4U6HA

Vaccinia l1/m12b9-fab complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
219
structure length
217
Chain Sequence
QVQLQQSGAELVKTGASLRMSCKSSGYTFTRFWMHWIKQSPGQGLEWIGYINPSTGYTEYNQKFKDKATLTADRSSTTAYMQLISLTSGDSAVYYCARSDQTNYLFPYWGQGTLVTVSAAKTTAPSVYPLAPVCGTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy chain of murine anti-vaccinia L1 IgG2a antibody M12B9
publication title Potent neutralization of vaccinia virus by divergent murine antibodies targeting a common site of vulnerability in l1 protein.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Immune system
total genus 44
structure length 217
sequence length 219
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u6hA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u6hA02
1FZKA 4ZODA 4XMPL 2PTUA 5D8JL 1H15B 3UC0H 1FV1A 4HWUA 1NCTA 2L7UA 3O6KL 4HK3N 1BOGB 2KUTA 1A7RH 3HE6A 3RZCD 2EDTA 1A1MA 1S7WB 3F7YA 2MOVA 3FQNA 1NDMB 4N0UE 4YHKL 1BQSA 4TNWF 3RIFK 3INUH 5E2JA 5TQ0L 5KN5B 4ODBD 3LN5A 3UJJL 4J3TA 3TA3B 2VZOA 3CDCA 5AUMB 4ZFZA 3O6MH 1HHHB 1T22A 5EU7E 3T0VA 5INCA 4U6HA 3REWA 3LEYL 1VEPA 5BS0A 4K7FA 5D1XA 3NCJH 1T1YB 1D6EA 3ARGC 4YDKL 5SV3A 1HZHL 4L8BB 3FCTA 1ACYL 4NNYA 3FO2A 3V5KB 1T66C 3JZ7A 1MCSA 1XF2A 1KG0A 4P3DA 4PGCB 3LRGA 4LSTL 3QHTC 1JRHH 1RZFH 2Y9RT 4JE4B 3RZCB 3QHFH 5LXGL 1ZT1A 5K9KA 2EDXA 3DYMA 4I13B 3WSQH 1SY6H 3RNQA 1MWAH 4Y5YB 3IS1X 2FYYB 4M5YL 5IM7A 4MD5B 3RX7A 3OKDA 2IAMC 4LHUD 2XQYG 1QFWH 4NRXA 4NWTL 2K9UA 2R2HB 2I5YH 5ISZB 1MRFH 1XF5A 5MEPA 1EA9C 1U58B 4PRPA 2XFXA 3HR5A 3H0TA 3MRHB 1A8JH 2PXYA 5I19L 5DMJB 1OHQA 4NQDD 1K4DB 4PJHE 3QPXH 5B38B 2W0FA 3D3VD 5L88L 4NO3A 5D2LB 4PJ7B 4ZUVB 5ALCL 4R96A 4PJCB 1MJ7H 1X5YA 2GJJA 3RL2A 4X4MA 3OJMB 3FB5B 3V4VH 4MQSB 1S7UA 1IFHL 1RFDH 5FA4B 2HVKB 2P24A 1OOAA 2BVOA 2BMKA 3N9GH 1IE5A 4LHUB 3GMPA 4ALAH 1MEXL 5DEFB 3O4LD 4G6FD 4YBQC 3UBXI 5DD6B 5I0ZA 4ZOAA 3B9AA 5SX5H 4B50A 2G2RA 2W91A 3DURB 1FZOB 4NQDB 4Q9CA 1IKFL 4YHLL 1UH2A 3ME0A 1AXTH 3QUMB 1TQCC 5KSBE 4Y5XA 4NKOA 4G9FD 4M4PA 4BSJA 3S37H 2NY0B 4P4RB 3PNWB 3QIWA 4HFUL 3ZT7A 1S7QB 3KHOA 3QXWA 5SWQB 5FOJA 1G6VK 2OTWB 1G9NC 4J3SA 1SJVA 3L3IA 5EUKA 1QOKA 2CLVB 5E4EB 3AREA 4MCZA 3X17A 1YPZE 3UYOD 4HIEB 2VXUH 5IJKA 3KYMB 3O4LB 2E7HA 5F3BA 1FDLH 3HAEB 3MRRB 1P84K 4OCRL 5GGVL 1ZT7B 5B39A 5K9OB 2R0LL 1BVZA 2ORBH 2DF3A 2A6KA 2XT1B 1N6UA 5T33L 2QADD 4WI7A 2LABA 3W5NA 4YC2B 1GHFH 4YBHA 3O3EA 1IQWL 5GRVL 1YMHA 4O4YL 2B39A 2OR8A 3MRDB 1E4XL 3FOLB 3ARVA 1TENA 1IGIH 5CSGA 3PGFH 2DQHH 3D0VB 3MRCB 4LPYA 4PREA 1N6QL 5D5MA 1EO8L 4GG8A 5ETUB 3DHJA 1IGJB 3RI5K 3NFNB 5IVXA 2CK0L 5IW6A 4GLRH 4MDIB 3BT2H 4FQLH 3HRPA 3QEHA 2OSLA 2VNCA 2AERT 3O3AB 1LK2B 1HE7A 4IOIB 3DJ9A 3MA9L 4QOKD 1JGUL 3V4UH 1QSZA 3PUCA 1ZS8A 5D71H 4AL8L 4X4YA 4YNYB 1EEYB 3DSFH 4G8FA 3RWIB 2IMNA 4NGHH 2WUBH 5T1KA 4MNGA 4WEUD 1YNKH 2VH5L 3BPNB 1L6XA 1RJZA 5IROC 5HGBA 4MQXC 5ESQB 2DDQH 3PDOB 3TVMC 3V52H 5GS2D 3E6FB 4HUUA 1JI2A 3V2AR 4UOW1 2QKIA 2ITCB 2YEZB 3DXAD 4LSPH 5BJTB 4I1NB 3QG6B 4UQ2A 4UNUA 3F7QA 4NP4L 1UVQA 5KVDL 1GGCL 4OBRA 3DX7B 1U8MA 2BK8A 3SCMC 5F9OH 5IB1B 2V2WB 1H5BC 5EU5A 5JW4Q 4P5TA 1FNEA 4QOKB 1I75A 4MXQD 1JHKL 1TTFA 1AGFA 1S9KC 3B2UC 2D7TL 5ITFA 1ITBB 3CSBA 4GS7C 1UCBH 2GTWB 2VR5A 4M3JA 1SJHA 3MACL 4G42A 3WNNA 4BSWB 3I84A 4QKXB 5HYQA 4K94C 1HSAA 2DBJA 5DVLA 4PRDB 4DGIH 1DBKL 2HT3D 4EDWH 2BDNH 5HHXH 1NGQL 4BKLA 2A9MH 3RVWD 4OUUA 1NAKL 1BBJA 1L0YA 3MSPA 4LLDA 4UZGA 1T3FB 1CE6B 2P8PA 3GSQB 4PJGF 4X8JA 4YE4L 2DKUA 1ZKAA 1WCQA 3EJYD 1CFNA 3I2CL 5GSRA 5C0FB 4I3RL 3DROB 3VMOA 4O2FA 3WDJA 2B5IB 1FC2D 1MCNA 4AQ1B 4JDVA 2HJLB 1HWGB 3B6SB 2Q1EA 1RIHH 4AZ8A 4KK5C 5I1KH 1I1AA 4XX1G 4XTRD 1UWGL 1J05B 3ZYOA 4XZUB 5JXED 1KTLA 2I07B 4U1NA 4IRZL 4OCYH 4YHZH 3P0VH 2VL5B 4YZFE 3VJ6A 2ATPA 1MLCB 3EW3B 3WJLC 3OX8B 3T8XB 3MBXH 4RDQG 1JPSL 4ZAKC 1ZVSA 3TJEL 3F5WA 4JG1L 3HI5L 3OKOA 3O4OC 1T2JA 5FUOH 1XGYH 1P4IH 1FG2B 3JV4A 4NRYA 4NM8H 1YEHH 1SEQH 1UH4A 4D9QE 4XVUD 25C8H 3QCVL 1HXYA 3RGHA 1RZ8A 3SQBA 2GJ6E 5H94B 2ICWA 1GH7A 5EWIH 3WIHA 1FNSH 4EQ3A 4HGWA 4PJ9A 3FO0L 4H25A 1HK6A 1XH3B 2AKRA 5HHVH 2D7QA 4BFEA 5DUMH 4NO0B 4JFDE 3ZSTA 3QB7C 3GJFK 4UU9B 1CFQB 2GFBB 4XVSL 1SBSL 3QFDA 4K2UL 2XKNA 2GI7A 2BNUA 1RUPH 1MCKA 4AT6A 3U1SL 4N5EC 1T1WA 1FYTE 1F4HA 1SJXA 4I0PA 5BV7H 1NAMH 1OT2A 2DQCH 4I4WA 1DSFH 4U1IA 1VFAB 3LV3B 3S36X 5DJYB 4XNQA 5I17B 3HE7A 1MCIA 2OR7A 3SDYH 4PJGB 1KXTB 4GRLD 2H41A 5DC4B 1G1YA 3IFOA 4ONHA 1L7TL 2DQIL 1W72A 5BXFA 3OJ2C 4MX7A 2F53A 3QWRD 3ZE0F 1KBGH 4ZFGH 5CD3B 3UDWA 2X4TA 1HH6A 4JJHA 1DANT 3KXFE 2MMXA 3O3UN 4OLXL 1J5OH 4M1CD 3RX8A 1QBMH 4EUPH 1BD2E 2WIIA 1Q0YH 3HPLA 2YS4A 5C7XL 1H8NA 1RZ7H 1CBVL 5I30L 5F6IC 2D7MA 3BN9D 5C2BH 1MCEA 4X5WA 3I9GH 1INQB 4GBXD 4BQ9A 3ZHDA 3A67L 2NY4C 1TJGH 2DYPA 3S5LA 4O58H 2CUIA 1DE4B 4K9EC 5FV1L 4GRLB 1D5BB 1NC2A 4WI9A 4X7SH 5JPMB 3TWCL 3P0YH 2APFA 3WIHL 1KB5A 1EXUB 4TQEL 5EO0A 4LSDA 3FN0H 4K94L 2FGWL 3B2VH 4HIIB 2H32B 3G6JF 4G6AD 4JFFE 5JR1H 1XCTA 4MB3A 1YNTB 1LO3L 2IADA 2Q7YA 3CXHK 4PJ8C 4OCWH 1HQRA 3FOMB 2GK0A 4FQXA 5CBEB 5M94B 1U8HA 5DJ8A 4NOFA 4P5MA 1EO7A 2R0ZL 2HKHL 3VXOB 2P5EE 1VGEH 4S1QH 