5CZXC

Crystal structure of notch3 nrr in complex with 20358 fab
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
220
structure length
214
Chain Sequence
b'QVQLVQSGAEVKKPGSSVKVSCKASGGTFRTYAMHWVRQAPGQGLEWMGGIVPYHGITDYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARDDYSTYAFAYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neurogenic locus notch homolog protein 3
publication title Characterization of activating mutations of NOTCH3 in T-cell acute lymphoblastic leukemia and anti-leukemic activity of NOTCH3 inhibitory antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 214
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5czxC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5czxC01
1DBBL 4G8GD 1MCEA 4NNYB 4P2QA 4K9EH 4O4YL 4IMKA 5D7SH 2DAVA 4JQXC 3DYPA 3L3IA 3F7YA 2VQTA 1NFIB 1KCUL 4Z7VA 4DKEH 5HHVL 2HVJA 3KPRD 4HMEA 1JYNA 3QHFL 1QQDB 1IE5A 1GCFA 1A4KB 4FFZH 1IT9H 4XXDA 1D5IL 5I1CH 2YUWA 2XPGA 4GG6B 5IP4A 2GJZB 5EU4B 4FTVE 4Z5RA 1WCBB 3WO4C 3QH3B 1OARL 2BVTA 3FO0H 2J88H 2E7CA 4QHNA 4QYOB 5IFAH 1IGFH 3CUPB 1XGTB 3GMMB 3CNKA 4EI5A 4UBDC 5DQ9A 2JELH 1A1MB 1M7IB 2VQ1A 2DJUA 5IEHB 1WAAA 2V2XA 2WW8A 4KAQH 4PP2A 3DTXB 1NCBH 5CEXA 1NJ9A 2IH3B 2DL2A 4HIEB 3UTQB 3MJ7B 1MNUL 3MRHA 1CIDA 2R4RL 1UM6H 3CJJA 3HPLA 5ESAA 1BBDL 4L8SC 3T3ME 2V5TA 1W0YT 4FXKA 4NUJA 1NCCL 2WINB 4WFFD 5ICZA 2HP4A 3UTZA 2VZSA 2C1OB 3THMH 3BIBX 4S10A 4PRHD 1YJDC 1OGAD 4F58H 2QADB 4LPUA 3UTTE 1ZLWH 1TJHL 1GC1L 3B2UC 2EH7L 4XPFL 4H1LB 2P44B 3ULUD 3F6LA 3VFNA 1MEXL 4G6JH 5JNYA 1DBAL 4U31A 5E1HB 2QJDA 4MAUL 2K7PA 2F19H 1I8KB 5JPMB 3RZCA 5E2VL 2HJKB 2NY0C 1EVUA 1B88A 2FLRT 1IM9D 3CLEH 2R1XB 5HGAA 1GHFH 1MRFH 4XNQA 5HTSA 4P48A 1JRHH 3D3VB 3SDAC 4QRRA 1Y18A 3UROR 4K3DL 2VWEE 5DHVB 2XWJA 3BO8A 1E6OH 2DBJA 2Y5TA 3UPRA 2YWZA 4JHWL 3T3PE 4HC1A 3VFUA 4O9HH 3T2NL 1RZFL 4LHUG 4LLUB 3TCXA 4CMMB 5IM7A 5DTFA 3DX6B 1RSFA 3NPZB 2H45A 1KN4L 1IARB 5F6IC 3L3OB 4KPHH 4XBPA 1IAOA 3BIKA 4MJ2A 4CW1B 2M26A 1RAMA 5DYOB 4HEPG 3GSXB 4S2SB 4Y2DD 5FA4A 1INEH 3UJIH 3SJVB 2LE9A 3JWOL 3R8QA 5I19L 2IBZY 3BH9A 2RIKA 3O2VH 4TULL 3V5HB 1NDGA 5HHNB 1FLTX 1A7BA 1BREA 3RX5A 2WP3T 4EUPA 2HT3C 3ZTNH 1HHKB 1A47A 2YMXL 1RULL 3FO1B 1JNNH 1S7SB 5F89B 4LEXH 3DIFB 1XIWC 2PXYD 1U3HC 5FB8A 3MRBB 3NN8B 3IAGC 4B0MM 4UNUA 4F15B 1FZJA 3O6FB 5AAWA 2IGFL 4PJBF 2LTQB 2XA3A 5I8CA 1JZ7A 3HI5L 4YQXL 1QR1B 2X4QA 2JB6A 4ZUVB 4M1DH 5DRNB 2LU4A 4ZOBA 1MJUL 3H9SD 3SDXE 5CSBA 3VWKA 4MA8L 1YEIL 2AV1B 4Y2OA 3QEGL 3W9EB 3OJDB 2FSEA 2E27H 3RY5A 4ZO7A 3DHJA 3GHEH 1ODAA 5D2LB 3T8XB 3NCJL 5DD6B 1DQLH 5F9AC 4WI8A 2R15A 4O02H 3IDGB 5J6GB 1KTDA 5C0CB 1LDSA 3VG9C 4XP6L 4R4BA 2HTKC 5FOJA 4MD0B 5BO1H 2AEPH 2F8OA 1NGPL 1QHPA 2NY3C 3P73B 5E9DB 3WNMA 4GRWB 1P84J 4PG9A 4H8WH 2G5BA 1KYOK 3PP4L 4C56B 1A0QL 2R2BB 1WGOA 1K4CA 4O5LH 4NZDA 4EN3C 1ZGLA 1T2QL 1FGVH 3MNZA 4PJGA 5J56B 4EQ2A 2F58L 2OQJB 5FM5M 4X4MA 4YBHA 4FS0A 5FKPA 3QUYB 3UBXB 3QBTB 1YJDH 2AQ2A 2AXJA 2J4WH 5SWSB 4YHMH 4DQOL 2A6KA 3F7VA 5D96C 3QPQC 3EOAA 3WJJA 1PBYA 3C09C 3QDJE 2UY7A 2JIXB 5HDBF 4YHYC 2EYRA 2PYED 3BP7B 1ROWA 4I48B 1KIUA 4JRYE 1TCRA 3CDYA 4YDLB 4K71C 4DN4H 4YJZL 3MRCA 3D0VA 4X7TB 4POZD 2F5BL 1AH1A 3G9AB 5L2KD 4QRQB 1CD1B 5IIEB 5KW9L 1CGSL 1RPQA 4GT7A 3RGVA 2K7QA 4QWWD 2NYYC 4I0PD 4NO3A 4X5LA 2R2EB 4Y5YB 3UO1H 3IJYB 3O4LA 2XZAH 3QHZL 1DUZB 5ALCL 1QNZL 3K80A 3BE1L 4H5SB 4Y89A 1BD2E 5GGRY 2DQHL 3CZFA 1TMCB 4IJ3C 3V4UL 5INCB 4D2NA 1MFEH 3FFDB 2X10A 1KIQB 3BRGC 4TOYH 1FNGA 4NYLA 4PGEA 3QRFM 2WSKA 4YBLC 4Z7UB 4X98B 4LDEB 4B7IA 2HRPH 1T1YB 1B4RA 4NZUH 3W11D 4QHKJ 3I2CL 1P9MC 4MLIA 3IDMB 4NO0A 1NCNA 3EYQC 3WL9B 1BEYH 4PBVC 1HQRA 2AJUL 2AJ3B 2AJYL 4BQCA 4FQXB 3VXRE 5ANME 5IMKA 3VH8G 3TCLA 5GSRB 2CIKA 4OGXL 5ADOL 4JFFA 3ECBB 4TUKL 4LKCA 1XH3B 5JMOC 3PJSB 4Q9RL 4PRAB 1HOCB 4URTB 5MEQA 4Z7QE 1RURL 1QBAA 3O9WD 1Y6NR 5F1KC 5LKNA 1S7UB 4Y1AD 3IDNB 1A6UH 4NM4L 3VGFA 2ADIB 4QRSA 2O5XH 1BOGA 4HS8L 4P2RE 4WCYH 3VXUB 2AKRB 5D71L 3JVGC 3L95B 5EZIH 2CIIA 3ULUL 3RI5F 1V7MH 4UV7H 4ZUSA 4Z7WE 3QUKA 4HT1H 4H88L 4MNGB 3P30L 2GJ6D 1FL5B 3LEYL 2JCCF 2NY4C 1F6FB 1PFCA 2IALB 3ES6B 4NRZB 4KI5D 4YFDB 3GI8H 4P2CG 2N1KA 3C6SB 4JQVA 5I75B 2GFBB 2NZIA 3QEQA 4J3XA 4JRXB 4ZS7L 2IC2A 3O6LL 4XCYA 1KB5H 4U1GC 5F7DA 3RWGA 1NH6A 1HYSC 1T5XA 5DUPH 1I4FB 3MCKB 1CFTB 4GAFB 3EDEA 1W2KT 4JHBA 1Y6KR 3HCVA 4QTIH 4QRPE 4KWUA 1D9KA 2OK0H 5JZ7C 3MRPA 5DFTA 3QXVA 4FQIH 2H6PA 1YN6A 3GK8L 4K2UH 1RD6A 3BHBB 1R3HB 3JV6A 3SO3C 5CBAA 3LEVH 1OAXH 1OP3K 4KFZC 1LE9A 1JJUA 1FYTE 4IRJC 1S78C 4GS7B 4Y19A 1D5MA 5FEBA 2H2SD 4NO2B 4HWUA 4LQFL 2IPUG 4N5EC 4S1RL 2BNQA 1X5YA 4MJ6A 1JZ3A 1H8OA 4GKZA 3PHQA 4NPYB 1NBZA 3N85H 1L7TL 4KKBD 5IJKA 3EYFA 2P5EE 1ACYH 5J13C 5HGGS 1ONQA 1U8JA 1FSKB 1UKTA 5AYUL 2X44D 3NCMA 5BRZA 3FFCD 3BGMA 3UZQA 2E7MA 1J0YA 1FPTH 2AXHA 4L3ED 1MH5B 4G9FA 4RFEB 3S6CA 5EU7C 3H6JA 1RUML 1GPOL 1YEEL 2P7TA 5E1AA 4O58H 4G8GA 1TZIA 3DVFA 4S1SH 4UB0L 1RUQH 4FQQA 2PW2A 1LO3H 1RUKL 1YECL 4RMUA 3U4EB 2YR3A 2I60H 4LLVA 4LVHB 4OZGB 1ZA6B 4HUKB 4HHAA 1ZANL 3VGBA 3GMRA 5BJTA 5DJ2B 3MRDA 4NQSB 4X6FB 3MO1B 2DICA 2DQCH 3QWQB 5C0AD 1T0NB 