4OR1A

Structure and mechanism of fibronectin binding and biofilm formation of enteroaggregative escherischia coli aaf fimbriae
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
144
structure length
129
Chain Sequence
STEISLEGLHNMGEQLFDGDILATGRIICRERHTGFHIQMNARQVEGRPGHYIVQGSKDTQSKLWVRLGREGWTSPQGIVRSGQEEQVIFDVMADGNQWAKPGEYIFSVSGKCLTTAVAKTATSTITVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into host recognition by aggregative adherence fimbriae of enteroaggregative Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords Invasin homolog AafB, Major fimbrial subunit of aggregative
total genus 21
structure length 129
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05775 AfaD Enterobacteria AfaD invasin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4or1A00
3UIZA 3UIYA 4OR1A 5D55A 2IXQA 2CNYA 2CO3A 2CO6A 2CNZA 2CO7A 2CO1A 2CO2A 4PHXA 2AXWA 2FVNA 2CO4A
chains in the Genus database with same CATH superfamily
2AQ1A 4P57A 1F41A 2YAFA 2EEAA 2Q76A 4OCRL 5KYYB 2VE6A 3CUPA 5AOJA 2ZWLT 4Q2ZB 1B4LA 1YC8A 2ITDA 4JFUA 4XX1G 5F6IB 3ILPA 5DWUL 4EDWH 3E3QE 3N04A 5CMAB 5CZXD 3IU3A 3FO0L 4OSUL 4LQFL 4IS6A 2B3RA 1KN4L 1P7KB 4P2QA 3SZ6A 5KVDE 4G6KH 1F4XH 2I32A 2WQUA 4LP8A 4LOVA 3KLHD 2GIMA 1PG7H 4F7MA 1JHTB 4PJ8C 2A4EA 2DDQH 1AP2A 3BIKA 2COVD 4NRYA 3B7TA 5D7JB 2XWRA 1G7MB 1U36A 2HMIC 3PAZA 4MD4A 4DTGH 2VDOL 1DJIA 4OZGE 5KYWB 1DJWA 1UD5A 1JZ2A 3TA3C 3RUGE 2XG5B 3LZNA 3PDGA 4Y4HD 3S3BB 4R8WL 2XCMC 1PLAA 2NRDA 3EJQA 4X7DC 3G04A 4NNXB 4QRFA 3CTTA 2X4QA 2IEPA 1X4XA 3VXSE 1ORQA 3FQTB 5IFHL 3AG3B 1BD2A 2H3KA 3PWPE 1FNEA 4KI1A 1CLOH 2IPTH 5F0MB 5KAQG 2UUDK 5C0RL 2HVJB 2GTZB 1X5KA 3MRRB 5ECJE 4L1LA 5CWSB 4PWJA 5SX5H 4UU9A 5E1IA 3LXCA 4J3SA 1BXVA 3F7PC 2D7QA 5KYWA 7TAAA 4F9LA 4KJPD 2BVEA 1XF2B 5C0DA 3HC0A 2MOQA 5JO5A 1FFPB 4G6JL 2XN0A 2E9GA 4JFEA 3MA7B 5E6YA 3FT2A 3SDDA 1ZKAA 4YXHH 4JY6B 4ZMLA 4NRZA 3FTWA 3EFOB 1MAMH 4YE4H 1RZ7L 5INCA 4MJJA 4NQCE 5I1GH 4TQEL 1I8UA 1IL1A 1J9QA 1LMIA 1S9VB 3QGVA 4EVNA 3GNML 1BBDL 2N7SA 2AJYH 1AKJB 1CDJA 3RVXC 3QDAA 4MJ5B 3MR9A 32C2A 5GRUH 3FUIA 4QXUH 5KVGL 2A9NL 2E0PA 2Y1YA 3CH8A 4YL4A 2JELL 4NQCD 3VXRE 1M7DB 2CALA 3WEAA 5IHHA 2HFTA 2Z7WA 4YHYB 4XOEA 5KYNA 3O6LH 1XF2A 2J1ZA 3FJTA 5GGRB 1OF2A 4OLWH 4AQOA 4XI5D 1HJBC 1AXIB 3J8F7 3EIFA 5MEOA 1X7QB 3MNVA 5JPMA 4FNSA 1J7VR 2A1WL 5ISZA 2BFGA 4DESA 3T9WA 4QD2E 2XV2A 2DQ6A 1JVKA 2Q86B 1S7RA 4F2MB 1IARB 3UO8B 4Z8FL 1TSHA 1ODAA 1NGWA 2UWEB 1NUDA 4J3OF 3IDIA 4DVRL 2VRAA 2CJUL 4JFHD 2K3HA 1F6AB 2X1WL 1ADQA 1RJZA 1B4JL 5D1QA 2AXHA 4YUEH 1BZOA 2A9DA 1OWWA 1OCRB 1V3MA 4HC1A 3IDGA 1NCBH 4KRNA 1L7TH 1VA9A 4UBDD 3TNMB 2YUXA 3MZTA 5I0WA 4JHZA 4WWNA 4AYFA 1AQ8A 3NCBB 5AB9A 5ID1A 1OAXL 4UQIM 3BIKB 1MLCA 1Q9OA 4LVOB 4YUEL 3IF1B 5AVZB 1TCRB 3KMDA 1YJDH 2NNXA 1PL3A 4WGVB 1WTGT 2ROYA 2BVOB 1QSFE 1U8MB 4EXPX 5C9KA 2AI0H 1X5AA 2DAVA 2XA8L 4WJG3 5A16B 5D93B 5AVUB 3ZZ1A 5CLWA 3CDYA 3CHQA 2R0WH 3MRIA 3QQ4A 5LLIC 2R39A 3QO0B 3T0DA 4AIZB 3MGTB 3QAQA 3ZT5A 5G5DA 1KUMA 1MVFA 2IDTA 4KKLC 1XD1A 4YDIL 5HP5A 4JZNA 5JXAL 1G7JB 2HFGL 1Z9PA 2DKSA 1KJVB 1RMFH 3SPJA 3RWCA 1GVIA 4YDNA 3V0EA 2CHDA 4DVBA 1TQWA 3ZBMA 1ZTXH 1HI6B 5GGVY 4TS6A 3JWNE 2X4UB 1MHHB 2DD8H 3IB4A 2IBGA 3UYOD 3RKPA 3QQ3A 3LKSA 4H0GA 4JDEB 1HE8A 4HPYH 2Y1ZA 3O2DH 5K93A 5IHWA 4L1BA 1NBVL 3LRHA 3L4YA 3T0EB 1X3DA 1IGYA 3DJ9A 4J8RB 1FNGA 4C4KO 1ZHNB 2DDQL 3CFKA 1D9KA 1D6EA 2ZX5A 5GS1B 4PLKD 1C8QA 3M86A 4HBCL 2GJ6A 1ZXKA 4HMCA 1ZSDB 2P47B 3SE9L 1A7BA 1B3JA 4MA7L 5DQJA 3HMXH 4PRNA 2FK9A 1IT9L 5B8CA 1HU8A 1CFVL 1YEHL 5C0AB 1SBBA 4F33B 3P0YL 1FVEA 4YDVB 4DN3H 2VMDA 3NMEA 3VFNB 1C5DB 1QBLH 3PG2A 5BZWA 5I1AB 1QBBA 3RGVD 2UUDH 2PXYC 2VMCA 3FB5B 4U6VH 3C75A 4HJEA 1YAIA 2YBGA 4YVUA 3FOLB 1M05B 4OQTL 1KNOA 3D7PA 4HX1A 1TTAA 3GSQA 2W65A 5AOMA 1IAIM 4LCUB 1U8IA 3CZGA 4ILDA 5IF0B 1MW1A 5CSBA 1L0XA 3M17B 4H0HB 4IIQA 3GS4A 1AYRA 1SY6A 2A77L 5FLUA 5B39B 2SEBB 1XGQB 3QJQB 3L13A 1FZMB 2E4TA 3D4GA 4TNVK 1BAFH 3TFBA 4MTMA 4CU6A 3BUIA 4H8WC 4HUVA 1PG7W 1KB5H 5C8JB 2I5YH 4FA8A 2I60L 4N5EC 4Q9QL 5CS7A 5HVHB 1UZ6F 2BW5A 3RDTC 2J72A 3WKPA 4CKVX 4J7RA 3W2DH 4FQLH 1G4MA 1PJWA 4CVZA 3ATBA 1V7MH 1C16A 3FUJA 5I1EH 3BFWA 5D2NB 3L3JB 5E8PA 1I1AD 3QEGH 3FB6A 3A67H 2BW4A 5AWNH 1VERA 3OPUA 1RZQA 2R51A 2EVIA 3GIZH 3MXVH 4NGHL 4HIJB 3CFBB 1J5DA 4I9WD 3RWFB 4G5AA 4H25B 5HVFB 4LVNB 1QR1A 3D09A 1UJ3B 3TO2B 5J6HB 5HHVH 3WNLA 4R7NB 3KE0A 4E9XA 2DQDH 4RGNC 5B22A 5HYJE 1AE6H 2UX7A 3FF8A 5DJ2A 1M2VA 1KTBA 1E8ZA 3DX8A 4FXTA 5T3ZH 4GBXD 3QWRD 2LFGA 4D3CL 4NSKB 4KKCC 1LE5B 2DI9A 4X8GA 1LDPH 2ICCA 1U2HA 5D1QD 1XGUB 2F58L 3B8SA 1IAII 3NABL 5D9SB 2BSTA 1KWKA 3VXMB 1K4DA 2FQEA 3LXUX 4OLZH 4ZMVA 1E4WL 4DP8X 5JDSA 1HQ4B 1BDYA 2QZQA 3OPZH 4QPEA 4XCCL 1G87A 1HWWA 1EO8L 2V5SA 3ARGC 3O2WL 4FFYL 4HIEA 4BFJA 3RL1B 3IMSA 2W9DL 4Y4KA 4HUCA 2ITFA 3S37L 4OZHA 1J5OH 1G7PB 1FYTA 4YWGL 5CD5D 2PCXA 4HUUA 4IIQC 5JXAH 2HG5A 4ZSOE 4MGXA 1IBGH 2Z8SA 4XO5A 1LWHA 1SLWA 2DIAA 1MCEA 2X3AA 3BCFA 4J3BA 5PAZA 5EPMB 3SDXE 5EBMA 4AGNA 4IGBB 3CFCL 4N2CA 1E9OA 1SOKA 1Z9SA 2EXWC 3TYGL 1GCFA 3WIHL 4GRWF 2EE9A 4LGRB 2E75C 4XN7A 2VKXA 4FCAA 1BEXA 4LNRA 