MJ4A 3D9AH 3RWHB 5GJTL 4H1LH 2Q20A 4QRUA 4UMGA 4I2XA 1CLOH 1KB5A 5KW9L 2E8ZA 4FXGB 1QYGL 5F9WB 3ARFD 1N4XH 2E7LC 2PF6A 5F6HJ 5E00B 5JO5A 1F4YH 3OHXA 1U2CA 4H88L 5BZWA 4D0DB 3OX8B 1HHHA 2FX9L 4LLYB 4RISH 4U1MB 4MZ3A 3TIDA 1KFAH 4PJHF 2WANA 4NDMA 3PHSA 3VFSB 3HMXL 1A47A 3ET9F 3K81A 4CGTA 3RUGF 1MCBA 1LO2L 4G8EA 2C3HA 5T5NG 2R0LH 4PGDB 5I8EA 1W2KT 1MEXH 1B0GB 3DVNA 1VFAB 2GEEA 4FNLH 3W9EB 3FFCD 4HXAH 4ZSOE 4RMVA 3HZKB 5J11B 1FL6B 3DXAD 4Z7NE 1NMAH 3UAJC 4RMWA 1IM3B 1AGBB 2OL3H 3HNTL 3GRWL 4MD4A 2ATKB 2ZCHH 1MQKH 3QEQD 1ZLWH 2HLFD 1FO0H 4MD0B 1HHKA 1I85C 4GKSB 4YHPB 5D8JL 4AY0A 4L3AA 4YO0A 2IAND 3AB0C 4P2RD 1OSZB 2KL6A 5EZJA 3MLUH 2ZUTA 5DVNA 5D93B 1R3JB 4J2XA 2Z31D 3IB4A 2YMXL 3T2OA 1HHJA 4U0RB 2CUHA 1IQDA 2X1XR 4O58L 5F1SA 1I9RL 4MXQC 4PP2A 5AD0B 4QHMB 3RGVC 3HZMA 3PP4L 4WU5A 2VZTA 1OOAA 2EXYD 5HHQB 2OR8A 4YHYC 1QOKA 4G8FA 4QRRB 2ADFL 1T03L 3D25B 1P7QB 3REVB 3FAXA 4HMEA 1J0IA 4KI5F 5IEHA 3WD5L 1EVTC 3GBMH 1T3FB 3ARQA 4H1LG 5LAXA 5GSVB 3FAWA 3LEYL 1BFOA 2AK1L 4OCWH 4M4PA 2YD1A 3WBDA 2R15A 2BRRL 3GSNB 3RX8A 1MQ8A 5I8EB 3TH4T 4QT5B 1MAKA 1G9MH 2DD8H 2G2RB 3MJ6A 5B3JE 4WWKC 3ZE2E 3PGDA 2QQLL 1BBDH 2IALA 4K94L 4ODHL 5HTSA 4HX1B 1G9NH 3GMNA 4KUZL 1T66D 5IT2H 3ULVF 2E9JA 3T77A 4EN3D 4HWUA 2X1QA 3UTSB 5DZLA 3IVKA 5K33A 3MBEC 3SE4C 3P3YA 4D9QE 1ZGLP 3T2NH 1HK6A 1FL5B 1L0XA 1KENL 3NIDF 2O5XH 2DYPD 1FZOB 5GZOD 1IAKA 5F88A 1PZUB 2BNRA 5FYJU 1LE5A 3UJIH 4NZTL 4OB5H 1NBZB 2ARWA 3CSGA 5I1KH 3P9WB 1CGVA 1ZT1A 1NCAH 3GJEB 1FJ1A 3AXLA 4U1HA 1QFUH 4HGWA 4MCZB 4W4OA 4QHKJ 4JFFA 1Q0XL 3DARA 5CD3A 3VWKB 3A6OA 2ZUWA 3SQBA 2WIIB 3E6HB 3QULB 3K8MA 3BAEH 5C6TL 3OGOE 4UQ2A 2VDNH 1RURH 1FZMB 2NY4C 4H5SA 3TFKD 2VITA 1IEHA 4LSVL 4L9LC 4R4NC 2H9GA 2Q1EA 3ZHLA 3HI5H 5L2KD 2X4TA 5IQ9A 1MFNA 4A2LA 4OZIF 3B5GA 2XFXB 5FDWB 4OTXH 3SKNA 1IT9L 2ZJSH 5BZDA 1I3UA 4MA8L 1C1EL 3HN3A 3GHBL 1SYVB 1ZA6B 4Z7OF 1WV7T 3SO5A 3O4LA 1I9IL 1I3RB 3IAQA 1D5BA 4FQLL 1K5NA 1Q9KB 4JE4B 4NSKB 2YWZA 3MJGX 1U6AH 5CSZA 4AMKL 5EDXA 1MFDH 1K2DA 2VAJA 1I9EA 3OXRA 5D1ZD 2NYYC 3MNZA 4R97C 3HRPA 2JKXA 1YNLH 4F37F 1NMCB 3O3EB 1CICC 4PJEB 1U3HA 3CGTA 2O93L 3KG5A 3RWGB 4O02H 1AE6L 2Z93A 4HUVB 1YY9C 5IM7B 5GS2D 4Q74A 2E9IA 4LDOB 5DMYA 5FA4B 5CD5D 4L3ED 1T1XA 3MCG1 5FGCB 3DRQA 5FO8B 1EERB 4EUPH 4CU8A 1JNHB 4C83B 2JK5B 2BCKB 3EW3B 3OQ3B 1KENH 2XPGB 3SJVB 2CLRB 1R3LB 2VISA 3RX7A 3RZCD 4OV5B 3CK0H 4AT6A 1DVFC 1U8IB 4WW2B 1J1XL 4YPGB 4QNPF 1CDBA 2OZ4H 4N5ED 1M1SA 3V6ZB 1G9NL 2PYEB 3OXSA 1NBVL 4OD2B 1HZHL 4X6FB 4H25A 3JUZA 4NO5A 3FL7A 3BQUA 1U58A 5ABDE 3NAAH 4UT7L 4LCYB 4X6EA 3TO4C 5ID1A 4OZFA 4OLZL 3WXVL 4E42A 1YN6B 2AK1H 12E8L 4MJ6A 4OCWL 5C3TA 1P6AB 5I8KH 4IRJC 4PRPD 12E8H 2X41A 4PJIE 2HWZL 3O8XA 1AC0A 4NCC1 4XNYL 4OF7A 2OTWA 3LKOB 2CDGB 4Z0BH 1BOYA 4EI5C 4AQ1B 3NOIA 4B0MM 3R06B 4P4KC 1IGTA 1ZT4B 1QSFD 3SE9L 2N1KA 4QKXB 2IAMB 3OPZH 4BYHA 4I8DA 3QCTL 2P7TB 4OGAD 4BH7A 1MCJA 15C8L 4PRNB 2YOCA 2A77H 1A1MA 3Q0HA 3MGTB 3PHQA 3BRGC 5CMAB 5IVZA 3B5TA 4HPOH 4NZUH 1NGQH 3MLUL 1S5HB 1X5GA 3MV8E 3JV0A 4OGXL 2A6DB 3B9VA 4RGND 2XQYG 1MJ8L 5J11C 1KLGB 3G08B 4U33A 3OZ9L 1JGVL 2R69L 3T4YA 1NBQA 3MJ8A 2AQ3A 3V7AG 2OL3L 2VXTL 4LLQB 3W9DA 2P5ED 4NNPL 2XN9A 2NY4D 5JR1H 1Z3GL 1QQDB 4XP5H 1MWAH 3TZVA 1CGUA 2BVOB 1ODAA 3VXTB 5EIIB 4XWOC 3L5XH 3S4SA 1P9MC 3S6CA 4Y4KA 1A9EB 4KQ3H 5A16B 3QHZL 5DMKA 4NQTA 4WTXA 1HOCB 4JFPB 5GS1C 2A6IB 3RIFK 4AMKH 5TE6H 3BP5A 5DXWA 3SJVD 3VXTA 3IDGB 3WNPA 1RD6A 1XGQB 4IRSA 3UZVB 3RP1A 3T8XB 3ES6B 5C7XL 1T20B 2AJZA 1SJHA 3MRGB 1RZIA 3CMOL 4M43H 3V5HA 5JOFA 4BQ8A 5E2UL 3P77B 2XWJA 1R5WB 3DOSA 4PB9H 1DL7L 5ETUA 5HHNA 3FO0L 5BJTB 1IT9H 4LBEA 5JW5A 5ILTL 25C8L 3OG4B 2M1KA 1NC4B 5C0AE 5J57B 3LMJL 1OAUH 3WEXB 1CL7L 4G8FB 3QIBC 4M03A 2M2DA 5F1OB 2X7LB 1EV2E 3H9HA 3GMQB 3V5KB 4O2CB 1RURL 1V7ML 1D7FA 1D3CA 2OL3B 4G6KL 4K8RL 3GSXA 3ELAT 5I1HL 5KSUB 2FIKB 4X7SL 4X4YB 1XF3B 3ARGD 4KY1H 4JB9H 2FIRT 1HHHB 4KI1A 4ZFZA 3QIUB 5E6ZA 1T7XA 5EWIH 4Z7VE 3X3FH 3BP4A 1KT2B 5IG7B 2C3WA 3PABA 3T0BA 1KB9J 4WO4D 1Q72L 1YEKL 2VLME 1YEKH 5ANMB 5GGQH 3VA6A 3QT2A 1NBYB 4XP1L 3OV6A 2Q8AH 1F58H 4C4KO 3G08A 1WTLA 4YIQA 2FHFA 1UB5A 3O0RL 2A6KB 2EH8L 4JKPL 1IAMA 4LLAA 1IFHL 3GGWB 2OR9L 4DOHE 4UTAL 43C9B 1KC5L 4XAKE 3BKYL 1ORSA 1XIWB 2FEDD 5JORA 1QNZH 3QDGD 5JXEC 1DEEB 3PWLB 4LPVA 1OTUC 5ETUB 3V4VH 3ZSTA 3RVUD 4URTB 1AXSA 5ICZB 2VR4A 4PTUB 4U7SA 4EN3B 1YEEL 1A14H 