3NTCL 1C5DA 1TQBC 4N9GB 5EN2A 3DURA 1SJHA 2NMSA 3CSYB 4NBXB 3QI9B 4ODXA 3SE8L 5KOMC 5JW4N 2FEEL 2OR9L 3HMXH 2GQHA 2R0KL 4EVNB 2GKIA 3M07A 4JFED 4X4ZA 3DV4A 2YPLE 4HIJA 5KS9B 3H0TA 3SE4C 2XTJB 1AJ7H 3HC3H 1L7IH 5JUEL 4WWKA 3OQ3B 1B6DA 5EZLB 3EOBA 3GMOB 3I9GH 5IVXF 3D18B 4J3UA 4BH7A 1PJ9A 2DQJL 3MLRH 1EERB 4GW4B 4Z76B 3T65A 4LU5L 1GIGH 1G7JB 5E5RB 5EIVA 2DD8L 3NFSH 3NZ8A 3P0YH 4M7KL 3HAEG 1Q9WB 4X80L 3C08L 3FMGL 4PRHA 2FGWH 3OHXB 3MRJB 4LSTH 3EBAA 1SBSH 1ZT1A 3I6KA 4RAVA 2X4SA 3AAZA 1BX2B 5T1LB 4YGAB 1NANH 4DEPB 3BSZL 4E0RA 1T7ZA 1JPSH 4J6RL 4XVJL 3NABL 1S7QA 4KK8D 1IM9A 3UP1A 3M1BA 5HHOE 3HNVH 2YD1A 4YXHL 5F9JB 1MY7A 3QJHA 3D2UA 3IFNH 2D0HA 1UJTA 2HTLD 3FONA 2AEWA 3A6BH 4I4WA 5AYQA 1V3JA 2CLZB 5GJSH 2E8YA 3RVXC 3NVQA 3SQBA 2BVOB 4K3EH 1LDPL 1JHLH 4XCNA 1T89C 2MQ0A 5GRUH 4KHTL 3FOMB 5T5FL 1TFHA 4QXGL 3WNLA 3BKJL 1MOEA 4ZFGL 3TA3C 4OCYL 4AK1A 3VXOB 2Q7YA 4PD4K 1UGNA 3LRHA 4JO3H 3P40A 2AGJL 5T3XH 3EDJA 4Q9BA 1QRND 5JW4M 4K55A 4NM8H 2EKSB 4JGUA 2BRRL 4OLUH 4YIQA 3TPKA 5KSAA 3WKML 5BV7L 3CPLB 4DZBA 2QKIA 3QCUL 5DJ0A 3WFEH 1VKXB 3TP4A 1NC4B 3SGKC 3D39E 2GUOA 1NANI 2B2XH 3CVIH 3EO0A 3GBNL 3LD8B 5CEYA 5EWIL 1TDQA 3RUGA 4Y2DA 1EJOH 1D3CA 1U8LA 1ZKAA 3C9NB 1KFAL 5E2TL 4K3JH 5C07D 1F3JB 3QIUB 1YEFH 1U3ZA 3HZMB 3S8WA 2HFTA 4P2OD 5D1ZD 5FECB 1F97A 1JZ6A 3LKQB 4OT1H 3B9DA 5I1AB 4FNLL 3F8UB 3T77B 3T3MF 2GAZA 1J1PL 4YC2C 5EUKA 1DBMH 4N90E 2PXYA 3PABA 2KDGA 3ZT5A 3OAUL 1OTTC 1MJJA 4U1NB 4PJ7A 2VDMH 2YD7A 4NQDD 5J6HA 3P9WB 3QDMB 1A9BB 1URLA 1QFWI 1I3GL 1GGCH 2B39A 1U8PA 4RWYH 4ZXBC 3SDCB 1S7TB 4R2GC 1F3DH 2GCYA 3IRPX 4JDZA 2F53E 2K1MA 2V5RA 4UDUA 1U3YA 1KACB 5LWYH 3PXJA 5TGBB 1EBPA 5CSZB 4ZDHA 3LH2L 2V9RA 4PBXA 3I02B 1BIIB 2FBJL 1QLFA 2NCMA 3VI3E 4X6BA 4Y4HB 1MVUA 1NC2D 3QG6A 2R8SL 3DX8A 1KOAA 1BGXH 4HUWA 3KPSB 1CF8H 3T0WA 3T3PF 2P8PA 2BVQB 3LKPB 5DC4B 1JUFA 3S3JA 5DZNA 2D9QB 5EZOL 2XT1B 1I9RH 4XHQA 3F5WB 1NFIA 5I1DB 3K4ZA 4QGTA 3BP4B 5DRWA 4M48L 4JKWA 1NSNL 2WBJB 4CADB 5F88B 3QAZB 3EZ8A 1QQDA 5C2BL 4XPHH 5IBUB 4FFVD 1FIGL 2YRZA 5B38A 1IC1A 1ZT7A 2YKLL 3MNVB 1AGDB 2APWA 1DLFL 4JY4B 1YNKL 5CHNB 1XGTA 4LSRH 2QV2A 1TPXB 1H3WM 5EA0L 1A1MA 2AERT 5IEHA 1AQDB 5DVLA 1KJ3L 5IG7B 1LNUB 3TYGL 2YZ1A 2E7BA 2J8UA 1X5LA 2IH3A 2PYEA 4Z7VF 8FABA 1P69B 1JTOA 3LKSA 4JGJA 3STZA 1RJYB 4XVSH 4D0BA 1PG7X 3U30C 5I2IA 5L2KA 4KJPD 1WT5A 2HFEA 1KTLB 3CFBB 3IU4H 4BKLB 4HKJB 3ME0A 3SHSA 5B39B 2RAMA 1CGUA 1IAIH 4HULB 1BJ1H 2BMKB 2V17L 4I0PA 3RTQB 1KJ2B 2BRQA 1A1NA 2ITDB 2CK2A 4ACPA 3IETB 3VU2A 5H35A 1LK2B 4TN9A 3M17B 4QGYA 2GIYA 5HYSA 4KDVA 1FYHB 2VDPH 2ITCA 1I8KA 1WAAF 5JPMA 5JLZB 2I5YL 3KYMB 4MWFA 1N5AB 4MCZB 5D6CA 4GXVL 1MCKA 2AJXH 4RZCB 4KV5E 3CU7A 3QRGH 4BUHA 2B0SL 1G9NC 2UYLA 3O8XD 4LMQI 4Q97A 2F54D 4JFOA 3KXFB 1NQBA 3O3DA 4CDGC 4RDQF 5T3ZL 2DBLH 4ERSH 3PQYD 1SHMA 1XGYH 2A6JB 3CK0L 3LKOB 1RI8A 5HHXL 3T1FB 3QPXL 1WF5A 1HWHB 2O5YL 2BNUB 1KTRL 2FJGA 1I9JH 3ARSA 4YFLF 5J3HC 3BN9D 4ZPTA 5FO7B 3GIZH 1WFOA 3MRGA 2BNRB 4BZ1L 4D0DB 4LLUA 5B8CB 4OF7A 1B9ZA 5CZVL 4K7PY 4F7EA 2GW5A 3RWIA 3O9WA 3ALWA 1GGBH 2C7UB 3BPOB 25C8L 5C0RH 3ARDC 3R1GL 4CDHA 5A2KH 5F7YC 4CW1A 3KAAA 1T20A 4AT6B 3IKKA 4ORGA 4CJ0A 3EDKA 5DT1H 3KG5A 2R39A 1Q9OA 4LCCC 4S2SA 2IPTL 2UVEA 5AZ2L 4PRNB 4I2XA 4YX2L 1DVFD 4JFXA 1EGJL 2R69H 1VACA 1A4JB 1MHPL 4OZFH 2GJ6A 1RVFH 1HHKA 5E4EB 1KB9K 3FO1A 1BFVH 5BVPH 4O2CA 5F7EH 5F89A 4JDTH 4KKNA 4TPRL 3DLQR 5D8JL 5F8QC 4L9LC 4RRPG 5L9DH 4AIZA 3TFKD 4QF1B 2CK0L 4NWUH 3OR6A 2AJSH 3DHMA 3QQ4A 4RQQB 4K7FA 4G6MH 3S5LB 4GG6E 3EIFA 3BWAA 5MERB 1BM3H 2VZ1A 4GW1A 3AB0B 5FGCB 4P5TB 5I76B 3A67L 2P4AB 5TFSL 2CDFB 1JHTA 3QUMH 2FX9H 3W9EA 1AD0B 1Q72L 2NY4D 4PJDE 3EYUH 2VXTL 3HE7B 3ILQC 1P4LB 2VIRB 2A1WL 1ZVYA 4HIIB 3HG1B 5J6GA 1TZGH 3DARA 3JXAA 1GZQA 4XB8A 5I1IL 3KLHD 3IVKA 1ADQH 1ZHKB 3GJEA 5DZLA 2VLRD 3RY6A 4MAYC 4PJEA 1A6AA 1BMGA 1J8HE 2XI9A 4Z7QF 4X6CE 4XWOC 4TSCH 3FFCA 4DW2L 2A0LC 3KLSA 4G7VL 5CKAA 3C8KB 1UFUA 3L3GA 3MBEB 1ZSDA 4MQTB 2OQJA 5HGHB 2B7DT 3U79A 3ARFB 1I7TB 5GRYA 4PRBB 3RL2B 4HXAL 1FZOB 3FB8A 3T0DA 3QUYA 5DRXA 1MCPH 3FO9A 5SWSA 3B2VH 1KLUB 4G6AC 4YUEL 4F9PA 1RZGA 5HHPB 4PTTA 3K2UH 5DD1L 3L5IA 2CXGA 2ZSVB 3L7EA 3MRFA 4MXWH 3KPPA 5AUMB 5CEZE 3D3VE 3TVMC 1IKFH 1FL6A 2DB8A 2VL4A 4X6DB 4H26A 4HLJA 3BP7A 4I48A 1JZ5A 4WVRA 1MAKA 1SM3H 1F4YH 2HG5B 4PRIA 5KSBF 4CRPA 1W72H 4L1HA 4YWGH 5BOZG 2PR4L 4KMTL 1QBML 2DDQH 4KGJA 1QLEH 4FQHB 4RBPK 4JFEA 3ZDYE 4C83B 4NT6B 1N0XH 4RISL 2G2RA 4RGMC 4GH7B 3LS4H 1IFHH 5BCAA 3R06A 4PJIA 3PXHA 2AXFA 2R2EA 4Y5YA 2NTSP 3BQUD 5HY9B 3IT8D 4JJ5A 4X7SL 3PGFH 4H5SA 4NCDA 4Y4KC 1G9MC 1MRDL 4APQD 3H9ZA 3EOTH 4R90L 5INCA 4M5YL 1ITBB 2FX7H 5E8NA 2NW2A 1CR9H 2R4SH 3H9HA 4R0LC 4DVRH 4YGVB 1WBXB 5K9OB 3WE6A 4JHAH 5IVZB 3SJVE 4N8VG 4XTRD 1OAQL 5I8EB 5EOTA 1T1YA 1DBJL 1LMKA 2X42A 3IGAA 4WNQA 4TUJB 5ACZB 3L3KB 1UJ3C 4TRPH 1DSFH 3QISA 4M7LT 5FAAA 3WL9A 4BFGA 1P4IH 1ZWIA 3ZYJA 1EGJA 5LQBH 4PGDB 4QCIA 4O2FA 1JGUH 2ED7A 2AJ3A 3S37H 4NOFA 4Y5XB 2B1HH 3C5ZB 4FQLL 4GAGL 5GSRA 4WWID 3MREB 5BZDB 4BQ8A 2EEAA 4OFDA 1MFBL 1HHJA 4NJAL 1MI5B 4KKAC 1T0MB 4LL9A 2AXGA 4HJGB 4PRAA 5CWSB 3MFFB 4OFKA 3S88L 