3C08L 4CSSA 3D33A 1Z3RA 1E40A 4FJZA 3VMOA 4M5ZL 1NAMB 4LP4A 3QNZB 5A1AA 2X42A 3PHQB 1M53A 2VDNL 3TN0B 5IB3B 3DVNA 3FONB 3FT4B 3QDJB 2WVTA 4ODSL 2NT0A 3L3HB 2WKGA 1YEDB 2VW6A 1Z5YD 3MNZA 2F8OA 2O4EA 4D7BA 3UADA 3VXUE 4Y9CA 3E2HC 3C08H 4AQEB 1SDDA 3DMMB 5I2IA 3BZFA 2AFNA 1MW3A 2UZIL 3W39B 4KU1A 1FL6B 5C0BE 3F05A 1X9RA 3CVHL 2OMTB 3POCA 4KTEH 3RPIA 5FYJL 4DIXA 4JQIL 5DZAA 4NPYB 1U8NB 5FR3A 1M1SA 1BQLH 1A7OH 2CKBH 5JW5B 3K0WA 3C60D 4RISH 1NGYA 3KLHC 4P5TB 1I1FB 3SGDI 3KYMB 3FRPB 3BZDA 5EF0A 1KWGA 4P2AA 5A2KH 3OZLA 4K8RL 1TEGA 3CQPA 4UTBA 1CF1A 2DLEA 2F1AA 4HG4K 3VVWA 1KCVH 1WTLA 2ITEA 4KX8A 2Y7QA 2DQCH 3X13B 3AB0B 1FYHB 2YUZA 3UC0H 1M9WA 5HHOD 1DJSA 3DGGB 2PPAA 2EXYC 2R1YA 4HCGA 2YK1H 3FPYA 5ABAA 5ITBH 3NCWA 3RP1A 3NZHL 2E7BA 3NK3A 1Q72L 4OM1L 2AERT 5I6PA 1F8TL 1AR1D 4YC2B 1DUYB 5D1XC 3FQRA 4PYHA 3WFBH 1HEJC 3BCDA 3PP3K 5KBMA 2O26U 2Y24A 4ZMXA 2VABB 2GUOB 4HD9A 4BA8A 3AJ7A 2C4XA 4X99A 1IBYA 1U3YA 4G6FB 1X7SA 3BH9A 4PJCF 4W93A 5GJSL 5FUCC 2HPTA 4OW6A 3HBZA 3PQYE 1EA9C 1P5UB 3BAKA 5FS5A 1RD6A 4U6HA 5K5YA 4PJXB 3EDDA 3MACH 4PFEA 4YGVB 4N87A 3LIZH 1OT1A 2YAMA 1OF0A 4PJ5A 2C3VB 3LAFA 5CKGA 3S88L 2EDMA 2JCCA 2ZNXA 3BUQA 3RY4A 3TASA 1BG1A 3T1FA 1AGBA 5FC9A 5TGBB 4KKLD 4J6RL 4WVRA 2E8ZA 4NNPH 1XV8A 1S3RA 5E1HB 4ZQTA 2FEDC 1XF3A 4GO9A 2MQ0A 4LOUD 5DHYB 4A2LA 2YQGA 1H3PL 5DHEA 2DIJA 4JRYE 3QA3A 5BOZG 4NENA 5BQDA 1KPVB 4UTAA 3MREA 1RJYB 3NIFE 1AR2A 4PRIA 4PJDB 1ZIBA 3DKHA 1P5UA 3BAIA 2GY7B 4H44C 5EBLA 4XO8A 1ROWA 3GSWA 4MJIA 3OG6B 1YEFL 3AS0A 4P5SA 5KVFE 2O6CA 4UT6L 4GQRA 4LESA 1YY9D 2IQAB 3QZMA 3WI9A 4U6YB 3HFFA 3MX0B 4KNSA 4YDLB 1O9VA 4B9JA 2IDCA 4MMZA 4TQIA 3VO0A 1U8JB 2X9XA 2OULB 5LAXB 2CJTA 2M8XA 4KNTA 2XN1A 3ROOA 3L3OA 4QIRA 5IW6A 1IEHA 2WN2A 3CX5K 2PPCA 4XOAA 1Z6JT 2HLFD 2YOCA 1CZ8H 2CUIA 2W9DH 1JZGA 1T1ZB 3COOA 4I0KA 1CFBA 3EJRA 3ZHDA 25C8L 2UY7A 2QVKA 4JVWA 2V5TA 4XNYH 1CLYL 3BUTA 2ZCHH 3V0IA 2ERJC 1FFRA 2QQQA 1OD9A 4HALA 4X80L 4XVSL 3JV6A 4OZIA 2YEZB 1QEXA 2MPVA 3NESA 3WTYA 2Q8AH 1TTCA 5DZLA 2OL3L 2XJKA 2XA8H 1IGJA 2CCVA 2EACA 2VQUA 3DRTB 3HPJB 4NZUL 3P30L 3DVGB 4LCCA 2IOOA 2D03L 4HS3A 4HUXB 4Y4FD 1E9QA 2WVSA 4RSYA 1NIDA 1R4XA 1PYWA 3JTTA 5A2FA 7CGTA 1DQQB 4FL4B 4PJDF 3EHBB 2R0ZH 5HYSG 1BPVA 1CGSH 1FAKT 4PRAA 5I8KL 3CG8A 3KGRA 1RZFL 2QDWA 4L29B 4K5LA 1TEFA 4XN8A 2E6QA 3FZUD 1FH5L 4GOSA 2VDRB 4YK4B 1MHCA 1JYNA 1XIWA 2P24A 2ZCZA 1F45A 1TZGL 3OXRA 2BVQB 4PVBA 1FE8H 1EWHA 5ID0B 2FX8L 1XF5A 5IB2A 1QYGH 2VDOH 2HVKB 4TUJA 3VFOB 1MRDL 5KN5A 4MKTA 3O9WB 1F18A 3MRMB 5FUOL 1NFIA 4HGWA 4BQBA 1ID5I 4HJGA 4DF9A 2FH8A 4PJAA 1IIKA 2R56H 2BY0A 3VFWA 5JHDD 4FQ1L 5EOCH 3MNMA 4WI0B 5GIRB 1U92B 4KAQH 1HL8A 4IDJL 2NTFB 3IXTB 2V9UA 4OF7A 5AL8A 3M07A 4PEEA 2CMRL 4UUJA 1A4BA 3I02A 2QFPA 1P4BL 3DX1A 4LNVA 3TFKC 1LNUA 3T0BA 3ARWA 5ESQA 5EULV 4J3TA 4QRPA 1TQTA 4JN1L 1LO3L 4JKWA 4OLUH 5L2KB 4TOYH 1LHZA 3FCGA 3HI6L 1JWUB 3PWJA 5CEXB 4OU3A 1TLMA 1YEEL 4PV8A 1WA2X 4YIQA 43C9A 4F57L 3HNVH 3TWCH 4G7YL 1TQCB 1N4XL 4NZTL 1UC6A 5F9JA 4DKEL 2X4PB 4RGND 5GJSH 3VM5A 2H4EA 3NDZE 4U1SA 3GZKA 4YSTA 1OM9A 3LRKA 4M02A 2YSSB 4QTIL 4IJ3C 4PREA 4YBLB 5H37A 5DS1A 2FSEA 4Q14A 4R7LA 1WDAA 3TM6A 4I3SL 43CAB 4ECNA 3MFFA 3K2MC 4G3YL 2LABA 4UQ9A 1SLVA 2DH3A 2B59B 5E2UL 3IDNB 3VYPA 1A7PH 2I24N 1BMZA 2P24B 1DQJB 1SXNA 3VACA 3MLXL 3NFNB 3QB7C 1QFWH 1J0ZA 1VESA 2NY2C 1QO3A 3QDMB 3VXSD 3GHBH 4YDMA 4XP5L 1OPOA 2XPZA 3CZFA 4OD3H 3M8OL 1MHEB 5DK0B 4FP8H 4JHWH 4F7EA 3P73A 1XH3B 3DSFL 1TYRA 4HS3B 2EADA 2Y07L 3V5KA 4J3OH 3MV11 1NAKL 3U1PA 4KKBC 43CAA 2RCSL 4X83A 2QDVA 4JQIA 4LHUD 3ARDC 1CBVL 1DL7H 2BX5A 3EO9H 5DURB 1A7RH 5HHVL 4ACPA 1R0AL 2BSED 5I1HL 1JGLH 3NJNA 3MJ8A 4I87A 1I7UB 1V3KA 2R15A 4R7DB 2DQDL 2NYYD 1QVOB 1DN0A 2B5IB 4I4WB 2YRZA 4JPKL 1TETH 2Y6TE 2I85A 1ZLSH 5ETUB 2VL4A 4WCYH 3D6GA 4G9DB 3VRJB 1OE3A 1NCJA 1PD6A 5F7FA 5KVGE 3ZDYB 1KPRB 5GZOA 4GPVA 1XBDA 1QI3A 4CJ1A 4JFHE 3KYKH 3BGFB 3WFHA 5HDLA 4BHUI 4FKKA 4UV7L 2BOCA 5E8NB 1A02N 3ZKMD 5EU4B 4DSYA 2YAOA 4DZBA 4IIZA 5HGGS 4M4RA 1S78C 3B2DC 4HEME 1ITBB 3I9GH 2DQGH 1E2ZA 1PZAA 3OHMB 4R97C 3R4RA 1RLBA 4GRLB 2BP0A 2HFGH 4MJHA 3X1BA 4Q4IA 3APFA 1ILUA 2Y5QA 1GZHC 3BPCB 2X70A 4NHUB 2VM3A 4QXGH 4A55A 4HU2A 5EO1A 1PCXA 4TTDD 2EH8L 1OGPA 1LTXA 4R96A 1DLHA 2F7IA 3HS8A 3KPPB 3AFLA 1L9TA 3OB0K 3WS3B 2NY6D 3M6DA 3B9KB 1T7ZA 3EOAA 3D85D 4HEMA 4LLQB 4C58B 5AVSB 1PY0A 2EDLA 4BFNA 4JHBA 4WO4A 3PFUA 1Z9OA 2QPUA 3S35L 5DRNA 2W60A 3T0WA 5AENA 3O6LL 1YZZA 3WNNA 1H8SA 1D6VL 5K1JA 1DVFD 1KLUA 1IZJA 3G6JE 4G7SB 1CICA 4K55A 4NP4L 2FIRT 1YO4A 2ICWB 3Q8EA 2Z4QB 3A0OA 4BUHA 4F2MA 3FK3A 4U0RC 4AY0A 5IBLD 3JVGC 4LPWA 2OZNA 3VXSB 2XVKA 1UENA 1FO0A 4F33A 2PXYB 5GS0L 3DV4A 2AGJH 1VF5C 1I8KA 1QLFB 2WV3A 3IGLA 3BDBA 2WBWB 5GISH 5FLVA 2AP2A 3KLKA 3S3CB 2OK0L 4LSUL 4NO0A 3LNGA 3N0AA 4UT7L 3GINA 4CN1A 4RISL 3DBSA 5HJ3A 3TURA 2GSIA 3T65A 1IEAA 4MNQA 4M8VA 1SM3L 4WSKA 2XVGA 3RGHA 4PTUB 1AHWC 2FBJL 5IG7A 4N6RB 2W88A 3KEDA 4BH8A 1BFSA 3I6KA 2P8MA 3C8KA 1ZA3A 5C0RH 2CUMA 2OLDA 4M8QA 5C86A 4Y19B 3I2CH 5FYLL 4HZLA 2XC8A 2IANA 4QRPD 5AW4B 3TIDB 2VC2L 1I8KB 1LYQA 1NUGA 1E3FA 2XPYA 2ZKHL 3FMGH 5FB8A 1NC2B 1EVTC 2W07A 