3HPLB 4IS6A 3ARGC 1QEWB 2FHBA 3OR6A 5B8CC 3BZFA 3MLRH 4EKXA 1T2QL 4WTWA 4PJIA 3IDGA 4ZQKA 1T1ZB 3EJYD 5FFLA 3O11A 4KV5E 1XCQB 3WHXA 1LK3L 4NM8L 5IK3B 2W07A 4M7KL 2R56L 2QL1A 5C0BA 2RAMA 2O5ZL 3L6FA 1KEGH 3CDYA 1AY1L 1IILE 2FX8H 3KPLA 4P46B 1KXQE 4XZUA 2EC9U 4JKLA 3DX8B 3D39D 4QRUB 4YDVA 3F5WB 2OYPA 1D6EB 4YXLH 3U9UA 4LPYA 1QUNA 4P9HH 3RGHA 2XTJC 5EO0B 3KDMA 1JYXA 5TF1L 5FCUL 4PLNC 3CVHA 1GC1L 3VRIB 4UT6L 4D0DA 4LNVA 4NWTL 1F2XK 1S7QA 1C08B 5CJ8A 3M1BB 4ODUB 1D5BB 4XI5C 1WISA 3V4PL 1QFWH 3HE7D 3O4LB 3BD5A 1DQDL 4RX4D 1M6OA 3QFJD 2VL5A 5D7SL 1D5IL 2X4OA 2QR0A 4LDLB 4DAGH 5DDHA 2VMFA 1BWMA 2FZ3B 5A2LH 1WT5A 4U4BA 1DN2A 2ZNWA 4DEPC 5TDPA 4HBCL 2ESVE 4YGAB 1QSVA 3PDOA 2FD6L 3CSYA 5J6GB 4ZAKC 4DGYL 1QFPA 5JIIA 1SJEB 2YD2A 2Q6WB 1IC4H 4H5SB 1IEBA 3DETC 3RWGA 3OJDA 5D1ZB 1EMTL 4YH6A 2NX5D 5FHBH 1XCTA 1MRCH 1RK1B 2PXYC 3ARDC 4AIZB 2IAMC 4JFFB 5EOCL 2GK0B 3JWOC 4U31A 1D5XA 1ZLSL 1QG3A 2O5YH 1OAXL 1YJDH 4FG6C 1QYGH 3EOYG 1HH6B 3L3GB 2LAAA 4HIEB 1B9ZA 3DX6A 3QEQA 5D2NA 5GJTH 1J5OL 5I1AA 3BRDA 3CD4A 4GQ9L 1INDL 4QOKB 4WU7A 5I1JL 2RBLA 1CICA 3HC0B 2AW2A 1KYOJ 3EDDA 1TVHA 5IMMA 2NY1B 3QEUB 1Q8MA 4OLVL 4OSUL 3T0EE 5EU3B 1P4BL 1DCLA 3RL1A 2OR7A 3JTTB 2GCYA 4U1LB 5C09B 1JGDB 1HWHB 2R9HD 5TJWK 3HE6D 1KIRA 5F3BA 1F11B 5DHYA 5C86A 1UM6L 5I76A 4WUUA 3T1FB 3IDYB 3WFEL 4H20L 4OD1L 1MHPL 1J1XH 4XH2A 4GMSL 3BH8A 3QCVH 1T1ZA 4S1QL 4Q2ZB 4BFIA 3CFEA 3P73B 4ODUA 5HPOA 3V0VA 3MNZB 1RFDH 4H0GA 2E9WA 2J1KA 2XTLA 1TJGL 4C56B 3RY6C 3SDCD 5IHUL 1QACA 4WGVB 5C07D 2BVTA 2ICES 2G5BB 5FUOH 4XTRD 2R4RL 4YDVB 2P5EE 1AE6H 4F37K 1QSFB 2WIMA 3TC9A 4XXDA 1YMMB 3TO4A 3JV4A 4TNWK 1T66C 3WFDL 5MI0B 4KUCD 2FECL 4UB0L 5ID0B 4OZGF 4OQ1A 1RJZB 1A5FL 3WXWH 3T77B 1TJHL 1B2WL 5FDWA 4WTZA 2E5EA 1UZ6F 5F3HA 1MJ7H 1NDMA 4WENB 2QSCH 1NCNA 4J6RH 4MQSB 1FNSH 4XNZC 4L4VD 4WW1A 5B22A 3RKPA 4OF3A 3BUTA 5JHLH 1NCTA 3HNSL 5DJ0B 4Q0XL 3BMVA 5DJCA 4FA8A 3FQXA 1VADA 5I73C 1UKSA 5B3JF 2VC2H 1NSNH 3CLFL 3HAEH 3CXDL 1OAQH 3K1KC 4PJFE 2UVFA 3BYTA 2FJFB 2Y6SD 1CXIA 2WWMD 5GSRA 4PGJA 4LLUB 3CNKA 2EYSA 3TT1H 1J10A 5I75B 1EXUB 4LCIL 5D70H 1GOGA 2E8YA 4J4PA 4ESKA 4LKXB 5AAMA 5AWNH 4R3SB 4CNIB 1FH5H 5D1QB 4WI2A 3I75A 5F6IC 4DVRL 4J3XA 2ZUQB 2BHUA 4M6NL 5FGBA 3VGHA 1BQHG 2VQTA 5AUMB 3NCFB 3ZZ1A 3O6LH 4TUKL 1IGYB 1FPTH 4C54A 5M7QA 3P9LB 1CK0L 4GRLA 1TQBC 1OAYH 5T1MB 5DJ2B 5DD6A 3VFVA 2VZVA 4TUJB 4O2CA 2R2HA 1PFCA 1ZANH 4I0PB 3TZVB 5CMAA 3VG0H 4NJ9L 1KJ3H 3VWJD 1NC2B 3AMLA 2O5XL 2C4XA 3OKKA 1UVQA 4L8SA 4PJ5E 4PJFA 5KSBB 5JNYB 3L7FA 3S36H 1RVFL 3UC0H 5E5MB 4M6OH 4PJBF 2AEQH 1I8MB 1LEKB 2VLLB 4FS0A 4KKBC 4OIBA 3CLEH 4HC1L 3GM0A 3MLVL 1CGSL 3O81A 2IADB 2IG2L 1N0XH 4UTBH 4JRYA 1EHLH 1BFOB 2YPLA 1HHGB 4CDGC 2HJLA 1X7QA 3HPJB 3EJZD 3VFRB 1NL0H 2K1MA 1CLYH 5FOJA 1S9KC 5D4QA 3SCMA 1SMAA 5C8JA 1HKLH 5HD8C 3MV8B 1UEYA 3RTQD 1ZMYA 2KQNA 3SGDH 2W0PA 4OUOA 3IDNB 1OGAE 2JJTC 2VQUA 4F57L 5IFJA 2G60L 3EO1B 4PG9A 3PQYD 5D5MA 1CGYA 3BZ4B 2ITDA 1MCSA 3GSRB 3LS5H 5FM5O 1HH9B 3MROB 4KZEH 1L7IL 1EBAA 4R0LC 1FAIL 4NIKB 3MLPA 5CWSA 1DR9A 3TWCH 2X4UA 1FL3B 1M7XA 1SY6A 4W6WB 1H3XA 4Y5VB 4C57C 2XTJD 3QXWA 2YC1A 5KSUA 4PGEB 4ZAKB 2BSED 3TCLA 5AYQA 4GG6A 1SQ2N 2DQDL 3RWEA 2BMKB 1IQWH 5DJZA 3I85A 2JK5A 1OD9A 2P5WB 4KVNH 5BV7L 1JGEA 1I1AB 4FQ2H 2AI0L 5DO2D 5C9JA 6CGTA 3G6JE 3EO9L 5J56B 1MVFA 1JMXA 1U8IA 3SGJA 3MLYH 3AREB 1S7TB 3FKUS 4PP1D 2VLJB 5DJYA 1UCTA 1VEOA 5FKPB 2Q76A 3QIWD 4Z7OE 5DK0B 3LV3B 1WBZB 4RMQA 3F62A 1AXTH 1J05B 1G9NC 4WFGE 1GGIL 2F54E 5IW6B 5I15H 3QPQD 1YNTA 1FYHB 5IESL 4MDJB 5ERWB 4OCXH 1OY3B 1AFVL 4C4KT 2BP3A 2YRLA 3MRLB 1G1CA 4LSRH 5EBWA 1PYWA 3RL2A 3SBWC 3QNZA 3T0EC 2JB5H 3C5ZD 4R4BA 1JZ2A 5L2KA 4BSWB 2FX9H 2V9TA 1F8TL 1UCBH 2EO9A 3IFPB 5LGHL 5GRJH 1SJEA 4IBLT 5DHVH 4HG4J 1HQ4A 4XAKD 5CSZB 4LLWA 3CSYB 1ZXQA 2Y6SC 1S78C 5T3ZE 2GTZA 1RK0A 1XFPA 1CXEA 1FGVL 4X6DE 2DDQH 3S5LA 3D9AL 3SGKA 4JVWA 4P4KD 5B38G 5EU4A 5CUSL 1HQ4B 1WBYA 4TUOB 2XQBH 3AAZB 1IE5A 3CCHB 3MV8D 5D7LB 3ARTA 4R9HA 3DUHA 2DBJA 3MREA 4LAJH 3RDTA 5BRZB 4HWNA 5CJOL 5IOPB 3ARWA 1AQKL 4WI3A 5IQ9B 4J7RA 4NKOA 3FN0H 4I77L 4NC1C 3T09A 2NX5E 2XWTA 4JANB 4HKBA 4IJ3C 3PQYB 1ZLUH 3X13B 3LSOA 5LGJA 1G0XA 1NUFA 4EI5A 5C0DB 4WHYG 2A38A 4ZAKA 3TCLB 3BH9A 4XXCA 4D8PA 4POUB 2VL5B 3H9SE 5FYJH 4F9PC 4GG8A 4LPCA 1F00I 3DVIA 1YEJL 5GJSH 2R4SH 5MEQA 5E56A 4HCRA 5D6CA 1ADQL 4JREB 2D0FA 3P0VL 4HUXA 4HWBL 