4OR1A

Structure and mechanism of fibronectin binding and biofilm formation of enteroaggregative escherischia coli aaf fimbriae
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
144
structure length
129
Chain Sequence
b'STEISLEGLHNMGEQLFDGDILATGRIICRERHTGFHIQMNARQVEGRPGHYIVQGSKDTQSKLWVRLGREGWTSPQGIVRSGQEEQVIFDVMADGNQWAKPGEYIFSVSGKCLTTAVAKTATSTITVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Invasin homolog AafB, Major fimbrial subunit of aggregative
molecule tags Cell adhesion
source organism Escherichia coli
publication title Structural insight into host recognition by aggregative adherence fimbriae of enteroaggregative Escherichia coli.
pubmed doi rcsb
total genus 21
structure length 129
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05775 AfaD Enterobacteria AfaD invasin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4or1A00
2CO1A 2CO4A 3UIZA 4OR1A 2CO3A 2AXWA 2CO6A 3UIYA 2IXQA 4PHXA 2CNYA 2CO7A 5D55A 2CNZA 2FVNA 2CO2A
chains in the Genus database with same CATH superfamily
5DK2B 1W8EA 5CJ5A 5TDOA 1OPOA 4PJHB 1DO5A 1EAPB 3ZUCA 4V33A 3IDMB 3H3PL 4FEIA 1MWAB 1ZMYA 1S9VA 5T3ZL 2H0PA 4TL5A 3RX8A 1ZAGA 4D8PA 4PJGA 1XR9B 3V4VA 2IPTL 2V9QA 2IFGA 4LIQE 2ZXAA 5IBTH 5A2CA 3NJIA 5EHFA 2PPFA 2ZXEB 2QQLH 2X9XA 5I8EA 4ZFGH 4XMKL 3E6HA 4J39A 2J20A 5C7ZA 1OHQA 1W0VA 3QAQA 4OVUA 1V05A 3NCJH 1SFDA 1NLDL 4QKTA 2X6VA 3TPKA 1CI5A 4RISL 4FJYA 2OV0A 3FQWA 1I7UA 3P9LA 5CIPA 5E9DE 1G84A 3O11B 4MAUH 4W9HC 5EOCL 5IROD 2I07B 3AY4A 4QRUB 2E86A 3M8OH 3P4OA 3QDGA 4JUSA 4RAUA 2RB8A 3VH8B 1JPSH 2BP5M 2CUIA 2D3JA 4TQHA 5DQJB 5DLML 1Q0XH 1AQDB 4TUKH 2F54A 5MI0B 3TTSA 3DVGB 2HT2D 5FCSH 5BO1L 1XMEB 3EYSH 3CZFB 4DO4A 1CGWA 2QQKL 3HS0C 1J87A 5F9DC 4Y4HA 1J8RA 3Q5TA 2F5AL 5ITFB 5AG8A 1KJ2L 1RZFL 1ITBB 4EJ1C 4R6UA 5ACZA 4NQCE 1NANI 4O2CA 1CLOH 2WYHA 5EBLB 3JVGC 4KTDH 3VD5A 1JV2A 1ROCA 4PRHE 4C4KT 2FZ3A 3FSAA 2B9AA 1Q9KA 2EIBA 3LQAL 4XP9L 4G9FE 1ZLDA 4KDTC 5CIPB 4F1SA 3QXTA 1P7QB 4YK4C 4N8CH 5IESL 5DJXA 3RGVA 2R56H 1J7VR 4PHZA 3MUHL 4M6OL 2Z31B 5E4IA 1FVDA 2FD6L 3CFJA 4HAKA 2FHCA 3WUWB 2WK2A 3OKNA 5C6PB 4A6YL 3K3QA 2YARA 3T0EA 1I3GL 5DO8A 5EBWB 5C2UB 3FN9A 4NIYE 4DAGH 2YSSA 3HFMH 5I0DA 2Q76B 3D2UB 1BVNP 2G3MA 4MAZA 4OM1L 3CWGA 1D5IL 4TQPA 5I8CA 1RZKC 2IQAA 1NH6A 5D6DA 2JKSA 4OH2A 3NVQA 4GPVA 5DYFA 5TDPA 3LH2H 3D87B 5LCVL 3WFBH 4OZ4B 5KSVA 2NNXA 5DWUL 2ZOOA 1I82A 4OGYL 4PGZA 4S2SB 3RLSA 4P4KB 4AKOA 2ICCA 1Z5LB 5EZJA 1KOAA 4JJOA 4DWHA 4U1IA 3RTQA 1YSOA 1QKZL 4IIQB 3MPCA 4QY8A 5FV1L 2BPBA 4YN3A 2G2PA 3SKOA 4F57H 1DSWA 2YUZA 3PP3K 4PJXA 3KHOA 1QO3B 4LVOB 4HPOH 4LE8A 4A04A 4PLKC 5IT2H 1TKWA 3GBML 1HQ4A 5T1KA 5A2BA 3IB4A 2NXYC 2BXYA 1NGWA 3SY6A 3KPMB 5L2KA 1KB5B 4X6EA 2Y1ZA 1UH4A 2ZNWA 4GKZA 2H8PA 3RUGA 3II2A 4P46B 4XN8A 1LXMA 4JKWA 1AS8A 1R34A 2KUTA 2JJTC 3FN0H 3PY9A 3I9AA 4POZC 2LT9A 1QBAA 2VXQA 4M93C 1HJBC 5ICXB 1ZLVH 2XN9E 3NSDA 1JERA 2DQUH 3JUYA 4YAQB 2CHNA 1GZHC 4X6CB 4GXUM 4WEUD 3NG5A 3UGXA 2F7RA 4LLQB 3V5KB 4RMBA 5CCJA 4WWKC 5B4MD 3VI3A 4K7PL 3P9LB 5JXEA 3VXPB 5CP3H 1TZGH 4UOW0 2X42A 1IUZA 1RD6A 5DJDA 2ADJB 5E94A 1E3ZA 4O5LH 2C3WA 4R97C 1VFMA 1L0XA 4HC1A 4OLUL 2GB2A 5GJTL 4GP5B 3MO1B 1N7ML 3QA3A 2FBJL 4WF7A 1JWSA 1HFUA 4HS3B 2DQDL 4LHUD 5C0DA 1FNEB 4NO5B 3SYCA 4X99B 5HYJE 2IG2H 2QSVA 3WSQL 2NY6D 3APCA 3FU3A 4KTEH 5F7UA 1PSKL 4Z7AA 5C92A 5IMOA 3NSJA 3BUYA 4LCYA 3OM3B 4UNUA 4BQ9A 1FSKC 4Y89A 3MLVL 3CX2A 1UYWH 2XIIA 4H20H 3RWDA 2H2PD 4IRJD 2FZ3B 5TE6L 4NQSB 4GG6E 2P24B 3BWSA 2XJLA 4QTHA 1HEHC 4AUJA 3ULUL 2EYSB 5CJQL 1CK0L 5FFLA 5DURB 5B21A 4YPJA 3AADB 3C08H 2WBXA 2ADJA 1SN5A 1ID2A 5LBGA 4JPWL 5FM5O 3BT2H 1IGIL 5D70L 5DZVA 2EECA 4IU3A 1NBCA 2BH0A 1KZQA 3HB3B 2R27A 3HN3A 4NWUL 3D3VD 5CIPH 2F1EA 1MCLA 3MO1A 2Y2WA 4Q9BA 3IN2A 2CIKB 2J8HA 2FUTA 5ACLA 2JSFA 3VXUA 5DS8A 1A14L 4HCIA 4RA3A 2HFTA 2Q86B 3WNIA 5DVPA 1RZ8B 5K9QI 4MKMA 4PR5B 5F9OH 5T1DH 3RTQC 3V0EA 3CDZA 1N67A 4UINH 3L3GB 3W11D 3JTSB 4NXKA 1IIKA 1XGRA 1RPUA 5JHDB 1J0KA 1KGWA 2WTRA 2VLRA 4AOFA 2F5BH 1KCBA 1A65A 1AZUA 2UZYA 5DMGD 1UM4L 3ISYA 3JWOL 5H35B 5IHUH 4BFNA 3BWUF 4H0IA 1ERNA 4BK4A 4M9PA 4MNQA 1HHIB 2ICEB 2N59A 1L0YA 1BFTA 5D55A 4I3SL 1BM3H 3UYPA 4JQXC 3ARWA 1JUFB 1HHGB 3TIDA 1S3RA 3INUH 2NY5C 4WEMB 3BAWA 2BY2A 2BNRD 5EU7E 2X41A 2W95A 1QR1B 3PWPB 2X10A 4V2BA 2ZJSH 2P7TA 3N2JA 3G9AB 1WC7A 1GR7A 4HMCA 4PS4L 2RALA 4M43H 4DK5A 4YFLI 1J8SA 3BQVA 4KY1L 5M94B 2LFGA 1EBPA 5HHVL 1FGVH 4IBUA 2XICA 3DK0A 3FU7B 2FX8H 5EU3A 5DRWA 2WV3A 1BEXA 1TZ8A 4FL4B 4KI5C 4BXVA 4WWKD 3F05A 5B4MC 1R9FA 4QT5A 3CK0H 3JWNG 4TF4A 1UWEH 3QZLA 1A5FL 1F4HA 5JHDA 1MCFA 1K6QH 3B9KB 2HJLB 4ZMOA 3HE6B 2QSCL 3ZT7A 4OJEH 5D1ZC 2YAMA 5DXWA 2EZ0D 1Q72H 1XZ0B 5T3XD 4IRSB 4PJGF 3WFEL 3ISWA 5FR3A 3RFZC 3PS6A 2MNJB 4UBDD 5KYWB 3HE7D 3HBQA 4AQAB 4AQ1A 5IJVB 1KPUA 4QF1B 3UYPB 4XN1A 3TXAA 1F6AB 4KKBC 4MNGA 4WSGA 5EPMB 4PREA 1N18A 2CAKA 1FG9C 3V0HA 4FFVD 5IR1A 1MI5E 3QDJA 1PZSA 2FHBA 2VQUA 2GBVA 1KLFB 3KLHC 5JYLA 1Y18A 2OMNA 4DGUA 2H2PC 4IRJC 1LP9B 4OIBA 4HZAA 5E1GA 4BUGA 4OZIF 4EPSA 4QRQB 3GZKA 2X9WA 3VM5A 4OF8A 4IOIB 1RZQA 1P9MC 2HFFA 5AUMA 4B3EA 1NKGA 4E5XG 4D7PA 5K9KB 3K8MA 