4ZMZA 3MROA 3EYOB 3BUYA 3MBEA 5JW4Q 2LT9A 5ETUA 2G9HB 3HC4H 4L9DA 4F7PB 1AZVA 4FXGB 4CVZB 3MFGB 1KN2L 3O4LE 3SBPA 5TF1H 4RMTA 1RJZB 5D1QB 1XTLA 4X0NA 5IV2B 2CD0A 3PHOA 1JP5A 5F7DB 4QHUA 3CQQA 6PAZA 3CBRA 3F64A 4NIKB 5DJXB 5I1KL 1IE4A 2ED6A 3MRBB 3IYLW 2E6JA 3EKCA 4KKPA 5I66A 2LOEA 3L9RA 1W72L 2WO2B 2F5BL 3OZKA 4IRZH 1GGUA 2Y72A 2VLLA 1TVHB 1EAJA 4X6CE 4GIPD 3QQDB 4L3FA 2WLZA 4XPGL 3ARGD 5IF0A 2V2XB 1YEJH 3VXSA 4OKDA 1B4RA 4NHUA 4PRPD 3TL5A 1JNJA 3OKNA 3L4CA 1IC7H 5KTEL 2G30A 2A9BA 4U33A 1QEWB 4GKSA 1Z3GH 4AM0B 4R0LB 3DX8B 1Y6MR 5MENE 2F8IA 4HG4J 5I1AA 3MRBA 2WZ0A 2YWYA 2GTQA 3L3KA 3HE7B 5SWQA 4BZ2L 2A83B 4DVRH 1O0VA 1F3JA 3QVAA 2QZ5A 3TU6A 4CADA 1OAKH 5MHSD 3WFCH 1WQVT 3QXWA 2EICA 3SKUD 1RZ8B 1KC5L 3KNBA 2HSIA 3RL1A 4JUSA 4YWGH 1OW0A 2APTA 3VMPA 2XQBH 1P7QB 1ZLEA 2O5XH 4RMRA 2Y3NA 5B39A 2JB6A 2Z92B 3IMUA 1W6LA 1MCRA 2HJLB 2DPKA 3DX6B 1UXMA 4TUUA 5AOLA 5J8OA 2V2WA 5T1KA 2YRLA 4KKQA 4AGLA 4ODUA 5JHLL 3NEXA 4OLYL 2NXZD 3DURA 4N8VG 4CVXA 3FCTA 4JKPH 4YLCA 1CTNA 5F88A 4JEGB 4HCRL 3FB8A 2PWGA 3T65B 2PF6A 4QRQB 3MBXH 3VFNA 3JWOL 3PWUA 4MASA 4ODSH 4H8HA 3T5WA 4E0RA 4ODWA 3G6JA 2HKHL 3QZNA 5DJYA 3RE0A 4QRRA 4A7UA 2W0FB 2R9HD 4JPSA 5K1VA 3DMMC 4PGCA 1MIML 5KSBE 1JF6A 5JPNB 2MWCA 4EIGB 4EEEA 5MERB 3HG1D 1M7XA 1OM3H 1AIFA 5IGXL 3WKYA 4TXVB 3DOSA 4P3DA 3NIGF 4JFSA 3WJMA 5B1CA 1VZIA 1I8MA 2M1KA 3AS1A 2PWHA 2AMUA 3JTBA 2GJ6D 4HKJA 5TQ0L 1PKOA 2RFXA 5DFWH 3JZYA 4LEXL 5TE4L 4GUOA 5D1ZD 3VFGL 1GJIA 5ALCL 2W94A 4QNPE 3PFQA 4U1KB 1MFAH 1ZS2A 1SY6H 2F5AH 3IE9A 5GSVA 5E6IA 3DIVA 4KZEL 4W9CC 4AYEC 3W37A 2FTAA 2DWXA 2JJVA 5ADOL 4GUPA 1IM9B 3WTTA 4XNMB 4LPTA 3QXDA 5I76A 2JTYA 4LIQH 5EN3A 5TE4H 1FIGL 4JFYB 1DTUA 3KM2A 4JFZL 4U1IB 3RVVC 1U93B 4CL7A 1SM3H 3AY4A 1OAUH 4I77L 3IFLL 3QZWG 1QBLL 4JY5L 2CPUA 3APCA 3UG3A 3B2XA 3TH2T 3OLGA 2X38A 1TZAA 3F6IA 4HC1L 4JW3A 3LSOA 2APSA 5D8JL 1YDPB 3RILA 3VXTB 3VFRA 4YPGB 1IILE 3HHRB 2GBTA 2YPLB 3SJVB 1NFDA 4DAGH 4APXB 4YXKL 1WBZA 2EVGA 2V2TB 4X4KA 1JPGB 1A3RH 3IU4H 1SDAB 3P3UA 3RPIB 4LBEB 4JN1H 5GS0C 3TO4C 2M83A 3BDYL 3O3EA 3QR2A 4KMQA 4AUUA 3QUKB 1TTUA 2YFNA 5GRWA 1FQ9C 2V17H 5CUSL 3MRPB 3SDCA 1RP9A 2NY1B 2P8LB 4Q9RL 4O51A 1CJYA 3REWA 1M6OB 3U9UB 2VLKE 2P80D 1WO2A 4OIBA 4PTTA 1VKXA 4UOJA 4N20A 4R2GB 4NM8H 4D0DB 2CO2A 2AXFA 4M5ZH 5JQHC 1VACA 3NG5A 4D94A 2K6WA 4BV1A 3HMWH 4FQ2L 4D9QD 3ESMA 4HIEB 4IRJB 2NQDA 3WFDH 3KWVA 3CMGA 4JANB 1AG0A 3DV6A 3ARBB 3QJTB 3ATDA 4ODBD 5C0FA 3LPFA 2EKSB 1NFDE 3UZEA 1BF5A 4WEBH 1KPUA 4L4TE 3HB3C 4G11A 1E8YA 2C7UB 3PWPB 4WWKC 3VWKD 2IF7A 4TVUA 4U3CA 3GJFB 2P46B 1OAYH 1XGPB 5GSVB 1OSPH 4AQ8C 3BISA 3CSTA 2HTKD 3QEUB 3G7TA 4O2CB 5FYKE 1T1XA 2L04A 3ARFB 4Z78B 1JF5A 1NCDL 3X1EA 3OKOA 2ZICA 3KJ4B 4MQ7A 1BXUA 4YDJB 5EF1A 3DJSA 5DD3L 4F1SA 3EGDA 1TVBA 2Y7QB 3SKNB 2F54E 2IALB 2V9RA 4HGMA 3B3IB 4Y2OB 1OXYA 2C3WA 2DM4A 3C5JB 3L3OB 1NCDH 2WBXA 5C0CE 5I1JH 1S9KC 1R3LB 2UXVA 4NJ9L 1N10A 2IO5A 3GJFA 1UM5L 3SDDD 1KJMB 3CDGB 2I9TA 2FT6A 3T1WA 4KVPA 3TS8A 3GUTB 1IM9A 4D9QE 3SDAA 1JK8B 1CFSA 5KSAD 3FH5A 4GSUA 1U8PB 3BVVA 2BOBB 5CD3B 2MOGA 3WFBL 3QO1A 4QRRE 3MREB 3UO1H 1JRHH 3MBXL 2OA9A 3V0WH 5JIMA 2W81C 3D48R 2Z3FA 3ZU8A 1EZVY 1T21B 2DWYA 5HBBA 3US0A 4V11A 3W0WD 4HCRH 2GI0A 2DQGL 4S11A 5JLZA 2EXSA 3IAPA 5E4OA 3O81A 2XTJE 5D7HA 1DQQA 1J88A 1VZGA 4H0IA 1CT8B 5E7BA 4JFVA 1UEMA 2O6FA 3L5IA 3UBGA 4CDHA 4NC2B 4LT7A 5IY5B 3EH5B 2FWUA 4PB0L 1T7XA 2KBGA 3W0WE 3I50L 1QSEE 2JB5L 2EABA 3MJ9L 2YWZA 3P3RA 4R83A 4JANA 2VH5L 3E0GA 4KPHL 1JPGA 3OVUB 2XKNB 2LAGB 4ABVA 3QRGL 1T7YA 2W9LA 4JHAH 4PJGF 3ILPB 3VTAA 4N8VB 2DTSA 3NA9L 3IGUA 2VDQL 4NENB 2JB5H 3MJ9H 1XR8B 3QH3B 1JHLL 4NQDB 4O2CA 4QXTB 5B1JA 1W9XA 4XZUA 3F85A 4UAOC 5A2LH 4E42A 3L9EA 5EO0A 1G1YA 2QQKH 2NOYA 2VLJE 3E1F1 1A7NH 4ZX4A 1BYNA 3UTSE 4WFFE 5SWZA 1A6AA 1G7HB 3Q9QA 1GZHA 3ESPA 2KPWA 4OQ1A 5F3BA 3ZRFC 1IKFH 3QUXA 5C0JA 4P8QA 1LEIA 4OH2A 2WWOA 4JR9H 5EU6B 1T6BX 3UTSD 3LN4B 2QKIC 3QYNA 1FRGL 4ZO6A 1CGWA 2C9QA 2CMRH 3GZQA 3LXBA 4G6FD 4IMKA 4LVEA 1LO3H 3EFDL 2Y9RT 1CLCA 3B7UX 3LIUA 3RGVC 2P5WA 4QO1A 1XR8A 4MZIA 1BPLB 1R3KB 4UDUA 1EJFA 1COBA 2FB4L 1XMEB 1GA2A 3VXRA 4ZTOL 1MFEL 4X9HA 4L18A 3GKZA 5PCYA 1XSJA 1F56A 3KLAB 3L4VA 5F9JB 3NVQA 2ESVA 1NDGA 4IJ3B 4XXCA 2E76C 3CDCA 4YBLC 4B95C 2XKSA 4OV5A 5IEHA 3GRBA 4W9ZA 3FH8A 3D50A 2D4DA 3MRLA 2CKBB 1DJZA 5ANHA 3V7AG 3WDJA 1NJ9A 1NFIB 4HGWB 2H26A 4N2GA 4D0BA 3P1VA 5GJTH 2PO6D 3ABZA 1ETZA 1UZ8B 2N0KA 2YC1A 3QPKA 5DJCA 3UAJD 4KUZH 4DEUA 5JPMC 1CDBA 1E28B 3I84A 2JKSA 4Y8AA 5EO9A 1F4YH 4LOUC 2WBKA 3GMLA 2DM7A 1TJIH 1JGVH 4AENB 5MI0B 2ZZUT 1CR9H 2DI8A 1XFPA 3CX2A 4AT6B 1MRFH 1L0QA 4BE6A 4PGJA 1IAOA 2EINB 1BIIA 2P48B 1O6VA 3FO0H 3CLEH 3ECBA 2E9JA 4GNKB 3U7AA 3G5ZB 3Q2LA 4G7RB 4Z7OF 4Y1AD 3DMMD 1OAYL 1OY3B 3U83A 3FTUA 4MA7H 3N43F 5DHDA 5DFAA 1DBKL 4AIZA 2OR9L 2Q10A 1JYXA 3FSAA 3NJXA 2EIMB 1HH9A 5E08H 4EIBA 5E2JA 2R0KH 4JFEE 1PEWA 5TDOA 1M57B 3CLEL 4AEIH 4OF0A 4KTDH 1NZRA 1KDJA 2G3ZA 3M1BB 1HILB 3S96B 1RIHL 4L37A 2ZUYA 4Q74A 2QV4A 2NQ3A 4ZPVA 1HL5A 1MAJA 2OSYA 3HI5H 3VE0A 4ORZC 3OJDB 1KTJA 5DCCA 5F7EL 2Q6WB 4EIZC 1ZLUH 4XNUL 1G6RL 2NY3B 4L29A 2DJSA 5EEWA 2H9GA 2GY5A 