3TYFB 5GZOC 5E9DB 3VFPA 3UBXI 2J8UF 1F3JA 5L8KB 4LMQI 3DMMB 3FO9A 4ODVH 4Y19E 1DJSA 3GSVB 1RZFL 4LCYA 1GAFH 2LFGA 1J8HD 3NA9L 1Z9SA 2VLJD 5BMFL 3B9KC 1BFSA 1C5BL 3OR6B 3VGGA 4OT1L 3HUJA 4LPWA 3RWEB 1AGFB 2PNDA 1DLHA 4OCYL 4NJAL 3H6JA 1AI1L 3FOMA 5K93A 4KAQH 1SBSL 3MV9D 1LNUB 4DVBB 3WUWA 4OBRA 1G7JA 1L9MA 5FYKH 5C0JA 5DJ6B 2GTWB 4LHQB 3U7AA 5FB8A 5CGYD 3UPAA 1J8KA 3K2UL 3CH1A 4AIOA 5TGBA 3SKNB 2NMSA 3MOBH 3TBYA 3AMKA 3O3DA 4JFDB 32C2A 4CUCA 2VDRL 2OQJB 2F8XC 3KWWA 3RVTC 3OF6D 1T0PB 4J3SA 2R23B 3K0WA 4M93C 4O4YL 4ONHB 4ZFOA 4DQOL 2J12B 43C9A 3DWTA 3N1PC 1CDJA 4PJIF 3GEWB 3RY6A 2J6EH 4N90D 2BJML 1BLNA 4P4RB 2PN5A 4ODXA 3LKRB 4JZOA 3LY6A 5DD1L 4LIQH 5IB1B 1REIA 5D1QC 4ZUWA 1F4WL 2VR5A 4N0CD 2ZUSA 5ITBL 4HS8H 3L5HA 4P4RA 1LE5B 4QEGA 5E2VL 2NY7L 4XHJD 3ARXA 2VUYA 1A3RH 3TA3C 3C2AL 4QNPE 2IF7A 1KCRL 3HKFA 1G7QA 5J6HB 1G6RB 2C3GA 4OCRH 2ZP0T 4HGKC 2HTKC 1I1CA 4R26L 2R2CA 2QADB 4PRDB 1TZIA 2M8XA 2AJXL 4G7VL 4FQCH 3QQ9C 3CU7A 4P9HC 2AJ3A 2WP3T 4ZO7A 2X10A 4PG2C 5A2JH 1NAML 4PJ9C 3QEGL 4MS8D 3W2DH 3RWJB 1MI5B 4LIQE 3SKUD 1P7QA 3REVA 1QSFE 2WBJB 3MRJA 4ONOA 1JZ5A 2C3VB 3FOMB 5F6IB 1CVSC 5GSVA 2MHAA 1S8DA 3U9PL 2J4WL 5KVDL 4X6CA 1MLCA 2EYRA 5E5MA 4PLKD 2BFVL 5F7FA 3S37X 4E41E 4JJHA 4OQTH 4N90E 3SOBL 1IM9B 3FHAA 3H9ZA 3LKNB 5ACLA 1EIBA 2IPTH 3HAEA 4EI5D 4DN3L 2DQEL 2OS7A 1T7YA 5FIEA 3KPMA 3IVKB 5DJCB 5BO1L 3QYCA 4Q2ZA 3ESUF 1IGFH 5I8OH 4ETYA 5TDNB 5H2BA 5D5ME 2J5LC 1K8IB 1BWWA 1QKZL 4BKLA 3V0VB 2NTFA 4LL9A 4LSSH 3EOBB 1UM5H 3E2HC 1PG7H 1IAOB 2QSTA 1RZ8A 4M48H 5DK2B 2KZWA 5FO8A 1BD2E 2JIXD 5T1KA 3T0XA 3LN4A 3ARBD 5C0GB 1F90H 4EBQH 3WN5B 1ZHBA 5TQ2H 2OJZH 4YWGL 2AEPH 4F7EB 3HUJE 4LFHG 3VD3A 4Z7QF 2F5AL 4NO3B 1CICB 2ZUQC 5IHZA 1FNGA 3O4OC 4LF3A 4K7PL 3BGAA 1CXLA 3S34L 4MJ6B 1PEZA 2ZCLH 2VE6A 3S88L 1JUFB 4JFFE 3CU1A 3B3IA 1I7TB 2HLFC 4APQA 1C7TA 3MUGA 3HC4H 4RBPH 4X6FA 1G7IB 5GGSB 2NNAA 5D7JB 4YEEA 2DN7A 5TH2A 2YR3A 4KRPD 1QBLH 5HGHA 4XPHH 4LARL 3ZKXC 3LZFL 2B20A 4POZD 5L88H 3CFEB 4WW2C 2Q7NA 1XAUA 5F96H 5HY9A 5C2BL 4KK5C 3ARBC 4CU6A 5TH2B 1WIUA 1FAKT 1AHWC 2XN9D 3C5SB 4QXUH 5DUPL 1W0VA 3MOQA 1CR9H 5HI4D 1QBMH 4MD0A 1RZJL 2VLKE 3KJ4B 1W8OA 4TTDD 2AEPL 3DURB 2DBLH 4LSPL 1HSAA 2IH3A 5C6PB 3QA3B 3SCMB 1QO3A 4PJ5D 4BUGA 1OARH 2FGWL 2HKFH 1T4KA 4GAYA 5I9QC 4IOFC 3BKMH 1SJVA 3MLZH 1JPGA 4WV1C 1SM3L 3BW9B 1RSFA 4MJ2A 4XVTH 1BD2D 3QUMH 5T1LD 1KB5L 4PBXA 5F89B 4HFWB 4QRPA 4OZHE 5IMLA 4GAYB 3MX0A 1WBYB 1RUKL 3GMMA 3U7YH 4RNRB 4B7IA 3JV6A 3MBEA 4KH2A 3SE4A 4JFQA 4C83A 4Y5VC 3VFGH 3KYMB 4RAVA 1VFBA 3MRDB 2IPUG 2ZG1A 4FN0A 4EDWL 4KTYA 4N0FA 2Y9RT 3X3GL 3CSPA 3RA7L 5T1MA 1KEMH 5IGXH 3OKYA 4M7JL 3V6OA 5H94B 3I9GH 3Q6GL 5HVGB 4CMMA 3KPMB 4HK3J 3GIVA 1UADC 3LQZA 4LSUH 4CADB 1F2QA 5ITFB 5D2NB 3BKJL 4MDIA 1Q9OB 1WBXA 5KJRH 3RWDB 4PUBH 2AXHA 1MVUA 1RULL 4PJEE 1QP1A 2DI7A 4NFBA 2AJYH 1H3UA 3MUGB 4OF6A 1LMKA 4R96B 3OGCB 1H15A 3IFPA 4DKFH 1O5DT 3PWPD 2HJKB 2AJXH 5D1XA 5E8DH 4I3RL 3P4OB 5E08H 3MR9B 1OTSD 2WBWB 5GGUA 3P2TA 2XWBB 1PYWB 1P84J 4OZ4A 3O4OB 4PJHE 5HYSG 5LWYH 4RGOH 1LO4L 3C8KB 2YXFA 1EO5A 3NFSH 2XZQL 1H9VA 4YE4H 1JZ7A 2BSSB 1U8HB 1DBKH 1YEIH 3F7YA 4N0RA 3A6BL 4XPFH 4K3DH 1ZTXH 4BJLA 4FZEL 4KTEH 5JZ7D 4M7LH 1MRFH 1NKOA 3D85B 4HUVA 2YPLD 3MNWA 3O6FD 4TVPD 5D5MB 4GRLB 5KVFL 1R24A 4F7CA 3OBAA 1FNLA 1MFBL 2RR3A 3DO7B 5ELIA 1XF4B 4WY7L 5ENWB 3K7UA 1EJOH 5DUML 2GSIA 2R2HB 3TV3L 3SCMD 5JORB 1VPOH 2DM4A 4YHZL 1MPAH 2FB4H 2CO6B 4KJPD 3C5ZA 5DMIH 2FJHB 2YEZB 3MRFB 1CDIA 5JHDE 1E27B 4DQOH 4O4YH 5DMGC 2C7UB 2CGRH 4KRPC 3WO4C 4K3DL 5E6YA 1DANT 3GSUA 1T89A 2B5IB 2A73A 1VEMA 5MHSD 5I18H 3RX5A 3QIUC 5GGTA 5ISZB 2HJLB 2B1HL 4KQ4L 4YAQA 3TESA 2L4OA 1MIML 2AJUL 3JWDC 2QQNH 4XP6H 3H3PH 3VD4A 4X6BB 4DK6A 3TEUA 4KHXH 4XBGA 2NR6D 3F6IA 3VWJB 3EYFA 4XVUC 4D2NA 1YN7A 3IT8D 1TIUA 1X4ZA 4XMPL 1HILB 4Y1AE 2NY5H 1BZQK 1S7VA 2CQVA 4NO0D 1QR1A 3P9MB 3VXUA 1UACL 5J6HA 3MUY1 4WO4C 4XBPA 1JPSL 4JFZH 5BVJB 4HMCA 4Y4FB 4JZNA 3DGGB 3KPPA 1U3HC 3RWHA 4TRPH 4PRAB 3VG9B 1ES0B 4NM4L 5TE7H 3HCVA 3GSNH 1MNUH 1HE7A 4AL8H 3BZEB 3TA3B 4AK1A 2E3VA 4Z0XB 4M62H 3HMWH 1I8IA 3HLAA 1HEZA 4WWKD 3TIDB 1H3VA 4RA0C 3OAYK 5C0EA 2WBJA 3NPSC 3O3AA 3V6ZA 1AQDA 5IB2A 2FATH 2FH6A 4J4PD 2F53B 1RUKH 5CCKL 1NGXB 5CCKH 1N5AA 5D1XB 2H45A 1HSBA 1NCBL 5DK3A 3BDXA 2G75B 5CIPH 2YSSA 4QXTA 3EKCA 2UZYB 3SKMB 2XTJB 3G6DH 3LSOB 5F72S 1U95B 5B39B 4OZ4B 4YNYA 4L3EA 