1NCNA

The receptor-binding domain of human b7-2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
110
structure length
110
Chain Sequence
MLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T lymphocyte activation antigen CD86
publication title Crystal Structure of the Receptor-Binding Domain of Human B7-2: Insights into Organization and Signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 23
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncnA00
3V6BR 4YDLC 1CR9H 4E41B 3BMVA 5E7FA 3I75B 2ICES 3VD3A 3FN0H 2FH6A 4IRJD 5TQ0H 2DWEA 1S78D 4XBPB 3DRQB 4RAUA 3SGEI 2RFXB 1F58L 1AR1C 1YY8B 4LPUA 1PZ5A 5T3XE 2V2TA 2HT3C 2PO6B 3ULVL 4C56D 3U48A 2X4NB 3MNVA 1AHWB 2K7PA 4K3DH 4M43H 5DA0B 4KUCF 4HIEB 4M8QA 2CDEA 4LCWB 3WEXB 5L8JB 3RIAK 4PJIA 1L7IH 3PQYD 1EVUA 4G80A 4RIRA 1U8JA 2XWBB 2P5WB 2C4FU 1PBYA 1WWCA 3K4AA 3WFCL 4DZ8A 1J8HA 1F58H 5HI4D 1TTGA 4EXKA 1XEDA 2Z91B 1S7WB 2K9UA 3I50L 2J8UE 3VD9A 3QUZB 4CU6A 2F9BT 2A74A 3QEQE 4YE4H 1WBZB 2NX5A 1CF8H 1XMWA 1HQRB 1FVEB 5FYJH 3OAYK 5DFVD 4I3RH 3V6OC 3QB7C 2FH8A 3IDJB 1OGTA 3IXAB 4OKVB 5FOBA 2XPGA 3FB5A 5IJKA 3UTPE 1FO0L 3ZHLA 4X4YB 1KCRH 3WFCH 4OCYH 3LKSB 1QP1A 4QF1B 3HAEH 3G5VA 2BNQD 4L8BA 4X8JA 2EE6A 2V9QA 5ID1A 3BN9D 4OZFG 5F1NB 4GLRI 4P59L 5EU5A 2V2XA 4K07A 4ZUVA 4I18A 1S7VA 1HHIB 5C71A 4WIQA 3MRKB 4DJMA 5JDJA 4P46B 1FRGH 3ARGB 3QQ4A 4LCWA 2O5XL 3WEXA 1A7NL 4X6DB 2HJLB 3S88H 2YA1A 4ZPTB 1XFPA 4U6TA 4U1MB 4PG9B 4PYGA 5TF1L 3O41B 3S4SA 2EC9U 1HYSC 5DR5L 3V6ZA 5IVOA 3MGAA 4N5ED 1X5XA 2ILLA 4F2MB 2FJFB 3DLQR 3GSQB 3ES6A 1RHFA 2QSTA 4DFIA 3DWTA 4YGVA 2OZ4H 3CCHB 4MQSB 4HFUL 3HZMA 1GAFL 3TBYB 1HQRA 1EFQA 1HIML 2J5LB 3MV7B 5IHLB 3K0WA 3PGDA 3CLEH 4OTXL 3STZB 1DBAL 1SYVB 3L3KB 3MUJA 1INEL 1P6AB 2HN7A 3QIBB 5JLZA 3IDJA 5I8KH 3CVHB 1QVOB 1T83C 2IBBA 1JYNA 3EFDH 4Y89A 1MCHA 4UDUB 4DVBB 3RTQD 3F62A 1JPTH 3MNWA 4PBWD 1F6FB 1J88A 3PHQB 4XCFL 5K9QG 1CD1B 5IB4B 3WS6A 4BZ2H 3GSOA 3FN9A 2BC4B 1CZ8H 4JRXB 5ITFB 1MVUB 2P7TA 2IPUK 3D39D 3MRKA 1UADC 3CFDA 4HXAL 4KHXL 2X44D 1GAFH 3M07A 4WVRA 3V4VL 2HJLA 3OXSB 5D7JC 5KS9E 4JHAH 4U1MA 1WBYA 4PRIE 3O11A 3WLWC 1DBAH 4JO1L 4U6HB 1KEGH 3O8XD 1CT8B 4WHDA 3TA3A 1CFVH 3BPLB 4YHKL 5C09E 1KPRA 5A43C 4MQTB 5IB2A 1IEHA 1DUYA 4PBVC 3RIFK 2EYTA 1KOAA 4MNQB 1QR4A 2AW2A 3ARBA 4PJGE 1EEZB 3DX7A 2HFFB 2XG5A 4N1CA 1YJDH 1NBZA 1K4DA 2RHEA 5IBUB 4KHXH 3P4LA 4I48A 2OSLA 3U36A 1FV1B 3L3KA 4JO2H 3WHE1 5EPMB 3MJ6A 2D03H 5IB5A 1G7QA 3KYNA 3L3HA 1JPST 1RZJH 5FA4A 5BW7C 2GIYA 2F8VA 4OGAD 4P3DA 4PJ7F 4Y4KC 2D7NA 4M02A 3VXSD 3O9WA 1Z2KA 2Z92A 4Y1AE 3ROOA 4ZFOA 4OLXL 5K93A 4YHKH 1CD1A 1RURH 3BXNA 5IB4A 4K3JL 2BRRL 4XP9L 1NC4D 2R29H 5HGAB 2BC4A 2BP3A 3QWOA 4DFHA 3RKPA 3BOVA 2AQ2A 2CRMA 2W59A 4XVUD 1G7PA 1TCRB 4PJEE 4RRPA 2C4XA 1MIML 4JR9H 8CGTA 1BVLB 5JHLL 1HSAB 4PGDB 5EOCJ 2RGSA 1M7DB 4JFEB 2NY6D 2X4OA 1NFDF 1WFTA 2DQEL 1A6UL 1CT8A 1L7TL 2FHCA 3TPKA 1S5IL 3EIFA 1MJUH 4LSTH 1WEJH 4YPGA 2F15A 4J3UA 4JGUA 4ONGL 5MEQA 4OZIF 4FNLH 5F9WC 3MGOB 3FQUB 1W8OA 4MNQA 4PGEA 1DVFC 5E9DE 1EEZA 1D5ZA 2NXZC 1IGYB 4QOKB 1SM3L 3IFLL 3MRJB 3LKPB 3SOBL 4PP2A 4NNPL 2BX5A 3VXMB 5ETUA 4WWKB 4YHOL 2I25N 4AMKH 4JAMB 3BP7B 3MXWH 4D94A 3CAFA 3GMMB 3J8F7 1F6LL 2DQEH 2B8OT 4L8SB 3HUJE 3ARDC 2JB6A 5I76A 4OQTH 2JCCE 3ECBB 4M7LL 5SWZD 1RJLB 3O6FC 2OTUA 4YBLC 5EU7E 2CK0H 4OZHE 3HMWL 4KHTL 3TV3H 3A6BH 3VXTB 2Y4SA 4HLZG 4KWUA 4PRAB 4YDVB 3P77A 1D5BA 4Y2DC 4OV6F 3IFLH 1MFBL 4P4KB 1C7TA 2FBJH 1BVLA 3SDXF 1HSAA 3EFFB 1MPAL 1AD0A 3MO1B 1JGLH 2X7LB 3RIAF 5GRVK 4X4MA 1SJVA 4JKPL 3N1FC 5E00B 3MGOA 2ZUVA 5JW4Q 4JGMA 3SDYL 4XCEB 2R0WH 3MA9H 1FHGA 1HHJA 3U9PL 1YEIL 1IGYA 4QOKA 5E8PA 5FB8B 3MRJA 2Z35B 1JI1A 1PW3A 3QIWB 3VWKD 2BCKA 1AY1H 5HDQH 5F9JB 3MOAL 1BD2B 1UQSA 4P5TD 2WWKT 4KKNA 4ODXB 5E6ZA 4PJDE 3KPRA 4FQJL 5FKPA 1UACL 3LQAH 4KK6D 2GITB 1N5YH 1J87A 3GMOB 4NC0B 3ZE0F 1A3QA 4F7EA 5BJTA 3H9HB 1DN0A 3ET9F 1NGXB 1EBPA 2D9QB 5E70A 3GNML 1CD9B 1NEZB 1R3JB 2DKSA 2XWJB 1INQA 1YNLH 3X12A 1VFAB 4L9DA 3WUWB 4NQCD 4C4KT 2AJ3A 4BZ1H 4Y5XA 1GPOH 3CK0H 4WI6A 2QSQA 5C08D 1BFTA 1DBKL 4XGZA 1KSRA 5ESAA 3W11C 1CFSB 3QUYB 1IQDB 2X7LA 35C8L 1OSZA 4FQJH 1S8DB 4ZPVB 1YPZA 4QCIA 4WU7B 3X3GL 3DYOA 3FRPG 4HQQL 3GBNH 3I3BA 2R0LH 4R96B 2WK2A 3GNMH 3PWLA 3SKUD 2HFEB 1GZPA 4LLYB 5I1AB 3MCKA 2WW8A 4J8RA 1ZOXA 2XFXB 4B41A 5FB8A 4Y16D 3DETC 4HZAA 1WC7A 3QIWA 4EQ2A 1MCWM 4AJ0A 4TVSa 3JV6B 4FQCL 4NUGL 4XPAH 4OGYL 1QLRA 2YMXH 2CJUL 3EJYC 5D7LD 1LEIA 4XP6L 1RZIA 2HT4D 1U58B 4Y0GA 4YHNA 4HQQH 5I16B 3MLSL 1NEZA 2NW2B 4IOIB 4HG4J 4WTWA 1J0ZA 3E8UL 1JZ8A 4N8VA 1FVDB 1U91B 3RWGB 4X83A 4YHIA 3OJMB 1KCLA 4YHPA 2H45A 4LSSL 3BUTA 3C8KB 1TJIL 3IFOB 2XIDA 1S3KL 4JKWA 4OGYH 1LK3H 3EYVA 1LDPL 5HHQB 1IQDA 5HD8D 3DI3B 4HKBB 4ZPVA 3V79C 4JJHA 4MCZB 4FTVD 3V5HA 5D70L 3MV9D 1LO3H 4Y5VB 1AGBB 3GIVB 3JTSB 4ZSOA 4RGND 5B38A 1T66D 4M00A 4R2GC 1MWAB 3OGCB 2FSEB 4PY8J 3MLSH 5FM5M 3HNVL 32C2B 5CGYD 3FFDB 4GS7C 4Z7UF 2B5IB 1CL7L 1BLNA 3G6AB 1RZKC 2VLJD 2VXUL 4OFIA 4OKDA 3MRIB 5GGVY 2KBGA 3RIFF 3JV6A 1KEML 3CVIH 4LSDA 4LSSH 5IKCB 5B8CA 3RUGF 1T2QH 1TJIH 2L4OA 4PS4L 3IFPB 