4U6HA

Vaccinia l1/m12b9-fab complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
219
structure length
217
Chain Sequence
b'QVQLQQSGAELVKTGASLRMSCKSSGYTFTRFWMHWIKQSPGQGLEWIGYINPSTGYTEYNQKFKDKATLTADRSSTTAYMQLISLTSGDSAVYYCARSDQTNYLFPYWGQGTLVTVSAAKTTAPSVYPLAPVCGTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy chain of murine anti-vaccinia L1 IgG2a antibody M12B9
publication title Potent neutralization of vaccinia virus by divergent murine antibodies targeting a common site of vulnerability in l1 protein.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Immune system
total genus 44
structure length 217
sequence length 219
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u6hA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u6hA02
3UTTB 1OTSC 2A6JB 5JIIA 4XNQA 3QUMB 1M7XA 1WFNA 3WKNA 3TO4C 3RZCC 4PRHA 5J0BA 1S8DB 5DVOA 4OCRL 5FHBL 3QQ9C 5IHUH 1JF1B 4AH2A 5I1KL 1VEPA 2I07B 3EDKA 3MZTA 2D9QB 2JF1A 4M1CD 3UJJL 4F57H 4GW4A 4UQ3B 5J6HA 3HZYB 3RX8A 5BVPL 4YHZL 1XF2B 3V6OA 2R15A 4DFHA 5TF0A 3O41B 5GGQL 2CK0H 4ZS7H 1NCBH 3C2AL 2XWJA 2AK4B 2YRPA 4OZGA 3QIBD 3U9UA 5CUSH 4NWUH 1EFXA 3F7PC 4L4VD 3RA7L 4GH7B 4Z7QE 4PJ5E 3U36A 1ETZB 1T1WA 1MLCA 3U4EA 4LCYB 2P42B 4PB0L 4KDWA 1MPAL 3S96A 1YEGL 4TSCH 5HDBE 3CSPA 3TBYB 1A4KB 3HPJA 2MFNA 3LKPB 3PGDB 2BVQA 2KL6A 1OB1A 1HSAA 3RVXD 3HKFA 1T6WA 3VG9B 4HKJA 4DKDC 3H2WA 2DQJL 3GO1H 1Y0LB 5FIEA 1SBSH 4WTZA 2BZDA 3PHQB 2B5IB 3UMTA 3VI3F 5ILTL 3QCVL 1NAKH 4XZUA 2HFGH 4H20L 1HI6B 3RIAF 4BZ1H 4EUPA 1MVUA 3H42H 1MIEL 3SHSA 4L3AA 3OPZH 4HBQA 2XPGB 1H3PH 2GIYA 1T80A 4D2NA 2P5EB 2ILLA 2DYPD 5GS2D 3CSGA 2YPLB 2C26A 2F54D 3IVKA 5D7IB 3MXVL 3MRPA 5C3LD 2PR4L 5HHOA 2Y7QB 4BM7A 5GGRA 5HVWA 5DQJA 3BKCL 5CP7A 1J8HA 5JLZB 4NQXB 1WITA 2OP4L 3PWPE 4NJAH 4LPTA 4RAVA 4X8JA 3RWCA 3F5WA 3DMMC 4HCRA 1SMAA 2QQQA 3EYVB 5DYOA 3TLRA 1BEYH 1MRFH 2BDNL 5FCSH 4OCNC 1KENL 3CFCL 5DJ0A 5TH2A 3QDAA 4I0CC 4OZFH 1RZJL 3EOTL 1ZVSA 3MJGX 4XMPH 4RWYL 1WAAA 2A83A 4YHPB 5EZLB 2DKSA 3STZB 1U8KA 4P99A 1PX4A 3MR9A 2DQEL 5GS1C 1PG7X 2VXQH 5IQ7H 3LN9A 5J6GA 4OCXH 4KUCD 3BIKB 5JDJA 1OL0A 4I13B 3WFEH 1N6VA 5EPMB 3QDMD 4KY1H 5KTEH 3NH7H 1QSFE 3GI8H 4P5TB 4CGTA 5JO5A 4JZOA 4P9HH 4NZDA 5EU3B 5C71A 3PQYA 1NCDH 3O0RH 3BKML 2YPVH 3WS3A 3U1SL 2MQCA 1UM6L 4MNGB 4S10A 1E4KC 2JJVA 1JGLH 4N9GB 1FFOB 2IBZX 3DECA 3CMOL 5E2TL 3BEVB 3MV11 4L3ED 3CXHJ 3ARGB 3F7YB 4BFIB 3FQXB 4U1LA 4ZFFA 2EYSB 2NW3B 4M7LT 4NN6B 3QNXA 1CLCA 4UIKH 2IG2H 5FA4A 1YMHB 5HHMD 1P7HL 15C8L 4LHJB 1CF8L 4L9DA 3QQNA 1NGQH 1BVKA 5DMKB 1RK1A 3C8HA 1F11A 1JWMA 4Z78A 3X17A 1MJ8L 1XCQB 5BS0A 3DROB 4LASH 3PWUA 2A0LC 4Z0XA 2DI9A 3CDGA 3GSVA 1FPTL 1WZMA 3NZHH 4F2MB 1RUQH 3SEPA 4ODTH 2FJHA 4DUXA 3O9WA 4LOUC 5IVXF 3SGEI 4NIKB 4DZ8A 5KSAB 2YD7A 4GT7A 3OB8A 1X5JA 3E0GA 2ZJSH 4CADA 5D72H 3VXRD 1OGTA 3QWQB 3ZKMD 4U3HA 4L8CB 4AG4L 5K59E 5I74B 4A6YH 3WIFA 3RGVB 4QTHA 4ZUWB 2HTLC 4HFUH 4FTVA 2Z4QA 1KB9K 3TPUA 2B4CH 1D5ZB 2EDWA 2CQVA 1IGCL 4OIIH 1U95B 2B2XL 4N5ED 3HRZB 4JAMA 3AXLA 5C0BE 4P5MA 1Q9WB 4XWGL 2ZUQC 3WJJC 1R3JA 1W72B 4QRTA 4QHMA 5F9WC 4TNWK 4PJHF 1CGXA 1VADA 5D7SL 3O3AB 1I9RL 1MCBA 1RURH 1P6FA 2VDML 3ZDXE 4IRZL 5C0JA 5HYFA 4I18A 3WSQH 5HTSA 1AGBA 3H7BB 4EBQH 1JZ6A 3TBTA 4LSPH 2EIBA 3MV9B 3D69B 1CDJA 5ESVA 4F37F 2HT4D 1INDL 3LD8B 3TO2A 5ACLA 4Y16A 5EO9A 1UACL 4QOKE 1KYOJ 1OF2A 5SWZE 1HHKA 2NX5B 1C5BH 1S7RA 4ELKA 1N0XH 4IMKC 5C08B 3NCFB 4XP9H 3DV6B 2MWCA 1W0YT 4GW5B 4BELD 3FQRB 1BBJB 5JXAH 2FGWL 3G5VB 1LNUA 2Z91A 1X5HA 1VCAA 1QZ1A 5DJ6B 3G5XA 1A6WH 1NAMA 3T2NL 3X11B 1JZ3A 3E6HB 2OXGA 1FL5B 2VLRB 3S36H 4WFEE 3WBDA 3UTQA 1EXUB 4P2QD 4JKPL 3KLDA 4X6DB 3SN6N 3GSUA 4PRIB 3DX6B 3ARBB 1DUZA 3H3BC 1J86A 5I16B 1DQLL 1ZSDB 1EO5A 3UYRH 3O3BB 5F7FA 5TDOA 3VG9C 1VEOA 1EPFA 1KG0B 5FECA 5FYKU 3P73B 4ORZC 2DQFA 3FT2A 5K93A 5C2BL 1R3HA 3HI5H 4ZPVA 2H32B 4NC0B 32C2B 5ESAB 3FB6B 5HHXH 1OP5H 1CCZA 3ZYZA 1UM4L 4IHOA 4X99A 3RUGF 1OPGL 4LSUH 3BP4B 1U2HA 2XA8L 3PIQA 4XX1E 4RMTA 4ZXBB 3TF7C 3RWJB 5ID1A 4OLXL 3HC4H 2YMXH 3IT8D 3DVGB 4RNRA 3ZKSD 1FVDB 3I6GA 5FYJD 3HPLA 1GAFH 3WHXA 1ZVYA 1A7OH 4KMLB 1G9EA 5HYJB 3V6FA 3EOBB 1MAKA 3MLYL 4HK0A 4WDIA 1JFQH 2VXVH 3MRNB 4YBHA 2YUXA 5FEBA 3JWOL 1J10A 2QBWA 4ZUUA 3BDYH 1KSRA 1KCRL 4NKQB 2D7TL 1Q9LB 1R24A 1MFEH 3IKKA 3QQ4A 4NM8H 1CE1L 1IGMH 5C0AA 2ZG2A 4P9ML 3NCBB 4HMEA 5BRZB 4EI5B 1EO8H 3CAFA 3AGVA 3X12A 1EERB 2Y06H 4MDJA 3MO1A 3OKLB 1Q94A 3OKOA 2NLJA 4U6XA 3BRGC 5ISZE 1MCLA 1IFHH 4KTDL 4N1EA 4NNPL 1BIIB 1DSFH 2P8MB 1HNFA 2UUDK 3M1BA 3NVQA 1F2XK 1RUAH 1BFVL 4LKXB 2NY2B 5DJXB 3BRDA 3PF2A 1KCKA 3SCMD 4P5TC 4HKXA 2J4WL 1T6VN 1WBYA 3BGMB 1IE5A 3KDMB 1JGVH 5DS8B 3HR6A 1ADQL 1JTTA 4WFGE 3NIDF 1YNLH 2MOVA 3OXSA 1WGOA 3MV01 2QSQA 1RQ5A 3MGTA 3CZFA 2BNRB 3VFWA 3GK8H 4TOYL 4GQPH 5GRVL 3ARGC 3QUZB 3JV4A 4PGDB 1DTUA 4XCNB 2Q6WB 1UT9A 1XIWB 4BSVB 3VXOA 1CL7I 3GHEL 4NN6C 4LLQA 4BH7B 4NO5A 3B9VA 2GUOA 4NP4L 5EWIH 3V8OA 4OM1L 5EUKA 4G8FA 3REWA 1B0GA 4G6ML 1UQSA 4M5YH 5C6WH 2FBOJ 4U1SA 1NUFA 2WWMD 1INEH 5C07A 1ZT7A 4Q6IA 2KUTA 3HE7B 4PG9A 1IKFL 2R23A 5HHVL 2APBA 3JV6A 4NQCD 1F4XL 3TNNA 2FDBP 2BX5A 1RIVH 4GAYB 