3H2WA 1OM3L 2V4LA 1P84K 4XXWC 1SYVA 1HI6B 1Q9WA 1UB5B 3LXUX 1Q90A 3S5ZA 1DBMH 1M7XA 3L6FB 4HJTA 4LCCC 4BINA 2GVYA 2Y06H 3HE6A 2Y36H 2DD8H 2OI9B 2VLME 2NLJA 1L7IH 3EJQA 3UAAA 2CNZA 2H5UA 2ZXCA 3O6FC 2J73A 1X6LA 5F93C 3WOVA 5J6HB 1XX9C 1SEQH 2VDOL 1RUMH 2NR6A 2CALA 3L4VA 4K2UH 1NGYA 2WCGA 3ZJAA 2UX6A 1OAJA 1MQKH 3TT3H 2ITCB 5J9PB 3DUSB 4KVCL 1IC7L 3IGLA 2CDEB 1L5GB 3T0AA 5HYEA 1BF8A 2Q86A 3SHSA 1YEKH 4X5XB 3MJ9A 2CWRA 3TEUA 3MCLH 4S1DC 4JO8A 4G8FB 3O2DA 4TQEH 2BVPB 4AWJC 4FTVD 5KYUA 2VXVL 1U8IB 3RFZB 2YR3A 2WQAA 3QNXA 5F7EH 5H35A 1TQWA 2DL9A 1XO8A 2V33A 4HDIA 4G7SB 5DK2A 3UTQA 4QRRE 4O4YL 2RJMA 3QDGD 43CAA 1BSIA 1JPFB 1O6VA 2FSEA 2W92A 2Q3ZA 4D8PB 4WUUD 1A7PH 4DOHE 1XT5A 4FQXD 4PJDF 2F54D 4JFQA 4N2BA 4TXVB 4PJAA 4PU2A 2Y3AA 4I48A 3QCTL 1MNUL 3I84A 4PJIB 1INDL 2W9EH 5F96L 2DIBA 1T83A 3WJMB 3QUGA 4PRIB 1KFAH 1PD0A 4H88L 1DJZA 3PUCA 3Q44A 1AZVA 5IWLA 4M7KH 4R26H 1QWUA 3DNKA 1MF2L 1NC4A 5EOQH 1OAKH 1RPQA 2WBJC 5CHNB 4MMYB 3RURA 4GRWF 2D7MA 1B0GB 1G7IA 2VOTA 4M6AA 5GHWL 5LB1A 3V55A 2AK4D 2ZWLT 3DX6B 3GSVB 2X4TB 5IVXB 1IBFA 3P54A 1NC2A 4OD2B 4D9RD 4JM2D 4U1GC 3R19A 4P05A 3N43B 4DGYH 1ZTXE 3VG0L 5EO1B 1QHQA 2DWEB 1WSST 3MXVL 4TOYL 3IDMA 3G04A 4I0CC 1EZVX 4IMKA 4JMNA 5D7JA 5HHME 3T4AA 3WY1A 1X5GA 4Z7IA 3Q6GL 5E5LA 4ODHH 3L9EA 3K2IA 5G5DA 1HCYA 3QUKA 4M8RA 4ZMAT 1YAIA 4K23H 3H56A 3HCVB 3REWB 2MEJB 4PJAB 4M1DL 5BCAA 3HRZC 4LSTH 3VXRE 2UWEB 1BGXL 4AQEB 1S7SA 2F8VA 5IBUB 1W0VB 1R17A 3NJVA 3PHOA 5FO9B 4ERSH 1RZJL 1AACA 2RH0A 4FQPA 1JGDB 1FFRA 2EXWC 4GO8A 1A3RL 2OTUB 3M1BA 1I7UB 5K9JH 2MCMA 3ILPB 2XWRA 3ZTNL 4CC4C 4LVHB 4N2OA 4ES8A 4L1TA 4TRPL 3C5XA 4MASA 2YLKA 3EJCA 1KYDA 5K9KA 1RZGA 5C2BH 1NFKA 5INCB 1DVYA 5DJ2B 4HUVB 1ED3B 2X4TA 1XXDC 2FH8A 2VJ0A 4S1RH 5H2BB 3SO3C 4EN3D 3T8MA 2XJKA 5E8NB 5SWSD 4XMPH 1S9VB 5CJXC 4U1JA 3V4VB 4HGWB 2W9DH 2YUXA 1AGFA 1TQUA 3WNJA 5DVLA 1MFUA 1IGTA 3P3YA 1ZTXL 3EBIA 3L5WB 4G1MA 4HALA 3B43A 2X3BA 5A2AA 5I8EB 1EHAA 3US1A 3HIZA 4AK2A 3K46A 1NGYB 3OMIB 2EC9U 3QUKB 3KJ6L 3Q9QA 1YEDB 3AU1B 1KCUH 3FL7A 3OL2A 5EU7C 4NP4L 4L4VD 5DUJA 3NFNB 1Z5YD 3L08A 3TH4T 3LIUA 4HJ0C 1HINH 3V5KA 3CMGA 1I9IL 4N5EC 4UMSA 1Z6JT 4AQZA 2R1WA 4AZ8A 1R5WB 2R69A 3ATDA 2WKOF 2OXHB 2YAOA 4I7ZC 2OULB 2VDPL 4JRXE 5DQJA 1KLUA 4UV4H 2F54B 4QTIL 2C4XA 5E24E 3QO1B 4Y1AD 2RFXB 1LNUA 4CC0A 1E65A 1W72B 4C54A 2ZUSA 2R69H 4J3SA 1N6UA 5JHBA 1UOKA 3OVUB 3VMOA 2YPVH 1D5XA 2PCPB 4YL4A 2ZKMX 4PJHF 1TPXB 3GJEA 4YHOL 1OANA 1BX2B 5ID0A 3S88L 2XI9A 1XCQB 5CR1A 3FQYA 3ZE0F 5DMKA 2ENQA 4U6YA 4XMLL 2AK1H 2JB5L 2W9LA 1CGSH 2JJWA 4I3RH 4TLKA 2MFNA 2HTKD 4HJ1A 3RU8L 1CGTA 4EUPG 2EVJA 3VTTA 5HHXH 1BIHA 4LOEA 4NUQA 3FT9A 4NS0A 2NOYA 4X7SH 5AW7B 1SY6A 1PL3A 1Q4NX 4GAFB 4PGEB 4B3VA 3I9GL 1JTOA 3RTQB 5D1QC 4IDJL 4A55A 2PPEA 4PRBB 2IMMA 4JPKH 5I76B 2OA9A 1NDGA 3ATBA 1H9DA 2W07B 1P7QA 1TZHA 1CFBA 3L1FA 3UTSD 2V2TB 1QO3A 3QW9A 1AS7A 2OXHA 2UYLA 4KVPA 5CFHA 3K2UH 5EU6B 5K39A 5ESQB 5HJGA 3NIFF 1DR9A 3MLRL 2QHRH 4X6EB 5EA0L 3FXIC 4AYEC 1RIUL 1VHPA 4H1LA 3DPDA 1SVZA 1P4BL 1D9KD 2NYZA 2K6YA 2QR0A 1FZJA 4JFZL 5JIDA 2BP3A 4OF0A 4Q56A 1QZNA 2R1YA 3U0TA 2KZBA 4X7EC 4B6ZA 4Z7VA 1S9XB 2WXGA 3I6KB 4CDGC 1KBVA 1XH1A 3OGCA 2WLZA 2NY5H 3MI6A 2LHAA 4JFDD 3N1GC 2YFNA 3GBDA 2OMUB 1YQ2A 5DEFA 3DX4A 3H0TA 1IJNA 3O3EA 2CBPA 5JUEL 3VI3B 2FGWL 2IANB 1RAMA 2KQMA 5GRJH 4CSPA 1RU9L 1X5HA 2Y6TE 1DTUA 2YD2A 3VXQA 2VLLB 2Y7MA 4HK3J 2BRRH 5DJDB 5B38A 3TBBA 1CFQB 1MIEL 4Z7QB 3LKPA 3K4DA 1KT2B 1DVXA 3KM2A 4GLRH 3LD8C 4MXQC 3MODL 1QHPA 2X70B 5D7KD 3HI1B 4GEIA 3NDYE 4GG6F 1MLCA 2EDQA 3F04A 4NQXB 3PNRB 4HWBL 3RWFB 3TEZA 3LZFL 1U8NA 3ARFC 4MA1B 3W5MA 1BFOA 1OGAA 3NPSC 2QTEA 4HJGA 3NACH 32C2A 3QYNA 4FRWA 4G9FA 3VFVA 2WKGA 4FLQA 5EEYA 3E8UH 4CJ1A 1ACXA 2K6ZA 2VJXA 4LL4A 4I2XA 4PD4K 2ITEA 4Z7VB 3BMWA 4XO5A 3EUDA 4P3DA 4QRSA 4QGYA 2R2HA 1S3KH 3O0RH 4P5MB 2Q3XA 4QTFA 1F45A 3U2IA 4IKKA 5E9AA 3GD1C 2ZD0A 2Y69B 2IBZY 4MNQB 3EBHA 4JFVA 5T5FL 2OK0H 3P0VH 2R0WH 3G5VA 3ETBJ 4H8PA 3GHPA 4K7FA 2VDQL 2D7QA 3I74A 1AFVH 1QASA 3QJHA 3BPNC 3FCSB 1JWSB 4HS3A 3MLXL 4YXKL 3APNA 2A9NL 3FUNA 4A37A 4AL8H 1LL1A 3BUIA 1HOEA 1EERB 3NA4A 4CW1B 4MB5A 3O9WC 4ELMA 1MQ8A 2W91A 3WXWL 1M2OA 1WGVA 1EUTA 1GKOA 2APVA 4MMXC 5HGGS 1EFXB 2XSKA 4PV8A 2Y1AA 1HHKA 1W72H 2DKMA 5JPNA 1EA9C 1PIFA 3V7AG 4GQ9L 3RVVD 1XGRB 4N87A 4JO5A 3O8XB 1AI1H 4HUKB 4X4XB 2DYPB 1NCDH 1CDJA 1TIUA 1PDKA 2WBJB 1KXVC 1AC0A 5IHHA 1OALA 2DWTA 2JMRA 3CLEH 4NQQA 3O2VH 1I75A 2Z8VC 3NCBB 3VU2A 1CBVH 1UOWA 3ZGHA 2BZDA 3H1ZA 4S1QL 3SE9H 2Q3AA 2A9ML 1JWMA 2QKIA 2ZXDA 3H4FA 4PJAF 1WDAA 1HTYA 2VZOA 2BSSA 1EVUA 4AQ1B 1OCZB 3MNWB 4AQAA 3F00A 4MYWB 5KOMC 5CD5D 1B6UA 3IJYB 5ES4B 2EILB 4PWGA 3SZKC 2Y7QB 1FV1A 2GTZA 4YHIA 5KSUA 2GEQA 3WKPA 3ZL1A 5JW5B 2R83A 4HIEA 4N25A 3VXUB 1CE1L 1N4XH 4LVNC 3L7FB 3DJZA 4B5EA 4DNLA 1QNZH 5HHNA 2CDGA 3FQXB 3K71A 1WP6A 5CJOH 3TJHC 2MCPH 4L9DA 3AWGA 4ZUWA 3IPBA 4Y2LA 3KPPB 2OK0L 1JZ3A 1TLMA 1MLBB 5DDHA 1T6VN 3B9KA 1JVKA 5T1LA 3V79C 4UU9B 1A3QA 1FBIH 2B5IC 4N1CA 4OT1L 5A2FA 2QPFA 1H6TA 3W57A 1GTFA 5DVKA 2Y7LA 2QMJA 3IDIA 4MZIA 1T0NB 3QUMB 4HMDA 5A2LH 2CO7B 3HBZA 3L5JA 1SDDB 4UNIA 1XSOA 4XN5A 5IJVA 2QKIB 