4WI4A 4D2NA 1G7MA 1FGNH 5EBMB 4O4YH 1IAOB 4MX7B 3FT4B 4ISVB 4BFEA 5I8OL 1LDPH 3DGCR 4N90E 1IKNC 5EBLB 1RIHL 1G9MH 1DQJB 5IHBA 1VEPA 3IXTA 5D70H 5EC2A 1WCBB 5I16A 2X4QB 2NW2A 3IGAB 4TSCH 2GUOA 4PUBL 1A6TA 4F3FB 5ACZB 5I71B 4H0GA 4I4WA 1ZWIA 4MXWL 3VD4A 5A2KH 4MGXA 1WGOA 4HAFA 3VG0H 4MA3B 1TZHB 5GGSY 1K2DB 1LP9F 1ZT1B 3UJIH 5E5MA 1MIEH 2VDQL 1NCCL 2IANB 4TTGA 1ZTXL 5T1DH 3ZL4L 1YMMA 1G7JA 3T0EE 4L8CB 3DO7B 3HCVA 4MJ5A 5IW6B 3JXAA 2A6DB 2HT2D 2IH1A 3G04A 1QRNB 1A6PA 4KY1H 4Y5VA 1JPFB 2P24B 4XMKH 1MFNA 4ZNEE 4H1LA 1MFCH 1Q0YH 1Y0LA 3MLXH 4GG6F 2D0FA 3FFDA 5HHOA 4FXGA 1AE6L 1MLBA 1YQ2A 5TF0A 1S9XB 4I0PD 4NN5B 1BQLH 3V4UL 3GHEH 5I1GH 1ZXQA 3NCBB 1IC4L 3BP4A 1AFVH 1IAOA 3GKWL 2HRPH 3W0WB 4OCXL 4P9MH 1YNKL 3A67H 2R56H 1U3HD 4NRZB 2Y7QA 1PY9A 4HMEA 3IDXL 4CJ0A 4G6MH 1CE6B 1NFDE 5EN2B 4H26A 1U36A 3WXWH 2YD3A 1LO4L 2DQDL 1LWRA 3WFZA 1KB9J 1JWMB 5CJ8A 5DC0A 4YX2H 2QLVB 4J6RL 2H8PB 2W9EH 4P99A 4OZIE 4HS3B 1FFPA 5DQ9A 4FQQB 1N7ML 3U9UA 4QXWA 4LARH 3WLBA 3DO7A 3ZKMC 4PJCB 1S7RA 4KRLB 5ICXA 2W65B 4NDMA 1EUTA 1QRNA 4JRWA 4G5ZH 2H3NA 5F3BB 2UWEB 4NKDA 5KSAB 2P24A 3O6MH 3JWOL 3CMOL 1UB5B 4UIMA 4FA8A 3KPSE 2WIIB 3IDXH 3WFDH 4FP8H 5EIIA 2VTFA 2C3WA 4LKXB 5LGKA 3JV4B 3GGWB 3PV6B 4OAWA 2E6JA 5I73B 4AY0A 1S9XA 1G6RB 3RVTC 4KVCH 2DQDH 1OTTC 4J6RH 2BNQE 5DD1H 4EDWH 2DQFB 5A2LH 2BHYA 3D6GA 2BVQA 1D6EA 1GGYA 1N7MH 3W0WA 3O2DA 2VXQH 4JFDD 2DDQL 4M62L 3L1OL 4JFPA 3OKDA 1FG2B 1HXYA 3O45A 5BV7L 3MBXH 5INCA 3SDXE 1PG7H 4HIJB 5JOFB 3LKOB 4HWZB 1FFRA 1OW0C 3KPNB 5F7FA 1PG7W 5K9KB 3C87A 3IJSB 3UJJL 1OB1A 3D2UD 2DTML 4JRYD 5J9PB 2F19H 5E8DL 5J12C 5F6IB 3VU2A 3VJ6B 3PXHA 3UYOD 3VXNB 2AGJL 4GXUN 3R4DA 1GVIA 3FAWA 3FMGL 2DBJA 1F6AA 4ELMA 2UWEA 5KSAA 2YBRB 5GGQH 4OV5A 2ZG3A 5SWSD 2W60A 3QZWG 5ENWB 4G6JH 2BRQA 3LHPL 2WIIA 1KXTB 2R1WA 1AKJA 4HPOH 4JN1L 4TN9A 1QBML 2W9DL 4WU5B 4XZUA 2YD2A 1IC5L 4QXGH 3T0AA 1G6RA 2VC2L 3U4BH 4NFDA 1MY5A 4P57A 1XR9B 5I0ZA 5DK0B 1KCVL 1AXSA 2X70A 3LN5B 4TPRL 4LSQL 2A38A 4OF5A 2OL3B 4GW4B 4IRJA 2ERJB 5FM4A 4PJ7A 5IW1A 5JPMA 5FDWB 1GGIL 4HWBH 1ND0B 4KJPD 4X6BB 3LHPH 1T0PB 1T2JA 5F9DC 3WS6C 3GRWA 3PL6D 4JHWL 5F9OL 4C56A 1S9VB 4JN1H 2XTJC 3MLYL 1QBMH 4S0SD 1MSPA 1Z9OA 4Y4FB 4G8FA 2C1OA 1U8IA 5IFJA 4G42B 4FQIL 5EULV 2VLLB 4Q0XH 1TNMA 2SEBA 5BS0B 1IGMH 4WO4D 4XVSL 5DLMH 3VJ6A 5D6DA 4KJWC 1DLFH 2ADJA 4YHLL 3RX7A 2APWA 2P1YA 3PQYA 1FC1A 4NWUH 4WJ5B 5KSBF 2FX9H 1F4YL 4UT7L 4HHAB 2IH3B 1KTRL 3BEVA 4K8RD 5KJRL 3CFEA 4MDJA 1GGIH 2PW1B 4LLQA 4OB5H 4YXHL 4KQ3L 2BHZA 2OR8A 2ZCLL 43C9B 1T0NB 5F9OH 3QDJB 4Z7VF 2A6IB 3ARBC 1OAQH 4OFPA 5T1LA 4G3YL 1D3CA 3SCMB 3CSYA 4XVSH 1FC2D 5DJZB 4LCYA 2J4WL 2VXSL 4YHLH 4R4FH 4JKKA 3OG4B 4OCMC 2NY5L 3BKML 3DMMB 3O9WC 1XH3A 4KQ4H 3SE3A 4M7ZB 5C0JB 1F4YH 1BZ7B 2QHRH 2WANA 4TSAH 4HX1B 3RGVB 5FO9A 5GSRB 3ZHKA 1IARB 4W70A 3RGHA 5ANME 1C12A 1M1SA 1CICD 5I1JH 5C0AB 1FL6B 3BFOA 4G42A 5KAQF 3EJJX 1SJHA 5LWYH 2PYEB 1QSFA 4G3YH 3MRQB 1N8ZA 5C0CA 5FUOH 1Z6JT 4Z7UE 3L6FB 4X5LA 2BVPB 4TUOA 4WJ5A 1AXTL 3BGFC 3VXUB 4I0KA 4HHAA 5KSVA 4I77L 4D8PA 2HKHH 1JPGB 3RUGE 3SJVB 1BEYL 3MLVH 1NC2B 1RFDL 3KYKL 4K7FB 2X9YA 1A3LH 4ZUSB 3ARYA 5AEAA 5HHVL 2Y06L 1X5GA 1MQKL 1TIUA 3D0VB 4YQXL 1ORSA 4U1LA 2HVJB 4GUPA 3SCMA 2OL3H 3GJFK 3STLA 1A14H 2NZ9C 3OXRB 5SWZE 4PRPB 1XGTA 3V0WH 2VQTA 1Q72L 2MPAL 1VADB 5DHVA 1I7TA 4ONHA 1R3IL 3T4YB 3S34L 3FFCD 4Q6YA 3ZYJA 5HPMB 4CJ1A 3DMMA 4M6ML 5C0JA 4M1DL 1MHCA 3RA7H 3B2UD 1V3JA 1PKQE 3RTQA 4JM2B 3RGVA 4HUNB 1YECL 1P84J 2ICWI 5HHMB 1BEYH 3QPQC 1IKFH 4HGWA 1WTGT 2ITDA 2FIKB 5J11C 4DTGH 1A1NA 3BPOB 1P7QD 2HWZL 1RZ7L 3BW9B 5DJ6B 1ZGLB 4GG6E 5GGRB 5GS0C 3SHSA 2FATL 3BPNB 3OJDB 4XMLH 3PWVB 4DAGH 1U8MB 1AQDA 2DQJL 4GRWH 2VITB 5TQ2L 1KELL 3HB3C 4TNWK 5AAWA 3W9EA 4FXKB 3TBWB 5HYJD 2Q7NA 1F02I 5L2KD 4M6NL 5BVJA 1OGAB 3WNLA 2XNAA 3L95A 3MJ7A 4KGJA 1XIWB 2Z31D 1QD0A 4ODSH 1AC6A 3MLTA 1DBJH 5L88H 4MCYB 1FNFA 1O0VA 4NNXA 3EUUA 3PWJB 5C9JA 2R4SL 2X4TA 1U6AL 4NQCE 1ORQB 1MJJA 5IF0A 1E6OL 2HTLC 3Q5TA 3SDCD 1OTSD 3MV8B 3VXSA 3VRJB 3TCLB 5C08E 1A47A 2AJZA 2YUWA 1QOKA 2NR6C 2H1PH 4JEGB 4XBGA 1BIIA 4EEEA 4L3EB 3RL2A 1MCQA 2XRAL 1H8SA 3BW9A 4CW1A 2HMIC 5D1XB 5D2LE 4NZRH 3QG6A 4S1SL 1C5BL 4NO3B 3B2VL 1UWXH 1I8MB 4FQXA 2R4SH 4LQ1A 1I9JL 4QRUA 1U6AH 2BOBB 1GJIA 1QSED 4LGSB 2EYSA 5ILTH 2P5EA 2W0FA 4YDJB 4KTDL 1E6OH 1UZ6F 3UDWA 4AIXA 4POZD 4N0FB 5AD0A 2GTWA 1OSPL 3U83A 5D7LE 1B3JA 3WIHH 3OL2A 2R9HC 4QO1A 4G7YH 5F1IB 2QADD 2Q20A 4WUUB 5CCKH 1KT2B 5KZCD 2MJWA 4GAGL 3NA4A 5CEYA 5GRXG 1F11A 5HGHB 1LEKB 2FD6H 4DN4H 3ZSSA 4DKFL 4UIKH 1NCDL 5E4EB 2Q8BL 2F54B 3ILPB 1A6AB 4KTDH 5KVGL 4HGMA 2IMNA 3FTGA 5C0FA 3MRRB 1GZQB 2H26B 1W72A 5DC9B 3MLRH 5JXAH 2LV4A 3MV9E 4HMDA 4CNIA 5EUKA 1KF9B 4RGNE 2Q76B 1ULVA 4YAQB 2C7UA 1LP9A 4UU9A 1YYMH 5FUZL 3QCVL 1I8MA 4GAGH 5D9SA 1FNEA 3BPCA 4P2RD 3QQ9C 3HNSL 2CRZA 4NQEB 4S0TD 2EDYA 2VLJE 1F90L 3MGTB 1JNLL 1RUPH 2ZUXA 4ODWB 3U2SA 3PDOA 5E0QA 4YFDB 1RZGA 4HFWA 4P23D 1NCTA 3D69B 3MRBA 5F1IA 2Y23A 3L9RB 2PW2A 3AS2A 4PJHB 3ULVD 1Y18A 1KT2A 3V7AG 3RVXD 3QT2A 3QEHB 1BZQK 5B8CC 4FN0A 1UKSA 1MY7A 1KTLA 3SGKA 5ISZB 2VKXA 