2CLRA 3FRUA 4YFDB 4XBEL 1SQ2N 2QR0A 3B43A 4GMTL 1RJYB 3HUJB 4KTEL 1GYAA 5FO8B 2OL3B 3HNTH 5EU3B 3BEWA 1DVFA 3VH8B 1CGVA 4HQQL 5IHUH 1QR1B 3SO3C 5I2IA 1JZ7A 3SE4A 1T03H 1I9JH 5F1IA 3GBMH 5GGRY 2GHWB 4RWYH 5DUBB 4PP2B 1P5VA 4JO4L 3AS3A 5FIEA 3GM8A 5F96H 5GGUA 4AG4L 4GKNA 1E6OH 4R4BB 3QDGD 5FYJL 2EXWD 3HMXA 3MUJA 1A0QL 4E41A 3QP3A 4PG2C 2Q76A 3IDXH 4J7RA 1CLOH 2H1PL 3QG7L 4PJAE 4LF3A 4YJZL 3DV6A 4HUXA 4OGAC 1K3ZA 4L9LC 1HHJA 4N1HB 3VWKB 2YZ1A 5GZND 3VWJA 4XP1L 4X8XA 5C07A 3VG0L 4MVBD 3GRWH 3CFDB 3KPRD 5F7YC 1QSFA 2X70B 4R7NB 5GPRA 4JKPL 3QXAA 1JUFA 1PFCA 1KB5L 4KKBC 3CLFL 2HJFB 3GIZH 3M17B 1S5HA 3QDGB 4U1JA 3GSNB 2XWJB 5CSZA 1F90L 3N85H 2XN9D 2IG2H 4OM0L 3HFMH 1MHCA 4RAVA 1JNNL 2BCKB 3RVVD 2BNRE 5L8LB 1OAUL 3CDYA 4NNPH 4Z7VB 3T3PE 3D2UD 1EPFA 1RK0A 3DO7B 5HI4D 3KPRB 1G0YR 3WUZA 1J1OL 3I3EA 3IFNH 3UZVB 1N2RA 3OZ9H 4QRQB 5FCUH 3EDFA 5KSVA 4K3DL 1X5IA 2C1PB 1ZHNA 3R0NA 4NBXB 3GSRB 3ZHKA 4XNZC 3JWNC 4P23A 5IW3A 3CFKA 1B6DA 2CGRH 2Z31D 3R1GH 5HHOE 1S5IL 1QRNE 2Y07H 4HWBL 2XN9B 3RWJB 5D7JA 4HF5H 4HKJA 4TOYH 2NY7L 2YZ8A 4HV8B 4ONFL 1JFQL 1P9MA 2OBGA 3RGVA 2VDKH 5FYLE 2DLFL 2EH7H 3WS3A 4K9EL 3SE3A 1F11B 1EO5A 2DQFA 3G5YA 1BMGA 3O2WH 4NFDA 2OJZL 4UB0L 2A6JB 4U1SB 1QUNA 4WW2B 5IMLB 1KJ2B 5FKPB 3O8XD 4ZYKA 3GK8H 2M2DA 5IGXL 4Z7UA 1EZVX 3MV7E 1LK3L 4LVOC 2V5SA 1DQLL 2VLRA 4JY5L 3NACL 4NQED 1KCLA 5EU4A 4RFNC 2ITDB 2YRLA 2Z31B 2ARWA 4UT7L 2ADIA 5IVZB 5I1AB 1DN0A 1NGPH 5GS1B 4Q6IA 3ARFD 3QIUD 1FNFA 1PKQB 2DKSA 4YIQB 4FFVC 4R26H 1GL4B 3EFDL 4WU5B 3ZE1E 3DX6B 4LAJH 1IC4H 1ZHBB 1RSFA 2NY2D 3WN5B 4M61B 4X98B 2BSTB 3VXTA 1KYOK 1OAZL 5IFHH 4KHTL 1QEWA 3O8XB 2IANA 5E9DB 4UMGA 4YDLB 3QRGL 3MLRL 3SOBH 1BFVH 1XCQA 4PJXB 2CDFA 4NQEB 1I8IA 3B9DA 1CTOA 1WQVT 2JB5H 1S7SA 2W38A 3GBNH 3LKNA 4GKSB 3VGAC 1VACA 3FB8A 1XGRB 1RUAH 5CEXB 1KCRH 1WZMA 3S3PA 2Q87A 1A3RH 1FL3B 1VHPA 3JTTB 1UKSA 4TPRL 1I85A 5EZIL 4XC1H 3ARFB 3QIUB 2Z9TA 4O51B 3WFHB 5D1ZD 4GFTB 3MMEA 1RVFH 2V5TA 3EJZC 4KK9D 3WEXA 2QEJA 1I1YA 2NY2B 3IJHA 1R0AH 1V7ML 3ARDD 3HRZB 5B22A 3EYFA 1FGNH 5EO9B 4LCCB 9CGTA 4NQSA 2AJUH 1LO4L 2JF1A 1DLFH 1IGML 3CX2A 3P9WB 1AKJA 4WUUB 4JJ5A 3SKOA 4HHAB 1U3JA 3C08H 4KRNA 1V7NH 1W0VB 1ZT4A 2YD6A 4PY8I 1N4XL 2HFFB 3EYUH 3KHQA 4OZFB 4NPYA 4ODXA 3R06A 5GS0D 4XNXL 3MR9B 3QI9A 1JF6A 3IRZA 3DIFA 2VKWA 2DQDL 1D7FA 5D1ZB 3K2MC 1TVBA 3STLA 4HKZB 1EFXA 4GUPB 4KV5E 4RFEA 2RQ8A 4ZPVB 2X5PA 1CL7I 5CGTA 2VDLL 5KANG 5FGSA 1YZZA 3BPCB 1VEMA 2EKSB 5EOQL 3DWTA 4N5UA 4UAOC 5JUEL 5MI0B 4CJ0A 1KPRA 3MA7B 1JV5A 2D0HA 1UWEL 1AD9B 3ARSA 1LD9B 5E94B 2GSGB 3P77A 2LU7A 1SYSA 5BO1H 2J2ZA 4XPAH 3B8SA 3GUTA 1SY6A 4XC3L 5FK9B 5CEZH 5LBSH 1MWAA 5HHPB 5MEND 1KJ3H 2EH8H 3KPSE 4P57A 3IDUA 1J0KA 1F5WA 5GRJH 1CDIA 3MJ6A 4HGKC 2YN5A 2HH0L 3QNZA 5GRZA 1MIML 2OX5A 4WNQA 4WDIA 3SO5A 2LFGA 5F7EL 5C9KA 5F89A 1WFOA 2VE6B 3NIGE 4XP5H 1BQLH 4PG9A 3UC0L 1DFBH 4LRIA 1S8DB 4P46B 1CIUA 1A7RL 4U0RB 3ZT6A 1AY1H 1NCAL 2YXFA 1X4YA 3TJHC 2V17L 3OKNB 1KJMB 1KCKA 1OTSC 3W0WE 3INUL 1ED3B 2DMKA 4DEPC 1EBAA 4MNQD 5CZVH 3MV9A 3FQUA 1ERNA 3QO1A 3O6ML 4TVPD 3MPCA 3RWCA 4BH8B 1A4JB 3VE0A 3NCJL 5JIKA 3JV6A 4DN4H 1TFHA 4WV1A 3UTOA 1JPGB 3TBYB 5I8CA 4MJ5B 3FFCD 3WE6A 4U7MA 2EE2A 2VC2H 2ZOLB 1WBYA 2JB6A 1JZ5A 3QQNA 3L6FA 4H8WC 1RZFL 3IDIB 3QHFL 3ARRA 1JE6A 3ZDZF 2HVJB 2VLKD 5D9SB 1KJVA 3ZHLA 3WSQL 1SY6L 2RFXA 3NFSL 4MD0A 4GQPH 4MNQB 2EE6A 3P40A 1RHFA 3TYGH 5TDPA 2BERA 3EO1B 4QO1A 3KNBB 1QFWL 2VUYA 4M6AA 2I5YL 4LHJB 1MRFL 2D4DA 3FAXA 1AGBA 1CE1H 5DC0A 4R8WH 1G7LB 3FFCB 2P5WE 3QPXL 4PB0H 3T0EA 4MJ6B 5DD0H 1ORQA 1IAII 4XB8A 4EN3C 3RWDB 1MJ7L 5JPNB 5CIPH 2A83A 5F7MC 5C0CD 3V4VL 2PYEE 5TDOA 4OBSA 1ZA6A 5IEHB 1RFDL 3MJGX 1ZHKB 4RNRA 5IK3A 1CDBA 3UTTE 3QUZB 3N9GL 5EZJB 4RIRB 3GHEL 5C0BE 1TCRA 4ALAL 2HG5B 2NY6C 4JFYA 1EHLL 1KOAA 5DWUH 4TSCL 2UZXB 1VFUA 5IMKA 1MAKA 3PGCB 1AXTL 5SWZD 4OZHF 4ZFOL 1GGUA 3HE6D 3MO1A 5F9DC 4OCLC 1NCCH 3S37L 3L3DB 3TPUA 2I26N 2OTUB 4M7LL 1W0WA 4QF1B 4PRBA 4PRID 5ISZE 1RY7B 1YQVH 4IHOB 4WTWA 3MGOB 2EDDA 2D9QB 2HTKC 4XP9H 1OSPH 2YUXA 5DRWA 1OCWH 3MC0A 3QDMA 4C4KO 2ZCHH 3JTSA 1FDLL 4FG6C 3VD9A 2ICCA 3WKNA 1R3LB 4KJQC 2NR6D 4M1DH 2ORBL 4NHUA 3DV4B 4ZS7H 1U3HB 5SWZB 4JFXB 4HIHA 2H3NA 4DK3A 4NN6C 4ETQA 1GHFL 1MCLA 3BQUD 2DJUA 2V2XA 5BQ7B 3U36B 4RGND 2R1WB 1IGIL 4OQ1A 1LO0H 1Z5LB 1J8HE 1JNJA 3ROLB 1QBLH 4IEFB 4PJBB 4AIOA 3AY4A 3RPKA 1F00I 3RDTC 1TPXC 4L8SC 3O3BB 3BT2L 2Z8SA 1JGVH 4YR6B 1BFSA 4JKMA 2E9JA 2GTZB 3RWHB 2H8PB 4KQ4H 3RKPA 1QLRA 5BVPH 4JANB 5D71L 5I74C 1BLNB 5K59F 4C56B 3DSFL 4X99B 2V7NA 3KPNB 3BQUB 4NGHL 4ZUTA 2WUBL 3BP4B 2R29H 1YNKL 1Z3GH 2J12B 4RGNB 5DQJB 4MD4A 3RWGB 4BELD 4L3AA 5FUCC 5D7IE 5EFIA 2DKMA 2DDQL 4NO2A 3V52L 3KVQA 1A3LL 4OZHB 4RZCA 4MNHB 3C8DA 5D2NC 3FO9A 5JLZB 3NCCB 1SEBB 4LSPL 2I9TB 5L2KE 3ARGD 3ECBB 1KCVH 1GAFH 2OXHA 3RHWK 5HGDA 2R69H 4Y7MA 4PS4H 2DM2A 4YH6A 5CCKH 2YMXL 4G80B 4PGBB 5E70A 5I8KH 4PTUB 1AIFA 2KKQA 1AGEA 2GEEA 3TBSA 4M9PA 2WANA 4TTDD 1FFQA 1OD9A 3D9AL 1U8KB 4QHNB 5HYSG 5D5MF 3AU1A 4CJ1A 2DS4A 2EDFA 1AD0A 1UCBL 2OJEB 3E6HA 3OR6B 5IVXF 1TTUA 5DO2C 4WIQA 2F19H 3V4PH 4P2RA 2YD5A 3BD3A 4FQ1H 4DGIL 3MNVB 3DBXA 5L2JB 