1RULH 3U0TA 1QABA 3D0VA 1EAQA 5GRVK 2ROXA 3BGAA 4A39A 2X88A 4KK5D 2HRPH 4RDQF 3HA0A 5SWZB 1B0RA 1HZLA 1OPGL 2JQAA 3QIUD 4U1LA 3G08A 4GAJL 4FYTA 4G7QB 3M7FB 1PKQB 1NGZA 4LAJH 4ZODA 4FFVD 2D9CA 3HG2A 3S36H 4GT0A 1HHGA 2J6WA 1QLEH 4KKNA 5T3ZE 4WW2B 3MODL 4ANXA 4ETQB 5KG9A 2E8YA 3R7RA 4XNXH 2JQMA 4WI6A 5DA0B 4CC1A 5I1CH 2DS4A 5M94B 1J9RA 1YAZA 5AVVB 4LASL 1MDAA 2BC4B 5CD5C 4MXVE 4OZGF 4WFEE 1KYUA 3C6LC 4AGOA 1LE9B 2H2SC 5K33A 5H4YA 4ES8A 4WEEA 5CZKA 1FSKC 4LHJB 1T5KA 3OKMA 4NC1E 4MA8L 2EEXA 4JM0A 3W3BA 3ZL4H 5AKVA 2R1WA 2J4WL 1N7ML 1BIIB 1RV6X 3BKCH 3RVXD 2ARJB 5KBKA 1FH5H 2W65B 3ARBD 5KSUA 2VTFA 3L2NA 1B4TA 2BS8A 4AKPA 5FKPB 3V52H 2GK2A 1KTLA 2Q7AA 2IGFL 4PJ9B 4XE5B 1A7NL 4WW2A 5A16A 4B0MM 2P8PB 1ETZB 4P48A 1BFVH 2BZDA 2VDOB 2Y69B 2QQKL 3DC0A 1MJUH 1UH3A 5K9OA 5E6RB 3GYRA 4Z7NB 1I1AB 1T4KB 4O9HL 4RRPG 4WHYG 1CBVH 3M45A 1P4IL 3QEHB 4Z7WF 4NQCB 3UGUA 3IGKA 4IRJD 3VGEA 5B8CB 5DMIL 1AHWB 3MUZ1 4BZYA 2Z7UA 4U6XB 4BFGA 2VLJB 4G9DA 4UQBA 3ZRSA 3QWQB 3SGJC 3JVFC 1C16B 1YC7A 4MXQD 4FN0A 1BEYL 3V6OA 4YX2H 5HYEA 2B15A 2RD0A 2MCPL 1DQJA 1YCSA 2YD7A 1A3QA 2H5UA 4CMMA 1ZHBB 4EN3D 1DZ0A 1PJ9A 2JJTA 2CDFA 4OIAA 1JDAA 1DJYA 4MAYB 2VC2H 4X4ZA 3SE4C 2D31A 4BM7A 4Z7VF 3N2JA 3Q13A 2O5ZH 3TO4D 1QR1B 4AH2A 5FO8A 3FU6A 3P4LA 3ZOAA 4RFEB 5IMKB 5JOPE 1XB8A 2HPOA 2WXOA 3N42F 1QHPA 3H8NA 2WVVA 4PP1D 5I1KH 5I1DB 2PABA 1DLHB 4LSPL 1T2QH 5D93C 4KK6D 3MMEB 4C4UA 3SQOH 3AW5A 1CMOA 4FF9A 3LYRA 1DN0B 5GGUB 4IOSA 5ICXB 1K5NA 1JDCA 1W72H 4H20L 1NMBH 1ZT1B 1E5ZA 3BEWA 4HJUA 4WV1B 3WE6A 4P9HL 4NQTA 3ET9F 3V5HA 1RUPL 3JVGA 2UX6A 1DVFC 4JG5A 2Z1KA 2EEFA 1V7NH 1KLGB 3EBAA 1T89C 3N1MC 3WN5C 1HHHA 1W80A 4IOIB 2V2XA 1T22A 1Z3GL 2XWCA 3ZE0F 2X5PA 1GW6A 1QFWL 1T0PB 1HDMB 2Y7MA 2B1AH 3QDGA 1IC7L 2IOMA 4OT1H 3UIZA 5KTEH 4P5KB 4Y8DC 1FO0B 4P04A 1NSNL 2IANB 3IPBA 3O3BB 1F6FB 4UANA 1HKLL 4C83B 2VLKA 5F44A 3F7RA 1SHMA 4RWHA 5FW8A 3TA4D 4BWTA 1ASOA 5EIIB 1NCIA 4DK3A 2KZBA 2V5MA 3EYQC 3W11D 4F37K 2PYEA 1EHLH 1H6TA 3B4NA 5C09D 2ZUTA 3A6OA 3F62A 1BF8A 1ZT1A 3ISYA 4WV1A 1WEJH 1T6VN 2X4SB 4ABUA 4MKMA 4OGZA 5CHNA 3BLKA 3NN8B 3HBGA 3TBTA 3HRZA 5GISL 5IV2A 4UIKH 4PSRA 1OAKL 3G5VA 2DWSA 3J07A 5C0CA 3QDGE 2BNUA 4AKOA 2NSQA 3ULUL 4OLZL 4UZGA 5SWSE 2OJZH 5CEYB 4G2AA 5FHBL 1NKOA 2PCFA 3MRDA 3V6FA 1OWRM 4QUOA 3KPRD 4LAQL 4LHUA 4XWGL 5E00B 3UTZA 1YY8B 1FZJA 1TUPA 4FZ8L 4P2QE 4HWNA 4X5LA 1A6UH 1RZKH 1DEEA 4LBAA 4MX7A 1G7JA 2FX9L 4JUTA 4XPHH 4ZOEA 1OAJA 3O2DA 4LFHG 4NXSA 1L0YA 1UWXH 4ZW3A 1SXBA 3GSQB 4N3TA 5DEFB 2FAUA 1FHGA 3UTTE 5CN2A 12E8L 3KPSB 3WNOA 1AC0A 1SOQA 3H7BB 1MW0A 1R5IA 2ZAGA 3W11C 5BXFA 3BPOC 4FRWA 3RWIB 1G5GA 2DTML 4I0PB 2CRZA 5I6NA 4LASH 2HA1A 4CU7A 5BQ7B 3ULUD 4XNZC 5CKAA 5I1CL 4F27A 4Z7VB 5IT2L 1WC7B 1YUHA 1MCBA 4JZJB 3DHUA 4ONOA 3SDCD 1ZTMA 2LLLA 5I1IL 4A67A 1BF2A 4X6DE 4GKZB 1ODUA 3MLZL 5HDWA 4I7ZC 2EYRA 3HZ3A 4K3GA 5BV7H 1R5VB 2C9RA 5I17B 3SSGA 4DGVL 3MRKA 4LEXH 5LBSH 3ZE2E 4CGTA 3K6SA 3FU0A 1AOHA 4KO6A 2AJXH 2FWOB 4P2QD 1MW2A 3DBXB 4QKXB 4ZXBC 2CO6B 3KXFE 2WAQA 2RH0A 3OJVC 1PFCA 2FBOJ 4QOKE 2DYPB 4S1SL 2VXUH 1FCGA 1F2XK 1OSZB 1Q4NX 3SOBH 2FIKA 3TPKA 1I8IA 1NAMH 3FXIC 4KITB 2B1OA 3ABKB 2YARA 5LBGA 1W91A 2PPDA 1A64A 3V0VA 2XTSA 4QOKD 4X6CF 5DJZB 1HSBA 5JHDA 1PBYA 3HE6D 1W72A 1UYWL 2E59A 4A7SA 2FWLB 2OK0H 5CLYA 3C6LD 4HV8A 3Q6FA 5L4FA 5D2LE 1OL0A 2ZG3A 3ZRCC 1CDUA 4BK4A 5FDYA 1WFTA 1PZ3A 4GBXC 5L0QB 1Q9LA 1BXAA 2Q1EA 3JTSA 2OKMA 4G6ML 4IU3A 5T3XE 4WI8A 3OKNB 3H0TA 1WZMA 3RUGB 3ZW3A 4WI7A 1E4XL 1Y6KR 3PABB 4OLYH 1U3HC 1XGRB 3BWUC 2BIQA 4F7CA 3VX1A 3NIGB 4X2UA 5JHDB 2WNWA 1NGYB 4Z7UE 2NZ9D 2EO9A 5EPMA 3WHXB 2KKQA 3BSHA 3DIDA 4IGBA 5HXMA 3FU8A 5T33L 3KWTA 4PVMA 4IRJC 2OZ4H 2VDRL 4NT6B 4K2UH 2HWZH 2CDGA 4I8DA 4FTVE 3RAJL 5I1LA 1GPOL 4DCQB 2BNQA 5BMFL 2YA1A 4MNHA 5GZNC 3W5MA 5T1MA 1HS6A 1NAMA 5BPPA 4HKJB 5KVDH 1MH5A 3FQXB 2XBZA 3CPLA 5DD6A 1IKNC 3QJVB 4GFXA 1SMOA 2VLKD 3FONA 3FT4A 1UQSB 4K3JH 3N40P 5AD0A 1N2RB 3FDWA 5DXWA 1VAHA 2Z35B 2WZPA 1MQ8A 2OXHA 2FR4A 1PSKH 4D7PA 1AZCA 1G0XA 3KJ4C 5ALCH 4NSKA 5TTRA 3CVIH 3FQRB 3G9VA 3U6RA 1YUHB 1RKRA 2TAAA 3GBNL 3M1CA 1P1VA 4MWFB 5CP3H 2MTAA 4ZUUA 2DL9A 2WP3T 3TCXA 5F88B 4DOHE 4XAKE 2FQDA 3EJZC 1F3DJ 3ZZLA 4HIIB 3L3OC 4FQ1H 3EXJA 3BAJA 4I5BB 3HIZA 4L4TB 5D4QA 5T1MB 2HT4C 2CIKB 3F04A 2XX0A 4JM2A 1TT6A 5B3JF 2YUVA 4EMZA 1H5BB 4J3OG 1YDPA 4KK5C 3SCMD 3QCVL 1W0WA 3QJXA 1FYTB 5GGRY 3ILQC 4J28A 2DLFL 4Y88A 3FC8A 4L0ZA 3MV9A 3QJUB 2ZOKB 4PJFF 1VFAA 5TQ2L 4B41A 5HHMB 3PXHA 1AKPA 1FO0H 3FU5A 1BVZA 2G5BA 3AB0C 4XX5A 4A7QA 1T66C 2JKRM 5I0YA 2Y36H 1AD0B 3RKDC 2VAJA 2OCJA 1IGMH 4L8SC 5C0BB 4NZDA 1KIRA 1CK0L 4EI5D 5IMMB 4PRIB 3UJJH 1S9YA 2HKFL 3HLKA 1U3HA 3NFPB 1A3ZA 1F97A 1IGCL 1IM3B 1MI5D 2VDMH 3ARQA 3BQUC 4LARH 2CZNA 5G4NA 3RTQA 1WIUA 5I5RA 4YDKH 1XCTB 3KPSE 3PJNA 2KLRA 3I50H 4HS8L 2VMEA 1FFNB 1NBYB 3NIDF 4ERSL 2CBQA 2HJKA 4OGYL 1AZZC 1ZS8B 5JIIA 2XIBA 1YNKL 2EDYA 3N06B 4PG2A 2DIEA 4UWQB 1VIWA 3VH8G 1GTNA 1U8NA 2IG2H 1P5UC 4QRUB 1A4KA 4U6TA 4F58H 1DE4B 2Y0SA 3GSXA 4EIUA 3ZL2A 2VDPL 1TLKA 1CL7L 3UP6A 4L4VA 2R4SL 1JJUA 5JNYB 5E2WH 1ZE3H 3GO1H 5DLMH 2BRRH 4LSVL 2YGPA 4HIHA 2ED7A 4FJ6A 4KFMA 