4N0YL 4P5TA 1FL5B 5I18L 1D9KB 2Q87A 3UAJD 4TUJA 4XXCA 3STBA 4DK3A 3NCEB 3QYCA 5EU3B 5FGSA 1A6AA 2P46B 5FECA 5C0BD 1JNLH 1WFNA 3S98A 1UM6L 4XH2A 3TVMD 1UWEL 1FPTL 3KLAB 2QBWA 4P2QE 5FDYA 3UCRA 3HPJB 3ARQA 3MRRA 1JHKL 2V5RA 3QNYB 5KSBE 5J4MA 5T3ZE 4LLDB 5LCVH 2ZWLT 4FQLL 2GSIA 4ZYKA 2IWGA 1MHHA 2ZOKA 1G7IA 1T5XA 1ZA3B 5ALBL 4NWTL 4ZFFB 1I3UA 3LB6C 5IVNA 3GSWB 2WSKA 3BAEL 3QJHA 4M9OA 2J6EL 5C07D 1CU4H 2AK4A 3QUMB 4NQEA 1RZKL 3DVGA 4HJJH 3MV01 2G5BB 2V6HA 4GAJH 3DIFA 2ZCKH 1YY9D 4XXDA 1EX0A 1FPTH 2VISA 4AEIH 4HK0A 3BN3B 2M1KA 1GC1H 4WDIB 5J1SC 5E94B 3UPAA 2EE3A 5FCUH 2WBJB 1A1OA 3BYTA 1HKLL 2VAJA 3QEHA 1ZVHA 3EOYG 4NHCH 4NWTH 4WHYG 5CKAA 1YN6A 3BAEH 4UT9L 5JA9A 5BQ7A 3VFNA 4OLZL 1JHLH 3U4EB 4YDKH 5DMYA 3BHBA 1D5XB 5T1MA 4S1RL 4LHUG 2ED9A 2ESVD 3WMSA 2XV6B 4N8CH 4WTZG 4EXPX 3OKOA 4IIQA 4WW2A 2HJKA 3WJLC 4PJAF 4HIHA 5CWSA 3QUXD 1YMHB 3RWIB 4R7DB 3DARA 2Z93A 2X4RA 4NUJB 3CJJA 4URTB 4A6YL 1PGRB 1CVSC 3T77B 3HRZB 2NLJB 3ZKXC 1GIGH 4FMFA 4UT9H 3IS1X 1L6XA 4AEHL 3O3DA 4D9LH 4AEEA 4OT1H 3WD5H 2RCSH 1RU9L 5I17B 2IG2H 5ABDE 5DMIL 5J12B 3RP1A 3E6FB 5IVZB 2WBJA 2B20A 2JIXB 1KCUH 3EKCA 2KPNA 1J0YA 2FECI 3LH2L 2BNRA 2F5AL 4H5SB 1JV5A 1IM9D 1NEUA 1DFBH 3KXFB 3RDTA 3NZ8B 1FFOB 4JREC 4MXVF 4ZS7H 1NMBL 4Q9RL 2AJVH 4AEHH 3RPIB 4JKLA 1XGUA 1OD9A 3VW3L 5CD3B 3EO0A 3QXDA 3ZDXF 5K9OA 2GY7B 3HTLX 4LOUC 4BZYA 4M1CD 3TP4A 1IM3B 1YUHB 5CSGA 1SJEB 4PJ9D 4D9QD 5C3TA 4NUJA 2AP2A 2I24N 4OF6A 2DIJA 3QUMH 1U93A 5IB1B 1RIVL 2X4PB 4K2UL 4M6OH 1LO5A 2NY4C 4HS6B 4APQA 2MQCA 4IDJH 3O4LD 1TTUA 3EO9L 4OCLC 3VI4E 3IYLW 3MLWL 1HILB 3C08L 5DT1L 1EHAA 1MCFA 1OWWA 5D93B 4MAYD 4X4XB 1F4HA 3Q3GA 3NIFF 4QNPF 3T0EC 5FV2A 1NAMB 2FYYB 4M7KH 5DSCB 2HRLA 4BFBD 1HXMA 3GK8H 2E7CA 3BP6A 4N68A 2IPTL 4OZGF 3ULVF 4R7NB 3DUSB 3CZFB 4W68A 3HN3A 4IRJC 4TULL 5HVWA 3KXFA 4MJ2A 1FFOA 2Z8SA 3S36H 4CVXB 4NO5B 2HVKA 4JO3L 2VQUA 1C16A 5IMMA 1U3HA 2WP3T 1MHEA 5DT1H 1T5WA 2DQUL 1W8NA 4MSWA 2HKFL 1HI6B 5B39B 3O3EB 1ZLSH 5JPNA 1UZ6E 4Z78A 4U1SB 2Z0BA 4EZMA 2AEPL 2GAZB 3B5GA 1CDGA 2H6PA 2J8UB 1VENA 2IPTH 5D6DC 1JN6A 2OI9C 4M93C 1MCSA 3QEQB 5DZLA 4HUUB 3KYOA 1DDHB 4AT6B 3PWPD 2IADA 1GHFL 1TZGH 4JO3H 4PTUB 2WLZA 2V2WB 3HC4H 4NZUL 3U46B 4B53A 1ADQA 1E0OB 5CZXD 2DQUH 1P9MA 4X4XA 4MJIE 5F7HA 4C57C 1Z3GH 3ULSA 2DQTL 2PXYD 2Y07L 3BP5A 4ZDHA 2BY0A 1KPUB 2QQQA 3HE7B 3RJQB 1AO7E 3HG1A 2IQ9H 1RJCA 1CG9B 4NKMA 5DFVC 1RZ8B 3RX8A 43CAB 3FL7A 4RMTA 1JUFB 3K2UH 3LEVL 5J3HD 3OHXA 1T4KB 4EUPB 4JFDA 3P0YH 3BKYL 3MRLA 1AGFB 3MODH 1CE1H 3FT3A 3N9GL 1OOAA 2FEDC 3GIZL 4H88H 3BZEB 1HI6A 3MRMA 3BN9C 1WLHA 4XNYL 1H5BB 4Y19E 3WFBH 3FOMA 3UBXB 3BDYH 2Y07H 4XMPL 5IIEA 4JRYA 2ICEA 3QEQA 4PY8I 4G8IB 4MLSA 4HKJA 1AJ7L 4FZ8H 3HE6D 1T1WA 3G5YA 3D85A 4L29A 3VFMA 3CXHJ 2CLRA 1A4KA 4N5EC 3U46A 3JWDC 3KPQB 5T3XH 5HYQA 3HI1A 3CVHL 1R5VB 2JJWA 4KVNL 3NH7L 3TH2T 3FFCE 2AI0H 4E42A 1NGPL 4XNYH 4P48A 1UZ8A 3IF1B 1TQBC 3V52L 5LXGH 3BQUA 3KPTA 3K74B 1NAKL 3EOAB 1MH5B 1RZ8A 5HY9B 3NACL 5TDPA 1XGPB 2APBA 1JUFA 2IALA 4X99A 4LPTA 3P4NA 3SE9L 1NCAL 3L5WB 2PCPB 3EYFB 1CD0A 5KS9B 1SEBA 3VMPA 1ZHLA 3P9WB 2C3VA 2OK0L 3RTQC 4PRIB 3C60D 3NCJH 1FBIL 3S5LG 4RZCA 1RK1B 5HDBE 4J3VA 5I2IB 5ICZB 3RVUD 4S1QH 3NH7H 5DJ2B 5C09B 4PRHA 1A7QH 1NGPH 3LRSB 1KCSH 5IUSA 1DP0A 4LHUD 4XB8A 3VRLF 5I1DA 2VDKH 1CYGA 2NXYB 5DRXA 2EDLA 5HYJE 5LGJB 2FWOA 3LAFA 4GMSL 5HGGS 4PLNC 4G8IA 3BJLA 2GT9B 3NACH 4PJGB 3PJSA 2WUCH 3HPLA 1HHGA 3VXRE 1F3JB 4LSRH 1AGCA 2XZQL 1IAKB 1NCAH 4G6FB 3IAQA 5SV3A 1A6ZB 4YEEA 4K7PY 3QPXH 1FBIH 2KDGA 2YD1A 4OF8A 3NA9L 4YZFF 5A3ID 4Y1AB 4RMSA 3QHZH 4L4TD 4DVRL 1ZA6A 1LO0H 5DK3A 1N0XL 2AJUL 4V2BA 1I3GL 5L2JB 5D5MA 4EUPH 5I30L 3MYJB 3L7FA 4NQXB 1QO3A 3GI9L 5CP7A 4HEME 4K3HA 4IRSA 3GSRB 4TVPH 5F1SA 4OGAC 1WBXB 4PJEB 1H15B 4LNVA 5GS0L 1WZKA 4YIQA 2VDMH 3GSNH 5JQ6H 5JXED 3QAZC 5HHXH 5E8OB 1CFTA 5I2IA 1CXLA 4XB7A 4NJ9L 3UTSD 3W82A 1ITBB 1QSEE 4K7PL 4KTEL 1CICA 3QXAB 1AGDB 2AJUH 5LGJA 4KK5D 5ERWA 1TJGH 1I3GH 5GISL 2YD4A 1I8LA 3U0TA 4GKOA 1J5OL 5E9DB 4PJGA 3R0NA 3QFJE 2X2YA 1A4JA 1F3JA 4NOFA 3GDBA 2FJHA 3FZUD 5FA3A 3SKNB 2OX5A 4EBQL 3QRGL 4U33A 4QXUL 1P4BL 5EWIH 2CDGB 3UDWC 3OKYA 4CGTA 2J12B 3B8YA 4LHQB 1MUJA 2F74A 4NHUA 1JGVL 4MXVE 1N2RB 2HG5A 3HUJB 4KPHH 1T7VA 2JCCB 1BM3L 1YN7B 4KTEH 5ALCH 4F7MA 3N1PC 1FE8H 3M1BA 1FYTD 3ZDXE 4CN1A 4OZHB 3CU7A 1CFNB 5C92A 3OAUL 4GT7A 5GISH 4HUVB 3GMQB 1J5OH 5D7SH 3GSRA 5EU6D 1R5IB 1JNHA 1R3KB 1B0RB 1IILE 4R8WL 2OXGA 4OIAA 5IV2A 3VG9B 3LCYA 1OY3B 1KNOB 1ZHNB 3VFUB 1DL7H 2DQHH 3C5ZA 1K3IA 4LCUB 2FJGB 1KGCE 3OKEA 1UYWH 4UDTA 3SPVA 3WFHA 5AYUH 4G8GA 3H3PH 5DK2B 1ZT7B 1I4FB 1JGVH 1YEEL 5DRZA 3EGSA 2C9AA 1ZVSA 2QQLH 4LLMB 2HA1A 3ZT6A 5E6IB 1U2HA 1D5IH 1P2CA 2ARWA 4U1NB 4QNPE 3OAUH 4HDIB 1BVZA 2I5YL 1IBGH 4Z95H 2ADGB 5JO5B 1NDGB 4OZGE 3BDXA 4UT6H 1BJ1J 4ZOBA 3VA6A 4PV8A 2YD6A 3WKNA 3O3AB 4OQ1A 1G7LA 4GQ9H 5FYJE 1JNNL 2FLBT 4GW1B 5KVFH 4JFOA 4LGPB 1E6JL 4GAYB 1OLLA 4WI5A 1FG9C 3LPWA 3SGKC 3UXFA 4P5TC 3V5DB 5IG7A 4MZ2A 1H3WM 1OAKL 3HC0A 4XXCC 2HFGH 2Q7YA 1ZHNA 4IOFD 1I1YB 2WUBH 1HZHH 3ARXA 5C07E 2GSGA 3L7EB 1INDH 3I3EA 5E2VL 4WFFE 