2VDQL 5E2WL 5FYKU 1F45A 4PRDA 3V5KA 5IWLC 3SCMB 1J87A 5JHDD 2ADIA 1VEOA 2D7OA 2ZJSH 2OI9C 2AKRA 3BN3B 3RVWC 5DD5H 4M6NL 3L95A 4FHBD 1CL7H 3CXHJ 4U1JB 1J0KA 3IAPA 3H9YA 3MACH 4IOFD 4OF6A 4W4OC 4OD2B 1FL5A 3O6MH 4PS4H 3DX7A 5HHQB 1CXIA 1TZHB 3GSOB 4L4VE 2VH5H 3QUXB 1H3XA 2GFBA 2CKBL 4RDQG 2I07A 1GVIA 1F00I 3LV3A 2HT4C 1AHWC 5E9DE 5C07A 5L6YH 2C9AA 4YZFE 5D1ZA 4P2OA 4C56E 4F57H 2YBRB 2XZCL 1T04B 3RDTB 2BSED 5CZKA 3JWDC 4WUKL 1BVKB 5FUCE 5IB4B 5DLML 1ITCA 1R3HA 3RA7L 4LQ1A 3VFOB 5J0BA 3NGBC 1LEIB 1ZVSA 4NO2A 1KIRA 1YY9D 4NQDA 3BDYL 4LSUH 4M4RA 6CGTA 4Z18A 5IBLD 1CL7I 3PDOA 3ZKXB 3QIWC 1VGEH 3QDHA 3RIAK 3REVB 1QFUH 4OQTL 5E2JA 2BOCB 4XNMB 5HVFB 1B0GB 3RWDA 3EJYD 5JIKA 4H20L 4HGWA 3RZWA 2JJSA 3MCLH 4A6YL 1EEYB 1CLYH 4E42B 3FRUA 1MHHB 3VXTB 4YEEA 4RFEA 2W9EL 2XN9E 1QEWA 4WTZG 4FA8A 3RJQB 4LGPB 2AI0L 3WKNA 3RHWK 1HH9A 3K2MC 4U6YA 3H2WA 1S5IL 5TH2A 1BZ9B 3P4OB 1S5HB 5F71A 4PJHF 4UUJA 4Z7OF 1G1CA 3ARXA 3HI6L 3PWPD 5DJ6B 2WZPD 1IM3B 3SKOB 2H1PH 5DSCA 3CVHB 1G9MH 1IBGH 5BZWB 1KPVB 1A1OB 3MRQA 4Z7UE 4OGZA 3LQZA 4X6FA 3MO1A 3UCRA 5CUSL 3FT4B 1RZJC 5FK9A 2VYRE 4U2YA 4MNQB 1MJ7H 4G80A 1S9YA 1I7ZB 4HQQL 2X70B 4HIXH 3CSYA 3W0WE 2DTMH 2XQBL 3CD4A 4IHOA 1T6WA 3RWEA 4AEHH 1ZS8A 4XNUL 2QLVB 5CMAB 2IEPA 4L3AA 2ESVD 2CDEA 3RY4A 1ZOXA 3QEUB 1CGYA 1FFNA 3ARUA 4JY5L 2BHUA 2V7HB 5DJDB 3RBSA 1RZIB 5CFHA 1NCTA 1RZ7H 3B8SA 5EPMB 4P9HC 4ELMB 3D18A 2EEDA 1PX3A 3HE6B 2R0LL 4JFPB 2BFVH 4Z76A 2YEZA 4PJ9C 4NP4H 1HILB 4NQCD 2XA8L 4Y7MA 4PJXF 4NQXA 4XVTL 4U1LA 2A6IB 1AC6A 3DV6A 4FZEH 4HKXB 2P5WD 2VXSL 4WU5A 1CG9B 1IC7H 1U8NB 3OHXA 2YS4A 3TO4C 3VE0A 2XXCB 2VAAA 4FXGA 3VXMD 4NSKB 3GMNB 5T1LA 4JFZH 5E8DH 3VI3F 4LF3A 4MZ2A 3D0LA 4OV6F 5HYJE 1VFUA 5C08E 1PKQA 4OLZH 3BAEH 5IB3A 3O8XA 3MLVL 2X40A 4ZUUA 2CKBA 2FLBT 1FP5A 4AL8H 4LDLB 5MENB 1YYLH 4JFDE 2WNGA 3WFHB 2V2WB 3DXAD 3TBSA 4HW6A 4F2MA 2QHLA 3O2DH 4F33B 1KJ2L 1H3TA 4OQ1A 1AC0A 4Z95H 2R1YB 4LSDA 4MS8D 4Q6IA 3SKJH 4RGOL 1UCTA 3VXOA 3V6FB 5GS0D 4G42A 4LHUB 3NPSC 4JCMA 2IADA 4ISVB 5DURB 2D03H 5FDWB 3TPUB 4LSQL 1JGLL 1ZXQA 3EFDH 3PL6B 1R5VB 3B83A 4OFPA 3DRQA 3S3PA 5J11C 4P2QE 1VKXA 4XCFL 1HHGA 5DMGD 3GI9H 5FYJE 4U3HA 5E0QA 1C7SA 3P11H 4OQTA 2Q6WA 1I1CA 4I3RH 4U6TA 5LJYH 3HZMA 1DVFA 1RU9L 2R2HA 5DHYB 4YK4C 5JORA 4A6YA 5I1AA 5I6XC 3QCVL 5KOVC 1MJ8H 1EK3A 2M2DA 5FHBH 2FJFA 3HB3C 5IQ9A 3T0ED 4NWTH 4K23L 2QQNH 4OD1H 1B4JH 3MJ9L 1QBLL 4TNWF 4PJ5B 4UINL 2PO6D 5F44A 1JNLH 1DEEA 2BDNL 2Z35A 4ZAKD 4G6FD 1YPZB 4PY7A 5FV1L 2F74B 3RQ3A 2XKUA 1N8ZA 2J8HA 1I9IL 3VXSE 5DJAB 1BJMA 2RCSH 1JZ8A 1VADA 2VE6B 2X09A 5HI3D 3ARVA 1AIFB 5A1AA 4ZFFB 5HI5C 4HUVA 2Q20A 1YYMH 3N0PB 5TGBA 1RZJH 5CSZA 2AK4D 1OLZA 1XGUB 1KF9B 3I02A 4F3FA 4CNIB 5CBEB 4JJHA 2NTFB 3V4PL 5KS9E 1FRGH 1WWAX 3LCYA 2XTJE 1T3FA 1L6XA 4P4KC 3KPSA 4OCWH 5D7IB 3MNWB 1RIVL 4BSWB 3HUJB 3LKPA 4X8JB 4NKDB 1K9TA 1A5FL 2D7PA 2VLRA 4HDIB 4KVCL 2VB5A 2VQUA 1KN2L 3F5WA 4XNYL 3NZHH 3ZYIA 2ZCLH 3OG6B 2DF3A 5JTWA 1WWCA 3DVNB 5H2BB 4GLRH 2ZSWB 1XFPA 43CAA 1UC6A 1KPRB 1EEQA 1GOGA 2WWMD 3AM8C 2AQ3A 3SQOH 2DM3A 5D5MB 4ZD3L 3ABZA 2Y6SC 3QB7C 3LN4A 3OB0H 1Q0YH 2CR3A 2HT2C 2PTUA 5GGUB 1AGDA 4KRMB 5JW5A 3WIIH 1Q1JL 5DD0L 1OAUH 2FECI 1KJVA 2WUBL 4BFIB 1QO3B 1T22A 4R4FL 1FE8L 1AP2B 1P7QA 1A3LH 4HCRL 4JM2D 5TE7L 5IG7A 4QRTB 5IFJB 3GB7B 5FYLH 4Y5VC 3C6LC 3F12A 4L8CB 3TWCL 3ARED 3O3AA 1N4XH 3OKMB 4ETQA 1CXKA 1EO5A 3VD9A 4KKLD 5F7NC 1U0QA 3WO4B 3QCTL 1U93A 5GISL 1KTLA 3U36B 4GG6F 4HKJA 3DGGA 3FB5B 2W65B 3FTGA 1W0WB 1X7QA 2BMKA 3WFCH 1KJ2A 1F4WL 1CDUA 4LCWB 1U2CA 4GLRI 5CCKL 3BQUA 4KHXH 5HYFA 3U7WL 3U1SH 1IQWL 1LK2A 4OGAC 4XPAH 5LBSL 2F15A 1JL8A 1H3PL 1WWBX 1B6UA 1M7DA 4PRPE 3S96B 4JFQB 3S97C 1N5AA 5CJ8A 1IGTB 1C5CL 4MCZA 5DR5L 1R3JB 2X4OB 3LMJL 3BXNA 4PJAA 4HX1A 4RZCA 4FZ8H 1YEKL 2ILLA 2YK1H 1WTLA 4K3GA 4L8SB 1T7VA 4MA7H 5IW1B 3JV0A 3BKCH 3ARYA 4KY1H 3TJEL 3ZKQD 4RMQA 1YMMD 3T1FA 3F58H 2HN7A 1HK6A 3SBWC 2VOTA 2BNUA 1Q0XH 3V0WL 4AENA 1U9KA 3KPTA 4HWZA 3B4NA 1CE1H 4RIRB 5FO7A 3VH8B 2BNRA 3ZKMD 1OWWA 4D0DA 1R6VA 3QDME 5ISZD 3SGJC 4WO4D 2NY0B 3MJ9A 3CZJA 4AY0A 4LGSB 3OPZH 2HMIC 4FP8H 1HI6A 1RIHL 2NR6C 3MLPA 4AYFA 3SDAB 1HXYB 3LSOA 4CJ1A 5I1KL 4M6OL 4NQEB 4XCCL 2W60B 1BQUA 5JHDA 1LHZA 3LIZH 4PRNA 3VRIA 1M71A 3NCFB 3HZYA 4DFHA 1S7RB 1EJ6A 1YEHL 2NXZD 2ERJC 4WI4A 5DK3A 2C26A 5F1IB 4XX1E 4PJGE 2WP3O 4UT7L 3I3DA 1ZGLM 1LEGA 2CLVB 1C12B 4X4ME 1EHNA 4HD9A 4ELKA 4LNVA 3LZFL 5C09A 4L4TB 4MQXD 4M62L 5ICYB 5F6IB 1KUMA 3RBGA 1CE6B 1HCVA 4Y16C 1FG2A 1A9EA 1SYVA 4QF1A 1YQVH 4V1DD 4UDTB 5FKAA 4Q7DA 1Y6MR 3MV7B 4RQQA 1YY8B 3S5LA 1CZ8H 4XWGH 4ZOEA 1J1XH 5E5MB 5I76A 1F11B 1I3RB 2KH2B 1DQDL 1I1YB 5KTEL 3L5HA 1VFBA 5GS0L 1JHKL 2EH8H 1GOHA 3QO0A 1AD0A 4D9LH 5IB1B 3VFRB 1G0YR 4YBQD 1XIWB 1U3HB 3HE7A 5DFWH 1D7FA 3JV5A 2QR0B 5AWNL 4HIIA 3HG1A 4WFHE 3KPQB 2B1AL 1J88A 5MEOA 4DCQA 3G6DL 3UTSB 5GRWA 2Y25A 2VDKH 2BSSB 4HCRA 2GHWB 4HUUB 1DFBH 4YO0B 4KK5C 2VDRL 1EAPB 1X6NA 4M7JH 4XPBL 3E2HC 1J0HA 4I3GA 5GSVA 3QA3B 3KR3L 1NBVH 3Q5OA 5F6HJ 3NCYS 2EDQA 3PGCA 2DQGH 4NNPL 5DO2D 3MBEA 1UZ8B 5LGHL 1KJMB 1I7TA 4P23C 2P46B 1UXSB 5D2LF 3VG9B 5I8OL 4YDIH 3CXDL 4HXBL 1CBVL 