2RCSL 4U1HA 3O8XD 3TBVB 3GNMH 5DFTA 4P59L 4PPTA 2AK1H 5KSAC 5IB2A 1U91B 2PCPB 4PGJA 3E1F1 5CKGA 1ZA6B 4JKMA 2WK2A 2XZCH 5E9DA 4HIHA 3GMQA 5EN2B 4HUXA 3ZKND 4JRYB 1JP5A 2X89A 3FCTA 2AJ3A 5I74C 2D7QA 4ALAH 4IIQA 3RGVC 4KKAC 1U58A 5T3ZE 2CKBA 5DSCA 1JGDB 1YJDC 3L5XH 5ADOL 5AD0B 4MNQB 3QRGL 2JJWA 4XT1C 5L2KD 3QCTL 1P1ZB 5GGTH 3WLWC 1UFUA 2GY7B 4Z77B 1RMFL 2EZ0C 4XCFH 1AY1L 1I1AB 1XAUA 2DKUA 1CDIA 3AREA 4M6MH 43CAA 2IFGA 4RRPA 4UV4H 1IZJA 4XBPB 3FB7A 1PQZA 5AG8A 4HZLB 1LE5A 3NA9L 3ULVC 2D03H 4H25B 4EVNB 4OQTA 3LD8C 3MRQA 3HR5A 3C5SB 4QHLB 3SPVA 2ZZUT 3BP7A 4XHQA 3ZDYF 3G6JA 4HK3N 1SY6L 2WINA 4UNVA 3SGDH 1O7SA 4Z95L 2HRLA 2FECL 3DPBA 3V4UL 1A9BB 3RHWF 2VXUH 2GJZB 2H8PB 3B4NA 5CCKH 3FONA 3I3BA 5C0CB 3SE8L 1R5VB 5HHQB 1E4XH 4AEEA 2W0LA 4TUOB 5E1AB 1BQLL 4K8RL 2JJSC 2OI9B 4ODVH 5CINH 4C56A 1N8ZA 3HC0B 3L1OL 2R1WA 4KUCF 4UMGA 2SEBA 3ARDA 4WCYL 5JXEA 3B9KB 2X6MA 1E27A 5DRWB 3FQUB 3SY0B 2APXA 3ARBC 4HIEA 4R4FL 3G6DL 4M1GL 1KOAA 4R26H 4LGRB 3DVNA 4P23A 4ONGL 2J88L 4JG1L 4Y89A 4PJIA 2DI7A 2NXZD 1P4BL 3LQZA 4AIZA 4KQ4H 1DCLA 3TV3L 4J3SA 1U8MB 4WHCA 5HYSB 1PSKH 5B3JF 1JYNA 1LO0H 2CIIB 4ODXA 2NYYD 1NFDF 1FVCB 3ZL4L 1H3UA 3FTGB 1LO4L 3QPXL 3VXTA 5AAMA 2CKNA 1BD2D 1S5HB 1I8MA 1U8HB 1DBMH 1YY8A 4G6KH 3NAAL 3IRPX 4U31A 5EC1B 3RY5A 4NQDB 2YS4A 4H88L 4RFEA 1GGBH 2DQIL 5E6YA 1BX2A 4NBXB 4W6WB 1KEML 5SWQA 3SGJC 4ZXBC 5I8EA 2FX9H 2YUWA 2GJJA 3KR3H 5CEZL 3VRIB 5A16A 4PJGB 2Z93B 4NQVB 1ED3A 2BNQB 5IB1A 3VI3E 2P7TA 3QI9A 1IM3A 3VXPB 4HJ0D 1QLFB 3PGCA 3G5YB 4BQCA 2IC2A 3TO4A 2C3XA 2CR6A 2J2ZA 3RZCA 4LCIH 4JQIL 4JO2H 2AJZB 3SJVB 1AGDA 1JWSA 1MIEH 2BSED 5HI5C 1LGVA 4WUUA 4IOFD 2DMBA 3P9LB 5CBEA 3L3GA 3DUSA 4EI5C 5CKAA 4CVXA 5JORB 1ZV5A 5C9KA 3D85B 5DHVH 4RBPK 4X6CB 2EIDA 3TIEB 2XACC 3HI1A 2QSVA 4LHUB 1BFOB 1RZJC 5FYLH 2X4UB 4JFHE 4KKCC 3S6CA 4JFFD 1CQKA 3TN0B 2X4NB 4OV5B 5KVDH 1REIA 4GXVL 1NLDH 2NY2C 5J4MA 2XZQL 4R7NA 3DIFA 3BN9C 1J0ZA 1ZANL 2DLIA 3RVUD 4K3DL 5J56B 3UTSD 4XPTL 2FB4H 3LKSA 2LV4A 4YUEH 4ZOAA 3ETBF 4OUOA 4KRPB 1EV2E 1YMMD 4HX1A 3V8CA 1OARL 3PWNB 5I17B 3QUZC 3Q1SL 5EU7C 3ROOA 1XIWC 4U0QB 2VLLA 3L5IA 1X6NA 4OM0H 4PJ7B 5I1EL 1I4FA 1G0DA 2W0FA 3QEGH 5DWUL 3VD3A 3O6KL 1I1FB 4X8XA 3MV8E 1RUPH 2QKIA 1I7TA 5LAXA 1FN4A 3HTLX 1KT2A 3V0WH 3VXQA 2PXYB 4W6YB 1KCUL 4ZFOL 1LVEA 4KDTC 5C09B 1JPTL 3HE7C 5FKPA 3P4MB 1OP3K 3D9AL 2IADB 5F89B 3CMOH 4OZFA 3A6CL 1MCOH 3MA9H 2V9QA 3BKYH 4ZDHA 3DMMA 4M43H 2ESVB 1QBMH 5IEKA 4GKZA 2PYEB 1MRCH 3QXWA 4OGZA 1F5WA 3NACL 3VXMB 1Q9OB 1HILB 1QLRA 3T1FB 4DGYL 1CQYA 4CNIB 4E41A 4YXHH 4X6DF 1P84J 2N56A 5EZJB 4TVPE 4OCLC 1JRHI 4MQXC 1J0YA 3BO8B 1IZKA 5EOQL 2ITDA 1RD6A 5GS1A 4HEPG 1UZ6E 1QHPA 5CGYD 5D5MA 5FO7B 4YDLB 1FPTH 4I2XB 2AKRB 5IVXE 1ZTXH 4ZAKB 1YEKH 4X4XA 4KKLC 2LVCA 1WC7B 4Z7UF 3V6ZB 3FO0L 2X5PA 4D0CA 1HKLH 4E9LA 3MYJB 4MQ7A 1DQDL 4MJ5B 3BZEB 5CLWA 1RUMH 1LEGB 5JZ7D 4FABL 2YA0A 3AMKA 4LVEA 1I1AC 4YGVA 3P11L 3TT1H 4C83A 3INUL 1AGEA 4RQQA 5DJYA 4YE4L 2QSCL 3GSRA 3T0EE 1EMTL 3HG1E 3FOLA 3IETA 5B8CA 5AG9A 1E4KA 4GFTB 5AZ2L 4XPFH 3MSPA 1TJIH 1FYTA 4ODUA 2Z31D 1KCVH 5F7HA 2ATPB 3FRPA 4NZTL 5F3HB 4TUKH 3QUKB 3GKWL 5DT1L 3SGEH 4BJLA 1VACA 2DD8L 4KHTL 4AEIH 1CBVH 1NMBH 4J6RH 4PJHE 2ZNXA 1TJGL 2EIZB 3QFDA 4G8GA 3V7MA 5D7SH 5C2UB 1M05B 4M1DH 1I85C 2ADIB 3GMRA 1I7UB 3P4NB 5DD5L 2OI9C 3IDNA 4KV5F 3TZVB 1A7QH 4NC2B 5TPWH 4C58B 3L3DA 3B9KC 4NKIL 1KN4L 1T2QL 1G0XA 1X5LA 4A6YA 5EFIB 5IKCB 1VKXA 1OAUL 3MREA 1GH7A 4QCIB 1T1YA 1KTDA 3Q6FA 4LEXL 3X13B 3WMSA 4HW6A 4M5ZL 5T3XL 4PJBA 3RWIA 1OQXA 4R90H 1K4DA 4CJ0A 4P5KA 2DQCH 2AEPL 3CLFL 1N59A 1MI5A 1D5BA 4G80A 5LGHH 3IDMB 5T3ZH 4JG0H 4Y4KB 5F7UA 4KRLB 3OZ9L 1T5WB 4KQ3H 2OJEB 4EOWH 4JRXA 5AAWA 1OTUD 2R0KH 4C55A 1B4JH 4O58H 4Z8FL 5D5ME 2V17H 1E4JA 4TSAH 2H1PL 4MJIB 1D9KB 3WJJA 5DVNA 4UT9L 5TE6H 3WUWG 1A21A 1MUJB 3VW3H 3R06B 1UVQA 2P1YA 4ONFL 1XF4B 5MEOA 4U3CA 4DK6A 4I77L 2FR4A 1H15B 1AJ7H 2DJ4A 1A6AB 2X1OA 5C0IA 5SX5H 1ACYL 2EEAA 1AR2A 3WFZA 4I9WD 3JV5A 5CILL 4YPJA 2EKJA 2VXSH 4KFZC 3AS3A 3UTTA 4X4MA 4LIQH 5DJZB 2A6JA 1JHKH 1YEIL 3U46B 1FYTE 5GS0H 4S11A 4AEFA 2VZ1A 4S1SL 3FFDA 1S8DA 3IFLH 5JUEL 3RUGE 3VXSD 5ABDE 3LS4H 4OI9A 4XI5C 1JF1A 4IMKA 1UM4H 2QHRH 4PY8J 4YJZL 1QTYT 3TJHC 4M7JL 3KPQB 3QFJD 4UQ3A 4JFZL 5DURB 4JN2A 3HZYA 4EN3B 1XF2A 2WLZA 5IK3B 1KN2L 3JWOC 3O41A 3ULUL 2ZCHL 5A40E 2EDHA 4DGIL 1S7XA 1X6LA 2IBGA 1EHLL 2R29H 4NNYB 2P48B 4PGEB 2B8OT 3TN0C 4TVSa 4WI7A 2GJ6B 2PTUA 1ETZA 4HWBA 5J57B 3K8MA 4QRPA 2DQDH 3VFNB 2Z9TA 1NLBL 2OL3H 2VXTL 1A7NL 3V52L 2CDFA 1U93B 4GW1B 3TBYA 2YD3A 1A4KA 5B3NA 3LKPA 3PGDA 5F6IB 2R0WH 3C6SB 5I1JL 5ECJE 5F96L 4KRPC 5CJQH 2R4RL 3C08H 1I3VA 3OAUL 1QBLL 1UEMA 5AYUL 2PO6D 4LLWB 1KJVA 1Y0LA 1NMAH 3GI9H 4X83A 3VJ6B 3MRBB 4PRDB 5EA0L 1T7YA 5E5MB 5E0QA 3MV7B 4NKMA 4URTB 4LCWD 3X3FH 35C8L 5HGHB 4XVTH 3BH8B 2E6PA 1HI6A 3LOWA 1A4JB 2VQ1A 3NIDE 2XPGA 2IAMB 1NSNH 3S34H 1J12A 2P5EA 1P7QD 2D31A 4NQEB 2PXYC 3S35L 4LRNL 5D7IA 2DQUH 2VNCA 5I1DB 5F7NC 1JYVA 3LAFA 1YEEH 1NL0L 2Y7QA 2X05A 3FQTB 3SDCD 3K2UH 2UZIH 2VR9A 4RISL 2YKLL 3V7AE 1IBGH 1OGAD 3UC0H 4ZD3H 3VFGH 5I0ZA 4U7MA 3RDTB 4FG6D 2V5TA 2VDQH 4P46D 3QUXD 