3RNQB 3ARZA 3I6GB 3LQMA 3BRGC 4M48H 4DOHE 1OAUL 4HD9A 1N5AA 4PRDA 2AXGA 3I6KB 4JFXA 4LPXA 1CLOH 2V9RA 3TT3H 1LE5B 1VGKA 1NLDH 3SQOH 1NDGA 1VGEL 1A6WL 4I0CC 2DOCA 5ECJE 1DUZB 2CMRL 3VMNA 4NO0D 4JQXC 1WAAE 4PJDA 3W39B 3TC9A 2AK1H 3LS4H 1B6DA 1J0JA 5DJDB 3QXTA 3QIUB 3NCMA 3OKKB 2P8PB 3DV4A 3PXJA 4JFYB 1A5FH 4OFYA 2ESVE 4Y16C 4P4RB 5FHBH 2NY2B 1QFWH 2LTQC 3R8BB 3D18B 1KULA 2EIZA 2APXA 2XN9A 3MPCA 2V9TA 2CDFB 1BQUA 3MJ9A 2FB4L 5BCAA 2NY7H 4GH7B 2HT4C 4OIIL 4XCYA 1I1YA 1X5LA 4IIQC 4WW2C 1ODAA 5HHNB 1RIUL 2ATKA 3PV7A 4UV7H 3CPLA 4LLUA 5IMOA 2PN5A 1LD9A 4R6UA 4Z0XA 3A6CH 3HS0B 4JFHD 5I6XC 4FS0A 5GRWA 1AI1L 4XRCA 5A2IH 1UJ3B 5TDNB 1MCLA 4YC2C 3CC5A 4GSDL 2X1XR 3QG7L 1GSMA 2G60H 5CILL 4G7VL 5HD8C 5JQHC 5I66B 5JW5A 4DN3L 4P2RA 1DUZA 4EI5A 3MTRA 4YR6A 4HEPG 1YEJL 4HIXL 4OIIH 3H9SA 1AGEB 4RGNC 1C08B 3WN5A 3IFNL 4LLWA 4JPKL 4EDXB 5IFAH 5GIRA 1BOYA 4G9DA 3GMLB 2VWEC 3MXVL 1IZJA 3ZDYF 4KRPD 5IESH 2YD8A 2QL1A 4FFZL 1EUUA 5DEFB 4GSDH 3P73A 5CMAA 3RDTC 5TE4L 3RPKA 3VRLE 2O93L 1E4KC 1ZS8A 3K1KC 3T0EB 2YEZA 1OT2A 1YEJH 1BHGA 1IAMA 4HIXH 3S6CA 2H9GA 5ESVB 5HHNA 1CDHA 1OAXL 3IFNH 2XA3A 2DI7A 4OD2B 4Y8AA 3FQTA 3WBDA 3MXVH 4YLQT 1UJ3A 3S96B 1DEDA 4NKQB 5AZEL 4FFZH 3QRFM 3X14B 5EO0B 2VZOA 5I66A 4TRPH 2HT2C 5DUBA 3KYMA 2FZ3B 3S35H 1Q9LA 5FYLL 1AGEA 3O2DL 3PWNB 2UZIL 4LCCC 4OZ4A 2XKNA 3GMLA 4PY7A 3MJ8A 3U7WL 5D7JD 3IKCB 4I0PC 3FB6B 3NVQA 3ALXA 4FFYH 5CEXA 3WLWD 4NN6C 1NFDB 3VGBA 4N9GB 4UNUA 4OJFL 3NAAL 4NPYA 3C9NB 5DEFA 4O9HH 4R3SA 2LE9A 3BYYA 1KPVB 4UQ3B 1Q94A 2NQCA 2W92A 3CGTA 3E3QE 4ZUWA 4OZIB 2P8MB 3O2WL 3N1GC 3CFKB 1HINL 1FGVL 1U3HC 2VAAB 3HZVB 4AYFA 1N4XL 4ODVL 3HC3L 3ZZ1A 2HLAA 3F7VB 3HKFA 3PWPE 3KPSB 1JK8A 4LAQH 5KW9L 1EJ6A 1P4LB 25C8H 4JY6A 5IP4A 4JFFD 4GKNB 5CJXC 2UVEA 1G6RL 3CFIC 2QKIB 1EGJH 5BRZA 1IC1A 1UWXK 2CIKB 2BNQB 3IETB 4F15B 1HDMB 1QFWM 5C9KA 1YDPA 5D1QA 4ZXBA 4C55A 2V5YA 1HINH 4ZO6A 2BDNL 4DGVH 1P9MC 2ZOLA 1X5HA 5KG9B 1MFEL 5CHNB 1I3RB 5DJXA 5T5FH 1B4RA 3QDME 1J10A 1ZGLP 3V7AE 3SDXB 4U7SA 5E2TL 5I19H 1NUGA 3GRWL 5E8EB 1MF2L 5IQ7L 4CMHC 1EAPA 5FV1L 1EZVY 3QUKB 1JI2A 1CGYA 2YPLE 5IEKB 5IJVB 3F58L 3IJYA 2H32A 1DE4B 4UMGA 2BERA 4XCNB 3VI3E 3TPUA 5T5NG 2BZDA 3SDDD 3BGMA 2YPVL 1TQBB 1NSNL 1I1AD 5MENA 3GUTA 1JHTA 3F7VA 3RJDA 2IF7A 1MFEH 2NXZD 3C5SB 4BQ8A 5FF6B 3MFFA 4TUKH 5DUPH 1P4LA 5EB9A 3L3IB 5JHDA 1MF2H 3TF7C 3NPZB 5IQ7H 2ICCA 5JR1H 3ARDD 1MREL 1JGUL 3IETA 2CUMA 4OD3L 1NL0H 3O4LA 4PJ5E 5DFWH 2FGZA 4H8WL 1BGXH 3N1MC 5DQDH 4KZDL 1PY4A 4DZBB 3IDMB 1GGUA 4WHCA 1EXUB 1NSNH 4L8DB 4X6EA 1I3RA 4MAYA 4Y2DD 3GO1H 4MD4A 4RWYH 1HKFA 1RUQH 1VACA 3O8XB 4Q6IB 5IJVA 2RBLA 4QHLB 4XNQA 4XTRC 5J89A 2R4RL 4YHZH 1EVTC 3O6KL 1YEHL 1U8LB 4P9HL 4DEPC 1U8HB 4CN6A 4KJPC 2DM3A 5DI8A 4DQOH 5IW3A 2EKSB 2E9JA 3B9KD 4OSUH 3WKML 4P2OB 1KB5B 4JFZH 2X4SB 3PL6C 2CKNA 3C5SA 3J7HA 3KLDA 4Z7WA 4BK4A 1MAML 3PHOB 4ERSH 1EV2E 5DURB 3JWDL 3MBED 4F8TA 4U2YA 2CIIB 4WO4C 2VMFA 1EHLL 2R2EB 1IEBB 2ZG2A 2IQAB 4L4TE 2B4CL 3TJEL 2YC1B 3WNKA 3HI5H 2N1KA 5DFTA 2AJSL 2YSSB 2XOTA 2EKJA 1LVEA 5H37G 1YEHH 4HSQA 2LAAA 4M9PA 3TO2A 3TN0D 4R4ND 3WIIL 2YK1H 3S4SG 3ZT5A 5I1LB 2ZG1A 4D0CB 3ZKND 4L3CB 3I6LD 4ZTPL 2IFFL 2QQNL 4HIIB 4JG0L 1N59A 2NY6B 2BY2A 1R3LA 1BQHA 5ANMB 1KIUA 2IPKA 3QFDA 3MA7B 4YDIL 4IRSC 4JPWL 1MJ8L 3KAAA 2OQJB 3M8OH 4PGCA 4NQDD 4PREB 1LK2A 4F9LA 4Z7UB 1T1XB 4GBXB 5DHVH 2DKMA 4P2OA 1BBDH 4NC1C 3EZ8A 5GS1A 2A83A 2R15A 3RUGB 4MD0B 1CICC 1OAZL 3LEXA 4WNQA 1G84A 2QQNH 2XQBH 4LQFH 3OX8B 4K7PX 4L4VE 4LVOC 4ONFH 2R2EA 3TFKD 1I8LC 5GGRY 2A6JB 2IQAA 4M4RA 2IAMD 3H3KA 2FLRT 3TZVA 4F80A 2YC1A 4ODTH 4QRQA 1ED3B 3ZDYE 3B9EA 5SWZB 3HE6A 3UTQB 5MEPA 3D9AL 5FKAB 3LN4A 4QTIL 2E27H 3MRDB 5SX5H 3QEUB 1J1PH 2OR9H 1I7UB 4YHYB 5CZVL 4GRWF 3BVNB 5EU6E 1XCQB 3RHWK 4UV4L 1PKQB 5DA4A 3CDFA 5GXBB 4PG2A 1D5MB 4U0RC 9CGTA 4JVWA 3VFRB 4LPWA 1P7KA 4LSVL 4ZOCA 3THMH 5DMKA 3UJTL 1QBLH 4K23L 1QUNA 3I9GL 2VDPL 1UWGH 5IOPA 5KTEL 2D31B 4GG6B 4M5ZH 1IFHL 1SEQH 2MSPA 4ACPA 3FB7B 3D9AH 4QRPA 4QTIH 1KB5H 3WO3B 1T1XA 3B2UC 4GBXA 1ZHBB 1F4WL 4UTBL 2CQVA 1IVLA 4X6CA 3BH9A 1PLGH 5B21A 4V1DE 2VL5B 3VWKB 4PJ8D 1FL3B 1RUML 3ETBF 4UV4H 3OKLB 4L4JA 1PQZA 2VABA 1BFOB 1CK0H 2EXYC 1HEZB 2X41A 3FOLB 5DS8A 3PNWB 3B8SA 1QPPA 4OF0A 2R0KH 1RULL 2GEEA 1EO7A 3EOBA 1BJ8A 2D4FA 2R2BB 3IU4L 2VDPH 3MRPA 5D7IA 4WEMB 1IFHH 4OLEA 1T7WA 3KPPB 4UAOB 5CP3H 1MI5D 2DLIA 2QQKH 1A2YB 2Y36L 4U7KA 1CWVA 4NQCB 4OGXL 3MQIA 5FIEA 1EHXA 4UTBH 2HH0H 2VLRD 3ULUL 2Q6WA 3DVFA 3KWWA 4OZFB 3SDAB 4AM0A 2NW3B 2F58L 2BFVH 4EKXA 5C08B 2R23B 1T1YA 3VFRA 2Z31C 4AH2B 1X7QA 5EZJB 5A1AA 1CLCA 1W72L 1PX4A 1A7OH 4LKCA 4J1UB 3BUYB 2MNUA 5D2LB 2G2RB 4IRZH 3Q6FB 4ENED 4HBQA 4GRLB 1CLYH 5M7QA 3SDCC 3HR5A 4L9LB 1H8OA 4WFGE 1DLHB 3NZHH 3B9VA 3ILQD 5EFIA 2VSDA 3U6RB 4OGXH 2CKBB 4Y16B 4YUEH 1Q38A 1FL3A 1NCWH 3RI5K 4HBCL 3PGFH 1K6QH 2VB5A 3DSFL 3F12A 3OZ9H 5D7LB 3MRGB 5CJQH 3BZFB 3F7YB 1RUAH 1FZKA 3F6LA 2ZUQB 2R2BA 2XZAL 4LVNB 5F7MC 5F7NC 3V0AC 5D96B 3KPPA 3CSPA 1E4XL 4M1GL 3ZKQD 1XGQA 3ESUF 4ALAL 1ZSDB 4OLUL 2WWMC 1QRKA 2COQA 3C5JA 4YC2B 5JOEA 2XA8L 3VCLB 3C2AL 3SDAA 2OMBA 