3IFOA 3PWPA 4LSSH 1O5DT 3VFPB 5HHPA 5TQ0L 4HLZG 4JFFE 3MLTA 1QR4A 2NY3B 3G6JB 1NFDA 1XR9B 3KXFE 2HAZA 1OM3H 5AUMA 1GGIL 2BVPA 1QFOA 3B5GA 2ATKB 2V6HA 3IJHB 3C5SA 4X8XA 1DANT 5JOFB 3NOIA 2H32H 4GRWF 4M61A 4EN3B 4TVPD 2DIJA 1I1AD 2A38A 4YZFF 5FCUL 5KBNC 1CFVL 5HHMD 2GSIB 1I85C 2E6QA 4LLQB 4FQHA 4GSDL 5DQDL 3TZVD 4OJFH 2XFXB 4MJIB 2W07A 2ESVA 2HKFH 4FQ2L 4UILL 4WHDA 43C9B 5GJTH 5D96B 4UAOC 2DQUH 4RMRA 1AE6H 1OL0A 1E4WL 3MJ8A 3C09B 5BS0B 3Q6GH 1QSFB 1JWMB 4C54A 4YHYB 3ROOA 4HF5H 3KYKH 4NC2B 4WW2C 2CGRH 1JPGB 4K71B 1T6VN 3QEQE 4NQCA 3OKLB 5IVZA 1CLCA 5JXAH 2F54B 5ID0B 3Q48A 2VXQL 2X1QA 4NGHL 1AGBB 4OLYH 5FUCC 1A3RL 1DCLA 2XZQL 4TUJA 1VFAB 4Z6AT 5ITFB 12E8L 3ZDXE 3VXMA 5E2UL 5SX5K 4F7CB 3L5XH 1BFOB 3ARGC 5IGXH 3DGCR 3RI5K 5LCVH 4IJ3B 3CSGA 4EI6A 1F58L 1OSPL 4Z7NE 1CDBA 4IMLA 3C5ZA 3RVUD 5EUOB 3MREA 5BZDA 1B0WA 1IZKA 3B9KC 2CMRL 1ORSB 1MCSA 2VO5A 4KQ3H 1T0MA 3MV9D 1F4XH 4JQIL 4YBLB 5CWSA 3DXAA 3MFFA 5EIIB 3V6OA 5BW7C 1EZVY 5FGCE 4Z7UF 2X4TA 2VDLH 3S7GA 3SCMA 3WD5L 1LO5B 1MCFA 2LAAA 1MIEL 5GZNC 3EGSB 5D2NC 4XP9L 1F6LL 5L8KB 4B50A 4QTHB 1NEZB 2FWOA 4HPOH 4G9FE 5SX4H 4WI7A 2A9ML 3REWB 4KRPC 1MCBA 2CSPA 4G6KL 2YUVA 1A64A 5D9SA 2EXYD 3UDWC 3G04B 4ZMAT 3ULVF 5CZXC 4G8GE 3SDDC 2XIDA 1Z5LA 1DLHA 2NY1C 5HYQB 4HKBA 1IT9L 4FQPA 5L2JA 3TT1L 3QUXA 4ENEC 2VUOA 1YEGL 3VXQB 1FNEA 5TE6H 3P4MB 2H2PD 1NUNB 3KPRE 4N0UA 4P46C 3NIDE 4OBRA 1UYWL 1IGFL 3RIFF 4C59B 4GKNB 1T04A 3ARBC 5JO5A 4N9OB 4H1LG 1BVKA 3J7HA 4NBYB 4NQTA 3PWUB 3T0EA 1KBGL 4KDTA 3TIDB 3B43A 4E41D 4G5ZH 4FABL 2NY4B 3WXWH 2W0PA 3VD3A 4JVUA 1TJIL 1I8LC 1LEIA 1EAJA 2PO6A 1AR1D 1Q9LA 1EX0A 1UM6L 2OMBA 4IRSC 1P4BL 3ZTJH 3VXNA 4PJ8D 5SX4I 4DGVH 4U1GB 1V7NH 3VW3L 3SKMB 3WHE0 5F70A 3U2SB 3REVA 5C9KA 4U1HB 3PV6B 4QNPE 5CJXC 1IC5L 4R7NB 3MRMB 1INDL 1ES0B 4R26H 1AO7D 3SO3B 1J5OH 2VZ3A 3KPMA 2AK4A 1EEYA 5CKGA 3IRZA 1S7XB 4IRJB 4JN2B 2A73A 4WFFE 3AGVA 1MHHA 5TDPB 5JW4Q 4JDVB 4XNXL 4PRHE 4WY7H 1OGAE 4LOUD 3MRNB 3QZWA 2L0DA 4UQ2A 3BVNA 4M8QB 5L7XL 3ULUE 2NLJA 1IGCH 3FQUB 2XWBB 3P77B 3AUVA 5GGTL 1TNNA 5C0BD 3U0TA 5T5NF 1B0RA 3OZ9H 1R0AL 1QSED 5C1MB 3P4OA 4GRMA 2P45B 5ECJE 4UIMA 4FXLA 4LSPL 2IAND 5DJ6A 1I7RB 3G5ZB 5IOPB 3SKOA 3CFDA 4IRZH 5J13B 1A3QA 3LQAH 1IGJA 1SY6L 4OZHB 5HDOA 1N5YH 2R0ZH 3EYSL 5F93C 3WFDH 2IF7A 3GJFH 4OZIB 1UQSA 4GO6B 1I7ZA 2X70A 5J1AA 5HGDB 2WIIA 5ENWB 4LLMB 3WCYA 3TNNA 5F3HA 3W82A 2UZIH 1XCTB 5CMAA 4KROD 4LASH 5IMLA 4K94C 3SEPA 4JM2A 5KVDH 5A16B 4N0YH 1R5IB 2VXVL 3TN0C 3O2WH 2X9YA 5DWUL 4OZGF 2W0FA 4NHUA 5FO8B 4GRLD 2NY2D 4X9HA 2IMNA 3VFVB 1TQBB 3HE6A 5JXED 3PWJB 3UJJL 3X3FL 1ZT4B 3X13B 3QDGB 4EJ1C 1IQDB 1RMFH 2IAMD 4NN6C 3GKWH 2BXZA 3TBYB 2R56L 4QT5B 1G84A 5F9WC 4BZ2L 1DQMH 1AXTH 2X4NA 5FYJU 2VABB 4QOKD 1HH6B 5E00B 5IROA 5EU5B 1WLHA 4PLNC 1TVHA 5DK0B 4NSKA 3GMNA 5D1QD 4PB9H 2C3XA 5DRZA 3QJFB 3TBVA 1ED3B 5D72L 5KS9F 1TETH 4WJ5B 4R3SA 2Z92A 5EDXA 1U58B 2KPNA 2MCPH 4PJ7E 5ELIA 4JO2H 2AJZB 3IDJA 4DOHE 3LB6C 2EDEA 2P42B 3VGDA 1WBYB 4OLXL 5MENA 3W81A 1JGVH 1IGYA 2HJFB 3V8CA 3RAJL 1YMMA 3H9SE 1ZK9A 5KSVA 4MX7B 4N0FA 5JA8B 1NGXB 3H3PH 5D70H 3UBXG 3MXWL 4F33A 3RRQA 5SWZD 2KQNA 5C0IB 2R1YA 4JR9L 4YFEA 4X99B 2Q86B 1C08B 4U6XA 4LHUA 2UVFA 2IQAB 5DJZA 3GSWB 1I7UB 3RZCC 1CYGA 4RFOH 2KQMA 3VWJD 2CXKA 5FUOL 3WS3B 5D6DA 1EFXB 1OB1A 4EOWL 5JQ6H 1EPFA 1HZHH 1U6AL 4ODVH 1D6EB 1IAKA 4WTXA 5DMKA 3W9DA 4CMHC 1DQQB 4DGIL 3FT2B 5ITBL 1K5NB 5DFVC 2QTEA 3OXRA 3TA3B 4O00A 3VGHA 3GO1L 2EEBA 2X89D 4N0RA 2J6EL 5CINH 3BP5B 1JF5A 4FG6C 4Q6YA 4NZJA 5GGTA 1GZPB 4ODBD 1ACZA 4L5FH 4PJ5A 3NFPB 4DFIA 4QXTB 3BKMH 4JPKL 5KANI 3U0PB 4WUUD 4IIQA 1YPZA 4V1DA 2F74A 1N64L 3VA6A 2J8UE 1OD7A 1VERA 2PYEE 1LO0H 3C2AL 3UZEA 1SY6A 3ET9F 5DJAA 2YOCA 3RL1B 1KYOJ 1SYSB 3OAYK 2VE6A 2YRPA 2FIKB 3NA9L 4YC2B 4O2EB 4PP1C 3U0WH 3O6KH 1Q94B 1D5BA 1MCJA 3OKOA 5JHLH 3UTPD 1XGUA 2YN5A 3P0VH 2BVYA 4DKDC 1T7YA 4WHYH 1PG7L 5CBEA 5I1HH 2NTFA 3EO1A 4OSUL 2OSLA 2R0WH 2EZ0D 3HUJA 2E5EA 4K94H 3CFCL 2R29H 3EJZD 4ZXBB 1UWXH 4AM0B 3CIQA 4GBXD 1ZLUK 4R2GB 4GW5A 3RGHA 5B3JE 4PV9B 1U8IB 1O0VA 1HKLH 1LP9A 4JZJA 3W2DH 1XCQB 2BSRB 4OZFB 5HXMA 2ZSWA 3HFML 5ERWA 4YEFA 1BPVA 3BT2L 4Q74A 4Z0XB 4HK3J 4RGND 1ORQA 1FCCA 1ZE3C 2BY1A 1T1XB 4J3OC 4TTDC 2QHRL 4UV4L 5HDLA 4JQXA 4BFIA 1A6TB 5SV3A 3HNTL 3G5YA 1CK0H 3GM0A 4JZOA 3LS5H 3DNKA 2A74B 1AD9B 3FAWA 5ICXB 3QUMB 4L8CA 4L8BA 4UT6L 3N50A 3OKMA 1I1AA 5A40E 3EO9H 2WLYA 4Y1AE 1JYWA 2VSCA 4NHCH 4K7PH 2P24B 2IFFL 1F8TH 4H0HB 3TZVA 3MR9B 4HSQA 3FQTB 4QHUA 4KVNH 4I2XE 4BSJA 1WISA 5ACLA 2WBWB 4WI9A 1UWEL 1W0WA 5MP6H 2P5WB 4LSVH 2YXMA 4JANB 4GOSA 3Q2CA 2FD6L 2X4UA 2GJ6E 3GMQA 3WFBL 3V7AG 4PUBL 1O7SA 1GC1C 2OR8A 3K1DA 4KI5E 5DMYA 1ZLVH 5EBWB 4PLKD 1LE5A 4DVBA 1CFSB 2ORBL 3T2QA 1R3JA 3DMMD 3U30B 5D93C 1NGQH 1RUPL 5E03A 4WHTB 5IW1A 5B4MC 2J2ZA 1MHEB 1EEZB 3GEWB 5CP7A 3TYFA 3EJJX 1MLCB 2O61B 2C3VB 5ALBL 1E4XI 2WANA 3RGVC 3E6FB 4YHNB 3BZDA 3MV8D 3IDIB 2NXYD 2J6EA 1T5WB 2DQDL 5JPNA 3MLYL 2O26U 3VH8A 4YHOL 3ZYOA 2HYMA 5A43C 1ACYL 3H3BC 5I1LB 5K9JL 1W72B 3MV9A 4HC1H 1BAFH 3EHBC 1NGZA 2Z93B 1HSBB 5DMIL 1MWAL 3MRKA 3SDAA 4U7KA 1FVEB 3WLWC 1HXYA 4JHZA 3SDXB 3RVVD 