2VERA 4F93B 3SOBL 3CC5B 3IFNH 4ODXB 4LIQL 1MFVA 5I1DB 4KHXH 4JJ5A 2A74A 4WFED 3U82B 2BY3A 4DJMA 1B0IA 2UZXA 3OR7A 5IR1B 2Q2LA 2YAHA 4GRMB 4Y16B 1XF4A 1QFHA 5AW9B 1ECYA 3U6RB 1J5OL 3OXSB 2AJUL 1L6ZA 2LU3A 4LNVA 3X1BA 3K4AA 3TJHD 5DJCB 4X2UA 1CXHA 4MGXA 3DO7A 3ME0A 4QT5B 4GUOA 5D2LF 3LKRB 4KHTH 4NAQA 2VKWA 5EH1A 1Z5HA 3WKYA 3C8DA 4PGJA 2W80C 2YA1A 2WXOA 5JPNC 1NWOA 4WZ9A 1A1MA 1CN4A 1T20B 4F2FA 4L3CB 1PQZA 4AV5A 1YNKL 3CZUB 3GBNH 4ZSOE 3W11C 1W8OA 3GIZH 4KMTL 4DF9A 2H6PB 4GKLA 1NCGA 1MJJA 3CZNA 4GRLB 1I4FA 3V4PH 4XWGL 2HRGA 2MNUA 3JV6A 2I85A 4NZTH 4HLZH 4YHNB 4XNAA 4LCVA 2B1HH 1QTYT 3BIBX 5CUSH 4MD5B 1ADWA 4JM2C 1L5GA 2J88H 4KRPC 4PBVC 4TQ8A 2FWUA 1KELH 2HFGH 1FNFA 1G6VK 1WHOA 4MRCA 2WKOA 3OHXB 4K71C 2D9CA 1XIWA 5AUMB 5DQ9B 5I66A 4LMQE 5IIEB 4P3CL 3SGKA 3H53A 1KCVH 1DL7H 3BX7C 5M95B 2DQIL 1G7IB 4HWZA 4MAYA 1SYVB 4PCTA 4Q52A 1OWRM 5HI3C 3QHZL 1B9KA 1N8ZA 2QEJA 3HUJB 2DEYX 2G3ZA 2YC1B 1FO0H 4G9DB 5D2LB 3X14A 4FL4C 1E4WH 5J5EA 3GMNB 4YLQT 4WU7A 1UC6A 5J11C 1D2OA 5ENWB 1EO7A 3ZPDA 2ITDB 1XCTA 3MLWH 4NM8H 3NZUA 2XYCA 5IHWA 4YSAA 2EVIA 1X44A 3IRPX 5AENA 2IDQA 4I48B 4OF7A 4FERA 1TJIL 1HEZB 3VQ1C 3LEYL 2PPDA 3RDTB 1VKXB 4FFYH 5DD5H 2B3RA 4YLBA 4PJBA 1WCBA 4KFZC 4OUUB 5BZXA 1RFDL 2K8MA 1NOFA 2XWDA 3ARFD 5BRZA 4LGRB 3RVXC 2AANA 4ZW5A 1N3NA 1NZRA 3IS1X 2AAAA 5CR8A 3T0WA 3P11L 2VAAB 2E6PA 5D1ZI 2N7BA 3CHQA 4YOKA 4ZAKA 2Z3FA 1U3YA 4LHUB 1V7NH 3NJGA 3VXME 2FQFA 1ZS8B 2BM3A 1PIGA 1CO1A 3FFDB 5J6GB 1IRAY 5BRZE 5KSAB 3IDNA 4QRRA 4GBXA 3JV0A 3BQUA 5TQ2H 4GJTB 1QLEH 4X42A 4CC1A 5EOCH 1M2VA 2DPKA 4AUUA 1BZOA 3O4OC 5DI8B 5TPWH 3E3QE 2BIMA 1N0XH 1MXGA 1LO4H 2OR7A 1FIGH 4XCEA 3U2SB 4M3JA 1KXTA 3WCYA 1IL1B 3BVTA 1MW1A 1JRHI 5BVPH 5HXMA 1J1OL 4X6DB 1CG9B 3MNMA 2Z4TA 2AJVH 1MG2C 2RCSL 1N5AB 3REVB 4UTAL 5IQMA 4IGBD 4HS8H 1GAFL 1ZKAA 5E1AA 2J57A 4RDQG 3POCA 5DHYA 1TMCB 3CC1A 5EO9A 4KKRA 3U1PA 4JFTA 2A5UA 1CDUA 5LJYH 1LP9F 1THAA 2NDGA 1RJZB 1U8MA 1G7HA 1ZE3C 1U8KB 4NN7B 4ODSL 1E9QB 3V0WH 2H8PB 3GRWH 1KPVB 3RUGB 4BCZA 4G11A 1CMOA 1EAOA 3VDAA 4B0MM 4WQOA 3C2AH 4HZLA 3GMLA 4NT6A 5I8KH 4MD0A 5E1QA 3EBGA 1MCWW 5F3HA 2LE9A 1S8DB 3M86A 3T0BA 2DH3A 2IOOA 4P23C 3NMEA 4PP2B 3S35X 4L1BA 2FB4L 4APXA 4G42B 1MCQA 2DQCH 2PYEB 5FECB 2BDNL 1ZANL 3HAEH 3O3DB 4MAYC 3VWJA 5A2JH 2WTPA 5FHAH 4B27A 3NFNA 2F1AA 1XH2A 3MSPA 1C08A 2AXGA 2YMXH 3EOTH 4P5KA 3RWCA 2WKLA 4LF3A 4KJPC 3QDJD 4G8GB 5KTEH 3GQFA 4WFFD 2FJGA 1EQWA 3GM0A 3FQUB 4XGZA 2R1XB 4W1TA 1N8ZB 3HUJA 4FP8H 4BIKA 1SOQA 4AYDC 3K6SB 1FORL 1J9QA 1KTCA 2JKIS 1AQKH 3QR1A 2KPNA 1NFDA 4FFWD 2PWFA 4ACTA 4H1LB 4OFKA 3JWNE 1HT6A 3KDPB 2ODIA 5CGBA 4MX7B 4DP4X 3F5WB 4L0YA 2JK5A 1JBJA 1D5BA 4MDRA 2OXGA 4IYKA 4WEBH 3SE3C 4DZBB 2HVKA 5IG7A 5IK3A 1JXGA 3BD3A 3H9ZA 1BXUA 3BKCL 5E8DL 3HJEA 4N8PA 4KUZL 3GUFA 3LVEA 1T7VA 35C8L 4XAKE 4MA8H 4OUUA 1H0DA 2VQ1B 3IDJA 2CBTA 1XD1A 4PJCF 5GRUH 4Q6KA 2UZPA 3I3BA 1EDQA 1X7QB 4JFHD 4XO9A 1JFQH 3FQ2A 5JW4M 1A7RH 3D12B 2QQLL 1SM3H 5EC1B 2GQHA 3NSCA 3U1SH 4AG4L 5AEAA 4K5LA 3B6SB 1GZQB 4O2EA 4U0QB 1U8JB 5HHOE 3MROA 2O61A 3UTZA 1WWBX 4HSCX 3RA7H 4IU3B 4P2RA 5FYKE 1W72A 1GGIL 3KGTA 2Q20A 4DN4L 4DEPB 5CINL 4HOXA 1MLCB 3M45A 1RVFL 4NQXA 4AGNA 4HKBA 4PRPD 5GGVY 3MUGB 3LH8A 1TETH 1MFEL 4RRPA 2NYKA 2BW5A 2XQYG 3G9VA 3BEVB 1IM3D 3ZT6A 4U6YB 5C86A 2X3CA 1OWWA 2HVKB 1AZCA 2IBBA 3R18A 1DBJH 4XP4H 2ZAHA 2DQHH 3S48A 2P5ED 3WTTA 5C0FB 1XF2B 3KPLB 1U6AH 1ORQB 3QISA 4P3DB 4QRSB 2HG5A 2WQ8A 1ZA3B 1KJ2H 1RZFH 1X7QA 5ALBH 5I1HL 3QDAA 2CBOA 3EFDL 3OX8A 3UADA 1HHGA 4V1DE 5AVSB 1NL0H 1JGIA 5HDOA 1U36A 5ESQA 4EVNA 3B6SA 3HVNA 3ZVVA 1U8MB 3GJFH 5ANME 2BP0B 4CN6A 2HLFC 1OW0A 1RHHA 3ARSA 1T1WA 4NHCL 4LLDA 5CZKA 4AQ8A 1KIPA 3GXDA 2GT9A 4H40A 5C08E 1R33A 1CK0H 4XNMA 2WGXA 3GXNA 5FGBA 1AKPA 1GYUA 4NPKA 3WO4B 2E7LC 3D69A 2OAAA 1MFDL 1INQA 1G7JB 1Q9LA 4ODBD 4YFEA 5IJKA 4OAWB 3MV8B 1XD0A 4JHBA 1OKEA 3PPEA 4YSPA 3IDYC 2FBOJ 2KT6A 2R8SL 5JIQA 1AOZA 4NSKB 1FYHB 3UGUA 1XTMA 4Y4HC 4LKCA 3V9FA 2EXYC 2QDWA 3FO1B 2O30A 4X7TA 4AE0A 2EYRA 3CVDA 1XZ0A 4PY8J 3QEHB 3KH4A 2C5DC 5CU9A 3OC5A 5D2NC 4N6RA 3RWCB 1YY9C 4LGPB 7PCYA 4K5MA 2VDRB 1YLBB 2HA1A 4XVUD 1I53A 1TEYA 3BO8A 4H8HA 4XGZB 4YO0A 5FYKH 4P48A 1MW0A 2VSCA 3GSWA 3CBRA 4K7FB 1NGZA 1TKWB 3VGFA 1NPJA 4M5TA 4HUXB 4AUYA 3QQDA 5T33L 2DQGH 2QADB 2EINB 2VZSA 1IAMA 2D3LA 1P5UC 3CFKB 1HILB 4WI6A 1T0MB 4S10A 5I1LA 3LZLA 4G8GE 4EN3A 1YN6B 4I3SH 4QHKJ 4Z3JA 1D5BB 2NNAA 3E6FA 3BWZA 3TBYB 5HHNB 3AQYA 4UV7L 3K71B 5C71A 2HFFB 1GJUA 3QG7L 1R5IB 3QQ3A 2PCYA 4XNUL 5FUZH 4YXHH 1F00I 4AYMC 2ZCKL 2R2HB 3E2HB 4QO1B 5DRZB 2YHGA 3ZKQD 1OF0A 3MACL 4QNPF 4K9EH 5F97E 3T6WA 3VXPA 5BS0A 3MRFB 2FX8L 3H3PH 3GZPA 3T0EC 3OSVA 2H2SD 4AMXA 2BVYA 4KJWC 3QWOB 4ZFOA 4WJ5A 4XBPA 4BKLA 1S7VB 1DCEA 3DYMA 3Q13A 3SBPA 2XQYK 3ABKB 1SOKA 5IBTL 1MDAA 4PWKA 4JPIB 3PWLA 1GC1H 1ZLWK 1KV7A 3AG1B 3EJTA 4ZW7A 1QPXA 1GJWA 1QTSA 1QBBA 1VFAA 1WFNA 2F19L 1NLDH 4MQXC 4F58L 3BSZA 1CLVA 1NINA 1OE3A 4CU8A 3O4LE 4OM0L 4DEPC 2EH7L 2A6JB 1V54B 1GIGL 1X5YA 4QRPE 4X4XA 4YQXH 4G5AA 5LGHL 3MV9B 4AKPA 3QORC 2HKHH 2WQSA 1EWHA 4NFBA 4HSQA 1MRCL 4AK1A 3AUWB 3KPLA 4YMPA 4TUKL 2EE0A 2I9LA 4GKNA 4ELDA 4RWYL 1IM3B 