4PJAF 2EIZA 3FRPG 4K3JH 3KPRE 1ZHLA 1WAAF 2BSSA 4U6HB 3GSNL 3LHPH 4LLUA 1X4XA 1IM9D 1N5YH 4XC1L 3V4UL 4X5XB 3NZ8A 3VFUA 3FO2A 2LTQB 2NW2B 3FQNA 4QOKA 4NZJA 3QIWB 4D0CA 4LVOC 4G9FD 3QQ4A 3O6ML 1IC1A 35C8H 5E99H 2D31A 4HWEH 1EO8H 4XMPH 2IANA 3MLTB 1FORL 3D5OF 2HTKD 2VIRA 1MHCA 4YXKH 3QUKA 1UKQA 4N68A 4WEBL 2APBA 1L6ZA 4QTIH 3QISA 3WKNA 4RMSA 1MIMH 2AJUH 1N8ZA 4XZUB 1TJIH 1NH6A 5IESH 3S37L 4XH2B 4PGBA 5L8JB 4PJGB 4X9BA 4HFUH 5ALBL 1TQCC 1RUAL 1NLBH 4HC1A 2FEEI 1IL1A 4WUKL 4HKBB 4WFGD 2LQRA 1Q1JL 1Q94B 5F1NB 3DRTB 3QI9C 3CH8A 4JM2C 3TPUA 4JQVA 2H9GB 4UIMB 3LKPB 1XGPB 4O00A 4LNRA 1OTTC 4YC2B 5JPMA 1QPPA 2B2XH 3PP3H 5JXAL 3TV3H 1M6OB 3TBVA 3QDHA 3U4AA 5DQJB 1NGPH 1YMMA 2N56A 3TO4B 4MJID 1MAMH 3V6FA 5JOEA 4NNXB 4KC3B 5DF0A 5DD0H 1E6JL 3BFOA 1G7HB 5KSVB 1TTFA 1RJLB 4KROC 4TULH 4BH8B 4P2QE 2X4NB 5BRZD 5AEAA 1F3JB 4M7LL 4DW2L 4CRPA 3GHEH 1ZHBB 3FFDA 1M7IB 5DJAB 4Z7NF 3PIQA 2Y5EA 4KJYA 4YDLC 4GSDH 5K9QI 4JFED 1K5NB 1Q9KA 1E4WL 2VRAA 4JVPA 3S97C 4U7KA 3RY5A 4HH9A 4AG4L 4TPRH 2XY1A 2LU7A 3HR5B 5DA0B 3ARRA 2PYFB 4Y1AA 4MVBC 2EXWC 3MZTA 3BIBX 3UTTD 2BNQD 4GXUN 3OKNB 5KVDH 1RK1A 5D7IF 5E08L 3GMMB 2DWEA 2NXZD 2H2SC 1YYML 1TZGL 5SV4A 3GO1H 4ZOCA 3GK8H 3TVMA 3RIAF 3PGDB 4ZOEA 2CRMA 1FCGA 8CGTA 2R0ZL 5J12C 4U1KB 1BBJA 1FG2B 1UWXK 1CT8B 2F19L 2D31B 1OP5H 2FBJL 3UXFA 5CILL 1R3HA 3UEZA 4MWFB 1EFXD 1NGYA 1I7ZB 4NQSA 4OGYH 3CFCH 2IGFL 1S9WB 1KB9K 4X0KA 2YK1H 2R2EA 2DTSA 4ZTOL 4BQ6A 1U2HA 3FO1A 2I9LB 4YDIL 1F3DH 1DQJB 3IDUA 3SPVB 3FT3A 1XIWA 3JWDH 2J6EA 4UAOC 2NX5A 3LS4H 4R0LB 5F9JA 1R5IA 3OG6B 2EDTA 5GGTL 4DW2H 1TDQA 2F5BL 3UYPA 3FFCA 5D9SB 5FUCC 5L7XH 1FVCA 1FH5L 3IDJA 3IU4L 3HS0A 2Q7YB 1J9CT 3VXUE 4P5MA 4PJEF 2EE9A 1OW0C 2YKLL 4IOFD 5DQDH 5I74B 4TSAH 3WIFA 1UZ8A 3HR5A 5D7JC 3ISWA 4H0HB 2EDWA 1BVLB 4L8CB 5B38B 4FFVC 3ULVL 5HPMB 4A6YB 5C0BB 4NN5B 3V0AC 2OTUA 4ERSL 1NGWB 3FJTA 2VDMH 4OI8A 4TSCL 5HHMB 4NO2A 4LPTA 4TOYL 3W9EA 3I02A 1HWGB 3R8QA 4OGZA 3GJFK 4KKAC 1WFNA 5ALBH 4ZNCD 5E6IB 5SWQA 3VXPA 2R29L 5BS0D 1CLCA 1T83A 4AEFA 4LHUD 4NO3A 3ZSSA 5CJQH 2JELH 2Z8SA 3MRHA 2MKWA 4JM2A 4G9FA 2YPLB 1IMHC 3HB3C 3PG2A 5KSAA 1AGEA 2DQJL 1A2YA 1DEEA 1QBLL 4FZ8L 1P6FA 3QSKB 4ZFGH 1FFNB 2C7UA 4QGTA 3WHE0 1BQLL 4Z77A 3EYUL 4ZFGL 1Z2KA 4HWEL 5LCVH 1RIHL 1AC6A 2IAMA 5HHPB 1NPUA 2F58H 2HG5A 4JJ5B 3I84A 4OD3H 4FFWC 4KGLA 3MRIA 4YHLH 4J8RA 2VXUL 3S34H 1DANU 2CDGA 1W0YT 2K7QA 3QWOA 4TSCH 3Q5YA 4PTTB 5CHNA 2MCPL 3WKML 5A2FA 3G6JA 4HXBH 2VH5H 2DIBA 3LHPL 4HWBH 2ZSWB 1CE1L 5TDOB 2FBOJ 4MNGE 1JWSB 2RCSH 4Y2DA 5C0AB 3T4YB 3JSSA 5GJSL 4MHHG 3H9HB 4JPWH 1JRHI 1MFAL 3O45A 4P2QA 2YRPA 1PAMA 2IQAA 4JO1H 4HEPG 4F7EA 5BO1H 4Z7WE 1YUHA 4Y4FD 2VZ3A 1VFMA 3OKKB 4PJFB 5DFWH 1WCQA 3X11A 4HMDA 2Y1VA 2XNAA 4JO4L 1CFSA 4U2ZA 3TNMA 3PABB 2AJ3B 3NCEB 3VXMD 4ZTOH 1C12A 3ZHKA 4S2SA 3MRPB 4KZDH 3C09C 3LQZB 1FFNA 4I13B 3EO0A 1NCDL 3V6OE 1QVOA 4OUUB 4MYWB 5F7LB 4YHNB 5DLML 2FIKA 1E6OH 1HXYA 4KTDL 1U93B 3DX9B 2CSPA 3SQOH 4ZUWB 5E2JA 4Q9CA 3Q6FA 1BIIA 5EPMA 1FSKC 3O3BA 1FIEA 4B50A 1RZKH 5D5MF 3MBED 1JRHL 4YGVB 3SHSA 2LABA 3DTXB 1AO7D 5C0FB 3IJYB 2ZSWA 2GI7A 3OAUH 5T3ZH 4OV6F 4AIXA 2NY4B 4ZMAT 4EVNA 2X4PB 1HCVA 4NOBA 3S5LB 3WCYA 1U91A 1MF2H 3PV6A 5JW5B 5F9OH 2GTZB 1A22B 4HBCH 2HLAA 2PCPA 3UTQA 5E8NA 1FVDA 5CFHA 3DYPA 4OFPA 1ZSDB 4L9LA 4XX1G 4P2OD 3L3KA 2DKSA 1WLHA 5D1ZC 1E4XH 4ZFFA 4WW2A 1N59B 1SY6H 2PXYB 3QUZC 1DP0A 2WUCH 3ROOA 2DM3A 5SWZB 1A2YB 1JK8B 5DJ8A 1GGUA 4N5UA 4MA7H 1LO0H 3G5VA 1BECA 3MXWL 4LVOB 4B7LA 4QHKI 3HFML 3WIHH 1H15B 4PGBB 1A7RL 1S78D 5EBLB 4N0FB 4JZJC 1C16B 2DQDH 3T0EB 3X12A 4OLWH 1AIFA 5FV1L 4XB7A 1WBZA 2HRPL 2HT4D 1KJ2B 1MCWM 4YXHH 2OI9C 2WUCL 4CMMB 1YPZF 1P2CA 1L7IH 1E4XL 3CUPA 3MA7A 1H3PL 2YEZA 3KYOB 1KEGL 1LK2A 3EYVA 2JB6B 3D3VD 2NW3A 2IC2A 4X7FC 3IXAB 2UYLA 4M7KH 1BVKB 1XF5B 4MA1B 2F8OA 4L29A 1OWWA 5F7HA 2DJSA 2H2PD 4MMZC 3RVXD 1PZ5B 2JCCE 3MNWB 2YZ8A 4YXKL 2EKJA 4PJXA 2J88H 4L4JA 3RVWC 5E8DL 1EO8L 1SJXA 3GKZA 3LD8C 5EA0H 5EBMA 5T1KB 4XCEB 5E8OB 1GZQB 2A6JA 1CFBA 4DUWA 2IG2H 4OFYA 4PUBL 5BMFH 1T1YA 3MZGB 3V6OC 5IVXE 2OR9H 1OSPH 3SDDB 5IB3B 1EPFA 1IFHH 2Z35A 3O0RH 4JKPH 1DVFA 4OZIE 4MHHI 4XP1H 3GBNL 4G9DA 3CFKA 4Y2OA 5D7LA 1HHIA 4JY5H 4D9LL 4DZBA 5DRWA 1FHGA 4NJ9H 3MUJA 5F8RC 5CZVH 2R1YA 1CT8A 3V0WH 4D0BA 2HT3D 4QLRA 1LEGA 1KJ2L 1S7SB 4L8SC 1U8MB 3SO3B 3ETBF 3VXSA 4L5FL 5CSGA 4NNXA 3QP3A 2MFNA 4WHYH 3AREC 