4EDWL 2BDNL 5HHXL 3S4SB 2FEEL 3RUGF 2MHAA 2VWEE 3ARGB 4OB5H 4LCWA 2Z92B 1HKLL 5ADOH 1LNUA 4F7MA 3P9MA 1IQDA 2ZOKA 3CSYB 4LAQH 4ZUSA 3VU2A 1RIHL 1QO3A 3X3FL 5J6GB 1KIUA 5KTEH 4K3JH 1WC7A 3WXVH 2V9QA 1FE8H 3P30H 5ANME 4YHZL 1NGXA 4OCYL 4BQBA 4V1DD 3P0VL 5EIIB 4XXDB 3V6FB 2L0DA 5DYOA 2W07A 4HXAH 1N3NA 4EUPA 3V5HA 2R39A 5IJVA 1DQDH 1Q1JH 5CHNB 3S36H 1NMCC 4YBQD 1IAMA 5FUOL 2DD8H 3MRIA 3VD3A 2Z8WC 4F33B 1XGYL 1P4IL 4NM8L 3HZYB 1YEHL 3GMLA 3TP4A 2B0SH 5CP7B 1RJLA 1G9MC 4YAQA 2QL1A 25C8L 2QHLA 1SJEA 4U1KB 3DX8B 3H7LA 5HGAB 5GISH 5EWIL 3SE8H 4G43A 5EC1A 3UBXG 2FBOJ 3LS4H 1B0GA 5HHVL 2BNQE 5DUML 2HRPH 3BW9A 4V1DB 1MLBA 4UQ3A 4R3SA 4LLWA 5C2UB 3U7AA 3H6JA 1KLUB 2PUQT 4UINH 1R5VA 3PP4L 2JCCE 1RUPL 2B8OT 4QRPD 2LV4A 1PVHA 4PJ5D 4P2QE 3IFPB 4LGPB 3TZVA 1NEZB 1NAML 4NHCH 1DSFL 1TQCB 5FM4A 4U4BA 6FABL 12E8H 4YDIH 4NC0B 3KLDA 4L4VE 3SDYL 3IDMA 3OQ3B 2ZUSA 5BZWB 5IWLA 1QG3A 3ULUE 2VIRA 5DXWA 5GQBA 2X4RA 1A9EB 3UYPA 4ZFGL 3S88H 1KBGL 2EIZA 3F8UB 1HIMH 1X4XA 4ZQKB 4KY1H 1DQML 3PV6A 5HPOA 1PYWA 4G8GD 3QWOB 2CIIB 4Y88A 1J5OL 2CLZA 3OPZH 1XZ0A 4IMKA 4X6DA 3V6ZB 1Q0YL 4QRPB 3ZDYE 1HI6B 4PJ5B 1RZ7L 3QFJD 1GJIA 5DMIH 1CS6A 2ZUWA 4KQ3H 3P4NB 5C2BL 4E0RB 1GRWA 4XWOC 2VTFA 2X4SA 3C2AH 4OZ4B 1JPFA 1NFDE 1TJGL 4WTXA 1BAFH 2R4RH 4O58L 3PWUA 4Y89A 3GRWA 3NZ8A 3UAJC 1NL0H 1XIWD 4X7SL 3QNXB 3HZKA 3RBSA 4QXTB 5C09A 4Z7QE 3P0YL 4MQXD 3FN0L 3EZJB 1S9WA 3EDKA 3B2VL 1FZMB 3G5XA 3QQ3B 4G8GB 1OVZA 2Z0BA 3O45A 1CZ8L 1Y6MR 1Q9WB 2E9IA 4YXKH 4AIZB 1VGEL 4S1QL 3B3IB 3QFJB 3SCMD 2EYSA 3ZO0A 1A7QH 5DS8B 2BHZA 3NCYS 3V0VB 3B2UD 5AYUH 4FQPA 4I77H 4Z7WA 1OQXA 3CFJB 5IHUL 3LS5H 5AEAA 4QYOB 3ZYIA 5KS9F 5CBAB 2HWZH 3KLAA 5IMMA 1I9JL 2NY1C 3NN8B 1T03L 3UJIH 4RWYL 4BM7A 1ND0B 5F96L 5FDWB 4NQCA 1KPUA 5FO9A 1E6OL 1MH5A 1WCBA 4JFEE 5L6YH 2GYSA 3R8QA 3BP5B 3LRSA 3EYSH 3IDXL 1YN6B 5EUOF 3SCMB 5DTFB 5EPMB 1CLOL 1H5BB 3X14B 2B4CC 1G9ML 3MV01 2ZG3A 4KMTH 1BX2B 4KK5D 4OLYH 3V95A 2GAZB 4XAKE 2ENYA 4YGVA 2B2XH 2CMRH 3U4EB 1MELA 4H5SB 1I3RA 3BYTA 4KRPC 4OFVA 4PRNA 1MPAH 3GRWL 4J8RA 4EDXB 3G08A 4LKXA 4MS8C 1QLEH 4JM2A 1T4KA 4P59L 3WFBL 4ZG1A 3GIZL 4IOFD 2VSDA 4YHIA 5FYJD 5HDBF 5MP6H 4LCIL 5DSCA 3HUJE 4HLJA 1PG7X 4CN6A 4FXKB 4N90E 3N85L 4Y19D 3UROR 3SJVA 2CDEB 3HFML 2YD3A 3I6LE 4DWHA 3GIVB 2I24N 4Q7DA 2M1KA 1S9XA 4GW4B 3TBTA 3O41B 5I8OH 2J8UB 3NIFF 3SGJA 3GMMA 2KQMA 3IFNL 3OZ9L 5FCUL 4NO5B 1HXMB 4CW1A 3O4OB 1RULH 4RGMC 4D94A 4MCYA 1JZ8A 4P5TC 1JCKA 2CGRL 3R1GL 2ZJSL 2Y07L 4LNRB 4Y19B 1IGYB 2XQBH 4HF5L 4TOYL 2NW3B 2G75A 1NGYB 5IFAH 1XT5A 4OLWH 2HTLC 2VDKL 4XBGB 3MJ7B 1AC6A 4UT6H 2EH7L 5IV2B 3G9AB 1CFSB 1OD7A 2ZSWA 4KVNH 4ELMA 2DI8A 2VR4A 2IGFL 3PIQB 4WFEE 3O2WL 4JG0L 4Y5VA 5EUOB 2VLLA 1HH9A 4HWZA 4JFPB 4O9HH 3GK8L 2JJSA 1SYVB 2ESVB 4K7PX 4D9LH 4N68A 2VISA 1BVLB 3QXDB 5D7LA 4HS6B 3WIIH 4D0BB 4KVCH 5GGRB 3EYOB 1UACH 1OWWA 1NGPL 3GGWA 3WLBA 5CD5C 1LMKA 1FYHB 1A6PA 2FWOA 3TN0A 4JRXE 5FB8A 5TGBB 4TUJB 3IDGB 4R26L 3EHBD 3WXWH 1IC4L 3RY6C 4M9OA 4IMLA 1T1XB 2SEBB 5C07D 5IFHL 3B8YA 1JF1B 4PJ8D 3QEUB 3DETC 1A14H 3SOBL 4OCMC 1BFVL 3QUXA 5F6HI 4FTVE 3GI9H 5LCVH 3LEVH 5DHYB 3GBNL 4XBPA 3OF6A 5F6IB 1RUAL 4B5EA 1XR9B 1KCRL 4PRHA 1A3RL 4QHKJ 1U0QA 2BOCA 2HJKA 4XC1L 1ZLWK 3VXPB 1J87A 3HI1A 3DMMD 1KGCE 1OARH 4Z7UF 3RWFB 5J89A 5IEKA 2ED8A 5KBNC 3FB6A 1HQ4A 5IVNA 5CJXA 1IBGH 3KPMB 1R0AL 5HHMD 4WW1A 5I0DA 1FGNL 2WP3O 4MDJB 1DLFL 1V8HA 3RPIA 4PJ8B 1QYGL 1P4LA 1UFUA 4KROC 3C08L 1V7NL 3CU1A 4R6UA 3QUMH 1PZUB 4P23D 3EYUL 2LTQC 1MY5A 4HJJL 3F12B 3HE7C 4O2CB 3U46A 1F6AB 2UUDK 1YC8A 1ITCA 4LCYB 5JXAH 3MOQA 3PJSB 1OB1A 4OGAD 2VDQH 2NZIA 4EEEA 2D7NA 3IXTB 1KULA 4URTB 2BVPA 2VOTA 1OF2A 2ICWJ 5E9DE 4HIXH 1HHIB 2O5ZH 3SO3B 1H3PH 3KR3H 3UJTH 5LVEA 1LE5A 3P4OA 2IH3A 1IAIH 5HVFB 4KKBD 5E2UH 4U6XA 3ZKSD 3HAEH 1MFAH 3S8WA 4GRWE 3L7FB 4P99A 5IHBA 4Q2ZB 3ESUF 4DKEH 4HKXA 4NFCA 1H0DB 2IJ0C 3VGEA 3MXWL 2Z35B 2KQNA 2VITB 4KK8C 5DJCA 5CEZL 5LBSL 2EDYA 4L9LB 1QSVA 1KJ3L 2EH8L 4JLRB 2YBRA 5E2VH 2NMSA 1N5AA 3HLAB 1GZQA 1DCLA 2J3SA 4X6FA 5E1AA 4C59B 1U8OA 2RGSA 5HGHB 3F7RA 1IEBB 4WUUE 1OP5K 3AS0A 1XAUA 4QRRE 1J0JA 2R1XA 5FOBB 5MERB 2DM7A 3PL6C 5ICYB 4DFHA 3WHE1 2NY3C 2VDPL 3MRMB 2C7UB 1D9KA 1A6TA 1FFNB 1TETH 2W60B 1WAAE 4XP5L 3TBWA 3W9DA 2AQ3A 4JQVA 2R56H 2X4NB 3EYVA 5FA3A 4E42B 3F65A 1T21B 1AY1L 1I7RA 3H9SA 5CIPA 4KJYA 1RQ5A 4I5BB 4WI2A 3LQAH 4I9WE 4Z7OE 2GJZB 4HBCL 4R9HA 2BVQB 5HVHC 1A22B 2OLDA 3CFIC 2ZNWA 5CZVL 2VLMD 2YUVA 2UZYB 5D1QA 1E27B 5F7DB 1ZVHA 2EZ0C 1Q72L 4HCRH 3D39A 1JZ4A 4QLRA 3CPLA 2G9HA 4DN4L 2FR4A 5FHAH 3V9FA 4BFIB 4XNZB 3MZTA 4APQA 2H2SD 2BSRB 2VC2L 1BVKA 3I3BA 4U2YA 2VLJA 4ISVA 1YY9C 3LQZB 1CFBA 1CICC 5KSAC 3C60A 3T0BA 4CVUA 2PTTA 3BPOC 4JGUA 3BMVA 2FIKA 3MZGB 1F58H 4Y16A 5CEYA 1JHTA 2QSVA 4FP8L 5CJ8A 1MJJA 5GS2H 3TYGL 1D5ZA 4GAGH 2DOCA 3PWLA 4PJDB 5T1DH 4LVEA 3WMSA 3KPQB 3NAAH 4JY4A 1NH6A 1JK8A 2ZSVB 5SWSA 2N1KA 1T0MB 1J1PH 5FGRA 5DJXB 4RFNB 2E6PA 3LEXB 4HK3J 3U7YH 5DD0L 4JZJC 3M1BA 1MCFA 2YPLA 4FRWA 4JZNA 4UIKL 4ODTH 3EJZD 4ZDHB 5IIEA 4J4PD 4F58L 1IRAY 3MTRA 4KXZH 3N1FC 1F3JA 5I73C 3ULUH 3QULA 1AO7D 3LPGA 3MBEA 4IJ3C 1J86A 1CWVA 5FYJU 4OZIE 5GSVA 