2XN9D 3GBNL 3GIZH 3GSOB 2UY6A 2Y25A 4KK9C 1ZHBB 4NGHH 5CZVL 4ZFOB 3T3MF 1WT5C 4QXTB 1A3RL 4BZ2L 1CGUA 4OLWH 1VFOA 2HTKC 1BM3H 5CGTA 5IV2B 1NGPL 1FO0L 4YHPA 3RIFF 3PUCA 5EZLA 1VB9A 5DK3A 5GGSA 2DMKA 3STZA 5D4QA 3WE6B 4BFEA 3OB0K 1JF6A 1QSZA 3ZT6A 4YDLC 5CD5C 4HPYH 3LEVL 5IMMA 1TZGH 4FFZH 1AO7D 1F4XH 1CL7H 2AK4E 4I3RL 4ZAKC 3BIKA 4IEFB 5JW3H 2NY3D 4O2FB 4Z7VB 5I1HL 2FJFB 4D9QE 2BMKB 2WBKA 5GGSY 4U1KB 4POZD 3MBED 3QDGB 1BGXL 4P5TA 5DR5H 2ADGA 5EU3A 3VXUB 1A6TB 5H94A 1P5VA 3UP1A 1M1SA 5E2JA 1E6JH 5T1LB 4MWFB 4U6HA 4D0DB 4XP6H 2IPUK 4MNGA 3TWCL 4X7FC 4JFEB 4M93C 1FFOA 4N9GA 3GEWB 1VFUA 5DMGD 4NBYB 2DLFH 4BFIA 2RB8A 3FQXA 1IJ9A 2EYSA 2NW3A 3LY6A 5EUOA 4PJAF 1AI1H 1YMHA 1NEUA 5F72S 2F54E 3I85A 5DMKA 4UU9B 4KMTL 1CICB 4OV6F 1XCQA 4BFGA 25C8H 3DROA 2DBLH 2YPLE 3ZE1F 5IF0B 4Y88A 2HN7B 5I19L 3S3JA 1BZ9B 5IBUG 1EGJH 4KK6C 2X1WL 3K81A 2VLKB 4F2MA 3TZVC 3SDYL 4G9FB 3T4YB 5D71H 4X6CF 3AS2A 3KJ4C 1DP0A 5KSAA 4BSWB 1IL1A 3QIBB 5FOBB 4M62L 2OM5A 3BW9B 3LB6D 3MRCA 1I9IH 3OTTA 4WFHD 2KQMA 5DUPH 3RI5K 3UX9B 2NY1C 5F1OB 4L8CA 1I1YB 5ICYB 5D1ZD 4EI6B 4TVPH 5JHDB 4MJ2A 4NFDA 1BF2A 3QIUB 4ZG1A 4LPXA 3MLVH 3RGVA 4ZUWA 4Y4KC 1T7VA 1D5ZA 3QG7H 4GAFB 4H1LG 1U95A 3HRZA 5T5NF 4PY8I 3QDME 1FL6B 3OR6B 1BJ1J 2ADFH 1IC1A 4FOMA 1F8TH 3DHMA 1NBYB 4JFPB 5ITBL 1TETH 1D9KC 4Y4HD 3ZHDA 2BVEA 1T83C 2F8XC 1YY9D 4XMLL 1SHMA 1V3JA 1ZLWK 1KYOK 4QRQB 3O2WH 3ARUA 4BH8B 3H7BA 4L3EE 1SBBA 4JZNB 1CD9B 1NGXB 2P5WD 4Y5YB 2VDNH 4P2CG 2C1OA 3KG5A 5HHNB 4XNYL 3VDCA 3MV9A 4NN7B 4J3UA 2ZG1A 3D69A 5FUCC 5HHME 2NTSP 1XF1A 1N3NA 4DAGL 3TFKC 4O5LL 4FFYL 2NX5A 3P4OB 3UPAA 2B0SH 4I0KA 2P46B 4YXLL 3QEQB 1FG2B 3RVVD 4MJ4A 3FQRA 1BBJA 4JB9H 4QGTA 1AH1A 1MJJB 3EBAA 3KXFD 3FT4A 4EDXB 3M8OH 5C70A 4XBEL 4LLAA 3FQWA 2YD2A 2JJSA 3X11A 4K07A 3E6HA 3MFFB 1FL5A 2VLRA 2YD5A 1S7QB 2VLJA 5BZDB 3I9GH 3AY4C 3WFHB 1PLGH 1CI5A 1KJ3L 1HH6B 4FFWC 3X14B 1AD0B 4KRNA 3M07A 1H8OA 1RU9H 3BDXA 4UTBL 1I9EA 4CVUA 5JHLH 2V6HA 3DX6A 1A5FL 1GJIA 3NCEB 1YEJH 5I16A 3D39D 1ZSDA 2QEJA 3VWKD 5F6IC 2Y23A 4Q2ZB 1P4LB 5D7JB 2DLGA 3O3BA 5I66B 4JLRA 2DJUA 4YX2L 1KG0A 5T1KB 3P73A 3FN3A 1T03H 1YEFL 3QCUH 4QF1B 2H32A 32C2A 3U30B 5FGCE 1K6QH 4G7YH 3MYZA 5ESAA 2DQTL 3LCYA 1F4WL 4KXZH 3HZKB 4GXVH 4OCWL 2IAMC 2GKIA 5MENB 1QRNB 4DWHA 3BP4A 5EC2A 3A6OA 2BSTB 2O5XL 3SGJA 4ZXBA 3RWJA 2HWZL 3EYSL 4PBVC 4XGZA 1T04B 3F7QA 4XAKD 1FDLL 3DTXA 5DD3H 2FYYB 1IARB 4K2UH 5HYJA 3EOBA 1U6AH 1CFSB 1QYGL 5HI4D 1OSZB 4DUWA 3EOYG 3RDTC 3O6FD 4NFCA 3MV9E 1QD0A 2Q1EA 2AABH 1Q9LA 1BPVA 2F5BH 2X4RA 2G75B 3WDIA 3PGFL 4TNVF 3U0TA 4U6TA 2ICWI 4FQLL 5BRZA 3S35X 4GAGL 4EI5A 5INDB 5EU6D 4I4WB 1A3QA 5C08E 3RTQD 2XQBL 1K3IA 3OJDB 4MAUH 1FFPB 2FX8L 1YEHH 3QAZB 4QRSA 4P2QE 2B39A 1GC1L 3W11C 4FN0A 2YA1A 4HH9B 4KRMB 4LNVA 4DOHB 4YBQC 1FO0B 3IU3B 3T0DA 5DJXA 1G9NL 2XTJB 1RULH 3LHPL 3BGMA 4X6DE 2MPAH 4PRIE 3UAJC 3GM8A 4RAUA 4RZCB 4U33A 1IQDA 1A9EA 3EZJB 1I3GL 2YR3A 1P2CB 2EH7L 3T0AA 4JM2B 1NDMA 3QUZA 4OCSL 4PGDA 4XCNA 2Q6WA 1XIWA 3B43A 4BSVA 5EIIA 3ROLB 2BRQA 4HS8H 4XNMB 4Z7UE 4BH7A 1ZOXA 3KGRA 2A9NH 1NANI 1EEZA 1F2QA 5A43C 1SM3L 4OTXH 1OW0C 4PJFB 3UO1H 3VDBA 4YWGL 4CN1A 3RZWA 4FABH 1RVFH 3TM6A 1CICC 3LRHA 5MP6H 2F5AH 3MODL 4KDTA 4QRRD 5GSRB 3HE7A 1QLEH 4OFVA 3BHBB 5FAAA 3F62A 2AXJA 3GRWL 3R8BB 1ORQA 1UH3A 4XNXL 5DMJB 5HYJE 3TBVA 4P2RD 3GMNA 3M17B 3QIBC 4U2ZA 3CNKA 4G6JL 4KROB 4N0YH 2OS7A 3DXAA 3P40A 3KPSB 1I7RB 5I1IL 2ZPKL 1C16B 3LH2L 4JRYA 5MHSD 3U4BL 3C60B 3PL6A 5BRZE 3QIUC 4EEEA 4V1DB 1OVZA 3HCVB 5DD5H 4GRWH 3NGBC 4Y19D 4KV5E 1AQKL 4PJCA 1FV1B 4F7TB 1PAMA 2PW1B 5AD0A 2GW5A 4MNQA 4HXAH 4K7PL 4PV9A 1P1ZA 3BOVA 3HA0A 1FZKB 1VGEL 3SQOH 3EO9L 4Z77A 3DRQB 1AKJB 3CSYA 4P2OA 2ZUUA 2V2TB 1GPOL 5D7LB 5KVMC 2Y6SD 1I1AA 1GL4B 2HFFB 2X70B 1OAYH 5DLML 4XBPA 1MEXH 1F4YH 4Y5YC 2VABB 2NY7L 1DFBH 3MLSL 4NN7C 4NUJB 4G6FD 2BNRE 4H25A 5K9QI 3C5SA 4DFIA 3MLRL 5EU7E 5F9JB 3NIGF 4I48B 2H1PH 1G9MH 5GS2H 1QSEB 4PRNB 1A9BA 3RAJL 2GJZA 4WO4B 5CP3H 4Q9CA 1RZKH 1R5VA 5HHQA 4LP4A 2UWEB 4Q0XL 2XZAH 2G60L 1I85A 4NQCE 4TUOA 5E1AA 1LK3L 2F19L 1K8DB 3U4AA 3VFOB 1TTUA 2X1PA 5E6ID 4U1GB 4G42B 2H41A 5GSVA 2XY1A 5BOPA 3WXWL 1XR9B 3HC0A 2V7NB 3IJHB 3I50H 1T1XB 2OMBA 4Y5VA 2Z8VC 5IW3A 3RWFB 3MUJA 3B9KA 5KG9B 5DRWA 3FQUA 4OF5A 4OLUH 1YN7B 3MRGA 5DQ9A 5IOPB 4NNXA 5IHBA 4AL8L 1CD1B 4R2GD 3ULUC 1BAFH 3HMXH 3QSKB 1U3HB 3U48A 5KS9B 2BY1A 5D7JC 5BZWB 3U82B 2VDPH 3UZQA 5EH1A 5DI8B 3WDJA 3QJHA 5FKAB 1U8MA 5HYSA 2JKXA 1T3FB 2FO4B 1UB5B 4YHLH 1FVCA 1IQWH 1IEHA 3FTGA 1HXYA 5L2KE 1S5HA 3ARXA 3U30C 1U8HA 3GSNL 3O6LL 4RFOH 5T1MB 5E99L 3STLB 3LIZH 3MRHA 3DURB 1IC5H 3E3QE 5DQDL 4J8RB 4XPBL 3TCXA 4G43B 2I60H 4PJGA 1G7IA 4NQVA 4UOW1 4NO0D 4TSBH 2WBJD 4Y4FD 5BJTA 3VXPA 2J6EL 1KIRB 1QLFA 3ALXA 3G5YA 3KYAA 3CXDL 4G3YH 3HNSH 1CG9B 1V7NL 3LKOB 4MA8H 2AJZA 3SJVA 5E4IA 4KJPC 1FRGL 1AFVL 4HUUB 5F1KC 2FX7L 5MEPB 2X4SB 5JORA 1MFCL 4JM4L 4QT5B 3V5DA 5EIVA 2OK0L 4S2SA 3D85A 5C0CE 3VA6A 3WUWB 3P30H 2YK1L 3TIEA 3QAZC 4LHUA 4WWKD 3Q6GH 1Z9LA 2X4UA 3S8WA 3QO1B 2XT1B 2YD6A 1Z0NA 4HC1L 2BJML 5TDPA 3T3ME 5CFHA 2X4NA 1MY5A 4OV5A 1PFCA 2BNUB 2A6IB 5EBWB 2XTJC 5KSBB 3E6FB 