3MNVB 3BO8A 3WLBA 1X5IA 1ITCA 2VQ1A 5B4MC 4G8GA 3C5SA 4HUUB 1T80A 3FN0L 3GSWB 3NCBB 1KB5H 4I77H 1IQDB 3TBWA 3TH2T 5E2WL 3N1FC 4S1RH 3L5IA 1NAMA 4L29B 5FK9B 4GRLD 4LLMA 1FL5A 5HGAB 2XQBL 1FZKA 4X8JA 5CEZL 4X5XA 4KPHH 3SE3C 1ZLUK 4JO3H 3DXAB 2WM0A 3PXHA 1T2XA 3SKMA 4HIJB 3PL6C 2DDQL 5ILTH 1Y6KR 5IK3A 3TYGH 2DBLL 1FLTX 3QQ4B 1N59A 1NC2A 4IRSD 4HKZB 2E9BA 3QUZB 5TQ0L 3G5XB 4ZDHB 4M43L 3MRRA 1T3FA 3FQUB 5FXCH 1AQDB 3U0TB 4JFZL 2VIRB 1F6AB 1ONQA 1L9NA 4LASL 2AABL 3Q3GB 2I5YL 4IRJB 2R2BA 3AY4A 1JZ6A 2YRZA 3P4MB 4XT1C 2V2TA 1HYSC 4Y5YA 1T89C 2BSRB 2DQUH 1T5WB 2CD0A 3PWNB 4NQXA 1N6QH 3MRNB 5C07A 1J7VR 2XZCL 3OKOA 3QIUA 1MWAB 2R29H 3S88H 4KU1A 4ELMA 4ZYKB 5GRUH 4GO6B 1W8NA 3FQTB 3QG6A 4XC3L 1T20A 5CP7B 1MCCA 4G3YL 1HIML 4ZS6D 3OAZK 4QHLB 2NY0C 4TYUA 1IAIH 4IRSC 3MLYL 3C60C 5C07B 1BM3L 2WAHA 1A6VH 5E6ID 4ERSH 2JE8A 4EBQL 4DK3A 1DTUA 3MLWL 5HJ3B 4PLOB 3MPCA 2I07B 5GS1B 4PD4J 3KPSD 5F97E 1FFRA 2K7PA 5CKAA 2MWCA 5IROC 3LRSA 2E6PA 4O9HL 2R9HC 4JDVB 1B6DA 4PJ7F 3VRJA 3B4NA 3VWKA 4JG0L 1EHNA 1MRDL 4BSVB 2D4DA 2N7AA 2RQ8A 3QPXL 4IS6B 5C08E 1FL6A 3UBXA 2FSEB 3VD5A 3VW3H 2QLVB 3D2UA 4WDIB 1SY6L 3QUMA 2V5MA 1CDGA 5DI8A 2B4CL 5FA3B 4Y2DB 4K8RD 3BWUC 1LO3H 3T0WA 4GUPA 5CKGA 4AH2B 4PV9A 1CE6B 2XZQH 4LCWE 3UBXG 1XF1A 1LO4H 3L1OL 4OZIB 5JXED 2C4FU 3GFUA 3MRCA 1AH1A 3PGFH 4XWOD 4N8CL 5ADPH 2MQ0A 4NQVA 2P24B 4RAHA 3WYRA 5ENWA 3KPPB 5H94A 3RWIB 1SBBA 1RJZA 4PRPE 3C5JA 1FO0B 1VGKA 3NAAL 3O8XB 2DF3A 2EDQA 3H7BB 2FR4B 1ORQB 5CZXD 5CEYA 2AJYL 2GUOA 4TNVF 5CP7A 4FQXA 2R0ZH 4JFDA 2XKUA 4GG8B 1ZS8B 3JUYA 5HGBA 5D6DC 1MREL 3Q3GA 4N5EC 2X5PA 5MEOB 4G9FB 4NRZA 5GS0C 3BXNB 2ADIB 3VXOB 5DLMH 4TN9A 5JXEA 1DVFD 4WFED 4E5XA 1FN4A 1E4JA 1H3TA 1KTDB 3UYRL 5J89A 5DQJA 4Y5XC 1OGAD 4M1DL 3C2AH 3E0GA 1S5HA 2LAGB 4NQDA 2XN9E 1U8KB 4BSVA 1ACYH 4DGVH 2CH8A 3ARGA 2EDXA 4BQBA 4YZFF 5CJXC 3K4DA 4HS8L 3OJDB 5D2LA 5FKAB 1MUJB 3QDME 5IB4B 4QRQB 1P7KA 1YNLL 3NCMA 2Z31A 1BGXL 3WSQH 1CF8L 2HRLA 1GGBH 3DVFA 3QO0B 4PJCB 2GK0A 3PQYE 5FYKE 4U05A 2V7NB 4PRHB 4X99A 4MDIB 4LCWD 4WWID 3TT1L 4AIZA 4LLVB 3BKML 3D48R 3MRNA 5JXAH 1ZHKA 1YQVL 4H0IA 3TO2A 1G7LA 1FZJB 4M5YL 4MXVF 4JAMA 3VFMA 3RIAK 5I1AB 4Y5YC 3N1QC 2DQFA 3DX6B 3QEQB 4LSPH 2C4FT 3WO4B 1Q1JH 3QDGA 4H25B 4NO5B 4E42B 4OF0A 4P23D 5JHLL 1JF1A 5A43C 4D94A 4F33A 4XC3H 4HFUL 4P2OC 1NUDA 3G9AB 2RJMA 5CGYC 3KPOA 3LQMA 3RWCB 4ZG1A 5DRXA 4P5TB 3SKOB 3G5ZA 1J1OL 3DVGA 4WHTB 2Q7YA 3BOVA 3HS0B 1BQLH 4UOW0 1KG0B 4QY8B 1YZZA 4IMLB 1DEDA 4KAQL 1XR9A 1JF6A 1ZHLB 2ZNXA 3J8F7 4OKDA 3O6MH 5C6TH 4WEMB 4K94C 4I5BA 4MD5A 5ACZB 3NA9H 3NIFF 1QO3B 2IFGA 3RHWK 2VXSL 3O9WB 5IIEB 5ERWA 4TOYH 4K7PH 5TFSH 4G43B 3TIEB 3C9NB 4HF5H 5FGCE 4OFDA 5EBMB 4M5ZH 4OB5L 1WF5A 2YD7A 3IU3B 5F9AC 5I66B 3QNZB 1KSRA 3IDMB 1I85A 4R2GD 2DQHH 4X99B 3HAEG 3DI3B 3OXRB 3VXRD 1R0AH 4KPHL 3MLSH 1S7TA 1Z5LB 4HJGB 5C0EB 3LN5A 3G6DL 2OX5A 3VXSD 3O3EA 1T6VN 1PQZA 5D96B 2E7CA 3ULUE 3BIAX 3OJMB 5INCB 5D2NC 1AIFB 4D9QD 3OKLB 1DFBL 2F5BH 3MV11 1AXIB 4K8RH 3ZT6A 4K94H 1NBZA 4NQDE 5DWUH 1YEGL 4ZFOL 3MODL 3H9SD 5EOCJ 1GZPA 1QVOB 4OUUA 2Y5TB 2BVQB 4XBPB 2ICWI 5IW3A 6FABL 5JDSB 2FH8A 3S9DB 5HDBF 1LO5A 3MRKB 3CFCL 4PRIB 1WWCA 1RZKC 3QUYA 2H26A 2GFBB 5JQ6L 1CTNA 1JWUB 3JZ7A 5E1HB 5HVFB 3KXFB 4ONGH 5LQBL 5IWLA 1X9QA 4XNZB 4P5KA 1JGLL 1UYWH 1NCCH 5IQ7H 4WFFD 3PP4H 1OT1A 5DVOA 4I9WD 1VA9A 1QRKA 3GKWH 4MSWB 3H0TB 4U1IB 4CW1A 5SWSA 5IJVB 4K7PY 1VEPA 3DROA 5GHWH 5J1TC 3DUSB 4NQCD 1IC4L 2CDEA 1RK0B 2CDFB 1U92B 5AD0A 3M45A 4OCXL 3J7HA 1QD0A 2CUMA 3LN5B 5CEXB 1CBVH 4M7ZC 4RDQG 4TPRL 3GMLA 3SY0B 5JW4R 4M9OA 3L6FB 1KCRH 1Z3GH 5FO9B 4NNPH 4Q9RL 3GRWH 3A67L 4ODSH 4E41D 4YDLB 5DJ8B 1NLDL 4ETQA 5GRWA 1JYVA 5F7WC 4JPIA 2AERT 4YBHA 1PY9A 4ZFOB 2AK4A 2DYPB 4MJ5A 3MCKA 3F12A 3CFJA 3ZE1E 2R0LL 2ORBL 1NGQL 3VU2A 2MNUA 3X11B 3FQTA 3QG6B 2R1XB 2G75A 4GRWH 4Y4KB 5BV7H 3BUYA 2CKBA 3GMNB 2Z8RA 4U1NA 2DWDB 1UA6H 1C12B 1T04B 5DUMH 5LG1A 1HNGA 2VO5A 3MXWH 3HMXA 1B0GA 4OLYH 2W9EL 4HSQA 4XMKL 5T3XE 2IPKA 3ARPA 3UJJH 5D7JD 4XX1E 5IKCB 5F7YC 3MFGB 4K9EC 5IBLD 1FAIH 4KZEL 8FABA 3C60D 1ZWIB 4U6HA 5E5UB 4PPTA 1ZLWK 5FECB 2IPKB 1X5KA 2AK4D 3MOBL 4LBEB 1NFIA 3NFSL 2I26N 2J2ZA 5IVZB 4HS3A 1ZT1B 4ISVA 2NW2A 3LKRA 4R6UA 1NAKH 4Y16D 2A6IA 3PWPE 1KBGL 1RZGB 1FL3A 3EJZC 3DGGA 5I1LB 5T3ZL 3U30C 4UT7H 3BX7C 5B38A 4HDIA 4PTTA 4K7FB 1NBVH 5A40E 2X4SB 4OT1H 3RZWA 3MYJA 4NT6A 2VAAA 