4U31A 5BO1H 2G3NA 1B4JL 3ARPA 3GSNA 3RGBA 3QFJA 1YMMA 2F61A 1YN7B 1G1CA 2QQKH 2XY2A 1NUGA 3OMZA 1I3RB 3VCLA 2R9HC 1UZ8A 1F4AA 1ADQA 3GI8L 3N41F 3QPKA 4U2YA 4FLOA 4N0UE 2WAQA 5CEXA 4KNTA 3LXCA 4ABUA 3T65B 4C83B 2XA8H 5JW5A 2NDFA 2P80A 5I1CL 5E51A 1DQTA 3KPSE 1TVBA 3BKYL 3D0VB 3MBWB 1ILSA 2EDRA 5EG6C 3D48R 3QXVA 4TSBL 1QZ1A 3RPIB 3TEWA 4FQHB 3A6CL 3FONB 3S7GA 4PRID 1JVLA 3E1F1 2VDLH 5EUKB 1VFAB 4XCFL 4HSAC 4YPGB 4A67A 5FUOL 3SQBB 2BP8A 4LVEA 2Z8RA 3FTSA 4TULH 3S36X 5EFIA 2A4EA 3RTLA 3NQKA 2NY0C 2QPDB 2E9IA 2CK2A 4IBQA 4FNLH 2VLRB 4YIQA 4XVJH 4QJ3B 3SGKC 1BYNA 1OCWH 1T20A 4N6RB 3K0YA 3QUMA 4HLZG 5LWYL 4Q14A 2WCPA 4MMZB 3U9WA 1ZVSA 4ETQA 4WWNA 4BHUA 3L45A 3MCLL 1GCFA 2LW3A 1BAFH 4KQ4L 4S11A 1AHWA 2BZ7A 3ZKND 1QI3A 3CC5A 3D08A 3LPGA 1OO2A 3TT1H 1D5IH 4F7EA 4S0HA 1CL7I 3BGMA 1BOGA 4NO2B 4DESA 4QOKD 1UM4H 3ZE2F 5EUOA 3IEAA 1BQUA 1KC5L 2NT0A 5E9DA 2J1XA 5EIIG 3VI3F 1VKXA 4HIPA 4O9HL 3PL6D 4MD5A 1DQIA 2VJ8A 2Y24A 5EZPA 2FO8A 2R23B 5ID1B 7FABL 2TSBA 3QQ9C 4I1RA 5EU3B 3B37A 4KZCA 4DP2X 5GQBA 1BZ9A 1FNGA 3QEQB 2EH8L 4MJ5B 3SQBA 3IMTA 4RETB 1R75A 5KVEH 4G6JL 3II1A 2VAAA 3CU1A 2CKBL 2ZPKH 4LSDA 3V6OC 4Z78A 4G6AC 5DMIH 5IM7A 3PWUB 4FMKA 3UC2A 3SB3A 1U92B 1KFAL 2EIDA 2IANE 5DC9B 1AJ7H 1J1XL 5BPPA 4LSRH 1VAHA 4W9ZA 5J6GA 4J3UA 2GKIA 3TBTB 2E8ZA 3AITA 5HJDA 3QHTC 3QT2A 3ZZ1A 1T66C 1X4YA 5F6IC 2PWDA 4IOFC 3PJLA 1IIIA 3L8QA 3WHXB 2GTWA 1WT5C 4FTDA 1HU8A 3SBWC 5KVFL 2GG1A 2X9ZA 4JHVA 4QRAA 2NY4D 5JOPD 4LZKA 5JQHC 4FADA 3L3KB 4YHKH 4LL1A 4QHPA 2BJMH 3LN9A 3EXLA 1IARB 1KDJA 2GSGA 4PVMA 3S8GB 3QDJB 1NAMB 2IOIA 3TVMB 5IMMA 1X9QA 1FJ1B 2AI0L 3SSGA 2IH3B 3I02B 4E42B 3HG1D 3ZDWA 4G5ZH 3TN0A 3QNYA 4MAYB 5TFSH 3VD1A 1YPZF 3ESUF 4KKAC 4IOIA 3QCUL 4Q9RL 4JY5H 3FUEA 2XZAL 5KBLA 1IFRA 4L9LB 4M1DH 2R4RH 2BWIA 1FYTE 4XC3L 2ZICA 1AR1B 4KOCA 2AHIA 4H8QA 1N7MH 3EYSL 3QUXA 4UQCA 4N0FB 2DOCA 3GTVA 2J4WH 3GZOA 4CVXB 4HUCA 5IVXE 4B0MB 1O6SB 1J0IA 2XV3A 3N43F 1S46A 3MFGB 5LBSA 15C8H 2IDSA 5DI8A 3MRNA 4KTEL 4XVTL 3D6GA 1UXSB 1BYPA 5T3ZD 2FX9H 2OZ4A 1B2WL 3LRLA 1M7UA 3GRBA 2ZXBA 1TVBB 3D0VA 3DX2A 1VENA 5DZAA 3DGDA 1KJMA 1SF3A 2Y7SA 3C6SA 4PG9B 3MFFA 4XMPL 4JQVA 3ZE1F 1NDTA 4JRYB 1QMUA 3VG9C 1CE6B 4EI5A 3UYRH 4YUEL 3GDBA 2F0CA 3ZXAC 1KGIA 1S4IA 2W9DL 4BZ1A 4X6DA 3OC8A 4AYSA 3EJPA 4ZUUB 1NJ9B 4ZAKB 5IVXF 2XKNB 2ZYRA 4GW4B 4LLUA 4QRTA 3HNVH 1RUAH 4APQA 4G80A 2UYLB 3V10A 1ZS8A 3FQUA 4J4PA 3FFDA 2EDJA 2FQDA 5C0RH 4M6OH 5ACMA 1UCTA 3H7BB 4PJ6A 1SXZA 2GUYA 2BOCB 3MBXL 5C0BA 3GXTA 3UTQB 1ZGLP 4L37B 3OLGA 3RWHB 5C0ND 4N2MA 2GJJA 1G6RH 3QAZB 1A7BA 4LPYA 4GG8B 1CICC 3EFFA 3ROOB 1E5ZA 4N0FA 1HDMB 4PUBL 2FT6A 3AT8A 4DAGL 2NNFA 3PNWB 2XTJC 5JTWA 4C55A 4EN2A 4GG6B 1KJ3H 4FNTA 1QPPA 4O2CB 3PL6C 3AQDA 2ZSWA 2IFFH 4M7LL 3DDFA 4PJIA 3OGCB 1ZHKA 4OQTL 3ZT5A 4KU1A 1PF3A 1RP8A 4X9IA 1S5HA 3FUFA 2V5SA 1E4XI 1ZWIB 1BFVL 1FI8C 5D9SA 3OMNB 5FKAB 2IANA 5DHXB 2A0LD 4I18B 4FZEH 1QEWA 2HH0L 4E9LA 2WXFA 5FV2A 1VACB 5C0EB 3BRFA 1HKLH 5DHYB 4X9YA 1LO5A 1FWXA 3PWNB 5E2WH 1KT2A 2XKNA 2CJ3A 1TMQA 1U93A 2R1XA 4NDMA 3ZO0A 4QNPE 4ZQKA 4WDIA 5B1JC 1MRFL 1QPKA 4HIIB 1MWOA 2BOCA 1PBYA 3QB7C 5D2NE 2IGFL 5J1TC 5EEZA 4NN5B 3DRQB 3HLAA 3MRHB 3ZTJG 2E46A 1U21A 3WHXA 3HMXH 2VISA 2PYEA 2GY5A 4BQBA 2WXLA 4OUOA 1H6UA 2HT3D 2A9DA 2ORBL 2X4QB 4LNRB 1BP3B 4KH9A 4BA0A 2NPLX 2CMRH 3WO4C 1P9MA 2SEBA 1SPDA 1NCCH 4OB5H 5CM1A 5IUCA 4U1IB 3DJTA 5D9SB 5FKAA 4WY7L 1U3HC 3E2HC 4GQPH 5EC2A 3ILPA 5H8DA 5T3XL 2FJGB 4XP5H 3C6LB 4KC3B 1ZY9A 1OPGH 1ZT4B 1U8JA 3ARDD 3QIWB 2MCG1 4DQOL 1RZPA 4JB9L 4PRPE 2FWSA 1G7PA 4JM0A 3QXDA 2H32B 1RZJH 1KACB 2IH1B 1U93B 2XN0A 5I0ZA 3ZKMC 1OE1A 4NQVB 3B9AA 5AVRB 5GZOD 3MUUA 4MJIA 1ZGLA 1WAAF 4CW1A 2DQDH 3DXAD 5DS2A 2FGWH 1WA2X 1HXKA 3GGWB 5AVYB 3FFCA 3DX8A 1Q0YH 2P1YA 5CU5A 1EXUB 3DURA 2J1ZA 3IWVA 2GJ6A 5L0QC 2YQBA 4KKCC 2VDNH 5IG7B 1PSKH 4HMEA 4WW2B 3VFGL 3D69B 2A7BA 2XY1A 5JPNB 5LQBH 4PHXA 3CZEA 1HN1A 5EDSA 2FR4A 1D6VH 3OXRB 1EO8H 4S1RL 4OV5B 3EGSA 3RPKA 2VT0A 1AKJB 1W2KT 1X5KA 1VGKA 4YDVA 4P5RA 5F7WC 4NUGH 1OM3H 3V4UH 2XXGA 4EI5B 4FG6C 1T5WA 4M4RB 4BE6A 4NERA 2A6KA 3UJIL 2WN3A 1V55B 4G7YL 2EYRB 3HKFA 1QUNA 2DM3A 2Y06L 2Q7AA 1MAKA 1TQTA 2XWJB 4LLUB 4QRTB 1G43A 4ZI8A 3X1NA 1AE6H 3DTDA 4ZFQA 5HDBB 5LUMA 5ETUB 1ZT4A 1KTDA 4NP4H 1UB6A 3IKCA 2WXNA 3MJ6A 2VDKL 4RVBA 4HIEB 4NN6B 3IAPA 5EU6E 2QELA 5C0DB 1Y6NR 3L5HA 4J23A 5DQDL 1ZSDB 3GK8H 1SJEB 1VGEH 3P3TA 2CDGB 3BEVA 3MC0A 1EEUA 3DURB 2B0SH 5F9OL 4QRRD 3HI5L 2IPKB 4P2QE 1QQDB 4Z7OE 4OCWH 1OP4A 2VDQH 3C8KA 2X4OB 3QRFM 4R90H 4X5WA 2F54E 3GF8A 1ZWIA 1Z9SB 2P8PB 1MFCL 4D9QD 4J5VA 5E00B 1U2CA 1UT1A 2KLRA 2YPVL 5CSZA 5D5MF 5LXVA 4I18A 2UUDK 1QEWB 5D1XC 3S88H 5AVUB 1KZYA 1B4LA 1JMZA 1NDGB 1H3WM 1W72L 3T6ZA 1MPAH 4HJJL 3T09A 2NQDA 4FLSA 4I0PD 2I24N 2VH5L 2X1WL 2X53A 4FG2A 3INOA 1BW8A 4PY7A 4Y4HD 1UXWA 1HNGA 1TCRA 1NMBL 3SKJH 4GRMA 4A39A 5ADPH 5KN5A 2HRPH 3LPPA 3K6DA 3KEHA 5AVWB 4AX3A 3OXSA 5LDSA 2XOTA 3T3PF 5J12C 3SIKA 4WWID 4N9GB 5E08L 4A2FA 4S1QH 4HS6B 5B1BB 4M7KL 3T3ME 5IROC 4OJFL 3LKRA 3BUPA 2R1YB 4JFED 3EDEA 3VFPA 4P23B 5GRZA 1LQSR 4LFHD 1UWEL 3PLYA 1RLBA 4FHJA 5C3LD 2DMBA 3SDDB 2EO7A 2I9LB 2Z0UA 3UBXB 