4KJQC 1JN6B 4X6EA 5JW5B 3W81A 4F3FA 4OI7A 1U8QB 2OR9L 4CDHA 5B4MC 5E24E 3JTTB 4RCAA 3B9EA 2VDKL 1S7UB 1MHEB 3PWNA 4I5BB 4JM2C 2ED7A 5DZLA 5TJWK 5I17A 1BD2E 4WIQA 4ODSL 3NFSH 4PJ7A 1CT8B 4P4RB 5FM8A 5LBSH 3ZTNL 4JPKL 4QY8B 4PIRF 4LQFL 4OB5H 1KPRB 4Z0BH 3WN5B 5DMYA 3PP4L 1N5AB 5E2UL 3TCLB 2EYRB 4NQDE 2C9AA 5FFLA 2OZ4L 5I1GL 1IM9B 3VG0H 3UTPD 2JIXB 1RJYB 3P4MA 4PJGE 5F89A 5IFAL 1P84K 1ZKAA 3CCHB 3ZT5A 2BNQE 1AXTL 2ESVA 1QP1A 4GRLD 2OYPA 2PYEA 4YGAB 2D3VA 3QHFL 1DN0B 5C6PB 4DCQA 1WT5A 3HNVL 3U7YH 1MRDL 4KROC 3VXMA 2E27L 1K3ZA 1HILA 4NJ9L 3T1FA 3SJVE 4LNRB 3AS1A 3UBXG 1MHPL 4CNIA 3C60C 5EZJA 2PF6A 3K3QA 5I71B 1KFAL 3BO8A 2EC8A 3BN3B 5F6HJ 3WKML 1NEZG 4FZ8H 4G6AC 4JFFE 3LRSB 3QNYB 5FO7A 4X6CE 4HZAA 4XRCB 2CIKB 4I2XA 1RK0B 2AKRA 4JY6B 4H8WL 2AV1A 4X6BA 4RX4D 5C0EA 1CK0H 1ERNA 3OKMA 3HN3A 1JUFB 1WC7A 5KSUB 3MA7B 3LKRA 1CYGA 3UTSE 4ZFGH 1HINH 3MYJA 4KUZL 3VE0A 1LEGA 4GG6B 4M62H 5KVGL 3QO0A 5FDYA 5I30L 2Y1VA 4KZEH 5KVEH 1DBKL 5F21B 2AQ3A 4K3JH 2MCPL 2IPTH 2IANB 3VWJD 8FABA 2JJUA 3KVQA 4YHKL 3BEWB 2VH5H 5DD1L 3FO9B 5HD8C 2B1HL 2ATPA 5GZOD 2K7QA 1U3JA 4L8SB 4K7PX 1FC1A 3WD5H 4HKBB 4Q9QH 4PJXB 2IQAB 5D6CB 5I8OL 2ARWA 3KHQA 2D4FA 3REVA 3IDXL 3DSFH 4RRPG 2EIZA 5FV1L 1QKZL 4WO4C 1IAIM 3O2DL 1R3IH 3GMMB 2JK5A 2VSDA 5FYJH 1OAZL 4OKDA 1KLGB 5AZEL 5IVOA 4GLRI 3T0BA 2VAAB 2AJUH 1MWAH 3L7FB 3P4NA 1I7UA 3LS5L 1IGTB 1KUMA 4UINH 5J3HD 4U1GC 5C09E 1SY6A 3HE6A 4IRJD 4XVUD 4XNYH 3O4LD 2Z35B 3E8UH 3TZVA 1NBVH 1T0MB 1LP9B 2VDRL 4UAOC 4NM4H 5FUZH 4XNZB 5ETUB 5EFIA 5IKCA 3HUJB 2WQRA 3BYYA 4U05A 2NCMA 3X13A 5TQ2H 1XGUB 1U3HC 4JFXB 1OLLA 3VXME 5GHWH 2CR3A 3OGCB 5F44A 2XKNB 3IDMA 3STBA 4Y4KA 2Y36H 1PY4A 3G04B 2CUHA 1HDMB 2V2XB 4JHAL 4X80H 4O9HL 4PJ8B 1FVEB 5TE7H 1BZ7B 3QZWG 3T4AB 4MX7A 5IBUB 3CDCA 4MJIA 1D9KA 4AK1A 2BVPB 1T83A 1A6VH 1MUJA 2YUZA 3R06A 1FZMB 4ZTPH 1H15A 1X5YA 1RIUL 4R4ND 4NUGH 1A6AA 2J5LB 3R4DA 4KJWD 3GSNB 3B2VL 4UNTA 5L88H 1UJ3B 4N1HB 1S9XB 2HH0L 5IHZB 4HQQH 2DLTA 5DJZA 3VI4F 1YC7A 1JVKA 4EDWH 4DGVL 3U46A 1RIHL 1BJ8A 4HUWA 5FUOH 3I6LD 4ZUTB 1BMGA 2GCYB 2DL9A 4H1LB 4XBGB 3VMPA 1FL3B 2YPKB 3FKUS 4YO0B 1I8LC 3NCMA 1HQRB 4MXQC 3W0WB 5IK3A 5GPRA 1KACB 1MFBL 1MREH 4MA7L 2KBGA 4BQ6A 1BBDH 1U8JB 4NNYA 1JHLL 2Z8WC 4N8VG 4PGEA 1YECH 3MBXH 4PGBB 3OBAA 3RY6C 4JO1L 1F42A 4F33B 3QISA 3VFNA 3MLZL 3D0VB 2ZCLH 1DVFB 1F58H 4RGOL 1FYHB 1J5OH 1U93A 3QEHB 3TYGL 5F9OL 3R1GH 4GAGH 4LCUB 2BC4B 1GC1C 4JR9L 5DJAA 3C6SA 4FQJH 4WU7B 1FGVL 2C5DC 1IAKB 1ZT1B 5I15L 1JPSL 5KZCB 4LLWA 2G9HB 3QXAA 3VJ6A 3RWHB 1D6EA 1ACZA 4PRDA 1G9NC 1MAMH 5E5MA 2OLDA 1WWCA 4PRPB 5DRZB 5HGHA 5C0ND 4HUMB 3BH8A 3P0YH 1S9WB 1T21B 1XCTA 3IDUA 3X3GL 5FM5M 3QPQD 2IAMA 4HIIA 2GY5A 3MCKB 3WN5C 2GAZB 3GSXB 3NZ8B 2IH3B 4NQEA 4AH2B 4I9WE 3GBML 5I1DA 4PRHD 5BMFH 4LSVH 4PP2B 1YPZF 1TFHA 2Q8BL 3SKJH 3FQTA 2P49B 3HFMH 4PRBB 3R0NA 2UWEF 4OCSH 4WY7L 3RDTA 5JOPD 3VXSE 8CGTA 1HZHH 1B2WL 3QUYB 4XPGL 3GSOA 5LWYH 2ED9A 4PJ9B 4YHMH 2W38A 5GIRB 4GG8A 5D1XB 3DYPA 3FO1B 4F7MA 4QXTA 3IXTA 4KDVA 1T1WB 3FFCB 1JNHA 1MLCB 2BXZA 4MD5B 3WO4B 2X4QB 5CEZE 4C54A 5IV2A 4YWGH 5J1AB 1EFXD 3VD7A 4H26A 4MXVE 5I71C 1M4KA 1S9YB 3HPJB 2J8UA 4PBXA 4OZHF 3WE6A 1K8IB 4FQ2L 1OB1B 3T2QA 3ILQD 5I8KH 3GRWH 3DVIA 3EFFB 3ET9F 1EEYA 3W9DA 3BH9A 4O2FA 4Z7VA 2FJFA 2BMKA 4POUB 2K7PA 3IAPA 3RVWC 4U1KA 3ARSA 1NANH 2D9CA 3QDGA 4QHKI 4UILL 1L7TH 2GJ6E 4EUPB 3FZUC 4MB5A 4JPIB 4JVWA 5JQ6H 3VXUA 1A6TA 5T1LA 4MWFA 3JUYA 1V7ML 4J3WA 2EXWD 4D0DA 5JOEA 4MQTB 3IF1B 1YDPB 2VLMD 4LPVA 2FH6A 3PXHA 3BE1L 4OF0A 3U0WL 5HHOB 1GGIH 1CLYL 4L8SC 5CP7B 1J8HB 2QQNL 3RWCB 4X8JB 4X7TB 5DD6B 3MV7E 1RUKH 5D1QB 2Q3ZA 5IT2L 4HT1L 3RBSA 1OW0A 3CZJA 2AXHA 1JHTB 1OAKL 4FQXB 5I1CL 5HGDB 4KKBD 2ZKHH 3RKDD 1HIMH 4NQEE 3VGHA 4H0HB 4DEPB 5IF0A 2A6DB 2HN7A 3NABH 1OGAE 4M6AA 2B1AL 1BZ9A 2Q7YB 1U8KB 2NY7H 1ZEAL 3IRZA 3QXUA 2XN9E 3NIGE 3EJJX 4UB0H 1W8OA 3T4YA 4G9FA 3PNWB 3SE3A 5J6GB 4XNZC 1BVLB 4BSWA 4CN6A 2IFFH 1UA6L 3QIBA 5FOBA 3SOBH 3BW9A 1S7TB 4ORGB 5C0BD 3ZZ1A 4NZRH 2IGFL 4OLZH 1I1YA 1LHZA 5ICYA 5F7WC 1JNNH 3PQYB 4O51B 4EI6A 5JHDA 4PLKC 3QIUA 1KJMB 2JB5H 4Q0XH 3ARPA 5GGVH 4J23A 1CLOH 1AO7E 5E7FA 1BOYA 5HDLA 1WISA 4TNWF 1H9VA 2I5YH 4PJ8C 2VOTA 3OR6A 1NBYA 4AMKH 4Z7VE 3O6MH 4LARH 5M94B 5ALCH 3GGWB 3C5ZB 1JL8A 3S5LG 3IB4A 3FN0H 4QOKD 2RIKA 2Z92A 3ZDZF 3F6LA 2AS5M 1FNSL 1CFNA 2J5LC 3MLPA 1QEWA 1RK1B 1F11B 4JZNA 3CFEB 1NGXA 1ZS8B 1UCBH 1UJ3C 2DYPA 1HEZB 4E5XB 4OFKA 4JFEE 2R69L 1O5DT 3NFNB 3QQ3B 2R4SL 2R0ZH 3UYPA 3S37L 5BS0D 4J4PD 3O11B 1DQMH 3RPKA 1S5IH 1MCPL 4WFED 3P4OA 3N85H 4DZ8B 2CKBL 2AJSH 1FG2A 1UENA 4M9OA 2H2PC 4NQSB 4CADB 1OGTB 3O9WD 4EDXA 1DBAH 3H9HB 1CXFA 3MFFA 1M71B 5KAQF 4QTHB 1S7QA 3WNPA 3HMXA 1NCWH 1UKSA 2VLKE 5L9DL 3WFHA 1MIMH 1HH6A 3X14A 4NQTA 1S3KH 4U6VH 4G9FE 2ZOKB 1DVFC 2NXYD 4FTVD 3IDGA 4WFHE 2OJZL 1MVFA 4P5MB 2B7DT 5KW9L 1T4KB 4Z7OE 5D7JA 3VFVB 5I66A 4F80A 3GSQB 4DN4L 3ZLQC 1CZ8L 1L7IH 5T1KA 1OAXH 1MFNA 5JHDE 1AGBB 5CBAB 2LABA 5B21A 1RI8A 3VU2A 4IRSB 2W1NA 3HI6L 3I3EA 1WCQA 1FGNL 1WJ3A 3TO2B 5K9OB 3HZKA 1P9MC 4Y16B 5T3XE 1I1CA 1EK3A 5MENA 1QRNA 2F58H 4LSTL 2BSTA 4MGXA 5GRVK 1C5CL 2P5WE 4FQIL 4WI5A 