5CZXC

Crystal structure of notch3 nrr in complex with 20358 fab
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
220
structure length
214
Chain Sequence
QVQLVQSGAEVKKPGSSVKVSCKASGGTFRTYAMHWVRQAPGQGLEWMGGIVPYHGITDYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARDDYSTYAFAYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of activating mutations of NOTCH3 in T-cell acute lymphoblastic leukemia and anti-leukemic activity of NOTCH3 inhibitory antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Neurogenic locus notch homolog protein 3
total genus 45
structure length 214
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5czxC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5czxC01
3H0TB 5E03A 1U8NB 3PHSA 1MRCH 3MNWA 3OSKA 3IXTB 1QBBA 2IH1A 3WD5H 4NHCL 1X4YA 1VGEH 3GSOA 2Z31C 3UO1L 4ZPVB 5F7NC 4JM2A 4PJGB 1BQHG 1F4YL 4QRTB 3TT3H 4RWYL 3VXMD 3TA3D 3R1GH 4IDLA 1PVHA 3FFDB 4DUWA 4JRWA 3DROB 4H25B 2B0SH 3V6ZA 3VFGH 4WNQB 4PJCE 4K3DL 1UWXK 4TTGA 2HVKB 4H26B 4V1DA 5C0AA 4XMLL 5FO9A 1DBMH 3QCVH 1TPXB 2NW2B 5D1ZC 5KSBF 2OTUA 1FORH 3KYNB 1BLNA 3QDJB 4CADB 2WP3O 4Z6AT 5JPNB 1QFOA 4PD4K 3GMLA 5C09E 2RAMA 2UVEA 1JPSH 1DQTA 4L29B 1VPOL 3Q5YA 4EIZC 1ORQB 3H3BC 1SHMA 1SY6H 3H9HB 3RWDB 1CFTB 2H1PH 4K71B 3AY4A 2A83A 4ZTOH 4U3CA 2XQYG 3RZCA 4HJGA 5A40E 2GY5A 3SQBA 3QYCA 4JG0L 3V0WL 2XN9E 3GSNL 3L3KB 4N0FB 4U4BA 3GIZH 5HYQA 3WD5L 4NO2A 2NW3B 4WW2C 5C0CB 3MX0A 3UO1H 2DAVA 1VKXA 5LWYH 4QCIB 5TFSH 4ALAH 1ITCA 2FIKA 3ISWA 3L3JB 4K8RH 3QFJA 4LCYB 1DQML 4OLZL 43C9A 1QSFD 1FLRH 2IPKB 3TO4C 5GGVY 5TGBB 3D0VB 4LCIL 1CFSB 3BKJH 2AABL 3SGEI 2ZJSH 4E41B 4HXAL 2QV2A 3QUZC 4KK8D 1W0YT 4K2UL 4PRIA 5T5FL 4F7EA 4I3RL 5FDWB 3ULVD 3ARPA 2APXA 4WCYH 4X6CE 2PYEB 4OUOA 1AFVL 2A2QT 4DK6A 5DRZB 4OZIA 4GBXD 5JOPE 4EI5D 1IVLA 3GGWB 1J88A 1T1ZA 1WT5A 3GM0A 2ID5A 1FYTD 5ITFB 2H1PL 1LP9F 3KPQB 4GRMA 5E8PA 3P9MA 5HHNB 4OM1H 4WO4D 2AKRA 1AXTH 2M2DA 4WO4C 1PY9A 4MGXA 4QRRE 1I8MB 1LO4L 2ZPKH 4NZRL 4Q6IC 3TBSA 1OHQA 2P8MA 4AL8H 4XMKL 3IDNB 3T77B 4Z77B 5KTEL 3O4LB 1LE9B 3S37L 4ELMB 1A8JH 3HZKA 3TZVC 3SPVA 3B2VL 3LIZH 4YDIL 2UZIH 1YEFH 4ODUB 4ZO7A 2G9HA 1AGEA 4NC1E 3WIHH 5D7LE 1OD9A 1EDQA 5IKCA 4XVSH 25C8H 1FP5A 4F57H 2WLYA 1YUHB 2Y06L 3VFWB 3SN6N 3D3VB 1KTLA 3C6SB 2AW2A 3NIDF 4MNHA 4GRWE 1EGJH 1Q9LB 1DBAH 2GSGA 3VXTB 3K0WA 1CFTA 2ZUUA 4PTUA 1TCRA 4QHUB 5JXEA 3WLWD 3WS3B 5E56A 2HTKC 3C5JA 4X4ZA 2Q76B 5DK2B 2BNRA 4YHYC 3IFPB 3N1PC 5JW4M 1OAZH 5MEPA 3QUYB 1F6AB 3K80A 1A6AA 3KHQA 3WLBB 5CZXD 2OM5A 2PO6D 3HC0B 1K8IB 1EEZB 2DM2A 1DE4A 4JO4L 1D5ZB 4GAYA 2QHRH 4F9PA 1I1AC 1QEWB 4MHHG 2J6EL 4NZDA 3T08A 4PBWD 3FT3A 4OUUA 2R9HD 5DUPL 2APTA 4NO5B 5C92A 3GSQA 5F1NA 3WO4B 4TSCL 5KVGH 4ZUUA 2PXYA 4HXBH 2G60L 4PGZA 1B0WA 2H2PC 1QYGH 4L1DA 4PP1C 4ZPTB 1JF6A 3UJJH 2VLJB 3MRLA 3VWKA 3ZT7A 3O6LH 1UB6B 1D6EB 2EC9U 1RJYA 2WWMC 5H94A 1A1OB 3DTXA 3K3QA 4LP4A 5JIKA 5FGBA 1W72A 5GJSH 1CIDA 1DLFH 1KCVH 4FXGA 1XF5B 4LSPL 4Z5RA 2C1OA 1RV6X 1A1NA 3H9ZA 1Y18B 4C56A 1G6VK 2DQCL 1XZ0A 3ZDXE 3IS0X 2VXSH 4H0HB 3QPQD 2AEPL 1KLFA 3MBEA 2PTTB 4P4KD 5FECA 5F7LB 4DEPC 3RWEA 2X1QA 1BIIA 3V5DA 1X9QA 2CLVA 4NCC2 3QA3A 5F7DA 5B38B 2AJSL 3GJFK 1SYSA 3RGVD 1IEAA 4CBPA 3WSQL 4AEEA 4DN4H 2X44D 3RX8A 3X17A 3VFTB 1S8DA 3NPZB 4YXKL 4ZS6C 5DRXB 3KXFE 4JFQB 1MI5D 3THMH 4PBXA 1AE6L 2WUCH 1S7RB 3QCUH 1QSVA 1RZ8A 2DI8A 5AZ2H 3SE8L 1X6LA 5D6DC 5IB5B 3PWLB 4IMLA 1DQJA 1K4DA 4FMFA 5C0EB 4YHIB 3UBXG 3EO0B 1BPVA 4XWGL 1I75A 1A6VH 1XGTA 4G80A 3WFEL 4EN3D 4NC1C 1S7WB 2EYSA 3KXFD 3QULB 5E8OB 1RZ7H 3L9RB 3M8OH 4JFZH 3FMGH 1KCUH 1QD0A 5DMKA 5GRXG 4EN3A 1ZS8A 4HIIB 1ES0A 1W0WA 4MCZA 3CFIC 3QDGD 5GS1C 4PJBF 2NNAB 3X14B 1UC6A 3U0WL 4C58B 5DR5L 1HNFA 2P44B 3LQZA 5JZ7D 4DGIH 3JWDH 2CSPA 1BVZA 4YGAB 4C56D 4BSJA 1LNUB 3ALXA 4FQXD 3S3SA 1E4XH 4NFBA 2IADA 3GHBL 3GI9H 3O6KL 3K74B 1QSZA 4QXTB 4LPYA 3C6LD 1I4FB 5CWSA 4G6JH 3QEHB 2EH8L 4Q9BA 3S35X 2DL9A 4HT1H 5JO5B 1FNSL 5I75C 3RAJL 1NL0L 4JFPB 1PEWA 1E4JA 5BRZD 4CNIA 2DLIA 1VFAA 3ROOB 4M61A 1AD9B 4WI3A 4OZIF 3IU3B 4F9LC 5IFHL 1OAXH 1BAFL 3N9GH 4JFDB 4Z8FH 1NLBL 4XP1H 2HTKD 3V2AR 1QHOA 5SX4I 3BAEH 1HSBB 4DGYH 1ETZB 4UT6H 1NH6A 5GJTL 1LEKA 1FFNA 3VXOA 1HKLL 4XVTH 3R4DA 4I48B 3T0ED 3D6GA 2NXYC 4EI6A 3V4PH 4APQC 3BGMA 5HYEA 4F7PA 1H3WM 1YNKH 2CDEB 4I8DA 1YN6B 3L5XH 1SBSH 3HE6C 3BSZH 3QA3B 4HLJA 3QG6B 4YDKL 4KFZC 4LASH 4NWUH 4X9BA 5IW1B 1NCUA 2BCKB 4M93C 2HT3D 3LS4H 4TRPH 4MX7B 2HKHH 3SQOL 1N26A 4ODWB 4G8GB 3TC9A 2R8SH 1ZT1A 4PJEF 1T83A 4ZDHB 4L9LA 1VEPA 1Q1JH 2DQCH 4XNZC 5IB5A 4C55A 3B8SA 3MUHL 2B1AL 2ICEA 4I4WA 1HNGA 3OKOB 3UPCA 3V6OE 1KPVA 4XTRD 4KU1A 2YD4A 2XTJC 4WUKL 5EFIB 2X4OB 3LRSB 1HCVA 5ENWB 1U58B 1GYAA 4I77H 4YHPA 3MLXH 1KCRL 3OGCB 4M5YL 4N1HB 1A6TB 1E27A 4ERSH 5MEQA 2NNAA 3CCHB 3EJZD 5T3ZL 1QRNB 4NDMB 2WW8A 5KOVC 1AE6H 2FH8A 5IR1A 4LLQA 1U8PA 4LGRB 3VI3F 5D6CB 3UTPE 1G7JA 3F58L 4PV9A 5AZ2L 3X11A 4HWUA 3RWJB 1D6VL 3IDXL 1BBJA 1MJUH 3C08L 2OI9B 3DUSA 1A5FL 2HLAB 2ZKHL 1T66D 4R2GC 5E5MB 2AQ3A 4I5BB 3GSNH 3T0DA 2DYPB 2R4SH 3G6DL 4LSUL 3MLPA 4LSRH 3UTTA 2UWEA 3NZHH 1BX2A 1U8HA 1R3HA 2FZ3B 5CWSB 3RWCA 