4G8EB 4D9RE 2G60L 2QV4A 2WNXA 1NBVL 3AU0A 5KVGH 3MRLA 3WNPA 3BN9D 5CJXA 2PXYB 2MCPL 1OB1A 1UWYA 2DB8A 3ECBA 1QHOA 3D3VA 3PWPA 4LPXA 5MHSD 3VXUD 1T0MA 4ABQA 4ONFL 1RU9H 5I1LB 1BGXH 3KPRE 5BQDA 4YSEA 1ZEAL 1NUDA 3FFCB 3G7TA 4C56D 2BIPA 3BAXA 1AS6A 3K80A 4QPEA 4OZHA 3WY4A 1BQHA 4ETYA 1KTLA 5SWSE 4YL9A 4WHYG 2XT1B 1N59B 4PRPB 4HK3N 4AYFA 4EIZC 4L0ZA 2WZAA 3KYMA 4MJHA 1NEZA 3HHMA 5B8CB 2QPUA 4CMMA 1JHLL 1IEAA 4LAQL 5EDXA 5FK9B 4P5SA 5DK0A 2UVFA 1T5WB 4RLDA 1GHFH 1OZTG 4G8IB 4ZO8A 3VXTA 2V5YA 1KN2L 4ZTEA 3T1WA 3MRFA 3G6DH 2W0FB 4H2AA 1D6EB 4I9XA 4BV1A 2ESVB 3BUDA 2DWSA 2NCMA 5H37H 4BH8A 1OT1A 1L7IL 3OWRA 1KJ2A 3OKMA 4XBPB 1S7VA 4HEMA 4Q6IC 2PP7A 1BVNT 1BCIA 1OK0A 4QHKI 2NX5E 3B1TA 3GRGA 1SXNA 5GZND 2Q7YB 5JXAL 5GGQL 1JGVL 3N40P 1QRNB 4XX1G 1MQKL 3IETB 3KJ6H 1BJ8A 1XBDA 2ZNXA 4Y5YB 1CXEA 5ABZA 1JYNA 2PPAA 1TUPA 3EH5B 3C60B 4ZUTB 4Y8AA 3TZVA 2GAZB 3NABL 4ANWA 1YEKL 2DWDB 5GGTA 5EUKA 1LO0L 3EYUH 3ARQA 1ZOXA 4PQXA 5D1QB 1DEEA 4KXAA 5IFJB 4QOKB 1BLNA 2G0LA 2BMKB 3NPZB 1CDCA 4W9GC 4NWTH 5TE7H 5DMYA 4XPHH 1AQHA 4RMRA 3L5XL 4FXKA 4OZIB 4LU5L 1P6WA 3HG1A 2KL6A 3QO0A 1YMMB 4DP8X 3STZB 2AQRA 4JFFB 1D6EA 2WIMA 1C1EH 4LRNL 5DFAA 3MRRB 4OCYL 5I75C 1IEHA 2KPWA 2H1LM 5FYJE 2E7MA 1OEZW 4DP5X 4F5CE 4F7EB 3SQOL 1JV5B 4P9HL 1PLCA 5ICZB 1UXWB 2CHDA 3AAZA 5KSBE 1RUQH 4H25A 4GYBA 4R4BB 3CAFA 1BA9A 2FWOB 4B9CA 3MOQA 1J86A 3VE0B 1I85C 1NAMA 2E56A 4OFYA 4R26L 3TVMA 3DO4A 1EJ6A 3DBXB 5CSBA 4B9ZA 1HXMA 3AM8A 4BFOA 1CFMA 3F12B 3PJSA 3TH2T 2APBA 2NY7L 2R39A 4Q58C 5F9WB 1GGBH 3ASWA 3D50A 3IMRA 5ERWA 1DEEB 5IFJA 3PWUA 1NMCB 2NY2B 1IE5A 2FATL 4M6MH 2O5NA 2P28B 3V0AC 1PCSA 1NMAL 5T1LB 3Q3GB 4TOYH 1L9NA 3IBEA 3TBTA 4YXLL 1YMHB 1T1YA 1JK8B 1AANA 3HC3H 2VL5A 1XF1A 3EHBD 4G43A 4CVXA 1IC5H 4X5PA 1FAIL 3H9SE 2NXZC 2BSBA 2VSDA 5EEWA 1KXVA 5FA3B 1L0PA 1UXSA 4HUMB 3ARTA 3DSFL 3HG5A 5JHLH 3SKNB 3D1MC 2VN5A 3IJSB 1BD2D 1UEYA 2YXWA 4JBSA 3VD0A 1A9EB 5AKVA 3KVDD 1N5YH 2Z1KA 4JRYA 2J8OA 4ZX6A 4F2MB 3WD5H 5K9JL 3IDXH 1NC4B 2AQ2A 3L17A 4NQDE 4KRNA 4FTVA 1NFIA 4E0RB 5JO5B 4TRPH 1IZJA 1YEFH 1WBXA 2KDGA 2QKIC 4O02B 1IEAB 1UUSA 2GI0A 1LO4L 2MQ0A 3LKNA 3LHPL 4TM9A 3QUML 4N0UA 2BSCA 2AQPA 1P4UA 4DPRA 3L3OA 4PJFA 5KBPA 3AS0A 1PX8A 3WE1A 2ESVA 5HDBE 4LCUB 2NXYB 4WUUA 3VXRB 4BDVA 4NFDA 2AJVL 2UXVA 3FHAA 5HVHB 1HH9A 1S9YA 2KERA 4PJ9D 2NY0D 3WGVB 3ZR6A 3ABLB 2PYEE 4N2NA 4HK0A 5IK3B 4WSKA 3ESPA 3L2MA 4QRBA 4LXFA 3CVIH 5B22A 5DK3A 2R15A 2WUBL 1AXSB 2JIXD 2UWEA 4UM9D 1VCAA 2M83A 5I26A 5AVQB 1YNKH 4ODSH 4ABVA 4NZRH 5JPMB 4J8QA 1IFGA 2YEZB 4YBQD 1FZOA 1CXLA 1OF2A 5D71H 5EZLB 3UJTH 5JOFA 3BYTA 5JHDD 1Y1DA 3EJYC 3MA7B 1BLNB 4B9FA 1Z9PA 4XCCL 5E2VH 2DQCL 2ERJC 5F2FA 4Z8FL 4BFBD 2R0WL 1WIOA 2V2XB 5DFVC 3VXSE 5D7JD 1E42A 1IX2A 2ZWSA 4PRDA 2OMWA 4BGDA 3TEYA 3TBVA 4N1EA 3ARDA 1T3FA 4G6AD 4YX2H 3BN9C 3GHEL 4HAFA 5DTFB 4J8RB 2Y07H 1J1PL 1BLIA 2EEAA 3CQPA 5ICYA 2JLLA 4YBHA 1X5AA 2NY3C 5AZ2H 4EZKA 3MFFB 1FORH 4ZS7L 1JGEA 3FFCD 5K5YA 1MAJA 3FMGL 2Y5TA 4XRCB 3QIWC 2P80D 4DVRH 1PZCA 2HX7A 4XZUB 4OBSA 1AD9A 2KH2B 1RIVL 5B1CA 2NQ3A 4ZO6A 4XOAA 4JY6A 2FHFA 4APQB 3W9EA 4ZFOL 3ZE1E 1WFOA 5F7LB 4AVIA 4BELD 2A9MH 3EDKA 5ECGA 2ZYHA 3MA7A 4TNEA 2E59A 4YZWA 4ATTA 4Q0XH 3BW9A 4CN1A 1T1WB 4N26A 4J3OD 3RWHA 3D85A 4KK6C 4MTMA 5I5JA 3Q3GA 5IEHA 2R7EB 1O6TA 3UZEA 1R3IH 1IVTA 5EWIL 4AITA 2AABL 3GGWA 1YNLL 5GRVL 2WTOA 3RVWC 3TBVB 3QEGL 1AZRA 2W5PA 3MREA 1TQBC 1BFSA 2HLAA 3LEVL 3A4AA 4CSTA 3LZOA 2OI9C 3O6KL 5HJ3B 3S3CB 1U3JA 4NQED 1E9OA 2IC2A 4L4VA 2VZ1A 4L8BB 4X80L 4OFQA 1XB8A 1YPZE 5CINH 5D6CB 4TSAL 4PRNB 3R06A 3KWTA 5CEZD 4P9HC 4F2MA 5JUEH 2AGJL 2OZ4H 3KPTA 1KIRA 5E9DD 4LSVH 1IBHA 3D4ZA 1DLHB 4X4YA 2J8UB 3HE6C 2CDFB 2BCMA 4NZUH 4CU7A 3C9NA 1N64L 2AQTA 1UKSA 1A1NA 3FB8B 3V6FA 2Y22A 2GJPA 2WVVA 3DVNB 3MODH 1AO7E 1X6NA 5BVPL 1OTTD 2I26N 2TAAA 1U3ZA 1OGTA 3R8QA 3HLKA 4KHXL 3LV3A 4J4PC 4ALAL 1F11A 1H3PL 3OV6A 4D9LL 5E99H 1AH1A 3HR5B 1DJHA 1LDSA 1BV8A 5GS1C 2WLKA 3DX8B 4XXCA 3HZKB 4H0HB 3MN8A 4R9HA 5ALBL 3I6GA 4MVBC 3TO4C 3B2DC 1JL8A 4LSPL 1IEBA 1UADC 1XL6A 1TF4A 2FR4B 5I24A 1QQDA 3EZ8A 3GTNA 5JW4N 2ZKYA 1QSFA 5DCCA 1U8OB 3ATAA 4RQQA 3OLEA 3PIQA 3KLDA 4ZSOB 4K3EH 5AKTA 2ARWA 2V3DA 1PVHA 3H0TB 3IU4H 3JTTA 5A2KH 2ROXA 5CLZA 5CSZB 2PXYD 5E6SB 2NTFB 3WMQA 4JFEA 1NMCC 2W60A 5C07E 3H2QA 1NC2D 2WM0A 3QIWA 3U4BL 5ESVB 5T5FH 1T6BX 4ALAC 4EDWL 4KROB 3VI3E 4HC1L 4IJTA 4BKLB 1URIA 2J8UA 1KIQB 1PU0A 3C9NB 1D5MA 1L0QA 4LQ1A 4PWHA 4UTBH 2A0LC 1P7KB 1RZKH 2WWKT 4FNSA 1FUNA 1DZBA 1OGTB 2JKRM 2KMWA 4IHBA 5FM4A 5K69A 3D18A 3KG5A 2W88A 5D1QE 4FMVA 4G3YL 3EOYG 4ZMZA 3LS5H 5C8JA 4J8RA 4QHLA 3UFIA 4ODTH 2XIBA 5DMJB 3WXVH 2PR4H 2FO4A 3GSXB 3S3PA 4FI8A 1S5IH 4JQIA 4RAVA 4NCC2 3RB5A 4JY4A 3LN4B 1P84J 1WCQA 2HXAA 5I0XA 5E8PB 2ZP9A 4L9LC 1OT4A 2OCJA 4UOW1 4LP5A 2KI6A 3JTTB 1DN0B 4PJXE 2VDML 1KNOB 2W65B 2JELH 1I3RA 2E74C 1SOSA 5IW6B 1Z9LA 3FSWA 3GMRB 3QG7H 3VWJC 3TPUB 1QI5A 1IGCH 1KCSL 2AJXH 2YOAA 4YDIL 3UTZB 2O61B 3B3IA 3PGDB 1CTNA 1MJUH 3PF2A 3T3MB 3WG7B 5IEHB 2R7EA 3W0WD 1E4KC 1X5LA 4FQHA 1JGLH 1MEXH 1JFQL 4PJ7E 1FVCB 1N26A 1NUNB 1S7RB 1V3MA 3BAKA 3NCYS 4JDTH 1F6LL 3ZE0E 1PFOA 3KL0A 3K0WA 1AO7B 2IPKA 