4OR1A

Structure and mechanism of fibronectin binding and biofilm formation of enteroaggregative escherischia coli aaf fimbriae
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
144
structure length
129
Chain Sequence
STEISLEGLHNMGEQLFDGDILATGRIICRERHTGFHIQMNARQVEGRPGHYIVQGSKDTQSKLWVRLGREGWTSPQGIVRSGQEEQVIFDVMADGNQWAKPGEYIFSVSGKCLTTAVAKTATSTITVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Invasin homolog AafB, Major fimbrial subunit of aggregative
publication title Structural insight into host recognition by aggregative adherence fimbriae of enteroaggregative Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 21
structure length 129
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05775 AfaD Enterobacteria AfaD invasin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4or1A00
2CO3A 3UIYA 2CNZA 2IXQA 4OR1A 2CO2A 2CNYA 2CO4A 2CO1A 3UIZA 2CO7A 2FVNA 4PHXA 2CO6A 2AXWA 5D55A
chains in the Genus database with same CATH superfamily
3BH9A 1S7UA 4HD5A 3ULUF 3JWDL 3RP1A 2ZONA 3ARWA 4KRLB 3V6OE 5CF3A 3B9KA 3SCMA 2VC2H 5D72H 4LEOA 1I9IH 1A22B 1MLBB 1UD4A 5HSFA 1DDHA 4W9JC 5EOTA 4KXZH 4JN2B 3NK4A 3HAEG 4QI3A 1UADC 3EDKA 2R51A 3HHSA 3VFMB 2C4XA 3ULVC 3EJJX 4GEIA 1G4MA 4LLUA 5ISZB 4BE5A 2X6BA 3LN5A 4OD3L 4WAFA 1FFOA 5TDPB 1XT5A 3HI6H 3RLSA 5F7YC 1EHKB 2APWA 5DHEA 1Q72H 5EH1A 4AQ8A 3OKOA 1LDPH 1BQLH 2WBXA 4NIKB 5DDHA 3CQFA 5F96L 3PWLA 4E9YA 2C3WA 3PPEA 1G7IA 1LP9A 3AVEA 5LN8A 1PX4A 4WTZA 4ZUSB 1CO1A 4Y4KD 3HI1B 1TZ8A 2FDBP 1BD2B 2IQ9L 3KLLA 1SJEA 4XPAL 4BHUI 3O4OB 5GRVK 1RHFA 2K6WA 4CN6A 1OB1B 1J8HA 3NIGB 3W5MA 4Y4FA 4NBXB 5DUPL 1ACYH 3M88A 3UAFA 2FBJL 2ODHA 2B39A 3DIFB 1E42A 1MFVA 3WI9A 2X4QA 5FV1L 3CFEA 2QQNH 1CUOA 4HDIB 5IIEA 3CDCA 4M8UA 1CD8A 1JFHA 1HL5A 3WJMA 2NNRA 1VACA 3DPDA 4P3DA 3ZSTA 4LAQL 3PDGA 4G8FB 2HVKA 2VZUA 1UHVA 2PO6B 3T2QA 2QKIA 4KOCA 4WNQB 4G9FB 5EEVA 4WHCA 4KTGA 3UOAB 3CLWA 4ZMXA 3U36B 3UAEA 2WWMD 2BXYA 2W0FA 3FU7B 5EUOA 2GJZB 1FQ9C 5IW6B 2CA4A 4DUXA 4BFIA 3T3PF 1A7OL 1NFAA 1YEJL 2X38A 3O4LD 3TJEH 2PYEA 4QRUB 5K9QI 2X05A 1P5UB 1T5XB 1PIGA 3AGVA 1E4KA 3QDMB 2BIIA 3KPMB 3H55A 5EO9B 4L1BA 4TQIA 2Y0SA 3F04A 5K1NA 1UXWA 1AGFA 3ZZQA 4GKSB 5J12C 3MGOB 5SWSE 1LK2A 3ATBA 1NGWA 2EDNA 1IEAB 1T22A 1XZ0A 1BGXL 1TXKA 3G5ZA 4OZGA 3KAAA 4N2IA 3K0YA 3GBML 5GZNA 4FNLL 5I1IH 4P0DA 2HTKD 2EJ1A 4PGDA 3QH3B 1HOEA 1V3LA 2CDEA 1NDTA 4PJXB 4PRDB 3V0HA 4HXAH 4OY9A 3T8XB 1NGZB 3GPEA 4KZDL 5AVXB 5KSBF 4JZNB 1G6RH 3LKRA 1QTYT 2H2PD 1B3IA 4YDKL 4JY6B 4Z77B 5EU7E 5DUBA 3MRKB 4KROD 5GSRA 5T1MA 2EAEA 1FH2A 2YS4A 1EIBA 1YMME 3KBFA 4XN8A 3HB3B 2FX8H 3KE0A 5BS0D 4FXGC 4TNWF 2AF2A 3P4LA 5H35B 1PW3A 3BGAA 4GXFA 5KJ7E 3WFDL 4C55A 2MSPA 3ARBB 4OUUA 2EZ0C 1NMBL 1RURL 3KM1A 1OTSC 1BM7A 1KUMA 3QG7L 2D03L 1EZVY 5KS9A 4LPCA 1C5CL 3MMEA 5C0EA 3FQRB 4KKLC 1TTUA 2LU5A 3QJVB 5K9OA 5FW8A 3HBQA 5HY9B 1FC2D 2FLBT 4PWEA 3O8XC 2EEFA 1R3KA 1TCRA 2P4AB 1J0KA 2CO1A 5E7FA 4AUUA 4U3CA 4WFFE 4M6AA 3QO1B 2WINB 4DP9X 4J8QA 2BIMA 4YHZH 1WFIA 3EDFA 4EDWL 1U8QA 2B3IA 4ODVL 2BNQE 5D6CA 4ZDHA 4ZZKA 5F88A 1IC0A 1S9YB 2WW8A 5GRYA 3M1BB 4E41E 3CFDA 4AL8C 3SDXF 1XD0A 5CKAA 1A1MA 1U33A 4JQIA 1HCZA 3C2AH 3FT2A 4PVMA 2HRPL 3G08A 1BOYA 3NJIA 3MA7A 2O6EA 4IBUA 5DRWB 3L16A 1OVZA 1OD7A 4JFYB 1NKRA 1W0VB 3HRZC 4HGMA 2AQTA 2G4GA 1JZDC 2DTML 4PSPA 3GZPA 3RFZC 3HIZA 4F37F 2VDOH 3S6CA 4U6HA 3NCYS 3INUL 2VABB 2ZYIA 5C70A 4CADB 2CLVB 4NN7C 1KF9B 1Q1JH 4HFWB 4X80L 3G5VB 4BFEA 3RNQA 4GJTB 4FG2A 3CMOL 2V37A 4LRNH 4BKLB 2AK1L 4F2FA 2JB6A 2VTFA 4JKMA 4YHIA 3GSQA 4JHZA 5B38G 3JV6A 4QRPA 3U9UA 4XXDB 2DDQL 1OCCB 3D3VD 4F7KA 1TLKA 4PJ5A 1UOVA 3MUHL 5DHVH 1INEH 1JE6A 4S2SB 3R4DA 4IRSB 3MLRH 2F5BL 5DVMA 1BREA 1T04B 2D3NA 3W37A 3X13A 4GRWF 1BZ9A 1CF8H 4LU5H 3TONA 4NFCA 1QUPA 3O3DA 4F3FB 5JTWA 3BE1H 5C0AB 1AG0A 3BAEH 1E6OL 1KLGB 3P4OA 4HP5A 1MHHA 4OV5A 5HYSG 2FWOB 1OCZB 2BOCB 4F27A 3EUDA 3IJSA 2J4WH 2EADA 4FQPA 4D9LH 4MAUL 3SE9L 2KDYA 2WXGA 5ITFB 5EBWA 1VPOH 5K93A 5IJKA 3CFNA 1W72H 3BEWB 4D0BA 5ILTH 4JRXE 1YQVL 1FF5A 4Y9FA 1Q9WB 3BZ5A 4FYSA 4IGBB 3S3SA 5I30L 4N0RA 4MSWA 2IPTH 5CS7A 4PS4L 3GD1C 3ZL2A 1FZMA 5D1QD 1NDMB 2NW2B 3NOIA 1ZY9A 5HYIA 8FABA 5CD3A 2I7OA 3VO0A 1J5IA 2XA3A 2VSDA 3J7HA 1CBVH 4A2MA 3KJ6L 1D5IL 3UAJC 4O02A 2WQ8A 2V17H 3EJYC 3DETC 5JDSA 5E8EB 5EG6C 3BPLB 1XTMA 2OZNA 4HWZA 3RVXD 4JFED 4HZAA 3QJRB 4LLWA 4AVJA 3R18A 4QHNB 2OTWA 3BKYL 4OVUA 4GXVH 4XE0A 5HPOA 4HJ0C 5FX3A 3S3DB 1R46A 1ZXQA 5ICZB 4POZC 1SY6A 4FQXC 1LD9B 5EBLA 3O6FC 4Y7OC 3V0EA 3V4PL 2VYRE 4BV1A 4BFOA 3S4SA 4YHOL 4JL1A 3L7EA 3RL2A 5IWLA 1KPUA 3TWCH 3ULVL 3LKSA 4NIYE 3TZVC 2NR6C 1OEZW 2WWOA 4HKBB 3VTMA 5EOCL 3H3BC 5I1KL 3ML8A 2DQHH 1TNNA 1ODUA 5E4IA 5GSVB 1UT2A 3BT0A 5KVFE 3JV4B 4YSTA 5T1LB 3RWCA 4AC4A 3ULUC 2QGCA 1CGSH 4GUQA 3QEUA 2ZG3A 4X5WB 1N26A 1QASA 3T0ED 3D12B 2WWKT 4GLRH 1Y1DA 3FCTB 3OZKA 4IJ3B 4QJ3B 3UZVA 1R0AH 4H25A 2XN2A 1OTTC 5IMKA 1S8DB 1JHTA 1OGAB 2A9AA 3ZK0A 5BQ7A 4JZJB 2C26A 4XNMA 5E08H 4I77H 1DQDL 3GLEA 3NFNB 2Z35B 2Q7AA 3CSBA 4U6XB 2P8MB 1ED3A 1KY7A 3JVGA 4WI9A 3OAZH 5E6ID 3GWJA 3DMMD 2BP0A 4FEIA 2W9EH 3O45A 2DQGH 4K7PY 5KYYA 1ZJAA 3RDTA 2VN6A 