4OLWL 3HR5A 1DEEB 4QRRD 2XXMB 4WO4A 1I9JH 4FN0A 3BIKB 5DD0L 4PJFE 4OFVA 3BIAX 4Q97A 3GBLA 3NN8A 3AXLB 1QR4A 2YZ1A 4AJ0A 3O2WL 5T3XL 3GSUB 4HUMB 1U8NA 3OX8B 1BZ7A 4OZGB 3X3FL 1D5IH 3ALWA 5F6IC 1F3DH 4JM2B 4QRTA 2FJHB 3IS1X 1LK3H 2FB4H 3QXTA 4GRWF 5CZVH 3GBNL 1HDMB 4NKDA 4O9HL 3T09A 4OCRL 3W0WB 4Y1AD 5C2BH 2CDEA 3BKMH 1QSFA 3KPRA 3PJSA 1P1ZA 4L3EE 1YQVH 1IZKA 1NGXA 2YD2A 4XCNB 1G7LA 5EUOE 4RGOH 4DZBA 2EKJA 2XRAL 4QRPB 1YMHB 2Q6WB 3VXSD 3RL2A 3DUHA 3TNMB 1MPAL 5F7UA 4LLUA 4OZHB 4QHNB 5DVMA 4L5FL 5I1AA 1GZPB 4Y19D 5A2KH 3CFJA 2OBGA 4LSRL 5CEZE 5FV1L 4LMQI 2DKSA 2MMXA 3QFDB 4RWHA 4P5MA 3S4SB 3EYVB 3T3PF 2ICEB 3QIWC 5I71B 4Y5XA 5J8OA 4XBEH 1NMCC 5E4IA 4MA3B 4PRHD 5GRUH 3ARFA 4BFIB 3UTQB 1JZ3A 4GAJH 4PJ5E 2GFBA 4IS6B 3P4OB 4AY0A 5ENWA 1CL7I 2ATPB 1FBIL 3QO1A 3O9WC 4P3WA 1KV3A 3LS4L 4PG2A 2XZAH 1BGXH 1XCQA 5KANI 3EYSL 2BNQB 3QUKB 5FKPA 3JWNC 2HH0H 2FCBA 5JIHA 1JHLL 5A16A 4JHWL 3QDMB 5F7HA 4ZOAA 2CH8A 1P53A 1EERB 1OARL 3MOBH 3DMMA 3WHE1 3BUTA 4FQIH 4FQLH 4RQQB 1YNLL 3DI2B 4G3YH 3RWGB 5KSUA 3IETA 4OGXH 1FO0H 1MPAH 1UKSA 4ODVL 5C1MB 5E2VH 5J12C 4U1IB 1OP5K 3P3YA 4LDOB 4GW1A 3ZDXF 1HHIA 2C7UB 5ESVB 4J6RH 4Q0XL 5EC2B 5B3JF 5ITFA 3S8WA 1R3JA 4OM0L 2DQEH 4WWKB 2CD0A 3P9MB 1WWCA 3RVVD 3G5ZB 3QH3B 1H3UA 4WI2A 1JZ6A 2CIIA 1CU4L 4ELME 5GGVH 2FJHA 3BEVA 1HIML 3PHQB 3MBEC 5MHSD 4KQ3L 4A2MA 3JV5A 1FVCB 4FFVD 4G9DB 3B9AA 2XWTA 2FX7H 5DC0A 4YFDB 1YEDB 3NFSL 5I8CB 4UILH 1U6AH 4FXKA 4NBYB 4FTVA 4HBCL 4UUJB 4WFGE 2NZ9C 3LSOA 4LCCA 4HZLA 1S9YA 1GC1L 2EE9A 3EOTH 5HHXH 3V79C 3VFWA 3PP4H 1L0YA 1OWRM 1D9KA 2ZG2A 5DVKA 3SO3B 3L3IB 5ACZA 3DJ9A 1JPST 3JTTA 5D6DA 1DLFL 1MFDL 1MJ8L 4W6XB 4ONFH 2Z91A 4S1QL 1N5AA 1K3IA 5CD3B 3BDXA 1UVQA 4HGKC 3BZEB 3O6FD 4LPVA 4HPYL 3QFDA 1P9MC 5IT2H 4KAQH 1N6VA 3VXQB 3VGEA 3BP4A 3FB6B 5CCKL 4DTGH 5EUKA 3FO0H 1FN4B 4UQ3A 3GJFA 4HUWA 4Y5VA 5J13C 2WLZA 4I18B 5DJ8A 4WRLA 1HWHB 1RZJL 4LIQH 2GFBB 2CRYA 1CGYA 5KAQG 1CI5A 4IJ3C 2V2XB 1EPFA 3TCLA 3NBNA 2ATPA 3SJVA 1C12B 2QQKH 4BZ2H 3ULVF 1OCWH 1OP3K 3TBVB 2A9NH 5I16B 3SDYH 5LBSH 1J8HD 4GMTL 5C70A 3WUWB 5HI4C 3QUKA 2P5EB 3HI6H 4JPWH 5BJTA 1B2WH 2VDNL 5IFJB 4KKLD 4OUUB 2ORBL 2BY2A 1OM3H 2E5EA 4XCFL 3MTRA 4ZUUB 4Z7UE 4YX2H 3FOMB 5HHVL 3UZEA 3ZDZF 3IETB 1KCSH 4U6TA 4QRQB 1N6QH 1NFDB 1UKTA 5C0BD 3EYFA 5FGCB 4HK0B 3QIUD 5CMAA 5DURB 3D3VD 1XIWD 4MAYA 5C6TL 1UQSA 4ONFL 1C5CH 5CP7A 3OWEA 5TQ0L 3GMQB 2X1XR 1WZLA 2VSCA 2HFGL 1RZFL 1K85A 4TN9A 1R3JB 4LHQB 3ZKNC 3QPXL 5F9WC 4HK3N 1JZ8A 2A74A 3STZB 5J89A 1A1OA 2Q3ZA 5BXFB 5EOTB 1FVEB 3Q48A 2PO6B 4XPFH 1KXTB 4JHAL 4X5LA 2R56H 1EMTL 3WDHA 3V52H 5CIPH 4Z5RB 4F57L 2CRIA 5TH2B 2A6IA 1E4XL 2WV3A 4PRBA 1YECH 1DJSA 1FAKT 1LO4H 4NQCB 4PBVC 1A6ZB 2JIXD 2D7MA 5INCB 1WK0A 1U41A 4L4VD 1G6RH 3GSRB 4NNXA 4X8XA 1BQHB 1CFVH 1PZ5B 4IMKC 3VFUB 4JY5H 4MSWB 5C9JB 3JTTB 1JF1B 3QIBB 4AMKL 3UTZA 3DIFB 3KS0H 1GH7A 1P7KA 2F54D 3MJ9H 4KY1H 4JFQA 4U0RB 1HIMH 4ZFOB 4C56E 5KSAA 2FX7L 5T3XE 4OZFA 3VW3L 3ULSA 3GJFB 1ERNA 2ZP0T 4HUWB 1NLDL 2DL2A 2XKUA 1DCLA 5CP3A 4AIOA 3BPCA 4LBEA 4NOBA 2OJEB 4OQTL 2YEZA 4D9LL 2EDHA 2F15A 1SYVA 3LD8C 2CO6B 4QRUB 4E5XB 4I0PB 5A2JH 4YFEA 1S5IH 4ZUWB 3V52L 1ZS8B 4Z0BH 4GMSL 4JY4A 4XHJD 2B4CC 2Z8RA 3WUWA 1OP3H 1QYGL 2C3HA 4K7PY 1I1FB 2ADJA 3U0TA 1I7UA 2XYCA 1QR1B 2YN3A 1CE6B 1A6WL 3DXAA 1QZ1A 4K3HA 4YDVA 2DBLH 4MNQD 5I17A 4Y89A 5DZNA 2W65B 1PKOA 4ZXBB 3UZVB 1MVUB 4P46D 1WUNT 2BNRE 4EKXA 1HZHL 4MA8L 4MB3A 1KIQB 4WU7A 5TPWH 1IC7H 4LQFH 2IAMA 1T2XA 3EYQD 4MMZC 2ICES 2ATKB 1N5YL 2AJUL 3CAFA 4RGNC 1WJ3A 2DJ4A 3MLTA 3BW9B 3SDYL 5J13B 3T1WA 4LSPH 3QIBC 1XIWB 3CZFA 3S4SG 2AERT 2X4TA 4D8PB 5JZ7C 3S5LA 5D7KD 5DS8A 3OAYK 4PJHE 2DI7A 4ODHH 4RRPA 3KJ4C 5CGYD 2GTWA 4XNZB 2QSTA 5EIVA 1J9CT 2QADD 4PJAE 1TVHB 4BA8A 5HVFB 1A7NL 4LHUA 4ZTOL 5D96B 1IGML 4HH8A 4M00A 2FEEI 3ARGC 3SCMD 1EO8H 4J7RA 1MOEA 3LS5L 3MXVH 3WIIL 2W0PA 5A2LH 2VAJA 5HHQB 3C5ZC 3HUJE 5I1IL 4EI6B 5ISZA 2R23B 5HYJD 4YBQC 4M5ZL 4GAFB 4KI1A 3O6FC 1G7PB 2DIAA 3NH7L 4LOUC 4BFBD 4R7NB 5I1JL 1EFXA 3HCVA 3CFBA 5FGCE 3D0LA 1JNNH 4YPGB 4A6YL 3RJDA 4ALAL 5HPOA 4GG8A 1I8IB 3KPLB 4MA1B 4P4RA 3UTZB 4HKJB 5BS0B 4MQXC 1FLRL 1AP2A 3X3GL 2EDDA 3FCTA 3O4OC 1I1RA 1U8JA 1DFBL 2DLEA 1CBVH 1T7YA 2AJSH 1ZGLP 2OMBA 2ZUQB 2XIDA 1PY4A 2DRUA 5F97E 1BFVH 4QXWA 4Z7VF 3VGHA 3NCBB 4L4TA 4QHLB 3L3DB 3O9WA 1U92A 1E4KC 4MXQD 5CEZH 1RZGB 4OF7A 2DMCA 1F5WA 2B8OT 5I66A 4MNGE 1ZA6B 5C2UB 3OKNA 5IIEA 3SEPA 2ZUTA 15C8H 5C07D 3D69A 1T7WA 4RISL 5E0QA 2YA0A 2P1YA 3H9SA 4PY8I 5C0FA 4OKVA 4FQJH 3DXAB 1ONQA 3MRGA 4OF5A 4XAWH 4QRSB 5HXMA 1NGQL 2ED8A 3I6LD 3RWJA 4YHNB 2F5AL 4NRXB 1H3VA 3FQUB 1P4BL 1KIQA 4I5BA 2DYPA 4FZ8H 3L1OL 4GKZB 2C3WA 1A4JA 2ZOKA 2UWEB 4MD5B 1NGWA 2DB8A 1UWGH 4PJXE 4GS7B 5HYFA 1MF2L 1L7TH 3CFCL 4TSBL 4WO4B 1DFBH 5E8NA 2YSSB 4BJLA 4F37F 1HKLH 1BD2D 1C16B 3PHOA 3WEXB 3CD4A 4LEOB 5C7XH 4LVHC 5L8KB 2VXQL 3IGAA 1BF2A 3RI5F 5T1MA 3HR6A 3GSXB 3AMKA 1PW3A 4PJDF 1M7IA 1IC5L 5EH1A 3U46B 5LGJA 4HMEA 2EH8H 1WITA 1JK8B 4N0CD 3GEWB 5CZXC 1YNLH 2GUOA 2R2EB 3DVFA 4X7EC 4ETQB 1JPTL 5JW4N 4H20H 4MD0A 4X4ME 3TN0D 2A1WH 5FHAL 5FHBL 2R23A 3BWAB 5BMFH 1CGUA 1BVKB 1JCKA 2HJKA 