4BFGA 1RULH 4UTBL 5J06A 5EO9B 5T3XH 4QT5A 2HTLC 2OK0H 3F7YB 1IM3A 1F4XH 4MJIE 2IMNA 2E7HA 1MJUH 1RZJC 4LSTH 4XNQB 5EC1A 4Y2DD 3UC0L 4X98A 2EH8H 1E6OL 3CFJB 3Q6GH 4N0UE 3U2SA 4XC1H 4Y1AD 5CEZE 2CDFA 3O45B 1TVBA 4HQQL 1EGJA 3P4MA 4GOSA 4GXUM 2ZSVB 4MNHB 3ROLB 3UTPE 4BQ9A 5HYQB 4FTVE 1ADQH 1JN6B 4ZSOB 1GXEA 3VG0L 1S7XA 4QWWC 4NHCL 2I9LA 4P2QD 4Z18A 4ZUTB 2DI9A 2GJZB 4WFHE 2NY2D 3N0PB 4JO4H 3VFGL 3L3DB 1CK0H 5IBUG 2QQKH 1JTPA 4NRZB 4P2OB 4F7TA 3QIWC 4DVRH 1P5UA 3GDBA 1YYLL 3K1DA 3DUSA 5HDQL 2AV1A 1AO7E 1EEYA 1MIEL 5GGVY 2E6QA 1WFUA 3QIBB 5DJXA 5CHNB 5L6YL 1G1YA 3MLZL 1BVLA 1KTLA 1E28B 4JY6A 4J1UA 4P23C 1V8HA 4N1HB 4Y4KD 1OAUL 3OR7A 4D3CL 1DVFB 1V05A 4FQIH 4UINL 1S9XA 4J3TA 1OF2B 4U3HA 1YN7B 3U1SH 5CBAB 3MRBB 2I60H 3EZ8A 4HWZB 1VFOA 4WRLA 3ZYOA 1CVRA 1FVEA 1FYTB 2G9HB 2MCPH 3WKMH 4NM4H 5TE7L 3K8KA 4FFYL 4NKIH 4FMKA 1WITA 4NUJA 3DX7B 1VDGA 4JDTL 2ZJSL 4X0KB 4YZFE 4JFXA 5GRJL 3CMOH 2JJWA 1JPSH 4YHLL 4LQFH 4HKXA 5FUCE 3SGJC 2B5IC 3TF7C 1J11A 1JTTA 1UH2A 4N9GA 3C8DA 1D5MA 2Z35B 1YMHB 5JHDA 3E8UL 1CFTB 4A2MA 3G5YB 2BNQE 3EYUH 4G9DB 3NIGF 4HHAB 1I7ZA 1KIRB 5ADOL 5F3BB 2CLVB 1U8OA 3B6SA 3EYOB 3HZYB 3ZDXF 4M7LT 2QQQA 1KELH 1DQQA 4U3XA 4PP1C 1I8LA 3L7EA 4NZDA 5HHOD 4R7DA 2B7DT 5MERA 4PJ7A 4N0UB 2ZCLL 4G8GE 5EORL 4HK3N 1KIUA 1IGCL 3ZO0A 3NH7H 1HDMA 4WNQB 1U3HB 3VFNB 2PO6D 2VLRB 2VDML 1DDHB 4APQD 1T21A 2OJZL 1IVLA 4YWGH 3X12B 3T0EA 3CFDA 1CXFA 3QBTB 1MI5D 1NMBL 5GS0D 1F90L 1AGCA 2NY1D 1EFXA 4FQ2L 2A9NH 3CX5K 4A6YH 5SX5K 1JPTH 4F15B 4G80A 4KMTH 3IXTB 3QDJE 2JTDA 3KPNB 4D9RD 3T2NL 1G7PB 3L95A 3O4LE 5C09D 1UM5L 4ENED 5MENA 3U46A 4BH8A 2CRZA 5F89A 1CD9B 1CFNA 1NEZA 5L7XL 4RGMC 4FQXD 3FO2B 4KTEL 3RNKA 1A7NH 3U9UB 3WS3B 3I6GA 5DC9B 1U41A 4NO0B 2UWEF 1JN6A 2D7OA 3GM8A 4C56D 4ODBD 3E6FB 4RGOL 2X4TB 4LLVA 3U83A 5KOVC 1T1WB 3LEYH 5D72H 3VMPA 2DWEB 5IFHL 2IGFH 1H0DA 1DZBA 1ETZA 2ATPA 3MOAH 3T0AA 1IC5L 1K9TA 4Z7VA 4MJIA 1NL0L 2Z92A 3DURA 3DI2B 3BVNB 3RL1B 1K3IA 3Q6FB 1S7WB 2ITCA 3VGAB 2ITDB 1HQRB 1FO0A 4HC1H 2OZ4L 4ELKB 3W2DL 1X5XA 2OP4H 1T4KB 5HHXH 3MA7B 3GK8L 1SVZA 4OZGA 2YBRA 3CK0L 3VXNA 3IXAA 1MY7A 3U0WL 3I75B 3QQ9D 3MV8A 1KEML 2CLVA 1CD1B 3KR3H 1OGTB 5ALCH 3ZLQC 1K3ZA 4DGYH 4Z95L 1ED3B 4BZ2H 2CK0H 1NFDA 3NABH 4YHIB 1YC8A 4OCRL 5C0AA 3TN0A 3HB3D 5J3HC 1T22B 3ALXA 4AG4H 4Z8FL 3A0OA 2ZCHL 4HK0B 5GPRA 2XZZA 3BMWA 1TETH 1X44A 1KTDA 5HHME 1D5IH 3MGOA 1MCOH 2X70A 3LKSA 5GIRA 3I3DA 1SVCP 4M6NH 4WO4B 2RHEA 3WNNA 3IKCA 2YN5A 5AWNL 4KFZC 4TVPE 2GITA 1FRGL 4Q6IA 4FQPA 1ZGLM 3LEXB 1SM3H 1N64H 5FAAA 1NGPL 4MB5A 5D2LB 5EUOF 2HVKB 1WJ3A 4H1LA 1YY8B 1V7NH 1I8MA 3MMEB 3QJFA 4P2RA 2EEAA 3ARUA 5DSCB 4GJTB 3EHBC 2WWMC 4YXLL 4TNVK 3P4NA 1K6QL 3NACL 1HHGA 3F7VB 4O2EB 2ZOLB 1IM9A 1VFAA 4JQIH 2DIJA 4YDJA 2A2QT 5JUEH 2VDOL 4KK5D 5EN2B 1NC2D 3VWKC 5T1LB 4JHZA 1RUAH 2BVOA 4GKZA 1OPGH 3MUZ1 4OTXL 1NEUA 4PJAE 4JGMA 4Z77B 4U6XA 3QI9A 3ULUF 1JMZA 3ZE1F 3VXNB 2FRGP 2YUZA 4GRMB 3GNML 2RB8A 5HVHB 3G6AA 5LBSL 4LSVH 4JZJA 4PGCA 1B88A 1J0JA 1SEBB 3W5MA 4GRWB 4G7YH 1PKQE 4R7NB 1ND0A 3DSNA 1YEFL 1DQML 1UWEH 5H37H 4FXGA 3WFDH 3HG1E 3TJHD 1UKTA 3FTGA 1VERA 3P77A 4X83A 5AG8A 1MI5A 3IGAA 5DC0A 5FUOL 2OL3A 4MGXA 2IBGA 4OM1L 5D9SA 4U1JA 4ZFFB 3IKCB 3S3SA 5I1KL 2LVEA 5IHUH 2VXQL 3L3KB 1R3KA 4TUJA 5C09A 3BEWA 1S8DB 5CGTA 3N1GC 4Q9BA 5I74C 2Z0BA 2EECA 1IKNA 1I75A 1M7DA 1KLGA 3E2HB 3LKQA 3V8CA 4ZD3H 1PG7L 1A64A 5EWIL 3DVNB 1Z0MA 4M7ZB 3D2UD 1DN0A 3IFOA 4GG6E 4JDZB 2P46B 1Y18A 4O5LL 3ES6A 3I50H 3GMPB 3UTTB 4X98B 1IGFL 2BNQB 2XRAH 3VFOA 1HI6A 2E6JA 2XWJB 1PDKA 2MPAL 4G6KH 3F8UB 5I1IL 2OBGA 5K59F 1MCQA 7FABL 3K74B 5IF0B 3H42H 1MCDA 5GZNC 3IS0X 3QWQB 4U1GB 1OSZA 5EZJB 4JFEA 4NGHH 3X17A 2FYYB 2R23A 4ONHA 1U93A 3S7GA 4Z7UF 3SOBH 1U8QB 5DHXB 4WWKA 3W0WB 3D0LB 5CP3A 4JZJB 2BFVH 3QHTC 4JZNB 1UWGL 5ID0A 3GBML 4Z9KB 4FQHB 1FGVH 4X6BA 2J4WH 3VDAA 1KPUB 2NPLX 4S10A 3H9YA 3UJTH 4PJCE 3BPLC 5T1DL 3WJJC 3TGXA 4G6AD 2NY6C 5EZIL 5F3HB 3RVVC 1YPZB 1AKJD 3UTSD 4PJ9D 5KN5A 3ULUL 2ZKHH 1X6NA 3D3VA 3QUMB 4IMKA 3MACH 1T7ZA 4OKVB 1MAJA 1KPRB 2DLFH 5FV2A 4WVRA 3KLHC 4LAQH 2P4AB 4X4MA 1IGIL 5DRZB 4FRWA 1EVUA 2ID5A 4ORGB 1FO0L 4XVSH 2D7TH 2DQIH 3QEHB 5JR1L 2GJ6A 1K8DA 3DBXA 3RPKA 4UOW1 3GI8H 4FHBD 5INCA 4RMUA 3GI8L 2ICEA 5D6CB 1Q94A 4IDLA 3GIVB 1I7UA 3S96B 3MNVA 1JF5A 2D2OA 1U3ZA 2IBBA 1SYVA 5SX4H 5E9DA 3VFPB 1F4WH 1PX4A 1P53A 1KPVB 3GB7A 4KKNA 4XGZA 4LEOA 