4RFNB 2F74A 1HJBC 5JPMC 2HJLA 1QKZL 2V7HB 5ECGA 4ZMWA 4POUB 3GSVA 1M71A 2J5LC 5CHNB 3PQYD 1KV7A 5GRZA 2WSKA 3CTTA 2J8HA 5C07E 3B2UC 5MEOB 4PS3A 2J56A 1PY0A 3GBNH 3UBHA 1UC6A 4NZRL 5AAWC 5DJZB 2VLKD 2ZKWA 3ALXA 1KELL 4I88A 3K72A 3L4YA 4HUWA 5CLXA 4GBXD 3RWGA 3BJ91 4KXAA 5EU6E 4WUKH 5CLTA 3ZYJA 3TN0C 2Z8RA 1U2HA 1UA6H 2GEEA 4OBRA 3KGTA 4J6RH 4PM1A 2IWKA 2PWEA 2CNYA 4MS8D 1QSED 1A6WH 3OKMA 3RVTD 1RUQL 3HKFA 2OULB 4LHQB 1I8LA 1K85A 2B4CC 3JWNC 5EDSA 1L0QA 3FT0A 1A6ZA 2GSMB 2Z91B 4YHKH 4R7DA 5DRNB 5T33L 5ISZD 1A4JA 2OR8A 1HINH 5JORA 3BISA 4H2CA 5JIKA 3WEXB 5SX4I 1XCWA 1T2QH 3OHXB 3UZQA 5JXAL 4UT9L 1CXHA 1OAJA 1HKLH 3CLEH 4Z7VE 1IM9B 5C97A 1G9MC 4X6BB 3TO2A 1BD2D 2FYVA 1FP5A 3AABA 4XXCA 2DM4A 2ED6A 3AY2A 3P2TA 5DJ0A 1I3RB 5B8CB 3M07A 3V5DA 4N0UB 4XNZB 1M6UA 1INDH 4S1RH 2QVTA 4Y4KC 3VG9B 2DQCL 4ELKA 2EDJA 2WXHA 1OAKL 3FO2A 3LKQB 2AABL 2AI0L 1NLDL 1FL5B 4OT1H 1P4IH 1B88A 4MD4A 2DQIL 4J8RB 2FR4A 5CCGE 3EYVA 4R96A 5KVEH 1T7ZA 3QEQA 4CU7A 2APBA 3WL9A 3QQ4B 2D73A 5HJGA 3Q1SL 5EF1A 2ZX9A 1G9NC 4LDLB 4OFIA 5IB3B 1MCEA 4NYLB 4LCWA 5AW5B 2XWBB 3DI3B 4G9FD 5B1JA 3BCFA 1D5BA 4NZTL 3BSHA 4L3EA 4BBWA 4AYSA 1UH3A 3CZKA 3QQDA 4ZXBA 3VFGL 5E94B 5HI4D 4BCZA 3IGAA 3MACL 2A9NH 2IDUA 3T9WA 4CSZA 1O5PA 3KDMA 3QDMD 4AL8L 5DJYA 1KCSL 3GPSA 4QHLA 4DW2L 3SDDB 3IVKB 2WWMC 4OJDH 1FJ1B 3MV7E 4OZFH 4LSDA 4WUUA 4YLBA 1P4BH 1FPTL 2Y3AA 2APVA 2ZWZA 3MRNA 3GSWA 4W70A 3RY4A 2L7QA 3V8OA 1DSYA 4KZEL 3L48A 6TAAA 4Q6IA 3MREB 4HS6B 4L37B 5AVRB 1BXVA 3ZMRA 3KL3A 4QRFA 4CSPA 4YXHL 4FQCL 1AS8A 2H0EA 4MDRA 2C3XA 3ASNB 3JT0A 3STLA 3WIFA 4ZMLA 3D48R 1FV1A 3GSNB 2R69L 2YQ2A 3MJGX 5GGQH 3ZW3A 1AACA 3FQYA 1KLUB 2ERJB 5EEUA 1KPRA 2ZXEB 3IT8D 3L5XL 4QLWA 1ZHLB 4JM2A 2XIDA 3DX7A 3MRPB 3P73A 4HJTA 3WO4B 4B60A 1N5YL 1B4JH 3NIGF 1W80A 2VZOA 3TT3L 3LHPL 3P54A 1P69B 3UTTE 2HTKC 2X1WL 4ZMYA 2AVGA 2AJUH 2IF7A 4CMMA 4FFTA 3Q6GH 3HB3D 5K1VA 5D71L 3WKMH 4C56A 3GMLA 4QRRB 5ITBH 1H15A 4HJGA 2H2PC 1ORQB 2GIXA 3L3OB 1GJUA 2AK4E 3ARBD 4HKXB 3V4UL 4RMUA 5CR8A 5IHUH 3J27A 1NIBA 3UEZA 4OGYH 4ANVA 1J10A 2H41A 2JI2A 4NM8H 5JHDA 1JHKL 2XIBA 1XGRA 2DEWX 3JUYA 3OSVA 3D0VB 5DJ2A 4XO8A 3RWFA 4F9LC 4X4ZA 1QUNA 5J4MA 1MJ7H 1O6SB 2HH0L 2EYRA 1RJLB 5I66A 3ZYIA 1EVUA 1ZHKB 5FOJA 2B1HL 1MVFA 3LTVA 4JEGB 4HOWA 2R2BB 1H3UA 5ANMA 4D7PA 3GLAA 5F3HB 2CH8A 4AJVA 1DVXA 3U6RA 1QEWB 1Y18B 3BP4A 1GAFH 5FUCE 2KPWA 1P1ZA 3D4GA 3L9BA 5SX5H 3VYOA 3VXNA 1KB9K 1AD0B 3EYFA 3QUYA 1IVLA 3MCKA 4LLQB 4NX0A 4KHTH 2VQ1B 3QFGA 4DEPB 5E5UB 2JB5L 2M2DA 4F58L 1AE6H 1EJ8A 2BDNH 2JQZA 4H88L 3W39B 2R0KH 1EDHA 1OSEA 5C9JA 3DOSA 5GGTL 2R29H 3OF6A 4M48H 1JV2B 1IB5A 1KFAL 1YEDA 2GITB 2YFOA 3EYUH 4LLDB 4LVHB 4PJXF 2X4SB 1NBVH 5DHVA 5K9KA 5HGDB 1CLYH 5I1DA 3OB0H 1ZHNB 2ZXAA 4DP8X 1FRGH 2GW5A 2K70A 3HCVB 3HA0A 4NN5C 1HHGA 4HH9B 1MVYA 3GS7A 4X7TB 1UD6A 5J13C 2Z8SA 2A4ZA 3L3DA 5CD5C 4P48A 5C0CE 5IHLB 4N5ED 1TQSA 5IV2B 1NTDA 4FQIH 2I9TB 1CDYA 1RXLA 1JGVL 3BFQG 4BQBA 1KGXA 3V2AR 3ULUL 3LKOB 1HJCA 2DD8H 4RNRB 3EFDL 1W72A 1CICB 2X28A 1BJ1H 4J3OD 3HMXL 4K73A 1HHKB 3U7AA 3WFEL 3WUWA 4CVXB 3ARRA 4UTAL 2C9SA 5D7IE 4X7CC 5KTEH 3AUVA 4IRSD 2XZCH 4B95C 1RZKC 2F7IA 4WWPA 2DV6A 5EUKA 1JFQL 4OF0A 5IFJB 2FJGA 1MIMH 3FQ1A 2OL3B 2OMYB 1A6TB 2X9XA 2YWYA 2LTQB 3DURA 4XNXL 5FC9A 5C0AD 4FLSA 4GP4B 3TVMA 3ZQ9A 3W11D 2YUWA 3ML9A 3CSPA 1WWBX 2HLAA 5IGXL 3D06A 3S36X 1RFDL 2YN5A 4AYEC 2E27H 3V5HA 1J8SA 3N1QC 5TGBB 2WLKA 4HPYH 3MFFA 5FPIA 1Y0LB 1UXSA 5C6TH 2CHXA 3CDGB 5CBEB 4BRJA 5CM1A 2I24N 1UZ6E 1LO4L 2EUVA 4IYKA 3R8QA 1G7HB 2G75B 3MA9H 1EBAA 3PAZA 1RCYA 3H42H 2X4PB 2P5EB 1S7WB 4U7KA 4HK3J 1BFTA 5J6SA 1LWHA 4L48A 1Z5LB 3GI8H 3QI9C 2EE2A 1S9KC 1JGDB 3FF8A 4GAAA 1D5ZB 5FYKE 3I6GB 4ZUVB 5D1QC 1ZA3B 1UVQB 5F0LB 1XB3A 3MU3A 1G7MB 1I1FB 3VXQB 4K3DL 1Q38A 4LSVH 4OBSA 4RA0C 3WKYA 1L5GA 4NBYB 1HSBB 4QR7A 2ENJA 3VB9A 4D9QD 3GRWH 1XF2A 1O9WA 3R19A 1ID5I 5EZIL 3IXAA 2DWYA 3OJDA 2B4CL 3MJ9L 3X1GA 1FWXA 5E6SB 2Q20A 1A2YB 1WEJL 4N28A 5BRPA 1MI5E 3X11B 2W65B 2O93L 1OWWA 2AV7A 2F19L 4Q89A 4PV1C 3QWOA 5T1LD 5GGUB 1CURA 1YEGH 2X89D 4HZLB 4XXWA 3MRHA 5E99L 2BSSA 3BRDA 2Z31B 3EXJA 5AAMA 4TTGA 1QA9B 4JDEB 1AH1A 3GXMA 1M7DA 4O2FB 1FVEB 2QLYA 3V5KA 1G9ML 4X5PA 4C57C 4AV5A 3D4YA 3IJYB 1OGAD 4Y1TA 3U7YL 3WN5A 4S1DD 1T0MB 3CV5A 3NZ8A 2DJ4A 1H0DA 1SUHA 3NJNA 4Y1AE 3T0EC 3PCYA 4W4OC 1XXFC 1DSFL 3HVNA 4ETYA 5E24E 3QIBA 1PAZA 2X87A 4L1TA 2HG5B 1MXGA 1SJHA 1MHEB 1L7TL 5IB4A 1HHJA 2NY5H 3VI4E 2V9TA 3N85H 1BP3B 2XG4A 4MAYD 3K3QA 4YAQA 2NSXA 1OF0A 4X0NA 4X6FA 4PTUA 4WY7L 2ESVE 1K8IB 4GO9A 4XCYB 3UYPA 4B53A 5E6IC 4I4WA 2VCOA 1PNCA 3DMMC 1ZS2A 5E8DL 1VADB 5FF6A 1G9NL 5L88H 4FDWA 3PL6C 1TZOA 2G60H 4O2CB 2MCMA 4N9OB 2BVQB 1UD8A 4F7PA 3KPRA 1XCXA 3ECQA 4KI1A 1KYOK 5CWSA 4O5LH 4TNGA 1MAML 1B0GA 3E8VA 2YBRA 2AV1B 3QO0B 5AW0B 2YK1L 5HVWA 5MENB 4UNIA 1BM3H 4LHJB 2ZP0T 2ADGB 3Q8CA 4IBYA 3PY9A 4YFLF 4DVRL 3LYRA 1TR7A 4D2NA 2F54A 4WEEA 1MFNA 3FCUB 3U6XS 2QEJA 2D7TH 3NCWA 5GISL 5IKCA 1TKWB 5GIRB 1GC1C 2C1OB 3H0TB 1N70A 5CN1A 3QEHA 4NKDB 5JHBA 2VSCA 4ERSH 3GTNA 5T1KB 3CK0L 3GIVA 4N2FA 3EFFB 3RVTC 2O5ZL 1U8OA 1J9TA 2YSTA 4NLAA 4YGAB 5AW3B 4N8CL 2X3CA 4PRPA 