4NKOB 2GK0B 5JQHC 3PDOA 5FM5O 4DZBB 2AI0H 3VG0H 4O02H 1OSPH 3DMMD 5C0AE 3RUGE 3KPLA 4M7KL 5DQJA 5DTFB 4PJBB 5IMLA 2Y36L 4JHZA 1U8QB 5JDSA 2YBRB 3P11H 3RTQC 1CK0H 1M05B 2JJUA 1T0NA 3C2AH 2F8VA 1DUZB 4NYLB 3GNML 2FWOA 1PJ9A 4JANB 3TIEA 2VO5A 3S4SA 1OSZB 4X6DB 1T21B 4F7TB 3GFUA 5AAMA 3CLFL 3RJQB 1MQ8A 3U79A 2VDOH 5E5UB 2HJLB 3DPBA 2V5MA 2AV7A 3MRHB 1OTUD 2VQ1B 3Q1SL 1F6LL 1IQWL 5IHZB 3UCRA 1HILA 1TTGA 3KPNB 1JNNL 2D2OA 3VCLA 4A6YH 5ESAA 3FQNA 4MWFA 5GS0L 4UU9B 3W0WD 35C8L 4JO1H 5J9PB 5CJBA 2AVGA 1IQDB 5C0CE 4Z7WF 1ZLSL 3HNVL 2BNQA 2GJ6E 4I3SH 2QR0A 2CR6A 2R4SL 1C7TA 4S1QH 1I9IH 4U1NA 2XKNB 1Z3GL 2O5YH 5HYSG 2APFA 1TIUA 4EUPA 4ACPA 2EDLA 3VXSA 3DMMB 5DD0H 1JNLL 2F74A 2VC2H 2AQ1A 4NJ9L 3QXDA 4UIMA 4GKZA 4LLYA 3RWHA 3D87B 1JP5A 1GHFL 3QIWB 2IH3A 2PYFB 3ZE1E 3CVHH 3QDGA 5E8NB 2C7UA 5D5MB 1LDPH 4R9HA 1JYNA 4KK5C 4FQHA 1L9MA 4WEMB 3UTSD 4XVJH 4OCNC 3ULUH 4M7LT 3BVNB 1HINH 1CQYA 3G5ZA 1T4KB 1WFOA 4WTWA 2F8OA 2CIIB 3O45A 3KPPA 3MV7D 1ZLUH 5CAYB 3T1FA 5EOQL 1WBZB 1KIPA 5F7FA 4NQCD 1LILA 5IEKA 3CXDH 1BVKA 3D2UB 4NQVA 4UDUA 1MF2H 4IMKA 3WXWH 4G9FE 3CUPA 2HJKB 4NKOA 4AIZB 4R8WL 1T5XA 3OR6B 3HPJA 2E7LC 1J8HE 5D1QA 1RSFA 1YN7B 1ROWA 3EGSB 3GKZA 4P4KB 4P5TC 1S9YB 2FNBA 5GHWH 4CN1A 5CEXA 1A47A 1MJJB 2NY5L 3H0TA 5AUMB 2G2RB 3OKKB 1W0VA 2BVPA 2UYLA 1Z9OA 3BKML 4NPYA 2VDQL 4B0MM 4P3CL 2PNDA 2Z91B 4UTBL 3JWDL 3C8KA 4NQXA 1OTSC 1BREA 2FSEA 4JAMA 3BZEA 3DVNB 2BSTB 5CUSL 1HQ4A 4HXAH 2NX5B 4APQD 4O2CB 2KH2B 5I1DA 4D9QE 5T5NG 5ADPL 4XPHH 3TM6A 3VRIA 4I18A 4PRNB 3WN5C 4X7SH 4KRMB 1AY1L 5CSBA 3G04B 3WHXB 2VL5A 4GLRH 1OGAA 1OW0C 3SJVB 5ISZE 3IDGA 2FJFB 2Z35A 2X4QA 4QOKA 1KJVA 4N8CL 1SJEA 2X1OA 5KS9B 1KLGB 1TTUA 1CDCA 5ANME 3K2UL 4OGXL 4XNXH 2QQNL 5GSVB 1JE6A 5IFHH 4LFHG 4IBLT 1TPXC 3BKYL 1YEIH 1NLBH 4KK6C 4XP1L 5BJTB 1A6UH 4K8RD 3AREB 1A9EA 3WXWL 2JJSA 2E8YA 1UM4L 4PR5B 5F96H 2W9DL 4XVTL 3VW3H 5ECJE 3RHWK 4OLUL 1UB5B 4WV1A 4Y4HA 5IK3B 5LGHH 2CGRL 1F4HA 5DMJB 1IAII 4NO2B 1C1EH 3SCMA 3BN9C 4JVPA 5C0CA 3T0BA 3FHAA 4AH2B 4M7LH 5C0GA 1MLBB 5DLMH 5BV7H 1N59A 1IT9L 1ZT4A 2DQIH 2BXYA 2EDEA 4X6BB 2VB5A 5HGBB 4G6FD 4K8RC 4GMSH 3BPLC 4RFEB 1BM3L 2FIKB 1XGUA 2WBWB 2Q1EA 4OF0A 1LO2L 2IPKA 3E1F1 4UT7H 5MENB 3PWNA 3WJJA 1CFSA 3FO1B 2ZWLT 1DBAL 2I9TA 4J6RL 4Q0XH 4UNTA 2NXYB 4WGVB 1CGVA 4Q9RH 1JGVL 4NJ9H 3FB7B 5DD6A 4CKVX 1KIPB 1SJVA 2YN5A 3UJTL 1EHNA 3SE3C 1C5DB 1X5KA 2R0ZH 3RKDD 2DQTL 3X12B 4GRLC 4XNQA 3HPJB 4P3DA 3PDDA 4RX4D 4PJHF 4P2RB 4K2UH 4RNRA 3U36B 4FFWC 1MCWM 1W0VB 3O11B 5L9DH 1CD8A 4Y5YA 1ZVYA 3DRQB 3DIFA 4PD4J 3CSGA 5EC1B 5MERA 2JB6A 1TQCC 4L8SB 4E42A 1EAPB 1RK0A 1NSNH 2VLJD 1LHZA 2B2XL 5IUSA 1FL3B 5I8EB 1G84A 3HZKB 3GMPA 2IBZY 1AKJB 1MFDH 4ZAKA 2ADGA 5T1KA 2RGSA 1X5ZA 3RY6A 4WWKD 2N4IA 1G0YR 5HGHA 1IFHH 2GTZB 3MA9L 4L3AA 3PWJA 3TBTB 1PQZB 4I0PA 5CIPA 4N90E 5F8RC 1CZ8H 1A4KB 1KLGA 5C0BE 2FGWL 1NC2A 1OL0A 5DRWB 1RJZA 4POZD 4LVNB 2VZSA 3I6GB 4G6AD 1GPOH 2WP3T 1TCRB 5LAXB 4M7JL 3RVUD 4GMTH 1MVUA 1RHFA 1XR8B 4IEFB 1H15A 1J0ZA 1A1MA 4S1SH 2DS4A 4OT1H 4CDGC 5CHNB 2PXYD 3PGFL 2Q8AL 1S5HB 3QPXH 4JFEB 1NAMH 1OAYH 1KTDA 1O0VA 2DQFA 1UT9A 1YYMH 2CIKB 12E8L 2XWJB 2ORBH 4AH2A 5C0GB 4C59B 1YQVL 4Y4HD 5D1XC 2R56L 4MLSA 4JKWA 2X4TB 4BFGA 4F7MB 5FYKU 2ADIA 1KJMB 1TDQA 3QDAA 3FFCD 3IFNL 2ZNXA 4O4YL 3TBYA 3PIQB 1PG7L 1HSAB 1NGQH 3GSQB 3WNKA 3ZYZA 2G75B 4OI7A 4ZTPL 1CT8B 4L8BA 2VXVL 5DMIL 5KOMC 3MRMB 2CMRH 4IRSD 3FB7A 1B6DA 4LARH 3RTQB 1CZ8L 2YR3A 2QBWA 2ICWJ 5HHQA 1FIGL 2ICCA 3QAZC 3OF6D 4CGTA 3U4EB 2JB5H 3VWKB 3WDIA 5E94A 1P4LA 2G60H 1KNOB 2EIEA 2EXYD 3AS3A 1DBJH 1I85C 2W07A 3FMGL 4YE4H 4JRYB 5DT1H 2XZAL 5AYUH 4FQ2L 3EOYG 1T1YB 4GOSA 4V1DD 3LVEA 1FJ1B 2VL4A 3DVIA 1XF5A 3B9EA 3H2WA 3S3JA 5DR5H 4L8SA 3VJ6A 3PABB 4FFVC 1RHHA 4Z7WE 4YGVB 1AGDB 1JPTH 1BHGA 1AKJA 4OFKA 4L4TB 2IFFL 1MCDA 3VH8B 3BEWB 1GOGA 3ZT5A 4Q9QH 3BIBX 3OZ9H 3O41A 3EO9H 2R9HC 5I1CH 3TN0A 4LP5A 1CICC 2F19L 2Z92A 2QQLL 1CLYH 3OKNB 5B38A 1RUMH 5CIPB 2EC9T 3BOVA 2VLLA 4NN6C 3MROB 4E9LA 1XH3A 3MV8E 2VKXA 4NO0D 5I74B 4PG2C 1N5YH 3OKEB 3PQYE 4EVNA 1CK0L 4TPRH 4JGMA 1KENH 4M8VA 1S5IL 4LPXA 3BAEL 3KR3H 3GNMH 3W9EA 4PJHB 3RVTD 4PGDA 4ZO9A 4CUCA 3C09C 2KQNA 5FGSA 3TVMC 1CICB 5IF0A 3HE7D 4MJIA 4NQSA 5JOPD 5DJCB 3V9FA 2XWJA 2A73A 4U6HB 4ZUSB 1ACYL 2MJWA 4UI2A 1NGWB 4M9OA 4HIIA 1ZHLB 1ES0B 1W0WB 3BSZL 4WUUD 2FGWH 3Q6GH 2VH5H 4YUEH 1CDYA 4PB0H 4JFFE 1DLHB 4IRZL 4GRLD 5F7MC 3OMZA 1WWWX 1NDMA 3EO1B 5I73B 4BELD 4MVBC 1IBGH 1P7QD 5LVEA 4Z0XB 1NANI 4DUVA 5SWSB 3GMMA 4UB0L 5BVJB 3RU8H 4DW2H 3BO8B 2F58H 1PFCA 2H26A 4NFDA 5DQ9A 2Y5TA 2BRRH 4QGYA 3A6CL 1EXUB 3X3GH 5BVPL 2VITB 1S7TA 3KPSE 3AFLA 1ZHBB 2QQQA 1JFQH 3BP7B 3W0WE 4X6CB 2LABA 5L88H 1QLFB 2B4CL 5I1IH 3TCXA 1T1YA 3QNZA 4X80H 1XR9B 4FFWD 3GUTB 5J11C 2YPLD 2YWZA 5HVGB 4KVNH 5F70A 4M5ZH 1IC4H 3H42L 3KYOB 4HW6A 1ACYH 5T3XD 5C07E 4GXUN 3BWUC 4LCWE 4WY7L 3E6FB 2W0KA 5DHVB 4NHUB 4ZQKB 3ARYA 4M6AA 1CGWA 4LSVH 4OGYH 4GQPH 4JM2D 3WJLC 1N7ML 3MCLH 5BRZB 4G42B 2FATH 2VQ1A 4P2OA 4RAVA 3VGDA 1MCSA 3KLAA 2X9WA 2CXKA 4YJZL 3TO4B 3IDYB 3VXRE 5DJDA 4M1CD 3KPMA 2R0KH 1OAQL 1F11A 1OAKH 4OTXH 2W60A 4JKKA 2BRRL 3N06B 1G7MB 