2BHYA 4KTYA 4YFLI 1SMAA 1X5JA 4AG4H 3DSFH 3KYOA 2EC9U 1MFNA 1WEJL 1NLDL 3FFCE 1AGCA 3QDAA 1DE4A 5IEKB 4L3EE 3HI1A 1JPFB 3P9LA 2PUQT 4ZOAA 5E8EB 3KPNB 3VMPA 1CU4H 2HLAB 4EDWL 3B9VA 5D7IE 1C12A 2YWYA 4ZSOB 2DMBA 3INUL 4GMTL 4L4TA 3ZT6A 4EUPH 3DSNA 1WC7B 3ARDB 3DO7B 3IFLL 2G60H 2ICEB 3NFNB 3V6BR 3O45B 4LCCB 1DBBH 2B4CL 3K81A 5CAYB 1H0DB 3P4LA 4O4YH 5C0AE 4UDTA 3C2SA 1BQLL 3MV7A 3T04D 3CFJA 4NN7C 4YPGA 4XMKL 2GSGB 1F11A 4B41A 4FTVD 2HFGL 5HI4C 5DDHB 4E41A 2Z8SA 1WFTA 3QHFH 4JFEE 1QKZL 2CUMA 3AY4A 4XPGL 5C0GB 3ROLA 3S36L 4MVBD 1G7LB 4MHHG 1D5IH 2DQFA 1XIWA 1U3HA 4YR6B 5F8RC 4PJ8A 1RJLA 4L9LB 2QR0A 5D7JD 4LRIA 1OARH 1KG0B 5I1JL 2W9DL 2V2TA 3DRTB 4JQVC 3WIFB 2BSSA 2MHAB 4G8EB 1ZAGA 1GXEA 4HUUA 1AO7A 1HHHA 4XB7A 2D4FA 3CU1A 4FFWC 2V7NB 4OM0L 3LRGA 3O41A 5HD8D 5C7XH 3SKNB 5IMOA 3ARTA 3O11B 2EICA 2R4RH 1BBDH 5SWQA 3UTTD 2VDNL 5LXGL 1KJMA 3O3EB 4MQ7B 1NCCH 1K8DB 1QSEA 5DJXB 3MUHL 2IANA 1OAZL 1ULVA 3D9AL 1CT8A 3GM8A 4PGJA 5DJCB 4MAYB 3OKKB 5HYEA 1TJHH 5FUZL 1GC1H 7FABL 2EH7H 3QIBD 4XPFH 1JHLL 3TJHD 1MEXH 1XR9A 3CFEB 3MYJB 1DBAH 4DKFH 4XMLL 5E6IC 4D3CL 1YN7A 4FQJL 5IJKC 4JN1L 2ATKA 5KN5A 2BC4B 2P8LB 2W38A 4N8CL 4HS3A 5E2VH 2ZUSA 5T3XL 4AZ8A 5I15L 2NY6D 3GSNA 5KSUB 1UM5L 1JPTL 2HFFB 2Q8AL 3VXRB 5ANMB 2ZUXA 1ZMYA 2XFXA 4MJIA 4YDVA 3PP3K 4RMVA 2ZG1A 2GITB 4K3DH 1QRNE 1FZKA 3LEXB 2I24N 4HIHA 1BHGA 3NCYP 5D7LD 3DI2B 2NW3A 3O0RL 3TBWA 4JHWH 1VEMA 5BS0A 1QSFA 4LLYA 4OT1L 3TVMB 3T2NH 5JXEA 4NQEE 3GIVA 1RZFH 4RSVA 2AV7A 1KCSL 2AABL 2XNAA 1MWAA 4GAJH 4G8IB 4P2RB 2IAMA 3EFFB 3MROA 4X6DF 3NH7L 2DLEA 1NDMB 4XGZB 1KN4H 4NN5C 3PHOA 3HAEA 4RGMB 1PD6A 2YXFA 1OOAA 5TPWL 4XX1G 3IDYC 4Z7WB 5ITFA 3EYVA 3X12A 1T83C 2NY5L 3BW9B 4X7FC 3G5XA 5H94A 4NDMB 2Q3AA 5IMMB 3Q0HA 4Y4KB 3BEWA 3JWOH 4I5BA 5I19H 4R4ND 4TULH 4Y8DC 4OFYD 5TF1L 3U6RB 5IK3B 5DF0A 3QUZD 4NQDE 4M02A 4R0LB 1RJZA 1DR9A 1NAML 2YMXH 1RULH 3D85B 4OLVL 5IBUG 1HQ4B 4PV8B 4TQEH 2G75A 4I0CC 5IW6B 5EIIA 1IKNC 5IF0B 1T21B 1B3JA 1UJ3B 2EYSB 4U1KB 1BGXL 3OKDB 1F2XK 1FYTB 1LO5A 2IGFH 1VB9A 3EGSA 2W91A 1T1WA 3HI5H 4YQXH 4WTWA 3BOVA 1WK0A 5ACMA 4EI5D 5D1XD 1JK8B 1JI1A 3ULUC 2C4FT 3REWA 1MJUH 3CDGB 2LABA 4MA8H 1YEIH 3G04A 3QWOB 3QEGH 3FB7B 1X44A 3UTSE 1CDYA 1LD9B 4MDIB 3W39A 2I27N 3RU8L 4WV1A 3VWJA 2P5EB 3NCJH 3FRPG 1J05A 4EBQL 1QA9B 5B39G 1YC7A 3IXAB 1JWUA 2VR4A 3ALPA 4JZNA 3VRLE 4XP6H 4ZO6A 3QXAA 1IEBB 2OI9B 3ULSB 3CH1A 1R24B 3MLUH 1XF4A 4YHIA 1NGPH 2FDBP 3R4DA 4ZQKB 3RNKA 2X89A 4D0CA 4DUVA 4WEUD 5EO1A 5GGQL 5AG9A 3RKDD 1JNJA 3FT3A 3LVEA 4RWHA 1FLRL 1KEGL 4OCRL 3PP4H 3STLB 1A0QH 4WW1A 3P4NA 1CFQB 4PGCB 1BJ8A 4WUUA 2F58H 1SJEB 1NBQA 3FQWA 3GMPA 1AHWB 4PY8I 5MHSE 3QDJD 2X4RB 4H25B 5EO9B 4QRRD 2HVKA 3U9UB 3EYOB 4JRYD 4Y2DC 4DQOH 1AY1L 5CSGA 3B3IB 3BJ91 3M8OL 4R7NA 3NACL 1U92B 3OX8A 5FDYA 5DEFB 2XTLA 2Y5EA 3BD4A 4R7DB 4PLJD 1S7XA 4IRJA 4JN2A 2JCCA 5C6PB 1JN6B 2ZOKA 3NGBB 3VFWB 2YPLB 5TDPA 2X7LA 2FH8A 3GUTB 4PPTA 3MRNA 4P5KB 4M1GL 3VI4F 4R96A 2WM0A 5GRXG 2F5BH 1FV1A 2VAJA 1AKJB 5FOBB 4OAWA 5KW9H 2XWBA 2PXYC 1EHAA 1BD2D 1CGSH 3RP1A 3QIWB 2GK2A 5C70A 2BCKA 2A6DB 2D7TH 4P57B 3T1WA 1H5BA 1IZJA 2WLZA 5B3NA 1YNLL 3QHZH 1N3NA 2ZUWA 5B21A 5ALCH 3WIHL 1QNZH 3BE1H 2DQHH 2F54E 4HV8A 4L29B 1I9JL 1KXQE 3V4UH 4YE4L 1BJ1J 4KTEL 3PQYE 4C4KT 4F7PB 1KNOA 2LAGB 1RHFA 1SVCP 3H42L 5HGDA 4ZPVB 3EKCA 4P3DB 1K8IA 5C0DB 4KXZI 1CIUA 1I1FB 3I2CH 3Q5YA 5EUOE 5HHOB 1OHQA 1CTOA 2LVCA 4IS6B 4JLRA 3VFTA 5A16A 4WI2A 2AJUH 1CQYA 1R5IA 2ZOLB 2AJYH 3FHAA 3OGCB 3O3BA 3BH8B 1H15A 1NAMA 4C55A 3OKYA 3MLWL 2VNCA 4OGXH 2R69L 1VCAA 1XGRA 3VWKD 3PWJA 5BVJB 1RHHB 1S7VB 3AXLB 3QDGA 4G43B 4P49A 2C1PA 4HUXA 4Q9RH 4ZO8A 2ZUTA 1RURH 1MCWW 3HC0B 4JCLA 4KUCF 5IHBA 4X9FA 1HH6A 4NM4H 1HDMB 5EU5A 4HS8H 3HZKB 3PDDA 5D71H 1FVCA 3QFJB 3ULUH 1ED3A 5C8JB 3GSRB 4OZ4B 5GZOD 1BM3L 3MTRA 5EZJB 1M6OB 3DMMA 2OJZL 1EMTL 3VJ6B 4H88H 3MRRB 3P30H 5IB5B 4ELMF 4PJ9B 3QFDB 3LEYH 3NCBB 4GQ9L 1QZ1A 2GK0A 5ESVB 2UWEB 1WBYA 4POZC 5EC1A 5C92A 5CLTA 1WT5C 1OAYH 3K1KC 4ZS7H 3PWVA 3O6LH 3TO4B 5I18H 4Y4FA 2E9JA 4QWWC 1MLBB 5H37G 2JB5L 3MV8A 1JFQL 3QNYB 4L3CB 2ZUYA 4I0PC 5C0FA 3BEVA 4X99A 4HWBL 1ETZB 5FYKD 3GRWL 5IVXA 4WFED 1C08A 4PJCE 3GK8H 4I1NB 2VISB 4YDKL 3QEHB 4TSCL 2ED9A 2P8MA 2NX5D 4TNWK 3RNQB 2I9LA 2VLRE 5BV7C 1G7MB 5K9QI 1S9XB 1PGRB 2EXWC 4LQFH 3WS3A 1QVOA 2ATPB 4S1RH 4ZUWB 2FH6A 4AEIL 3W11C 2ZKHL 4JPWL 4HH9B 1D6EA 1L7TH 3FT2A 3RWCB 4OI9A 3O4LD 3RWJB 2X41A 2RFXA 3NPSB 1X5XA 4JRWA 5AYUH 5KVFL 4U0RC 2BK8A 5T1KD 5DQJA 5AZEH 4TTGA 4M43L 5J11B 2LVEA 2CO6B 1GRWA 1WCQA 1OP5K 3SGKA 3P3YA 1RUMH 1GPOH 1YEEH 1G9NL 4PREB 3K4AA 3RVTD 4RRPA 1FDLL 4LLDA 1VENA 4OZHE 3U0PA 4X83A 1BIHA 2X5PA 3O9WC 4UB0H 4JO1L 1FVDA 3QWRA 3WIHA 4OZIE 1RUKH 1EBAA 1YECH 4WFGD 4YK4B 5EU7E 5I6XB 2APVA 4FTVA 3PIQA 3HN3A 4D8PB 1ZANH 4HZLB 1E4KA 1UH2A 4M6MH 1Q94A 1EDQA 3NTCH 1F6AA 5CIPA 1ZA3A 3MX0A 4TSAL 3TBTB 3BDBA 1PSKL 2YHGA 3SE8H 5GGVL 4FFYL 3WNOA 1DJSA 3C60D 4KI5C 4DZ8B 1JPST 1NAKL 2OR9H 2R0KH 3LPGA 1MHCB 1ZV5A 4GG8A 1YPZF 3BPCB 1XR8B 3LKRA 3UMTA 1U8MB 3FB6B 1P4IL 5LGJA 5E8OA 5JUEH 1XCQA 2D7NA 1NMBL 1PYWB 4LKXB 2Z31D 3U4AA 5FIEA 3GBMH 3NCEB 2DQJH 