2R1WA 1Q0YL 3BVDB 3BZFB 3F7QA 4PP1D 3RYMA 4EUPG 1W6LA 4NP4H 2HVJB 4LSQH 1ES0A 4YE4H 1C8QA 1L0XA 4Y5XA 2V2XB 2IV9A 1OSPL 1NGPH 1VEOA 1DJSA 4LQ1A 4F8QA 1IM9D 3W0WE 1CDCA 3P0YH 1YMMB 1IIIA 4MA8L 3M8OH 2JF1A 4CJ0A 1K72A 1KNOA 3WV0A 3VM7A 3N91A 3RUGA 1E7UA 2EECA 2NQ3A 2V0AA 2V8MA 3WIHL 4DEWA 15C8H 2J1ZA 1QBAA 2H2SD 1BBDL 3N06B 4K8RH 3NJKA 5KG9A 3O4OC 3VD4A 1KG0B 3FO9A 2GJ6A 2FK9A 3QCVH 5FYKU 4MKMA 3RY6A 4LLAA 4D9RD 1T5WA 1KBBA 3MRRA 4PJFA 5D9SB 1KCBA 3QDJB 2D8KA 3G6JE 2VOTA 2ZXDA 1U3NA 3QWNA 4HD9A 2WQSA 4OLZH 1FO0L 1VF5C 2CKBB 5C0DB 3SDCD 5I5JA 4AEIH 5HHVL 4GW5A 2R56L 2WNGA 4J3OG 2NY4B 1EDYA 4UDUB 5B7FA 4QHMA 2X3AA 1U8MB 4XPFH 2YHGA 3MLYL 2NDFA 2PO6C 2BNQB 3G04A 1BAFL 3V8CA 1OP5K 4KQ0A 2BIOA 4N0FA 4E41B 3U1QA 3P1VA 3SDDD 2Z1KA 3GM8A 3P30L 1RK1A 4QJ4B 1KXVA 1GGCH 2XQBH 1EAPA 2YUXA 5HI4C 3C5SB 4FQLH 1BIIA 1NZRA 1P5UC 4XN1A 2BCMA 5DHDA 1P5VB 4ZFZA 1V7NH 5D2LB 4WWKB 3BT2H 5TQ0L 2ZCKH 1GZQA 4XN2A 1YA5A 3V10A 1Q0XH 3JWOC 3H6AA 4ZSOB 3VGFA 2CU9A 4L18A 3MRBB 4UMSA 3FQUA 4YDIL 1ZT7A 4LKCB 2C34A 4K7FB 2HWZH 3FHQA 3IFPA 2ORBH 1U8CB 2YGNA 1B90A 1U2YA 3VA2C 3AZUA 3F83A 1YCSA 4UYQA 3NFSH 1T7YA 2H5UA 4P5SA 5LGHL 3BDYH 4QRRD 2KS0A 1S3RA 1RZKL 3DNKA 4LZKA 1DBML 5HGAB 5CP7A 4K9EH 5E1AB 3DX8A 1KTLA 4FHBD 4JKPH 3M7FB 1R3HB 4WO0A 2I60L 4NO0B 1E8ZA 2P47B 5DWUH 3KM2A 3L95A 4GS7B 3GMQB 3HB3C 4YVUA 3JT2A 4E42B 4BFGA 3B1UA 3EGSA 4UQEA 1A8ZA 1BX2B 4PJGA 5DR5H 2HA1A 1FYTD 3WHXB 4D3CH 3UCQA 3EO9L 5D7EA 3MRLA 3I6LD 3ARBC 1WLHA 1IFRA 2ICEB 1S5IL 1CLCA 1ETA1 1JNHB 2E9BA 2CDFA 1R9FA 3C8KA 2R29A 1ND0B 4RRPA 4ZMVA 3SDAB 1OAYL 4XVTL 4AGPA 2V5SA 1TVDA 3OPZH 5HHOE 1WFJA 1KGUA 4LESA 1FGVL 1F4XH 4TMPA 2Q7YA 4ZJ9A 2Y5TB 3FFDB 2WWKO 1A3QA 5B1BB 1WCBB 4HAGA 2IADA 2PN5A 3BVNA 1LO2H 5TQ2H 4ZFQA 2KLSA 2R2CA 4XGZB 3B7TA 1JNNL 4QXGH 2FYYB 2Z0BA 3V7AG 2WQWA 1ZLVK 1YEEH 4IMLA 4JO1H 3APMA 4R7LA 3T0VA 5I17A 1AXTH 5DS8A 2VXQL 4HYTB 4WHTA 3RX7A 4BK5C 3ATDA 5KVDE 3O3EB 3QUXD 4E36A 3BEVB 3K4ZA 1QNZH 3RIFF 2A38A 3VD1A 3GGWA 1AS6A 5H37G 5HP5A 2ALWA 4PJDE 2J6EH 5DZPA 4D0DB 2NCMA 2BNRE 5D1ZI 1QFWH 5IB1A 4OB5H 1CICD 1NCCL 3C87A 5LLIC 1A9VA 3N0PB 3U7WH 4IHBA 2ROYA 2XACC 1G7LB 5FO8A 1W0YT 3IFOB 4JFWA 4Z7AA 4KFMA 1KJ2L 1FNAA 2GC4C 1T21B 4KY2A 4N5EC 4ABQA 4JRWA 2X70B 4HISA 1LK3L 2ZICA 3MLWH 3P02A 5ECJE 2A6IB 3H54A 4QAMB 3EYSL 1JP5A 3FL7A 4N6RA 2C3VA 1QPXA 1B6DA 1J1PH 4Y5VA 4ZQKB 1SXAA 1HFUA 3OG4B 1ZRUA 2N1KA 2EEBA 2GAZA 2YD1A 4IRSC 3ZTJG 2Y06H 4OLXH 3GXPA 3VXUA 3GIZH 4HCIA 2UYLB 4UNTA 2LU4A 1PIFA 2VDNH 3WEOA 2IMMA 4HSCX 4WFHE 2Z7UA 3MXWH 4A39A 4M7JH 4N3TA 3KPLB 3HE7A 5CCKH 1RJCA 4KO6A 3W11C 5ACLA 4IKIA 5ICYA 1HILA 5E4OA 4JKNA 4DSYA 5C07B 1K3IA 3CLFL 4YLQT 3GRWA 3I3BA 1TPXB 4DP4X 1IGJB 5I5RA 4MXVE 4XBPA 4G42A 2P5ED 4IGBC 3MCG1 4Y2LA 3CVBA 1D6EB 1KCLA 3DRTB 2J1YA 4LIQE 3OMZA 5HJDA 2QQKH 3OHMB 3D18A 3DPBA 1B4LA 3MRCA 3A4EA 3QIWA 4NFBA 1SGKA 4Z3JA 3V6FA 2BSTB 3DX6A 4I13B 1WSST 4XE5B 5EU6B 3L5IA 1Z9SB 2ZG1A 1NA8A 4OZ4B 4O00A 1NC2B 3HAEA 4XB7A 4NM4H 2RFXB 3H7BA 3KWUA 1GC1L 4XB8A 1AP2A 3PLYA 3NAAL 3QHZL 4IBWA 1CK0L 2PP9A 1G7QA 4BEIA 3K2UL 4G8AC 3I9AA 2JCCE 5LBSH 3M17B 1LP9E 5E0FA 1HQRA 2WGXA 1NAKL 5J1SC 1A7NL 3U4KA 3MPCA 2QQLL 3FONB 1DSWA 2BIHA 5EC2B 1S46A 2Z31D 3SKNA 3B9VA 1J8HE 2F58L 3QZWB 4N20A 4A6YH 5J6HB 5I73B 4Z7VB 3LZFL 1OGPA 1ZMYA 2OJ1A 1RMFH 2WLNA 1FHGA 3Q01A 1L6XA 2OBGA 1E4WH 3FUJA 4JAMB 1UT1A 3DX2A 4UAHA 4XCEA 5IT2H 1XSJA 1SVBA 1NEZB 4IJ3C 4OD2B 3FOMB 1T1WA 1KTKE 2RHEA 4YX2L 3WE6B 3ZO0A 5D7LB 5I1CL 3GKZA 1OAXL 4M8VA 3V6BR 3IAGC 1F58H 1QHQA 4GG6A 4S1DC 1BOGA 4JZJC 1A47A 2XQYG 4J3TA 2EINB 4NT6A 4S1QH 5IVZA 1MOEA 4KH2A 1C1EL 4HIQA 5ALCL 4ZYKA 1JPSL 3BUYB 2DQTH 5EUOE 1P1VA 1ZGLB 3UX9B 3A6BL 1HSAB 3MN8A 4NC1E 4WZ9A 3BRGC 1Q9LB 2CRIA 2PYEE 4RFNC 3IGFA 1F3RB 1TSHA 1PEZA 3LQZA 4TSBH 4UU9A 4MKTA 4P2RA 4OU3A 5AZ2H 4JG9A 2XQYK 3K6IA 5MEND 4RFOL 4GAFB 4ZUUB 1IAIL 4X9IA 2ZXGA 3I6KA 2FQEA 3UJJL 1BF2A 1SQMA 3ARGA 3L08A 3KGRA 4Y5YA 1LL1A 4U7SA 5KYNA 1VEPA 4OGAD 5J3HD 3DECA 4GI9A 1CFVH 3LKPA 4HMDA 2ICWI 5CO1A 3TXAA 5DJCA 2BRQA 4NPKA 1BAGA 1AI1H 5BV7B 4OQTH 5EFIA 5T1KD 3RVWD 5F7KC 3T65B 3WY4A 3OBAA 3JWOL 1C16A 2ITFA 4PTTA 4WVRA 1R5IB 4HVBA 1IQWL 4KK6D 3FU0A 2WQRA 4KH9A 3B7RL 5FYLE 4CUCA 4M56A 2YXWA 3UBXG 5I1AA 5SWQB 5BMFL 1EFXD 3VFTA 4J3BA 4ZPTB 1OQOA 4J3SA 1JI1A 1SXZA 3RI5F 1RK0A 4L5FL 3SPIA 1KEMH 1M7IA 2XHNA 1YMMD 1OANA 2NOYA 2VNCA 4PP1C 2PCPB 1SLWA 4LVOB 3CXDL 4UT6H 3OHXC 1IC7L 1AHMA 2WWNA 5BZWB 5KS9E 4H8WH 5E56A 3B7SA 2AK4B 4QRAA 4UTCA 2XN9A 5EPMB 4PWKA 1OCOB 3QDGA 1K4DB 4N1EA 4BZ2L 1MRDH 3DROA 5FCUH 1WZMA 1G43A 5K9QG 4NO3B 5B8CC 3U0WH 3MNDA 4XNZC 2PPFA 3QDJD 4XODA 1IGCH 1YN6B 3VG9C 3KYMB 1E28A 4JFUA 2VR7A 2MQGA 2H2SC 1W8OA 4U3SA 1LHZA 4OJFH 1LEIA 1IFHL 4X5QA 2Y5EA 2NY4D 2WOYA 3AWFA 5GGVH 2N0MA 3G9AB 2YSSB 5IW3A 4NQEA 5F9JA 1E9QA 7PAZA 4U1MA 1A14H 1HU8A 4TV3A 1RU9H 4Y4HA 3CFJA 2BNQD 4A7VA 5AZEH 2CG9X 4XOEA 5I28A 3N1GC 4A04A 1JK8B 1SEBA 1YMHA 2NZIA 4LPUA 4APXA 4Z78A 5BXFA 4K94H 1XF5B 4HX1B 3AGWA 4NUGH 4S0SD 5EO0B 2C4FU 4JX0A 4JB9H 4M62L 3WXVL 2VO8A 1PLCA 5KYUA 1DQKA 2WCGA 2IFGA 4Z5RA 3FQNA 2P5WB 4WWKD 5ID0B 3UDWC 2WP3T 3SDDC 5DSCB 1J1OL 3O41B 