5FO8B 1DR9A 2HLAA 2FYYA 3QWRA 4WRLA 4XC3L 2Z91B 1TJHH 1CFSA 3ZE0E 1OSZA 1S78C 4ODSH 1A6UH 3QUYC 4PJ9C 4XH2B 1QFWL 5D1XC 2XWBB 5MEQA 1BQHG 2G75A 3WO4C 2FO1A 1MCRA 1F90H 3WLBB 4LSRL 4UOW0 5INDA 2E7HA 4I4WA 3QEQE 3S4SG 2AVGA 4ISVB 1H3XA 1MNUH 3KLHC 4O2EA 2NY6B 3OJDA 1FFPA 1U92B 3VXRA 2Z8RA 3CVHH 5DO2D 2HMIC 5EU5A 3KJ6L 1ONQA 2XV6B 1ND0B 1EO7A 4HH9A 3B8YA 4NCC1 1FO0A 3IU3A 3UPRB 2H26B 3D39E 3D18B 5DFWH 5IHUL 5EORH 2R2BB 4HGKC 4UZGA 4RGNB 43C9B 3ULUE 4RZCA 1L9NA 4K7FB 4H8WC 5ID1B 4ZOEA 1P2CA 4JM2A 2WW8A 2CK0L 3I6GB 4ZS7L 1NCBL 3HPLB 5F93C 5CZXC 5BV7H 1GGCH 4HK0B 5CUSL 4XNMA 2EXYC 4NWUL 1XGRB 2M8XA 4WI4A 1D5XB 2AP2A 5D1QC 3GMLB 4ZUUB 1EJOH 4NN5B 1R24B 4PJFA 2CPCA 4F15B 3QQ4B 1NUGA 4TSCL 1GYAA 3MRFB 4FQXC 3DETD 5KVGH 3ULSB 3RVTD 5IUSA 2AQ2A 4JFOB 2A2QT 4WW2B 4DEPC 5FGSA 5GSRA 5JR1H 4LPUA 3PP3H 4MDJB 3D6GA 1KB5H 4OI8A 5C0AD 4OCMC 1AGCB 1AD9A 3GO1L 5GRYA 1SBSL 5E2VH 4XP1H 4Y1AB 5ERWB 4X9IA 2ZNWA 5F88B 2MNUA 3M17A 4XCEB 3M1BB 1NAKL 1MQ8A 2XY2A 1DQQB 2HFGL 4BZ1L 4TPRH 3OPZL 2WSKA 1H3PL 2X41A 4NHCH 2O5ZH 3CC5A 3KPSA 3T2PA 3AAZA 4Y5XB 1I7RA 3AU1A 3MOBH 2EKSB 5D2LF 4JVUA 4L4TB 4WNQB 3GB7B 4V1DA 3HCVA 4L5FH 5L6YL 1FH5H 1KEGH 4HS6B 1FV1A 3VFWB 1G84A 4F7TA 5I18H 3FOMB 2PW1A 1H5BB 2DBJA 2XWTB 4NJAL 3U7WL 5EOCH 1BEYL 1OQOA 2EO9A 1MRFL 4LDOB 1HHHB 3K4AA 1H3WM 3DRQA 3C5ZC 4DOHE 3BQUD 4KK8C 1HSBB 3MUZ1 2AAVA 2V2TA 1JBJA 5D7LA 4A2LA 5EUKB 1UQSB 5I2IB 4GLRH 1EVTC 2X70A 4XMPL 4U1SB 2V5MA 3MRMB 5C07B 4NRXB 4Q6IB 2VABA 2HJKB 1JIBA 4NUJA 3ARFB 3CH8A 4JFDB 4HLZH 2VXQL 3UBXB 5IQ7L 1VFAB 4OCXL 4MS8D 5F9JA 4HJJH 3TH3T 3WFEL 4KI5C 5KANG 1MWAA 1NEZB 2WBWB 4KY1L 4MVBD 5KTEL 4I48A 5IB2B 1QSEA 3CK0L 3NH7L 1XFPA 3GI8L 4OZGF 4P9HL 3QUXC 3VD4A 3V5KB 1VFBB 1NCDL 3O2VH 1TNMA 3O0RL 4S1DD 4QRRE 2JCCA 3EHBC 2YPVL 4WI2A 3BPNB 1B3JA 4HUXB 1QBBA 5E2WH 3DSNA 1K8DA 1LDPH 3VFOA 1JGLL 3BIAX 3VI4E 5TQ0H 4IIQB 1J1PH 4OF6A 4CL7A 5E9DD 2CKBB 5DSCB 1BJMA 3IJHA 4AM0B 2J3SA 1R3LA 1T1XA 4X0KB 4DZBB 2X89D 1SVCP 2P4AB 2ARJQ 4RMQA 5KG9A 1QNZH 3EDJA 4UIKL 1YN7A 2QTEA 2IG2L 1UADC 3DVFA 1GIGH 5IOPA 5TDNA 1CD1A 4M8VA 3KYOA 1NGQL 1U3HA 1RAMA 2RGSA 3W2DH 5KS9A 4OGXH 3NCJH 5BZWA 2HT3D 6FABH 3KPSE 3AREB 4P48A 4Y19E 5DI8A 3CLEH 5FKAA 4K3GA 2HP4A 4LASL 1T3FA 3MACH 1UB5A 5F7MC 1PQZB 2X1QA 4LHQB 1LE5B 4IRSC 3NZHL 1RUQL 1CXEA 4ODTL 4YEEA 3D2UD 2WM0A 4HXBL 5T1MA 3STLA 2ZSWB 4Y16C 4GBXD 4K55A 3G6JB 1QFPA 4AIXA 2E8YA 1WEJH 2WINB 3OJVC 4Z6AT 2MCG1 2ZJSL 5D72L 1OAQH 4X9BA 2A74B 5T1DH 3SDAB 3T8XB 2R9HC 3FONB 5L8JB 4BKLB 1IEAA 1L4IA 2H2SD 4A6YL 2Q3AA 4QYOB 4HFUL 4LQ1A 2B4CL 3F8UB 12E8L 4GSDH 4OIIL 1WAAF 4C56B 5EB9A 2KH2B 7FABH 1CG9A 1KNOB 1J1OH 1CU4H 2QLVB 4XVSH 5IB4B 3RNQA 4IDLA 4HUUA 4HIEB 1I8LA 1NUNB 5MEPA 2X4SA 3ARDD 3QZWB 4P23B 1RURL 5IVNA 2AV7A 4ZNEA 2ZUWA 2NY6C 2W9DH 4MZ3A 4PJIB 3K8KA 4W4OC 3WSQL 1ZT4B 4FQCH 3WUWA 4EBQL 3LQZB 2UWEE 1MCWW 4LSPL 1KC5H 3QWOA 3DO7B 1I3RB 2ERJB 2EDTA 4MA1B 4ODXB 1RZFH 4YZFE 5GRXG 1Q0XH 2ATKB 5BVJB 5IGXH 2BNUA 4ZNCD 1ZHLA 3WHE0 2A6IA 1NPUA 1T89C 5C0DA 1GGYA 2F8OA 3MGOB 5KSBA 3NTCH 2YSSA 3VGGA 1C5BL 4JO3H 5JW5A 2BHYA 1N0XL 2VERN 4MDIA 4LPWA 4XP9L 4RGNC 4OZHE 1C12B 5SWQB 2BERA 1U8QA 2HJFA 4WFFD 3JTTA 5JXAL 3KPTA 1S7UA 3C9NB 4LKCB 3HNTH 1MHEA 3A0OA 5GISH 5A16B 1A6WL 3RP1A 4GUPA 3QI9B 4OGAC 3S36L 2WIMA 1CT8A 3OGOE 4P4RA 5DDHB 3L3JB 3OHXB 4ONOA 1UB6A 4XVJH 5E08H 4QY8A 4NN5C 4YHIB 3KPRB 1HNGA 4F15C 4N8VB 2EYRA 1AGDB 1JWSB 5DFVC 1OTSD 5IM7B 1IM9A 5CBEB 1A14H 3DUSB 3TO4D 4WW2C 3UYRL 3RZCD 4Q9RH 4XX1G 4ZO7A 2JIXA 1RJYA 3HZMB 2AQ1A 3QQ9D 1G7LB 3H9SB 3TBWB 3BKJH 4WUUD 3CFBB 5HDQH 3HI1B 4EQ3A 2MSPA 3VGBA 3HI5L 1HHJB 4TRPL 4Z7WA 5HHXL 1L9MA 3ZO0A 5IT2H 2J7LA 3GRWA 1R6VA 4LSUL 3GM0A 4Y5XC 4LNRA 1MF2H 5FYKD 1N26A 3KPNA 1S9VB 1A1MB 4FMFA 4PV8B 1XT5A 3HC4L 3KPPA 3BAEH 2YMXL 2YD4A 4CU7A 2LAGB 2E6QA 1A7OL 5CEYB 4ZNEE 3LRSA 2DKMA 3QNYA 4HX1B 2UZYB 3HG1D 4XRCA 1H5BC 4AENA 4ERSH 1RK0A 4JY6A 3OF6A 3HLAB 1JFQL 2VXVL 4I0PB 2AXGB 4PG2C 1QFOA 1WIPA 1JUFA 5KSUA 1F6FB 2W9LA 3BDYL 5DVLA 2W0FB 1MFEL 1B0WA 4NM8L 4GG6A 1IGML 1P4IL 1G7HB 2DQHH 3GJEB 1FN4B 1EO8L 4NFBA 3BJLA 2Y06L 4Q6IC 4XAWH 2GEEA 1ZMYA 2YN3A 4IDJH 1T66C 1ZHKA 3BEWA 5FKPB 4ZSOB 3ARFC 3FO9A 1IFHL 3QULA 4OSUH 2EDLA 5B39G 4L8SA 4WTWA 1WQVT 1DSFL 1G7MA 4OZFB 3UXFA 4PJXA 2IQAA 3T3PF 3T08A 1G6RH 1RUAL 2DTMH 5GRZA 4GKZB 2DJSA 3H0TB 1BFSA 1JGVL 2BFVH 1B6UA 3GMMA 3DMMD 1YNLL 1JV5A 1KLGA 3UTPE 3BUTA 3BPNC 2VAAA 4E41B 1IGTA 5IQ9A 1QR1B 4ODBD 3GK8L 4TUJB 4TTGA 5IROC 4RA3A 1DDHB 1TCMA 3JXAA 4B7LA 4PB9H 2Z35A 3GFUA 4GMSH 4KTEH 3QJFB 1B4RA 1T0MA 1LP9A 2EIEA 5ETUA 3HUJA 1ZLVH 5EWIL 3I2CH 2WUBH 4L3CB 3TPKA 1ZA3A 1ZWIB 4D0CB 1XGUA 4M5YL 4JFXA 2G5BB 1INEL 3QA3B 1F3JB 1FE8H 1JZ8A 4C83B 3AREC 1AGEB 3JZ7A 1KLUB 4OLYH 2J1KA 4OFYD 5B8CB 3OL2A 4YHNA 4M7LH 3G04A 1HDMA 2V2XA 5DRNB 1XMWA 1YMMA 3GNML 1BZ7A 4ETYA 2LU4A 1JI2A 1WSST 4ODWB 2AK1L 1FYTD 4XCYA 1FZMA 5D2NB 3T77B 4AYFA 1U8NA 2XZCL 1J87A 3SDAC 3QFDB 2GFBB 4G8GB 4GG6E 4OT1H 5I9QB 3GSNA 4ZFZA 4ALAL 2A73B 1S9XA 4K94H 1K4CB 4N0UA 3VFPB 2IANE 3IDNB 4K3EH 3L5XL 1OTTC 1QHOA 4UBDC 1BF8A 3MLXH 5JXEC 2CLZB 2A0LD 4ZUTA 3ZKXB 2BY2A 3C5JA 2GCYA 4H1LA 