4U6HA

Vaccinia l1/m12b9-fab complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
219
structure length
217
Chain Sequence
QVQLQQSGAELVKTGASLRMSCKSSGYTFTRFWMHWIKQSPGQGLEWIGYINPSTGYTEYNQKFKDKATLTADRSSTTAYMQLISLTSGDSAVYYCARSDQTNYLFPYWGQGTLVTVSAAKTTAPSVYPLAPVCGTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Heavy chain of murine anti-vaccinia L1 IgG2a antibody M12B9
publication title Potent neutralization of vaccinia virus by divergent murine antibodies targeting a common site of vulnerability in l1 protein.
pubmed doi rcsb
source organism Vaccinia virus
total genus 44
structure length 217
sequence length 219
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u6hA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u6hA02
4HMCA 5CCKL 1PSKH 4XNYH 2VC2L 3TCLB 3GHBL 1T1YA 3B9AA 4ZUSA 1DUZA 3EOAA 2WBJC 4Q9QH 4P4RB 3KYOB 5ELIA 4PUBH 3SDCB 5C6WH 3V6OE 1MRFL 1EIBA 2AV1B 2CDGB 1I1RA 3QIWC 3PWPB 2JJSC 3VWJB 3WYRA 1O7VA 1IM3A 2R4SL 4PJ7A 4PJ8B 5IG7B 4LVHC 3MUZ1 1G7LB 2HRLA 4PRIB 2A74B 1CYGA 5BRZB 4EI6B 4KKCD 5CZVH 3CFBA 4DK6A 4K94H 2X7LA 4ERSL 2BC4A 1UB6A 1BZ9A 5KTEL 2WV3A 4IRJB 4RAHA 3H42H 3PWVA 4LPVA 3U79A 5ICZA 3EOYG 1Q9OB 4PGZA 4DAGL 4ALAH 5E6IC 3C08H 1YPZE 3GSRB 5IK3A 4QHMB 5DLML 3IDUA 4D3CH 4U33A 5CD3B 3ES6A 5IVZB 2W60B 1MIML 1YEJL 2V2TA 1G7MB 4GRLD 3T65B 5IJVB 2VLKA 1M05B 1X4XA 3ARFC 3VD3A 5HGHB 1J8HA 4NQEA 4OUUB 4XXCC 2HT3C 1J1PH 4HFWA 1A9EA 3QWRA 4DWHA 5I71C 5BZWB 5EUOF 2R9HC 1T4KB 1D3CA 3EYOA 3I50L 2VDOL 2FJHA 1MH5A 4Y89A 1XF2A 1CDIA 3FJTA 4OF6A 5TQ2H 1KENH 4KK5D 1WBXB 2IADA 4O58H 4WCYH 5IW6A 4Q7DA 4ZAKA 3RVUD 3WN5B 4NDMB 4D8PB 4YFLF 4KJWC 4I5BB 1MRDL 4WW1B 4PJ5E 1NC4A 3ULSA 3D18B 1FQ9C 2EH8L 1FNHA 3O81A 5HVFB 5HDBE 3RX8A 4BK4A 4X6CA 2R69L 4DK3A 2P47B 1GYAA 4KPHH 5BCAA 3BIBX 1T83A 4ZPTA 4GRMB 4JO3H 3IRPX 3WEXA 4U1JB 4HZLB 2Y6SD 4NO2A 3IXAA 3GMPB 3MGOA 4P2QD 4ZDHB 4ZTPH 2XIDA 4FZ8L 3GIZH 1I9IL 1JGDA 3QHTC 