3O0RL 2EH8L 1B6UA 1J12A 4J23A 3MR9B 3DSFH 3IVKA 3ZKMD 1MCOH 4Z8FL 4MYWB 3SGDH 1FYTA 5LVEA 3TYFA 3MV9B 1B0GB 1NGYA 1J8HD 1VERA 1G9NC 1DQDL 4RGNB 2D7TL 1BVKB 4JFHE 1MCBA 2ATPB 3V6OE 4GRLA 4U6YB 2A0LD 3MMEB 2CXGA 4L9LA 2O61B 2WAHA 2YRPA 3QR2A 4S2SB 4GKSB 4KROC 4OFKA 4ZUTA 3BDBA 2GCYA 3HLAB 4XVJL 2VLJB 4JG1H 4E41D 2NX5D 4MWFA 2OTWB 4MD5B 1DQQB 2XA8H 4WGWB 3RX5A 1S7UB 3N85L 4MJ6B 3T3MF 3VFGL 5EUOE 4BFGA 1LGVA 3E2HC 5JORB 3BZFA 3LMJL 1Q9KB 4ZFGL 3DXAA 4LCIH 4YXLL 4U3XA 1YEDB 2VL4A 1DN2A 3BIKB 2H2PD 5L6YL 3CXDH 1NCNA 2X1OA 4ZQKB 2R2CA 3D25A 1EEUA 4LEXL 2DBLH 4ZNCD 4RFOH 7FABH 2Y5TB 3WN5C 3OKMA 2W91A 1DANT 4OZFH 2PETA 4Z18A 4ESKA 2F8XC 1K4CA 5GGSA 3VCLA 2VDOL 3NTCL 4LCWD 4XHJC 4Z77A 5CBAB 1U92A 5IGXH 1CGWA 5CAYB 1K8IA 4P2QB 3N85H 1VKXB 3ULVC 1FSKC 2BSTB 3RVXC 5KSBB 1H3XA 4TOYL 4NKOB 4LVHC 4WHTB 4LEOB 1JCKA 5JOPD 1BQSA 3LMJH 3TESA 4JO4L 1QA9A 4MQ7A 5J6GB 5EO1B 4LCCB 4U6YA 3FO1B 1U41A 5CINL 1Z5LA 1K5NB 1YA5A 3LQZA 1SY6H 1T21A 4RX4A 3QUZD 2WINB 3V2AR 2DQCH 5FK9B 3BGAA 1T6VN 1DQMH 5F7WC 1QSVA 2VJXA 2FX8H 2OTWA 2A6KA 1FN4B 3W5MA 5CIPB 3VXOB 1DEEA 3QDAA 2BSSA 1J1XH 2YXMA 5HJ3A 4XNZC 3IKKA 4F7PB 2QR0A 2GY5A 3O6LL 3T3PE 4N8VG 3W2DL 3FAXA 1HOCB 4U1JB 4Y4HA 1C1EL 5C70A 1K85A 3REVA 2EDTA 3OR7A 1UB6A 3BZ4B 1YY9C 5ICYA 1ZK9A 5E03A 2R1YA 1YYLL 4BELD 2DIBA 4JN2B 4LSPL 1JMZA 1X5KA 4KC3B 1BX2A 2VQ1B 5B38G 2G75B 2VIRB 2YXFA 3VDBA 3H9ZA 5HDLA 3RHWF 5F3HB 3VFVB 3BKJL 3TA3D 4NYLB 3VRIA 1BREA 3W2DH 4LK4A 1S7SA 2EXWC 1S7QA 1HHHB 2MFNA 5DWUL 3VA2C 1YEFL 1RVFL 4J3WA 1WQVT 1A3RL 4DWHA 3T2NH 3MV7D 3MLUH 1EO8H 5F70A 3QUXC 4R26L 1MCNA 4XPGL 2RQ8A 5T5NF 4F7PA 2YRZA 4FHBD 2JELL 4GRWE 4HUWA 4F58L 1XF3B 1JL8A 3T0VA 3I84A 2WWKO 4WCYH 1RJYA 1U8QA 1XGYH 1XR8B 4QRRA 4U1JA 1QLEL 4X0KB 5C0NC 5KVDH 2O5YL 1IAIL 3G6JA 1U8NA 5D1QC 3QWRD 4UNVA 3KPMA 1FIGH 1S5HB 3MCLH 4JFQB 3RRQA 5E2UL 1ZLUK 3GFUA 2K7QA 3D2UB 5J13B 3TBVA 4PJFA 3QI9A 5GRUL 3TO4B 1AD9A 3P4MB 4C4KO 4H1LG 4MNGE 1Q9WB 4R26H 4XPGH 4RNRB 4PJIF 1I8KB 2VH5L 4BH8B 1A7PH 1T0MA 2KQNA 5F3HA 3EDDA 4N0RA 3UYRL 3FCTA 1MHPL 2ICWA 4NYLA 1CBVH 1Y6NR 1V3MA 4JZNA 5JW4R 1SVCP 1AH1A 1CXHA 5BVPH 2O5YH 5LJYH 3H7LA 2NY1B 4I5BB 4MNQD 5JNYB 5J6HA 3M17A 4NKIL 5E2UH 2BSRA 1CQYA 2ARJA 4M1CC 4HCRH 4M5YH 1BFSA 3PABA 4RCAA 4CRPA 4QHNB 1GH7A 1ADQL 4L1HA 3PIQA 4DGYH 1NH6A 3RWFB 1X4ZA 1P53A 3CFCH 4LVEA 4R0LB 2V5MA 3GJEB 1NAML 4X0KA 3RZWA 3DOSA 3BWAA 5MI0B 2BOCB 3QDGE 4D0BB 4PJXA 1MAJA 3PL6B 4OLVH 4X98B 3ROLA 1T3FB 4OD1H 1IC7H 2RAMA 4JDVB 4JZJA 4NCC2 1EZVX 4U1IB 1B90A 3DRTB 4B50A 4NO2A 4MAYC 4Z5RA 1FVCA 2G9HB 1G7HA 4PIRF 4O51A 1QYGH 5GS0D 3VFOB 4K9EC 4IJ3C 5L0QC 4NT6A 4JFED 1ADQH 2BVUA 2YRLA 3HB3D 5F89A 1HSBB 1UT9A 3OG6B 1ACYH 3JSSA 5F72S 2P47B 1HHKA 4I5BA 5DVNA 1OCWL 4NGHH 3NFNA 4HGKC 5DTFA 5DJCA 1D6VL 1KLGA 3OKNB 4JY4B 4QOKD 1UM4H 2DN7A 2GJ6A 1ONQB 2DYPA 3E3QC 5AZ2H 2V7HA 3ARFB 5TFSL 1KN2L 4CN4A 2DD8L 4CADA 3NFPB 4JQIH 3VXMD 3QHFL 3KPRD 3GB7A 4MJIB 3V5KB 4JFFA 5EZOH 4BSVA 5C8JA 4E5XB 3I6LE 5F7KC 5MERA 1A64A 1FFQA 1BAFL 1T04B 4X98A 4EN3A 3EJZD 5D2NA 4G9FA 4PPTA 4NN7B 3GMPB 1WFUA 1REIA 1OCWH 4U1IA 5FO7A 3WJJA 1OPGL 4MJ4A 3CFBB 4DCQA 3P4OA 1OQXA 4LRIA 5DEGA 3JWNC 2NY3C 5E8NB 3NN8B 3TIDB 1I9IL 2I26N 4DKDC 4Y19B 4XPFL 1QBBA 3V7MA 3QO0A 5C7XH 3RZCB 1NLBH 1F4XH 3FB8B 4L3EE 5F7YC 2EE9A 1F2XK 4EVNB 1BAFH 4DW2L 4F9LC 5E5UB 3SDDA 3WXVL 5TPWH 5DO2D 2FDBP 1PSKH 2OXHA 3LKQB 5GS1C 2CH8A 2PYFA 4XP5H 2X5PA 3QIWD 1BD2D 4X9HA 5BZDB 4OIBA 2AV7B 4HC1A 3PGCA 1LO2L 3FFCB 5ID0A 3RWDB 4X5WA 3TZVC 4HUMB 1IL1B 1QFUH 2YUZA 1AO7A 1T22B 3HE6C 1R0AL 3QBTB 3H8NA 4LU5H 5KOMC 2UZYB 4JZOA 2GTZA 1S7XA 1ZT4B 5D8JL 4Q2ZB 4WW1A 3NGBB 1J11A 4YFLF 3HFML 3WXVH 4I2XE 4AL8H 3C8HA 4UTAL 5IM7A 2AKRB 4ZFZA 4JDZB 1HH9B 2OS7A 5E8NA 2W0KA 5EH1A 3RWEA 3T65B 2F54E 4ONOA 4Y19A 5FGBA 3QUYD 4ODHL 3HR6A 3QQ9D 5DHYB 3RY5A 1E4WL 3QJFB 4ZUUA 3MUGA 5J8OA 1OAYL 5HYJB 4FQHB 2ZCHL 3HZKB 3DURA 5EORL 1U8OB 4X5XB 3ZYZA 5IT2H 1KJ3H 1R0AH 3AREA 4RWHA 3WO4C 5L2KB 1NGQL 1I1FB 5D8JH 4LAJH 2Z31B 3FO0H 2FIRT 3B9KA 4YNYA 1WTLA 2VXVH 4UTAH 1R3HA 5BZDA 3F7PC 3OF6A 4U3CA 1MI5E 2VDNH 2F53A 3U1SL 3GJFB 2VO5A 3MBEA 4MDIB 1MJ7L 2VLRE 3I3DA 3SDCB 4ZO9A 2BNUA 4WI3A 4BH7B 4U1GB 1Z9MA 2FL5B 4OFVA 3LZFL 4UILH 3SE8H 2A1WL 2B2XL 2F5BL 1UM5L 2I9LB 4JB9H 4Q2ZA 5IQ9B 3TIEB 4R4BB 2GHWB 4XPBL 1KIRB 2ZUYA 1TVHB 1UCBH 4P5MB 3TN0A 5A3IC 1HH9A 4F7CB 2EDHA 3SBWA 2E8ZA 3L3OA 3CFJA 4JY5L 2C4FT 2JE8A 4HS8H 3UBXI 1QSEB 2C26A 2EEBA 4TSBL 4UB0H 3WHXB 3EO1A 3ZDZF 4YBHA 3VGDA 1VB9A 3VXRA 3QFJB 1HNGA 4KV5F 4NQDA 5JXEC 3LKRA 3JUZA 1KTDB 3CDCA 3QZWB 2QADB 4IEFB 5I8EA 5E08L 5I1CL 3KYAA 5KZCB 3SQBA 2A9ML 1BOGA 2IMMA 1MCKA 3QH3A 4JPIA 3LKNB 3VDCA 5C0EB 4PV9B 5ITBH 5A16A 1U8PB 3INUH 4N8PA 4RGMC 5ADOL 1M71A 1BZ9B 2EDRA 2OJEA 3OB0H 4NBZB 4O2EA 1H3PH 2VXTL 1E27B 3EOTL 5IQ9A 3AM8C 4Z7NF 4R4BA 4LBEA 2B1HL 1J8HE 1IRAY 4P5MA 4QY8A 4X8XA 4KGLA 4XC3H 2IAND 4OCWH 5E08H 3CH1B 5T33L 5I1CH 3SO3B 4BQCA 4HK3N 3F7QA 1AIFB 4PJBE 4LSUH 5TH2A 1DSFL 1QRND 2EC9T 2NX5E 2EO1A 1C5CL 1YPZF 3FKUS 3ZTJG 1U2CA 1TPXB 3ALWA 5CUSL 4K3EL 4XNXL 2O5ZL 3PDGA 4P23B 4UQ2B 5GZOD 5IMKB 4P49A 