4NQSA 4X8XA 1K3ZA 3ROLB 1XH3A 3G6DH 3AMLA 4ZW8A 1MF2L 5TJWK 4QRPE 4XPBH 1A4AA 5C0CB 5FA3B 1YG9A 4CN1A 5B38A 4JFVA 4ZAKB 5DC2A 5I23A 1CGXA 3QFJA 4JFOA 4JHVA 5D7JB 4P5KA 3CXHJ 5JW4M 2KH2B 1GY2A 4OCRL 5CEZD 4LFHD 1K6QH 1E6JH 1YUKB 2CBMA 4G3YH 4ANWA 1H3VA 4G6ML 1ZIAA 1SDYA 1UB5A 3EFOB 4KY1L 1HXMA 3VMPA 5DURB 5LNDA 3L8QA 3IDMB 5D7IB 2ERJC 4U0QB 5A2BA 4IBQA 3PUUA 1WT5C 2DWDB 3E80A 2CHWA 3FBQA 4GAYB 4R3SA 2CHZA 3OZ9H 4RZCB 3OR6B 5KVGH 5IEKB 4G5ZL 5IHZA 2SEBA 2OYLA 5HVHB 2M8XA 2FE0A 3QARA 4D0CB 4HIJA 2G0LA 1L4IA 4P9HC 2UXGA 1QFOA 4N0CD 1L7IH 2CR0A 4XMLH 5ESAB 4NHCL 4ZO6A 5DYFA 43CAB 3QHTC 1MRFH 5IHBA 1XBRA 5JW5A 4Y2DA 3L3OC 1T1ZA 1DVSA 1ZVNA 1OARH 2EDQA 2IALB 4BH7A 3HMWH 5ACZB 3TX4A 1XR9A 3L4XA 1T3FB 3SDAD 4MZRA 2OR7A 3SE4A 4OAWB 3BVXA 1KCRH 3QJFB 5H94A 3SPCA 1DQML 4ATWA 2NTSP 2KI6A 2ZX7A 3H85A 3HR5B 4CC1A 3D25B 3VWJB 5J6GA 3MRFB 3MRIA 3L9YA 2B08A 4LSSH 1E2WA 1J5OH 1ASPA 4H8VA 4GUPA 1JRHL 1VEMA 5D2LF 5D55A 4XH2A 1CT8B 1WZLA 2IAAC 1TYEB 4GRLA 2EKSA 3TLRA 2XNAA 1I1AA 3S5LB 1RVFH 3BP7A 5DFTA 3BD5A 2Q6WA 3OM3B 3QC5X 3BPNB 2HLEB 2YXVA 3A4AA 2IPKB 5E8NB 5C0FB 5I1LA 3A67L 4DEPC 3KLKA 4GW4A 3D2UA 3GINA 4WV1B 1T4KB 2JKTM 1MI5B 4AYGA 3KW8A 5F7NC 3UPRB 1HZHL 2WO4A 2A1WL 3FCGA 4LVHC 4M6OH 3B6SA 4Y0GA 1F42A 3ILPB 3O4LA 3SDYL 2I69A 3I9IA 4M6NH 5KBNC 5DLMH 2PXYB 4DGYL 3QEGH 4LCYB 4PJIB 4U6YB 4UNVA 1ECZA 4HCRA 3FCSB 4G82A 1X5LA 4NZDA 1QLRB 3DGGA 4IDJL 1BPLB 4UINH 3FB6A 1IT9L 1PD6A 1DVFB 5F7MC 1PVHA 4Y1AB 1CICC 2DYSB 1JGIA 3HHRB 4KKCD 2OJZH 2XXGA 4OCMC 4YHPA 4AQOA 1JMZA 1QP1A 3R06B 1NCIA 4CBZA 1G5AA 3V4VH 2GUOA 5GGRA 3RG1C 1OM3L 1WH0A 3TBYB 5ESVB 2LTQC 1XGPA 3BMVA 4Z7NB 1VCBC 2BS71 3CX5J 2BSRB 5CKGA 2ESVB 4OLVH 5DD0L 5FO9B 3L3IB 4BXSV 5C07D 4AH2B 1ERNA 3MLVH 3FRPB 4OVVA 1OSYA 5FIEA 5CGMA 1T03L 2HJFB 4Z1PA 5JOFB 1UM5H 2XFXA 5DD1L 2H1LM 4WWOA 5DYOB 4PI0A 4YLCA 1KTBA 5G5DB 3O0LA 3DJSA 5A3ID 1A0QL 2P3YA 4AYMC 2WYTA 1YYMH 5LBSA 1G84A 3NTCH 4XVOA 2YGPA 5JIDA 4RQQB 4M6ML 5SWZE 4ZFOB 5INCA 4PJAE 5FKAA 1ZT1A 4X7SH 1QBML 4MA7H 4QGYA 2EXWD 2GFBB 4XO4A 1HX0A 2C9QA 3NRPA 4HK0A 3W2DH 4UQDA 2W88A 2XTLA 5FHBL 4A6YA 3F6JA 1F2XK 1NC2D 1EJ6A 2ZOUA 4XR8C 3UEQA 5JDJA 4FZEL 4YL9A 1ZGLM 4PBXA 2VXVH 1IBBA 1GGIL 2E0PA 3RBGA 2Y7OA 3QRGL 4Z0XB 4KVCL 3V6OC 2FECL 2VDKH 1DFBH 3K0WA 2QPSA 1JHLL 1UM4H 1U8NA 4KTYA 1GS7A 3OKNA 4XZ4A 4ZK8A 4ECNA 1FNGA 3AS0A 4NQVA 3V0GA 4ZW3A 1JK9B 3CJJA 4WK2B 4QHUA 2BWDA 2LFGA 4R0LA 3WFBH 2NW3B 3T0AA 2VDLB 2OFQA 3W0WB 2VXUL 1J05B 4PYHA 3BQUB 1IEBB 4MQXD 3VFOA 4XBEH 3TBTB 4DQAA 1DJHA 2Z31C 4K5MA 3O9WB 1PDKB 2XC8A 3VU2A 4EUPH 1TIUA 1CTNA 2CMRH 5FOBA 5D7LD 2E75C 5HGHB 2BSCA 4Q4EA 2DF3A 3D5OF 1FFRA 3VNZA 4K3EL 4IRJD 4M1GH 1N3NA 3T08A 2V5MA 5KN5A 1FI8C 3IJ8A 1Z9PA 2XBDA 4LCWE 1WFNA 4ADJA 2AXHA 3IGKA 3RWHB 1ZTXH 2XZAH 4JANB 3X3GH 4L3EE 4ELDA 3F7PC 3T5WA 4LFHG 5CZVH 1JPTL 4F7TB 2YPLE 4J2QA 1F0LA 2XWEA 4U3HA 3K8MA 1JCKA 1VENA 2YAEA 3KPOB 1OP5H 2VLJA 1NJ9A 1KCUH 1RZFH 5GRUH 4RIRB 3CSGA 4ZOEA 5IOPB 1GYCA 3VFSA 3BVTA 2X42A 3QJHB 3SGJA 4I3SL 2BMKB 4I2XA 3UC2A 3QJXA 4PBDA 5LGJB 3OJMB 4IIQB 2WUCL 1NICA 1QLEB 1F11A 3L9RA 2QMJA 2Q3ZA 4L8DA 1F4WH 3RGBA 4FQQB 4QNPF 1G1CA 4UIKH 1MW3A 4Y19B 4UT6A 1O6VA 4JG5A 5J3HC 1OAZH 1JZGA 1TJHH 2BNUB 4QRQA 2ZSVB 2FO4A 1T89A 3PWNA 4OZIA 2H26B 3PUCA 2WVVB 4QRTB 4Z7VF 4FXKA 4XPTL 3B2VH 1JDAA 1PU0A 4Q7DA 2ATPB 2CK2A 5DFAA 3E0GA 2CJUH 3APCA 5DJ8A 4MDIB 2LV4A 2IXQB 4C56E 5IOKA 3VW3H 3OGOE 3RVWC 4HXBH 3SSGA 1N59B 1RL1A 2JK5A 3MBXH 5BO1H 2WZAA 3GSNL 3SPVB 2IG2L 4U6VL 1DO5A 4ZUWB 1GGTA 1DQJB 1N10A 4KK6C 4LL4A 2VO5A 1PL3A 3MNZA 1DBKL 1QRNA 4KXZI 3QGVA 4NRXB 5JHDE 3FHEA 1H6EA 2AK4D 4N5UA 3O3UN 4KQ4L 4WI0A 3ARTA 3BHBB 1XDTT 4G11A 2NPLX 1L0PA 3VH8A 1O7DE 4P9HL 4PHZA 1MNUL 3WGVB 4JR9L 1UKTA 3UTZB 4BDVA 1UWEH 4G80A 5JW3H 2J71A 4NNPL 4EBQL 5HDBE 2IV8A 4NWUH 2C3HA 4N8VA 1EJOL 5AB0A 2YEQA 4HS3A 1RKRA 1X7TA 1ZEAH 2IWFA 2OV0A 3VXSA 4B50A 3E6HB 3I75A 1S7QA 4X4XA 3N3EA 2D7OA 2WANA 2VDQB 2EABA 4N87A 2AEPL 4PJBB 3F12B 1ZXKA 5J7CC 1I8MA 2NY4C 3T6ZA 4AMXA 2WXLA 2NT1A 2R4SL 3VFUB 4YXLH 2ED7A 4BH8B 2I07B 4Q97A 4U2ZA 1IGTB 3FTUA 1ZLVH 1GZPA 2WIIA 3TT1H 5F3FA 3VI3E 4EVNB 2V9RA 2HFFB 5DZ9A 2P5WD 2Q9OA 3MLSH 3PQYA 2JKRM 3QQXA 3PGFH 5AW1B 4RSYA 4P2CG 1RJYA 2C7UB 4F9PC 5T1JA 2ZF8A 5E9DA 4WJKB 3KLSA 1JAEA 4AITA 1EHLL 5C0CD 4TSCH 2GTQA 2OX5B 2ALAA 1GPOL 1YEJH 4ZAKD 4JRFA 3KLDA 4R26L 4WWKC 1F1AA 1N8ZB 1UJTA 2WMPB 4NGHH 5D7JD 2BNRB 4GBXA 4NJAH 2ICWB 1ORSB 3HG1E 3AWEA 4KJQD 4L4VA 3WDHA 2VDRH 3APFA 2YFNA 4NQXB 2A83B 1U8JB 3CSYB 5DURD 2VRQA 1XB8A 3D9AH 5GS1B 1QSEA 3F64A 3ZIYA 1OT1A 3P11H 5H37H 4UOJA 2WLMA 1NFIA 2XWTA 3ARDD 1JZ2A 4FG6D 4IRZL 5CSBA 4MMXB 4YPGB 1M56B 5JUEL 3U4BH 4FNLH 4AM0A 3NEEA 3TEZA 2UXTA 4WWNA 4YWGL 3JTTB 1AQDB 1FCGA 1XCTA 2EXYD 1XIWA 2VZ1A 2GB2A 4ZZFA 2F08A 2EIJB 2OL3L 3ZRFC 4GS7C 1MPAH 1T6VN 2YMTA 3GJFB 4P3CH 4CKVX 3UO1H 5IVNA 3H9SA 1JOIA 2AJ3B 4MNGE 4N0CC 2JLPA 4HUXB 1DVZA 3GKWH 1DUZA 4FP8H 4W9HC 4YC2B 2VWEE 4F8TA 3CSTA 5HVGB 2B8OT 2QR0A 2ICEC 4OH2A 3BYTA 1J9CT 4XC1H 2QVFB 3VWJD 3BH9B 1S7UB 4MDJA 2L8AA 1KBKA 1LWJA 4G7VL 3SDAC 3ZRSA 1ULVA 1RURH 1D6VH 3VGAB 1BFOA 5FYKD 3B9KB 3SCMB 1ADQL 