2FJGB 5BW7A 1IM9B 2ADGA 43C9A 5BVJB 4ZXBC 5B8CA 4GQ9H 3VGAB 3MLYH 1FGVH 5T3XE 2EYRB 2LQRA 3BH9B 5IOPA 2FL5B 5HJ3B 3HNSH 4J6RH 2JLLA 3SE3C 2J1KA 4XVJH 1CD0A 1RZKH 1NCCL 2R1YA 2VKXA 1DQJB 1U95B 4HK0A 3L5WA 1CDYA 3BZEB 4ERSH 5EBMA 3TBVB 5IFJA 1FFOB 5DJDB 4I2XE 1AO7B 4XP9L 1OSPL 2UWEE 3OB8A 1M4KA 5KSUA 4Q97A 3MROA 3VXSD 1KIPA 4N0FB 1FVCA 3AM8A 3HZVA 1JGEA 4M1GH 4PJIB 1T6VN 4LDLB 1U8IA 4ZS7L 4UV4H 3TT1H 4C54A 3JWDH 1I1FA 3RBGA 1QFPA 5F70A 3OJDB 5E03A 5IMOA 4FQJH 4NKIH 4X9HA 3LKQB 4K71C 5AD0B 1LO0L 1UGNA 3UTPD 4LSQH 1MRCL 4PV8A 4X83A 1MFCH 1QBLL 5AWNH 5ADPH 1HDMA 2EYTB 1U8QB 1YN7B 4UAOB 1CD9B 3WJJC 3VXSB 3AXLA 1M7IB 2CKNA 1JGVL 2WAHA 2YD4A 4LLVB 4BH7B 2XWTA 1MI5A 2YUZA 1YDPA 3CC5A 3G5ZA 1QRNA 1NDGA 2Z8RA 4O5LH 4KQ4L 4OFDA 4ZFOB 3TJHD 1TZIA 1ZEAH 3ARBC 5BVPL 1OTSD 1IZJA 1T1ZA 2YUWA 5JHDE 2R29L 4PGEA 1Z3GL 2CKBB 1M71A 1LDPL 3TCLB 5K33A 5EU6E 4CU8A 2H32H 3K2UH 4G8EA 3TEUA 2MCPH 1BM3H 3PHSA 4P5KB 3FT4B 4F9PC 5C3TA 3JSSA 1HSBB 2CRZA 3LH2L 1TZHA 1GAFL 3EUUA 4NT6B 1N5YH 3BVNB 2VRAA 5B38G 5I75C 2VAAB 1X7QA 4H26B 4PS4L 4OV5A 3FRPG 5CCKL 4X6CA 1C08B 2IPUK 3D0LB 5C0RL 5I76A 5I6XC 3V6OE 4Y4FA 5HPMB 2ZPKH 1K85A 3CZFB 1WZ1H 2AJXH 4BZ1H 2OL3H 2VN4A 5C08E 1LEGB 5ICZA 5DFVC 4D3CH 4DEPB 3REVB 4PJBE 4X9BA 3V4PL 3NPSB 4LHUG 3GMOA 4AEFA 3MNZB 4FQ1L 5DUPL 5BRZE 1UC6A 15C8H 3LN4A 3L3JB 3QR2A 1WSST 4W70A 4AM0A 4YHOH 4G6MH 3SDAA 1FVDA 2NY5H 4GG6E 4FABH 3NFPA 4D0CA 1EEQA 2C3VA 1HEZB 5KOVC 4UT9H 5IB3B 4C56E 3VFMA 1OGAE 4LAQL 2VQUA 1CFTB 1YMME 3L3HB 2EO9A 2ARJQ 3PWPA 4O00A 4Z78B 5GGTH 5C0AA 5KTEL 4K3JL 4Z0XA 3WXVL 2DMBA 3O6FA 3HCVA 4WI8A 1FE8L 3P30L 3IJYA 5H2BA 2YK1H 1W2KT 1JYXA 3LN9A 5F71A 5GGSA 5L8JB 1QRKA 4XCNB 1RK1B 4HXAL 4HGMA 3Q6GL 3PQYB 1DQDL 1Q1JL 4NZDA 2NY6D 3S36L 4AY0A 3GSNH 2DD8L 2PO6C 1WIPA 4KTDH 3O6LL 2AXFA 4HEPG 3MV8A 2ICEA 4LLQB 5HYJD 2B0SL 3FQRB 4K23H 5AZEL 3MLVH 4EXPX 4PJFE 4ZOBA 3L3KB 2XY1A 3KS0H 4WFHE 3OAYK 1YECH 5GISL 3BZFA 3SE8L 3HI6H 3IU4H 5C1MB 2LU3A 4LSSH 3IKCB 3LKOB 2HRPL 4F3FA 3A6OA 4DZ8B 3PWNB 2HTKD 4WV1C 2XNAB 2NYYD 3EOTH 1NC4A 3C6LA 4AH2A 5HYIA 2NY6B 4FG6D 1GVIA 4KJQD 4YGAB 1OAXH 3VXRA 1G7HA 5HYJB 1S9VA 4NHCL 4L4TD 3VFUB 2XA8H 3HMWH 2FD6L 4BUHA 1F3DH 2H26A 3WDHA 1L9NA 12E8L 4JN2B 5FYKE 2EC9T 1JN6A 3BSZH 3ZDXF 3B5GA 3VI3E 3LAFA 3KPSA 3TC9A 4JPWH 3AGVA 3O0RH 1KJ2H 3T4YA 2C9AA 2NX5A 2XRAH 1WEJH 2APXA 1HIML 4K3EH 2AK4D 3EYQC 4KY1L 3QUKB 3K1KC 3RDTD 3OPZL 2A6IA 1ODAA 3T0EC 5FKAB 1AI1H 1NMAH 2GSIA 2UYLB 3FQWA 1AHWC 1FFRA 1IARB 5EZOL 1NANI 5DMIL 4KQ3L 1VFOA 2HA1A 4L4TB 5C0ND 1N6VA 2X4QA 1CGXA 4NN6B 4MJID 1OAKH 2O5XH 1VGKA 1BAFL 2R4RL 1NCBH 5L7XH 1T2QH 5I1DA 1G7QB 3D25B 5DZLA 1U3YA 3CUPB 4X4XA 4Z77B 2F54A 3AB0C 4PY7B 5DVNA 4QXWA 4LLYB 2PKDA 4BSVB 2ED9A 4KWUA 3RDTB 1TPXB 3T2OA 4L8SB 3U48A 5E8NA 4P0DA 3FB7B 1UJ3C 1RURL 4PBWD 4PY8J 4RWHA 1QLFB 3OXRB 2YSSA 4WRLA 3VG9C 5I1EH 1A7QL 1UM4H 3MRKA 1WWWX 2ADJA 4FZEH 1HILA 1YYMH 3QDJD 4HJGB 4KDVA 4MJIB 5AYUL 2HN7A 1JWMA 3GB7A 4ZSOB 3QUYA 5I74B 4OI8A 4Z0BH 2QSCH 1LE9B 4G6JH 3LS5L 5DO2D 3I6KA 5CGYC 3VXMD 3NABH 2HWZL 3GBLA 3LD8C 1H15A 1PG7H 1PY9A 3UJIL 4M8QB 1BZ9B 3IRPX 5D2NB 4YDVB 1C12B 5HGGS 4XRCB 1BOGA 1MCOL 4QHLB 4PLJC 5L6YL 2DLTA 1S7WA 3FFDB 1NDMA 3A6BH 4DKDC 4HAGA 1R3IH 3EYSL 2OZ4H 5KN5A 2IH1B 4NRZB 4Y0GA 4ODSH 3TA3A 4FMKA 5AUMA 5CJQH 2B2XL 1C8PA 2CMRL 3QO0B 1HHHA 3CFEB 2B1HH 2EEBA 2R8SH 3T2PA 1MPAL 5I1GH 3VXMB 1T1YA 5D6CB 4M48H 2RB8A 1QLEL 1DTUA 2VXQL 4HIJB 2NLJB 3HC3H 4H20H 4PGCA 5J9PB 1ZTXH 5MP6L 2YR3A 3RZCA 1KTRL 2IBZY 1MVUA 2OI9C 1U8PB 3BIBX 5GS0H 1XFPA 3C09C 3P2TA 5F7WC 4Z7WF 3NIDF 2Q3AA 5IBUG 2V5RA 4Y5YA 4AIXA 2FYYA 5FECB 4MD5A 3OKMB 5H37H 4Z8FH 4ENEC 4H88H 2C3WA 4OF3A 4ZD3L 1FO0B 1OAQH 1QZ1A 2R2HA 5DQ9B 4K7PH 4L5FH 1U58A 5I8OL 2R2EA 3ULVC 3MRHA 4PJHF 3BPLB 1K4DA 4U1HB 4XPBH 5AZ2H 5B38A 1RULL 1NMCB 5TQ2H 5D2LA 4PJ7A 4ZUVA 4XP4H 5HYFA 3K0WA 3KPOB 4WWKD 4PJCA 3F7YB 1LEIB 2AK1H 1CL7L 2XQBL 1KSRA 4ODWB 5CP3H 3ZE2E 4MWFB 2DIAA 5IFAL 3OAZH 4OLWL 5FA4A 1IAOB 2CQVA 2HVKA 2QQKL 4UT6L 3IAGC 1OPGH 4KVNL 4N0UB 5IQ7H 4J3WA 4LHUA 1II4E 1T7WA 4FHBD 2ZWLT 4F37K 4OF5A 3HTLX 5DEFA 4F8TA 3VDAA 5DD6A 4O9HL 4NNYB 3KLSA 3DURA 1FZOA 3QQ4B 3IFLH 1SVCP 4X5LA 4NQDA 1IVLA 5A40E 4D9LL 4N9GB 3QUMA 4RRPG 4P3DB 2X4PB 1QFUH 4WWKB 3WIIL 2G5BB 2DJSA 2KZ1B 5HI5C 4NDMB 5ITBL 4P4RA 1I7ZB 3PNWA 4LQFH 3BKCH 2VXSH 4HD9A 4XWOD 1UACL 4CVZB 1S7QA 3SGEI 5SWQA 3VH8G 4RSVA 5T3XH 2OTWA 1UT9A 1T89A 1YPZF 2CLVA 2HLAB 5HYEA 1J8KA 4MA3A 4TVPH 3MRNB 4GJTB 4HIEA 4XNMA 4JKLA 3S34H 1NLDH 3KYMA 3O4LA 1XF5B 5DJ0B 3HAEA 3MRRA 1U8NA 1PEWA 4NQVB 5D8JH 1HCFX 1A14L 1S7VA 4K8RC 3SDCC 4D8PB 1RIVH 3Q2CA 3GI9L 2ID5A 4G9FA 5LCVL 3LEVL 4ELMF 3RJQB 3W82A 3CFCL 3WIFB 4DUWA 2HAZA 2DIBA 4PJHB 4RBPK 3MRDA 3BH8B 4LSVH 5TQ0H 3FOLA 3SKJL 2AJSH 3MRCA 2FX9H 5ETUA 4M93C 4OTXH 2E7LC 1IGJA 3NFNA 2ESVE 1PSKH 1FG9C 1IBGL 4MDIA 1DEDA 2C1OB 4LEXH 3RKDD 4YDKH 2VABA 2I60H 2D31B 5E08H 1KLFA 4WO4D 3O3AA 1LK2A 4IOIA 5KVGH 1K8IB 3BJLA 5KJRH 4POYA 2PTVA 5I8EB 3QUML 5IBTH 5FM5O 1NJ9B 5LXGH 4YNYA 5LWYH 1EEYA 4G6KH 3RWIA 1HYSC 2VZ3A 5A3IC 5JXAL 1MNUH 4JRWA 4OCXH 5ESQA 5KSBB 3UTQB 1X5GA 2VDQL 3PDOA 1ONQA 