4ZOEA 4JM4H 3RWJA 4D9RE 2C1PB 2XKUA 4OZGB 4C58B 3SKMB 4LVHB 3MOBH 1VFBB 3GMNB 5K9JH 5GJSL 1T2XA 5FYLD 5HBBA 3TBTA 2NMSA 3W0WD 1KJ2A 1A21A 1CLZL 3MRCB 1KV3A 1ETZB 3SN6N 5DRWA 4RISL 1U8PA 4XP4L 3BMWA 1JRHH 3U30C 3TVMB 4MAUH 4OBSA 3C6LA 3FQXA 1AP2B 3LDBB 4PRNA 3VGAB 5CUSH 4XC1L 4O2CB 3RNKB 5CJ5A 3QNXB 4XNXH 2O5ZH 4WV1A 5GHWL 1YC8A 3V6FA 4LNRB 4O02L 5JOPE 3IDGB 5I74C 5IEHB 5F21B 2ADFL 5M95B 3GSXA 2UY7A 5H35B 3D3VA 1JGDB 4A2LA 3RY6C 1JYWA 1D7FA 4GJTB 5C07B 5EZIH 1JWSB 2DL2A 2FR4B 2I9TA 5KSAD 1Z9LA 2Q8AH 3TCXA 4YO0B 1BBJB 1YQVH 5JW4M 4XP4H 1I7ZB 4DOHB 5IK3B 4X7DC 1AKJD 2QEJA 1FYHB 3DTXB 4FABH 2VLKA 4IOFC 1A0QH 1FO0B 2GKIA 4HK3J 4P5KB 3PP4H 1S9YA 5EC1B 3VE0A 3HNTH 1G9NH 3Q6GH 4F7TB 3MJ9H 3JWOC 2YWZA 2MTPA 2YOCA 3BESR 4NP4H 3QULB 3UZQA 2XTJE 3TNMB 1ETZA 1O7SA 3FONA 4DUVA 1M6OB 4NQUA 3L5XL 4ORGB 5F88B 4Y4HC 4CMMB 2XG4A 1RD6A 5CD5C 2ESVB 4X7FC 2V7NA 4ELKB 4IMLB 5H2BA 4PRBB 2AJXH 3C6SA 4X9FA 3BI9X 4OGZA 5KVMC 1H3VA 3QUXB 3HAEA 1QFWI 2ENSA 3CLFH 1RMFH 4MA1B 1I1CA 3O2VH 2B0SL 5JUEL 3FRUB 5BV7C 5CKGA 4PGBA 1LEGA 4M8VA 4JANA 3OV6A 5E1AA 2FR4A 4U1HA 4Q9QL 3WNMA 4YO0A 4NQVA 4NM8L 5MHSD 1CDIA 2ZP0T 1X5YA 2R8SL 5T1KA 2WNGA 5EOTA 4UUJA 1XF2A 3P0GB 3ULVH 3AS0A 3H3BC 4J3SA 5I9QB 1CQKA 5DDHA 5T1LD 4E41A 1Q9OB 2EO9A 3I75A 3MNZB 2OZ4A 5KN5B 3I02B 3O4OB 3OAZH 5BO1L 1IM9B 5CLTA 1V8HA 3DUUB 1KIQB 4U6VL 4XBPA 3DRQA 1X4XA 2EDBA 4QGTA 2E7MA 4EQ3A 5ADPL 5CBEB 2RFXA 1P1ZB 4Q9QH 4CMMA 1YY8A 3O3UN 4ZAKB 2FEDD 5K33A 2AVGA 2PO6A 3SKJL 3VWJB 5EBGA 1HQ4B 3I85A 5IVXE 2X4NA 5SX5K 3CUPB 3I50H 4I3SL 1AHWA 4PJ9B 4X4ZA 1KBGL 5BS0D 1PD6A 4DK6A 4HIEA 1QSFD 1XZ0B 3FRUA 4EOWL 1IE5A 1UFUA 3L5IA 3OQ3B 3LS5L 5C0CD 4FFVC 4KRPC 1N6UA 5BO1H 2XWBA 4TVPE 2P5WA 1TQCB 3FN3A 4U6VH 1TZIB 5EO9B 4S1DD 1FO0H 1JZ5A 3FHQA 3JBG7 4WFED 2Z91A 3SKJH 3KPLB 1S7WA 4XAWL 3QDJD 3U79A 4P59H 3QUZA 1JBJA 3HA0A 2QJDA 4I3SH 5L0QB 4PTTB 1WBZA 4XWGL 2EH7L 3SCMD 1FVEA 5DZNA 2YA2A 2AXFB 2O5XH 2QSCL 1A7NH 2ZUTA 3DUUA 1NMCC 5E2JA 4BKLB 3DMMD 3IXAA 3G5XB 2YUXA 4OKVA 5TF1H 4QT5B 2GK0B 1NGWB 3I2CL 4X4YA 1CXEA 3RGVD 5DR5H 3LKSA 4QF1A 3VWJA 4BQ9A 2Z8WC 4X7CC 3LPFA 5F1NA 4JZJC 4G43B 2H41A 4DUWA 1TENA 1HHIA 4CVZB 4X4ME 2PYED 4HFUH 4NZTL 2NY5C 2YZ1A 3EBAA 5CJOL 4P46A 3RBSA 3ARGA 4X6DA 4KV5E 1HIMH 4ZPTA 2AAVA 1N0LA 4PG9A 1QZ1A 4OTXH 5GSVB 1INEH 1FQ9C 1EERB 3O41A 4KMQA 3VXUD 3PWPB 3WS3B 4ELMF 2UWEF 4DGIL 4WUKL 3QEGL 1TXKA 1OHQA 1T7ZA 4F2MA 1XGRB 2FJFA 3GSQA 4XCFH 2OP4L 2PXYB 3RFZC 1I7RB 2DQGL 1SVZA 4OUUB 3CCHA 3GSVB 3DSNA 1N64L 3TBYA 2H32H 3ZE2F 3FQRB 1EFXB 1QEWB 4HXAH 1UA6L 3MV7A 1MAKA 3STZA 3V4VH 4Z7NE 1SYVA 4G6AC 5F96L 3QIBA 4KJYB 4PR5B 2FCBA 3QDMB 2NCMA 3CVHA 1QVOA 4JO1H 3LSOB 4UDUA 4DVBA 4WEUD 5EZLB 5KSUB 4K9EL 3GBML 3PHQA 5HHMD 5CEZL 4R97B 4EN3C 5D2NC 4FG6C 2AJYL 2LABA 3QWRA 2YPLB 5D72L 2OP4H 5I1KL 4EI6B 4JRXA 1YPZE 5ITFA 2YZ8A 1MVUA 3AAZB 4PLOB 3WJJC 3MRFB 1CI5A 5FUCC 2P48B 4LRIC 3KS0H 3X11B 1JTPA 4N1HB 1MCWW 4O58L 3ZYIA 1FJ1B 3OXSA 1CFQB 4FQXD 4U6HA 5IMLB 3B9DA 4OLYL 2P5ED 1CN4A 2ZNXA 4UINL 4XNMB 5BXFB 2JK5B 5EDXA 3AUVA 3ZSTA 4K9EH 1HH6B 4OLXH 3LPGA 3VGFA 3SDDC 2AJYH 3MLPA 2XACC 3GSUB 2BRRH 4K3JH 3AU1B 4XP9H 5I1KH 1XIWD 4BQBA 1I1AC 4PJ5B 3FQRA 2HFFA 1EFXA 3SE4A 1QFPA 4O58H 3P40A 1RQ5A 1FV1A 5SWQB 2EEDA 5EPMA 3QDMA 5GS3A 1MIMH 4YPJA 5JHLH 3ULUD 3LSOA 4R90L 1NKRA 3MV8D 3C60B 1N26A 2NY0C 4UINH 5D1ZB 1A6UH 1L7TH 5KAQG 1S5IH 4UOJA 4ODBD 5INDB 3FO9B 1Q0XL 2YPLA 4ONGH 5HGAA 4KK8D 2KZWA 1FLRL 4LHUB 5DGRA 4ZSOE 1TCRA 2BY1A 1TJHL 3MRHB 1SM3H 4G8EB 1N6QL 5FGBC 1CFQA 4PGDA 3RL1B 1GGBL 5GS2D 3SOBH 4NNPH 1M7DA 4JFEA 3H7BB 5EOQL 4YHOH 2OJZL 3NPSB 5L9DL 4Z0BL 3VFTB 4OF3A 3BSZL 4KKBD 1II4E 2HP4A 2R0ZL 5C2BL 3LEYL 4LL9A 2X89A 1FZMB 3FQUA 3GSUA 4M7LH 4L4TB 3AGVA 2X42A 3IU3B 3B9KC 3HMWH 4KHTH 2FO4B 1TJHH 4M61B 3LKPA 4PGJA 5B4MD 3S3PA 3MBEC 1MFBH 1N6QH 2F8OA 4OF7A 2JKXA 3VXMA 4WWKA 1MPAH 3EYOB 3BP7A 4JAMA 3GMMA 4GRMB 5D1ZA 4L8SA 3X13B 3NIGF 1YMME 3ECBA 5J06A 4JKPH 3WCYA 3OWEA 1RJLA 4Z7QF 4XPTL 4RMRA 3SDYH 4YWGL 3UTTE 3WYRA 5HGBB 3TN0C 4R4NC 4U0QB 3VXTA 4LASL 4YDVA 4PRAA 3ZKNC 4KRMB 3U9PH 1YEIH 3SBWC 2ITCB 4GMTL 4P4KA 3T1FB 5HHOE 3EFFA 5DC4B 2AK4D 3MOAH 4NQED 4LP4A 3MO1A 1UACH 1W0WB 1EHNA 4L4VB 4D3CL 5E00A 12E8L 3B6SB 1DQLL 4JQVA 4XCEA 2CGRL 3VDAA 3IJHB 2UY6A 3JTTB 5FO8B 2GFBB 1FNGB 5E24E 2Z35A 2FO4A 5F9JA 1IGIL 4GMTH 1BD2A 2VR5A 5EU6B 4WHYH 4ODXA 1D9KD 2EYRB 3H0TB 3GMRB 1DBKH 3TFKC 8FABB 3VGEA 2IAMC 2PTTB 2W38A 1F5WA 2GITA 3GMOA 35C8H 4CL7A 1FZJB 5AAMA 3H9HA 1NGXA 5FYKL 3GHBL 3X3GH 1CVRA 5B22A 1ZKAA 1R3JA 2WP3O 3SKOB 2XWJA 1VFAA 3G08B 3WUWA 1QPXA 3FJTA 2FX7L 5F7EL 3DHJA 1Q1JL 5DD5L 1NJ9B 3U30B 3BKCL 4FQCH 1IGIH 4NUGH 5I1HL 4V1DB 5TGBB 1CFSA 3QUYA 2CJUH 1S9WB 4F37K 1S8DA 1N3NB 4HJ0D 1A22B 2YA0A 4WU7A 5IBTL 4XP6H 5FYLE 1NQBA 5HSFA 3TT1L 4R96A 4QKXB 1ES0B 3GHBH 2YD7A 4NNYB 2HFEA 5I1AA 4LLYA 1MFDL 2WBJD 2CPCA 2XFXA 1QFHA 3E8UH 5KANI 2BNRD 1NBVL 4PJ8C 4Q7DA 1BWMA 2DWDB 4Y5YB 1S3KH 3ZMRA 3RDTD 4FQ1L 3K3QA 1WITA 1ZE3C 1VFUA 3JVGC 5J1TC 3C6LC 1U58A 2P8LB 5BZWB 4AENB 1QKZL 4JPVL 1G6VK 4HH9B 5M94B 4YDLB 4Y8DC 3BIBX 4WV1C 5L7XL 4IOIA 