4PRIE 3H9HA 3V4UH 3FQWA 2GY7B 5FCUH 4C83A 1MCPH 1MHCA 4I4WB 3OL2A 3ZTNH 2QHLA 2ADFH 4LLWB 3QDME 1LWRA 2YPLA 1KPVB 3CMOL 5K9JL 2DF3A 4DN4L 4PRPB 2VXQH 1U8KB 5HSFA 1UEYA 2H8PB 4U6HA 4ZUSA 5I76B 1DSFL 5EFIA 2NW3A 1LE5B 5KSVA 2UWEE 3IJYA 1N8ZA 1RUPL 2CJUH 1S9VA 4R96B 4KKCD 2MSPA 3L1OH 4JPKL 5T1LB 1GOFA 2CPCA 1MFBH 1IRAY 2Y4SA 1NDMB 1MY5A 2XN9A 5C08B 2ZUVA 1GGYA 1FRGL 3KR3L 3SDDC 5CEZD 1UM4H 1QSEB 3EZ8A 4XPBH 5CJOL 3CU7A 4HIJA 4JPVL 3KLHD 4M7ZC 4OLEA 5E6ID 1S7VA 4MMXC 5LGHL 5FDWA 4GFTB 5CJXA 1EX0A 1BMGA 3LEVH 3BGFC 1K9TA 2A0LD 2KQMA 1CR9L 1MJUL 1EXUA 1U95A 2DQIL 3AROA 1CF8H 3UC0L 3EGSA 1S7XA 1Z9MA 2Y6SD 2AXFA 5KW9H 4GRMB 4RAHA 5CJ8A 4MJ4A 2HG5A 1MAJA 3DX8B 3EDKA 3D39B 2DM7A 1JHTA 2ZCKH 4MJ5B 5D2NB 1Y0LB 1EVTC 4PJ9C 3EOAA 3L5WA 3NFPB 2CUMA 1FFRA 5KZCD 2NY0B 3VMNA 3N0PB 1NMBL 3Q1SH 3DX9B 1GRWA 3HAEB 3UJIL 3QIBD 4JZOA 2FSEB 4JAMB 3RY6C 4ZUTA 3OAZK 1FFPB 4M7KH 5E2TL 5GS0H 4LK4A 3HS0B 3PGCA 4ELMA 1WAAF 2D03L 5CSZB 4I0PC 3F62A 2OQJA 3R8BB 3L7EA 4IRJD 2YUVA 3NVQA 3SBWA 1NAMB 1P1ZB 3D39E 4YEFA 2W0LA 1JMXA 1I1AB 3G04A 2E9BA 3WHXA 4YHOH 4X99A 4CMMB 5GZOD 3ARVA 1X7QB 3MJ9A 5DJDB 1ZSDB 4U1GC 3GMOB 3RWFA 1GC1C 3LRGA 3INUL 2UUDH 3QUZD 1MEXL 2AJXL 4KJQD 1WF5A 4BM7A 4P46B 3U82B 4XBGB 2AGJH 4JO2L 1A3LH 1LEGA 1P7QB 1I7ZB 1FQ9C 3ARFB 2VTFA 4BFIA 4WV1B 5F93C 4XVJL 1W72H 3DARA 3MZTA 1FNGA 5IK3A 4JFFA 3T3ME 3FQTA 3MA7A 3IFLL 4WFGD 1F6AA 5CKGA 4QOKE 5HVHB 1ZT4B 3ABZA 1KEML 1F42A 4U7KA 3H9YA 2O26U 2P5ED 4U3XA 1XCQB 2H3NA 1HQRA 2V2WA 3PP4L 4BK5A 4OLZH 5FKPB 6FABL 5EOQH 4GAJL 1IGJA 1T5WA 5DDHB 1H0DB 1XCTB 1IGCH 2NX5D 3IDMB 3DRTB 3B3IB 3OJDA 2J6EA 4HIJB 1DZBA 2P8LB 1MCFA 1KPRB 2QKIB 3ULUL 3ZSSA 3QJHB 4HJ0C 5GRZA 3DXAE 4Z78B 5E6IB 3WXVH 2CKBA 3BYYA 3VGFA 3SO3C 3ARBB 1HHIB 4LLAA 5DJXB 5L8JB 4P2RA 4JREB 1Z2KA 1KPUA 4OLVL 5DWUH 4RNRB 4P2QD 1AXTL 4XXDA 4ZOBA 1CDBA 1HWGB 4Q74A 4JFXA 4AM0A 4PJEE 2BVUA 5IB3A 4GT7A 2NY4D 5DUML 5B4MC 3QIUB 1DN0A 5DURD 4UAOB 1QFWH 4MCYA 4PJGA 1KSRA 5AWNL 1HYSC 2VXVH 3KXFA 1D9KD 1KN2L 4D0DB 1KUMA 1OPGH 1RUQH 5D2NC 3HB3D 1FFPA 3RA7L 3HG1B 2NY1C 3FAXA 2VLKD 3TN0C 2AEIT 3C8HA 4YFLF 4W81A 1FIGH 1JNJA 5GSRB 1J1XL 3MBEB 5T1KB 1CU4H 3PUCA 4H26A 4FXKB 2GTZA 4FTVB 1ZTXH 4O51A 2AXGB 5GXBB 5JXAL 4M43L 4KRPB 2BVOB 3MGTB 4KJPD 4DN3H 2AQ2A 2Y06H 4WW1A 3V5KA 2YK1H 4GXUM 3I02A 4PRDB 3VGAC 2Y07L 1IEAB 4ZSOB 4F3FA 3RVVC 1N3NA 2NYYC 1S8DB 2IQ9L 2NXYD 1X5LA 3HUJB 1FNLA 3G6AA 3STLB 2WINB 3QEUB 4M4PA 3M45A 5CBEA 1G7HA 4JDVB 5DO2D 2NY1B 3V7MA 2EE3A 4LGSB 4NN5B 2A83B 4LSQL 3CLEH 4PRHA 3T0VA 4N8CH 4PJ9B 4LRNH 5EO9B 2Z8WC 2MCG1 1S78C 3SE4C 4G6FB 5IMOB 1SVZA 4JQIL 3I50H 5HYQB 2OCFD 3MA7B 4GBXC 4YHOL 2C9AA 5DUMH 3NOIA 1UM5L 2GAZB 5D93C 3QULA 1MWAA 4H1LG 3LOWA 4LVHB 3LZFL 2ILLA 4JO4H 4QKXB 4E0RA 4IIQC 2PO6C 2QHRL 1HQRB 3F7YB 1H3XA 1YDPA 5F6HI 1WBYB 1FZJA 4OZHF 3RZWA 3BZ4B 4M7ZB 3PIQA 3SOBH 4AMKH 4HF5L 4ENED 1OGAD 2FEDD 2NZ9D 3M17A 2SEBA 1CS6A 4IRJC 5EG6C 5C6PB 5D7SH 4NQCE 1RU9H 5KSBA 3WLWC 1FHGA 4F7EB 4G8GD 3R0MA 1BGXL 2PYEA 2JCCE 2ITCA 4FG6D 4P9HL 5CMAB 3BDBA 3IFLH 1TZIB 1FV1B 1RMFL 1RJLB 1NMAL 3RPIA 4UIKH 5IBTH 1I4FA 5E7BA 4HH9B 1ZT7A 2NYYD 1IAMA 1YEHL 1NAKL 4YXHL 3Q6GL 1U36A 3W81A 5F7EH 2HLFC 4K7PX 3FRUB 4G3YL 4Z7WA 2P5WB 3NFNA 5E6ZA 2BXZA 2GW5A 2VAAA 3TBSB 2BDNL 3T3PE 3GIZL 3BYTA 3FN0H 2DLGA 2CLRA 1J12A 4J8RA 1NCWL 1RHHB 3GDBA 4HV8A 5JLZA 3CVHB 1JNLH 4P5TD 5ETUB 4NQCA 3TH2T 2P47B 2WUBL 4GG6F 4DOHE 2C3VB 5FA4B 1KG0B 4Y16C 2AXGA 2B20A 5BVPH 4NNYB 3L95A 5IBUB 1TJGL 3MV8A 3AM8C 1FL6B 2E7BA 4K3EL 1WBXA 2BCKA 3QI9B 1H8OA 3TNNA 3MROA 3KYKL 1Q9LA 3QEUA 5CBEB 3KPTA 3TA3B 2ZNWA 3WS3A 4KK5D 4HKZA 4OAWA 1A9BA 5DK2A 5E24E 4FP8H 1CLOL 4YXLH 2VQUA 1NBZB 4MJIB 3QUXD 1WWAX 1KB9J 5B3JE 4Z7NF 3WLBA 3D9AH 3KDMA 4PFEA 1U58A 1BFTA 3ZE0E 2DM3A 3QJFB 5I1JH 2O61B 4JZJA 1KB9K 2IALB 1B4JL 1NLDH 5HHMB 1OAQH 1BOGB 4NJAL 4X7DC 4R90H 1QRNA 4NDMA 3BZ4A 3H6JA 3FOLA 3FT3B 2ZUXA 3B9DA 3VMOA 3ESVF 4X6EB 3DURA 4NO5A 1G7JB 3IVKA 5J4MA 1FVDA 1N0LA 4KROB 1ND0B 1MCPL 2SEBB 3H9SE 3SKOB 3VWJA 4AT6B 4B41A 3DUUB 1HH6B 4HIHA 1YEJL 1T80A 4N0CC 1ZLVK 3KYKH 1HHJB 3ARZA 3U30B 2VDNH 4EDXB 3P73A 2DLHA 3B9KB 3NA9H 3QP3A 1A14L 1WTLA 1B9ZA 4PJ5B 1DVFB 5INDB 1KIRB 1BJ8A 1DQLH 1IC7L 4LQFL 3HE6B 5HHVH 3N85H 3DTXB 4G9FD 1JTOA 3O4LE 3MLRL 3AB0B 4WWID 1MFBL 4XNXL 4LPCA 2IBGA 4YBHA 4ZOEA 3S36L 1YMMB 1WISA 1Q9WA 3V5HB 1RU9L 3EJJX 4N8VG 4BQBA 5GISH 3KJ4B 1XZ0B 5F96L 1BQUA 5TDNB 3ZLQC 4ZQKA 2X05A 1KFAH 1SM3H 5J1AA 4NKDB 2VABB 2EIZA 3W0WA 2PN5A 4PUBL 3ZYOA 1LEIA 1K2DB 5JW5B 1MVFA 4RAVB 2GEEA 5FYKE 4LDEB 1EK3A 4DCQA 3CNKA 3PNWA 1VEMA 3FJTA 4KXZH 4WFFE 4XXCA 1NGYA 5FO8A 3O3UN 3EFDL 3X13A 2M8XA 4GJTB 5KVMC 2IBZX 1OW0A 3OAZH 5DYOB 1FSKC 1UADC 4N0UA 2P7TA 3MLVH 4KPHH 5C86A 3QHZH 3LB6C 5I1AB 3FCTB 1CLZL 1NC2D 1PEZA 2Q7YB 4HKZB 4IMLB 3RDTC 3T2OA 3V0VB 5EORL 4Q9RL 4M3KB 4U1MB 4G6MH 1OVZA 3P4NB 4QHLA 1B4RA 2FYYB 4PB0L 1BFSA 2VYRE 1FNEA 3RWIB 4Y4HC 5D1XD 3S36H 5GZNC 4M5YH 1VFBA 1P6FA 3ARGD 3SCMC 3ES6A 4Y0GA 4R96A 5C08E 5K59E 4CW1B 4N5ED 5E4EC 1QBMH 3FOLB 5IVXE 9CGTA 4XNUH 1WFTA 4PGJA 3MRGB 3VMPA 5A16B 4OIIL 5DHYB 5EU6D 1FYHB 1FVDB 4F58H 4JN2A 2AJZA 