4CSPA 4Q97A 4UTBL 2FJFA 2ZSVA 5IMOA 1HNGA 1Q0YH 1HXKA 1E9QB 1FH2A 1FFPA 1VGKA 2C4FU 3RTQD 1RUAH 4KV5E 5F9WB 2BSEA 1CXHA 2HTLC 4ZUWA 1IM3D 1MI5B 2WWMC 4ZTOH 1I4FA 4DP4X 4OI8A 3IN0A 1OAUL 3C6EA 5FFLA 1A1NA 3ENEA 6TAAA 1WWAX 3MN8A 3PL6D 4IRSB 4X4XB 4C56A 3IGFA 3PV7A 4JDZA 4YEEA 5JXEC 2XWJB 1QSVA 1CFSB 4Z7QB 1NICA 2Q2LA 1AD0A 5ALBL 3VDCA 3ZIYA 5J4MA 2UYLA 3ECQA 3O6ML 2IDUA 3LS4H 1RAMA 1UXWB 1A2YA 5F7HA 2R8SL 1F3DH 3U0WL 4DO4A 2HFFA 5KYXB 1A6TB 4PJGA 3J27A 1F1AA 3L7FA 4L8SA 5GJTL 2X7LA 1MELA 2H0EA 3FU7B 1FVDA 3NIFB 5C07B 1MRCH 5JW3H 4BCYA 4M7JL 4C56E 2EDTA 4OIIL 5ENWB 4ELKB 4LGPB 4UQ2A 4KJYA 3V0HA 4LF3A 3GMRB 4GP4B 4FLOA 3QG7H 5HHOB 3O2VH 2WQRA 4L8DA 3NEOA 1MWAA 1XL4A 3B3IA 4Y2OA 1TOXA 4B9YA 4MRCA 4WENB 3X3GH 2NYZA 1PG7L 1DQKA 2BFVH 1MEXH 1G7LB 4N8PA 4XP9L 4LSQH 2H0FA 5HHXL 4ONFH 1UA6H 5DD0L 1C12B 3B9DA 4UBDC 3HMWL 2BOCB 4FQ2H 3PRZA 5ACZB 3LCYA 1MHCB 4HIXH 3VI3B 4OD3L 2VZTA 4K3JL 3S7GA 4H88L 4IU2A 2WB1A 1QO3B 1GYCA 4ZTPH 1XCXA 1EFQA 1J0KA 3KLAA 2EYSB 2FVNA 4TMPA 2YD6A 2PYEE 1EPFA 4M29A 1TKWB 1B0WA 1XHHA 2OXGA 5D7KE 1FORL 5KBLA 4U3HA 2B14A 2AVFA 1E5BA 5AOKA 1YNLH 1ZLWK 1MCDA 3Q9PA 4K7PY 4L37B 1OIOA 4GKOA 4XB8A 3EYUH 4J8QA 1OGAE 3HMXL 4YHYC 3OGCA 3WY2A 1ZGLM 4K5OA 1BGXH 3G6AA 3MGTA 1HWHB 3X11A 1X9LA 5D4IA 2XZAL 1S2EA 4QHLA 4QY8B 3T3ME 3IU3B 2AZUA 3QWRA 3F7VB 4Z7OB 3PGFH 1GMEA 5LGJA 3T6WA 2OX5A 4DZ8B 4RGMB 3CZKA 5BOJA 4G6AC 4PBXA 4EPSA 1XZ0A 2ZXCA 4BHUA 3NSDA 1PZUB 2YRBA 4OFDA 4NM4H 1M7DA 3WFHB 4B7IA 2QADD 3IDJA 3VG0L 3HUJE 5MEPB 2OL3A 2ZSVB 4NZFA 3DROB 5LN8A 2K70A 3ARDA 1BBJA 1JVLA 3P4MA 3TTSA 1PLBA 2HMID 1HOCB 3ESVF 3H3KA 1NOLA 3HI6H 4L8CB 3VAEA 3KCPB 2BVPB 3IJEA 1YEEH 3FFCA 3MV8A 3F01A 2CR3A 4J5VA 1D9KB 4LCYB 4RFOL 3C6LB 1H9VA 2BP0B 4TSCH 2XQYG 2YMOA 4ZFFB 1IQWH 1HWGB 2WTRA 1S7RB 5IFJB 3S88H 3LN4A 3MLYL 4FCHA 2VUYA 2WYIA 5HDBE 2MQGA 3ASNB 3EW3B 1UT9A 5JQ6L 4PB9L 4M1GL 4UM9D 2I69A 1X9QA 1N8ZB 3N9GH 1UUSA 2IFFH 3EOAB 4ZAKB 4WK4B 1IGIL 3G5ZA 1GGBH 3VXRB 3E8VA 1RUML 1NCGA 3GO1L 4N2MA 4GSXA 3HNSH 1USQA 1JVOA 1RK0B 2HN7A 1KNOB 3PWPD 1S7UA 5BV7L 4GEIA 3NRPA 4AI7A 2E27L 1DBJH 4WI0A 3BIAX 5JW4R 4OJEH 2BVOA 1CDIA 1ANUA 5F9DC 2AJXL 1YMHA 3BUYB 1DVYA 5AQ0A 1UZ8A 1S78D 5IQ7H 2NYYC 1EZVX 1XGTA 2HX8A 5GRYA 2E27H 3LPOA 4YX2L 5L2KA 3FTYA 5GGRA 2YAPA 4K3EL 1E4WH 1L9OA 2K45A 4UB0H 5E70A 2GTZA 4PRID 2J43A 2WWKO 4ADJA 5CEXA 3LHAA 3AQZA 5GS2D 1IJNA 3GSRB 4FI7A 5IHUL 3V6OE 3C2AH 2VN6A 1DFBL 3MYJA 2HZHA 4X80H 2BWQA 1I1CA 4GLRI 1D5MB 2EVJA 1O9ZA 4PTUA 3ZUNC 1O6SA 5GGTL 3MCKA 3P40A 3VSTA 1TNMA 3AABA 2UZYB 1KB5B 2NX5A 5F8QC 4LLVA 4JJ5B 3EO0B 4LB8A 4HSQA 4NO3A 1UUNA 3G04B 1HHIA 3FQ1A 2X89A 5BRZD 4NX0A 4JMNA 3DUUA 1TR7A 4PJFE 1B2WH 1QKZL 5JOFA 2ZUSA 4M7JH 3IAQA 4OZ4A 1U8HB 5IUSA 3EYVA 4Y4FA 2B1HL 3QDMA 2D7TL 1MEXL 3ZDXB 1I8AA 2ENYA 3B43A 4Q52A 4XPAL 1CS6A 2WCPA 1LO0H 2NY2D 3BH4A 1AOZA 1O6SB 1WGOA 4UINL 5E56A 5F7DA 4XO9A 4I88A 4CW1A 4FI8A 1RJCA 4TRPL 3UX9B 3IFNH 2QV2A 1I7ZA 3GB7A 4EKXA 3QEQB 3UERA 4YH6A 1QA9B 1ZMYA 1J5HA 2ZKYA 2B1HH 1J0IA 1MFDL 3DTXA 4HJ0D 1MRDH 2Q9OA 3FT2B 5HVHC 4NRZB 3TBYB 3UPRA 3G6DL 3EJSA 4DKFH 5CF3A 1G7MA 35C8L 2X9ZA 5J12C 3F7YA 2IGTA 4IHOA 5AUMA 4RFEA 4Y0GA 3NQKA 5LWYH 1CUOA 3KXFB 3WCYA 4ADIA 3THMH 3WXVH 3B37A 1PSKL 2DQFB 4RIRB 5E5UB 1UGNA 4NCDA 4U0RB 3FB7B 3GMNB 2AGJL 1SXAA 4AEIL 2NR6D 4FZ8H 4IBTA 5F7WC 5JIQA 1QI4A 1RIHH 2VJXA 4LVNC 2JIXA 3BEWB 3PHAA 2WY3B 5HGBB 2CA4A 2WLNA 4JB9L 3WIFA 3DPBB 1IBBA 1WF5A 4P4KC 3WLWC 3X2QB 1OSYA 4OJFL 3A3YB 5AZ2H 2VUOA 4QGTA 3ZLQC 2EUWA 5DA4A 5E1AB 3VW3L 3G3LA 3AWEA 3TEZA 4YE0A 1BM3H 3UBFA 3KAAA 4PLNC 4R4BA 4LMQI 4JG9A 2YK1L 1CQKA 4M8QB 3NP3A 4EZMA 1O7DC 2VXTH 4Y7MA 9CGTA 2EYTA 4QTIH 4OLVL 1MCLA 3PXJA 1NEZG 4BKLA 3QPXL 1BZ9B 1WISA 3BZFB 1UOWA 1Y7VA 1BYOA 2FT8A 1I9RL 3D0LA 1P5VB 2AJ3B 5I15H 5GRUL 1B6UA 3L3KB 1YNTF 3FOLA 4ISVA 3GSRA 4HAGA 4OUOA 4QKTA 3TBTB 1PGRB 2VRKA 2J5LB 2FHCA 3Q2VA 1RZGA 3GD1C 3S5LG 4N2AA 3U25A 1DUZB 4XVOA 3MRHB 4KZ0A 4PS4H 3UG5A 2EYRB 4BUGA 1MCNA 2L0DA 5IHBA 3ARFD 3ZKXC 4PB9H 2AQPA 5D1QC 4YDKL 3HI1B 5DJYB 4I3RH 1T20B 3GMMB 1AHMA 4FTVA 4L1DA 2X89D 3CDZA 1XGQA 1NBQA 3H3PL 5F93C 4B60A 1B9KA 4WUUD 4ZXBB 2YKLL 5E6ID 2BO0A 2BSTB 1KTRL 4QT5A 2PXYA 4TNVF 3OHXC 1OSPL 5FO8B 1MLBA 4APQC 1LDSA 5FGCB 4IBSA 2VDNB 3KG5A 3SD5A 5IHZA 2V5YA 3ZKNC 2P43B 4YJZL 1R5IB 3WEBA 5BXFB 5DHXB 2NY4C 3LMJH 3D18A 3RL2B 2JMRA 1U91A 3CD4A 3UYRL 3SY0B 2OP4L 1N59B 3OLIA 4UIMB 4G1MB 4PRDB 4R2GD 4QMEA 3BP7A 1RP8A 3P77B 1KBWA 1BQ5A 5DT1L 4HUMB 3TNMA 1NC4A 2DM2A 2X0VA 4E68A 4E0RB 4R0LC 2GUOA 1U95A 4U49A 3KBEA 1SVBA 2OR7A 3NUKA 2H1PL 4JJHA 4XH2A 2QPDB 3IMWA 3IDXH 4FNLH 4Y4HA 1F42A 2HVBA 4CADB 3SDXF 5HHNA 2WBJD 1YJDL 3X14A 1J11A 4Z3TA 1KLGA 3KLDA 5KANG 1GOHA 3EJUA 3TO4A 3LSOB 1U41A 5EBGA 3GLAA 4R7NA 2WIIB 3PHQA 5IB3A 3MO1A 3T77A 1DQTA 2VM9A 4Z0XA 4OVUA 1FBIH 4DFHA 1FP5A 3QUZA 4LO9A 1QRND 2O5ZL 3MV7B 1D5ZA 1KGXA 3GSNA 1WAAF 4WU7A 3LKRA 1DDTA 5AW3B 2OZ4L 4ZFQA 1T5XA 2LU7A 4AQZA 5JIKA 1IC4L 4JRWA 4GJTB 2VXQL 1EXUB 3QZWB 4LCVA 4MYPA 4Y4HB 4GKZA 1EGJL 4JFYA 4ALAC 1KY6A 1ET5A 3OMAB 3KXFD 1ZAGA 3IFOB 2ILLA 3LPGA 4NAQA 3FTSA 4HK0A 1N5YL 1GPOH 1JZDC 4Y1SA 4NWUL 2X4TA 