4HUXB 2J8UB 4QHNB 2FB4L 1I3VA 5DS8A 2JJSA 4PRHD 3D69B 4OLEA 5FGSA 1NDGB 4UT6H 4LCWB 3ZKSD 3FCTA 1WCBB 1EJOL 1IQWL 1GRWA 2OZ4A 1JGDA 3O11B 3V7AE 3C6LB 4ORZC 4DZ8A 4PS4H 3IETB 1O7SA 2Q8BL 4RIRA 4M00A 3PGCA 4PJAB 1MRFL 4OZGE 3D6GA 3LV3A 3FFDB 5C9KA 1JNLL 4Q9QH 3WL9B 4HZAA 1YEHH 3WO3B 4EUPA 4Z0BL 4YE4L 4RIRB 3UTPD 4HKZA 5E9DD 3EDJA 1ULVA 4NDMB 2BOBA 3CIQA 1M71B 2AXFB 5D1XD 3FB8B 3INUH 2Q6WA 4HPYH 5FYKL 2Q86A 2NXYC 3MLRL 4NGHL 4KK6D 1Z9LA 1INEL 1OD7A 5HI5D 4L3CB 4X4ZA 1MI5E 3C87A 7FABH 5I71C 4JAMB 3VFMB 4OCSH 4OZHF 1F42A 1ZVSA 4K23L 4XAWH 3MO1A 2HFEA 3L3JA 2IAMD 3TO4D 2B0SH 5DQ9B 5T5NF 5KJRL 1CGSH 4I3SL 2VUOA 3PXJA 2HH0H 4HV8B 3DJ9A 4N0UA 2VABB 2GYSA 5JTWA 1G84A 2HKHH 3I9GL 4NQEA 1RVFH 1HH9A 3KPRA 1HDMB 4HEME 1F58L 1GC1C 5EBWB 1QHOA 2NY3B 4CKVX 5IGXL 3P0VH 5B39A 1E4KC 1JNNH 4HHAA 4KRLB 5BVPH 3ZL4H 1GPOH 5ISZE 4YBLC 2H8PA 1D9KC 2RGSA 3P30L 2R4SL 5ECJE 2X4QB 2D7MA 1F02I 1FNHA 1J1PL 2DKUA 2PTTB 1VHPA 3ARDB 4KI5E 2PYED 5IKCA 2H2PC 3AS1A 1D6VL 3MFFB 1PG7X 4JO2L 1R3HB 3RVXC 4FABL 1HYSD 4YDKL 2GJZA 4UT9H 5E03A 3VD7A 3ZKMC 4G6FD 5M95B 4F8QA 1GSMA 3PWLA 2AV7A 5ESQA 2NTFB 2Y06L 4YUEL 4AEIH 5CBAA 3VXUB 3PDDA 4JFOB 3DHMA 3E1F1 1U6AL 4JY4A 3MC0A 5I1DA 1G6RA 1QSZA 5DJ2A 4GKNA 3UTZA 5CLWA 1MLBA 1OAQL 4X9GA 2ZWLT 4OZFH 3Q1SH 3FO0H 2JJTA 3OR7B 5DFVD 1I7UB 2MQ3A 3S96A 3RVTD 5D7IB 5E2UH 1CR9L 3HNSH 4F33B 2YZ1A 2IEPA 2VE6B 1OAZH 3R0NA 1CI5A 1UCBL 3RGVA 3NCJH 3ZMRA 3QI9D 1PEWA 5HBBA 5F96L 4NQDB 5FYLD 5DUBB 3JBG7 5LXGH 1X6LA 2ZOLA 4OQTA 2X05A 1S7RB 1FZOA 4JRYB 3QHZH 2FJFA 3RGVB 5KG9B 2Y06H 3T1WA 2H1PH 4JZOB 3EFFB 1A7PH 5EN2A 3VFRA 2XIDA 2VDNL 1GIGL 3TJHC 4WJ5A 1WTGT 2VDLL 3LD8B 4J8RB 1V3JA 2VLRE 5GRZA 4J3OC 5E9DE 3QZWG 5GS1A 4Q6IC 4N0YH 2EIZB 1ZEAH 2VL4A 3RU8H 4P2OA 3L5JA 5FOBB 1CWVA 1JGVH 3VGEA 4F3FA 5DO2C 1H8OA 4ZNEA 3B43A 2CRYA 5GIRB 2GTWA 1ND0B 3BZ4A 2EDBA 1MFEL 3ZDYF 4Q6YA 3PL6D 5EULV 4LCCA 2ZPKH 5IFJB 3KR3L 1OB1A 3W5NA 5I0ZA 2GT9A 3IJSA 5CGMA 3FB7B 3UBXB 1NDMB 2WQRA 4JEGB 4P2QB 1MHPH 2VR9A 2A77L 3GUTA 2A0LC 4IOIB 4R3SA 4CNIA 4JFYB 1EUUA 1CE6A 1XIWD 5I8OL 2NZIA 2X7LA 4X6EB 2P8MA 4O51B 2D03L 4DTGH 3EOTL 1XGYL 1ACZA 3MV9A 3QZWA 5TDOA 5E8EA 3TJEH 2IPTL 3SDYL 4JFYA 4F57H 1KUMA 4RDQF 2HAZA 4PJ8B 1FYTE 3MJ9H 2BRRH 4ZTPH 4EXPX 2H3NA 5C08D 2BVPA 5D72L 1H5BA 5EZLB 5EZOH 2OJEA 4MA3B 1UQSA 5F1IB 3V6BR 2CKBB 2L7UA 5EOQL 1KACB 4BH7B 3U9PH 1ZA3B 1DBAH 3TJEL 1JNLH 2EEBA 1IC7H 2G2RA 5SWZE 2XNAB 3SN6N 5C0BD 2OXGA 1WAAA 2APTA 4V1DD 1Y0LB 4KRPB 3P9LA 3CLEL 4ZUVA 3RBGA 1MRCL 3ARFA 5F7DB 1MHHA 3H7LA 1J0HA 3QXDA 1NEZG 3MRQA 4JM2D 2CLZB 3I6KB 3GJFB 3UTTE 3JV4B 4HS3B 5KG9A 2WK2A 1X5ZA 3OKMA 5HVHC 3KPRD 4IHOA 2XN9B 3WE6A 4JRXE 4M4RA 2JF1A 3LRSB 4M6ML 5JO5B 3GMLB 2JJVA 2YWYA 2VLJE 2NY1C 3MJ7B 3K46A 2WLZA 2A6DA 4L4VA 5DHVB 5C0RL 2DKMA 2CMRL 3O6LL 5D7SH 4QRPE 1EZVY 2YD4A 4MNQA 3BQUB 1DQDH 3NPZB 1G7LB 4H1LB 2GY7B 1A7PL 3BGMB 4GLRH 4EZMA 4LAQL 1BD2B 2EICA 2SEBA 1OM3L 5I8CB 1VACA 2CLRA 3HE7C 1I1YA 1EGJL 4Z7QE 5EIIA 2HFGL 2VQ1B 2X44D 1MFDL 3HRZA 4P5KB 4RNRA 3U7WL 3L3IA 1GC1H 3SDAB 2QV2A 3E8UH 1A7QL 3RI5K 1EBPA 1ZLVK 2GSGB 4XMLL 3MRKA 3O6FB 1KIQB 4W81A 3ZKNC 3OKEA 4BUHA 4XCFL 4OFKA 4Y4HB 5KOMC 1MCLA 3GB7B 4TTDC 2KPNA 5KANG 2P5EA 4R90H 1AXSB 3RRQA 2E7MA 5DRXB 4P57A 2AXGA 2O5ZH 4IMLA 2R56H 5DDHB 1NUNB 2IH3B 1OP5K 3U1SL 5EH1A 1P1ZA 4FFVD 3WFCL 1DBJH 1CXKA 4LVNC 1RIVH 3DYMA 3GZKA 5E1AA 3C08L 5DJZB 1G9EA 3WN5C 5C08B 1HXMA 1UH4A 1CD1A 3EGSA 3AU1B 1I4FA 5D93C 4UI2A 2WP3O 4XCEA 3R06A 4R4BB 4PV8A 5K9QG 5HDQH 4Y5XB 2XG5A 3WIFB 3V4VL 3BAEL 4HH8A 3DO7A 4GMTH 1C5BH 1A6ZA 4WUUD 4YDKH 4JR9L 4QF1A 4G80B 1KC5H 3LOWA 5HYSA 1SMOA 3CVIL 3QXDB 1MHHB 3I50L 5KSBE 4PBWD 3QEHA 2V6HA 5FM5M 2VTFA 3RNQA 4ACPA 4X4YA 1MUJA 5IB4A 2UV3A 2PO6B 2VLRD 3B9KD 3WLWC 1BAFL 5L9DL 3OL2A 4R2GC 3ZL4L 4GW5A 2DM2A 1JNNL 1DLFL 3JTSB 3MTRA 2GK2A 3CCHA 4PIRF 1TITA 4ZO6A 5I6XC 4M3KB 3MQIA 4S1QH 4HFWA 5E7BA 1CDCA 1UXWA 1CGXA 1U8OB 3B6SB 3HC3H 4HJJL 3S35H 2WWKO 3VDBA 3SKJL 2X42A 1T7VA 1ZA6A 3CVHL 3WDHA 2CJUL 4JR9H 3BJLA 4X7SH 5T3XL 2VLLA 5I1HH 1WZLA 2MJWA 1Q0YL 3MRQB 3W39A 5HHNB 4K23H 4XAWL 2A6KA 5JQHC 5BXFB 3QXAA 1T6WA 3TN0C 3BQUD 4LEOB 3HNVL 4MCZA 1QSEA 4ONFH 4PRIE 4RWHA 3GJEA 3B2UC 3C08H 3INUL 2F53D 4JKMA 4NN6C 1CU4H 1KN2L 2C1PB 4HJ0D 2WBJD 5E7FA 4L4VB 1J5OH 3DV6B 1W72A 5D7JA 5GISH 3LIZL 3DXAE 5AZEL 3QDMD 4Y5XA 2ADFH 1T03H 5JUEL 4P9ML 4PJHB 4FFZL 4JQIL 