3QG7H 4LEOB 4RFEA 2XPZA 2FIKA 1DDHB 3BVVA 5C9KA 3QWRD 1OE3A 5EOTB 2BK8A 2BS9A 3HHSB 3KLHD 3DJTA 4N4YB 4H0IA 2J88H 3KPQA 1N64L 2XG5A 3OAWA 4LLUB 2VDPB 3B3BA 4JO2L 2AAAA 3IKCA 3LN5B 5C08E 2D2CC 6FABH 5JQ6H 1FFOB 1ZIBA 5D1XA 5JNYA 1JVKA 5DQDH 3TIEA 4P59L 4CRPA 1YAZA 3OKOB 5DDHB 1MJUL 1IGFH 4X6CE 3PWLB 3D30A 1G7IB 1LP9B 5I2IA 5D7IF 5LWYH 4ZW6A 2ZNWA 3K71A 3V4VA 4G6FB 5GQBA 2PXYD 3ZRCC 4V1DE 1SJEB 3BKJH 5C0ND 5JIIA 1CLZL 1J8HB 4FLRA 1H19A 1RULL 4Y4FB 1TG8A 4PU2A 2J12B 2F9BT 2HRPH 1MCDA 3CVHH 8CGTA 1DVFD 5L4IA 2X4QB 1OOAA 3CFEB 3Q44A 5IIEB 4MJJA 4BA8A 4BK4A 5F7DA 5JQIB 5I8OL 3L1OL 4X2UA 3WJMB 4RWYL 1VACB 4ZO8A 4P3DB 4OGQC 3TESA 3P9MA 2HVKB 1EVTC 3PHOA 4MBOA 3IGLA 5IEHA 2QKIB 4MA1B 5IUSA 4PP2A 3CMOH 3ZZSA 1FNSH 4JRYE 4KKCC 4JJHA 4R4BA 3K6FA 1UCBL 3KPRE 4Z7WE 3LXCA 2JELH 2W0FB 3IU3A 5EUOB 1NKGA 4CAGA 4BFIB 4AM0Q 2PABA 5MHSD 1PS3A 2PYEB 2F5BH 2Y22A 1A3LL 4N2AA 5FO7A 2Q8BH 1SHSA 2APSA 1YN7A 3DBXA 1KTCA 1P84J 1ROWA 2F54E 2XZZA 4N3UA 4CC4C 3QAQA 3OLEA 4PYGA 2CM5A 2XY1A 1BEXA 1TPXC 3DKHA 3LRHA 4HJSA 3HI5L 1UXWB 3E9UA 1AGFB 4GY4A 4I0PA 3KXFA 4XNAA 4ZTPL 1FBIL 3LZNA 1LK2B 2AZUA 1J18A 1NGWB 5FFOA 1T22B 3TH3T 1XZ0B 3G5ZB 4OZGB 5A3IC 1YQVH 3FC8A 2XY2A 2QSVA 4MCZA 4PG2A 3L3HA 4UQ2A 1CVSC 3DX0A 2LGNA 3ASWA 3CPLB 4PGDB 3AREA 2CDEB 3GZKA 1Q9KA 1I3GH 2BP8A 1UFGA 5AEAA 4PRPE 4PS4H 2YUVA 3T8MA 5I19L 3NACL 4PJIF 1RZJC 3SPGA 3TV8A 3ZDYE 4M5ZH 4WGWB 1UEYA 3PAUA 4A2EA 4EUPA 2EDFA 3BP5A 4KWUA 5DUBB 5GSRB 3SGKA 5EBGA 5T1MB 1FC1A 1UYWH 1UZGA 1TZGL 2Y2YA 4C4UA 2JJWA 1HIML 1OO2A 3U83A 2GK2A 2VRKA 3RUGE 4G5AA 4F92B 4UCFA 1CR9H 4OCSH 2XLLA 3BAKA 4DH2A 4OUUB 3BQUD 4XVJH 3GHEH 2HKHH 2DEYX 4N2GA 4R9HA 3FF7A 3GMRA 3IN0A 3CFMA 2NZ9D 1E4JA 2X5PA 3CFQA 2GJ6E 3GBLA 4LBEA 4ZRGA 5KS9B 1V27A 3ECBA 4Z7NF 3FUEA 3MMEB 3RWIA 5I0ZA 2Z8VC 5C0EB 5I16A 4PJFE 2A6JA 4YJZL 1WQVT 2Z65C 5D1ZD 2OSWA 5K9OB 1RAMA 3POHA 4MQXC 4P49A 3QPXL 3QXAA 4ODSL 1R3KB 1TCRB 5ABZA 3DYMA 2JFCA 3N1PC 2AJXL 2WP3O 4UILH 5EZJA 3EIFA 3OPUA 4GLRI 1RJZA 5E95B 4W1TA 1AD9A 3GMPA 1SZNA 3T6VA 4FA6A 3CD4A 5EWIL 2ADJA 5EORH 1ET7A 1U8QB 2R0LL 3BZDA 1BV8A 1J0ZA 5D6CB 4ZDHB 1TLMA 2OZ4H 5F88B 4KI5E 1HNGA 3NJLA 1RP9A 3CFDB 1MFDL 4FQHA 1A1MB 4H5SA 2CKBL 3W38A 4ALAH 1AFVL 2AKRA 1GCYA 3UACA 3FT2B 2VJ0A 3G08B 1SXCA 3GHBL 3MA7B 5AW9B 1YQ2A 2EVIA 1UM6L 3FUNA 3NSCA 1RI8A 1XV8A 2DY2A 3RWEA 3PXLA 3AJ7A 4HHGA 4U6HB 1KTDA 1IGIL 4Y19D 4PGZA 1TEGA 3RNQB 1BMZA 2UZIL 3T2PA 3AXHA 3CN0A 5IB2A 2JB6B 2R2EA 4YHIB 3GSQB 5L6YH 5IVXA 3JV6B 3L17A 4FFVD 4QRPB 3BGMA 3U9UB 2YD3A 4OLUH 1WS7A 3ULVE 3FH5A 4PJ5B 1TTRA 2YEZA 2Q8AH 5BV7C 1QATA 5A7EA 3TNMA 5CINL 4UBDD 2A5UA 3X13B 1BZ9B 4L2LA 1OW0C 2GSGA 4GG8A 5TPWH 3O3DB 3IMBA 2VITA 1OZUA 2OA9A 3BDBA 4MNQA 2GBAA 3P4OB 5AOIA 5DVNA 1MHHB 1RIHL 4OV5B 1D7FA 3FTVA 4AXWA 3FPYA 5KJRH 1ZA6A 3SQRA 3MUZ1 5EBWB 4ZG1A 4PRHE 2D7PA 2ZNXA 3AC0A 9PCYA 3Q2VA 5DCCA 4D0BB 3HNVH 4LGRB 1B0IA 5FGSA 2XWDA 1FE8L 4LVOC 4X99A 2WNXA 4X5RA 4TUKH 4MSWB 1J9SA 7CGTA 5DMGD 1FZMB 2B0SH 4XCFL 4XMTA 3C6EA 4UWQB 3Q1EA 1IC4H 3NEOA 4IMKA 5JXAH 8FABB 4BZ1L 4MQSB 4UT9H 1TETH 1GMEA 3KYNA 5CD3B 3MV8A 4KMTL 1VESA 3BCDA 5TE4L 1DJXA 4DPBX 4O02B 5JDSB 4FF9A 4HWZB 3VSTA 2G0KA 2R0WH 4LLWB 1MWAH 3DSFL 4APQA 1UWGH 2OTWB 4FABH 4B5ZA 4ZD3L 4JY5H 5HHPA 4ONGL 5EZLA 2AABH 2AI0H 4I5BA 2XETA 1JPGA 2AXFA 4MAYA 3LDBB 4FZ8L 5EBLB 1QI4A 3S4SB 5ABAA 3L7EB 3RL2B 2E7LC 1I4FA 1KPUB 2QTEA 3LKSB 1MCHA 3P77A 4JE0A 1CF1A 5CIPH 5AENA 1UWXK 4HJEA 5H37A 2YXFA 4P23A 4PR5A 4EIUA 5IESL 3FAXA 4GSDH 3RWCB 1WFTA 3NP4A 2NMSA 3QEUB 2DLIA 3IS1X 3QJUB 4ZTOH 4KMLB 4DN4L 2XT1B 3CHSA 5IP4A 3UZVB 4JO3L 4H25B 5BO0D 4NOFA 1LO3L 2BNRD 2R1XA 1N9PA 5GZOD 5IMKB 3DK0A 1JHTB 5FK9A 3J2PA 3V0WL 2QV2A 4HU2A 3DXAA 1KCSH 4XNMB 5AD0A 3S96A 3AS2A 4ZAKC 4Y8DC 3IU4L 1ED3B 5D7JC 5F9WB 5KVFL 3W9DA 1IBDA 4ZTEA 2VQ4A 1TQTA 3HS9A 2BP0B 4I3RL 4BSJA 2QV4A 4KJQC 4M5TA 3O45B 1XEUA 2Y6SD 4IS6A 4XP6L 1XXDC 2B2XH 4LRIA 2KT6A 4U1IA 5KYYB 4FQCH 3RDTB 1DO6A 4BXVA 2F74B 4DKEL 5F9DC 2HJLB 3LNGA 5AW2B 1XGTA 3BKCL 1EZSA 1NGYA 2BXZA 2DQDH 1ZPLA 2NZ1A 3E9TA 3GSVB 1M71B 2ZX6A 2VC2B 2ZCLL 3PWPA 4FG6C 1H9DA 4WFHD 5HVHC 3S37H 3BUIA 3AG2B 2KZWA 4PJBF 2Z4QA 4QTHA 4WU5A 3VD7A 3FTSA 2EXYC 3K72B 5LGKA 2R9HD 1R3JA 4N24A 3KDPB 4HUWB 3U4AA 1H3PL 3RWGB 2C9AA 2A9BA 4RGNE 4PJ7A 2EEDA 4H20L 1UKSA 4H8HA 2BPBA 3N5AA 3V4UH 3LZOA 1JERA 1UD5A 1T66D 1IM3A 3B9KD 3SCMD 3VRLE 5IJDC 3OKMB 4YGVA 4MQ7B 4HK3N 4UQ3A 3O6ML 5T3ZH 1P7QA 1GZHA 4PUBL 5BRQA 1HEJC 4OLEA 1ZJBA 3VWJC 1F97A 4KHXL 1A6ZB 4B9KC 3BKML 3Q5TA 1OPGL 3V0AC 2IWGA 4R7DB 3SDCA 1AJ7H 5EIIB 1A4JB 4E9VA 1URIA 1WIOA 3CVHA 3WTSA 5JORB 1CD1A 3E8UL 1AQMA 2FATH 4GP8B 1V54B 4HFUL 1RZJL 3KLHC 1UKQA 2PW2A 2WAHA 1F86A 5ES4B 3BPNC 1F5WA 2IBZY 3EH4B 4PWFA 5CJBA 3UZQB 5HTSA 5GS2D 3UP6A 1LEGA 4G6FD 3TO2B 2LLGA 5DUML 4ZOAA 4WV1C 4AYID 4HJJL 2XKSA 4M9OA 3UXFA 1A65A 5DJ0B 3GZQA 4Y4FD 3CFUA 2FEEI 3V5DB 1TCMA 5HHME 3INOA 4ELKB 1WITA 2YA0A 1KFAH 1Z3GL 1IL1A 1MCFA 1LNUA 2FSDA 2PXYC 3FO2B 4TLSA 5GGSY 2E56A 4XNYH 5C0NC 4PMFA 4MD4B 4HS8H 3NVQA 1BJ8A 1ET5A 4TNFA 2XQYA 3A23A 3WS6A 3EYVB 4R96B 2FR4B 2V5TA 3QEQB 2F7QA 3WL9B 3O2VH 3TIDA 2HYMA 2XKNB 1DVFC 5BQDA 