3MGAA 2DWEB 1BP3B 1YJDH 3STBA 3E6FA 3Q3GB 5E00A 3BWAB 2O5ZL 2ITCA 4HCRA 2YEZA 5BJTA 3KR3L 2NY1B 1C16B 3UJTL 5IESH 1IAIL 5E2UL 3DX7A 1MFAL 4KI1A 5IB1A 4N1CA 2GITA 4JO2H 4OKDA 4NCDA 4S0SD 1YPZB 3ZYZA 4QOKA 4CAGA 3SGDH 2FNBA 4DKEL 1A6AB 1G0DA 3NCEB 1RZGB 4X4ZA 1KEGH 5ALCH 4R7DB 1GOFA 2GTWA 4BSWA 5HYSB 5EBWB 4W6YB 3U7WH 1KT2B 3Q6FB 4PRDA 1QPPA 1IFHH 4N9OB 4PREB 4JAMB 1X5AA 1RUQH 2MSPA 1WTGT 2H9GA 2BC4B 1T3FA 5LKNA 2YD8A 4KHXH 5EIVA 5C0FA 2WV3A 5JDSB 6CGTA 3MYJB 3DROA 3QA3B 1QSEB 3QEHB 1PJ9A 2KL6A 1TETL 5T5FH 2X1PA 5DHVB 3SDXE 2HJLA 1ZANH 3B6SA 2R56L 1CTNA 2X42A 4LIQH 1IZKA 1J05A 4XZUA 4Y1AE 4MB4A 2I07A 3VXUE 4MNGB 5E8EB 2HTLD 2Y25A 3LQAL 4LGSB 3BP7B 2VL5A 1MLCA 3OX8A 3T8XA 2XZCL 4L3EE 2QKIB 1OWRM 1LP9E 2OXGA 4NC2B 1DBBH 2E9WA 3ZKMC 5EBLB 5A2FA 1UVQB 3UPCA 1FG2A 2DAVA 3DPBA 2XACC 2YC1B 1U8MB 4RGMB 5FHAL 4HUWB 1I9EA 3STZB 5EU5B 4WGVB 5H94A 3LRHA 1KEMH 1UB6B 1FAIH 2XKUA 4KDTA 5CUSH 1XH3A 3PE9A 5CD5D 5JXEA 5EOTB 3AMKA 1UB5B 1VB9A 2E7BA 5M7QA 1RUKH 1D5XB 4UU9A 4EVNA 1CFQA 4F15C 2GFBA 1F58L 1XGUB 1EO8H 5INDB 4IRSD 4XCCL 4OUUB 3L3GA 3EKCA 3EO9H 3NAAL 3NZHH 4ZOCA 1SHMA 2X9XA 3DETD 2A0LC 1ZAGA 1VFAA 3LV3A 5DJYA 3JUZA 5I17A 4WHDA 4L29B 1JGUH 1F6LL 4PJGA 3U7YL 4OCSH 3WO3B 3LQMA 5I71C 4CMHC 1CDHA 4CDGC 3PP3K 3AMLA 3T2QA 4D9QD 4IIQC 3D18B 5CD3A 4ODTL 2GJ6D 5HHQB 2A1WL 3P4LA 3ZKXC 4KJWC 3NA4A 4IRSB 1BEYH 4WU7B 1GZPB 3F5WB 3IXAB 3VW3H 3ULUL 3NVQA 4HC1H 4Y4HC 4OF7A 1CQKA 4JFDD 3LVEA 1JYWA 1GGCH 4LOUC 4WFFE 3IDYC 1IL1B 1INQA 1OW0A 1FZJB 2AJZB 4ORZC 2FB4H 3CCHA 1T0NB 4K55A 1UYWH 4KROD 4PGJA 1HXYB 1G9EA 4IRJC 1RZ8B 5IQ9B 3GMNB 1FGVL 3MLYL 5FO7A 4GRLA 1D5BA 1FYTD 5JPMA 4J6RL 4JGMA 5F1NB 2E6QA 4XVJL 1EXUA 1RZKL 2XIDA 3QWRA 35C8H 3MACH 4HIIA 2H32A 3FT3B 1YNTA 4MMXC 3WNMA 1U36A 1R3JA 3TPKA 4ERSL 3QFDB 1JBJA 3FOMA 1OTTC 3A6CL 5CBEA 1VPOL 3G04B 5CLTA 3LSOA 3VXOA 1V3KA 4JFDB 1QHOA 4M7KH 4AT6B 1RZJC 3KDMB 2Y5TB 3QH3B 4NSKB 1OGTA 3KXFD 2HP4A 1FAKT 1I9IH 4GBXA 4I4WB 1RJYA 4U1IB 4KROB 3TLRA 1CGWA 4M1GL 2OL3A 4MAUH 1BD2D 2LTQB 4U7KA 3TT1L 1CXKA 1P5UA 3HE7B 2X09A 2OS7A 1FYTB 5GHWH 4MQTB 3UXFA 5TE4H 1QR1A 5E1HB 5J6HB 3JWDL 5DMYA 1X5FA 3SKMB 2X40A 5DUBA 3BDYH 4G5ZH 4FQJL 3V0AC 2X4TB 4NKIL 5D7SH 3ET9F 1G9NH 2F5AH 3L7EB 4RMWA 1QPXA 4R4BA 4KZDH 4KTYA 1GCFA 3HKFA 4LSQL 5FGCE 3HI5H 3PL6D 3U83A 1MFCL 5ADPL 5AWNL 1AR1C 1HCVA 3WD5H 1MOEA 3HPLB 4JFFD 1WWAX 2AV1B 4Y2DC 4BJLA 4EZMA 3KXFB 5E0QA 1AJ7H 4QNPE 4W68A 1BD2B 4EI5C 3VWKA 1GC1C 5EB9A 1HN1A 2P5ED 1ZEAL 1B3JA 3KYNB 3NCBB 1MCDA 5C0DB 3MFGB 3CFDA 3MX0A 5AAMA 1BGXH 2WQRA 4NQXB 4R7NA 4LU5L 2F15A 1NGZB 43CAB 3M17A 2HJFA 3ZTNH 5JA9A 2MCPL 1BM3L 4XHJC 4XVSH 3QDGA 1T5WB 3IDJA 1A6ZB 4MA8H 2EZ0D 3PL6B 2CUHA 3GSUB 5F9JB 3GSNA 2GK0B 1YEDA 1OP3K 1QTYT 2XWJA 4PJEE 4JVWA 2NY3B 4P5MB 4ACPA 5ACZB 4JFFB 1A6WH 3MBED 4UDTB 3KPPA 1N5YL 3G6JA 1D5IH 1FJ1B 3DOSA 2LE9A 4F7CB 3WFZA 5DRZA 2BCKA 2ZPKL 3GKZA 3OMZA 5AAWA 4CBPA 1WZ1L 1BBDL 1YY9D 2AJXL 2P5EB 4BZ1L 1A02N 2OL3L 4Z7VA 2YD1A 2EDJA 3DO7A 3KPRA 1CICD 5KSAD 2JK5A 5HVHB 2RR3A 3BMWA 4LASH 3DRQB 4L8DA 4QRQA 1LO2H 2C1PA 4MXWH 4XPFH 5GGUB 1ROWA 3GSRA 4GKNB 3ZMRA 5F1SA 4NZRL 15C8L 4PBVC 2XWBB 5HI3D 4XPGH 4PIRF 4YHOL 2MQ0A 2NY5L 5I66B 2XN9A 4FABL 3RWJA 5C7XH 5K9QI 4F7PB 4O02H 2VUOA 4HV8A 4UT9L 4PUBH 5IKCB 3QXUA 4HUXB 2JJTC 3MODH 3D2UA 1F11A 5GGTL 5AG9A 1J18A 2A6JA 4U1SA 4HUMB 4WW2A 3TWCH 1CICB 5KSAB 4PJAB 5JNYB 5IMLA 1KJ2A 2W9LA 5FKPA 3BPOB 4NKQB 3BX7C 2HFGH 4K94H 4XMLH 2BNRD 1TMCB 2YK1L 3JWOC 1TJHH 3MRFB 4WEBL 4IS6B 4X6CF 2J8HA 3K1DA 4DQOH 3CSPA 2VR9A 3RRQA 3S7GA 4OUOA 2ITDA 4JQVC 2Z31A 3QT2A 2FEDC 3L5IA 2C4FU 2WINB 5IVZA 5I1AA 5IF0B 4KTDL 4YEFA 1MHCB 1PKQA 1H8OA 1CLYL 4K23L 3MJ8B 3MLVL 5TJWK 1MF2H 4JZJB 4YIQA 3O2DL 5HHOD 3ZE1F 1QRND 3ARWA 5T3ZE 4WU5A 3DX6A 4F7TB 1ZHBA 3HI6L 2I25N 3WN5A 1RK0B 4M61A 4X98A 2BSTA 4NKDA 3O8XA 1JI1A 1FSKC 5FYLD 3T3ME 4LSSL 5F7NC 2BNRB 3QWQB 5KSVB 5I73B 2FO1A 4PJXA 4P2CG 1ZHNB 4NQEA 5I1IL 2C5DC 5FYJH 4IJ3B 3EOTL 4NZTH 2GUOB 3HPJB 4GKSA 1XGRA 4BQ6A 4H0GA 2KDGA 5CEXA 4ZTOH 4BK5A 4OGYH 1FH5H 2DMCA 5EA0L 1FL3A 3MV7D 3JTTA 1OAXL 3ARFA 3QIUA 2H1PH 4ZXBB 4O51A 4U3XA 2XA8L 32C2B 1GC1L 3DVIA 3HMWL 4Z7NE 2Q86B 2Z93A 5J06A 3MXVH 5JHLL 1LHZA 4MJ2A 3C5JB 4OKVB 2VZSA 3BSZL 1JP5A 1T5XB 3C8KB 3HRZA 5EO9A 5GJSL 1VA9A 4ZUWB 3PQYE 5A1AA 4JPWL 1WF5A 4KK6C 3O0RL 5F8QC 4WUUA 2XRAL 4HHAA 1WEJL 3CLFH 4K3EL 3OL2A 1W0VA 4NNXB 3HG1E 4YHPA 2HFFA 4OZFA 3RIAF 5F6HJ 1IMHC 3MR9A 5I1CL 1F90H 1R3KA 1NMAL 2O5YH 4KKNA 2OZ4A 3TT3L 3MV7B 4LGRB 4OGXH 5D1ZA 3SE9H 2IBBA 4HKZA 3ARBD 3UTSE 4W4OC 4ZPVA 5JA8B 3A0OA 3T1WA 1OAKL 2O5XL 1NCBL 3VXNB 5L7XL 3ARDA 3BPCA 4ZNEA 4K71B 1NFIB 3S4SG 1O7SA 4NZUH 3RVXC 3MA7A 4C83B 1AD9A 3BKJH 4K3DH 5BW7C 3WV0A 3Q48A 5A2KH 1LD9A 5E94A 1WWCA 2GSGA 4M03A 3BDBA 3PHQB 1MFNA 1Z6JT 4RMRA 5FK9A 1XF4B 1Z9OA 1CK0L 5I1EL 1UM4L 4FZ8L 2MPAH 4FZEL 1YYML 1RPQA 2DLFH 4OFKA 5E5UB 3ARBB 4EXKA 3T04D 3U0TB 4AEHH 5DFVD 4K9EH 5JOFA 4Z0BL 2QSCL 4G6JL 4DAGL 2HMID 4ZTPH 3NIGF 4NN5C 3N1MC 3NABL 8FABB 1A5FH 2AVGA 2VE6A 3TFKC 1PG7L 5EOCJ 1YNLH 4P3WA 3OG6B 4P46A 1S8DA 1E4KA 3NACH 3AM8C 1KIRB 3R06B 3DUHA 2APTA 4LL9A 5I75B 3OKNA 4F9LC 