1J8KA 2LVEA 3DX8B 4ELME 1UEMA 3Q5OA 1FVDA 3HNVH 1U91A 4YJZL 2VSCA 5A40E 3RWGA 1GL4B 1CL7H 3D0LB 2VDRL 2VXUH 1C7SA 3C8KA 3IFOA 2IGFL 4KK9C 1QBAA 2N4IA 1PZUB 1KEMH 4HKXB 4APQD 5E4IA 2CKBL 4PS4H 5HHQA 5GGVL 5HI3D 3WE6B 3ZE2E 2XYCA 4HKBA 4FQ1H 4GXVL 1GCFA 5I8OH 4MCZA 4NO0B 1DCLA 1RJZB 1BF2A 2ZSVB 1AGBA 2ZNWA 1RIHH 3JTSA 1LILA 3GIVA 5AUMB 3H42L 4JPVH 4ENEC 1MWAA 3OGCA 2FSEA 2YKLL 4NNYA 4PD4K 3L3GB 32C2A 2CSPA 4PJ7E 1C5DB 1JF1B 4PUBH 3ILQC 4MXWH 3G6AA 5E2WL 1E28B 4ZG1A 2FGWL 2P49B 3MRIA 5AG9A 5HGDB 5IKCA 4Y5YA 3BO8B 5JIKA 4C56E 2VDQH 3IFPA 1WWAX 1NCCH 4X9GA 5EBWB 1UXSB 3KXFD 5EBMA 1ZTXH 3ZL4H 4MX7A 3FT4A 4ISVA 1JPSL 5GGVH 4YHML 5EBLA 1B2WL 1DQJA 3FT2B 4I3GA 1I3VA 4HT1L 5DYOB 1WCBA 2HYMA 1RHHB 2X4QA 3IGAA 2AV1B 4XNUL 3PQYE 3DV6B 4TQEL 4KKAD 4F3FA 5ACZA 1PDKA 2YHGA 3SGDI 3Q1SL 1PKOA 1XCTB 1AE6H 5MHSE 4MA3A 1G0XA 1TZHA 3S5LB 1OP5H 1K2DA 1ZT1A 3V4UH 4HF5L 4X7SL 4N9OB 3PP3H 2IANA 1IC4H 4L8CA 3V95A 5IW6A 5F97E 4OCNC 2A6DA 3GKWH 1T20B 2JTDA 5LBSL 1RJZA 4YHMH 4OCXH 5EUOB 1JPFA 1YNKH 4LIQL 1Z0NA 1F45A 1Y6MR 2A0LC 1I75A 3V4PL 4W4OA 1LE9B 5DJ8B 1LO4H 3HG1D 1FNLA 2WLYA 3MROB 3MYZA 3ELAT 4NRXB 4U4BA 4KUZL 15C8L 4CUCA 3T2QA 2AXHA 4UBDD 2BSED 3RAJL 5IJKC 4GKZB 1QSFE 4NRZA 1V7NL 5C0CE 2PO6C 4TYUA 1KFAL 3JWOH 2CUHA 5T3ZL 3UTZB 2H2PC 4AQ1B 3CMOH 1CE6A 1CGUA 4WW2F 5EN2A 4HWBA 4I18C 3RWHB 1AHWC 3OR6B 5LGHL 2YUVA 2YD9A 3S37X 1DBBL 1JWMA 3VGGA 5HTSA 2EECA 2H8PA 1TFHA 4HS3A 4WFEE 4FQQA 3QEQD 3KDMB 5TDOB 3CMGA 4QHMB 4PJCA 5JZ7D 2W65A 1NFIB 4NQSB 1J05B 1T20A 1UJTA 15C8H 3D85D 2DDQH 4M62H 3L1OH 5F3BA 3BH8B 1UB5A 2DIAA 5BV7H 3UTPD 4P2YA 3MX0A 2WV3A 4LKXA 5I15L 3JV4A 3GGWA 4U05A 3QUZC 2AABL 3PV6A 2ZKHL 5D7JB 3VD7A 1GGTA 3ZE0E 3BQUD 2PTUA 1GRWA 3NIGE 4JCLA 3UJJH 2DQFA 2DTMH 1YJDC 3MUZ1 4X6FB 5E8DH 4Z7QE 3P30L 5K9QI 1A9BB 5EA0L 2AGJH 1XF1A 4FMKA 4XTRD 5C6TL 3D39E 3FMGH 3U0PB 1FG2A 2ZSWB 3C2SA 3UTZA 3MRNB 4HIJA 3WV0A 5JOFA 3LKOA 5HHPB 1CD8A 4HWZA 1JF5A 5C0GB 2V17L 1EEYB 3OR6A 3KPNA 4PRHD 3RWCB 3UTOA 4OCRL 5I15H 2W9DH 5K9KA 4HUXB 1IC5H 3IJSA 2VC2H 3KG5A 3AXLB 4P2CG 3F5WB 3DYPA 4P46C 1W0VB 5J9PA 1T83A 5HVGB 2ED7A 4O2FB 4Y4KB 4J4PA 1KCVH 4QHMA 3QA3B 3VXNA 4U6XB 3DBXB 1I85A 5TE6L 1MRFL 4TPRH 1YEKL 3WFEL 4LSQH 5C6TH 5C2UB 2YBRA 3N0PB 3TA3C 1YEGL 3CD4A 5ENWA 4GRWB 4F37F 2MHAB 2CRYA 3BE1L 4WU5A 4JHWH 2FEEI 1SBSL 2VZVA 3MLYH 3VXSE 5I8CB 3UYPA 3OMZA 1XR9A 5DK0A 4FQIH 3T0BA 4PLJC 3LN5A 1A9BA 1T7YA 4IRSD 2OL3A 4GW4A 4X9IA 3QISA 5TE6H 5JW3L 3U0PA 1QLFB 5FHAL 5JA8B 4MNGB 5F9WB 4QXTB 1XF5B 5FDWA 1T89A 1YEGH 1K9TA 4UT7H 1DVFB 1ND0A 3MREB 4X6BA 3BWUC 3KPOB 3OJVC 1QHPA 5HHPA 3OB0K 5KJRH 5E99L 3ZE1F 2NXZB 1S9VA 1UVQB 5D4QA 1WT5A 4FZEL 4YXHH 4KQ3H 2ZCLH 2P5EE 4Y4FA 5C0RL 2NXYD 2C5DC 2VLLA 2OLDA 1J86A 2Z8VC 4P0DA 5BS0A 4JHBA 1U9KA 4Y4KA 4MB4A 1T1ZB 3L3DB 3ARDB 5DJAB 3E6HB 2YS4A 2J4WH 2VOTA 4G6FD 4F57L 2VXSH 3BPLC 2IH3A 2NY5H 3BKMH 3O6FB 4YBLB 2PW1A 2GW5A 4ETQB 4J7RA 2D3VA 4QLRA 43C9A 4CKVX 1U8KB 4Y2DB 1T0NA 4N0UE 3QDGB 3QDJA 4HXBL 2A6IA 4AIOA 5HVFB 4M3KB 3T04D 4MVBD 1WF5A 2CLVB 5DJZA 5FAAA 2DMCA 3IDIB 4N5UA 4X7TB 1TETL 1LP9E 4OFDA 5AG8A 1AXTH 3C5ZD 1XF4B 1BZ7A 4LPCA 4I77H 4HX1A 1WWWX 5GSRA 4G8GD 1RFDH 3KYKH 4U1KB 4HV8B 1Z9SA 5C0AA 3KJ4C 1FL6A 1URLA 5HHVH 2Y06H 3U0WL 5L8KB 2EXYD 1MQKH 3DX6B 4YQXH 2PYEA 1L9MA 4X7EC 5DF0A 3MRQA 5E9DD 3UROR 1CIDA 3TNNB 1T1ZA 3T4AB 1Q72H 2MPAH 5DJAA 3WIFB 2YN5A 2IEPA 3L6FA 1WCQA 2BVPA 2QHLA 3MUY1 1RI8A 4GO6B 4GW5B 1R3IH 3VXUA 3S34H 3ZO0A 3VFWB 4M6MH 1JPGA 4M1DH 4HC1L 2C3GA 3SJVA 1NC2A 4K7FA 2IBZY 5E95B 1IEAB 4ZUSA 1TITA 1YECH 3BT2L 1FZOB 1N6VA 3QDGA 3FQNB 2A73B 4FOMA 5DVMA 3W9DB 3D0VA 4J3OC 5GGTA 2HVJA 3WIHA 2W0PA 1OARL 2HWZH 1RZ7H 3OXRA 3WSQL 4PRPA 1EJOL 4BSWB 1VADA 3IDIA 2FATH 4ZMAT 1S7TB 3REWB 3H6JA 4XP1L 3T4YA 1ZLVH 3S3SA 4PB9L 5HPMA 2DQJH 4L8SC 5TQ2H 3KNBB 1FH5L 1KELH 1R5WB 2YPKB 4JM2A 1A9EB 4KZEL 2DLFL 4HC1H 1J0IA 2AK4E 2WM0A 3EJZC 4K71C 2FIKA 5HDOA 3BT2H 1ZANL 4ODUB 2KL6A 3X3FL 4IOSD 5H94B 4M6NH 1I8IB 1NPUA 4WEBL 4Y5XC 2BVEA 3MC0A 5DJ6A 1ZGLA 5GGRA 4XCCL 2AXJA 3TNNA 4P4KC 4QHUB 3OJDA 3PWVA 3JV5A 3WIFA 1U8MA 1OM3L 2DLEA 2VITA 3RKDC 4L3AA 4XPHL 1DTUA 1F2QA 2GJZB 1U3JA 4FXKA 3CDGB 3TBWA 3AVEA 3E0GA 3U82B 1YNTB 2WWMD 4JQVC 2E3VA 2XTLA 4L5FL 5EIQA 1OGAA 1QQDB 4GG8B 5MP6L 1M4KA 2DQIL 5DO2C 4OFYD 1XIWA 1FCCA 1KG0B 2XRAH 2XQYG 3QIWC 4HZLB 3KR3L 2CLZB 5D5MF 1OF2B 4XCCH 4MCYA 3OAZK 4S1SH 4I2XB 1C5BH 1JGEB 3REWA 3PWJA 2XN9D 4QHKJ 3B2VH 3BD4A 5CLWA 2BXYA 1ORQA 4R2GB 2M2DA 1I9JH 1VEMA 2YPKA 2Y9RT 3MV8A 3VRJA 1TMCB 4GS7B 3LIZL 4KROD 3TCLA 4IHOB 2DMBA 3V0VB 2Q86B 1B4JL 1OSPH 5H94A 2O26U 4HPYL 4L3EA 1RZFL 5EOCL 4FTVE 5MP6H 5D1XA 3ZT7A 5TE7L 2DICA 4M4PA 3QCUL 4NO3A 4PJGF 3ME0A 3QUYC 2VWEE 3KGRA 3MZGB 2L7JA 2BOBA 4EI5D 3WUZA 1NANH 3P0VL 2ADIB 4YDJA 5F8RC 5I1IL 1MI5B 4DKFH 5LQBL 1NCDH 1TNNA 2XZCL 2W07A 2HJFB 3H9SD 2Q8BH 2B1AL 5KVGH 1BQHG 1YNTA 1SMAA 4N0FA 3QIUD 2VLRB 4XHJD 5GJTL 4HPYH 1RZFH 1KJMB 4WUUA 2CLZA 2NY2D 1IT9L 5TE7H 1F4AA 1JF6A 1LNUB 4RFEB 2FECL 2JB5L 4FQ2L 5HGHA 1LEKA 5FUZH 3QCVH 4JDTL 4PJEF 2EDOA 3VFSB 3W5NA 5DQJB 2J1KA 3HNSH 2DAVA 1NDMB 2F54A 