4XBGA 5GGTL 3EDEA 3LV3B 2YPKA 4A6YB 4YO0A 5SWSB 1VKXB 1ZHNA 4XCFL 1HQRA 3Q6FB 5IB5B 1GHFH 2N7BA 4PJBB 3W0WA 2CUMA 2V7HA 4LU5L 4LOUD 1K4DB 3CMGA 4MAYD 1RY7B 4P5KB 5E00B 4OKVB 4UV4L 1QPPA 3O4LE 1MI5B 1U8JA 2ERJC 4F7CB 2D03L 3EYUH 2AXFB 4MA1C 3QYCA 4JRXB 4PGBA 3CPLB 4F33A 3JBG7 2VZUA 1VESA 3D0VA 1E4WH 1LP9E 2HTLD 5IEHB 2Q86B 2DL2A 2VXUL 1UVQB 2BC4A 4OF7A 5CCKL 5ANMA 5I1LB 4WU7A 2NMSA 1E4XL 4HC1A 3SDXB 1IAKA 1ZT1A 3D0LB 2WV3A 5FB8B 5C0IB 1RHHA 3RWHA 4ODVL 2IF7A 5CINL 3QI9C 4PRPA 5DRZA 5INCB 2A1WH 1ORSA 1QA9B 1S9WA 4MSWB 2VZSA 1T21A 1P9MA 5C7XH 1UWGH 3FFDB 2ZSVA 3MCKA 3G6AB 2GAZA 3GSXA 4ODHH 3NZ8A 3UTTD 5E94B 1AC6A 3IS1X 4R26L 2IH3A 1AR1C 4KK5C 1O7VA 4PP2A 3CVIH 4JN2B 4KQ4L 1KJ2H 1G7JB 1PSKL 2C4FU 4PRBA 1LO0L 4RIRB 5CAYB 3S36X 3BSZH 1CXLA 1S7XB 3I6LE 2Q76A 4K3HA 3QUYA 2OZ4A 2Y5EA 1LE9B 4PJ9A 5GIRA 5D1XA 1DBML 3FO1A 4ZQKB 1NCTA 2V9RA 4G6KL 2RBLA 2K9UA 3BD5A 4XC1H 2AK4D 4ELMB 3FFCA 4MD5A 1BHGA 4QRPB 1TVBB 1GGBL 2X4QA 5BO1H 4D9QD 1J88A 4GKSB 5J1AA 2CDFB 4PJEB 2Y07H 3TESA 2VISB 2FX9L 4HGMA 3KR3L 3MOQA 1S9YA 1K8IA 4YIQA 2X1XR 4HLJA 3W0WE 5A2IH 1ROWA 1CIDA 4RDQF 3WDHA 1FNAA 1MOEA 4OGYH 3EFFA 1KJVB 5AYQA 2OR8A 4I0PC 3QDJB 3SO3B 3ARZA 4NKMB 2D4DA 4LCIL 2R2HB 4JO2L 5J9PB 2V2WA 3MJ9H 4JPIA 4M6OH 5D2LE 2VQ1B 1NGZB 1N6QH 1ITBB 4GQ9H 4ZS6C 2EDRA 3QR2A 2D31B 2CGRH 3G6JF 3IF1A 4FA8A 1YDPA 3TA3B 4UDTB 1R5WB 5L6YH 2P5ED 4GKOA 1CR9L 4JN1H 1PEZA 3K7UA 1A3LH 2YPLD 5EO0B 3S4SB 5FYLL 3IGAB 4X7TA 5DD6A 3U7WH 5KVDL 1JMXA 4PRPE 1NLDL 5D1QA 1BZQK 1A7RH 4OZIA 2VE6B 1CWVA 4PRHE 1JHTA 4FQXA 4JQVC 2FB4L 4YUEL 3EGSB 5HGDA 1LO2H 5EZIH 4HUNB 2YN5A 2A6DA 2Z8SA 5GGSB 4PJ5B 2Q7YA 5DHXB 1IGYA 1MLBA 3GJFH 5JOPE 3QFJA 1BECA 4E42B 3RI5F 3V6OE 4RA0C 4NC1C 3J7HA 4P9HC 3PNWA 2MKLC 4PJIF 3O2DA 1W0WA 5IMMB 4OM0L 5EBGA 4F9LC 3QEGL 4P3CH 1BVLA 3HB3C 4OZGE 5CJ5A 4U1JA 4LBEB 1RUPL 1S7TA 4ORGA 1JE6A 3CK0H 4NYLA 3V0WL 2ADGB 4I3GA 3N50A 2NY0B 4WI6A 5H94B 3RWDB 4O51A 3TT3H 1KJMA 2OTWB 3BUYB 4U6HB 3TJEH 3P9MA 1BLNB 3S9DB 5B8CC 4P5TD 1N64H 3BJ91 2VWEE 1YQ2A 1MCOL 5C0FB 3MA9L 3BKYL 2PTVA 1S7WB 1OCWH 4M43L 1QBML 4PS4H 5FM5O 3F7RA 1MRCL 4XMKH 5EUOB 1R0AH 2EEDA 3GGWA 3C5ZA 4F7PB 2Z0BA 3ARGD 5D2NC 4H0GA 4LCWA 2W59A 2CRIA 4EQ2A 5HPOA 4N5UA 2RJMA 2VLME 3PWPB 5I9QC 4YXHL 1GGUA 4CDGC 1MCNA 3CFEA 3KYNB 4M7ZB 4DKEH 1ZS8A 2X2YA 2JLLA 5IESH 1XR8A 3WIHH 2AERT 1HEZA 4E5XA 4XB8A 1CFBA 1IAMA 5HHOE 3CDFA 3NFNA 2I25N 3QQ3A 1ZTXL 5GXBB 1UZ6F 1YEKL 4PFEA 1J8HE 3O11A 3VD9A 1Z9OA 4HXBH 3ZKXC 5CIPH 5ACZB 3P9WB 2I26N 1HKLL 2GSIA 4OQ1A 3VDAA 2YC1B 4L29A 5IFHH 4WHYH 1RUML 1IL1B 3QUXA 3U9PH 4NQSA 2B4CC 4FP8H 4OIBA 3MRCB 3TT1L 4X7SH 4NOFA 5CJ8A 5KSAD 3VFTB 3H9HA 1X7QB 3CSBA 1U2CA 3UJIH 1WAAE 3KWWA 4XPFL 1M71A 4C4KT 1TJIL 1CDYA 2CRMA 1QSFB 1KCVL 2GTZB 1P53A 12E8H 1GVIA 3H8NA 1CLZH 3BWAB 1EZVX 5IB3B 4TUKL 2NW2A 4KZDH 1ES0B 5FHAH 3RGVD 2ZOKA 4KKAD 3EYOB 4AEIL 1CBVL 1NMBL 4J6RL 1OT1A 5J7CC 1FBIH 3LPFA 1EEUA 3TVMB 5ITFB 3WNLA 1T4KA 1UWEL 1AXSB 3BP5B 1UM5H 4K23H 5GJTH 3VFVA 3GSQA 5DUMH 4M1DL 3PQYE 2E8ZA 3BRFA 2Y5TB 3WLWD 3DX7A 5CBAA 4LLYB 2X09A 2EZ0D 5FV2A 4IRSA 2C1OB 3BT2H 1BOGA 1A7QL 1PKOA 5TPWL 5CSZA 5K9OA 1N3NB 5GQBA 4UQ2B 1DL7L 5KN5B 3ULVD 1J0IA 3MV9D 4RMWA 3TIDB 1E6OH 3HAEH 5D7KE 2XFXB 1U36A 1Z3GH 4R90L 1AE6H 1T7WA 5EZOH 5FO8A 4ZOBA 5I76A 2DQCL 4QKXB 4J3VA 2DMCA 2X7LB 3FT4B 1V8HA 1D7FA 2NX5D 1KBGH 1Z6JT 4CAGA 2ID5A 5LGHL 2E9WA 5T3ZL 4JG0L 5C08D 3FQWB 4KQ3L 4ZUVB 4EOWL 2OCFD 5BS0E 1WZLA 1BWWA 5F1NB 2VLJB 1NC4B 2R0KL 5DEGB 4XH2A 1B4JL 4O58L 1YQVH 5J3HC 2XWBA 2EE2A 3LSOA 2GTWB 4P49A 2V17L 4TSAL 5ICZB 2IBBA 4APQB 1PGRB 2VL5A 5TE6L 5D5MF 2VLRD 3ISWA 3VW3L 3KS0H 3WLBA 4LPYA 5L8LB 2DLEA 1AQDB 3MRJB 1AJ7L 1Q72H 4JDVB 4OCYH 4BFBD 4ISVA 4GAJH 1DQJB 2EC9U 3K8LA 1CFVH 2KDGA 4W4OA 1ZLUK 4PRID 1U92A 3ARBD 3MRIA 4JLRB 2VXSL 3RIFK 3DYMA 4LIQL 3SO3C 1JHKL 5H35B 4LL9A 1ND0A 4FTVE 5GS0L 3UPRA 1J1XH 4TRPH 2H26A 4F58H 1T89A 3IFLL 4I3SH 3D18A 2UUDH 1NDGB 4DKFH 3LS4L 2FEEI 4CU6A 2R2BA 3BD4A 5DJCB 2QHRL 43C9A 5EC2B 3QEUB 4K7FA 2F15A 1BREA 1NC2B 4XGZB 3ALWA 5CZKA 3TA3C 3OXRA 2NY5H 5CGMA 4D94A 3DTXB 1D3CA 5SWZB 2FSEB 2PETA 4ZXBD 2R29L 4Y2DB 4PJDB 1X5GA 1XGRA 3GIVB 4N90E 1D5XA 5F8RC 3GMLA 3W5MA 2DQDL 5EU4B 5HYJD 3MLWH 3I02B 2OL3L 5DHVB 2X4RB 2DIBA 3U0TB 3MRFA 1P4IH 3ULSA 3D25B 1ZVHA 4JFOA 2R0WL 4WW2A 1RSFA 4P3WA 2G2RA 1U42A 5CJQL 3CX5K 3C08L 2NY4B 3LZFH 5HI5D 1KPVB 1AGCA 4MZ2A 3GI9L 1NMAL 5BRZD 4PJBF 3T3PE 4EI5D 3KXFA 4Y1AA 3OV6A 4P4KB 4QRSB 5ERWA 5F88A 1I9JH 4XCEA 2JB6B 3X3FL 4WI9A 3AC0A 3K4DA 2H6PB 4XVTL 5DUBB 1DQQA 2FCBA 1GSMA 2W60A 1KELH 1NSNL 2AJVH 3S34L 4RFNB 4ONHB 4Y5XA 2XNAA 2EKSA 4G9DB 4KKCD 2NY0C 1XGQB 5F3BB 4S1RH 4JHBA 1ZE3C 4L4TA 4M7KH 4WNQA 2DQUL 3GB7A 4RAUB 2NY2D 2YWZA 5HVHB 1IQDB 3QDHA 4MA3B 5E8DH 1YEEL 3BN9D 1NCAH 4BA8A 1A9EB 2HKHH 3K2UL 4HS6A 2BP3A 2UZIL 1D5IH 1TENA 3FOMA 3O3UN 1H5BA 1IBGL 2XWTA 3UC0L 4ZD3L 3LKNB 1NDMB 2NZ9C 3VFGL 1CGSH 3S3SA 3KAAA 2D0FA 1TZIB 4PG2A 2VDQL 1AC0A 5EIIB 1JPGB 3GIZL 3U2SA 5EO1B 1HHHA 2BNRD 4NGHL 3LEYH 4YQXH 1UZ8B 2DICA 3QUZD 1T2XA 1HSBA 2DOCA 1FNFA 3DBXB 1L6ZA 4XWOC 1EEZB 4OLWL 5D93B 1XIWD 1BM3L 1T22B 5I2IA 3K1KC 