3OWEA 4PGBB 1RPUA 4HQQH 3C08L 4LCWB 3WAKA 4JG0L 1Z1WA 4MB4A 1D5BB 2YMXL 4NKQB 4L3EB 4UF7C 4AWJC 5F7EL 1YNKL 1UD2A 2QHRH 2YC1A 3GXTA 4U2YA 1SLUA 4ZXBB 1QQDA 3QQDB 1MG2C 4P2RE 1DLFH 4QTIL 2W9DH 5IMLA 3IGAB 2PYED 1OF2A 2VLRA 4KPHL 3D87B 1IBZA 3KDMB 4OSUL 2WZPA 1WHOA 4BK8A 3C9NA 3AU1A 3CC5A 4GPVA 5DJYB 3QUGA 4QHLB 3QZOA 3ZSSA 1T0OA 1U92A 3CZJA 4KRNA 4WUUB 1OK0A 3MRNB 3GSWB 1AO7A 1JGUH 4R2GB 1FYTA 1EHNA 2YRPA 4Q6IB 4TS6A 3OV6A 1N6QH 3ZQWA 1JYWA 4Z9KB 2O6FA 1MRCL 1A3RL 3UC0L 2DTSA 4OGXL 5FDYA 5GZND 3STLB 3WIFB 2AW2A 1FV1B 2EDYA 1LP9F 4RISL 1WBXA 2Y7SA 1K5WA 1Z9OA 3RX8A 4AIOA 5F1IA 1KPRB 4EN3A 4RMTA 4JM2B 3IYLW 3DX7B 3P73B 2DS4A 5L2JA 2IBGA 1IRAY 2Y1YA 3CUPA 3TTYA 3UBXA 5F1SA 3AM8A 1BYNA 2AQPA 3WD5H 1MIEH 2MQ3A 1P4LA 4CMMB 3SOBL 2XV2A 3OC8A 4C56B 3ZGIA 5BV7L 2P8PA 3GMLB 2ZX5A 1H15B 4HJGB 1DN0A 2VN5A 1TITA 3LH2H 1ROCA 1XB6A 2XN9E 4IBLT 1J0IA 1DJZA 2YD7A 2FZ3A 2I25N 4A2HA 2OZ4A 3T3ME 5JHDB 1P6WA 1XGRB 3QUXA 1DBJH 1UGKA 5DJ2B 3TCXA 4E2OA 5A16A 1AXSA 3RWFB 1QUNB 3DVGA 5LXGH 4HUMB 3BQUC 5EUOF 3GM0A 1A25A 1G0DA 2FJFA 2EYRB 5CILH 5DD3L 3IFLH 4UYPA 5I66B 3HPLA 2WTPA 2NZ9C 3ZDWA 2V4LA 3O9WC 1MY7A 3NA4A 4HG4J 2NY1B 1TJGL 5ANMB 4GQQA 4NQEE 5HDBB 3S37X 4FKEA 5EOQH 4DVBA 4EI5A 5FECA 3U6RB 3BP4B 4NNYA 5IR1A 2J1WA 2VDOB 1P1ZB 5ANHA 1UOKA 4M5YL 5DC4B 1EZVX 3VXNB 4K7PH 2G3NA 2F8OA 3EYFB 3QUYB 1XSOA 3MCKB 1RY7B 1KXQE 1NLBL 1RZ7L 3PE9A 4DGVH 3W1ZA 4OZGF 3CDFA 4HWEL 1FGNL 3H3PH 5DTFA 5C9JB 3X17A 1E67A 3DOSB 4JQXA 5TFSH 1YEDB 2N59A 2JJSA 5K9KB 2W0KA 2DICA 5I1DB 4RSVA 1WIPA 4JPIA 4ONHA 4V2BA 5A2KH 5KBDA 1HHGB 5JR1H 5E6RB 3P2DA 2DLHA 3L3DB 1Z0NA 2YMOA 4LHUA 1B9ZA 2Q2EB 2EH8H 4OLYL 3P3TA 2VLMD 3WEAA 3MR9A 4IIQC 2X6AA 3ABLB 4M1CD 4LGSB 3JWNE 3QXUA 1W72B 5TF1H 2VH5L 4QRPD 3CSFA 5KANG 3WUWB 2AP2A 3KEHA 3T3PE 4PJ5D 3HOGA 3U9WA 4XP5L 4A38A 2WM0A 4XVSL 3H6JA 3DGCR 1J9QA 5KS9F 5EUKB 1MFAL 5CZRA 1A9BA 1VAHA 2FJGB 4FFVC 3DURB 1NAMH 4OCXH 4XBGA 3ZZ1A 2R4RH 3SEPA 5F6IB 4G6JH 3TVMB 2F1AA 5GISH 2J7LA 4FQ1H 5J1TC 4Q14A 5BW7C 2HLAB 3GSUA 1ZLSL 4B7LA 3IFNH 2AJYH 1OZTG 4UBDC 4NWTL 4FYQA 3VQ1C 1B2WH 2JV6A 2IGFL 4ODUA 5I8KL 3MFFB 1MWAA 1UXSB 3RIKA 5GJTH 1ZV5A 1MFBL 4HUCA 5KSBE 2ZP8A 4ZX3A 2B9AA 3SYPA 1OSPH 1FHNA 4KZCA 3D09A 1QWUA 4JPKH 1QZ1A 4QXVA 3PHQA 4M7KH 5CIPA 4MA8H 3AY4C 2A6DA 3VFRA 4NNXA 4XC3H 1RUAL 5DMGC 3S2AA 5M94B 1CYGA 3WNNA 4ZNCD 4TL4A 2DKUA 1NCWH 2ITDA 4MLIA 4KTEH 5L7XL 3BWUF 2WXMA 4PLKD 3CN4A 1L5GB 3VXOA 4IBVA 3F01A 2FAUA 3SQBA 2K1MA 1M4KA 3GO1H 3KCPA 4HA1A 1OTUD 1XF2B 3F7LA 3IXAB 3QZLA 3OJDB 1IKFH 3KJ4C 2APXA 1QW9A 3MCYA 3DIDA 1K2DA 5I1GH 4MASA 3MCLH 2XPYA 2H3NA 2EH7H 4FMKA 4NZUL 5FYKL 4YBHA 1YECL 2AV7B 3IMUA 3O4LE 4DP7X 2WBWB 2A9CA 4FQ2L 2CBTA 3QWOB 4AKOA 2B1OA 3MRHB 4ZFGH 4JMXA 2OMZA 2BSSB 5E03A 4OQ1A 3ABMB 3MLYH 3QISA 4TVPH 1LE9A 4JW3A 3RJQB 1LO0H 1M7DB 1GGBL 3V5KB 4JHWL 1MFCL 2YPVH 4G7SB 2AJZA 2MPAH 4MWFA 3WN5B 5I0DA 5DJAA 3SDXE 3NZ8B 4HALA 3CHOA 4AOFA 1HK6A 4E9LA 2IDFA 2BWQA 3WO4C 5AG9A 3TV3H 4FEMA 3BUQA 1FIGH 3QIBB 3TH4T 2NNCA 4U1GB 4DP0X 3FTGA 1SJHB 5GZOC 2WKLA 4JFPA 3V0DA 4K3JH 5IB4B 5I6MA 1HHJB 3WJJA 2XXMB 2XG4B 1CGYA 3CWGA 4PJ9A 4HBCL 4YAQB 3DGDA 3RDTD 2R8SL 4RBPK 5GS1C 4X6FB 4PTUB 2IVFC 3UYPB 1JNLH 3PYCA 1QRKA 1OD9A 4I4WB 5I1HL 3U79A 4E68A 5FF6B 3PP4L 3SYCA 3LIZA 2Y6SC 4MMXC 4F7PB 1EFXA 3KPRB 1PG7H 1U3JA 4UV4H 5CWSB 2YARA 1JZ5A 2G5BA 1U6AH 2G9KA 1RUML 1BQKA 4Y7MA 1B0GB 1PZAA 2IPUG 2ARJA 2YBRB 3LN9A 4AQ1A 5CEYA 1GW6A 4K7PX 4GRWE 2XPGA 1AZNA 1K5NA 4G6AD 2F54B 1F4YL 4I1RA 4X5XA 3NCJH 1GHFH 5M7QA 3P9WB 5BVPH 4YC2C 5IKCB 1KEGH 3FQWB 1MJ8H 1W8NA 3B3IA 5FHAL 3EO9H 2HZHA 3QEHB 1KGYE 2IPUK 1T66C 3VGAC 3B9KC 1G4RA 3GIVB 3L6FB 5BRZA 5TE7L 3ARYA 4M8QA 3GMOA 4U3XA 3SCMC 4Z7OE 4ZFOL 1T1XA 3HNTH 1VLXA 1BXXA 4BINA 2EE9A 5MERA 4LARL 4FQJL 4X7FC 4PRPB 2R1WB 1Z9NA 1I8IA 2AVFA 1VFMA 1QVOA 4AQAA 5E4EB 4PJ6A 1Z7JA 4AVHA 1FGVH 3QCUL 4GIAA 3ZDYB 1ES0B 4QRBA 3TH2T 1UXMA 2VM3A 4Y5XB 4EJ1C 2QGDA 2HUHA 1T2XA 2WPGA 3AADB 2ODIA 4KUZL 5JW4N 1KNOB 1JNNH 3S35H 4AQ8C 3VWKA 3T2NL 3RUGB 1BF5A 3WIIH 3CBRA 5KOMC 5AAPA 5I15L 2AC0A 1VSCA 3OLGA 5FYJH 1SJXA 4WI2A 5KG9B 3FO9B 2GJ6B 4U1LA 4WCYH 4Y4FC 4GMSL 3GTVA 1T5WB 3MRRB 1J87A 4PJFB 1ET8A 3OX8A 5CJOL 2VDLL 3OLIA 1T80A 3QEQD 4LT7A 5FO2A 2QQQA 3F58L 5IK3B 1TQCB 3ERXA 1QFWI 4GW5B 3VD3A 2N0KA 2PYFA 4LCWD 3GJEA 1UH4A 2N4IA 3IJHA 3QZPA 3N9GH 2D31A 3FW6A 3NH7L 4QHMB 2A77L 2DRUA 3TS8A 5F9OH 4ZXBD 1CDIA 4X4YA 5HJ3A 1NCBH 1XAUA 3G04B 2QKIC 4B9ZA 4MA1C 4Q0XL 4YQXL 5E2JA 1LK3H 4EOWH 2CIIA 1ZSDA 2GBUA 32C2A 4N0FB 2E7HA 4FNRA 1BCIA 4YK4B 4WLCA 3DLQR 4I2XE 3LVTA 2DYPA 5IBLD 1CFSA 4LOEA 1RK1B 1A7RL 5HHNA 4WUUD 3FH8A 1EAPB 3ZVVA 4NC1C 5DJXA 3MLXL 4JHBA 4HU8A 1BIIB 1BZ7A 4R2GD 1SDAB 1E4KC 3PNRB 4ZFZB 4HIXH 4W9CC 1QTPA 5KSAA 4YSEA 5D1QE 1KJ3L 4CKQA 2YPKA 1GZQB 1BZEA 3HS0A 5JA9A 3FFCA 4B5EA 1S78D 4HPHA 2IOMA 1WP6A 4KAQL 3FQUB 3JZYA 1W16A 1ZT7B 4FG0A 3ME0A 1RUPH 4JM2D 1QLEL 3IFPB 5GZNC 2J3SA 1SN5A 1MCRA 1ZLEA 3AFLA 4AYFA 3RB7A 4B9YA 4DAGL 5J8OA 1U91A 1A5FH 1GS6X 3M6DA 4C56D 2BZDA 1EBPA 4QYOA 1VCAA 2BY1A 1QRNE 1JZIA 5CP7B 1EUUA 1YJDC 3DX8B 1KTLB 2Z9TA 2BJMH 2XU9A 4JBSA 3LQAH 4TPRL 4F1SA 3L95B 