1N6UA 2PCPB 4FP8L 3WJJC 3JXAA 1QRKA 1U8LA 1HH6A 4F15B 3V0WH 5KSUB 5SWZB 4RDQF 2N7BA 5FYKL 1ZANH 3NZHL 2BNQE 2GJ6A 1HHJA 4NCC1 1PLGH 5KSAD 4XAKE 3ZZ1A 4QXUH 4PJ5A 4TYUA 5INDA 1N2RB 1MI5B 5CS7A 5EU7C 4JFPA 3AS2A 3IKCB 2EDWA 2A6JA 4JFHE 4XBPA 4M61B 5KVDL 2NY5C 1KGCD 4D0CB 2EDXA 1KB5B 2IMNA 4MJ5A 5D2NA 4D0BA 4I3SL 4LU5H 3L5WB 3NFPA 3LCYA 1ETZA 1SQ2N 3MODH 4ZPVA 3QWRA 1RZ7L 3DX9A 5GRJH 5L88L 4LF3A 4I48A 4ZUTB 3LV3A 5J1AB 2BVTA 3AY4C 4NBZB 5CSZA 3RNKA 3MACL 3TGXA 2HVKA 5ALBH 1FO0B 1PG7X 5EZIL 3U7YH 1R3IL 2H32A 4XHJC 4EXPX 3UYPA 1E6OH 4LPTA 3ARWA 1WFNA 5DYOA 3ZTNL 3NCFB 2A1WL 5FHBH 5FHAH 5IMLB 3IFNH 4G8GA 2WANA 4J23A 5DO2C 4KH2A 2LVCA 1HINL 3SE4A 5GISL 1IKFL 4PJ9D 1ZLUK 3RA7H 1TQBC 3ZE2F 5DJZB 5JXED 4X4YA 4KJPC 3LPFA 2FX9H 2I26N 3S3PA 2R29H 5DJ8B 2NTSP 5HDQH 1KC5L 2VLRD 4NQEE 1GAFL 1FBIH 4LU5L 5MEOA 1AQKH 1LO0L 1B0RA 3CSPA 4UQ2A 5MENE 1VFBB 3ZL4L 2JCCF 3ES6B 4JFFD 4OIBA 3CCHA 3LHPH 4OF6A 4YE4L 4IHOA 5DT1L 1IQDA 5I8KL 5JA8B 3U0PA 3QEGL 2JJTC 4KPHL 1V3JA 4PB9L 1S9XB 2V2TA 1I1AD 2OP4L 4IRJA 2G5BA 4TOYL 5DHYA 4HLZH 5TGBA 3P30L 1J0YA 2IQAB 4HKBB 3FFCB 4LLVA 5DEFB 3SKNB 2NY6C 3STBA 3OJDB 2VR9A 4EUPB 4PLJD 4G6ML 1PX3A 3HTLX 4EOWL 2NZIA 3OJ2C 4KV5E 1G1CA 2VDRL 2FHCA 5E6IA 2AV1A 1I9IL 2IMMA 3C87A 5E7FA 5TF0A 5T1DH 1JNHA 2IF7A 2NTFB 1TVBB 4NIKB 1T1ZB 4JPIB 1NMBH 4P2YA 3UJIH 1BZ9B 4OZHE 5EA0L 4B7IA 3BKCH 1N4XL 2DTMH 1WVZA 1JTPA 1H9VA 2C26A 1GGBH 5LXGH 2KZWA 1GHFH 1YEEH 1ZAGA 2DD8L 4PJCA 3CFKB 4PY8J 3O45B 1DN0B 3L6FA 1R5WB 3KXFB 3T77A 4Z77A 3RKDC 4A6YB 4J1UB 3HHRB 5C0RL 3DX7A 3Q5OA 5I8KH 3AM8A 4CVZB 1I9RL 1MFEH 3I2CH 3CDFA 4BYHA 1A6ZA 1O7VA 5DMYA 5DRNB 3UTSB 1AGEB 2AJXH 2XZQL 1YN7A 4P4KA 2RB8A 3BH8B 1NCCH 4WW1B 4MQ7B 3S96A 3SDCC 2ZKHH 4MSWA 2WWKT 3QQ3A 4MNHB 1KLUA 4NPYB 4EJ1C 4KMLB 4EDWH 3CFJB 3I85A 4UOW1 2NY3C 1P7KB 3P40A 4F7CA 3DVGB 2YC1A 1ZK9A 2V17L 4MAYD 1JL8A 3GMRB 4JVWA 2E8ZA 2NX5A 3MRDA 1E4WL 2OR7A 1HHGB 3UMTA 5ALBL 1M4KA 1JN6A 3QRFM 1RZJH 5C9KA 1P5UA 5B21A 2CUIA 2PW2B 3MRFA 5D72L 3P11L 3QO1B 1G9MC 1E6OL 1ZHNA 2GT9A 1TVDA 3K81A 3ZMRA 1TNMA 3V95A 1FZMA 2EEAA 1R5VA 4M6NL 4XP9H 4PJ7E 4NKMA 3LQAC 4QHMB 3IRPX 1OM3L 2IQAA 4HKBA 4LLVB 4Y4FD 3SKNA 4ONGH 2OL3H 4X9GA 1VPOH 5D7KE 1U8OB 5AD0B 5C09B 3R06B 4L8CB 1RULH 1UB5A 5H37G 5KSBB 4ZMAT 1WCBA 2N56A 3VXMA 1M6OA 2R1WB 4Z7NE 4JO1L 5GS2D 4FHBD 1L4IA 2IAMB 1KC5H 2M26A 3KAAA 3FAWA 4L5FH 1RJCA 5FYJD 1C5CL 2P24B 4JQXA 1TVBA 2IGFH 1V7NH 1IFHL 5D5MF 3VD9A 1BZ9A 2W9DH 1Z3GH 2O5YL 2CDGA 3KYAA 1H3PH 2PETA 1RK1A 2X4SB 2XPGB 3T2QA 1OTUC 1WQVT 5CILL 1NJ9A 1QSFE 1D3CA 5AG8A 4OZGF 4N5EC 4Z7WB 2VLRB 5ID1A 2V5TA 4K8RL 1W72B 5JW3L 2NR6D 1OAKL 3PE9A 4FXLA 4JHAH 4LCIH 4L8DB 3RPKA 4V2CB 4M43H 1GJIA 1HYRC 4PGCB 3AREC 4KKCC 4X0KB 4MHHI 2ADFL 3ZHLA 1IGFL 4OT1L 3ECBA 5T5FH 1AQDB 3PGFH 2C3VA 5FA4A 4XXCC 3IJHA 3W82A 3TBWA 4HJJH 1GIGL 4XNQB 2XFXA 1KN2H 2AXJA 2AK4A 4ONGL 2B1HH 3MV8B 1KF9B 4MQ7A 1Q38A 4YHKH 5F7DB 3REVB 5L8LB 3HAEG 1OARH 3MOBL 5EO1B 3U36A 2VUYA 3UYRL 1GL4B 4P2OC 1RULL 2MWCA 3EBAA 1I8IA 1PKQE 2D9CA 3FZUC 4HGMA 4HKJA 1CL7L 1ZGLA 2IG2H 3JV4A 1D5MB 1IL1B 5MERB 4PGBA 4F7CB 1OTTC 1WCQA 4UT6L 2IGFL 5CINH 1MRDH 4QRRB 4ZTPH 1L6XA 3FB6A 3PP3H 4NP4L 4O00A 3QIWD 5ESQB 1DQDH 2E7MA 2VXUH 3NAAL 1IEHA 1IAKB 4ZAKB 5GRWA 3ESUF 3LIZL 4YDIH 3SGEH 2NY2B 1ZA6A 2ESVE 3L5XL 5TF1H 5GGVL 2JB5L 2XTJB 4JR9H 2XICA 5C07B 1FFOA 3VFSB 2DKUA 4MCZB 2V5YA 3LKRB 1RD6A 1AR1C 4JQVC 2W92A 4GQ9H 4LCUA 3QEQE 5IFJA 5D2LA 3H9SB 4X6EA 4YK4B 3DURB 1JWMA 2BRQA 1MJ7L 2J5LC 4R4BB 3VWJB 2NY3B 3S97C 1HHKB 3MJ7A 5DJYB 2EDYA 5TDOB 4JFEA 2AK4D 3EYFB 1BQSA 4I0KA 4HIXL 2K3TA 4HC1A 4NQDD 4I3GA 4G7YH 1OAZL 3QEHA 3TYGH 4ZO8A 3OKYA 2Z93B 3Q0HA 5FAAA 2HKFL 4F7MA 5I74C 1RUML 1VFAB 3RZCD 1YYML 3HE6A 5MI0C 1VESA 4C57C 3OHXA 4GKOA 2I07B 4JFDA 5C0DA 2K7PA 1M7IB 2NY4C 4AEHH 4FQQA 3QNYA 3GJEB 1EZVX 4M7LL 4KHTH 1L9NA 4GG6E 4NQDE 3HZMA 4PGCA 5BV7L 1OCWL 3VXOB 5EUOA 4EZMA 3SDXA 3GKWH 4PRBB 3T0XA 2F53E 4OJFH 1MHHB 1NGZB 1PG7H 3U4AA 3U4EA 2XFXB 1XF4A 4PPTA 2CMRL 1NCTA 4RFNB 1CFNB 2BSED 5T3ZE 4U2YA 3RVTC 2WUBH 4OLYH 5CBAB 5D96C 5DC4B 1D5MA 3RVXD 3MODL 4ZFOA 2XTJD 3QZWA 1D5IL 1JGEA 3KHOA 5JUEH 1DDHB 4K3EH 4KUZL 4QRRA 1RZKC 2Q7YA 1AGDA 4NRYB 5AYUL 1B3JA 4FFZL 4PGEA 5CZVL 1U0QA 4U1MA 2YPKB 3RU8L 4DW2L 1DVFD 2ZSVB 4Q9CA 5TE7L 1HEZA 3VH8A 4KKLC 1NBVL 4PY7B 4FRWA 5HHMD 2JE8A 5TE4L 4NN7C 5EZIH 2X7LA 1ULVA 1SYVB 2GYSA 4QRUA 2R69H 3A6CH 5D7LD 3IAPA 1FFOB 3KPRD 3OGCA 1JZ5A 4MWFB 5FUCE 3MGAA 3MZGB 3LKRA 1J1OL 2LVEA 1JYWA 5J9PA 1XGYL 3JWOC 3U7AA 1DANT 3MRIB 5ICXA 1UXSA 5I19H 3MMEB 3BDYL 4POZC 2XKSA 1MREL 1JZ2A 2AS5M 2EC8A 4R4FL 3H42H 4U1NB 4CDHA 4ZXBA 3MNZA 4JN2B 2AJZB 3UTTE 3KLSA 3QDHA 1NUFA 2W0FB 2A6DA 5ICYB 3DOSA 1WAAA 3W9DB 5TFSL 4RIRB 5CP3H 4UNUA 32C2A 4UMGA 3QI9D 4TPRL 1U8HB 3QI9C 2PYFA 1CN4A 3OG6B 4GKSB 2VZVA 1YY9C 1CD1B 1MI5A 2CLZA 3QEQB 5JUEL 4GKNB 3M8OL 3BMVA 5F6IB 5EU3A 5DEGB 3O3AA 3D18A 5FUCC 1RFDL 2ERJB 2W9EL 3P0VL 4BKLA 1FCCA 4Z7VB 5ERWA 1UZ6E 3G5VB 5TE7H 12E8H 4D9RE 1I7RA 1TVHA 4LAQL 2ARJA 4Z0XA 3NGBC 4LSQH 4IOFC 1DQLL 4Y4FB 3B43A 4FQIL 2V7NA 4WHYH 3MBED 2H26B 4HIXH 1NGZA 3BN3B 3OGOE 1XGPB 4IRZH 3VH8G 