1KJMA 3A6BL 4XNUH 5CP3A 5I6XB 2OZ4L 1ED3A 1YEJH 2O61B 5FFLA 3W9EB 3BHBB 1PQZB 1TVBB 2KH2B 5E8PB 4ODSL 1FRGH 4FXLA 5EULV 5CJQL 3DTXB 1UZ6E 1MCWW 1CD8A 1IEAB 1DL7H 2R8SL 1WV7T 5HY9B 4BH8A 3HZMB 5I1GL 1A4JA 2J7LA 4JN1H 3MCG1 3KYKH 3KPSD 1NQBA 1GOHA 4S1DC 3ETBF 4JRYE 4M48L 4DVBB 5DI8B 1JPGA 3TBYA 2Y4SA 1WZKA 3MLRH 1JF5A 1JV5B 3K74B 4ODVH 4WY7H 4XCYB 2IALB 2ZOLA 4X9GA 1IKNA 3HC3L 5CKAA 4H20L 4QRUB 1ZTXL 5FAAA 3IDIA 1P6AB 1NEZG 2PO6D 1FORH 5GS0L 1T04B 3AVEA 1QQDB 3GHBL 2OQJB 5D9SA 3WNKA 4U0QB 2RHEA 4CGTA 1NUDA 4MNQA 3QBTB 1K3IA 5FUCE 1Y0LB 4Z8FL 2BY3A 2AAVA 3F7PC 4H88L 1QVOB 2PW2A 3EO1A 3KNBA 2DQEL 3QNZB 4MYWB 2ZUQC 3W0WD 1OAQL 4K7PL 1F2QA 1V7MH 4L5FL 4LCUB 3M45A 5T1LD 2NTFB 2D4FA 1DLHB 2YPKB 4GSDH 1G7LA 3FFCA 4X9IA 1YY8B 5JZ7C 3D5OF 4XPBL 5HHNB 3TO4D 5AZ2L 1EVTC 4MJ6A 4Y4FC 5TQ2L 4XP4L 2PO6B 2GIYA 3RWDA 4OZGE 5JPNA 2AK1L 2P4AB 3MCKB 2DQDH 1ZV5A 1WITA 5EZLB 3V6OC 4XCEB 5IEHA 1NSNH 1ZHKA 4WVRA 3NGBC 1ZGLP 5EZJA 4RIRA 3W0WB 2HG5A 4YFEA 5T1LB 3AFLA 5EOQH 1DBMH 3MCLH 1KYOJ 5K9JH 3EYQD 4WV1B 3QXTA 3IFLL 2K1MA 1EMTH 2AI0H 3P9LB 4I18C 2IF7A 3L3DA 2OTUA 4LQFL 2VXSL 4QF1A 5D6DC 2P5WD 4G3YL 2UY7A 5C0CA 2RFXB 4IHOA 3F62A 5HVWA 5T3XL 1J1XH 3MGOA 3SY0B 4GAYB 5IBLC 4DZBB 5J12C 3VI4E 4TVPL 3ARPA 4PJ7F 3S34L 2J8OA 4PJCF 2PYED 1R3LA 4CDHA 5F7EH 4Q0XH 1F45A 5F7HA 2OP4H 4XPTL 1MHHB 3QDAA 2WBWB 2OYPA 3DV4A 3UTTD 1U3HA 1KN2L 5F88B 5SWZA 5C0BD 4D0DB 4JFXA 1TNNA 3T0EB 1R6VA 1ORQB 1RIVL 3HS0B 1AHWB 1NCAH 2V17H 4LDEB 1UA6H 5DZNA 5BQ7A 3WL9B 2P5WB 4PRIA 4S1SH 3TO2B 1T83C 4LSVL 3HN3A 2R1WA 5BS0E 2AJSL 3EDDA 2FX9L 4QRSB 1CIDA 1Z5LA 2NXZC 5F3HA 5IK3B 5CGYD 4OTXL 3ELAT 2D3VA 1PSKL 3O3BA 5ERWB 2FX8H 3AB0B 2EDEA 5ISZD 2PYEB 4LEXL 4YR6A 2ZCKH 2GTZA 2I60L 3RWHA 1HOCB 2QQLH 5E08L 4YDJB 5E6IC 3UTTB 1A7NH 5KVGL 2H8PA 5C0BB 1UJ3B 5KJRL 2XI9A 3LPFA 5IBTL 4JANA 3VG9B 1BLNA 5LWYL 4G6KL 4X99A 1MCWM 3KPNA 3BQUA 4PLKC 4XB7A 4JCLA 3W39B 3BP4A 4RAUB 5ESVB 1MNUL 5DQJA 4F57L 3RWGA 4RX4D 3TIEB 4OCXL 3NFSH 2YOCA 3IU3B 4PRPE 2OR9H 1YJDL 4OZHA 4MNHA 2FHCA 5JLZA 4NIKB 1SEBA 2I9TA 1T7YA 3LD8B 3ECBA 1A47A 2BP3A 3FTGB 5IESL 4G80A 2EO1A 4PGBA 3X13B 1J8HD 3PDGA 4JO2L 3I02B 5IB5B 2Y36H 2DWDB 1U8KA 2MQ3A 1ZLWH 1J88A 4QHNA 4X4ME 4I0KA 4HIHB 1NUGA 1BZ7B 1KEGL 2OJEA 3SKUD 1Y18B 3OR6A 2NY0D 4U6VL 1YA5A 3BE1H 3U7WL 4ENED 3MNVA 4Z5RB 5L2JA 2DIJA 5BZDB 3S4SA 1RUQL 5ALBH 3CNKA 3DUSB 3ARGA 3GHEH 4KHXL 2Y5EA 2IPKB 4JFHE 2CO7B 3UYRL 1G7JA 5JW5B 1EHLH 1Q9LB 1WFUA 4TSCH 3PXJA 1J8HB 2GY7B 3CSYA 5T5FL 3QSKB 1MIMH 4Y8AA 1ZANL 2NW2B 2XV6B 1ZE3C 5L2KD 2OI9B 4LIQL 4CRPA 1L4IA 3C09B 2YXMA 1F42A 2WLZA 3QUYC 1MCBA 4QHKI 5F1KC 4M7LH 2WSKA 1UXWA 4HBQA 5EIIA 2CKBH 3V6FA 5EFIB 1U3ZA 4HC1A 2X89D 3CDFA 5AG8A 5CHNA 4P9HC 1DBBL 1L0QA 4BZYA 1V05A 1ZSDB 5D7IB 4F33A 2UZIH 1G7PB 1T0PB 3HZYA 5DD1H 1JWUB 3WDIA 5CP7A 4NJAL 1A7OL 4HAFA 3LKSB 4U1KA 5L2KB 3DX8A 4TTGA 5HGAA 3WHE0 1KEML 4X7CC 5HI5D 1FAIL 3IGAB 1T20B 5FUZL 5CUSL 1U93B 3LIZH 4LVHB 2D7OA 4HKBB 1P4BH 1OP5H 5ID1B 4V1DA 1MCHA 5IVXE 2BSSB 2DN7A 1RUKL 3U0PB 2ICWI 2X44D 2F9BT 3RIFF 1KLUA 5I1HH 1QSEE 3V8OA 3GI8H 3EOBA 3EO9L 2X4OB 4LCWB 1KFAH 1BHGA 3NZHL 2APWA 4UDUB 1NEZA 2WIMA 1U8LB 4K8RD 3SDCD 4MNGE 5JIPA 3L9RB 3OWEA 4H8WH 3RUGA 3ULUF 4OCSL 2V2TB 4MLIA 3W5MA 3UPRB 5KOMC 4DOHE 2WNGA 1A9EA 5EO1B 2BHUA 4LBEA 3QWOA 5FYKL 1A3LH 2CIIA 1ORSB 1BEYL 5IJVB 3OXSB 1FL6B 1NLBH 3VW3L 4HC1L 1WGOA 2BNQD 5ANMB 3V6ZA 2GCYA 3MLWL 4J1UB 4QRPA 4TUOB 1HI6A 5DJAB 4PJ5A 1YUHB 1IAKB 2VZUA 3P4NA 2CSPA 2YMXH 4E0RA 1I1CA 1NFDF 1RJLB 3SDCB 4OZ4A 4E9LA 2FB4L 1UYWL 1ZLUK 4UBDC 3D9AH 4P2OC 1IGFH 5A3ID 3QNXA 4QXTA 1MJUH 4P2QD 3B9KC 2FJFB 3SDDC 2GW5A 3VGGA 35C8L 1FZMA 3QQ9C 4UQ3B 4M93B 4NCC1 4G8GA 4L4VD 1SVZA 3ULUD 3DGGB 1Q9WA 4DGYH 4JDZB 1MHPH 4QHUB 2BNQB 1MIEL 3MJ9L 1AXSB 4AIZA 4M7KL 3B3IA 3QFJA 5IW1B 2DBLH 4AEEA 1HKLH 4QRTB 3MQIA 5DS8A 1I9IL 3R4DA 3V0VA 2JCCB 4MAUL 1FIGH 2IMMA 3X3FH 3EO0B 1XIWA 3IDMB 5GHWL 4QYOA 4P2QB 5TE4L 5IROA 1GGTA 2H45A 4OIIL 5CBAA 2R23B 3NN8A 1QFWM 5FF6B 3U0WL 4NO0D 4KRLB 3BDYL 4G5ZL 5D7SL 1ND0A 1G9NL 1A3QA 4L4VB 5FDWA 4JPIB 2F5AL 4LLAA 3VFTB 4KZDL 4P9HL 3HB3C 2EXYC 3BEVB 4X6DB 3BP5A 4JB9L 4JQXC 1LO5B 3T0WA 3WD5L 3SCMA 3VFSA 5DTFA 5EPMA 4YC2C 1H5BA 3RVUD 3X14A 1AJ7L 1BX2A 5DVMA 2GAZA 1TITA 1JPFB 2A73B 5CS7A 3U4EA 4H5SA 1TJIL 4G7YH 3NZ8B 2BHYA 3DYOA 5L0QC 4EDXA 3IETB 1BGXL 2DQGH 5F1OB 1NFDB 4KPHH 4JHWH 5KG9B 3VCLB 5IHLB 2R0KL 5CMAB 3ZTNL 3IVKB 4J3XA 3HUJF 4MA8L 3PP4H 2QADC 4S0TD 3U4BL 4FXKA 1Q94B 1A6WL 4FQHB 2JJUA 2DRUA 1D5IL 4MZ2A 4YK4C 2CDEA 3RI5F 2V9TA 3MYZA 4JFED 3GIVA 1KF9B 1IC5H 2F53E 1ZHLB 6FABH 4TULL 4GW4A 1NCNA 4U6YB 5IBUB 1WBZB 4WFGE 3O11B 3O41A 2J8UA 5IT2H 3AS1A 3WJLA 4XAKD 1WZLA 4LASL 4LSRL 1LO2L 4NO5A 1HXMA 5FGBC 1EDQA 3EBAA 1DQMH 3DECA 4MXWL 4XPFL 3SGKC 5KS9A 4O2EB 1BIIB 1NKRA 4HMDA 4XNYH 4XPGL 4HFWB 4LNRA 4Y19A 1IGYA 1FQ9C 4XPHH 4O02L 2NW3A 4YWGH 1JYVA 1MQ8A 1NGYA 4KKLC 4JFEB 4PUBL 3D85D 3D87B 3EAKA 4X7FC 4XBGA 3MJ7A 1NBVL 4UNVA 1JGDB 5IV2A 1CFSA 4YGVB 4ZNCD 3MODL 3VFOB 4N90D 1B0WA 4J3UA 4OSUH 3PIQA 1OY3B 1DZBA 5EUOA 3BKMH 4IM8A 2MWCA 3EJJX 1G0XA 4JFPA 3RAJH 4LKXB 4F15B 3I6LD 1QFHA 2HFGL 4XMLL 