3MRMA 3QPQC 4XP5H 4M7ZC 4NRXA 4DQOH 2EO1A 2HJKA 4HULB 1Q1JH 4UDUB 1DBBH 2NR6C 3ARFA 4JFDA 3UBXA 2HKFH 4YDKH 3P0VH 4HPYL 1ORQB 1TZGL 4FFZL 1VFAA 4JY4B 1CL7L 4H0IA 5JW3L 4NZUH 5JW4R 3GMNB 2VYRE 3HE7D 1NEZA 4OLVH 4D3CH 5DR5L 3MX0A 4QNPF 3V5KA 1VFBA 5ISZB 2DIAA 1E6JL 4WGVB 3DXAB 1EJ6A 1JNLH 2P47B 1U41A 4XP6L 5C0AE 3PL6B 1QFHA 1P69B 3N1FC 3AROA 5IROA 4Z5RB 2DLFL 4LLVB 1L0QA 2J8HA 3L95A 4AM0A 4JRYD 1H8NA 4PJCB 4KVCH 4X0KA 4DZBA 5I75B 4MLIA 1D6VH 4OAWB 4MQXD 3CUPB 1AI1L 2DDQH 4G7VH 1JMZA 4PV9B 5B39B 3E2HB 3TVMC 3CSYB 4P2OB 2F53B 1DBJH 4MNQD 2DLHA 5IMLB 1FIEA 5GGUB 4KKLD 1DLHB 4LU5H 3MMEB 25C8L 1BQUA 2DBLL 2OSLA 3GDBA 3FMGH 4L4TE 3RWGB 2E7LA 1EGJL 1ZAGA 2HFTA 1FIGH 1I1AD 2XTLA 1FNHA 5D7IF 5D71L 3LQAH 5LCVH 2ZSWA 1P5UA 3D3VB 1Z5LB 3NPZB 4UV7H 2HT2C 2Q8AH 1I9IL 2QADB 1G7QB 2A74A 5DUPL 3IS0X 3ZMRA 3SDAA 3T8XA 5IR1B 1FLTX 4TVPL 1MCJA 4BKLA 1JZ2A 5HI3C 1UXWB 3MLVL 5JPNB 4QYOA 1DLFH 4HBCH 1LO5B 5C07E 2ITCB 3QG7L 2NPLX 1OWRM 4QXWA 5C0CD 5B38G 5GSVB 1KNOA 4DN3H 4M48H 4U6YB 1LK2A 2ADFL 1F8TL 4Y5VB 1KULA 4N1CA 5J89A 5IB4A 4APQC 1TETL 4N9OB 4HCRH 3MRGB 4YNYA 4P2RA 5FA3B 5DQ9B 2X4PA 4NNXB 3SBWA 2NQCA 1WF5A 4XP4H 5C6TH 3QZWA 3PHSA 3B9KD 1U8LB 3O2WL 5HSFA 1ZT4A 5E9DE 3MLTA 5FCUH 4Z76B 2R8SH 3DO7A 2VDNL 3QIWB 1I3RA 3QJHB 3IFOB 1OHQA 1OD9A 3ZTJH 1P7KB 1XH3A 2ATKA 5BVJA 1G0YR 1HXYB 2EYTB 5GRJH 5BXFB 3MGOA 1G7PA 3MRHB 2AI0H 3NA4A 2B0SL 3P77A 3JWNC 1JGUH 2MJWA 1FAIH 1C12A 3QP3A 5EUOF 4JB9L 3M8OL 3DX9B 3OAZK 3C9NA 4LKCA 4NQDD 2ICES 1G7IB 4ZUSB 4MB4A 3IKCB 3UJTH 4Y2DC 3MTRA 5BJTB 3I9GL 5F9DC 2VKWA 1PLGL 1HH9A 1XGYH 4OD2A 5DDHA 3L3JA 3OHXA 1M7IB 4YHIA 5IMOB 1VSCA 2BNQD 1RU9L 4G5ZH 3PP3K 5JHLL 3KPRA 1KJ2A 2VC2H 4JPWH 4N8VA 2CRZA 1X5FA 1YEJL 3G6JE 4X4YA 5IM7A 3V0AC 3VFUB 1RFDH 2M1KA 5C92A 3HZMA 3SJVD 3V5DB 2NY4C 1G7LA 4S2SB 1T5XB 3H9SA 4XI5D 3TBWA 1LO3H 1NFKA 3CFBA 1T03L 2OL3B 3MFGB 2WLYA 4P4KC 1CR9H 5T5FH 1ITCA 3QCUL 2MMXA 1HHJA 1OP3H 5KJRH 1K6QL 3D85D 3ARRA 5E1HB 4C56E 4G7YL 5TDPB 5I1AA 2C1PB 3UPCA 4LHUD 3LDBB 4RFNC 3VMOA 3BPLB 3HC3H 4YDJB 4X6EB 1S9VA 1A1MA 4PV8A 3BVNA 3TN0D 4F3FB 4EKXA 3AB0B 4Q9BA 9CGTA 2AGJH 5HVHC 4FMKA 5DD3L 4KAQH 1GZQB 2WWKT 4K2UL 5CEYA 4KPHH 4PJIE 4WUKH 1U6AL 3Q0HA 4FFVC 5E8PB 3HLAA 3ARVA 3H6JA 4I0PA 2AXGA 2LE9A 3SDDB 3C8DA 4KRPD 1LD9B 2AABL 3VRJB 3O3EB 3ULVF 2F5BL 5IBLC 5HDOA 5D93C 1G7HA 3EO1B 4QTIL 3V0VB 1G1YA 3GJEA 3LRGA 4WFFE 1PYWB 5LXGL 3MRKA 3Q5YA 3C6LD 4MAUL 4ZTOH 4ZSOA 1YEHL 1UCTA 2VDOH 1W2KT 4OD1H 3V4VH 4LF3B 1CIUA 2PXYD 1AGFB 3O81A 4IJ3B 5F7LB 5C09D 1F3DH 2PUQT 4N0CC 3H0TA 2XQYG 1RULL 3GJFA 4DCQB 1K2DB 4XPHH 5J06A 4JQVA 2ESVD 1E28B 2MPAL 1EHAA 3CFKB 3VFSA 6CGTA 2PYED 2PW2B 5HVGB 3PG2A 4KK9D 3L5WB 1WFTA 3PL6C 4WUUE 5F8QC 1QR1A 4TUJA 3VXMD 1DDHA 2YZ8A 2HTKD 3RU8H 1V3KA 5I75C 3QJFA 4HS8L 1SYSB 5GS3A 3LEXB 2AV1B 4L1DA 4X6BB 1VPOH 4F9LA 5C0EB 4R3SB 3OKMB 5DJDB 3QB7C 1NJ9A 2A9NL 2QQKH 4L3CA 5AWNH 5FYKE 3LKRB 1ZWIA 3E2HC 4OTXL 5CD5D 4JO4H 3UO1L 3VE0B 4P2OC 4CVWA 2KKQA 4HMCA 2G5BA 4ZAKD 1RVFL 5JMOC 3QA3A 1F3JA 4YXKH 3QO0B 5MP6L 2F5AL 4MHHI 3V6BR 1KLUA 3SE4C 1UG9A 1QLEL 5DVMA 1UKTA 5CJOH 1N4XH 2PKDA 4M93B 8FABB 2VN4A 3MV8B 4DVBB 1TPXB 2BSRB 2P45B 3K46A 1V3LA 5DRNA 1JYWA 4YHOH 5JW4M 5DD0H 1T0PB 1C1EH 5E56A 4ODWA 1CFTB 4R96A 3O3DB 3V4PH 3REVB 3MCLH 3WIHA 5D2NA 3T77A 1Q38A 4WJ5A 3VCLA 4N0YL 2QADC 2GFBA 3ME0A 1UWEH 3EW3B 2JK5B 4PLJC 4X9FA 4UT7H 5T33H 3VRLF 3RPIA 2A73A 5CIPA 1K4CA 3VFPA 4J3OC 3HE6B 3QXDB 3MRDB 2W9EH 4HXAL 3MRLB 2CH8A 2FATH 2CLZA 4Y5VC 4TULH 2XRAH 3KJ4B 3SQOL 4KK6D 3LV3A 1DL7H 1FC2D 1MJ7H 5SWSA 4LDEB 1PKQB 3TZVD 5IB5A 4AEHH 2DQGH 4FXKA 5E00A 4PRAA 2NY1B 1OAYL 3UROR 5IVXB 1MHCA 4OKVA 1HKFA 2VQTA 5HGBB 1KXTB 3AVEA 1MEXL 1F4YL 3QIWC 1DFBL 4X9HA 4K8RD 3S5LA 3WFBH 1K9TA 4E41E 5HPMB 2FIRT 4F7CA 1FORH 4HWUA 2AXFA 1QG3A 3RX7A 2GT9A 3CPLA 3PDDA 5C0RH 4NC1E 5C3TA 4PP1C 3BXNB 3A6BH 3T0EB 4Y4KD 4MX7B 3RQ3A 3WFDH 1G9ML 5IEHA 2Q86A 2GSGB 5CWSA 1YC8A 1X9QA 2OTUB 1VFMA 4Y7MA 5I1LA 1RZKL 4JDZA 3SDXA 2XZAL 3D0LA 5GS0C 5FB8A 4MJID 1D9KD 2A6KB 3JWDC 5CD3B 1SEQH 1KTLB 2R2EA 3KLSA 3ES6A 5INCA 3I50L 1QA9A 5IW1B 4MSWA 2FHBA 4OLUL 2M2DA 4HUWB 4POYA 3JWDH 2VJXA 3G6AA 3T1WA 3HZVB 2YA2A 1AHWB 1BAFL 2K1MA 5E94A 1YN6A 3HMXL 4ENEC 4CUCA 4HV8B 3TFKD 4LLDA 2VDPL 5CEZD 3DO3A 4G8GE 5EG6C 1G7JA 1MSPA 2VZVA 4JDTH 4RIRA 4DVRH 4YHLL 3QHZH 2CXGA 1MELA 1IQWL 5DURD 4AT6B 3OAYK 4EN3D 1LE9A 5DEFA 5LQBH 1IAII 4RFOL 3CFIC 4ZQKA 4XHJC 1NBQA 4FQQB 4ELMA 3LIZL 1UXSB 4WENB 1TVBA 3LDBC 3I6KA 4PJCF 1IC5L 2E3VA 4XXDB 3BPLC 4GKSA 2JELH 4PJEA 3CFJB 2VISA 3AB0C 2I60L 2XZZA 2GJ6D 4FNLH 5IIEB 5DJAB 1UWXH 3L3IA 4PJBE 4TSBL 3S88H 5JPMB 3MNVA 4MJ6B 3NCYP 3QXAB 1TQBB 1EBPA 1D6EB 1MI5E 3SDDC 3QDJA 3OB0H 1MFDH 1VHPA 4G3YL 3HNSL 4JRXE 3HS0A 1IEBB 2R2HA 4MA8L 5J9PA 1XCTB 2IALB 1N5YH 1NGZA 3I3DA 4WU5A 5H2BB 5C0GB 4ZO8A 4HIIB 3MV7D 4U7SA 2EICA 4S1QH 2B20A 1BQHA 1RZGA 3TA3A 3VFRB 1YYMH 4UDTA 3P30L 3V95A 1R5WA 2IAMD 3B9AA 1T2JA 5L2JB 2CJUH 4LLMB 3RUGB 4NDMA 3EYQC 3Q6GL 2OTPA 4M4PA 4NQED 2BCKB 2FEDC 4PUBH 4IJ3C 3IGAA 5EO0A 3S4SA 4X4ZA 3EJZC 2EE3A 3UDWC 1C5DA 4HPOH 4WGWB 3UTTE 4X4ME 4GG8B 4OQTH 4F7MB 4UI2A 2VE6A 3IXTB 