4JQIH 4GAGL 3TYFB 3ZTJG 3RHWF 5BMFL 1NCNA 4P9MH 3TFKC 3O6KH 2I5YL 2MTPA 3BDYH 3QDJE 4RX4A 3P9LA 4N5UA 1KIUA 1NGXB 4XCNA 2FIRT 3ULUF 4ETYA 1RIHH 1T5XB 2VSDA 3BZFB 3P4MB 5CLTA 5D9SA 1CFNA 3QZWG 4R7DB 3ZDYF 4P59L 4XVUD 2LE9A 4NSKB 1MJJA 4NN5C 3GUTA 4P57A 1I7TA 1TFHA 1K6QL 4OZHA 4FQCL 4HD9A 5C0BB 4AENA 2FDBP 5SX5H 2V5RA 1JFQL 4LSSL 1JRHL 1A7QH 2FBOJ 1AHWA 4F8QA 5BZDB 4NRYA 3R8QA 2BSTA 1MIEH 1DBKH 1HQ4B 4JPVH 2EZ0C 4MYWB 7CGTA 3ULVC 5I1DB 1U92B 2Z4QA 5TDPA 2AJVL 1FLTX 4D2NA 3VRIB 3IFOA 3FB5A 3NFSH 4IS6A 4P5KB 4WGWB 3BXNB 4G9FA 1ADQL 3GSWB 2RR3A 2NXZB 3IDJB 5IVXF 4F58L 3UDWA 1RIUL 1B0RB 3MUGB 1GC1H 3EOTL 5HHXL 1II4E 2BK8A 2Z9TA 1SJEB 3OB0K 3IT8D 3C60A 2NLJA 1Q9OA 2LU7A 3O3DB 2FATL 1MJ8H 4JREC 3SY0B 1E28A 5EZJA 3LDBC 3G6JF 1VDGA 1MHCB 5FM4A 4HS8L 1UXWB 5DK0A 4OQTA 5C0JA 32C2B 5E2TH 2H8PA 5ANMB 4QT5A 1A7BA 1LE5A 3IJSB 4UBDC 4GKSA 2NTFA 4J4PC 2XZZA 1BFOB 3I6KA 2YSSA 5JPMA 1G6RB 3O3EA 3RBGA 4PJ7F 1NGPH 2FH6A 1L0XA 1UG9A 1ZANL 4LCCC 4PP2A 4U0QB 3N1FC 4KGJA 3U46A 5LGJB 5C08A 3WUWG 4KKNA 4MD4A 4X6DE 1F02I 5F1OB 4H88H 4G43A 4ZUVB 1A2YB 1WC7B 4RISH 3ARDD 1NUGA 3F5WB 5BOPA 5L0QB 4CVZA 5ITBL 3F6IA 4QTIL 2AJ3B 1I3UA 4QY8A 2BHZA 5IW6B 3BZFA 4X6CF 2HFGH 1IBGL 3U30C 1KEMH 1UWEL 2HG5B 4MS8C 3MFGB 3MV8D 4JZNA 3VFVA 1D9KB 3BUYB 4PRPD 4LAJH 3QQ3B 4NJAH 1FGNH 3AVEA 2W9LA 5JDSB 2HT4D 3EOAB 1AJ7L 1RUKH 3BQUA 3MV7A 2NXZD 4B7LA 3BHBB 4WFHD 1OAUH 2ERJC 3HZYA 4K7PH 1UKQA 5HGAA 3MV9D 4NYLA 3TIEB 1AXSA 3OR7B 2DTSA 3HAEH 3BPNB 3L3HA 5K9QG 1T21A 3U9UA 4F7TA 4U33A 4URTB 1LK3L 2FB4L 5IJKA 1JI1A 4P9ML 4UQ3B 1RVFL 1MCLA 2A9ML 1HH9A 2D9QB 1OF2B 4HKXB 3IFOB 4PRPE 3LKOA 3RNQA 3GSWA 5FO9B 3TCLB 3WIFA 2X40A 3S36X 2NW2A 4PLNC 1G6RL 2GT9B 3RI5K 2Q3AA 3UYRH 2XRAH 3FONA 1CFVL 3QUXC 2CK0H 1FZMB 1R5VB 1CL7H 3AS0A 4JRXA 3GJFH 1JGDA 4JZJC 2PYED 4PJFB 5MP6H 5LAXA 1QACA 4YO0A 2H9GA 3WYRA 3PL6C 1UXWA 4YK4C 2FJGB 1AI1H 4WTZG 5F21B 2GCYB 4RMRA 2J8HA 4P46C 1N4XH 1IGYB 2VWEE 2JKXA 4N0FA 1MEXH 3MPCA 3U0WH 5J6HA 1ZA3B 3EOBB 2Y36H 1UWXH 3IDYC 1WTGT 1R3LB 4HDIA 3MRJA 1BFOA 1J18A 4DKDC 5AZEL 5FXCH 3C2AL 3QXUA 2CDGB 1HCFX 1MAKA 4OD1H 2VISA 2H6PA 4MNGA 4CL7A 2DWDA 1LO2H 5CGMA 4JFOB 4RBPH 4UT7L 3OKDB 2YA1A 3TT1H 3MLVL 2GQHA 4H0IA 4QTHA 1DQQB 4NUJB 2YWYA 3MO1B 5D2LE 4HEME 4G43B 5BS0E 2BSRB 3OKMA 3Q2CA 1WZ1H 4KK9D 2A6IB 3MV11 5KSAC 2QSQA 5I2IB 2C3XA 3QUZB 3NPSB 2VUOA 2EH7H 4HLZG 3ARBA 4ZSOE 5INCA 1IGTA 3ETBF 5GJTH 1A6PA 5D7JB 5HHNA 3VFUA 4XPAH 1PAMA 4ZD3H 5IG7A 3QEQD 5L9DL 4IOIB 4LSDA 1I8MA 1M7DB 3B6SA 3UZQA 2BMKA 3MV7B 4HAFA 3BQUB 2YXMA 3WNPA 1ZGLB 2Y7QA 3BHBA 1O5DT 2H41A 3QT2A 3VJ6B 4L3CB 4HF5H 2DICA 2ZSWA 3QUYC 4FFYH 4JDZB 4P99A 1LDPL 2R1XA 1UA6L 4JRYE 2PF6A 3FQRB 4HKXA 1BD2A 5JIIA 4MXWL 3L5HA 1VEOA 3BEWA 2G9HB 1JJUA 2X4RB 4QXUL 4X7FC 4G8FB 3V5KB 3LN5A 1U8IA 1GCFA 4Y88A 5I1GL 4KK8C 1S9WA 2B1AH 3ARSA 2I9LB 3G6AB 3STLA 2LU3A 3DYMA 2D03H 3ARGB 1VGKB 1G7HB 2CRZA 2ENSA 3KNBA 3VD7A 4PTUB 3CFEB 3VFRB 5JHDB 2NY7H 4DN3L 4KKAC 2H9GB 2W65A 2XWBB 4H1LA 4S1SL 2D4FA 3MJ7B 4J3VA 3V6OA 5F71A 1IGYA 4FOMA 5D5ME 5KSBE 3CDYA 3EDEA 3IFPA 3NCYP 2FGZA 4TQEH 3SGKA 4Y4KB 1A6AB 3I3DA 1F4XH 4XCCH 3CLEL 3U7YL 2FBJL 2YS4A 3QAZB 1ZHLA 4ZNEE 3QRGL 3F7YA 2DWDB 5DS8B 3OKDA 4CAGA 1EJOH 1IGFH 1YQ2A 4UTAL 1T04A 2FD6H 5DD3L 2GTWB 4XPHL 5C0DB 4MXWH 5FF6B 4YNYB 3D85A 3QUXB 4DQOH 1TTFA 1GIGH 1HN1A 3GJEA 4PJ7A 1EJ6A 2B5IB 5M7QA 3HC3L 1A7OL 3HMXA 5SWSA 5JQ6L 1QFHA 5CILH 3VA2C 2W59A 4LHUD 5I1GH 3N1MC 1MHHA 1KCSL 2Y5TB 3D25A 3H3PL 2HMID 4U05A 3C6LA 1ZXQA 5SX4H 4HWBL 4I1NB 3KPRE 2EYTA 3NMEA 1XF4B 4UT9H 4F80A 2OL3B 4Y7MA 3IKKA 3SKMA 3ZE1F 4OD3H 1UZ6F 1XGQB 2X9XA 3S88L 1JWSB 3QNZB 2ZG3A 3DRQA 1PKQB 4RWYH 3T0EC 5HHPB 2YKLH 2IAMD 5E08L 1RK0B 1F4XL 1JGEB 3B9KD 3TP4A 1WZ1L 2XXCB 4XB8A 4ORGA 2BZDA 4NHUA 2Q20A 3ULUC 5GIRB 4TUJA 5EU4A 3FQRA 4HC1H 4S10A 2IFFH 2R2HA 4WFHE 4CVXA 1SBBA 1QBLL 4H5SB 3RWEB 1GZQB 5CJQH 3TBTA 1INDH 1NKRA 1AD0A 2AAVA 4P2OB 4YR6A 4DQOL 1A14H 4BH8B 3KLAB 1RZJC 1T0MB 4C4KT 3L7FA 1OPGL 1RUQL 2OTWA 1NFDE 3QFJE 2R0LH 3VFOB 3ARXA 1NC2B 4FQCH 3BRFA 5IVZB 2R0ZL 2YD7A 4D94A 1ZMYA 3LKQB 4LSSH 1RZ8B 4PJIB 3LKNB 2HAZA 5E2JA 5JHDD 5L2KE 4UT9L 2HN7B 5TE6H 5IFAL 4GS7C 5CHNA 4OCWL 3DGGA 1DUYB 1IE5A 5FM5M 2I24N 1YY8B 1S7WA 2EYSB 1PD6A 4HUXB 1OP5H 3TPUB 4XH2B 2VR5A 2VLKA 4M03A 4WI4A 2D31A 2DWEA 2ADIB 4BSWB 4LRNL 1C16A 1UGNA 4NZTL 4N90D 3D18B 4JDTL 5HYJB 3IGAB 5I1KL 4RFNC 5IOPA 4Z7VA 5HDBF 1HSAA 3I50L 1QBLH 4G7YL 3MA9H 3MNVA 2XACC 4NQEB 4P2QA 1CE1H 5HGDA 2X89A 4LEXH 5ADOH 1MCQA 5F9JA 4EXKA 2V7NB 4OM0H 3RTQA 2I25N 2J2ZA 2QADB 1VADA 1I3GH 4XP5H 1TCMA 3VWKD 5E1AA 3HN3A 3O2DL 4LNRB 3G9AB 3SOBL 1DVFA 1EFXD 1T1WB 4YIQB 3T2NL 3NACL 4K94C 5JDJA 1S7XB 3JUZA 2EIBA 4CNIB 4JCLA 5IB2B 3BQUC 4NO3A 3RX7A 1W8NA 1YEJH 5D7SL 4ODTH 2R2BB 3K1KC 3FT2B 4K23L 4NSKA 2FHBA 2ZPKL 4P4KC 5DTFA 2Q8AH 4W68A 1JHTB 2ICWA 4NQDA 1U8QA 1WIPA 4AIXA 5GZOC 4AENB 1XF2A 1WV7T 1RMFH 5FYLH 1U6AL 4JFDE 3BISA 1G7QA 2OK0H 2VLRE 3QWOA 1U91A 1OSZA 4X6DA 4RGNE 2C3GA 2VABA 4OGYL 2OTPA 1EO8L 2YHGA 3H3PH 2D7OA 3ZKXC 4WNQA 4BK4A 1NEUA 1B90A 1Q72L 3DO7B 1WZMA 1LEIB 4XPTL 5IESL 1NAMA 4V1DB 3BXNA 4G9FB 1T22A 4HUKB 