1G43A 1U8IB 3AC0A 4K5MA 4MSWB 1BAGA 5IIEA 3KL0A 5FXCH 1BXXA 2XNAA 1I1RA 2VNCA 3TVMD 4WKZA 3WMSA 4J3VA 3VFUA 1CFNB 5E6SB 3ABMB 3W56A 3TVMB 4MVBC 3T0ED 1UKTA 4X6BB 2FEJA 3LPWA 3ETSA 3UP1A 2H32H 5HHXH 4AIXA 4I1NB 4TSBL 1HQRA 2NW3A 4JFWA 2HFEB 4LCCC 2GEEA 2Y7OA 2WLLA 3AGWA 4OD2A 5D7JD 1KN4H 3BZ5A 3IEAA 1YSOA 2BDNH 3HG1A 1DJHA 4XCFH 5D5MF 2E7LA 3EZ8A 3MQIA 2ADGB 2VLRD 1H5BC 3OQRA 2J1KA 5HDBF 4FLSA 2ITCB 4PGEB 4ODTH 1S8DB 3D3VA 4U6VL 1OZTG 1FN4B 3ME0A 4LIQL 1PFOA 3R8QA 4K23H 4P2RE 4XXDB 4Z77B 3RIFK 1C1EH 1CFNA 3EYSL 2CM5A 1MCSA 2AXFB 2V2WB 5DO2C 3ATEA 5H4ZA 4X0KB 3MLWH 3CXFA 3MLVL 4XCNB 2CE6A 1GJUA 4OCNC 1EO5A 3ZGHA 3MJ9A 1YJDC 4YAQB 2JJWA 3EO1B 3GXFA 1PYWB 4ODTL 4PJBE 5I17A 5IEKA 4FQPA 4AYGA 2A77H 3QUYC 5JHLA 3EJZD 4ZMNA 4YHPB 2CNYA 1CDCA 3WLBA 5LXGH 5BO0D 3EDJA 4M5YL 3BQUD 4OCWH 1T7VA 2A73A 3IKCB 1TZIA 1WD8A 3ULVL 1BLIA 3CC5A 1HYRC 1ID2A 1A7QL 4P2RA 5FUZH 5C0ND 3GTVA 5EO0B 1BAFL 1GKEA 3TGXA 1N0LB 3CVHA 3CV5A 2OMYA 1BOYA 1JXJA 3S34L 2BOBA 3UROR 2OJEB 3TBVB 1I9RH 4DPBX 3TT1L 4B97A 3BDYH 3GLEA 4PS4L 5EUKA 5IQ9B 1HAWA 4MSWA 4OBRA 4WWKA 2ZXWB 2AV1B 3EJJX 1JI1A 3RQ3A 5E2TL 3UBXA 2E47A 4FQXB 3US1A 4ELMA 3QNZA 2WTPA 5EUOE 4NKIH 3B8YA 4N5UA 4OTXH 5FYKD 5I1IH 5ADPL 1J8KA 4X5WB 4YSAA 3KW7A 2VN7A 1JL8A 1GMIA 2ADFL 2NY1C 1DE4A 2NUTB 2K6YA 3IJ9A 4P2RD 4WU5B 3RA7L 3PWVA 5AD0B 4JG1H 1RU9H 4K7PX 4A7GF 2IXQA 2WXHA 3ERXA 3LKRB 4L1SA 4XNMA 3SE8H 4NQEB 4P23C 3O45B 1OGSA 2F61A 3C8HA 3F65A 5EN2B 5C0GA 3TZVD 4KGLA 5A6LA 1YEIH 4J3UA 3ARGA 3QDHA 1Z9SB 2NNCA 5CSZA 4A66A 5BS0B 3DVIA 1CICD 3ARBC 4P2OD 1LNUB 3SDXB 5IREA 4XVTL 2BZCA 4FL4C 4C56D 4H1LB 4PWEA 1RU9L 4TQ8A 3US9A 4LLWB 3VXQA 1AE6L 1EBPA 1FNAA 2QELA 3MBWB 1OAQH 4W9JC 3LNEA 3B2VL 1NANI 3C09C 3BSZH 3PAYA 4ZPTA 3S4SG 4G82A 4HWZA 4QRSB 1ZOXA 3NTCL 2MQCA 1G6RH 1HQ4A 1U2YA 2QT6A 3AADB 1NBYA 1X5YA 3QQXA 4JFPA 1EO8H 1LQBC 5DD3H 4MXVF 4Y5YA 5EU6A 3TT3L 4ZMOA 2ZP0T 2CJUH 4AEEA 3KPTA 2ZYHA 4DW2H 1M2OA 2PTUA 2R1YB 3NSYA 5E6ZA 4AL8H 1KJ2H 3L9YA 2CK0H 4LLAA 1ZSHA 4J12A 3VXOA 2QHLA 2XDHA 1C9SA 1UHVA 1JFQH 3TCLA 3O9WC 4HETA 4N3UA 4Z7UB 4AL8C 3IWVA 1G9NL 4FDWA 5DJAA 3ZR6A 5I24A 2JI1A 1FL5A 4G8GB 3SYOA 4MCYA 3VXQB 4U3SB 4UQDA 4MAZA 3ZO0A 3PAVA 5BZXA 4L4VB 3GUTA 3KYMA 4HF5L 3E6HA 1KXHA 2DM3A 4F2ME 3BFOA 3BP4A 4L0YA 2I07B 4TULH 2HKHH 1UXSA 3BWSA 1CWVA 3K91A 4KJYB 3MLTA 4X8JB 1JNHB 1VCBC 1LXMA 2ADYA 2ENQA 2LU5A 2UWEE 3SN6N 5C0JB 3MJWA 4NZRL 4XCEA 5DWUH 5EZLA 3QJFA 2HJKB 3LEXA 2O61B 4ZNCD 2ZWSA 4YGVA 3UBHA 4CN6A 4QI3A 2JFCA 2EIBA 3X17A 2J6EL 2IWKA 1WCBA 5DI8A 1J48A 4PW9A 3HZVB 5BW7C 2N7BA 1AC6A 3Q3GA 4XN4A 1AHKA 1SMAA 5FYJD 3KPLB 3DETD 3PP4H 4JDZB 3KH4A 4JBSA 3CE1A 5DHYA 3FNKA 1YN6A 2EILB 5C9JB 3OKYA 1ACYL 1JGUL 1W6WA 4LEOB 4UQ3A 5D72L 4MJIE 4M7LH 1I8LA 4JGUA 4OZHF 5DUPL 1DBKH 1ZCRA 3FZUC 1J1OH 1Z7JA 5DHMC 1BQHA 3FULA 3TJHD 4JRXD 3WJLA 4PY8I 3S2CA 4K7PL 2H6PA 3HE6C 3UL4A 1NC4D 2JXMA 1V55B 2J1WA 3N43B 1A3LL 1G7HA 3C8DA 3FQWB 4KDTA 4ZUSA 1Q0YL 3I85A 3QUML 5I16B 4F2EA 1JGUH 5TE6H 5IFHH 2J8UF 1D7DA 4Z95L 2NY2B 4M7LL 3MGAA 4Z3FA 2JJSA 4BQ6A 4BXSV 2DQIL 1MCQA 2CNZA 2LV4A 4YL9A 4Q2ZA 3JT2A 4AOFA 1JS4A 3L95B 3UC0L 3BN3B 2E56A 1A66A 5J1TC 3JBG7 1JYVA 4QLWA 4DP6X 3H9HB 2E7CA 4TUOA 4XE0A 3S35X 1KYOK 3WKML 1BBJB 3ARDB 3UAJC 4ZRGA 3CX5J 3O9WA 4PJHF 1MAML 4JFTA 3D9AL 3RGBA 2N7AA 1AP2B 3HC2A 5HHPA 3BYTA 3GI9L 4M6ML 3C5ZD 4JFDD 2MFNA 5LN4A 1NA8A 2CBPA 4E41B 3MGOA 1IL1B 2J3SA 1R3IL 3DI2B 4XB3A 5I74B 3LS5H 4KQ3L 5JW3L 3ZDXF 1MUJB 4M1GH 4ODHL 5EC2B 2B4CC 3ATFA 5CLZA 4FG6C 3MV9E 4I18A 3QAZB 4RDQG 4EXKA 2IH1B 3CWGA 2LU4A 2ZG1A 2NW2A 2F53E 4B6ZA 2VRQA 4JHWL 3LN9A 4K15A 4X5QA 5HJBA 1LQSR 3MTXA 3T6ZA 4DN4H 1ZVNA 5CM1A 4J6RH 3II2A 4X4YB 4PVLA 4R97B 4M93C 4GRLC 1GC1C 4Q6KA 3LJ3A 1U8KA 3KBFA 3F6JA 4ZX5A 4NNPL 4FG6D 4XPGH 4YQXH 1S7XB 2GIYA 1II4E 4Y2LA 1MN4A 4LEOA 4UQ3B 3ATAA 3CMOH 5F7NC 2AXGA 2NMSA 1YPZA 1MQKH 2BY3A 4QTHA 1AS8A 3CCHB 1K72A 3CSPA 4MFHA 2QTVA 3TJEH 1M4KA 4WF7A 1XXDC 1OARH 3GSNL 1OAQL 1YEJL 5E5LA 3U6XS 5DVKA 2IH1A 5K9QI 5E23A 3HBPA 2D0HA 3RFZC 3G6AB 3N55A 1P4IH 1ZHKA 4NQEE 4MHHG 3AUWB 4PJCE 1MCHA 1TG8A 1KXQA 1PQZB 4JFDE 3MU3A 1BVOA 4MQXC 5CCHE 4L8DB 3NACL 2BSSA 4M6OH 1IFHL 3H2QA 1BD2E 3J2PA 1ZJAA 2H32A 2GBUA 2N56A 2ZXBA 4GMTL 5DGRA 5I71B 1LO2L 2ZPKH 5ESQB 1OCWL 1QAWA 1XF5B 4HCFA 25C8H 5CBAB 1VFBA 1HCYA 4IS6B 1OTUD 3HVNA 4PLOB 1RSYA 4NO5A 4U2ZA 4OZIB 4NM4L 2YFOA 2ZXDA 1ZHBA 4JFQA 3GXTA 5B1KA 3MRIB 1ERNA 1WA0X 3QQ4B 2EDDA 4FKHA 1WJ3A 1RK0A 3GXDA 4XP1L 3LRMA 2BJML 3DIFB 4LCYA 5MP6H 3OKKB 4A68A 4GG6E 4CC4A 3TX4A 5L88H 1N5AB 2D03H 1AG6A 3GTNA 2I7OA 1PNCA 4D8PA 4JO2H 2JKNA 3MODH 3WO4C 4DP7X 2KZWA 5FYKH 4NP9A 4L8BB 1AACA 2VH5H 4KPHH 5F1IA 2WP3O 3NAAH 3QNFA 4DK5A 2EH7H 2H8PA 2UVFA 4FX5A 5EEVA 3G5YB 4WW2C 1XL6A 5E4AA 2J12B 4FQCH 3DHPA 2C4FT 4KHTL 3SE3C 1PY9A 4BFIA 1E30A 4X7SH 3WS6C 3IK2A 4AC4A 4PJIF 1HL4A 1F4WH 3TEUA 2ZOOA 2ZOTA 4PRPA 2P3YA 5ID0A 3F58H 2H0PA 3IWUA 1MCKA 4H26A 3SKMA 1QYGL 5IR1B 2WSPA 5GRJH 3OBAA 2JVUA 1OGAB 3ZE2F 2C26A 1J9SA 5JHBA 2X4NB 5FO2A 5DQJB 3L5HA 2XFGB 3DK0A 3BZEB 2JB6B 1KTKE 4NC1C 3H9SA 4FEIA 1MJUL 4DN3L 4DTGL 5K9OB 1OGTA 2ZYRA 5F6HJ 2QTEA 4XBEH 4JQIH 