4ZFZA 5C86A 2VUYA 4Q6IA 1XEDA 4LPXA 5GPRA 5E8EA 4B7LA 5LXGL 4LEOB 4RGNB 2R0ZL 4MB3A 4CMMA 3LQAL 1U8HB 3T3MF 3O11B 3VXPA 5ISZB 1CT8B 4IOSD 4NQSB 3QRFM 4PJHE 2X4PB 3G6DL 2FR4B 4P3WA 4QRQA 5DEZA 3HS0A 3NIDE 3ROLA 2GEEA 5HDOA 2AXJA 3CVHL 5BVPL 1A4JB 1GGUA 1BM3H 3IDYC 3WO4C 3MV11 2J12B 1RK1A 3ZKXB 3OJDB 2BSED 1Q38A 3TO4B 3WBDA 3T0XA 5FKPA 2OR9H 1MCWM 2YPKA 1HOCA 4Z7OE 3F7YB 1OGAA 1CIDA 1I85A 3GUTB 3CXHK 3BJLA 2UWEF 3KNBA 3O3DB 5DD0H 1KJ3H 2C3GA 2E6QA 5DRWB 4KQ3H 3D39D 5EOCL 3AS3A 3GSUB 2EH7H 1NLBL 2GJZB 1AHWB 5F1KC 3TGXA 1QO3B 1WGOA 3HKFA 3CXHJ 3HC3L 4E9LA 3Q6FB 4L8BB 2NX5D 4LEXH 3VWKB 4F2MA 1QLRB 3NACL 3LS5L 2W65B 4S1QH 1CGSL 2DKMA 4WU7A 1ZHBA 2CKNA 3OR7A 2ITCB 5HHOA 1FBIL 1FN4A 4NT6A 5TPWH 4PJXB 5B4MD 4Y88A 1KLUB 3KJ4B 1JHKL 4ODTH 4F9PC 3BP6A 4NQTA 4KROD 2ZPKH 1DDHA 1A6TA 1X5GA 2VAAB 3BXNB 5JPMB 3MRPB 3L3GB 3TNMB 4RFEB 4UBDC 4Z77B 4OV6F 1K8IA 5ECJE 5GSRB 2DN7A 1T20B 4U7MA 2VH5H 3TIDA 4K9EC 5IBUG 3M17A 5JHDE 4OIBA 5DMIH 3SBWA 2VTFA 1M7DB 2JCCE 4OFPA 5F6IC 4LLMA 1C5BH 2DQIL 3MV9A 3SDAB 1NC2D 4EKXA 3EW3B 5L2KD 5C08B 1X5IA 3EFFA 3AUVA 1MUJB 2B1HH 2XWTB 3CC5B 2PYEE 3EGSB 4KTEL 5ICYA 3UTZA 5JOFA 1SYSA 5D1ZB 4WHTB 4P4KA 1P53A 2OM5A 3RTQB 2O5YL 1JFQL 2JKXA 3PHQA 1A3LH 3MACL 4TN9A 4C56A 1T89A 3U4EA 4XPHH 3PQYE 4L4TD 1RIVH 3H6JA 1ZS8B 4YNYB 5CWSA 1CTOA 4XPFH 2H8PA 3N1FC 5JDJA 5TF0A 2GKIA 4KXZH 3MFFA 1U8LB 1TNMA 1VACB 3MQIA 1BD2E 3MLPA 3UZVB 1IC5L 2XZCH 2HFGH 4KKBD 3KPOB 4L29B 5EZLB 2VLME 4H8WC 1JVKA 4GG6B 1F6AA 2NY7H 4NQXB 2QKIA 3OKLB 3DJ9A 4FG6C 4L8CB 2DQEL 4XAKD 4XMKH 5IBLC 4CNIA 4XXDB 3OQ3B 1OLLA 3QDGD 1H0DB 2HMIC 1IKFL 2M2DA 4HUMB 4OGZA 1S9WB 5KSUB 3VW3L 2ADIA 1CGVA 3VH8G 1FL5A 2OXHA 2Y72A 4PRNA 5C0BD 3RVXD 1UM5H 1QFWI 4XPGH 2XKNB 1RZJH 3CFKA 1QSED 5FK9B 2RFXA 3SKMB 4RIRB 2Y7QA 3DVIA 3U0TB 5MP6L 1I3GH 4N8VA 4D9QD 2Z93A 3GSOB 3UJIH 1NFDF 4LP5A 4RFOL 2IAND 5I1HH 2DQJH 4NQCA 3ARVA 2VL5A 3FKUS 3L3KA 1F4XH 1FNLA 4H1LB 2BFVL 