4R0LB 4IOSD 1MELA 5ELIA 5ESAB 3FN9A 1X7QA 1YEKL 3B9KC 2FLRT 3QDJA 5DFVD 3GMOA 5GRVK 2NY5H 4KWUA 2ZCLH 1TZHB 1NBVH 5IVZA 2NLJB 5E08H 3MLWL 4P46A 3UTPD 1CGSH 4Y2DC 1TJGH 3KJ6H 4G8GE 4TUOB 4Y16B 1CBVL 4HJGB 4HC1L 2HT4C 4LGPB 4KZEL 1P7QA 1PDKA 3CMOH 3VFNB 3MUZ1 4K9EH 5IF0B 5B39A 5I19L 1F3JB 1KB5L 4LLYB 4JFFB 2X1WL 4QT5B 4JPWL 1RPQA 3KLHC 3RWIA 4X7SL 2IH3B 4LVEA 4OGAD 4XNMB 4DGVH 3L5IA 1RUPH 2VLKB 3QDGB 3I6KB 3BRGC 5MEQB 4BSWA 4TTDC 3O3EB 4AQOA 4JQXC 1CD0A 4JRXE 2H3NB 2FEEL 2E7LA 3L3JA 3MUY1 3BVNA 3I75A 43C9B 2P45B 5HDOA 4MJ2A 1H0DA 1X3DA 5JORB 3X11B 5T33H 3DLQR 4NQEA 4P2QB 3DRTA 5MP6L 3B3IA 4Z9KB 3DUSB 5E2WL 1T89A 2P8LA 1T1XA 5FK9A 4KI5C 4ZUVA 3ARBC 4G7VL 5BRZE 3OKLA 3ULUE 3T1FB 1MUJB 4GW5B 2Q8BL 3LEVL 2ZCLL 5HI5D 1P7HL 4M6OH 4UOJA 3ZYIA 1R3HB 5I1HL 5KG9B 4FZ8L 3HC4H 3O6LL 2CKBB 4QO1A 1X5FA 5AZEH 1N2RA 4CU7A 5JTWA 4NOFA 1IT9H 4M8QB 3IRZA 3TO2A 2GI7A 4TSCH 3V7AG 5IWLA 3WN5A 3RP1A 4S1RH 3FT2A 1F58L 1MIEL 3F8UB 2WBJA 4Q2ZA 3TJHD 1BZ7B 5D2LF 4AM0B 1IM3B 4JKPH 2I5YH 1NCDH 2X70B 5TJWK 2VMFA 1X5JA 5D8JL 4XB7A 1P69B 4HS3B 3J7HA 5IQ7L 4H8WC 4P59H 3OR7A 4TULH 3LV3B 3LKSA 5E6YA 2MKWA 3LEXA 1EEUA 4XP5L 2EDQA 4K71C 2EYRA 3ARDB 5IMMA 5GGQL 2V5SA 1NBQA 4YWGL 4IRSB 4WEBH 1QSFB 2EH7L 2VZUA 1UJ3B 2HMIC 4O51B 3NACH 5IKCB 1CIUA 5BW7A 4DAGH 1T03H 4KMQA 2NPLX 1WIUA 3TO4A 4NNPH 1YUHA 2Z35B 3TNMA 2K9UA 5EO0B 3S34L 3D3VA 2AI0L 4NN7B 2MCPH 4QHNA 5SWZD 4ELKA 1GZPA 3CK0H 1AO7E 2WINA 4QF1B 4M6OL 4RFOH 1YEEL 3E3QE 1UACL 1JGDB 1QTYT 4PLKC 2OK0L 4JQVA 4C83B 4KHTL 2OJZH 3E8UL 2PYEE 3HE6D 1NSNL 1URLA 5IBLD 3F12B 1EHLH 3UYOD 2R4RL 3VXUB 4LLWA 2FJGA 5GGTH 5IHBA 1UA6H 2MQCA 2GCYA 4X7TA 4FQPA 3EYUH 4H8WH 3UTQA 1F3JA 1FFQA 1A6VL 3WFEH 3UTOA 3VXNA 4KRLB 4U3HA 1TMCB 2XY1A 3VXME 1A0QL 2X4UB 2NQCA 2ITDB 1L6ZA 3MRJB 4UQ2B 2DDQL 5DHXB 2EXWD 3HC0A 1DL7H 3K4DA 5D71L 5DJ0A 4JKMA 2VISB 4TULL 4X6DF 4LRIC 2J8UB 2V2TB 3GO1L 1QEWA 5TPWL 2VDKH 3L5JA 2YRZA 5EB9A 3WKNA 4XWGH 3QQ4A 4PYGA 3TZVA 1DQQA 1QSEA 4S2SB 4NUJA 1GPOL 3AMLA 5DI8B 1T3FB 3GRWH 3K8LA 4ZO6A 5IBUG 4EUPH 1S7VB 1YMME 4WI6A 4P0DA 5DD6B 3HRZB 3QXWA 1QG3A 1ZLVH 4TOYH 2VC2L 5HPMB 3FT4B 1FGNL 1MHPL 1JNHB 3RPIB 3MRLB 4MA1C 1ZT7B 3VG9B 3VI3E 1D6EA 1IGMH 4G5ZH 2JCCB 4WW2A 5EUOF 1J1OH 3SDAC 4TVSa 3IXTA 5H94B 3HE7A 3QH3A 5T33L 5EULV 1V3KA 2VAAB 4IIQB 5E00A 3KWWA 3JVGA 3MXWL 1EAPA 2XI9A 3MLSH 4B5EA 4OV5B 1SY6A 3DROA 1HOCB 3WO3B 4AQ1B 4Z7OE 3EJYD 1T7ZA 3V6ZB 3CVHA 1BZQK 3ARDA 1T0PB 4LARL 4MA7H 4QEGA 5D1XB 3L7EB 5I8CA 1K8DA 1I1AA 3V5DB 3PWJB 3V6FB 4NNYA 2X4RA 4E41D 1R24A 2QJDA 3VGBA 5C08D 5A2IH 2OTUB 1U8IB 3S96B 5EIIA 2Y07H 4OF3A 5I6XC 4QYOA 1FPTL 1WBXB 4NKQB 4P23A 4JKPL 5JHDE 2I9LA 2PXYC 4OCLC 1RJZB 4Z95H 3L3GA 2VDQH 4M1GL 3VU2A 3O2VL 1NCCL 5K33A 1FL5A 4JJ5A 4LAQH 4U1HB 1CF8L 4XRCB 1CWVA 3VXUA 4YDKH 3MRDB 5KS9F 2P42B 4JY6B 4ZXBC 4HFWA 5JOFA 4TRPL 3O0RL 3EO0A 4GAGH 3HFML 4DVBA 3MJ8A 3SQOH 2YXFA 1CDHA 4NNPL 1ZHNB 4S0SD 5GGRA 3SGJC 2BVQA 3LN4A 4PJXB 3EUUA 3K2MC 1QPPA 3BP6A 1P5VA 3F58H 3SDCB 1I85A 3NCMA 2GSIA 5HDQL 3HI1B 1JTTA 3ZKSD 1EHLL 4NBXB 2R4RH 1T3FA 2LU4A 1L7TL 4TSBH 3WDJA 4RCAA 4ZG1A 5AD0A 1S7UA 4JCMA 5IFAH 3MRMA 3PP3K 1LNUA 3VXMB 4Y19A 3DUUA 4WU5B 5KN5A 1YJDL 5C7XL 4MNQB 1A0QH 1NMAH 1JPFA 4PJDA 2VDPH 1DL7L 2YMXL 4J3WA 3NA4A 3U4BL 1KNOA 1D7FA 1KIRA 5E8PB 1KPUB 5HDBE 3QXAA 1C7SA 2IPUK 2XPGA 2A74B 4JR9L 2AKRB 3STZA 4EOWH 3KYMA 3HE7B 4JFYA 1FVEA 1FJ1A 3RDTB 1PKQA 3MRNB 6CGTA 4F9PC 4BZ1L 1HSBA 5SWSE 1NCWH 5ACLA 1TZGL 1Q9WB 1FORL 1H3PL 2PW1B 1H5BB 4YHML 4X4XA 3FO2B 4K94H 3M07A 4KI5D 3RIFF 1MHPH 5IROA 4WI9A 2HWZH 4PV8B 2J88L 3BPOB 2L4OA 1RY7B 4RGOL 2BVOA 4I0PD 2YUXA 2WQ8A 4FFYL 3GSRA 4NNXB 4KK6D 4N8VA 1YPZE 1T0MA 3QHFL 8CGTA 4ZSOA 1SJHB 2VLJE 1NGYB 5FO8B 3UTTD 2B4CH 3VFOA 2HKFH 2OYPA 3T4AA 2J12B 5DJAB 4GW4B 2WZPD 1XH3B 4WUUB 4LKCA 3KGRA 3LKQA 5E95B 7FABL 1I3RA 5FEBA 5IVXA 4GRLB 5EO9A 3W9EB 4OZFB 4UAOC 3SDDB 4MA7L 3EYOB 4OLVH 4ZNEA 4HFWB 4NQSB 4OJFL 3ZDZE 1YY8A 2WQRA 3F7QA 2V6HA 5I15H 1XFPA 3IXAA 4NUGH 1EEZA 1Z9SA 1TZGH 1DQDL 3O8XB 1A6TA 4ZYKA 1FZJB 5DFWH 4K94L 1KBGL 4Q58C 1HXYA 1F00I 1DLHA 4WTXA 4XC3H 1EUUA 3UXFA 1NDGA 2P48B 4U1KA 4DZ8A 5JNYB 3MNVB 5I1LA 3OAYH 3KJ6L 4K7PL 1S7UB 1HHKA 5DJYA 2EXYC 4OM1L 4N9OB 4NKIH 4KUZH 4Y8DC 2EE2A 5AEAA 3LH2H 1D5XA 2X4PA 4DKEL 4RZCA 1BVLA 2NR6C 1LK2A 1K3ZA 2BC4A 4HEPG 2YPVH 1AFVH 5D7IE 4LNRA 1DEEA 3T3MF 2KDGA 1T1WA 3ILQC 1FNAA 2CJUL 3NCYS 1U3HD 1FGVL 3QXAB 3RL1B 3NPSC 3GI8H 3N85L 1VB9A 2N7AA 4Z7UA 4J3XA 4EN3C 5IMKB 1E6JL 5HTSA 4KQ4H 4HWBH 1DTUA 5CJQL 4K7FA 4CU8A 4J8RB 4OZFH 4AL8L 5F3BA 3MREB 4HV8B 5JLZB 4EBQH 3SDXB 2BHUA 2CKBL 5FOBA 3LN9A 2PTTA 4AEHL 1AR2A 2IFGA 3MGOB 5F9WB 5BRZA 5SV4A 4NZUH 3U2SA 1CR9H 3WKMH 1A21A 1EFXB 3TJHC 1T22B 3C5SA 5K9OB 2Q6WA 5ABDE 3REWB 3RL2B 5KW9L 1JZ7A 3T4AB 3CPLA 2ARWA 5E99H 5GGSY 3J8F7 4UNVA 2FRGP 3ME0A 5D7JC 3RFZC 4TNVK 3WFZA 1A64A 2C4FU 4XNYL 4J3TA 4UILL 1DDHA 5HHOD 2D7NA 4WHCA 3H7LA 3QXVA 3QO0A 4P5MB 4TUOA 3EYVA 3VXUD 3SDDA 3MOQA 4YHIA 5DJZA 4LLDA 2CDFA 1Z6JT 2WIIB 4Z7QF 1QFUH 2Y1VA 5I1KH 2X7LB 3L9RA 5DA0B 1OOAA 3A6OA 2JELL 5MEOB 4EN3B 4APQA 3O8XA 5F9AC 3QQ9D 1JZ4A 2IALA 4ZYKB 5CCKH 