3DDGA 4XCFL 1VLXA 1UWYA 1ILSA 1T6WA 3MBED 8FABB 3DHMA 3TPUA 2HYMA 5C92A 5E95B 3RJDA 3IF1A 1VFBB 2ZKHH 2Y25A 4XBPA 4MJ6A 2KLSA 3UPAA 1Y18B 3PY9A 2APFA 3HAEG 1NL0L 4IRSD 4WFHE 3PL6B 3VFPA 1L3WA 1LK2A 3GRWA 4RAHA 1S7WB 4YZFE 4OLUL 3MNDA 3QDGD 1V10A 4PS7A 3O3BA 3ULVF 4JHVA 4C83A 1JZ7A 2CXKA 2J55A 3L45A 3S5LA 1TVHA 3RNKB 3QQDA 4JDVA 5ABZA 2QFRA 3P9LA 1K2DA 3MRGA 1UWGH 5IROC 3W2DL 2LVCA 4PV9A 1OP3H 1AGDA 1UH2A 5L2JB 1NBCA 4F20A 1IEAB 2A9AA 4BRJA 3CFDA 5T3XH 4F7TA 2XUWA 2GB2A 5HGHA 3ZSTA 3G5VB 2O6PA 1C5DA 5LQBL 3A6CL 2Y1VA 3VFVB 4XP6L 2FECI 4BFRA 3HG3A 5EOCJ 3O6KH 1LK3L 3ALPA 5IVZB 2HTLD 2JE8A 2WN3A 3OHXB 4ORGA 4LLDB 4ZXBA 3GXPA 3WFEH 1XH2A 1FNHA 1LLAA 5I30L 3UH8A 1OT2A 1P1ZA 3IN2A 3PPEA 4QLRA 4XO3A 3RWFA 1A4JB 4WV1C 5CJQL 5D7IA 3FFCE 3MV8E 1VENA 3NCEB 5FOBA 3LIZL 5AUMB 2NY4B 4ZMYA 1E6OH 5IVXE 3WY1A 1HINH 1ZSDA 4ZX3A 4BD4A 5SWSD 3QR0A 1DVFB 2MCG1 4KTDL 4UZSA 3I9IA 3RBGA 4D3CH 2FWOA 1AO7D 4NN5B 2FEEI 1CYXA 3E80A 3FS9A 4BJLA 5I0DA 1GZPB 3MAWA 1YMMB 3ZTJH 3D69B 1CB4A 5DJXA 2YLKA 2YD9A 4CMMB 4DGYH 2PYEB 1AMXA 1ZLSL 3CSFA 5F8RC 4Y1TA 1RIVH 5D70L 5HJ3B 3GBLA 3WU1A 3VRJA 3WNKA 2XXMB 3QJSB 5I8CA 2XACC 4CDGC 4PI0A 4M8UA 1QNIA 1UM5H 5DC4B 3V6FB 5CBEB 4QCIA 3FH7A 3VD5A 1RY7B 4NJ9H 2GFBA 3MYZA 2Z0BA 1BCIA 5J7CC 3BRGC 3BJ91 1KG0B 3C6SA 3LQZA 1GH7A 2JJUA 3MV7A 2OMXB 4FHBD 4P2CG 2VO8A 3KJ6H 4AVJA 1A0QL 1BZ9A 5JOEA 1EGJH 2OCFD 4BCZA 3UDWC 3V4VB 4B5ZA 2EE2A 5I0VA 4MMYA 4GG6A 2AQNA 2F15A 3FQNA 3V4PH 1VZHA 2QR0B 5J56B 4RZCA 2XHNA 5J0BA 3P4NB 1PZ5A 2AAVA 2XICA 1L9NA 2XXFA 2IBZX 1MCOL 2QLVB 3NAAL 1JPEA 2CUAA 3A4EA 3OHXA 1YNKH 1WC7A 1AY1H 4GBXA 2MKWA 2EUVA 5C0AD 4DQOH 3TNNB 3JYBA 4WTZA 5EZJA 2XZQH 1MKFA 2DLHA 4WK2B 2X1OA 4JZJC 2IBZY 3WOVA 2BCKB 5C6TH 4AXWA 1A25A 1E5AA 5FO9A 1A1MB 3CVHH 2ICWA 4YSDA 3ZO9A 5KJ7E 5KS9F 3SBRA 3MLRH 3TO2A 5J6HA 2EE6A 3GIVA 3TV8A 2IH3A 4X7TB 4GW4A 5ITFA 3GC3A 3K6SB 4QXVA 1F11B 1X5HA 3PP4L 3E8UL 4JM2C 4DH2A 3H6AA 1XAKA 5IW1B 3WYRA 3IFLH 3VD2A 1TTBA 4OF6A 4XWOC 5FYLE 3BVNA 2X87A 1Q90A 4MXWH 3QISA 5E00A 5LWYL 3WO3B 1BLNB 5DD1H 3OAUH 1EXUA 5DZPA 4JO1H 4F9PC 2Y7LA 4Y7OC 1DSWA 4BUQA 1QRNE 2B0SL 5H37G 4HKZB 4PMFA 4X4MA 4HXBH 5D5MB 2XG4A 1JHKH 3L4WA 2CBTA 4P46B 3TIEA 5EZIL 3QUYB 3STBA 3P2BA 4N85A 2Z8VC 1XSOA 1FG9C 2N4IA 3ZDYE 1NUFA 2RFXB 4Y4KB 1I53A 1P4UA 4E5XG 4JO1L 4P49A 4XHQA 5E9DE 4N90E 3K8MA 1ZTXE 3EDEA 2WXIA 4KX9A 1TZIB 1CVRA 2KC0A 1F8TH 3U2JA 3NJJA 1KCRH 3W9DA 2BIIA 2X2IA 5IWLC 4RNRA 3D0AA 4Z7WE 1ZHLA 2F54D 4ZYKB 3H9YA 5KS9A 3T4YB 3HC4L 1BJMA 2CHWA 2YXWA 3KYAA 5AVRB 4BK8A 2CJ3A 5L8JB 1A6VL 2PKDA 5EUKB 1W8EA 4YN3A 5CFAA 2P1YA 1TFPA 4YHNA 5JZ7D 4HCIA 5TPWL 1DLFH 3KCWA 3ZN6A 5E6IC 3OL2A 1SQMA 4YPGA 4OCRH 5IIEB 3HNTH 3WBDA 3L3HA 2P7TA 2G4EA 4YFLF 4J23A 4FMVA 1FFTB 3VGAC 3IGAB 3ZPDA 2CK2A 5DZ9A 1CN4A 1F3RB 3O45A 5C0GB 3JWDH 5AWNL 3HHMA 4A2MA 1O5PA 4LKXB 4Z7OE 2GSGB 4QTFA 3L4XA 1QBMH 2X53A 4XAWH 3GRWH 5JYLA 3QUZB 1JF1B 4AX3A 1NGXA 1A2YB 5AW0B 1F4AA 1M7IA 1KBKA 5ILTH 3CIAA 3MBWA 1EVUA 3K81A 3KEHA 3JWDL 4NUMA 5CJOH 3B2VH 3HE7A 1S8DA 1FN4A 4UOZA 4BELD 4UT9L 2FD6L 3UTPE 5KOVC 4HKZA 4KXCA 5DRZA 1KFAL 3ZE1B 1F58H 4WWKD 2OR8A 5AZEL 3NIDB 1M3IA 1AKJD 1RIVL 1TJGH 5D70H 5JXED 2WQSA 3RDJA 5DSCB 1LM8V 4JKLA 2WUBH 1WBYB 3QI9D 1HJCA 5AB2A 2AI0L 5F7KC 4WU5A 1CIUA 3CN4A 5GGSA 3W9DB 2QGBA 3MV9B 5CNHA 2YO3A 4KMTH 1G9ML 4KI5E 4NZUH 2H1LM 4MYWB 2ZCLH 2A2QT 4I3GA 1L9RA 2PLTA 4MD0B 5IWLA 1PLGH 4OCSH 3QUKA 1PMYA 5LB1A 4GKLA 4BSWB 4YHNB 2X44D 4CUCA 5C0BA 3M46A 5EB9A 1KTCA 5LG6A 2FHFA 2OBGA 2ITCA 3RGVB 3MUGB 5LCVL 4QHPA 3H53A 4Q9CA 2NY3D 2XWEA 1PX4A 2C3VA 2VLRB 3CN2A 5ABDE 5G4MA 3RIAF 2AANA 3N9GL 5FUCE 1WPCA 1FFNA 1UVQA 4LSQL 1HILA 5DMKA 4U31A 1ONQB 2HVJA 3LDBC 4BSVA 1RHHB 3CPUA 5DO8A 1U8CA 5J13C 3N1FC 4KK8C 3WXWL 4G6KL 1OTSC 1I9JL 2J4WH 4A7VA 2WW8A 4PJAF 2EJ1A 3AZUA 2XY2A 1XR9B 2FQGA 3HC0B 5JO5B 4WUUA 4DKTA 2ZWZA 4Z3IA 3QXDB 4PJ5D 3EOTL 2Q5BA 4KI5D 4HUWB 2JKXA 5DVOA 4KDWA 3WMPA 3SCMC 1OTSD 5FFGA 2FUTA 2ZOKA 2WTRB 4RAUB 4UTAH 4QGYA 4JL1A 3QQ9D 3C5JA 1HSAA 3FYEB 3K80A 3MR9B 4A6YA 4ELMB 3FSOA 4URKA 4PD4K 3VNYA 2WLIA 3B6SA 1UM4H 2CG9X 1X5IA 3EFFA 4LRNL 4YXKH 2F2HA 4Q7DA 2GCYA 3GGWA 4NRXA 5L4MA 4HISA 4BFFA 4Z78A 5ITBL 5I74C 3M1OA 5FHAH 5ICUA 4LSRH 3WIIH 4OZIE 1QSED 3IDJB 3MRQB 4PWIA 2IDQA 2GK0B 2GSMB 3W81A 2H6UA 3MUJA 1BQRA 2NY3C 1D7BA 1NCCL 2AC0A 2O5NA 4KKBD 1CYGA 3KWWB 2YGVA 2WKOA 2YA0A 1FGNH 1L6XA 1A7PL 2VLJD 2VSCA 2YQ3A 4LEBA 4ZUTB 3WTSA 3L1OL 5JZ7C 2AV7A 2VWEC 2DQJL 1J86A 1OGAD 1S7XA 1GGBL 3GSNH 3MA9L 5KW9L 2R0KL 1T4WA 1XH3A 3QXVA 2K7PA 3PF2A 3UZVB 1PZ2A 3SDAD 3FFOA 1RVFH 2NY5H 2VM4A 3G5XB 5G55A 3SHSA 2H9GB 1NSNH 2EDBA 2MCMA 1HHKB 3FQ4A 1E7UA 2FJHB 3UEZA 5EOQL 3ZDZF 2WQAA 4MAYA 3LH9A 1FCCA 1R47A 2VLME 3OMNB 3P0YH 5INCB 4PJHA 3K0YA 3LN5A 4POUB 2Z93A 5F7UA 3DO7A 4XP4H 2OSWA 1YECH 1I31A 4RH4A 3EYVB 4Y4FB 2XG5A 4HT1H 4E9RA 5CZVL 4Z3HA 3BSZL 2VWEE 4PCTA 1D2OA 2WVVB 3P2TA 1G6RB 4PJ9C 4F8LA 2ORBL 2VSKB 3HG5A 3FRUA 1XGTB 2FX7H 2A6JB 3GZPA 5DRXB 2WKOF 3PAUA 3QPQC 4LPXA 2F53B 2C1PB 4NN7C 3O11A 4F8PA 2F7RA 3LHPL 6PCYA 2IDSA 4L3EE 3FN9A 3L7FB 4P3CL 2F53D 2Z31C 1WAAE 3WE6B 2CO1A 3UJJL 2G60L 3LRLA 1YUKB 