2O5ZH 4G6FD 5E5MA 3X3FH 1ET8A 3C8KB 3WS6A 2O5YL 4PGBA 2QFRA 1FL5B 2DWYA 4Y5VB 2GIXA 4YIQB 1XMWA 3GS4A 1G9NL 2HT4D 2CBQA 1TJHH 2VB5A 2X44D 3R06B 4FYRA 4KXZH 4NM4H 4JY4B 3HHRB 2BOBA 2VLRD 1ORQA 1FBIL 1XAUA 2HN7A 5EF3A 1JNLL 2ZWZA 3BKJL 3HNTH 2WD0A 3RY6A 3S4SG 3E7JA 3SDDD 2LTQB 4OM0H 4F8NA 2HJFA 5FWRA 2UY7B 2PP8A 4MSWA 1RIHL 4JO3L 1I8LC 2DICA 4JHWL 5I1EH 1G1KA 2XRAL 5FO8A 4Y4FD 1MVUB 5GGVL 5HYIA 1A8ZA 1BBJA 4LEOA 4HBQA 3L4UA 4MCZB 3MBED 1S7WB 1IAII 4N1HB 3ESMA 1M3JA 3JYCA 2KZ1B 2NXZD 1TTFA 1OTUC 5E5UB 4YSSA 3IGKA 1KULA 2IIJA 5BS0E 3ESVF 4G8AC 1KB5H 4YHZH 4JFFE 3TCLB 3DSNA 3DOSA 1ZLSH 4KHTL 1AAJA 5I6XC 2XA8L 2FT7A 1WPCA 3NK4A 1EGJA 2H26B 4RESB 3S3JA 4IEFA 1P5VA 3D7PA 2NTFA 1NCBH 3X12A 3WNLA 5DJ6B 2H45A 2VDLB 2PCFB 4Z7VE 2YPKB 5CKAA 4KUCD 4YEEA 1GOGA 3RWEA 5BZWA 5FGRA 2DYRB 5E0QA 1BREA 4FZ8L 3ZSSA 3V4PL 4J2XA 2H1PL 4W6WB 1CXFA 2I7OA 2IF7A 3FRPG 1MUJA 2VMFA 1RK7A 3CH1A 4HX1B 1Z3GL 3I75B 4Z7QF 1D9KA 2V7NA 1R5VB 2HTKC 4Y2DB 2EXWD 1BWWA 4I9WE 2VWEC 4JNXA 5CUSL 2P48B 3FOLA 4H25B 3TBSB 1BQHB 1E5AA 4MCZA 1S7WA 5FHAL 1E2WA 3X3GL 2DWDA 1N70A 2B4CH 4K8RC 5GZOA 2X88A 3FJTA 4MJID 4NBXB 2VR9A 4AGMA 3P02A 3W1ZA 3I6SA 1JZ6A 1CZ8H 5D1QA 4UDUA 4M6NL 3DSNB 4IW4C 4LEBA 2X4NA 1HVXA 2GFBA 1QLEB 3L7EB 4M00A 1ROWA 2QLYA 2NY3B 4UANA 3UMTA 3AM8C 4Z3FA 2AEPL 5LN8A 3QORB 4UQ3A 4AZUA 3LEXA 4Y4KD 1V3KA 4A7QA 4L29B 2H6PA 3FUDA 4LSQH 4GKOA 1S78D 2CO4A 4P46D 4XAWH 3RWIB 3TA3B 3MRQB 3QJXA 1YEGL 3VDCA 1ND0B 4ABWA 2YWZA 4TSCL 1H3UA 1QEXA 3M7OA 4FFTA 3C6LC 4UDTA 2CLVB 4QYAA 3QG6B 4LPCA 1MDTA 4PI2A 1U3HB 2Y1VA 3TZVB 4PJ9A 2E9GA 4ZD3L 4R4BA 4Y2DA 3Q05A 2RR3A 3VE0A 4JFUA 5GGRA 4R7NB 3GMPB 2EC8A 1L6XA 4PGBB 2NUPA 5JPMC 4G80B 1TSHA 4AGPA 2CO2A 5L7XL 2VSMB 2CRIA 3DX3A 5FO7B 1XGQB 3X14B 5AOZA 3VGBA 2CR0A 1N0LA 5DD1L 1GSKA 4IGBC 4S1SL 3TM6A 4XMKH 5LGKA 2WWMC 3AUVA 4IOSD 3VFRA 3UX9B 4G82A 5D7SL 3SPHA 5IB1B 2FJHB 5EO0B 4EI5C 4QMEA 1KYFA 4BDVB 1RVFH 4YDKL 2FJFB 3P0GB 3DMMA 3KVPA 4MDJA 4FF9A 5D4IA 5TFSL 2IJ0C 1MCHA 4YQXL 1BVLB 1MFEH 3QJVB 4I4WA 1C12A 3CSGA 4KK6D 4AJYV 2JKNA 4WKXA 4A1RA 1RV6X 1DFXA 2WXPA 5I5RA 1F3DH 2XWZA 4GW1A 1SNRA 2OJEA 5DZNA 3IFPA 5TGBA 5HDQL 4XNZB 2X5PA 4PJ8B 2BNUB 5IF0A 4N3UA 3T4AC 3ZY7A 1N3NB 4NJ9H 4MHHG 2XKSA 4J3OF 1FRGH 3L81A 3TIEA 4FD0A 1DCLA 5D2NB 2EDLA 5I1HH 4AV4A 1NL0L 3CHRA 2G3XA 4P9ML 4OCXH 2FO1A 2OMTB 4Q97A 3D30A 4YUEH 3VTAA 1A2YA 4G43B 3UPCA 3S37H 4PRDB 2RBLA 3MX0B 1RJLB 3UPRB 1JZIA 1HZHL 4XPTL 5INDB 4RZCB 1IMHC 2GIMA 2ADFL 1OTSD 2F58L 1NFAA 2YQ2A 1IVLA 4WI9A 1X7SA 4P2OD 1N6QH 3IPEA 3B1UA 4AQOA 5B7FA 1BVLA 4HX1A 4UUJB 1KF9B 5IMKA 4OIIH 1HSAB 3HPJA 2BDNH 3SGDI 5I1IH 1WFTA 5E9DB 4ZFFB 5DJYB 3NJFA 3KYNA 1G6RL 1JWUB 1D5ZB 2NW2B 2AP2A 4RMUA 2FL5B 5TH2B 2OJZH 6FABL 3FW6A 3VMNA 4A7GF 5JO5A 3GKWL 4MA1C 1JPTH 4IU2B 3BDYH 3B9KD 3L3JB 4POUB 2Y3NA 4YSRA 1MCPH 3ZO9A 1P69B 4NKMB 3QXDB 3CLFL 4OQTH 4YVUA 2D7TH 2L7JA 3NAAL 3OJDA 4IRSD 4O9HH 4JFPA 5K1JA 4PEEA 4QXGH 4YH6A 2CGZA 3DGGA 3PV6B 3L2LA 3RNKA 3FTGA 2QLVB 4NPJA 1K8DB 3BLKA 3FULA 4FDWA 5C7XH 1HZLA 3G5WA 2HH0H 3GMOB 5D7IB 5CEYB 2WLIB 1MKFA 4PJAE 4LAJH 4NP9A 1HKLL 4FAAB 2ZPKL 4F7PA 3FUMA 2OM5A 3EJYD 2BSRB 4GQZA 1Q1JL 5JW3H 1B9ZA 3CSTA 3PDOB 1LP9E 1BMGA 1F3DJ 2XWXA 4FABL 4HKXA 1I1AB 4MA8L 4HWUA 5FUZL 4OJDH 5C0CA 4F9LC 1OF2B 1XWVA 3UBXI 5SWZB 2NYYD 3CHPA 3B2VH 1UQSA 4DKEH 2V9RA 1WJ3A 1GC1C 5DVOA 1QSFD 3GI9H 4K55A 2GUOA 3C60C 3ARVA 1ODAA 4MJ6B 5I73B 2BJML 4DEUA 2VGLM 4C56B 1A1NB 3V6FB 2LU5A 1TQVA 4YGAB 4NRYB 2WXRA 4B9IA 3S2AA 1CXKA 3VFRB 1CGVA 4JFPB 2FJHA 5EO0A 4EQ2A 5D8JH 2A6IB 5C9JB 3LQMA 5MENE 3X1FA 1RK1A 3UIZA 2F19H 3X13B 4RX4A 5I23A 2WXJA 5HI5D 5E6UB 3RWJA 4LBAA 2MHAB 4D8OA 4WGKA 1KSRA 3MZGB 1QAWA 2EABA 3PUUA 1UWGL 2H32H 5FYLL 2DQHL 5LGHH 3V0JA 4XWOC 3ZZLA 3AGVA 3W2DH 1I1AA 2UZIL 5A40E 1OGAE 1HXYB 4KO6A 1DSFH 4ZDHA 1CT8A 2Y2YA 4AENA 3DVIA 5IMLB 3DUHA 4HKJA 3OF6D 1YNTA 1B4JH 1U30A 1BQRA 2EACA 1X9LA 1G7MB 3UO8B 5DD3H 1PX3A 3WS3A 5JNYB 1SN2A 2O6EA 5ESVA 1BBDL 4OFYD 3BPCA 2ENSA 3UO1H 1KGJA 2XZCL 3IJ8A 4PV9B 4NUJA 1R0AL 1N10A 1WZAA 3NCXA 1L7TL 3UYRL 1C16B 3IFOA 3ULVE 2PABA 5I1CH 1QVOA 4JFYA 3F85A 4G7YH 4L37A 3LKOA 3V7AE 3QUYB 4TSBH 5TE6H 2J6EA 3MOAH 4ZYKB 2EDFA 4KTGA 3G6JF 1WISA 3T1FA 4AEIL 5ISZD 3PGFL 3OG6B 4ZPTA 4TYUA 2EVHA 4FYSA 1AKJD 1QA9B 4BFEA 2DL2A 2EIJB 2JWYA 2J6EH 2VABB 5DJYA 3PAUA 3V5HB 1D5ZA 2GJRA 1XF2A 1G9EA 1IGYB 2YGPA 1CPUA 3S8WA 1VGEL 1U58B 1CJYA 4HISA 3RKPA 5LBSL 2L7UA 1KJ3L 3Q7JA 4G72B 1XF3A 1OAQH 2ALAA 4HIQA 4NNYB 5T5NG 5KW9L 3C6EA 2X2YA 4KI5E 1LO5B 4JO2H 3ULSA 1YRKA 2Z7WA 4EVNB 4R90L 3WEXA 1RJCA 5KSBB 1CD9B 5IBLC 3JQOB 5BZZA 2C9QA 1MCDA 4U1NA 1RULH 3T6VA 4JW3A 3MLUL 1KIPB 1ZSHA 3G6JB 4FZEL 4JLRB 1KC5H 3IRCA 3SJVD 2NUTB 2ADYA 5GGSA 3QUYA 4ZW6A 3QRGL 4BQ8A 2XV6B 1MPAL 4HJJH 4NI3A 3FTUA 2VISB 4E9YA 1PW3A 4R5VA 1OGAD 3KWWA 2XWBA 3BMVA 4Q9QL 1ZT7B 3QI9B 5KVEL 3N1QC 1JG9A 2FO4B 3GSXA 1QFUL 3GS7A 2QVKA 4G6JH 4HKXB 4X9BA 4HCGA 1GA2A 3ET9F 4WUKH 5C07A 3UPAA 5F1NA 1IT9H 2IGFH 3A47A 2ZKWA 4MJ4A 3MACH 2A77H 5CZXD 3V5HA 3K8KA 2HN7B 4EKJA 1FG2B 5C09D 5C08A 5AW1B 5KYYA 5JXEC 1DLFL 2HPOA 4RH4A 2VRQA 4UAOB 3MDJA 3LSOB 1OSZB 3QCVH 4ZUVA 4PJHE 4YHLL 1C7TA 