2MCPL 5C0NC 5ICXB 1UXSB 3BH9A 3RGHA 2EEBA 1YNTB 2IWGA 4OFPA 3MMEA 1I3GL 4PG9A 2CGRH 4IRJB 3LEYL 3RVUC 3QDMA 1ZVSA 2KUTA 2VOTA 4KDVA 3TWCH 1EIBA 4NRXA 4Y1AE 3T65B 2OJZL 2W0FA 4LVOB 2LV4A 2XQBL 3VFMA 5IVNA 1T83C 5D1QD 3FRPG 4QXTA 1DBKL 4W4OA 1W72L 1A4JB 4GQ9L 1OT1A 3T0WA 1MREH 4NUGL 1CDJA 5I18H 5HHOB 4GUPA 3CJJA 5JO5A 3CU1A 4M8QA 1ADQH 3TO2B 5K93A 2CRMA 3TZVD 5B8CC 2DOCA 2C4FT 5KVDH 4FTVE 3O3AB 1IZJA 2GKIA 3WN5B 2QSCL 1U2HA 1JGVH 1KBGH 2EDRA 3AU1A 3D48R 2DI9A 2IH1B 2GHWB 2DMKA 1A3QA 3ARDC 2V7HB 2APBA 3ARFC 1N0XH 4AG4H 5B38G 1ITBB 1I1YA 2YRLA 1MNUH 4ODTL 4ETQA 5BO1L 4YXKH 4DKEH 4G9DA 3MRPA 5F89B 2BNQD 4YDLC 2OQJB 1LP9E 3BFOA 1F2XK 2OR9H 2BFVL 2ZG1A 4P23C 3VD3A 1MLCA 4QNPE 1ZHKA 2R39A 3CH1A 5GGRY 4OD2B 1OT2A 2PR4H 5LG1A 4LCWD 5J12B 1BLNB 5EO0A 5L7XL 3T04D 4KZEH 4MX7A 1G0DA 3GKWL 1EEYB 3ZHDA 1EJOL 3GMLB 3LKPB 3TO4D 4QF1A 2D7TH 4JFZL 1DUZA 3THML 1A22B 3FL7A 5BZDA 3PQYB 3SE8H 3B5HA 5M94B 3BP4B 4GRWH 3WNNA 1I7ZA 1XF3B 2WIIA 2FO4B 3NCCB 1M71A 4OQTH 4D9LH 3IAGC 2BNUA 2Y9RT 4U1LA 1JPGA 2RIKA 1FNEB 2VWEC 4P5KA 2DLTA 2Y6SC 3FQTB 1HILB 5F1SA 1N7MH 3MCLL 4JFEE 5DVLA 1HXMA 1LO0H 3RY4A 1LP9A 3NIDE 2ITDA 4APQB 5DJ6B 1WEJL 4FQ1L 4QWWC 3TBVA 2BOCB 2XG5A 3MV9B 5A43C 1ZE3C 2NY2C 3E6HA 1C08B 2DMBA 4KJYB 1AO7A 4LCYA 4GLRI 5FYLE 1VFMA 4PG9B 43CAA 4KTEL 4PV9B 3ZTJH 1ZOXA 1XCTA 2QEJA 2XTLA 5EZJB 3T65A 3TZVB 3QG7L 3KPOA 2HT3C 2PCPA 8FABA 2F53D 2HLAA 1U8OA 1U8LB 1KYOK 4W6WB 2CXGA 3C2SA 5SWZA 4QRQA 2VDRH 3NCEB 1MCNA 1F58H 4O2EA 3QIWA 2I60H 2FZ3A 3RWCB 3IJSA 3CFDA 4N1EA 2DBJA 4D9QD 3AXLA 5F8QC 3HNTL 3RAJH 2Q8BH 4G6KL 3DBXA 4G8EA 1GGBL 2B5IC 1KB5A 2DKMA 5I1HH 2NY2D 4OZGA 3TWCL 2BOBB 4YWGH 1A7NH 4C4KO 3O9WD 1GXEA 2EKSA 1QHPA 4MCYB 3IDNA 5DGQA 4GRWB 4YZFF 2IEPA 4PJXF 3TESA 5EN2B 1V3MA 1ZEAH 3ALPA 1WBZA 3MRPB 5F89A 4X0KA 3BJ91 3F5WA 3ARUA 4LVOC 5GSRA 5BV7B 2AJ3A 3KPRB 3PJSB 2VLMD 4W70A 3CUPB 1FO0A 5SWQA 4WWKC 3GSNB 2AK4B 4LHUG 4NO0A 5FYJU 4U0RC 4MQXD 4GBXA 4K3GA 5EO1A 2EE6A 2DN7A 2MHAA 2QSVA 3BUYA 4F3FB 4NZTH 1EEYA 2BVPB 2UYLB 1RAMA 3PWUB 1ZKAA 4RRPG 1JYXA 3DI3B 1YYLH 3DGCR 3MR9B 3C8KB 4NQXB 3HZYB 3PQYA 4P9HC 1KN4L 2F19H 1AXSB 1CE1L 2V17H 3CIQA 4QXGH 5KSAB 3L3HB 4UDTA 4IRSC 4MAYC 4OFIA 3S35L 3MBXL 1OD7A 1TJIH 3DO3A 4X4YB 1C5BL 1M1SA 1IAKA 2BNRB 1AC0A 2VERN 4RMTA 2NY3D 3P4OA 3MJ8B 5HD8C 1U93B 5MEPB 3WIFB 1SJXA 3BP5A 3VE0A 3RY5A 5IB1B 1UYWL 2PR4L 3RRQA 1YMMD 5GGTL 4EIGB 3QHFH 4ZUWA 4I2XE 2FR4A 4JY4B 3LN4B 4PJXA 4D9RD 4FQJL 5GSVA 3VG9C 1I7UB 5EZLB 2HT2D 5HGGS 3V0AC 1OLZA 1CDIA 3HB3C 4DVRL 5CEZL 3P77A 1D9KC 1OWWA 1DANU 5FYLL 4QHKJ 4JO2H 5JMRA 1V3LA 4Y19B 1TJHL 1T2JA 4ZPTA 3GK8L 3QDJD 3X3FH 2J4WL 4TNWK 4MNQA 3EOBA 1DP0A 5IB4A 5HJ3B 3CFDB 3AGVA 1TZIA 3DWTA 4HDIB 1JPFB 3MV9E 3CX2A 3ZDYE 1HYSD 3T2PA 1IKFH 1H3GA 1CDUA 4OIAA 2OR8A 4BUHA 5HYIA 4Y4KD 5IVOA 1P4BH 1B4JH 4HWZB 5KVFL 3S35H 1VFUA 2F58L 4YDJB 2I07A 3ZSTA 4KC3B 4NRZB 3L6FB 1UWGL 4DJMA 1DBBL 4R6UA 4LHUB 1BD2E 3G6JB 1RUAH 3QHTC 4YHZL 5EN2A 3DX7B 3TIDB 5ETUA 4ZNCD 4RDQG 1U3YA 2XN9D 4PV8A 2YPVL 3CDCA 3HMWH 3MRKB 1BIIB 3E2HB 4Y19E 3GSNA 4WIQA 2B1HL 2J8OA 2E27L 1IM9A 1CICD 5D7JA 4HQQL 4YPGA 2MHAB 1F4AA 1NC4A 3QIUC 5HI4D 4Y5YB 5EU6E 1TJHH 2IG2L 2AXHA 1NUNB 1Q0XH 1KELL 3MRRA 2M1KA 1UVQB 1X5AA 4E42B 1DBML 3ZKXB 4LKCB 4PJ5D 1TETL 3GMRA 3G5YA 5DFVC 3GMPB 1TENA 5ALCH 3T4YB 3EYOA 4BH7A 1JN6B 1BD2B 3DHMA 5IEHB 5KVFH 3DETD 3L3DA 3O9WB 3JSSA 1U93A 4F37K 4OBRA 2DD8H 4H1LH 1MRFL 1QQDA 5EU7E 1T6WA 5J7CC 1JUFB 1R0AL 4DEPB 1JI2A 1FYTE 5F44A 3CLFH 4LLMB 5GPRA 3ARGA 4KZDL 1WSST 3T8XB 3LQZB 3CFEA 5F9OH 3VFRA 5JHDA 4L4VB 1CQKA 2MNUA 2VZOA 4DZ8B 3GB7B 5HYJE 1X5HA 5IQ7H 5C09A 2ED9A 2F53A 4WHDA 5D7JD 1NUDA 1C5BH 1UCTA 4HUUB 1M6OB 2R1WA 1NFDA 3W9DA 1KTDB 4ZFGH 3QUMB 3CSYA 3ZE2E 4KGLA 1T89C 4U31A 3HNVH 5B8CA 1BVLB 4Y4KA 4WHTA 5I0ZA 3U6RA 1UQSB 1Q0YH 3BT2L 4BZ1H 4DAGL 2A0LC 4L4VE 2EDJA 4JRYD 3CZJA 3LZFH 5DEZA 5DEGA 3ROOA 1L7IL 4F33B 3FTGA 4YDJA 4RAUA 5T1MB 4Z7UB 3HZVB 5H37H 2ARJB 1LEKB 4OCMC 3MREA 4X5XA 5TH2A 2OXHA 2GUOB 2R2EA 4K55A 5TDNA 1INQB 5F72S 3W5NA 5EBWA 3PWPA 2ZCKL 3BGMB 3IJHB 4E41E 3MRKA 3CXHK 1FNHA 5CD5D 4N1CA 3ULVL 5CSGA 5JW5A 1A7OH 4UIKL 5IBTL 3UPRB 4FQXB 5IJVA 4DCQB 4HBCH 3PNWB 4CMHB 4PREA 4QLRA 5D71H 3CGTA 5C9JA 1J11A 1Z9LA 2CO7B 3QIBA 4OLYL 4P57B 3TH4T 5BW7C 2P8PB 2OI9C 5C6WH 2XA3A 4PGBB 2YBRA 4JN1H 4HPOH 5E8DH 1OP9A 4M4RA 3PABA 1J7VR 4MJID 1ZV5A 3PQYD 3FN0L 2ZUSA 2FWOB 3QO0B 3OJVC 4JANA 1J8HA 1Q9KA 3ILPA 4KTDH 4FABL 1J10A 4LEXL 4BH7B 3P4NA 4CVXB 4H5SA 3P2TA 4QNPF 2FYYA 3LRHA 2AV7B 3MRHA 5DQDH 5EBMB 1CYGA 5E4EB 2R69L 4TVPD 2VRAA 4YR6B 1EA9C 3C5ZA 4FTVD 5TQ2H 1J87A 1R6VA 4UU9A 5DA4A 5LBSL 3B5GA 5FYJH 3O6FA 4LCUB 1EAJA 2OSLB 3MRCB 4U6XA 4ZFZA 1FH5L 1EHAA 1MY7A 3C60B 2R1YB 4M48H 4UBDD 5I8OL 4EVNB 1QKZH 2O5XH 5GGTA 1AC6A 4X98B 2CQVA 3D3VE 1AY1H 1BBJB 4YQXL 4PGDB 2F53B 2NY1D 3K8MA 2WSKA 4KDWA 4XCFH 1Q94A 4HUUA 4YHKL 1FGVH 5GZND 3I3BA 2J6EH 3GBMH 1C1EL 5DJCA 2F54B 5HVWA 2XA8L 4KVCL 3IYLW 4N9GA 1XT5A 3HR5B 4HXBL 4XH2A 4OZIE 2PKDA 3CZFB 5E8DL 1AQKL 1V05A 2Z93A 1O7SA 1MIMH 1G6RA 4OBSA 4MAUL 1RZFH 2GJ6D 4HMCA 4EBQL 3TA3C 5KJRH 2A6JB 4XBPB 5D70L 3GSUA 2VXUL