1T4KB 4KJWD 1SYVA 4R4NC 4JFQB 1TJHL 3VMPA 1IGTB 4Y4HD 1BVLA 4DQOL 3QXDA 1CZ8H 1INDL 2AP2A 1H8SA 4MXQC 4D0BA 4R90H 5HDQL 1HHKB 4Z7VF 5GGRA 5I9QC 4WENB 3MLPA 4LP4A 2VB5A 3EYOA 4CMMB 3BP6B 4XT1C 1P7KA 1GIGH 1YEGH 3D85B 3EOAB 1MF2L 1J11A 5TGBA 5DK2B 4N8PA 5I71B 4CMHB 1U91B 4KH2A 3VWKD 1RUMH 2ZG2A 4D9RE 4IIQB 3RVWC 2SEBA 1FO0H 1CG9B 3BIKB 1VDGA 5DRNB 4HZLB 3FAWA 3VRLE 4CU7A 2YA0A 1JF1A 3ZKXB 4E41E 3QEUA 3NIFE 3TNMB 2Y7QB 4DKFH 3H9YA 4Y4HB 4WFED 4NZTL 2ZKHH 3IT8D 3MLUH 5DHYA 4HWBA 4ZTOL 4OGYL 1XR9A 1FH5L 2YWZA 4OLZH 4XTRC 2JJWA 4WW2F 1G9MH 4IRJB 3VXPA 3OJVC 1BWWA 1QSFE 3QEGL 2G60H 4P4KC 3EIFA 3RWFA 3MXVL 3RL1B 2ED7A 3KPMA 4M62H 4ZUUB 3WUWB 1CVRA 2VQ1B 4MDJA 4JRXD 4PJ8A 4P59H 3WFBH 5IR1B 4QTHB 4OD3H 3FHAA 3OAUH 1F4WH 2BRRL 2XY2A 4XVUC 1AR1D 2VISB 4LCIH 2WBJD 5L9DL 3F12A 4Y2DD 4O2CA 1F6AA 3VRJB 2O5YL 4LCYA 4CL7A 1HYRC 3PJSA 1M05B 4WJ5B 4IDJL 4OGXL 3DMMA 1I3GH 1V3MA 3IXTA 4MXVF 3SE9L 4EI5D 4FTVD 2W1NA 3RFZC 1WIOA 4LPTA 3N06B 1HHIA 2XYCA 1JPST 3CU7A 4PJXF 4L9DA 4LPVA 1F6FB 1AGDB 5D96C 4ONOA 3RWEB 3RA7H 2E27L 3QIBC 3TH4T 3JVGC 4OFPA 4JRXB 1KGCD 5F9AC 3L7FA 4NZUL 4FFWC 3RX5A 3BKJL 4Q2ZA 4PG2A 2WBJB 4NUJB 4D2NA 3VA6A 1H0DA 4LEOB 2EICA 3SKNB 4Y2DB 2ZJSH 4M6ML 2Z35A 3T4AB 1CVSC 2VITA 2P46B 4L3CB 4L9LA 2BOCB 1JRHI 2JIXD 2MPAL 4JLRA 4EI5B 4FTVB 1WWBX 3HLAA 1H3GA 1DUZA 5F97E 5HGHA 3WLWC 4AEHL 3BXNB 1IEBA 4Z7UE 2QBWA 5FOBA 2IGFH 5MERA 4JG0H 2VLRE 2IBGA 4ZTPL 2F5BL 3MRMA 1A5FL 2C7UA 1FL5B 1FFNA 2W60A 3HC4H 5E9DD 1YNLL 3MNWB 1UZ8B 2X4NA 4GBXC 3UMTA 2VDRH 4E42A 1XF3B 2ZCLH 1T21A 2DQJH 1WUNT 2JTDA 4I5BA 4XNUL 4RMVA 1S9YB 2GJZA 5DMKB 1YEJL 2BVQA 2JIXB 3H3PH 4G6AC 2IANE 1FRGL 1NGWB 3GJFB 1E27A 5F7DA 1DL7L 2FHBA 1TZGH 5FCSH 4MA1C 2AJ3B 4JN1L 2Q7NA 3KYKL 5T5NG 2IBZX 4BFIA 1MCQA 2W9EH 4Y4KC 3Q5OA 4WUUD 1CQYA 4ODVL 2R4SH 4WY7L 4QRRD 2BSRA 2AEPH 2FEDD 2DL9A 3ZKNC 1FIEA 1FORL 4GRWB 3LQZA 2B4CH 3LKRB 3SPVB 5MEQB 4JQIL 4PRAB 1CDGA 3HA0A 4X0KB 1N5AB 2RCSH 5CGMA 2HYMA 1E28B 4X6BB 5KVEH 1JTOA 2BZDA 3P4MA 4PJDA 4I9WD 4ESKA 3KPQA 4KFZC 2ZSVA 1NBQA 1T0MA 4DKAA 3K46A 5DJXA 3TBWB 1QYGH 2F8OA 3JV0A 3LEXA 4GSDL 5DHVH 4QRRB 2CJUL 5FA3B 2Y23A 1K8DB 4OT1H 4HJJH 1NBYB 4ODUB 3B9EA 5GZNC 1WT5C 4HH9B 4MVBC 3V5DB 3BRGC 3WS6C 4ZDHA 4LK4A 4GRMB 1XMWA 2P8LB 1X5ZA 5CINH 1NSNL 1ZVYA 3WKMH 3ALPA 4KU1A 1KLGB 1FSKB 4OZIF 4HWEH 4KK6D 2FJGA 1DBML 3CPLB 1UJTA 3MCLL 5K9JL 5BVJA 5J1SC 2EYRA 3BH9A 4GLRI 4P46D 1EMTL 2AI0L 5HJ3A 3RVVC 2IQ9H 4ISVB 3MXWH 2RIKA 4S2SB 1AP2B 1FHGA 3DUUB 1DQJA 1JIBA 1C7SA 1U95A 3BZEA 4J4PA 5CEYB 1J1XL 3TBVA 1FFOA 1Q38A 4NKMB 2UWEF 2APBA 3MLTB 3R0MA 5DJDA 1NUFA 1AO7A 3MFFB 4HLZH 1BQHB 1Z0MA 3RVXD 3B83A 3MREA 4N0FA 3HNVH 2VDPH 1MUJB 4Q0XL 2OP4L 4HT1H 4PJIA 2HFEB 2UVFA 4KUCF 3CMOH 2JELL 3H9HB 3MV9E 2JJVA 4JZNB 1UA6L 2EDLA 3OJDA 3QEQB 4HBCH 4S1SL 2X9WA 3LKQA 5T3XD 5H35B 5AD0A 2FRGP 2Z91B 4HMCA 3QULB 2EYTA 1U8QA 1Q72H 1X9QA 1XR8B 2FX8L 3UTZA 5DR5H 4XXCC 3VXSA 3TFKD 2IPUG 4CVWA 1OTUC 5GSVB 4LLVA 2ZCKL 5CILL 4BH7A 1Z9MA 2QQLL 2NTSP 1A7NL 2BFVL 1M6OB 2EECA 3F58H 4ZFOA 4XCFL 4Q9QH 2R15A 5IOPB 4OF6A 4OZIB 4HDIB 4ZS6C 4PTTB 2Y6SD 2AQ1A 2WWKO 1BFOB 3FZUC 2I27N 3TCLA 3E2HC 4HK0B 4KGJA 5DRXB 4U33A 4EOWH 4P5KA 4KUCD 4FP8H 2OR9L 4LLUB 2IFFH 3UCRA 1CFVH 1U8JB 1HSBA 3QUZD 4NN5B 3NOIA 2AW2A 4S1DD 3T0EE 4NT6A 1MJ8H 3BVNA 3OB0H 4Q58C 1OM3H 2EIDA 2VAAA 4H26A 4QY8B 3VRIB 3D69B 1C08A 3D0LA 4MAYD 3C5ZC 4I2XB 5HPMA 3CZFA 2UWEB 5D1ZC 2Y36L 1LEGA 4KK9C 4PJBF 3T1FB 3DHMA 3TYFA 3REVA 1RI8A 1HNGA 3O9WC 4UIKH 3WFEH 3ARDC 3G6AB 5IMOB 1EEZB 2LAGB 4ELKB 3ILPA 3GSXB 3BE1L 3MNZA 3U9PH 1I8LA 4KKAD 4F58H 3VD7A 5T1MB 5ALBL 3L3JA 1A1NB 4GG6F 5JHDD 4H1LB 2FCBA 5EU6D 2PW1B 5C8JA 3MGTB 1HEZA 4MAYB 5JZ7D 1ZA3B 3BUYB 3ORJA 1LEKA 1CFTA 3L3HA 1U3HD 4Z78A 1LVEA 2XZZA 5DZOA 3GSOB 4JREC 1I4FB 2CKBL 3QDME 4XCNA 5C08D 2ZUQB 3GSWB 3CDGB 3PQYA 1EVUA 1DQTA 5JHDB 1A2YB 5EG6C 4CADB 3QHZH 5EU6B 5DEGB 3S96B 1NBZB 4TNVK 2UZIL 3FQXB 1X7QB 4LLQA 4PJFF 5DD1L 3FQRA 1P53A 1G7MB 5BRZD 4MHHI 4Y4FB 1I7TB 2ZUUA 1K5NB 1KB9J 1XGTB 4WTZG 4GT7A 3LIZL 4Z76B 4C56D 2VDMH 1P4BL 1OGAD 3IKCA 3LKOA 2OK0H 2AXHA 5C9JB 3GJEB 4DZ8A 2VO5A 1YMMD 3QRFM 3PWNA 1HKFA 5IBLD 3NGBB 5C08B 5T3ZL 3GMOB 4K07A 5I1HL 2XNAA 1D6VH 1XEDA 1MRCH 3P73A 3GI8L 3HMXH 3H8NA 1I9RH 1Q0XH 1KFAL 4GKZB 5HYJA 3VFUA 3C2SA 4X5XB 4LLMB 3H2WA 5BRZB 4CNIB 1CLCA 4I18B 3O3DB 4ZO9A 5GRWA 4H8WL 4JN2A 3V8CA 5LGJB 4GG6B 3VI3F 1KPVB 4NM4H 2P45B 1B0RB 4HS3A 2CIKB 2H2PC 2P49B 4I3GA 1KV3A 1OGAB 1LDPH 3ULVE 3PWJB 1YMMB 4WFHD 3ARYA 2NXZD 3ZT5A 4HXBL 5J12B 3QUKA 1GOGA 1WLHA 4TNWK 5E2TH 1NLBL 5B39G 5FKAA 2UYLA 3LH2H 1EGJH 3VFNB 2ZUYA 5E6ID 1HNFA 1T66D 4L4TA 5EC2B 5C0RH 5F7KC 4LMQE 4U1MB 2AXGB 1AXIB 4P2RE 4RA3A 2YN3A 5C0GB 1IGFL 4PLKD 4JPVH 2UV3A 1G7QA 3D25A 4EIGB 5C0JB 1EH9A 3ZTJH 1MJUL 4HUVB 3CUPA 2A9NH 4PJFB 4Z77A 1LWRA 4PY7A 2X4UB 4LCWE 4LLYA 4BSVA 2NXZB 2AK4A 5FYKD 3DI2B 4P48A 3RDTA 2IAMD 5DUPH 4L8SA 3KYOB 4DGYL 4WUKL 3FB7A 1C5CH 1MHPL 4U49A 1FCCA 3DX9B 1QLFA 3OXRA 1C7TA 2DBLL 5E6IB 1NAMA 5JOPE 4LFHG 2HT2C 2WMPA 3CZJA 3RTQC 5JMRA 2F74B 3CMGA 2YRPA 4MJIA 3S98A 1FIGL 2R9HC 4ZSOA 5I1LB 2XTJE 3X12B 3TESA 2EC9U 5SV4A 