1ZXQA 2LAGB 2CMRL 2XPYA 3O0LA 1UH3A 5DZJA 2D31A 2EE3A 4RAHA 1EEQA 2W0PA 4EKXA 3D18B 4MJIB 1ZGLB 2NX5B 5TTRA 4E41E 4P46C 4AY0A 3GXUB 4R83A 1A4CA 1WF5A 4QRPB 1S7RA 3X13A 4XMVA 1X3DA 3D05A 3FS9A 4NO0D 3SODB 1Q72L 4Z3HA 1NIAA 3PFUA 3SD5A 4P2OC 5HHMB 1L9PA 1TR7A 2WB7A 3WFEH 2EC9T 2B14A 5AL0A 5TF0A 3CDYA 4F8PA 3OZKA 4XMUA 1WQVT 2J21A 4ICXA 5I1KL 4E68A 3GINA 1Z1WA 4PB0H 1X5JA 1FHNA 4B9YA 3UAJC 2B2XH 3CLWA 3QO0B 3ZMNA 1P5VB 2VDNL 1I9JH 4LLYB 3VFGH 4B97A 4R0LB 4PWIA 2ZZUT 1AD0B 1MCNA 2C3HA 3HC2A 3KLAB 5E7FA 3B3IB 4OIAA 1XV8A 2BWDA 2B1AL 15C8L 1XQ4A 4ZUVB 2Z4QB 3BWAA 1CFVH 3UZVB 5LAXA 4KJQD 5FX3A 3PWJB 4LDOB 3GFUA 5EU4A 3Q1SL 1SRDA 2X6UA 3ZX1A 4GFTB 4XAKD 1OD7A 5FGSA 1SJEA 2VDLL 2OCCB 3GSRB 3VU1A 3MBEB 4C59B 3SCMA 2DD8L 2EVGA 5IB3B 2QZQA 3MRGB 2A4ZA 1ULVA 2ROYA 4LGSB 4P4KA 4JO4H 3DWTA 4JHAL 2ED8A 2Y7OA 4W70A 2IADA 4LASL 4V1DB 3ZLQC 1SEQL 4F91B 4Y2DD 4XXCC 5JDSB 3J2PA 3H9SD 1XF5B 3V6OA 3JZYA 1FC1A 1FFNA 1IB5A 3GK8L 2ADGA 3KPOB 4AEEA 1VZHA 1SYSA 4KJYB 5B3NA 3VMPA 4FQCH 3WI9A 4OFPA 3GSNB 1IC7H 3RL2B 1A6TA 2JE8A 1MFMA 1SBBA 4ONGL 5L4MA 4GSDH 4MSWB 5G4NA 2CD0A 1BAFL 3RWEB 25C8H 2KKQA 4GIAA 3WEXB 1ML0A 1T22A 4HGMA 1E0OB 5AW0B 1ASOA 2Y23A 3U0WH 5EOTB 5CEZL 1EH9A 3MV8D 1URZA 1E5UI 3P30L 1ORSB 1P5UB 3N3EA 3O81A 1Q94B 3BP4A 2V7HA 1E40A 3CFEA 2YD7A 2YKLL 4KRLB 5GGRB 2P44B 3AQXA 4FNQA 3FU8A 1JIBA 1G0DA 2P5EA 5I0YA 4WI0B 5EFIB 3ARUA 4F7MA 1J8KA 5F88B 3DTXA 3SQOH 1EEYA 3S3BB 1OD9A 5E2WL 2H26A 5JIKA 1UD4A 5DZOA 4P4RA 3QCTH 5LHDA 3MRJB 1QP1A 2E4TA 3P2BA 2XVGA 3QFJD 3QJSB 3QQNA 4HD5A 4L5FL 3UBXA 1EV2E 2TRHA 3B8YA 3KPNA 3N9GH 5C6TH 5D1ZA 2BNRB 3OMAB 1GGTA 3LKQB 5CWSA 5HHPA 3NJXA 4IS6B 3LSOA 4BWUA 1MI5B 4LO9A 2PXYA 1OB1B 3ECBB 4YS4A 1AIFB 1UA3A 3L4CA 4P57B 2C7UA 2R0ZH 1H9VA 4Q9CA 4YGVA 3SDCB 4OZFA 1LK3L 1RPKA 3QQ4A 3QIWD 1B3IA 1MXDA 3D9AL 3LNFA 4I0PC 2B20A 5K33A 2D7OA 2A1WL 2HTLC 2YRBA 2X0VA 3FU0A 4N9OB 1M4KA 2BNUA 4DGYL 3QARA 3QJTB 4EXKA 3A67H 3H85A 5D1XA 3VFWB 4BFIB 4HUUA 4MJ5A 5T3XH 3Q6GH 1NEZB 5B8CA 3QEUA 1MAMH 4WI0A 1OPGL 2HT2C 4F7MB 3GO1H 3W3BA 3KS0H 1EX0A 1V8HA 5I82A 1QTPA 3S3DB 3ELQA 3TA4D 5SX5H 2V8LA 2OL3H 4YSOA 1G1OA 4JN1H 3CXDH 4LK4A 3GS0A 3T2QA 3L2NA 5J0BA 2HPTA 1JZJA 1GSMA 5DJAB 2N7AA 3G3LA 4FQLL 4JFOB 2PLTA 1YEJH 4IS6A 2O1AA 3LQZB 3KBFA 4I4WB 2WYZA 3SDXF 2B3IA 3ARBA 2VR3A 3CHSA 2C7UB 1UZ6F 3PL6A 4KNUA 2AK4E 3G6DL 3TURA 3X11A 4OGZA 1NCNA 5AAMC 3GEFA 3BD4A 3FTVA 3R7RA 4ZFFA 2VNCA 3RIFF 2JFCA 3DVFA 2MIZA 4EOWL 2CA4A 3SCMB 2YK1L 3FTXA 1TENA 1BM7A 3W0WA 3FT2B 1DQJA 1JZGA 1F02I 2K3HA 5D2NA 3UP1A 2ATKA 1A4BA 3BVUA 3PFQA 2Z31D 1V7ML 3JT2A 3S35H 3V7MA 3V4PA 5C0CD 3NN8A 2YGVA 4ZMNA 2BMKA 3OKLB 5A3IC 1LMKA 3FHEA 1PJ9A 3FKUS 1F5WA 3W9DA 3W81A 4L1LA 1WBZA 3F7VA 2OMTA 1KEMH 2B9BA 3L3IA 4RFNB 3T3PB 3B7RL 1RZJC 2A9AA 3FTGB 5AAPA 3GLEA 3QDMA 3MGAA 4M8UA 4GBXD 3TC9A 5F6HI 3B2UC 4M4PA 4F7PB 2ZUVA 4BFRA 4NPYA 3TFKC 1Z9NA 3HI5H 2IFFL 5EOTA 3KLLA 1A4JB 1I7ZA 1U8QB 4KUCF 3O3AB 4LLMA 4ZX4A 2A73B 3C60D 5K9QG 1OZUA 5DSCA 5D6CA 1OY3B 1Q94A 2Y0SA 4DCQA 2NZIA 4LESA 3UROR 5IGXL 4NAMA 4B9GA 2BHZA 2ZUXA 2HUEA 2W94A 1RHFA 2A6DB 4H4NA 4OF5A 4RFNC 1MVFA 4D0BA 2P8LA 5KS9F 2PW2B 4PJDB 4XB3A 3PJSB 4HJEA 2WIIB 2GUOB 4I5BB 5AZ2L 5CZVH 3DJ9A 5ABAA 2VWEE 5F44A 2VH5H 2AK1L 2JB5H 2P5WA 5AB0A 4NX0A 5JA8B 1I1RA 1WZLA 3MX0A 3ECWA 1VFOA 3BAIA 4FFWC 2A6IA 4X7SL 2JNZA 5AG9A 3BZEA 4RDBA 5LXGL 3F01A 1AG0A 5DEGB 5E6YA 1TVDA 1RMFH 5CXPA 2XN9D 4IBVA 1QSZA 2DWXA 4F2ME 4B5ZA 1IC4H 2F15A 4PLNC 5ITBL 3PQYB 4JRXD 5ILTL 3UC0H 3ETSA 4L4VE 4J1UB 4M7JL 4BGLA 1LDPH 1IC5L 1YY9D 3C2SA 3DHMA 5SWZA 5D1XB 3VXUE 3ERXA 1HI6A 1Q9WB 3QH3B 2QVTA 2PO6C 2ZKHH 3AT0A 3DSFH 1UH2A 2IQ9H 4BSVA 1UGNA 4JFZH 5CLTA 3CCHB 3TL5A 5J57B 2A83B 4G70B 3G5YA 3BPCB 4R7XA 1KY7A 2P47B 4MMZC 4F33B 5C6WH 2BIHA 3OBAA 1HL5A 5A6IA 4U4BA 4F8LA 3IE4A 2BNQA 2COQA 2OTPA 3GXPA 2Z9TA 3S36H 3LMJL 2BCKB 4LCUA 4WUUB 3VXRA 5L88H 3VRIB 1CDGA 4Z5RA 4NGHL 1DVSA 2FGZA 4AKQA 4FNPA 1HHHB 4EO5A 1YEFL 4JFSA 5BV7L 3UZQA 3KPRD 3RE0A 1IAKA 1MCOL 4H8WL 4LRIA 3KYAA 5KVDH 3UABA 1IBZA 4GUQA 3VJ6A 3P77A 3HN8A 5K59F 2DQEL 3RVUC 1NCUA 4R3SA 4HFWB 3V6ZB 3ARGB 4BM7A 4UYPA 3U2JA 1LYQA 4JM2B 1HXYA 1KN2H 1PG7W 2RMNA 4R5TA 4YDLB 3NH7H 2FRGP 4LDEB 1MJ7H 4YDJB 1BAGA 1W80A 1FFOA 4OZFH 1E27A 3O6MH 1DFBH 1I8KB 2NY1C 4O2FB 3MA9L 1XR8A 3VSQA 5I6OA 1MELA 2CNYA 3VYNA 4FI6A 5F71A 4WJG3 3CCHA 5DT1H 4PV9A 3GSQB 5ALCH 1AC6A 1D7CA 1MFAL 1WBZB 3F7VB 4XPAL 3BSZH 1A6PA 3HZYB 4PJDE 4ZNEE 2MJWA 5JOPE 5DQDH 4XNXH 2AVFA 3MLZL 2I32A 4OZGB 3UEZA 4YLCA 3UOAB 3P73B 1T3FB 4Q4IA 3PABB 1YA5A 3ABMB 1CF8L 1BJ1J 5E56A 2R4SL 1A4JA 1U8QA 4LLMB 4U3CA 3FCTA 5IROA 2QTVA 2HFEB 4XZ4A 2GITA 1E7VA 2DEXX 3T2NH 5EUOE 4WFFE 4XHJC 4NBYB 1UURA 1G9MH 2BO0A 4JFDE 4DCQB 4UQBA 1DBKL 3TN0D 1CT8B 4M3HA 2HRLA 3DX6A 3MJ9H 3L4YA 1H5BC 4ZOBA 3B2MA 4M7LT 3CPLA 4RGMC 4Z7UB 2HWZL 3SKMA 3NGBB 5CLYA 4ODTL 5KZCD 3SDXB 2MOGA 3ULSB 2NCEA 1I8KA 2C4FU 3QUXD 3T0EB 2G2RA 4BUHA 4ZOAA 2PO6A 1E7UA 2NY4C 3U83A 4C8XA 1HS6A 3NJLA 3WDIA 4FQJH 4N5ED 4DGVH 4LPTA 3U46A 2OBGA 5I71B 3REWA 4XOCA 3LDBB 4R4NC 4EUPB 3N1FC 2D2CC 4ES9A 1XBRA 3U48A 3DOSB 1QA9A 4M8VA 4K3JL 1KCSH 1O0VA 4LOVA 3WMSA 