4LRNH 5FUOH 3O6LH 4FS0A 3VH8B 1C7TA 2V17L 2LU3A 1Q0XL 2I25N 4U1GC 5IFHH 5E8PA 2ERJB 5EO0B 5LWYH 3D85B 3K2MC 5T3ZE 5GS1C 4F3FA 1T66D 5DK3A 4P2OB 5H94B 2A77L 4OLUL 3P9MB 4P2RE 5IVXE 3EFDH 1OTTC 2C4XA 2NY4D 1WWCA 1OAQL 4PLKC 1OAUH 2LU4A 2ORBL 4GT7A 1E4XL 3FO2A 5GGRA 1L6ZA 5BMFH 5IF0B 4Z7WA 1YECL 4TUKH 1TVBB 3MV7E 5IGXH 2LTQC 4OTXH 5DK0A 4Z0XB 1ZANL 4R96B 3TH3T 1HNGA 2DJSA 1A7OL 5LQBH 2E7HA 5DD3L 2E8ZA 3ZT5A 1AD0A 3VFTB 4LLAA 4IOIA 2ZG2A 4WFFD 3IDIB 2PW1B 1VGKB 4G7YH 1QLEH 3EHBC 5FHAH 3C5ZD 4L1DA 4UOW0 4OD1L 1P7QD 2LAGB 4WO4A 3MBXH 2E9IA 1BLNB 3ZTJG 4RAVB 1P6FA 3P4NA 4R4ND 4QT5A 2BVPB 1QR1B 1T2QL 3RPIA 1F00I 1YDPB 5D7JA 1HHIB 1ZWIB 5FYJL 3R1GL 2FIKB 1I7RA 3O8XC 4PR5A 3QDJB 3S35H 2DQUL 3HAEB 4ZO8A 1QSFA 3PV6B 5LVEA 4KKAC 2OSLB 3QUZA 2AK4A 1U36A 2NYYC 1BZ7A 1WVZA 1S8DA 3QNYB 4CW1B 2NY6C 3LS4H 2WLZA 3MRCA 4YHIB 2I24N 1TQBB 1K6QH 4TSCL 5HHQB 3IAPA 5KS9E 3B4NA 1KEGL 4CN4A 4WHYH 3RWGB 2EIZB 2GTWB 4GAJH 3ZKSD 4NPYB 4MNHA 4K3DL 5A3IC 4QRUB 5IMOB 2CKBH 1D6VH 1N0LA 4UMGA 2QTEA 4MA1B 1I8LC 3DTXB 3LMJL 4U49A 1YYML 4LPUA 1NGPL 2GSGA 1KTLA 2PTTB 4WU5A 4O51B 1PG7L 1UACH 1E6OL 4MXVF 4MD4B 2M8XA 3DV6B 1MQKH 3IDXL 5BZDB 4B7IA 3M1BA 1X5ZA 3SOBL 3UTTB 1N5AB 5I1DA 4Y4HC 1U2CA 2HKFL 2JCCB 3KPMA 2XRAL 5E8NA 3SDXB 3TT3L 2MWCA 1UZ6F 1PG7X 1DL7L 5KSBF 3RZCC 2IF7A 4U1MA 3ULUH 4X6EA 2HLAB 1LEIA 3O6ML 1AE6L 1GRWA 2KQMA 1S9YB 3Q2CA 1WC7A 3KHQA 4JFED 5EU6D 2E27L 1G7PB 1L7IL 3PQYB 3MUJA 4JM2A 1JPST 4S1SH 3MODL 1KACB 2VLLB 3MRBA 4K8RC 1AFVL 4WUUA 5DUBB 1Q1JH 5SX4H 3T0EB 5HGBB 4OQTH 2YSSA 3MCG1 4S1DD 1NFIB 4YK4C 4CGTA 5E00A 4FQ1H 2EIEA 1S7SB 2HLFC 4NZUL 1PG7W 2ARJB 4Y2DC 2I9TA 1J0YA 4MD0B 4HAGA 1WFNA 3IAQA 4R97C 1SJEA 4ZQKB 4X80H 2X4RA 3O45B 4L9LA 4D9LL 1CL7L 1WBZA 4HV8B 4JHAL 1ONQB 3K7UA 3C6SB 1FPTL 1MSPA 2DMKA 4YXHH 2VISB 3OKKB 1W2KT 1N64L 4NWUH 4Z8FH 1RJZB 4CUCA 3DX6B 1XGUB 1C5DB 3ZKQD 1SYVB 4F7EA 3RY5A 3FO1A 4JFDE 2B4CC 4UUJB 3D1MC 1KB5A 1I3UA 