3P0VL 2Z93A 3F7VA 4DO6A 1CGWA 5HBBA 3EGSB 5TH2A 4PJGB 4PGEA 2FIRT 3NABL 4GQ9L 3NEXA 3MRLB 4JY4A 1N2RA 2Y07H 1WTLA 1PAMA 2CDFB 5DRZA 1HHIA 2HFGL 1CC3A 3C8KB 3HJEA 1TO4A 1J1XH 1MHPL 1FFNA 3L4TA 1WAAA 3VXSE 1I8AA 2NY1D 1KENH 3X1FA 1EMTH 3HZ3A 1E27A 4PGCA 4PW3A 2Q7YB 2F58H 1PG7X 4I9WE 4GKLA 1CWVA 3FSWA 3KEDA 2IADB 3CFTA 3BVNB 1VFOA 4JHAL 1PKOA 4OLWH 3QIUD 3EH3B 1OP9A 3QUYD 2VXSL 1FCCA 1VGKA 4IDLA 4XP4L 3FU3A 4AGOA 4AZ8A 1JZ7A 2QSQA 4DHLA 5KBPA 4I3GA 1YRKA 2OJEA 4Q9CA 3LEVL 1A9EA 2CQVA 5FLVA 1KV3A 4IMLB 4ONOA 4NAJA 5I17B 3U25A 1M7XA 1I82A 1JZ4A 3PQYE 1DBBH 2VDQL 3G6AA 5DS8B 4WHTB 4JM2F 2NLJA 1C1EH 4DESA 5EC1A 3GGWB 1UWXH 3LMJL 4W9ZA 3V95A 1NAMA 3VYNA 3WGUB 3WKNA 2MQ0A 2Z64C 4NAMA 1BIHA 1CZ8H 2Z92A 3D85A 3WNMA 1LWRA 4ZX4A 3ZTEA 5EZOL 3FH7A 5IB1B 3BWUC 4R7NA 1XAKA 1A7PL 4W9KC 5FO8B 5L9DH 1JNJA 3ZUNC 1X6NA 1G94A 3QXWA 5KVDL 1QSEE 5C3IA 4KMQA 4PWHA 3P4MA 4GQZA 3O6LL 2OMXA 2CK0L 4O9HL 4OUOA 4W6XB 5I6OA 4N6RB 3S35X 2C3VB 3K2MC 5C0RH 4Y5VB 2JWYA 1JF1A 2O6PA 2HFTA 2R59A 5ISZE 1UH2A 4GKNA 2GAZB 1AGCA 2W60A 3VXUB 3DO3A 2IC2A 5HDQH 4UT7H 3T8VA 2KZBA 3FB7A 4KJPD 2WSDA 2NRDA 5HDBF 3MTXA 4FGMA 1OKEA 1U8HA 2BSBA 3II2A 3HE7B 5HGBA 5ICYB 1HILB 3S34H 5IJKC 1BEYL 2ZT9C 3I74A 1C5BH 1DEEA 2BY2A 4Z76A 4XBPB 4G42B 4V11A 1KN2L 2X0VA 1N6VA 1EGJH 3P3YA 4L5FH 5KWYC 3SJVA 4IW4C 3ZKXB 1KN4L 3D18B 3DPBB 3QIWB 2BVOA 4A55A 3V6FB 4RGNB 3IJEA 3DX6B 1OAUH 4UDTA 2AEQL 3ABGA 2ADYA 3BWZA 3CFCL 3OQRA 3R8BB 5CJ5A 1YEFH 3OR7A 3HAEB 3TU6A 3P0GB 4IRJA 3N04A 4QOKA 2HKFH 3H7BB 3U0PA 2DOCA 2YPVA 3CQPA 3C5ZA 1AP2B 5F72S 2FX9H 2CIKA 3D69A 5DEGA 3VSVA 25C8L 3ZU8A 1HHHA 4G9FE 3RIAK 3L5JA 5DEJA 1G7QB 5AW6B 4PLKC 4DF9A 2K4AA 5E2WL 2FB4L 2E6JA 1HQRB 5FFLA 5E4AA 3LDBC 1MQKH 3QDME 1KBGH 5IWLC 3HLAA 3SKNB 1GJIA 4JCWA 5AKSA 2VDPL 1NCDL 3TA3D 4CBPA 4JGJA 1F6AA 1AQHA 2XVLA 2NUPA 1T2JA 3DWTA 2NXZB 5B7MA 3E3QE 1X7QA 1KIUA 4FRWA 2EUZA 4PLOB 4XCEB 4WGVB 1FORH 3C8DA 1RSFA 2HJKA 1T1WB 3QIBD 3WXVH 3L1FA 4H0HB 3WN6A 5FM5M 5CCJA 2MPVA 4GG6B 3S3CB 1BOGB 3BZEA 4NT6B 4QF1A 2EO7A 2VIRA 5IVZB 1FL3A 5GJSL 4MQTB 3BLPX 5BCAA 3S5ZA 2J73A 5F9WC 4ZYKB 3JVGC 3O11A 4MRCA 2ZXBA 5C3TA 3RDTC 3KPRD 3UERA 5J1AA 5M95B 2R15A 4NCDA 4BUGA 3CE1A 1DHKA 1MCOH 3LQZB 5H2BA 1CDGA 2R7EA 4UU9B 4K23L 4P2RB 1UG9A 3ZDZE 3VNYA 2X53A 4HIPA 4HT1H 1JXKA 4OTXH 4MB1A 3I6KB 3ARGB 2QKSA 3KXFE 3V55A 4Y5YB 2F54D 4UV7H 4G5ZH 3B5GA 4FL4B 1TJIH 1CIUA 3C2SA 2C8NA 3LKPB 1I9RH 1KJMA 4Y88A 4HBQA 5AYQA 6PCYA 4JZOA 5DJCB 1OQXA 1HTYA 3L3GA 3QULA 4FULA 2VKWA 3LVEA 4G6AC 4JFQB 4WTQA 2QFRA 2EXSA 3R1GH 4CU6A 5EFIB 2BP3A 1EA9C 3EJQA 1MREL 1RUKL 3HTLX 2X2IA 1C16B 3EJCA 1WUZA 3LEXA 1CTOA 4FFYH 2G2RA 4PTTB 1I8LC 3DDGA 1A7QH 5DK2A 1YC8A 4JM4H 4PRPD 2OCJA 3GBDA 1AQKL 2FQGA 3HLKA 2PCXA 4MJ2A 5F0MB 1AKJA 4N2CA 4NCC2 3LX9A 3H7LA 3VFTB 5ELIA 2N56A 1OGSA 1AGEA 1RK0B 2E86A 1HNYA 1M7IB 3OKKA 1I7RA 1P7BA 1W6WA 3TZVB 1JRHH 1GH7A 4JK0D 3BX7C 1WZKA 5CBAA 5I26A 3MKKA 3SE8L 2Y4SA 1UB6A 1YJDL 2VR8A 1N4XL 5EU5A 4BWTA 2XN9B 4AW4A 1L3NA 3OQ3B 3QDGB 1KACB 2DLEA 4HW6A 3M46A 5FYLL 3RAJH 4XX1G 3DROB 1BFVH 4XXCC 2ZUTA 2GJ6D 3T3MB 4MCMA 5IQLA 1CLOH 3HZVA 4UOW0 2CHNA 1ZDQA 1UFUA 1DR9A 2Y7MA 5JYMA 1A6UH 1E28B 3NZSA 5F1NA 1DE4A 4FFZH 4BA0A 5CFAA 1GOHA 2YJQA 1FNEB 4IU2A 1T0NA 4QMEA 2ID5A 4U3SB 5J11B 3I50L 1T4WA 4FXLA 4WI5A 4X6DA 5KSUA 1LEIB 4XPGL 3WUWG 1UACL 2I27N 2RQ8A 1NSNL 2HX7A 4NQEB 5EEWA 1BAWA 5F9JB 1E9QB 4U1MB 2F0CA 2YA2A 1XSIA 2YD9A 3BQVA 5C0AE 4HEPG 2YRBA 4IDJH 3CFJB 4Y4HB 4RMVA 3AQZA 3X3FL 1INQA 1IT9H 4KI5D 4JKLA 3LQMA 3GK8H 5B1JC 5HHXL 3ROOA 2FGWH 4MZ2A 2E7DA 2IDSA 2J5LB 1SEBB 1YMHB 3ARDA 4Z8FH 5E6ZA 2HG0A 4APXB 4Z78B 4RAHA 2VR4A 5BXFB 4ZXBC 3UYRL 4ETQA 4PMEA 1PYWA 1SEQL 3ARUA 3ZE2E 4P57A 2HN7A 1MY5A 4WEBL 5KYUB 43C9A 4Z5RB 3FQNB 2OXGA 4OM1L 4TQHA 5T3XH 4JQIL 4LPWA 4JPVL 3ZDYF 2RCSL 2DMCA 3FZUD 3MLTA 3P9LA 4MS6A 4NQSB 1XH3B 5HI3D 5C7XL 4X50A 5IVXE 4R2GC 4XWGL 5IQ9A 1DQQA 1SN0A 2A73A 1ASQA 4Q6IC 3KWTA 2CLZA 5B38B 1IAOA 4OFKA 3QFJB 4JFOB 3GXFA 4DFIA 4P5KB 4PB0H 3RUGF 2RIKA 3PJNA 4XCCL 1S78C 4A63A 1EV2E 1UB5B 3ESPA 4K15A 1HXMB 1IGML 1NUFA 4FHKA 5E23A 4MNQE 4AYBA 4K3GA 4M6MH 4D9QE 2DMBA 4JM2C 1WK0A 2FH8A 1GYWA 1GY1A 4LDCA 3WHE0 2EUWA 5HDOA 4DQOL 4R3SB 1PZ5A 5ADOL 3ULSA 3KR3L 4PJFF 2ZJSH 1URLA 2SEBB 2EDMA 3MJ8A 3QZBA 2XA8L 2WO2B 1XGQA 3IDGA 3QQ9D 3TNNA 2UVFA 4POYA 2BC4A 1DL7H 2Z6FA 3IMVA 4HIJB 3VGEA 4HSQA 4R5TA 4EF3A 2RQEA 5A2CA 1WD9A 4S0TD 1X9UA 1YSOA 4MBRA 4Y2DB 5JW5B 1H6FA 1T1ZB 3HEIB 2IAND 5IQ7H 1WBZA 3QR0A 1WS8A 3FMGH 3LRMA 1HZLA 4BH7B 1B9KA 4Q4IA 1EDQA 1JZJA 2E76C 1AY1L 5HYFA 3EOBA 1LQBC 1G87A 3SKOA 4KI5F 2A6KA 1FFQA 3MV8E 5DT1H 1E30A 1OGAE 3N43B 3HPJA 1JGEA 5H94B 3GI9L 5JMRA 4WEUD 1WA0X 1X6LA 2YKLL 1O7DC 3BSZH 3EO1A 3QP3A 4W9LC 5J6GB 3MRIB 1CE1L 3V7AE 2NY1C 4GUPB 3WFCL 4BUQA 4KDWA 3LEYH 1DVUA 4XH2B 1JJUA 1BZOA 4NO2A 5LAXA 3IE9A 1J8RA 4GRLB 5D7HA 1X5KA 3B9AA 2EKSB 3L1GA 3LHAA 4G70B 2XNAB 4NJ9L 3EOAA 3BP7B 2Q6WB 3QUYC 2O5YH 4JFFA 3S2CA 4O02L 1FH5L 5I1LB 3BESR 4GW4B 2E6QA 3D2UB 1N7ML 1QLFB 5BJTA 3W56A 5L2KD 1PD0A 1MCWW 3KYKL 2UX6A 5IVOA 4ZI8A 3LS5L 3B6SB 4MRBA 3O4LB 4WI8A 3EUUA 3ZKND 2PWFA 4TQPA 1SY6L 3A22A 