2NY7H 4NKDA 1ETZA 4JM4L 2AVGA 4IEFB 5EWIH 1F90L 3QJQB 4JDTL 4U0RC 5FYKD 4DKTA 2AS5M 5HPMA 1FC2D 5DZPA 4L8DA 3BH9A 2NR6D 2O5ZL 2J12B 4HH8A 4JFHE 4PLKD 4GUPA 4BSVB 4CVZB 3MBEC 1PLAA 2Z35A 5E2TH 2X4UB 3KLAA 4IRZH 4JPQA 4PMEA 3PQYE 1B4RA 4NQDD 3CDCA 5AD0A 5L4FA 3WJJA 4NM4L 1NAKL 2BNQB 1M6OA 3U30B 3L5WA 2BVQA 4E5XA 1LM8V 5I1JL 4NCC1 3WFDH 1F11B 2DMKA 7PAZA 1A6UH 1PLBA 5GGTL 2BW4A 3VYPA 5SWQA 4M62H 1GPOH 5C97A 2CPCA 4UQAA 3RHWK 3TA3D 3F6IA 4E9RA 4I0PB 1N64H 1FFPA 3B2UD 3B2XA 1JZEA 1RUKH 3T71A 4MQXD 2XWBB 4L8CB 3B9DA 4MZ2A 1XFPA 1LE5A 3VA2C 4P23A 2AQNA 3NTCL 1VLXA 1WHPA 5F1NB 3BISA 3F83A 4HFWA 3V6ZA 1HZKA 3OAUL 3O9WB 2P5EE 4EUPH 4Y1AB 4XVSH 1H19A 4FQXA 4G6ML 3Q6FB 2AEOA 3F64A 4FULA 1MI5D 2FTAA 3RUGF 1PD6A 4ZPVB 4YDJA 3HHSA 4FFZA 4R0LA 1YQVL 5I6XB 3BESR 2AJUH 3O3BA 3L9RA 4UT9H 4QRFA 4RMSA 2FEJA 3D3VB 2BHYA 1K4DA 1V5JA 1AQMA 1CLZL 2CE6A 3BN3B 4UAHA 1RL1A 1OE2A 1T22B 1QABA 2W0KA 5HVFB 5HHOB 3GJEB 4R7VA 4L3AA 2WUBH 4PTTA 3DI3B 5MERB 5I9QC 2ADIB 4OKDA 4FKEA 1KIUA 4U1LB 1FH5L 4UAOC 1MWAH 1T03H 1LE9B 3FUKA 1EGJL 1HNFA 4J3XA 2HX9A 1BPVA 4KMTH 3HUJF 2YPVA 3D4CA 1RZKL 2LTQC 4E9QA 5BVJB 1ZK9A 4XCCH 3GKZA 4LL9A 2XFXB 2DYSB 3UBFA 1T1ZA 4KI5F 4TTDC 3IVKB 2FEDD 2MPAH 3AY2A 3B83A 4WV1A 4W9CC 3RZCB 2VC2H 4WENB 4Y5VC 1T04B 4XCNB 2ZX8A 3KNBB 3P4MB 2AZAA 2HLFD 4A2LA 2B08A 3DVGA 3G6AA 3QBTB 2XVKA 4XPGL 2DF3A 4ONHA 2PR4L 1CZ8L 2VW6A 1F13A 4K94C 1I1YB 2VO5A 2VZUA 4YFDB 2DQIH 4H0LC 4HW6A 2QVMA 4E41B 4KK5D 3FT4B 3IMWA 1RUQL 5IF0B 2R2BA 1VJSA 3BP4B 2WTRB 4EDXB 5I18L 4L8SA 1KGCD 4Y19D 5KS9A 1AO7A 1WZ1L 2Z92B 4U6XA 4FQ2L 2EXSA 4H1LH 4NC1C 5E5MB 2F7IA 5AZEL 3THML 3QZMA 2XLLA 2AQQA 4LEXH 1E6JH 1MJUL 4N3TA 2AXJA 5I17A 5F88A 1F8TH 2G4GA 1DVZA 1ICTA 1J0HA 3AXHA 5KANI 3T77B 2ZUTA 4NXSA 2GK2A 2N7SA 2HUHA 2BSTB 1A6TB 2MKLC 1YVLA 4R2GD 3RZCA 1NCHA 1B88A 1R3IL 2Z31A 5E6IA 3HI1A 5CEZE 3DYOA 3MRDB 1GZPA 4X98B 5TD4A 1S7XB 1KWGA 1AIFA 1LO3L 1WITA 3PV7A 1TJHL 4PGCB 43C9A 5JHLL 3O6KH 5GSVA 5SWZE 1OW0C 4ZZFA 1BBJB 4OI9A 2OSWA 1J5HA 1U2YA 3UXFA 3QYMA 4Z3EA 2AITA 4M1GH 4JQVC 1WRFA 4QR7A 1NANH 2AGJH 1K5WA 3FH5A 3IDXL 4OZ4A 1GMIA 1FYTA 3GHBH 2EIEA 3UDWC 5BV7B 2AEQH 2ICEC 4LSVL 2FX7H 1UXMA 5B3JE 5HGHA 1OL0A 2V2WB 3F7QA 1YEHH 4D94A 5TPWL 2TSAA 3HAEA 5KAQF 4XHJD 1KGYE 1IJ9A 1INEL 3CSPA 1CURA 3WIHL 3TYFA 1R24A 1A6VL 3F2LA 4U05A 3KPNB 5HVWA 2P5WE 1FIGL 5KYXB 1RLWA 2BSTA 2BHFA 2AMUA 4ZFZA 4YHYC 3FCSA 4WFHE 4OKVB 4JZNA 1ZHNA 1YDPB 3HZMA 4HXBH 4JQIH 4UM8A 4A7VA 1F4WL 1MCWM 2HT3C 3LQZA 5KSAC 4XVUC 4YHML 1M71A 2QGDA 1S7XA 1T4WA 3K81A 2CLZB 4WWKA 1ADQH 5IEKA 5MERA 4M29A 4BKSC 4D0CA 1AMYA 4B96A 5EOCJ 5DRNB 4HHAB 3FOLB 3S37L 3TBSA 2VERN 3VXMD 2H3NB 4E9SA 3VI4B 1C5BH 4XPTH 4OV6F 2OSXA 3EO1A 1DQLL 4QCIA 2Y25A 3ZOAA 3EJZD 5I1GL 2X87A 3DK2A 3SDCC 1JXDA 3QXWA 4LSUH 4XMWA 4ZTOH 4Z8FH 2FD6H 5DF0A 3LHAA 2FB4H 1WBYB 3ULUF 4RBPH 5EMYA 4A2GA 3MVSA 2O6DA 5KYXA 3FQ4A 5TDNA 4YSTA 5HGAB 5F7AA 2ITCA 4GRWH 4B9PA 4N8VA 5LG1A 2ZTBA 1TNMA 3EHBB 4GRLC 4AEHH 3G5XB 1F56A 4JFDA 2W8CA 4P04A 4NPYB 5L9DH 5LCVH 1BD2A 4X99A 2Q6WA 1I7ZB 4WO4A 2DEWX 3AREA 1SUHA 3WXVL 4AE1A 2C1OA 5CF3A 1GZHA 1Q1PA 4LSSL 2ATAA 4YNYA 3BUYB 3N06B 1T5XB 5MHSE 5BMFH 3RZWA 4YE4L 4X0KA 4BQCA 4ZX3A 1T2JA 4AENB 4PBXA 1P2CB 2V5RA 3VI4A 5I19L 4TQIA 4KZEH 1IU1A 2G5BA 3AQZA 3OKOA 3R0MA 43CAB 2VE6B 5GS1B 3ARXA 5E0FA 3OB0H 4NKOB 5IQ7L 4P4KD 3LS4H 1S6NA 4PRHA 3IU3A 3DV6A 2BS8A 3WDJA 1SLVA 4HCFA 1WBYA 5E6ZA 2EE2A 4X8JA 3B2VL 3FN0L 4M8QB 2AABH 2BCKA 1USZA 3K91A 4GRLD 2NXYD 4PTUB 4GSUA 2O5XH 3K6OA 4HV8A 1J8HA 4JCWA 3H55A 3VNZA 1WYJA 4H5SB 1SM3L 1IM9B 1Q9OA 4HEPG 1E9PB 3NCJL 2EE6A 3QQ9D 1S78C 2P8MA 1NA8A 3LVTA 4HFUH 4Y5XB 5F8QC 4AMKL 4QHNB 2ZXGA 1BG9A 4PR5A 5E8OA 3GLDA 1I7TB 3RWGA 5B1JA 1JNHA 1Z9MA 3ABGA 4R3SB 1CVSC 4MAUL 2UWEF 2E75C 1HIML 1T5XA 4XZUA 1BQHG 3MGOB 2WINA 4HETA 3JV4B 4X7DC 3O45B 4NQUA 4BWTA 2WIIA 3H9YA 3BE1H 1TETL 3CN2A 3G04B 3T4AB 1QW9A 2GEEA 4H13C 3N41B 3HVDA 4YWGL 3RQ3A 1BVZA 4Q8BA 2EYTB 3NSYA 3V5DA 2FBJH 5BJTA 4UQDA 4FA7B 5JQ6H 3CN4A 2ZP8A 4RGNC 4ALAH 2YD3A 4D9LH 1A3LL 1I4FB 4CGTA 5E99L 5J8OA 1BWMA 1EHLL 3G08B 3FT0A 4NENA 1QFWI 3MLPA 2Z1PA 2OMXA 2ZUQB 2J7LA 1CLOL 2HLAB 3NIDE 4AQ1C 1T6WA 5LBVA 4EAEA 3ZL2A 3IJHB 4KKCD 5SV3A 3IAQA 3KWWB 5D6DC 2WZ0A 4BSWA 1JHKH 2CLZA 2XZCH 2BNRE 2B4CC 1C5CL 4GI9A 1NOLA 3FCTB 4P2OB 2CUAA 5DGQA 3VFUA 2F53E 3TA3C 1CDYA 2H3NA 5CJQH 1I7TA 4JM2A 3MGTB 2CJUL 2ZUYA 3F7LA 2YQ3A 2FL5A 2N0KA 2BS71 2F58H 3FDWA 3HE7B 5IB4A 5TH2A 5K59E 3W37A 4AJVA 3GMQA 3RIFK 1RZIB 4KRPD 2PPCA 3EW3B 1WE5A 4Z7UA 5H37G 3MRCB 1YYCA 5LVEA 4Y19B 3GUTB 3ZDXE 1NAMH 1PKQA 2G5RA 4PJ5A 3VFNA 3D85D 5F1KC 3FTYA 4W6YB 2PNDA 1UZGA 3FB6B 4PJ5E 2H9GB 4PBDA 5E4OA 2HAZA 3CTTA 2R2EB 1YJDC 1I8UA 4ODWA 4XVOA 3HC0B 1B4TA 3NIGB 3DGGB 1QWNA 2OJZL 3PV6A 3VRIA 6FABH 3H2PA 4KZ0A 3V6OE 1JPTL 2ZAIA 1XGUA 2JI1A 4OM1H 3HS0A 1ZRUA 1MY7A 5BZDB 6PAZA 3DXAA 1AG6A 1IAKB 3QR0A 1NGXB 4Y2DC 3M1CA 1BZDA 2VMCA 1QBML 1ZPUA 1GGYA 4K7PX 1YPZB 5HGDA 3WFBL 3Q1EA 2C9RA 2H3XC 2ZUUA 4JKKA 1LHZA 4U1SB 5IY5B 2EKSB 4M6NH 2WBJD 4FX5A 3EO0A 1P1ZB 3MLUH 1OOWA 3MLYL 1YYLL 4DQOH 3FQTB 1E4KA 2VDMH 3BT0A 4JFEB 4DTGH 4GOSA 1B0RB 4BBWA 3NIFB 2XG4A