3UTTA 1G0DA 4LU5H 3QG7L 2H2SC 3CMOH 2DD8H 4FMFA 4P4KB 2QSQA 1MSPA 4M7KH 4NKMB 4X80H 2PYFB 2ICWA 3FMGH 3MUGB 3Q6FA 5D7IF 3H7LA 4NRYA 3QIBA 4U6VL 3HUJF 1PQZA 1C5BL 4U49A 1F42A 4LHQB 1U41A 1WV7T 4GUPB 4KKBC 2A74A 3BSZH 2XV6B 3RY6C 5IESL 4Q9QH 4ZNEE 35C8H 1D9KD 2FEEI 4J6RH 2ARJB 3NABH 3L9RA 4XVJH 5E56A 4U1SB 4JG0L 1TXKA 1IILE 2F9BT 5DHXB 5JHDE 4YXHH 4LMQE 2P1YA 2P24A 4G7YL 3MLXL 4YH6A 3FQTA 2SEBB 5D5MF 5HBBA 4GKSB 4HK0B 3HR5B 4JB9L 3MRIB 2FX8L 4PG2C 3GSQB 4QXUL 4HGMA 1RV6X 2B20A 1LDPH 3AU1B 2BNQD 4HWBA 5D7LA 5GS2D 5L6YL 3GRWA 1XGQA 3ZDZE 4KHTH 5GGRB 5T5FH 4QXGH 3BKJH 3X11B 4Y5VB 3C6LB 2QL1A 4OCYH 1CFSA 2ENYA 5GIRB 3D39D 5CD5D 4GKOA 2AGJH 2O93L 4Z8FL 3IFPB 1XGPA 2YA2A 2BRRH 5BV7H 4N8VA 5BRZD 3QCUH 2CQVA 1A2YB 2D31B 1P1ZB 3GBNH 4OM1L 5DS8B 1FNAA 2Z4QA 5EWIH 4K3HA 3WLBA 1KFAH 4U7SA 2O61A 3FHQA 2C3VA 4HMCA 5E2TH 1YDPA 3VA2C 1VGEL 2QBWA 3LQMA 4KTDL 1FO0L 4OFYA 5EOQL 3BPLC 1T5WA 1TTFA 4FNLH 3VDBA 3QUZA 3SE9L 4Z78B 1FBIL 5ESQB 2VLLA 3BRDA 1J1PH 1OLLA 2XKNA 4HGKC 5EOCL 2H32B 3NAAL 3JTSB 5I1LA 4F7TA 1NCUA 3CFKB 4JY6A 2CUIA 4HJ0D 3OAUH 1L9MA 4NKOB 4JKPL 4MMZC 1H9VA 3BZEB 2F53D 5DEZA 1I3GH 4QY8A 4NCC1 4KK6D 3U9PL 4PJDB 4XP4L 3I84A 4BFEA 5D1XA 1XF5B 4ZFZA 2FBOJ 3KPNA 2HLAA 5J9PB 1IBGL 2ADGB 5FGBA 4WWKD 3IJSA 4H8WC 4MSWA 4KU1A 5TE4L 3CX5K 1MCLA 3LH2H 3DETD 4KK8C 1AGEA 2FBJH 1DQJB 2XRAL 3PWPE 3DO7A 1J8HB 4HIXL 1T1ZB 2BSTA 2H8PB 2HTLC 4X6CB 4P59L 1J8KA 4P0DA 4G9DA 1NFDE 4AEHL 4P5MB 5I1EL 3EW3B 1H0DA 4UTAL 4CVXB 1OT1A 2P49B 3IKCB 1N0LA 5EZOH 2ERJB 2IWGA 1EIBA 2GSGA 3OR7A 4M48H 1U8QA 5I71C 1NSNH 3F65A 5FYKL 2EIBA 5DDHA 4X5XB 1EO8L 3GMLB 5C2BH 2XWTA 1KT2A 2FJHB 3V52L 4CN6A 1FIGH 1SJXA 4L8DB 4YR6A 3BZFA 3WUWB 3OSKA 4XRCB 4Y16B 1LEKA 3KHQA 4NC1C 3DUSA 3CC5A 1KG0A 3D2UD 3QDJA 1IEHA 4MA1C 4I9WD 1PZ5A 1DLFH 1J1OL 3DRTA 1YNKH 1ZHBB 1N2RA 4JRYA 4P4RB 3WIFA 1GAFL 1IC7L 1WVZA 4G8EA 5GGSY 5L0QC 1ZHLA 1A14H 4LPXA 5GS1C 2I9TA 4NQCE 4XMPL 2VLJD 5D1ZC 4P2OC 1KJ3H 3G08A 5TDOB 1OF2B 2V7NA 3TYGH 2AEQL 3P9MA 1FGNL 2P5WE 3B6SA 1XF2B 2EE2A 1GJIA 1Q9KB 1RUAL 4I77L 4WTZA 2FB4L 5KSAD 1BD2A 2YRLA 1N59A 4KZEL 1K8DA 5EU6D 2V17H 3H3KA 5DJXA 4LARL 5AG8A 1CDHA 2JK5B 4MAYA 5HDQL 5DD3H 4EXPX 4ODWA 2VLKD 3MYJA 3E2HB 1C8PA 3JWDL 4Z77A 1KXTB 2BHZA 3DXAE 4OCNC 2I5YH 4DUWA 4GXVH 5KSUA 4GAYA 2W59A 2B0SH 4P23B 3VXRA 1H8SA 5ANMA 3PWLB 5AAMA 1AGFB 1U8HA 1BP3B 3WHXB 3DVGA 4J8RB 5CGYC 2EDDA 4JAMA 5T3ZH 1G7HB 3S4SB 3TIEA 4TSBL 1FO0A 3CK0H 2EDXA 5HHXH 1CICD 3QPXH 2PTTA 2O5YH 4I3RL 1R3KB 3BZ4B 4DGYH 3KHOA 3L5WA 2Q76B 4ODTL 3TVMA 3P2TA 4FQCL 4L1DA 5MEPB 4BZ1H 4RAUA 3MJ6A 3G6JF 5E95B 3ZMRA 4KJYB 2W92A 1OQOA 4G8IA 5CZVH 4I0KA 1PEZA 2YC1A 4FFVC 4OB5L 2IH1B 5KZCD 1NDMA 4CBPA 2DKSA 5I30L 3UBXI 3VRJA 4OD1L 3ZSSA 25C8H 4NO5A 3R1GH 1RK1A 2WV3A 1Z0NA 4J1UB 4U6HB 4ZTPL 4X4YB 1FIEA 3GSUB 3EUUA 1VPOL 4POUB 4AQOA 4UAOB 5DEGB 2IPTH 2VN4A 4FQ1L 4ZSOE 5AZ2H 1F13A 2QQKL 4BUGA 4L4VB 3WYRA 4YX2H 2KBGA 4XVUD 3U6RA 1RZ8A 5IK3A 3HZVA 3GJFB 1VDGA 5KG9B 4WW2B 5KSBA 1KCRL 1ND0B 1X4XA 3IDXL 4LCIL 4YAQA 1F4HA 4MJ5A 4OUUA 3KPLA 1RZJL 3G5VA 3QXDB 4QRPA 4TPRH 3IS0X 4KJPC 5F96L 4X4XA 5D8JH 1KPUB 5C6TL 5IF0A 2FO4B 4Q9CA 2EDOA 1UJ3A 2GTWB 2DLIA 2EYSA 5HGBA 4S0SD 3U7YL 1Z9OA 4XBGB 3ZHDA 4LP4A 1OW0A 2AK4E 3ARGB 3RWHB 1FL3B 3ZYZA 2DQTL 3QNXA 5DGQA 4LLAA 3A67H 1Q8MA 3CDGA 1CXEA 5TFSH 3B9KB 2HJLA 3WS6A 2HLFD 2CDGB 4JKLA 4QRUB 2NX5A 4P9HL 2DS4A 2APXA 3SKUD 1EXUB 1Q72H 5EUOF 1HHIA 3GFUA 2DQIL 3T4YA 2VXTH 3QULA 5ID1B 3SQOL 5GRJL 3KLDA 2C3WA 2A1WH 4RX4D 3O8XC 4BSVA 5LAXB 3V79C 5IWLA 1NMCC 3WMSA 3IXAA 1BBJA 5I1IH 3FL7A 5D2NB 3CLFH 1HEZB 4QHMA 2XN9B 5F97E 2QADD 5CS7A 4BJLA 1FORL 1DDHA 4KRPB 2OXHA 4WDIB 5T1KA 1IVLA 5IKCA 5LGKA 3BN9C 1BQHB 4DW2H 4Q6IC 3SDDB 3MA7B 3RX7A 1JV5B 4G7VH 3KJ6L 3SOBL 2NY1B 3KWWA 5ADPL 5E7BA 2PETA 1I8IB 4PLOB 3HS0A 3HLAB 2VITA 4XCEB 1D5XB 2EXWD 4E5XB 1OD9A 4LCUB 4MNHB 4HXAH 4P46B 2R2CA 3SPVB 3D3VD 2M8XA 2PW1A 4XAKD 4HKZB 3EYOA 4YUEH 3ARBB 1V3LA 3B3IA 2DYPB 5DD1H 2IPKB 3W0WB 1U92A 1ZEAL 1DVFC 1UZ6E 2CLRA 5C9JB 3VFWA 3AROA 2YPLA 1XEDA 4EQ3A 5T1MA 4NNXA 2PR4H 2Q3ZA 4KMTH 1QBMH 1CLZL 1BVLA 1K2DB 3C60A 4IRSB 1AKJA 3IF1B 4OKVA 3DX9B 4JG1L 1ZVHA 2YSSB 4PJCF 5T1DL 3ZE2E 2A6DA 4P57A 1I75A 1L0QA 2CUHA 4XBEL 3TFKC 5E4IA 4N8PA 4X7SH 1NGYB 2Z0BA 1MRDH 4IOIB 3SJVD 3MOAH 2Z31A 4R90H 4M5YH 2UV3A 2OJEB 4LEOB 5BXFB 1CE1L 3I6GB 1YMME 2ZCHL 3OTTA 3U46B 4KJQD 4XC3H 4ZTOL 2DKMA 1UWGL 4NRXB 4RCAA 2VL5B 1OAQH 4P3CL 4X7EC 2D9CA 1DBJH 5F1NA 5GRZA 4HMDA 5HYJB 2H26B 5C08B 5HHOA 5ISZE 4NQVA 3OKNA 3KLHC 5DUBB 5LG1A 5FO9B 3O6FD 3GSVA 2CJUL 3JUZA 4OI8A 5J06A 1NBYA 1OP9A 4LPVA 3OGCA 4JFDB 5JDSB 3BH8A 2ARWA 3X14B 1P7KA 3GNML 1BLNB 3F7RA 3TT3L 3Q3GB 1LO2L 4FQLH 1UH4A 4GAGH 4OZHF 2Y7QA 1MFBH 3AXLA 4OZIF 3H7BA 1OP3H 4G43A 5I66A 4CVZA 3K4DA 5M95B 3S88H 3KPOB 2XG4A 2VDQH 2YPKA 2KZ1B 5E2WH 2A9NL 2HKHL 1SEBA 4ONHA 1UB6A 1U8KA 3E6HA 4PJHA 1N7MH 5C0CD 3FOLA 1QSVA 3HZKA 1W8NA 1YQVL 4P2QB 3TN0B 1T4KA 3QT2A 3D39A 3L3IB 3MA9L 5C8JA 3GSRA 4OZ4A 4I18A 3JV4A 4MZ3A 4TUOB 5EZJA 2Y07H 2HVJB 5E9DD 5EFIA 4B5EA 4AH2B 4V2BA 5SV4A 4V1DE 4NN6B 4C56D 1KSRA 4MXQD 1F5WA 1V3KA 4ZNCD 3NIGE 