4GRMA 1JPTH 4HIIA 4ODWA 2VDNB 1T7WA 1G9EA 1V3JA 3DXAE 3L2LA 4LSTL 4U1SA 4NQDA 4F20A 4PJHA 3DGGB 4R5VA 4EMZA 5ETUA 3FB6B 4N2EA 2OXHA 5TD4A 4PJGF 4I3SH 4E9XA 4EAEA 5TDOA 1A64A 1WAEA 1IEAA 5FW7A 2J1KA 2WUCH 4H26A 4ZO9A 4XMWA 1EGJA 4YHPB 3FRUA 1FAIL 1S7TA 3KWWA 4XMKH 3II3A 3VXUD 2JTYA 5DRXA 2GUOB 3NCMA 5I74B 2YZ1A 2DIBA 5GGRB 2OR9H 4RBPH 1QHOA 2F7RA 3COOA 3IDYC 4HHAA 4J7RA 1XGPB 1ZKAA 5F6IC 5LNEA 3OXRA 1XGYH 1JXJA 4G6KH 3TVMC 5LXVA 3HE7D 3MXVH 4ZPVA 4J27A 3CXHK 1EAOA 4KROB 2VMCA 3QT2A 4XPTH 1XWVA 1A8JH 3SE3A 2YUZA 5GXBB 5J9PA 1VZHA 2WLIA 2AS5M 4CNIA 4EQ3A 1KBVA 5AQ0A 4KJPC 4KBPA 3FUMA 2XFXB 4PJ7E 3GSNH 4QRSA 2IG2H 1UUNA 4P5MA 2VC2L 3QIWD 5D72L 4CA4A 1I9IL 3APDA 2X44D 5T5NG 1DBKH 5INCB 5FKAB 4RGND 1ZT1B 2BFGA 2W81C 4YDNA 4YEEA 4ZODA 4D9RE 2WB7A 3VRJA 1SMDA 4HK0B 3AU0A 5D1ZA 4YSRA 4A6YB 5E2VH 2VWEC 2WIMA 3Q13A 3KPPA 4U31A 1OCRB 1QHPA 1U30A 3HI6L 4OZFG 1A02N 1Q72L 1KDIA 5DEFA 1LDPL 1BQLL 4NNPH 4EBQH 1A6PA 5DVPA 3V4PH 3BUTA 4Z7OB 4Q9RH 1U8NB 3OKNB 4OZHA 1CTMA 4JQVA 4FTVA 4UB0L 1FNGB 4NQVB 5FA4A 4QHUB 2I5YL 5AB9A 5C0GA 4FTDA 3FT3A 4K71B 4R0LB 4GUCA 4WW2A 1MEXH 4IQHA 4NS0A 3VFOB 1GW0A 1QWNA 5K59E 2R4SH 1CJYA 1RIVH 3CU1A 4XXWC 2H6UA 5JOEA 1UZ8A 1N0XH 5DD5L 5AAMC 3WXWH 1EUTA 1A6VH 1WGOA 4NQQA 4ODHH 5FOBB 4NBZB 4MTMA 3WN5C 4PREA 4YZWA 1U9KA 2DQUH 5JIHA 1QEXA 1N3NB 5KN5B 3TM6A 3MUGA 4GO8A 4MJ6A 3QIBC 4U1GC 1ECYA 5LCVA 3TBCA 3T4YA 1XX9C 3TJEL 1ML0A 4UM9A 1CDBA 2ED9A 1UASA 4JJOA 1YDPA 1R3IH 2IQAA 4QRRE 3D0LA 2VLRE 1U8PA 5F89A 2DI9A 3IETA 4GFTB 3E7JA 2KZ1B 1D7BA 1WBYB 4P2RD 3SODB 3NFPA 1U41A 3VRLF 2VLJB 1KBWA 1KGWA 1NJ9B 5FWQA 4FFYA 1J0YA 3RWDA 3ZHNA 4G7QB 3DV6A 5DZNA 3ARGD 3VFSB 1AO7E 1WC7A 5I8CA 2C9UA 4WSGA 2EIZA 4I2XB 1FYTE 4ONFH 3C6SA 3HNSH 1C12A 1PCXA 5GS0H 2FD6H 5D4JA 4GB9A 5I1IL 1F11B 3L9RB 5SV3A 4L8DB 3B56A 2EDRA 4WI6A 4HXAL 3VA6A 4F2MA 2Q87A 2WY3B 3JV0A 4HJ1A 3TO4A 4ZOBA 2OM5A 3CU7A 4QRQB 4OZIB 2FO4B 3PWNB 3VUAA 1EO8H 1KY6A 4AIZA 3O2DH 4FXKB 4K8RD 2ADIA 2DWTA 1J0HA 3F65A 4HGWA 2MKWA 5DJ8B 3MNVA 3MBEA 3VFNA 4A7QA 3OC5A 1CFQA 4ZMQA 1EEUA 1YUHA 2GKIA 4I85A 5C8JA 2JK5B 5H4YA 1E3XA 1YYLH 1MJJA 2GJRA 3SZ6A 4DKFH 1FDLH 4FFZA 3FU8A 4GAJH 4Y2NA 1RHHA 4FI8A 3NIDB 4GG6F 3MNZB 1ADQH 5E4EC 1QRNB 4WJ5A 1OAQL 2WAQA 4Y5XC 1MFEH 3Q2LA 4WI0B 3QDGD 4H0GA 3MODH 9CGTA 4KOBA 1EXUA 2E4TA 4L9DA 3VH8B 4LK4A 3OXSA 3R7QA 3TJHD 4P59H 2P26A 4F7MA 2XWXA 5L0QB 4X5WA 4BDVB 4G80B 1WTGT 3WU1A 4NQTA 3B8YA 4YHZL 5J56B 4HS3B 1B2YA 4WO4A 3L9EA 3RY6C 1ETZA 3VXSB 2DMGA 3I75B 3HC4L 4NQED 1S7QB 4HOZA 4X4XB 4C4KT 1DQIA 1TQCC 2E9WA 3C2AL 4YSOA 3G9VA 4R5XA 1I8MB 2NNFA 3ASOB 2ZUXA 3REVA 1LTXA 3VFWA 4WQOA 2BZ7A 1LDSA 2XV3A 5D4QA 3SYQA 2ZOKA 2V7HA 1GZPB 1OV8A 3L1OH 2WIIB 2VDOL 3F6IA 2Y24A 3CDZA 4KI5C 5MI0B 4YK4C 2Y2TA 4BFBD 1EZUA 3FO1A 3PQYB 1CG9A 1SMAA 3MBWA 5DJ6A 1KXVC 1Y1UA 4LRNL 1RJYB 2X40A 3D50A 1UCBH 2Z8WC 3DVIA 4J1UA 5E9DB 5CLYA 1IBHA 1PKQE 1XH2A 4XOAA 2PTTA 3T0XA 4DGIH 3QFJD 2JJTA 3VSUA 3MLRL 1TTCA 4GBXB 3NJFA 2KMWA 1CF8L 2EYSA 4LU5L 5HI3C 2E7MA 4FA8A 4L4VB 1DZ0A 1X5HA 3BE1L 1CI5A 3VJ6A 2WJ5A 3GYRA 2CCWA 3FPXA 3F7YA 3PF2A 1HVXA 1I1YA 1QSEB 3PHSA 4I9XA 2CUHA 2AFNA 5FGBA 4AEHH 2VN4A 4TULH 3KLAA 4FLOA 4QHPA 2DWEA 2X4OA 3T3MF 4IOSD 4D9LL 1X4XA 4LVEA 1JI2A 1W72L 1NFIB 2XWTB 3VXMA 5ALBH 3MI6A 4AM0B 1EFQA 3BSZA 3MC0A 1KT2A 1WZ1H 2ZKHH 4I18A 2IPTL 2EVHA 1XCTB 4Y2DD 2EACA 1XIWB 3U6XA 2N3JA 3NACH 2CD0A 1QNIA 3QQ9C 4M29A 4M5SA 4S10A 4W6YB 3RKPA 3KLQA 3MDJA 1JF6A 3H9SB 1CBVL 4UMGA 4I87A 4A1RA 1GIGH 3FTXA 3QNXA 1DUZB 2WLLB 4X8CA 5KJ4A 3CBJB 3ISYA 2V17L 2QR0B 4F57L 1M05A 3K81A 3BFWA 3WTUA 1WE5A 4MDJB 5JXEA 1WICA 4G7RB 4GXVL 4AI7A 1BFOB 1HT6A 4RFEB 2XRAL 3CZLA 3UBXI 1AGBA 1NIFA 1SOQA 2FIKB 2Q0ZX 4GRLD 4BIKA 4IU3A 3QYNA 3TWCL 1I1AD 4P4KA 4DERA 2F8VA 1OE2A 4M61B 2XG5B 4ODSH 5B22A 3KW7A 3IKCB 1KJVA 4WHDA 2DYRB 3UTPD 2AJXH 1HXKA 2FT6A 2DQHL 5D1XB 5JNYB 2Z7WA 3D2UD 3TIEB 3OKYA 1D9KA 3A24A 1U0QA 1R5WA 3ESOA 3IMSA 3RGVA 2C3GA 2YJLA 5IY5B 3PJLA 2VXTH 2LLNA 4AK2A 1R0AL 4PVLA 3FB5A 5I2IB 3KZ8A 5MENE 2AJVH 1P9MA 3K71B 3V4VB 1HAWA 1AZCA 3Q8FA 1C5DA 5TK2A 4UTBH 1MFDH 4I77L 2PCFA 3NSYA 3G5YA 5EDXA 1CGTA 3ZKNC 3GHBH 1F02I 1VGEL 3TFKD 2AGJL 1HE7A 3HRPA 3US0A 5LG1A 3BN3B 3NBNA 2VUKA 5CGYD 3QPKA 3LRGA 5F7DB 2BVPB 3UTQA 3T0WA 4ABWA 1JZ8A 2LVCA 3CHQA 5I9QB 3P9MB 1AOZA 3PHOB 2VL4A 3MRGB 2OMUA 2Y7QB 4Y9CA 5IEHB 3NN8A 5I1JL 3GBNL 1J9RA 3N43F 4N2MA 4OFYA 4PP2B 4QKTA 4Y5VC 5MP6H 3NQIA 4B96A 4R4BB 1JD9A 4NSKA 1CVRA 4NRYA 2ZOWA 1TZIA 3IU3B 4G72B 3QQ3A 3A3YB 4JO5A 2MOGA 3SBWA 4ESKA 2NTFA 3QNZA 4HF5H 2BSDA 3AXIA 3WNOA 5K69A 4J2XA 5JW4R 2H3KA 3V4LA 5I82A 1SPDA 1L9RA 5FO7B 1TDQA 4WUKL 1ZVSA 3ZKQD 3HE7C 1YN7B 2HPOA 3DBXB 1UA6L 3MOAL 2BVYA 2VDKB 4J6RL 3UTSA 3ZDZB 1V7MH 1T0PB 4OIIH 1XQ4A 1A6WL 2PWGA 2DM7A 2GEQA 4KKPA 3NIFE 4I0PB 3L3JA 3KXFB 4KKAC 2B3RA 3GC3A 3LCYA 1PLGL 4IOIA 3KH4A 3QDJE 5EN2A 4N0YH 4YHKL 5A6LA 3ZKXC 3CZUB 3S7GA 1CS6A 1XMWA 4MCZB 1QFUH 3L3HB 3QIWC 4UQ2B 1HINL 3ZL4H 5BRZE 4BSVA 3AREB 4RGNC 1HH9A 1OT2A 1Q9KB 2BP8B 3GNMH 3E6FA 1F8TH 1DP0A 1G0YR 3FBKA 4RESB 5KEZA 4LCIH 1T2QL 4KKZA 4KX7A 3U46B 2VSKB 2UWEA 4NQUA 1QEWA 4EUPB 1UCTA 3BP5B 3CLEL 5SV4A