2RAMA 4JY6B 5FYLH 3T4YB 5I1JL 2NX5B 4M8QA 1BZ9A 5D2NA 4YDVA 1C12A 4XRCA 2IAMB 3Q6GH 4QHLA 4CVXB 4LPUA 2AABH 3FFDA 4XH2B 4YX2L 3HE6C 1KTDB 1FNGA 2EDKA 4N0RA 1S3KL 5CWSB 3O6LH 2IH1A 4NRZA 2YWYA 3QDJA 5AZEH 2A77H 1J0HA 4UIMA 4LHQB 3CFEA 4YXHH 5TF1H 1VGKB 5J57B 2EDWA 4G7YL 4U05A 3MRJB 3FONB 3RY4A 1CGSH 3VXMA 2BVTA 5D6CA 2DQGL 3MRQB 1KELH 4KPHL 4JHWL 4GW1A 4P9MH 5D1XC 5DK3A 2NLJA 4HLZG 4B53A 5J9PA 1W0YT 1ZGLB 1U8PA 5A2LH 2DI9A 4CN1A 3VFWB 5DDHB 1ZLVK 3GMQB 4M7LT 3I85A 1ETZB 1JNHB 3EFFB 1RV6X 3GKWH 2FD6H 1IC5L 5CAYB 1QKZH 1IT9H 3BFOA 1ZXQA 4YFLI 3PABB 3I6KB 1N64H 3CVHB 3OGCB 5IT2L 1BF8A 4X6DE 2BY2A 3MUZ1 4U1HA 4QXGH 3K8LA 4XAWH 1UM6H 2PXYC 1U41A 3KPOA 5C0IB 1FLTX 4A6YB 4G8IB 1LEIA 3LHPH 4XNYL 3ZE2F 1W8OA 4QT5B 4KUZH 4ODWA 5EZOH 4XPHL 4MWFA 4YWGL 5C09E 1ULVA 2FH8A 3RHWF 3FHQA 1IAOA 1N7MH 5E5MB 5ICXB 3DVNB 1P1ZB 4N0UA 4OSUL 3RP1A 2BRQA 3BKML 1TIUA 3RAJL 1MFEH 1OP3H 4UUJB 5J4MA 3TVMD 4N1EA 1YEKH 3QQ4A 2DQTH 1A9BB 1T7VA 2GK2A 4U31A 1ZOXA 4N9GA 2FZ3B 2X4PA 1GGIH 3H42H 4TTDC 4WWKA 1QD0A 1MVUB 4MSWA 1SM3H 2G5BA 4R90L 1RURH 3MLZH 4NDMA 5JW4N 1G1CA 1I7ZA 4Y5XC 4CVZA 3W11C 1EERB 4Z7WE 1K2DB 3CFBB 3NIDE 5B3JF 1GIGL 2J8UF 5D7KE 4UBDD 1YEGL 4UI2A 1A1OB 4P2OD 3QIWC 1X5LA 2AS5M 2CDGB 1C5BH 2HLAA 3B9KD 3MUGA 5DJZB 1RUML 4XMKL 3SDDD 1DDHB 2P43B 1OLLA 1A6UH 3MRNA 4NQCE 4P2YA 3IF1B 1FO0L 5DJ0A 3AREC 5ESAB 3FT2B 3QQ9D 2R2EB 5IG7B 4NQVA 5HSFA 3TVMB 3B5TA 5M95B 5IJKC 2ERJC 4DKFL 5JW4M 3T77B 1MCOH 4D8PA 2ZKHL 1FNLA 1U2CA 3MLUL 4WHTB 3ES6B 2D0FA 3C5SB 3WIFA 2CRIA 4GAFB 4OLZL 4LSUH 1FCGA 4PJHA 5C6TH 2E6JA 3VFGL 3BH8A 3S5LG 4WTZA 5GGVY 2ARJB 4DUXA 4P2OB 3EZ8A 2G60L 2DJ4A 4PB9H 3ARZA 4GS7B 3B9KB 4M6NH 5JIIA 2QSTA 3SDDB 4TVSa 1EK3A 2XPGB 4M62L 5E2WH 2C1OA 1I7UB 3TNNB 3WNOA 1BJ1H 1MCJA 4PR5B 5ID0B 2D31A 2NPLX 3PGDA 4CKVX 2ZUVA 4WCYH 2VXQH 4AYFA 4OD3L 4ZAKD 3HB3D 1K8IA 3D3VB 3OAUL 1F4WL 2EXYD 5J8OA 3SJVE 1WBXB 5I8EA 3GSVB 1NJ9A 3VMNA 3T0XA 2QHRH 5D93C 4JVPA 1CD1B 3UTQA 5KSBA 3MOBH 2GY5A 1I3GL 5A16B 2DWEA 3G6DL 3Q3GA 3ZL4H 2CH8A 3BWAA 2VN7A 4MA3B 3PWVB 4ZD3H 1C16A 2M26A 4XNMB 4NBZB 4W81A 3P0GB 3RA7L 1A21A 4G6FB 1U8NB 4WO4A 4LARH 4ZAKB 1YPZA 2ESVD 1S7VB 3H9ZA 1ES0A 2BY1A 3I50H 1A6AA 1N0XH 1RZGA 3TH2T 3H3KA 4G9FB 2X1WL 3S3JA 4N5ED 4R7DA 3X11B 3HC0B 3VFVB 5D4QA 2WQ8A 1N8ZB 4ELME 1CL7H 2IQAB 2VDOH 5HYSA 5EBWA 4KKCC 1KT2A 3Q6FA 1FBIH 1QACA 1IC7H 4JAMA 2QQKH 4DK6A 1Z2KA 2UVEA 3D1MC 5L0QB 2BC4A 2CO6B 3OKEA 4BK4A 5L8KB 4F7EB 5D7LE 5JDSA 3MYJA 3QA3A 1QSEA 3SDXF 3B5HA 2VABB 4NYLB 2FLBT 3HC4L 5DHVA 4MMZC 2I9LB 4FQCH 1X5KA 2QADB 2VDRL 4PV9B 4TN9A 2ZCLL 4ODHH 2DQJL 1MREH 4R0LA 5ITBH 4YK4B 4KKLD 1XIWC 1I1AC 5E8EA 3BP7A 3M8OH 2NY4D 3ZTJG 1DBAH 1ONQB 2LVEA 3H3PL 5ABDE 2HLFC 5E00B 1LP9F 3U30C 4RMSA 4AEIL 2K7QA 3GNMH 1TZGL 5FYKU 3LMJH 5IB4B 5EBLA 4R4ND 1XGPB 1WFTA 2YC1A 3L3OB 2PYFB 4I48B 2W9EL 4HUWA 3SEPA 5CEZE 1EBPA 3STZA 2GITB 1N26A 3MRBB 4PRHE 1YQ2A 1YEEH 2R4SL 4JFZH 2AEPL 1UB6A 1QP1A 5GRYA 2CR6A 1RMFH 3U9UB 5EOTA 3CFCH 1UB5A 2B4CL 4PJ9C 1P2CB 2NY4B 1GGYA 1D5XA 3SKJH 4G7VH 3UBXA 2W92A 1XGUA 2RCSL 5INDA 1PZ5B 4OI7A 4Y1AD 3DXAB 1VESA 3VXUD 2H9GB 5KVEL 5JO5B 1R24B 1F4YH 1RZIB 3LB6C 3H7BB 4L3ED 5EORH 1NCWH 1E4JA 5TH2B 3AAZB 4I0PC 4L29A 1H3TA 5I9QB 4OT1L 2O93L 2FO4B 2B1AH 1U42A 3SDXB 3D18A 3QZWB 2F58H 1WK0A 1OSZA 1TLKA 4P4KD 5HHQA 4QXUH 3Q1SH 4TSAL 4IRSA 4WU7A 3UDWC 3X3GH 3RY6A 1GZPA 5CINL 3KJ4C 3ULSB 4Y1AB 3IXAA 1VEOA 3WKML 1ADQH 4IOFC 3VXUB 2ZZUT 4N8CH 1L7IL 3OKLB 2FH6A 4HWEL 3ULVH 1KN4H 2Q3ZA 2FJHB 5DC9B 4BFBD 1IL1A 4L3EB 1UH3A 1FZJA 4DW2H 3QDHA 2AJZA 1UQSB 5H8DA 5DD5H 1T0NA 1LP9B 4JM4L 2F8XC 4EBQH 4S1RL 4S10A 3GMNA 5ENWB 5IQ9A 1NCDL 4DN3L 2IQ9L 5E24E 4ZFFB 5F1NA 4IBLT 4KMLB 3EOYG 2FBJL 4PJDF 3I75B 5GRUH 5C3LD 5F7UA 3FT3A 2GJ6A 4P4KB 2AEQH 4DJMA 4EVNB 5KVMC 2YPVH 1BIHA 1IGCL 3G04A 2AV7B 1Q9OB 5J3HC 3QIBD 1QA9B 3L3GB 4JFDA 2YD9A 3KDMA 2Y5TA 4TSBL 3QH3A 4FQXC 4NSKA 5J56B 4FFWD 3NA9H 3HNVL 4KI5E 3H9SE 2LU4A 4HT1L 2Q6WB 2FSEB 1KIQB 5D70H 1WTLA 4ZMAT 3CMOL 1FYTA 5DT1H 3VDBA 3ARQA 1UEYA 2J5LC 5J6HA 4QCIB 3MRPB 4WFFD 2R2BB 5LQBH 3SKMA 4FQQB 1DVFC 3GM0A 3QNYB 3D39E 3WLWD 5JORB 3SE4C 3L7EA 3KAAA 4M8VA 2XZCH 4QWWC 5D96B 5EN2B 3VGFA 1PLGH 2NZ9C 3VGDA 1HINH 3QIBB 3NCYP 1TVHB 1CGYA 2ZNXA 2AV1A 5DVKA 3KPLB 5DR5L 3KXFA 4MZ3A 1INEH 2PN5A 4GH7B 2VLJE 4QNPF 2DM4A 1EV2E 4K8RH 3U2SB 1P7QD 3CCHB 1TCMA 1BD2A 1U2HA 3DSNA 2DTMH 3F58L 3L1OH 5FO7B 4Q9QL 3KYNA 3VGBA 1TTGA 5C0DA 3EHBC 1F4XH 3BIAX 4NQXA 1R3HB 3VWJC 4EKXA 3MLSH 1NGZA 43CAA 4AQOA 4FFVD 4EOWL 2G5RA 3L95B 4P49A 1R3JB 5SWSE 1T5WA 1A6ZA 4YPJA 3CGTA 4PJIF 3PL6A 3OGOE 4PJEF 2IFFL 3GSUA 4XCCH 1CFVL 5F9JA 1IEHA 3I6GA 3LSOB 5ACZA 3QAZC 4JFFA 2AEIT 5KVFH 4JFOB 4UDTA 5JOEA 4OJFH 1MJ8L 4Y4KD 1OM3L 1FJ1A 1OGTB 4LVOB 4GBXB 2YPLE 1IM9D 4F7CA 1P7QB 1KB9K 4LPWA 5HTSA 3ZKND 4M43H 2EE3A 4UV7H 3DMMC 3MLXH 2P5EA 3QEQE 4NWUL 4M00A 1DQQB 1NPUA 2CXKA 3DRQA 3WFEL 1W72L 3T65B 1P7HL 2A1WH 2W65A 2Z4QB 3U9PL 4HPOL 1BJ8A 4MA1B 4FOMA 1FN4B 2XWBA 5GRXG 3CJJA 4HJ0C 4P23C 5I66A 5DA4A 3T0AA 4F7PA 4Y4KB 2OTPA 5FGCB 1Q9KB 5IKCA 5D7JC 4ZPTB 3N1PC 3VFPB 1P9MC 1ZWIB 3RGVC 4GXUN 2QQNH 3V7AE 1PDKA 2Y1VA 1CICA