4XXDB 4GMSL 4OTXL 5F9WB 2CKBH 3IU3A 4K07A 4Y88A 2FEDD 4Z5RB 4U1MB 2APFA 3RFZC 4Z9KB 3SY0B 4X0KB 3TO4A 1V8HA 2XY1A 3NIFF 4QHNB 3N06B 5GHWH 2I25N 5GRVK 3QNYA 3QUYD 1YMHB 2XY2A 4JFYA 1PY4A 2XZCH 1CWVA 5SWSD 5IV2B 3U4BH 3BQUC 1IGML 5DQ9B 4WUKH 1P2CA 4APQC 2V2XB 3FCTA 5DLMH 4PP2B 2VISA 5CEXB 3RA7H 3QEHA 2JIXD 1U91A 3RPIB 5JIHA 3VXSB 1NBVL 4PJXA 4PRID 3MRHB 1OAKL 4N1HB 1G7QA 2F53A 3HPLB 5ESAB 3BDYH 2VZTA 4KJWD 4F9LC 5T3ZD 3ILPB 4XTRC 4NUJB 2OTPA 4ZUWA 1MFDL 5DJYA 5ICZB 3UTZB 4GXUN 4OQTH 4S1DD 3L7FB 4H20H 2L7UA 2F5AL 3VFNB 3H8NA 1LGVA 4A6YH 4XP1L 1I3VA 1FCGA 1QG3A 1AFVL 1AI1L 3RZCB 1I8MA 2XACC 1CD9B 2W9EH 2IFGA 2PF6A 5C71A 4ZO9A 4QO1A 3ZDZF 4PREA 1ZLSL 3ZKSD 4M03A 5HGAB 3OXSA 2QQQA 4XNQB 1KXVC 1S5IH 4HK3N 4KZDL 1JYXA 2EDBA 4CMHB 4J23A 2ZG3A 3MUY1 4TVPE 3HI6H 2XWJB 1OGTA 5HHME 3WBDA 3BO8B 2FATL 4D8PA 4KK9D 2Y5TB 3UPRB 4FQXD 3ULVD 2OP4L 2LQRA 3WXVL 1JWSA 3BFOA 5CUSH 3VFUB 1UCBL 5EBLA 4IOFC 4M7LL 3TBTA 4HQQH 3V5DA 5DTFB 1FFOA 3RKPA 2NQCA 2XQBH 3KVQA 2XG5A 4XNUH 4XBPB 1IAOB 3BIKB 4OLYL 3MQIA 3OV6A 1U8MA 2QSTA 2VLJA 3WN5A 3FB6A 3TNMA 5FA4B 2VC2L 3VXUD 1NEZG 3GHBL 2B8OT 5IGXL 1PYWA 1QFWH 3KYNA 2R0LH 4EUPB 4U4BA 1JTPA 1LQSR 2XA8H 5EU6A 1PW3A 3QFJE 1YY9C 3MLSL 4GXUM 4PRPB 2VXSH 5FB8B 4S11A 4M3KB 5IBLC 5CEZL 4JRXD 1A6ZA 1INQA 1KLFA 1FZJB 2VLKA 4AMKL 3MV9E 1REIA 2GTZA 2X4QB 2UWEE 2JB6B 4YHPA 3EJYC 4NJ9L 4P99A 3HRPA 1NFKA 1J9CT 1G7IB 3FN0L 1MRCL 3MLVH 2FSEB 1A7NH 2VZUA 3HNSL 1CD8A 4F37F 3JBG7 1JF6A 2WAHA 5FYLE 4F7MA 3MRIA 1CICA 1FN4B 5KJRL 1KTDB 5TE6L 3D6GA 3BUTA 4PIRF 1KJ2H 2ZPKL 4R4BB 4DK3A 1A7OL 1A21A 4LFHG 2X4PB 4RGOH 3B8YA 3PGDA 5FYJD 2IMMA 2FHFA 1JGLH 4HH8A 3L3JA 2G5BB 2PKDA 4XXCA 1K4CB 5DK2B 5HJ3A 5CGYD 4XCFH 4PJGB 3MNZB 2EYTA 3EOYG 2OTUA 2OLDA 4NNYA 4E41E 1X6LA 2ZG2A 1RU9H 1UH3A 1MFCL 3QCVH 2A6KB 3F7VB 4QEGA 1A8JH 3EOAB 5GXBB 5F7HA 4HG4K 2IG2L 5D93B 4X7CC 1A4KA 3JTSA 3L6FB 4M9OA 2EYRB 4K23H 15C8H 4GG6A 3MJ9H 2GJZA 1QBLH 5EU4A 1WCBA 3OMZA 3QH3A 4UINH 3MRCB 3D0VB 2BDNH 3QI9D 4QYOA 1IGCL 4BQ9A 3AMKA 3DECA 3CUPA 3RGVB 3SBWA 1I9IH 3GMMA 4KC3B 3QQNA 2Y72A 1RZKL 4LNRB 1M7IA 5IQ7L 2J5LC 4CKVX 3DTXA 3ESVF 4IRZL 2XTJD 3CZFB 5C0BE 4HIEA 3UTQA 2VUYA 3MJ7A 4KDWA 1QSEE 3T2PA 4PJBE 2XZZA 4M1CD 5ILTH 4RX4A 1FZMB 2IANE 4JREC 1OTSD 3M45A 4LIQL 3V4PH 1FNGB 1J8HA 4NYLB 5E08L 4X5WB 4PGEB 4X6CA 3MLZL 3TV3L 2WINA 4K8RD 3SDXF 3ARZA 1A5FH 3V6OC 2C1OA 4KVCH 4CVXA 1J12A 5EG6C 2JJWA 1KN2H 4NO0B 4H1LA 4XNYH 4BZYA 5F7MC 1NPUA 4KKCD 4MS8C 5T1LD 2QSVA 4X5XA 5GS0C 3GMLA 4ZFOB 1IRAY 2HJKA 2FJHA 2CIKB 1ZGLP 2MJWA 4JFFB 4ZD3H 3MZGB 3UXFA 2R1XA 1BFTA 1MF2L 2R1WB 3D3VA 5MEQB 1E28B 4U05A 1Q1JH 5DMGC 2WMPA 1ZHBA 3VFGL 1HN1A 1CGTA 1T2JA 2WUBH 5DHVA 3BD5A 1OPGH 2R9HD 4NN7B 4R4FH 1FE8H 4QRSB 3ZO0A 1BOGB 4HCRH 3WNKA 5TE7H 1OF2A 2CIIB 3TWCH 2MQ3A 4RAHA 4ZUSB 4CMMA 5T33L 4QOKE 1XF3B 3QUKB 5E99L 3DX6A 3T0EC 3Q1SL 3AS0A 3QCTH 3OKEB 5GGVY 5GISH 3L3OA 1DQTA 1NC4D 2PO6C 1JGVL 5DYOA 3BJLA 3G9VA 1F4WH 4ZAKC 4W81A 5HDBE 1QPPA 3QEQB 3GSXA 4J7RA 5CCKH 1T0PB 5F7DB 4NZTL 5D70L 3RWGB 1IQWH 4OLEA 3SJVA 1NLBL 1T5XB 3QIUD 4IDJL 5L8JB 5F9DC 1E6JH 4YHKL 5LBSH 3V5HA 5HHNA 2IQ9L 4W6YB 5HI3C 3MRPB 1NCAL 3VDCA 5JOEA 3ULVL 1C5CH 1YN6B 2H6PB 5DR5H 3JV6B 3LMJH 5CBAB 1S7SA 1LE9B 2NPLX 5SWZE 3DIFA 4Y19B 3PWLA 3HRZB 3MRBA 1G7HA 3NN8A 1N6QL 3GBLA 1TNMA 1UKQA 3O6FA 4LGRB 3QDMD 3BKYL 2DM4A 3NMEA 1SBBA 1T80A 2J12B 1QR1A 4MJ6B 3BZ4A 4NBZB 4GKZB 3V0WH 4ZUVA 3SDCD 1QTYT 5E6IB 2Q76A 5DRNA 3EYFB 3PNWB 5MEPA 2AV1A 1IGIH 3ZSTA 3KLAB 1ONQB 1U8JB 1FNLA 3OJDA 4JVWA 1J7VR 2WWMC 1F90L 3BGMB 1CGVA 5BMFL 4G9FB 1RIHH 1E27B 4HWNA 5D2LA 3T8XA 5DD6A 4JGMA 5I1KH 3IDGA 4M6OH 1VFOA 3K74B 4XCCH 4Y4HD 2P7TB 5E1AB 4CU6A 4R97C 1UZ6F 2MPAL 1DL7L 5C0CA 1Y0LB 5EU3B 4G8GB 3KPSD 4MD0A 1CCZA 4YHLL 4FQQB 2PW2B 3E3QE 1YEHH 4XC1L 2YZ8A 1IL1B 2KL6A 4JM2C 3P73A 4UT7H 5E9DA 4WUUE 4HHAB 3KPRB 3MXVL 2WBJD 4OZFG 3GMRB 1ND0A 3AREC 3UYOD 4C56A 5INDB 2R2BA 3LZFH 1MIML 4PJFE 4M62H 1HSAB 4NN5B 4UIKH 1VFMA 1MCCA 2WK2A 5EN2B 4KKLC 3DURB 3P0VL 3MMEB 3IDYB 1KPUA 4ODXB 2GTWA 2Q8BL 3UBXA 1T03L 3RHWF 4Z7WF 1DBKL 2GEEA 2DIBA 2IJ0C 3DV4B 3RWHA 3UTPE 2JCCE 1KELL 5IROC 1CDGA 4CVWA 1P7QD 3PUCA 3H0TB 3RX8A 4WGWB 1DQDH 5B22A 2PTVA 2JIXA 3B9KA 1UVQB 3S36X 5GS0H 1JHKH 5KVGL 4WWKB 5FYJL 3EOBB 1ZHNB 5F7FA 4BH7B 4X7TA 3I50L 4QRQA 1CD1A 5AWNH 5IIEA 3V0AC 5LAXA 1G9EA 2B1AH 4RBPH 3NZ8B 4LRNL 3Q5TA 3G6DH 1K6QL 3C5JB 4PRHB 3RTQD 1OGAB 3TC9A 4JFHD 3IJYA 2XN9A 4E9LA 6FABL 1DUZA 3I6KB 1X5IA 1CLOL 3AAZB 5FA3B 2VDRH 4RGNE 4WDIA 5KVEL 4XPBH 4E0RB 3FFDA 3ZKMC 3KR3H 4LK4A 4ALAL 1KIQA 4WO4C 2OTWB 1IM9B 1WBZB 4NNPH 5F1SA 4XCEA 3DWTA 4OD3L 4Z7UA 4E5XA 4X98A 5LGHH 4HUMB 1KC5L 4P9ML 3FONB 4MNHA 3KXFD 4WI3A 3BP6B 5I8OH 3CXDH 4HXBH 1A7QL 1F02I 4LSVL 1CBVH 3IDMA 5D6DC 3C87A 2DWEB 3CMGA 2DYPA 2VJXA 2IPKA 5TQ0H 1T66D 3HR6A 4XCNB 4FQXA 2NXZC 1WZ1H 3ETBF 3UAJD 2V5SA 5I8KL 1C1EL 1GGIH 4Y8AA 5IB2B 4NKQB 5C9JA 1BZ7B 2BNRD 1KIPB 5EB9A 3ECBA 5FCUH 1CFVH 1XH3A 3CAFA 3DYMA 3PJSA 3BPNC 4JPVH 4MQXC 1HOCA 4GSDH 5DQDH 4DZBB 2QKIB 3AS2A 1A7PL 2GUOB 3EO0B 4FQ2H 1S7UA 4UILH 3LHPL 4K8RL 5CEYB 3IDNA 3RUGB 4Y2DB 1KCVL 1U8LB 4JEGB 4IIQC 