4A6YB 3ILPA 1F00I 4ZTOL 1F90H 3EZJB 1A6VL 2XZCH 2WQRA 4N1EA 1GZQA 2H26A 2BY3A 4MA8L 3P2TA 2DWEB 4ZD3L 5FCSH 2CR6A 3VFPB 5E1HB 2Q76A 4YAQA 4RAUB 1FNSL 4U2ZA 4HWEL 2V2TB 2N7BA 1VDGA 4Z7VE 1J1OL 5C6PB 3P11L 4N0YH 5I18H 3MGTA 3VH8G 4Y5VC 3MNVB 4ODWA 2BXZA 3BX7C 1KJ2L 1UM6H 1UWEH 3FN0L 4M8QB 5B3NA 2Y6SD 5IBLD 5TQ0L 1JHKH 2B5IC 3D69A 5HVHC 1WVZA 4FQLH 3ISWA 4MLIA 3L9RA 4G80B 4RIRB 1U8JB 4PJHA 3TJHD 3GI8L 3U4AA 4LLAA 5ALBH 4RFEA 4DZ8B 1J8HB 5ISZA 1FL5A 3VFSA 1BF8A 1D9KA 2J6EH 2EXWD 2DM4A 1NDMA 5EU3A 1RZKH 1KYOJ 4K3DL 4M43L 4PJBB 2A74B 2VYRE 3KLAA 5F7LB 2NX5B 3HPJA 1KJ2H 4IMKA 3QNYA 5I71C 3OJ2C 4LLDA 4LDLB 1L7IL 3IAGC 1Z0MA 3KLHC 1WWBX 4RQQB 3B4NA 3VFPA 4YBQC 1CDYA 3UP1A 1ZA3A 1OGTB 4ZFFA 1X5AA 1HKLH 5FOBB 3GI8H 3EYSL 2XPGB 3FB5B 3GSWA 1QTYT 4OLWL 5FGRA 1FCGA 5BRZD 4WI7A 5C0ND 3G5VB 3QUMA 4L8BB 4X8JB 5ID1B 4OLZH 5D1QD 5EU5B 4ZXBD 3HG1E 2G5BA 2V2XB 4YE4L 4ZUVB 4I18B 1S7VB 4PJDF 3IB4A 1CF8L 4S1RH 5FYJL 5HYIA 5EU4B 4W4OC 4I3RL 4JFDE 3QQ4B 5GZOC 5AWNL 4WDIA 5E94A 3GBLA 4NN5C 1JRHI 1DBML 4XBEL 1FAKT 3S4SB 2W1NA 1KCRL 4OCYL 3V6ZB 2XQYK 3EYSH 4L1DA 4OLWH 4A6YH 1ZLWH 2C3HA 3U4EA 4LPVA 4XI5C 3ES6B 1D5XA 4YGVB 1MVFA 3D87B 4PJBA 3F6IA 4JRYE 1FRGL 3UMTA 1DR9A 3HZMB 1RU9H 5MEND 3S88L 3PGDB 3KPSD 3RY4A 1XT5A 5AWNH 5DMIH 1YMHA 2HN7B 4RQQA 3RWIA 5JLZB 4CU7A 4R7DA 5SWSE 5HYSG 1X5JA 4KI1A 1JZ7A 3AB0C 1DBMH 4XBEH 5JHDD 3N50A 5HI5C 3LH2H 3T77A 3MNWB 1RY7B 3HRZA 2F5AH 2NLJA 4H0IA 2BMKB 1EDQA 2OZ4L 5KSAC 4XVTL 5GRJL 1NBYB 5IFHL 1OW0A 1NMBH 3GSOB 5K59F 2XTJB 4Q9RH 4LGRB 5CSZB 2P7TB 5I17A 5EU4A 3CFDB 3LRGA 3VW3H 3CLEL 2EZ0D 3TEUA 3B9AA 5I73C 2E7HA 3E6FA 5IVZA 1WBYB 1LMKA 1U95B 2JIXA 3O11B 5I8KL 5E7BA 5CEZD 3EFDL 2Y5EA 3ARTA 1JPTL 5F93C 3TA3B 4H5SA 1RIVH 4PRHE 4K2UH 1KPRB 5IB2B 4BZ2L 3NZ8A 1K3ZA 1MCDA 1CZ8L 1DUYB 3EO9H 2EYTB 4XVTH 5GRJH 3RPIA 3MLWH 5IFHH 1QR1B 3ARBB 3C08H 3DX7B 2VRAA 5CD3A 1NBZB 1K4DB 4HKZB 4JHAL 1B0WA 4I48B 4RSVA 2OSLB 5LG1A 3U36B 1IM3A 1YUHA 1RPQA 2HAZA 1SJEA 5IB5B 1KEGL 1G7QB 3KYNB 1J18A 3L3HB 5FA4B 2AEIT 4P3DB 3CX5J 1CFVL 5F6IC 1OL0A 4J4PC 5IB1A 2X4PA 1NCBL 3O9WB 2Z92B 3ROOB 1I85C 4ZFOB 4HS6A 2BMKA 3BXNB 3CSGA 4TULH 4KI5C 1NBYA 1HE7A 4LLVB 5D5ME 1HILA 5CSZA 1UXWB 3QWOB 1YJDL 1KIPB 3DGGB 5H37H 1G7PB 2HKFH 4JO2L 4BJLA 4F9PA 2D03L 1U95A 1RZJL 1NAMA 2NY3D 2FYYA 2ARJQ 5DSCA 2J3SA 2A2QT 5IVXB 2X4OB 2E8YA 4KDWA 4R7NA 2AEPH 3BGFB 4H8WC 3KLSA 3DUSA 4NC1E 4YPGB 3CZFA 1NCBH 1RURL 2MKLC 1EH9A 2ERJC 2R29L 4RA0C 5MEQB 4CVXA 4NO5A 3GM0A 3SE3C 1T89C 2N56A 4PGEB 1QR1A 5F1OB 1GHFH 1D5ZB 4HKZA 4P2OD 3ORJA 4NZUH 3RVVD 1WT5C 5B39A 1YC7A 3GSNB 3O3EA 4JR9L 4Y4FC 5DURD 4EJ1C 4PP2B 5JDSB 2DQTH 2XI9A 4U1SA 4BUHA 2GAZA 4MS8D 1OVZA 2G5RA 5ETUB 4LSTL 1MJUL 1WEJL 2J8UA 3TZVD 2IBGA 4P9HC 2VZUA 1VHPA 2JB6B 5I76B 1XAUA 4FNLL 4HUUA 2J7LA 3CU1A 1DDHA 2CR3A 2BVYA 3LEVH 3MV11 4AT6A 4LLVA 2OTUB 3BKYH 1UXWA 4PTUA 4S1DC 1KIPA 3DO3A 5J11B 3KJ4B 2V2WA 3DGGA 3N9GH 3S3JA 3P77B 1D5BB 3GIZH 4RDQG 2X1PA 2E6PA 1KPUA 2B4CC 4AMKL 1AD0B 1KTKE 3HE7A 3MXWL 5IVXA 4XX1G 4XMPH 3SCMC 4G8GE 1CG9A 4OQTL 43CAA 2VLMD 4QYOB 5ACMA 1T4KA 4EUPA 1NCUA 4B5EA 1AJ7H 2CK0L 3DMMC 1I9EA 1AGFA 4M7ZC 4QRPD 3P3YA 3TV3L 4GBXD 3A6BL 3RGVC 1HHJB 4KXZH 3BZEA 5E8PB 3GSNA 4OI7A 1H5BA 3X17A 2FBJL 3CVHH 2BCKB 1KJVB 2J2ZA 4KVNH 3UBXA 5JDSA 1UQSB 5DVOA 2C3XA 1JGLL 3KPRB 2YWYA 5FKPB 3V52H 4QGYA 3ESVF 3QXUA 5I1EL 2DM7A 2Y1VA 4F7EB 1NAKH 5BJTB 1DN0B 5L2KE 5FYKU 1HWGB 2R0WL 3MA9L 4K71B 1NUNB 3HMXA 3SE9H 1INQB 3X12B 2OK0H 3KPQA 1C8PA 4V2CB 2A9NL 2AJ3B 4Y5XB 1R5VA 1AY1L 3OB8A 5HDQL 1SQ2N 2EDQA 4J3TA 3IF1A 3A0OA 4XGZB 5ESAB 3EDFA 4JKMA 5FYKD 3LQAL 1N5YL 1OSZB 3EOAA 1MH5A 2PUQT 5HY9A 1YPZB 1XGPA 4QCIB 4QYOA 1ACZA 1A02N 4GMSH 5I1EH 1X3DA 2WZPD 4PJAE 3AFLA 3L5WA 2PCPA 3EYFA 1YNLL 1MOEA 2XZQH 5KS9A 4MQXD 3PWLB 1GZPB 3MCKB 4PRIA 4JM2C 4BZ1L 4J8RB 3QO1B 1PJ9A 1GPOL 1RK1A 3CK0L 2A9NH 5ICZA 1WC7B 1KJVA 4Z7WF 3SGJA 1OTUD 5DJ2A 4KJQD 5C09A 3BPOC 3NA9H 4JVPA 5GGUB 3LRSA 4H20L 2D7MA 1QLRB 4DVRH 1N0XH 1OP5K 3BPNC 4JCMA 1LEIB 2IBZX 1RZIB 4B0MM 3PP3K 3GBNL 2GT9A 2R0LL 5I30H 4YHNB 4PGZA 3GI9H 4FQXC 1IAKA 5IR1B 1JTOA 1A6ZA 4N8VB 5GS0H 5DRNB 1ZLUH 4YHIB 2XN9E 2MQ3A 4YHPB 4XPAL 4Y1AA 3SDAD 2EDXA 2GQHA 2YMXL 4NJ9H 1XIWC 6CGTA 3EYVB 4H20H 4K7PH 5KOVC 3DX9B 5L2JA 3MYJA 3V5HB 4NQXA 2EE2A 4ZSOB 2X1WL 5B38B 1JP5A 1WBXA 4PJEA 4GRLD 3ULUC 1H15A 4EBQH 3QRGH 1WIOA 4QXUH 3QO1A 1P4BH 1RV6X 3ARVA 5E8OA 1MEXL 1BLNB 3EHBC 4P2RE 4JGJA 5B8CB 4KK8C 1LK3L 5GGUA 1U3YA 5K59E 1G7MB 5D1XC 1HNFA 1X9QA 3QXAA 3H9SE 1AGDA 1BM3H 2CUIA 1LO3L 1J9CT 3DXAD 3C09C 5E9DA 3NIFE 3IXTB 5EC2B 1EIBA 5IR1A 3SKNA 2GUOB 3U7YL 1A6TB 4R8WH 3ULVE 4I4WB 2CDGA 1ZWIB 2Z4QB 5DRNA 2DMKA 1JYXA 4KKBC 1MEXH 3CVIL 5E5MB 3HI6L 1N2RA 1T2QL 3HUJA 1FGNL 3SO5A 1KCKA 4O4YL 2JCCA 1YMMB 1G7JB 1YEEH 1GC1C 1YN7A 3DX9A 3HCVB 4MJ5B 4C54A 1JZ3A 5C0BE 1G9ML 2IH1B 3G04B 4OZHA 1CFNA 3UTTB 4G6KL 3RU8L 4HUVA 3GMQA 4H1LB 4TSCL 5B4MC 2ZUUA 1R5IA 1R3KA 1B0RA 1Y0LB 5E4EC 1GYAA 1KNOA 2I5YH 3VFUA 3RQ3A 3U7YH 5HHOB 4RX4D 4FXGB 1MLBB 4LCUA 3VG0L 5HVHB 2FJGA 3UJIL 1Q8MA 4B7IA 1MIEL 4X6CF 5E56A 5DK2A 1ZT7A 1I4FA 4U31A