4PJHB 4I13B 1MXGA 1XCWA 4PJ7B 3IJSB 3K6DA 1KXTA 1MG2C 2WCSA 2AK4A 1HEHC 2AF2A 3FYIB 2Q76B 3RVWC 3LNHA 4IOSD 4AJWA 1TF4A 2YC1B 4PIBA 4Y9GA 5B1JC 4DFIA 1YPZF 2IVFC 3SDDB 2IPKA 2NYKA 3FQWA 4PRHA 4ZUSB 4MQXD 3BKCL 5I1EL 3GDCA 4B27A 3QG6B 2CLZB 4KHTH 3APDA 3X1NA 3LKNA 4F7MB 1BFOB 2MNJB 1UT2A 1EXGA 2QPEB 4M48L 4Z0BL 2DQEL 1CICB 3BIBX 2AEIT 3PV6B 4GAFB 1A6ZB 3P69A 3FCSB 4QXTA 3CCHA 5FYJH 1E5CA 1TZOA 4ZQKB 1JNNH 1HHKA 3SIKA 4LOFA 2ZD0A 3GS0A 2JLPA 4NNXA 4X5XA 2HAZA 2CQVA 3N40F 4PUBL 1HH9B 3DUSB 3CZSA 3GDBA 3UAFA 1FNFA 4HFUH 4HKBB 4JE0A 3TP4A 3QG6A 1D5BA 3F7QA 3QDJE 2HKAA 3EG9B 3DYPA 1LEIB 3RWCB 2EE0A 1TJMA 2V3DA 2CHNA 5HJGA 1PX8A 3U2SB 1XZ0B 1YYLL 3EDFA 1MJJB 1YMHB 3AUVA 1UACH 5JA8B 1IO4C 5GXBB 3BT0A 2IQ9L 5CCKH 1JE6A 3RX9A 3MRHA 5F21B 5C70A 3L4UA 4GKNA 4N6RA 5BRZB 3QZLA 5IJVB 5CJXA 1U8OB 4X6DB 3RG1C 4AG4L 4PJ9A 4D8OA 5BVPH 4DEWA 2DQIH 1TTRA 4GS7B 4LLMB 4A2FA 3DJZA 4U1LB 1H6UA 2E74C 3NJHA 1H3VA 4UILH 3E6FB 3VTMA 1AJ7L 4R7XA 4RQQA 2BP8A 1SJEB 4A2GA 1OKEA 4PJIA 5MP6L 1MJJA 2ARJQ 1MNNA 2PR4H 4IKLA 4OGQC 5J89A 2SEBA 3FW6A 3P0VL 1HDMA 3H9SB 5INDB 3UTTA 3SY0A 3ZY7A 1URZA 2DLIA 1XCQA 2CM6A 2MTPA 1IJ9A 4FFZL 5F6HI 3VG9B 4OGXH 4DP9X 1T0MB 1KOAA 4JFFA 2A74B 3LH8A 1P0SE 4PPTA 2CDFB 3WFEL 5F1OB 1UCBH 8FABA 2CO4A 4HIXL 2QHRH 4MNQB 2GEQA 4FLHA 3TLRA 5CGTA 4M43H 2WMPB 2BVUA 4OGXL 1DQML 1J1PH 4NDMB 3BPOB 3BKYL 4PQXA 3TZVA 3W9EB 5EBWA 1DQIA 5IROD 1U4EA 1KJ2A 4G8IB 4K5PA 2LTQC 3BRDA 1OE2A 4L5FE 3LEYH 2AQQA 4FZEH 3VXRD 2FZ3A 3I6GA 3LKOA 4XNZB 5KBNC 1F6AA 4OCYL 1KB9J 3T4AC 1E65A 1Q8MA 1E9PB 4KK9C 1OCOB 35C8H 1ADWA 3LKPB 4BA0A 2BVYA 2B9BA 1QFUH 1WD9A 3V0AC 2NNRA 4TSAH 1G9MC 4DGYL 5SWQB 2ID5A 3GBNH 3T2LA 3EYQD 2I25N 3N6YA 4WO0A 3O4OB 3TA3A 5D71H 3WUWG 3ZTDC 4HDIB 4NKOB 2GSIB 2YEVB 3IFOA 3T3PE 1N70A 5IBUG 5D1XD 3B9KA 5KSUB 4JG0L 1I9EA 2APXA 1IC5H 4EN3C 1WFNA 4G72B 1U95B 3FL7A 3NPZB 3B56A 4DHLA 3VD3A 1G9EA 3BVUA 3OWRA 1USZA 3GSUA 4GSDL 2HLAB 4MZ2A 3QP3A 4MXQC 5IJKC 5L6YH 1JPSL 2ZOWA 4MB1A 2EE3A 5IROA 2VUKA 2YAHA 1TMCB 1A7QH 5FUZL 1U9KA 3L48A 4LCUA 3DURB 2R59A 5FYLD 5KSAB 4APQD 5IHZB 1IAKB 3MLUL 3GBEA 2KQMA 3DYMA 4PV9B 2VC2B 3MPCA 4O02A 4JDTL 5AL0A 5L2JA 4TLTA 4WUUE 1Q38A 1KZYA 1JPSH 4HHAB 4LDCA 3TV3H 1IEBB 5DR5H 4A6YL 5EF3A 3LH2L 3JWOH 3CZEA 4HW6A 1P7QD 1JV5B 4J39A 4PI2A 4GBXB 3VXUA 5ANME 3C2SA 3MACL 3FOMB 4ZFZA 4CMHC 4W4OC 4XH2B 1QMUA 4IKKA 2D8KA 2XRAH 1N7MH 5E9DD 3CZLA 2R29L 1DUZA 2BNRE 3BFQG 4R7VA 3TV3L 3JSSA 4P2OB 2AVGA 4NERA 1WHPA 5L4IA 3E8UH 4ZT1A 4JQXC 2FJGB 1ZA3B 1BJ1J 2D7NA 2JNZA 3VUAA 5ISZD 1MFNA 3SQBA 2UWEA 3H85A 3MO1B 3T77B 4QDGA 1T2XA 4TSBH 4B9CA 1WP6A 3GUFA 4K3DL 1EHXA 4UQEA 4GRMA 2EEDA 3RNKA 2R23B 1S7QA 2R4RH 3VA2C 3WTVA 2DWTA 4QRBA 4ZSOA 3MRGB 4NJAH 4G8GE 4AYFB 2NNAB 3I3EA 2Q0ZX 1AS6A 4KZDL 1GS8A 5I8CB 1UD2A 4K9EL 2PR9A 2XKUA 4J1UA 4AM0Q 4MA1C 1UB5A 2Y2TA 3APMA 3VI4F 4NS0A 1E4JA 2MCPH 3QO0A 2YPKB 3OSKA 4JR9L 3U7YL 4A04A 2X12A 4BDVB 1UD3A 3A5VA 4PM1A 3X13A 4G80A 5TDPB 5DEFA 1C5BL 3MVSA 5C0AE 4MS6A 4AIOA 3T0XA 4YBHA 1DVFA 4NZ8A 3ABGA 1R24A 1ZWIA 5D55A 5FWQA 2VW4A 4GAYB 1PCSA 4WW2F 1QPKA 3Q06A 3P30H 1JCKA 3L3IA 3BAEH 2CLRA 5DDHB 4GAGL 4QHKJ 2HUHA 3O3DB 3GQFA 2NR6A 2YS4A 2TSAA 3D85A 5DJ8A 1OOWA 3SCMA 5GS2H 1IAMA 3QHZH 3HUJA 1ZHNA 3KDMA 4JM2D 3VGAB 3WFDL 4PS3A 1KF9B 4N0FA 3QUYD 1WICA 5IFAL 4DJMA 1T1WA 3MHZA 1H6FA 4G8AC 4X42A 2ADFH 2DYPD 2VLRE 4WSGA 1UG9A 2ZCKH 3BVDB 4JLRA 2G3XA 2OI9C 3ROOB 1AFVL 3HS0A 3VXOB 3ZQWA 1IM9D 5AG9A 5DVLA 4HS6A 2Q7YA 3ROLA 3TCTA 5E8EA 1OTUC 1JWMB 4OJDH 3T1FB 4TNGA 5IW1A 5H2BB 3O41B 5I6XB 4LCWA 1YEHH 2R23A 4OCYH 1MFUA 3QORA 2YIHA 4JO5A 4GUPB 1F58L 3TVMC 3ZJAA 3ZR5A 1RH8A 1I8IB 1KDIA 1DZBA 5CCGE 2YD3A 1YNLL 3NJKA 1DHKA 3BLPX 4MXWL 3HZKA 2EC9U 2XZCH 3I74A 4HLZH 4D9RD 1NLDH 2X6UA 3MCLH 1EJOH 3MRPA 3SDCB 2BVTA 2OFQA 2V37A 4AV0A 4U1NB 4BZ2H 3FUMA 4K23L 1KMGA 2NY6B 2WGNB 1QSFB 3HUJF 4HHGA 2ADJA 2OW7A 7FABH 4MMXC 2W1NA 4WWID 3IM1A 3MLWL 5DVNA 3MX0A 5GHWH 3V4UH 4YXLL 4OZIF 4PGDA 1T5XB 5B39G 3ARXA 3I9GL 5C0FB 5KYUB 2EC8A 4YAQA 1S7TA 4X4ME 3N0PB 3C87A 4DETA 4RVBA 1R24B 2R0WL 3NSJA 3GIVB 4RMWA 5CR8A 3ZK0A 4QYAA 3QWOA 5CU5A 2I60H 3V9CA 4CNIB 1M6UA 2X9WA 1D5XB 4M5YH 3T3MF 3UZEC 5DR5L 5F9WC 4A6YH 1N0XH 4G5ZL 3ZQXA 2K6ZA 4XMKL 1KXVC 1T1XB 4R26L 4O2FB 5EBLB 4R3SB 4KI5F 4NOBA 4EI6B 5CEZD 1JI2A 2JXMB 5CGMA 2AJUH 1IQWL 1XXFC 2X6AA 5FCSH 2EYSA 3NGBB 4QOKA 2IDFA 3VXPA 3VFWB 1ACCA 1M1XA 4H25A 2MQ3A 3AG4B 2VZSA 4Y5YB 3IJ8A 5DD5L 5KSVA 3UTPD 3W39A 4DGVH 4RDBA 4WI3A 3CPLB 5DD6B 4ACTA 4ELDA 1CU4H 4LEEA 4PJXA 5DLML 5FX3A 1GCYA 4HS6B 3ZKND 5L4JA 3V8OA 1AR1C 3RHWF 3T2QA 2KZKA 4JO8A 2CDEA 3OKEA 1M2VB 3ZXAC 1JZIA 4N9GA 2OQJB 4BFEA 1BZQK 1QBML 3OXRB 4OJAA 3JV6B 5D7LA 4XXDA 1QBAA 1XF3B 3LNDA 5HHPB 4FQIH 2QADC 1RZIA 3K6FA 4GIOA 4NT6A 2Y6SD 3FTZA 4J4PA 4M03A 3VU1A 1KJ3H 4HQQL 4JFXA 3V0VB 3OC5A 4U2YA 1TXKA 4ADGA 3LX9A 5EU7C 1CVSC 3BE1L 3L08A 2I9LA 3DETC 4FABH 4LKCB 3WLBB 5SV3A 2NW2B 3VD9A 3C9NA 4MJID 2VMJA 4YNYB 5AALA 1SF5A 4HUUB 4MNGA 2OQJA 5LDUA 2DMBA 3ZX1A 3G5WA 1ONQA 1T83C 5LBSA 1MI5E 1RHHA 1UOLA 1JGIA 4ZW7A 1I8LC 4GW5B 4TOYL 4QTHB 3QYCA 1VB9A 3FO9B 1FNSH 5TD4A 3QFJD 3TBSA 3BVWA 2I9LB