3FKUS 3VXUA 5DUML 2PN5A 4KMQA 5I16B 1E4WH 1UT9A 1R3IL 3UJTL 4C4KO 1WZLA 4I3SL 4MNGA 3A6CL 2GAZB 3I6GA 3FQNB 5EUKB 2AJVL 1B2WL 4OLWL 2BX5A 2IALA 3ES6A 4YBQC 4NRZA 5K33A 2PXYB 5C09D 2VXQH 3JTTB 3C6SA 4NGHH 1AXIB 1XF1A 1A3RH 1MJJB 4JRXA 2XZQH 4PJ7B 2H26A 3ARPA 12E8H 1OQXA 5J6HB 4EIGB 5CJOL 2UUDK 5E2UH 1I4FA 2QQLL 4DOHB 3MCKA 1CFTA 3QXTA 3TF7C 3DSFL 5C0ND 2RJMA 1G6RB 1U8PB 2UUDH 4TNVF 3F6IA 5GRVL 4OFVA 2Y1VA 1F58H 1OSPH 3H9SB 1BLNA 3BHBA 2A77H 4JDZB 4P5TD 4CL7A 2ZCKL 4JZJC 1IAIM 2CMRH 1A6WL 4U33A 4U3CA 2XYCA 3SDYL 1PG7W 4ZDHB 4JQIH 5DO2C 2AQ1A 3HE7D 4KQ4H 4X6BB 4AEFA 3QG6B 4WEBL 3HG1D 1OY3B 3DX8B 2G60L 4HUWB 3MODL 3WD5H 2P8PB 1UACL 2DLGA 1MIEH 4NPYA 4XP9H 3TN0A 5IHUL 3HMWL 1JUFB 2E7LC 2VLMD 4OKDA 2A9MH 4NQUA 4G6KH 5DRWB 4TUOA 5JMRA 4R8WL 3I3BA 1MAML 4AH2A 2Y23A 5D2NE 3V6ZB 1MH5A 1I1AC 4MJ4A 3TT1H 3CDFA 3MBED 1KLGB 1YEGH 5B38B 5J12C 3TZVC 1QYGL 1ZT7B 4U1MA 3SY0A 4X0KA 3ARFD 5KAQF 5JR1L 3U4EA 1YMHA 1MCHA 1UYWH 3D1MC 4NZRL 4OZGA 1ZA6A 5IV2A 2E9IA 4RMWA 4XP5L 2O5ZL 3QP3A 4M6AA 5DJ2A 1SEQL 4NQSA 1KBGH 2J8UB 2PYEB 3RPIA 1M7XA 4HBQA 4DTGH 4FABH 3LKSB 8FABB 3VXSA 1T0NA 5C7XL 3PV7A 4N9GA 3STZB 4D0BB 1JP5A 1TJIH 2FIRT 3QI9A 5I2IB 5L2KB 1P4BH 2HFEB 3ILPA 5DJ8B 2UWEF 3KDMB 2NZ9D 4EVNA 1LO4L 5JOPD 1JMZA 3W5NA 1GH7A 3VW3H 4OF5A 4JO4L 4I0PB 5EOCJ 1A1NB 1ZLWK 1X5KA 5KS9A 5H35B 1IC5H 1QP1A 2VN7A 2BXYA 3L7FA 1INDH 8CGTA 1AQKL 5HYSB 5EZLA 5J7CC 3GMOA 4DKFL 2ITCB 4OF3A 4D9RD 2VSDA 3RVUC 1JZ4A 1H3UA 5BV7B 4XNXH 4MWFB 1CS6A 4GW4A 1IC4L 5D6CB 3AC0A 1Z6JT 3X3GL 1G7JA 5L7XH 2UYLB 2JJTA 5GGTH 1Q9WA 2MFNA 4JFOB 3O3DB 5EIQA 1R0AH 3MRJA 2Y06L 5A3ID 4LSPH 1BX2A 4JVPA 1SY6H 2FJGB 4S1QL 2YPVL 3EYSH 4HWEL 4U0RB 1PVHA 3MRLB 4ZPTB 2NY7L 1CXHA 3FAXA 2EXYC 1YEDB 3MRGB 3C5ZD 4NKIH 5F9JA 2DLTA 1VSCA 4GAJL 1UG9A 1MI5D 4F7EB 4XI5D 4BQBA 5D7LE 4UT9L 5IVNA 3RWIB 1NKRA 3O9WB 2CLZA 1VHPA 2D0FA 4Y1AB 1T20B 1X3DA 2BVOA 2H2PC 4ORGB 2VXUL 3SCMD 2RGSA 5FCSH 4ONGL 1Q9OB 3FOMA 2VXVH 4I2XB 3WSQL 1M05B 5DWUH 4J4PD 4JFXB 3VGAC 3WUZA 5CJQL 5TF0A 1VACB 2EE9A 1JRHI 2GJ6B 3UJJH 2EKSA 4H0GA 5EC2B 3X3FH 1FC1A 3AY4C 3CPLA 4ZFOL 1ZTXH 1MREL 4O2CB 2FRGP 1NC4A 1JVKA 4TQEL 1AR1C 2R56H 4PRPA 3QUXD 3AVEA 4PJ8C 4Z7VE 4BZ2H 4LRIC 2CD0A 3C9NA 3JUYA 1MQKL 4AIZB 1F3JA 3QIUA 5FHAL 2EDJA 3R8BB 4G3YL 1KEML 5DA0B 5FECA 3MUZ1 3IXTB 3LKQA 3OR6B 5IVOA 4HFWB 3RDTD 3QQ4B 4K7FB 5D72H 5C3TA 3T77A 3BWAB 4GW1B 1OTUD 1G7IA 2Z8RA 1JHTB 4TVPH 4LOUC 3QQ9D 4Y0GA 4OLXH 4OFIA 4U1NA 3BMWA 4RNRB 2EDTA 2ZUQC 3RAJH 1WAAE 3QDMA 1A9BA 1FN4A 4ODHL 1GZQB 3MXWH 3IVKB 3SDCA 3GJEB 4KV5F 1S7TA 4JR9H 3MLUL 2X4PA 4PJEB 1A6AB 1HIML 2OMNA 4ESKA 3ZL4L 3FFCB 3S34L 4L3EB 1BIIA 4FRWA 5DK2A 5M7QA 4Y4HA 1KENL 3L3GB 1TJGL 1NCWL 1ZSDB 5FUOH 3KS0H 4PY8J 2BVQA 1OT2A 4KROC 3E8UL 4EOWH 3FB8B 5JW3L 1NKOA 2XXMB 5C3LD 3UC0H 1U6AH 5DRXB 5IR1B 3FO9B 5ITBH 4DGIH 2MSPA 4W4NA 5I1DA 3BP4A 1RZGB 5TQ2L 4PTTB 2GYSA 2WBJA 3GO1H 4CADA 3CGTA 3L7EB 3RWFB 5F88A 3MRFB 4GQPH 1EUTA 2J6EH 32C2B 3KPPB 5LVEA 4XAWL 3L6FA 4GRLC 4QRRE 2NY2C 5C0AB 1FL6B 4H26B 5JXEC 4M5ZH 4PRIB 1FH5L 4MNQD 5DVOA 2I26N 2IAMC 1UXWB 1JF1B 4JPKH 2EIZB 3MNVA 4JFEB 4JY4A 1WUNT 4KUCD 1N64H 2G2RB 4U2ZA 5CHNA 2OR7A 3C2AH 2D7TL 4LNRA 5DVMA 3R06B 4PJIB 3UYRL 3ZKND 3BPLB 2AXFB 4HFUL 1AQDA 3O4OC 5D1QC 1LNUA 5DXWA 3ZT7A 4JJ5B 4HPYH 5F3BB 3NA9H 3V4VL 4N0CD 1YEJL 5J57B 2JF1A 5DGRA 1RJYA 1RQ5A 5FXCH 5E8NB 1QSZA 2NW2B 1FAIH 3FZUD 3HE6D 1NL0L 3H9HB 1FZMA 1PG7H 5IBTL 3FRPA 3WE6B 4X5WA 1K4DB 4OSUH 3CFBA 5CP3A 4WU7B 3QO1B 4BKLA 5JW4R 1UA6L 5B39A 4YDJB 5KAQG 1L9NA 3FO2B 1Z3GL 2ZUUA 3HC4L 3RTQA 3TGXA 2ITDA 3CFCH 2B4CC 5EOTB 3T08A 4BH8B 1RFDL 3IGAB 1S3KL 1T7XA 3IETA 3LRSB 4WNQB 4UOW0 2CPCA 4PJDF 3M17A 3S37X 1ZWIB 4QCIB 4O2FB 4XHJD 2D2OA 5JLZA 2ADFL 3VG0L 3KYMA 3HFMH 3T2OA 4ZFOA 1WZKA 4OCSL 4FOMA 3WHE1 5I73C 3BT2H 4WENB 1HHJB 5I1GL 3KXFA 1MFAL 2AXGB 2IPUK 2R1WA 3D25B 4WV1C 3VWJC 1GGUA 1E28A 1HYRC 1NMAL 4YHZL 5MEND 1XT5A 2QHRH 4UV4H 4X6CF 2A6JA 3LKOA 3DPBA 4PRDB 3V5KB 2DLFL 3HNTH 3VMOA 4LCYB 4BK5A 1FJ1B 4PJFF 4X6EB 5I71B 4IOSD 1MCRA 2Y36L 1PZUB 5EORL 4UT6H 5B8CA 4LHUD 1QRNB 4ZS6D 5DURD 1XF3A 5J8OA 4XPTL 1FFPB 2IFFH 3PL6D 1DUYB 5ABDE 3E3QC 2C7UA 3OKEA 3DX7B 4MA1B 2EC8A 1UWEH 2X1WL 4AT6A 2I07B 1J0JA 1OAYL 3LV3B 5C07B 2FD6H 5L0QB 5I18L 5KSBE 3WFBH 5IFHL 4PUBH 5GS1B 5D1ZB 4P2OB 4J12A 4M9PA 3OAZK 2X9XA 4OUOA 3K3QA 1DP0A 3OAZH 3ZDYF 1A4JA 4UI2A 4JM4L 2ORBH 3U7AA 5IW3A 1RUPH 2OX5A 1V05A 1WIPA 5CILH 3GSNH 5IT2L 5FYKE 1ZVSB 1KIRB 2OZ4L 3HRZA 4NQDB 4PB0L 4WFEE 4PJ5D 1X5AA 4ODSL 1MPAL 4YXKL 2EZ0C 2WWKT 3PDOB 3EJZC 5ALBH 1K3ZA 1FNSL 4JE4B 2NX5E 4GBXC 1J11A 4D9QD 1H5BC 5MERA 5E6IA 2DQDH 3O81A 3MLYH 3TH3T 4P5TA 3MOBL 3PNWA 2WUCL 3RWDB 4YHOH 2N7BA 1QBBA 2CDFA 2DQEL 3KLAA 4HGWB 3N9GL 2L7JA 1CVSC 1WFUA 5K9JH 1EHLL 2DWDB 2L4OA 5AZEL 3FRUB 4NUGL 5DMIH 1MWAH 1P4LA 2VIRA 1E27A 3UPCA 1NC2B 3O4LE 1QEWB 2C5DC 1CFNB 4RGNC 1EV2E 1Y0LA 5EU3A 3HAEH 5DZOA 1A7RL 1JYVA 1ZHKA 1A22B 4Z0BL 1HH9B 2AK1L 2ICES 1WEJH 1NLDH 4ORZC 4U6YB 2NY5C 5TH2B 4HBCL 4UUJB 1PLGL 1IL1A 1G6RL 5DSCB 1AR2A 4EDWH 3KPRA 1JGDB 3MRQB 4R9HA 4KRLB 3LQZB 1KGCD 4YPJA 2HH0L 5INDA 3L3HB 3INUH 4M6ML 4GMTH