2R2CA 1JNHB 3RDTD 4HGWB 3EGSA 1IVLA 3FO2B 5KOMC 4M02A 4H26B 4S0TD 4PJ5A 2J8UB 5H8DA 5DF0A 1JPST 4D9LH 1I8IB 1JK8A 2UZXB 4E42A 5DXWA 4XTRD 5DK2B 4JE4B 4MAYB 3NFSL 1OY3B 4M00A 1EEYB 3W9DB 3BH9B 4MXWL 5LBSL 5CMAB 4QNPE 1N2RB 4LBEA 4OB5L 3EIFA 4Z0BL 1FLRH 3H9YA 1T7ZA 3W11D 1E4XI 4E0RA 5GZNC 4QRPE 4TTDC 3RWDA 2XA3A 4CMMB 4MNHB 4JJ5B 4YBQD 2OTWA 3BUYA 3MLUH 3VG0L 1KXQE 2XYCA 4PGZA 1BLNA 3QDGD 4MCZA 5LKNA 1NCCH 4EXPX 3VXUD 2ZUYA 1TPXC 2BY3A 5T1LD 5C0FA 3UAJD 3JV0A 1A2YA 1S7WA 4LEOB 5BOZG 4N8CH 4PJGF 3IU4H 4QWWC 3QDJE 4JFED 5K9QG 1LEIA 4F7PA 1YNKH 3U7YL 1WCBA 1NKRA 5M95B 3BESR 5JOFA 3PWPA 5A3IC 3KYNA 1CDGA 2P5EE 3EJYC 1ZLWH 1CDUA 4IMLB 5GRWA 1NH6A 4FZ8L 5D7IE 1N7MH 3L9RA 3THMH 3WXVH 3HE6C 1EAPA 4U49A 2O93L 1CICD 5T5NG 4LFHD 3FT3A 1CK0L 4HWNA 4HAFA 4ZOCA 5ACZA 2O5YH 4ZFGL 2YC1A 1HINL 4BYHA 2VLKD 3UZVB 4JPVH 5E8NB 1MJUH 2CD0A 4GRWB 3LN4B 4G9FD 4L4VB 2EDFA 2C4FT 1EUTA 4KZEL 5KVEL 5KVFH 1EIBA 2X10A 4JHZA 3VFTA 4K3JL 1R5IB 2IPTL 3EFDH 1MFAH 1X7QA 4AQ1B 5EIQA 1JTOA 2VH5L 1VA9A 3WNMA 5GGTA 1UYWH 3B2UC 3NGBB 1QSFA 2ZUVA 1J9CT 2GTZA 4F8TA 3BWAA 5JHDD 3WD5L 5IB3A 4Q9QL 3QIUD 1ES0A 3KHOA 3T0EC 4HUVB 3EYOA 3DSFL 5FYKH 3S98A 2P24B 2HRPH 1H3TA 1JCKA 3TVMA 3W9EA 5CHNA 4BQ9A 5ITFA 1R3IL 3B5TA 3ZSTA 1AXSA 3BP5A 4PJ7F 5T3XD 5FYJL 1I75A 3AMLA 1X5ZA 2Z92B 4R6UA 2AJUL 1MWAL 1CFNB 2Y5TA 2APVA 1QEWB 4W6XB 4UINL 4LLYA 4LSSH 5D8JH 4U4BA 2X4TA 1SVZA 3WIIH 2DB8A 4WV1B 2DYPB 4MNGE 4YR6A 3E8UL 2F54B 4R97C 5SX4I 1MCKA 1NBVL 4S0SD 4DW2H 1Z0MA 4GKNB 4NM4L 5FUZL 3DWTA 4UQ2A 5KN5A 2I9LB 2WUCH 5E5UB 3KYKH 5ALBH 1AHWC 3TIDA 5EUOE 5TQ2L 2XFXA 4QXGH 1HWGB 3VGAB 2HVKA 2OX5A 5GHWL 4JFYA 1INQB 2X7LA 3OG6B 4FS0A 1YUHB 4C4KO 4Z9KB 3QEQD 1JZ7A 4ZUVA 5C8JB 2Y36L 3OKDB 5F1NA 3CH1B 4X80L 3IJSB 1NC4A 5DEGA 1OSPL 5TE7L 4LVOB 5GGRY 2GTWA 4QXUH 5ICZA 4APQA 1A6VL 4KHXH 3IDGB 4OIAA 1I7ZA 3PWLA 1RZ8B 4ZTPL 1HYSC 3IFNH 1AQDA 3MRJA 4JDVA 5L7XH 4NUGL 5TF1H 4RMRA 5EDXA 1CXHA 3QDMB 1DQJA 4MMZC 4LSQH 1FFQA 4Q7DA 5C0BA 5L88L 2R56H 4OD3H 3ULUD 5DMIH 2EDJA 4HQQL 1TQBC 3JUZA 1A6ZA 2ENSA 5D7JD 4EDWL 5H35A 3V9FA 3VH8G 1I3UA 4JZJC 2R39A 5FUOL 5T1KD 5IBTH 2R0LH 5F7YC 1NDGA 4L3EB 1QFWM 1NFDB 5DVKA 3DRTB 5B38B 5DJCA 1WK0A 1SJEB 4FQPA 1JZ4A 3QEUA 4MYWB 3L7EA 1NC2A 5HHMB 4R8WH 3NOIA 4UTAH 1MREL 3F58H 5MEND 2HLAB 1QRND 1A7PH 1BBDL 1YEDB 2YEZA 4QOKA 5ESQA 5SWZA 1MCFA 2FSEA 3TEUA 5FOJA 1CS6A 4MLSA 4Y2DA 5H37G 1YECL 3MBXL 3MOAH 4PJDA 3GIVA 4JCLA 3ULVE 3OQ3B 3DX8B 4WEBH 4P0DA 1IGFH 3EAKA 3QWRD 5EU4A 1U3ZA 1X5KA 5IMKB 2A77H 2ZCLL 3BMVA 3I02A 1F58L 3GJFK 5DHVA 5MEQB 1J5OL 3RJDA 4PTTA 1KIQA 4QTIH 4J4PA 1SJVA 3R1GL 2NX5E 3D25A 4DK3A 4FQJL 5E8EB 2AJXH 2VUYA 1KCSH 3GHBH 5LXGH 5D6DC 2X44D 4O2EB 4KJPD 1KPVA 5F1SA 3VXRB 1MAML 1IGIH 3LMJH 4HWEH 4MAYC 4P4KA 5EU5B 2XXMB 4JY5H 2JB6A 4QGYA 1ONQB 2H6PA 5DUBA 2HVJB 3P0YL 2VLRE 5JA8B 2VLJE 4Q58C 3D87B 1I8KB 4C59B 2X40A 1TXKA 2FL5A 1VGKA 4ONHA 4G9DA 4KJYB 5F3BA 1XGQA 1MQKH 3UCRA 3SE9H 1CDCA 1B0RB 1QVOB 1XF3A 5D70H 3P0GB 1OD7A 5BMFL 4LSVL 4MA3A 2VRAA 3GUTB 1HOCB 5FGCB 2XTJD 3SKJL 4FRWA 4KJQD 2MHAB 5KSVB 3HFML 1A0QH 3LKNA 1MY7A 3C09B 4UT6H 5D96B 3A67H 1TZIA 1HZHL 4NT6A 3ILPB 5B4MD 2HYMA 1JPGA 5LWYL 1IC7H 5EO1A 4YHML 4FQ1H 4BUHA 4JM2D 5I6XB 4UOJA 1UZ8A 2VDLH 3DBXA 3LPGA 2CUIA 1T22A 4YDVA 2F74A 3WFCH 3M45A 5A2JH 1KPUA 1JRHH 5I8CA 1FNEA 4C57C 5ADPH 4HF5H 4UDUA 5I8KL 1OOAA 3BD3A 4MXVF 4M1CC 4JY4A 1AD9B 3OR7A 2ZUXA 3SE3C 4HLZG 2COQA 3BFOA 4PJDE 3QUMH 3CU1A 4KVNH 1L7TL 5JQ6L 2BSSA 5ISZA 1CE6B 3CC5B 1QSVA 4P2QB 2X9YA 3AAZB 3VRLE 3AU1B 3W39B 1C08B 3DI2B 2QQLH 4B0MM 1MCIA 1W8NA 2E5EA 5FYLE 2ADJB 4KROD 4Q74A 4Z5RA 4HUKB 4LLVA 3CU7A 3KPSD 1GGIL 3T09A 3PV6A 3H3PH 2VKXA 3C60D 4HEME 1F4HA 2UV3A 3RVXC 1LQSR 4OAWA 4V1DD 1XF5A 3CUPA 1TCRA 3OWEA 3GZKA 1RUKL 5GJSH 1RZ7H 5CSBA 2IH1A 5B39A 4G6AD 1CDBA 2EC9T 4IS6A 4HWBH 3VA2C 1RJCA 2F53A 5IMLA 4FZEH 5GGUA 1DLHA 4LAQH 3MMEA 2ZKHL 1HIML 4Z7UB 3SE4A 1N6UA 3NABL 4BQ8A 2B5IC 1NGWB 2DM7A 3DV4B 3RWGA 1AKJD 2E6JA 4WV1C 5K33A 5D7LD 3L5HA 1IT9H 1G9MC 4R0LB 4UB0L 4PREB 5F7EL 2XIDA 2EH8H 3T0XA 1RZKC 1PVHA 3D3VA 2IFFL 1Z5LA 1MWAB 5GRUH 3SOBL 5HD8D 4NZRL 3VGAC 1G7QA 3RWEB 4OLZL 5IR1A 1YYLH 1JZ5A 1JNNL 5IJKC 4K9EC 2JCCB 1TLKA 2JB5L 1UXWA 5JPNA 2XKUA 1LO5A 1QSED 5GGVL 1CLOL 4GS7B 3TYFB 2ITCA 4WO4D 1JGEA 5SV4A 3EZ8A 2I5YL 1CGTA 4K9EH 1DEEB 1Q0YH 4LVOC 2J8UF 1R3LB 3EO0B 4U6YA 2FLRT 4AMKL 3L6FA 4UAOB 2C4XA 3O6ML 4LARL 5ALCL 5FA3A 5TDNB 1OWWA 3SKNB 3FN0L 3KYOB 4Z7VF 3SKOB 4DTGL 4BSJA 2ZWLT 2C7UB 1U8LA 1CGVA 3R0MA 4YDIH 3DXAE 4N8PA 3SCMB 4Z76A 1PG7H 1UCBL 3QIWA 4JRYE 5JDSB 3IFOA 3O45B 3CFDB 1OP5K 1U3HD 5C9JB 1P7KA 4LFHG 4U2YA 3G5ZB 5F70A 2D7OA 2EYTA 2R0ZL 1U3YA 4PJCE 5HBBA 1DQML 5BXFA 1S5IL 3WNNA 4MNQE 3N85L 2AJSL 1NGYA 2ZCKH 2KQNA 5HHPB 4QEGA 1RJZB 3AUVA 3DX9A 2F53E 3BQUA 5CEXB 1DBAL 5E7BA 2A9MH 1IEAB 1SMOA 4F9PA 2ENYA 5AUMB 4ZUSA 1IC4L 2YBRB 3IKCA 5CS7A 1NCWL 3BP6A 1MIML 1IAIH 1BIHA 5D9SA 1KGCE 1M7IA 1S3KL 2BXYA 2CLRB 4U6VL 5IMOA 4IM8A 4NQCB 1U8IB 5E8OB 3RNQB 3D3VE 3O8XB 2E9IA 4LLUB 1Z9SA 1MCHA 3VFUA 3HRPA 4LGSB 2V5SA 5EBMA 1NKOA 4GO6B 2CXKA 3FHQA 1T5XA 2AV7B 1L7IL 1DQTA 1LWRA 3PWJB 1OAXL 4GMTH