1KN4L 3T3ME 3ARDD 4K7FA 3KYMA 5T5FH 3QIWA 5LGHH 3WIIL 3QO0A 5C7XH 1U0QA 4OFIA 4FG6D 5GGRB 2Q76B 1G6VK 4NN7C 1HEZB 1A7QH 4LU5H 1D9KA 4V1DE 1LP9A 3GSQB 3MV7B 4P5TC 5GGRY 1UA6L 1J05A 4WFHD 3PHOA 5TE4H 3D3VB 3CZJA 5DA4A 1TVBB 4MNHA 2NLJA 1OWRM 3TBVB 1I7RB 5E4IA 5J9PB 4UDTB 5DVLA 1W72H 1GGIH 3GMRA 1W0WA 1MQKL 4HG4K 1GGCL 1AP2B 3MRPA 4EOWL 1GGCH 2AEWA 2H6PA 4JN1L 3SGDI 4DN4L 4J3UA 4Z8FH 1AKJA 3NFPA 1U95A 5JPNA 3IAPA 3D69A 4G8IB 1WUNT 5H8DA 4RQQA 4ZXBC 1IGIH 4U1NB 1QEWA 4NRXB 5J13B 3U4BH 2ESVA 1RMFH 1WVZA 3GSNA 3UYOD 5JIKA 4P49A 5FYLE 3ZYIA 2XV6B 2PKDA 1NGXA 2MKLC 5CJBA 3VXMA 3VD9A 3HMXH 5IMOA 3LKOA 5A2KH 4BA8A 1U8QA 5FYLL 3W0WA 3QHFL 1KTLB 4LRIA 5J1AB 1DBBL 4P5TD 2N7BA 4UDUA 15C8H 2GW5A 1XEDA 1FJ1B 3GKWL 5J4MA 3D25A 3VGAC 5C0FA 3OKDB 4RGMB 3TWCL 4DGIL 5IEKA 1T22A 2HT2C 5T5FL 1QZ1A 1B4JH 1KN4H 5BXFA 1DBAL 1OB1B 2Y72A 1A6PA 3TT3L 3QEQE 5IHZB 4OKVA 5I17A 3CX5J 2APVA 4MWFA 3PHOB 3AC0A 1Y6NR 2BNRD 3VFSA 3KJ6H 3WXVH 3FOLB 5EU6E 3UTZB 4ZUUA 3H42L 3BDYH 3KNBA 1BREA 3PUCA 1S7WA 2R1WA 1QLEL 2XOTA 4P3CH 4XNQA 5D7IA 1N0XL 2W91A 2CJUH 1RQ5A 2APXA 3MLVH 5GGRA 4RCAA 1BJ1J 3QEUA 3HC3L 4HJJH 4NQVB 4G42A 1N6VA 4X9HA 1RZ7L 4H8WC 2Q8AL 1BQSA 2MSPA 1AR2A 4M1CD 1XR8B 4OJFL 1C8PA 2UYLB 1WZKA 3CZFA 4GRMA 4WTZG 2FO1A 1F6FB 5IVOA 2EZ0D 4M5ZL 1DQJA 3SPVA 4BQCA 2NY0D 1M7IA 4UNTA 5DJAA 2QHLA 1LP9F 1BQHA 3R0MA 5SX4I 2YXMA 4PP2B 4LQ1A 5EORH 3CVIH 5CD5C 4DJMA 3VRJB 3QRFM 3ULSA 3U46B 3V95A 1ZWIA 1A1OB 1MCKA 1KV3A 1LP9B 3GSQA 3MV7A 3WL9A 4V1DB 3HHRB 3O3DB 5IP4A 4MJIB 1F6AA 3WNMA 4NNYB 4G7YL 4OF8A 2QSQA 3RTQB 2HFFA 2ICWJ 4BSWA 1GGTA 3R1GL 5BZWB 3QJFB 4P2RB 5C1MB 1CL7H 5D1ZA 3OHXB 5F9DC 3KPRB 3RQ3A 4RWYL 1RIVL 5IFAL 3FHQA 1H0DB 25C8H 2YPVL 3CLFH 5TGBB 1I1YB 2F53E 4UILL 3U6RA 2F9BT 4PGDA 4YJZL 4XWGL 3CDGA 4M61B 1MFCH 4NQSB 1QBAA 3V79C 3ARDA 4ODTL 1FNSL 2WSKA 3VJ6A 4K71B 3SDDC 1WWWX 4WHTA 4RWYH 4D3CH 5K9KA 4OLXH 5SWSD 4ZPVB 2IQ9L 5MERB 1BBJB 3BO8B 1V3LA 1Q9OA 5A2IH 1OT2A 2PW1B 2ILLA 2Y36H 1L4IA 1CF8H 1UXSB 1MIEH 1TLKA 2DMKA 3CXHJ 5H35A 4E9LA 2AXGB 1T21B 3F7RA 1NAMB 1ZT7B 3EZJB 4LHUB 3BRFA 5FYKD 4FXLA 1S3KH 4MNGB 3D18B 2D0HA 4GKNB 4IEFB 3C8HA 3IJHA 5BS0A 3DXAA 4UIMA 4IM8A 3QA3A 2C1OB 5ICXA 1MJ8H 5IB3A 4MLSA 1QSEE 3KLDA 1U8HA 2BY3A 2ZUYA 1GPOL 4V2BA 4JHWL 4M3JA 5ALCL 5GGSY 4QRSB 5K59E 2YSSB 2SEBB 5I8CA 4JM2F 2H2SD 4PJGA 2QADC 5DRWB 2FEDC 2OI9B 1HYRC 3QCVL 4RMRA 3LPGA 3VE0B 1FV1A 1E4KA 2HH0L 4S0SD 3D39E 1DBMH 2BVEA 4LOUC 4EDXA 2AS5M 4CL7A 3LQAC 3WS3A 1PBYA 2OK0L 4KHTL 4KUZH 2PR4H 3PJSA 2GJ6B 4V1DA 4X6CF 2Q87A 4PJEA 4I1NB 1ZVHA 1D5XB 4LNRB 3IDNA 3CFBA 1I9JL 2HJFB 2ZSVA 1KULA 3HG1D 5GZND 4H26B 3EOAB 3B2UD 1CN4A 3GGWA 4KDTA 3V6FB 4X6CB 3L3IB 4RSVA 4WHCA 3GJFH 4PB0L 3O9WA 3FT4B 5L2KB 5BOPA 3EDKA 2P49B 1T2JA 1CLZH 3JV5A 1A7NL 1I8KA 3F6LA 1ZLSH 2A74A 3EO1A 4PG9B 2HT2D 4MZ2A 1HILA 3K3QA 4I9WE 3UJJL 4XMKH 3PDOB 3U0PA 5FHBL 1XCQA 3WHXB 1DBBH 3O41A 4X6DA 4I0PC 5EO9A 4BM7A 4PLJC 3HZVB 1DE4A 2P45B 5E2TH 1O0VA 2M26A 4NQED 1EJ6A 1VESA 2YMXH 3L5WA 4AH2A 4A6YL 3GMOA 2AKRB 2FD6H 2IBZX 5IVXF 5IF0A 2P8LA 1R3IH 4N1CA 2YUWA 3LKQB 2BMKA 3LDBB 3OWEA 1F13A 3QB7C 1NLDH 2BXYA 4DAGL 4N0YL 1JGEB 4M8QA 2P8MB 4UU9A 3N85H 5IVXB 3BPOB 2V2WA 5FDYA 2DQIL 2P42B 4KV5F 5DTFB 5GRUL 3NZHH 3O2VH 3HRZB 4IMKC 1L0QA 3MV9B 3QZWB 2JCCF 2XQYK 1MCPH 3BP5B 2NZ9C 4G6FB 2J8UA 1FLRH 5BZDB 4NCDA 4ELMF 4LDEB 4V2CB 4S1DC 1LO2H 4K3EL 4DFHA 5L8LB 3T8XA 4MNQB 3PL6B 3ZT7A 3BGFC 5MP6L 2JCCB 4OLXL 4G8IA 3ZKXB 2DQGL 4EJ1C 4JFEB 4ETQB 5IW1B 5IBTH 1WK0A 3T3PF 3B2VH 4QXTB 4CU7A 4UBDC 4NKMB 1PW3A 4NRXA 2CIIB 1UJ3A 4FFZH 5TQ0H 1S7VB 1IEAA 2FX8L 3IDIA 4BSJA 5T1DH 1LHZA 3MRHB 4LCUB 2WIIA 3E6HA 4K3HA 5AZEH 5HHOB 5LAXB 2I9TB 4I0PD 4F8TA 3W9DB 5IUSA 3I2CH 3IFLH 43CAB 4OZFG 4JO3L 1EHAA 1J12A 2EE3A 4HJ0C 3HZVA 2BNRE 3U79A 1T2QH 3DV4A 1DSFH 4QCIB 2DQTH 1KLFA 1WEJH 2D9QB 3QQ3B 2LVCA 1YEGH 2X4SA 3BPNC 3STZB 4U1JB 4JFEE 4WCYL 4JPKH 1Q0YH 1DFBH 2PO6A 3HR6A 2R1XA 3FOLA 3UTSA 5IVNA 3SKJH 4DCQA 3SJVE 3OX8A 3S35L 5EO1B 1PGRB 3VFWA 1JYWA 1BJMA 1TQBB 5DD6B 1HHKB 2QADD 2F54B 4KKBD 2R0KL 5D71H 3UMTA 4S1SH 2PETA 4S1SL 3GBNH 4PJGE 3VWJA 4CN4A 4NQCE 3PWJA 2ESVB 3MRIB 4IRJA 2VXQH 3ARVA 3WEXA 1J8HE 3O9WC 3RBSA 1G6RH 4Y5YB 4GQPH 2IWGA 3VCLA 1M71A 3MA9L 2VXSH 4OZHA 1F4XL 4KY1L 4OGAC 1BEYL 4ZS7L 3ALWA 5JIPA 4N1EA 2FX7H 4F7MA 3G5XA 4K07A 4JPKL 4P3CL 1R5WA 4ZAKD 3D0VB 3H0TA 4U1IA 4CW1B 3BDYL 1QRNB