3FT2B 3HE6A 3AAZA 2VUOA 4JFHD 2AEWA 2NY5H 4HIHA 4YDKL 1JTPA 4ZFOA 4NRYA 1Q94B 1F3JB 4MA7H 3WO3B 5D2LA 2ITDA 4NM8L 1SJVA 3ZYJA 3QBTB 3QO0B 4HK3J 4P2RB 1OB1B 3C60D 3BP7B 4NYLA 5JDSB 1IGCL 4LSPL 5C0IA 5ILTH 1Z9MA 4E41D 1RHHA 3TP4A 3NCCB 4U7SA 1XGQB 3VRLF 3EYFB 1LE9B 2DD8H 2CLRB 3MV7B 3G5YB 1TXKA 1YEKH 2ZCKL 4OD2B 5HYJD 5C0CE 3V79C 2AAVA 3C6LC 4ZUVA 1T7WA 3QUKA 5EZOH 4UTAL 3JTSB 4HULB 1KULA 1AGBA 4P3CH 3VXNB 4PRPA 3MA9L 5E1AA 3M45A 4X6FB 5EOTB 1MCOL 2WK2A 2IAMB 3VJ6A 5EU7E 1A1OB 3HNSL 4HAFA 4CJ1A 4DQOH 1DE4B 4G8GD 1PZUB 4PRDA 1KXQE 2IH3B 5HPOA 1A7PL 1EAPA 3DVGA 2YBRA 4LK4A 4MS8C 5MENA 3MRIA 5EH1A 4M61A 1G7HA 4ODSL 4KZEL 3CX5K 3SDDA 5IB5B 3MYJA 1BQLH 3WIFB 1EO8L 1XGYH 3RKDD 1EGJH 3HUJA 1ITBB 2YZ1A 5KS9B 1NCBL 5HYSG 5I1AB 5CJXC 3QUYC 4RISH 3QCVH 4P2YA 2W0PA 5D5ME 3QWQB 3CPLB 4FQQB 3P77B 4Z7QE 2WUBL 4LASL 4B41A 4AEIH 1CDJA 2F54B 4U6YB 4UT7H 4EEEA 2ZCHL 4HJJH 4JN1L 4XMLL 4LKCA 5FV1L 4OAWB 2AJYL 1S3KH 3U6RB 2QSCH 4XTRD 1SM3H 1WTLA 5DHYB 2J3SA 2BOCA 4P46C 4KK8D 1TFHA 3U4BL 4QHKJ 3WKNA 3OG6B 2PTVA 1BVZA 1JWUB 2FD6L 1A1NA 1J1XH 1U42A 3U7YL 1FO0B 5F72S 3QZWA 1Y0LB 1RIUL 4FP8L 4R0LC 25C8H 3KS0H 2GITB 4OQTA 3DX8A 4MAYA 4X98B 5LBSH 3NN8B 3ARPA 3KLAA 3BP5A 5CUSH 1W72B 4Z7VB 4ZFGL 2FEEI 2YMXH 1EPFA 4RNRA 2IWGA 4N0UA 3S34L 2VDNL 2YKLH 2WWKO 1URLA 3S96B 5J3HC 1F4HA 2P8PA 1JYVA 1CDUA 3MRFA 2YPVH 4CDGC 4LLWA 3U2SB 5A2KH 1YN7A 3DMMC 4EOWH 3EYQC 3F12A 1DBBH 3AY4C 3GRWA 4NZRL 4OJFH 3T3PF 1FZMA 1BECA 1B9ZA 2AW2A 3IFPB 3FQRA 1AC0A 1XF5B 3I6GA 4TVPE 4Z7UB 4ONOA 5DJ2B 2Z91B 4PB9H 4P5TC 1JPTL 4PJ9C 3O3UN 1LHZA 3S36H 4G6ML 3BH9A 2EYTA 4YHKL 2P5WA 4BH8A 3U7AA 4UU9B 4UIMB 3TESA 1UJ3C 5EN2B 3O6KH 3T04D 1FJ1B 3VDBA 2C4FT 1KIRA 2IFFH 4NFBA 3UJTL 3IDMB 4LHJB 4TQEL 4ODBD 4HUWB 3QIUB 1NAKH 3WSQH 4RAUA 3K3QA 3IJYB 2F9BT 5K9QI 1BIHA 5JHLH 1XCQB 3QCUL 3KPRA 5GS0D 4P23C 2X89A 1GC1C 1XGTB 2J6EH 5HY9A 2XKSA 2Z31B 5EU7C 2KUTA 1HSAB 3TA3B 2OK0H 3MCKB 4MCZA 4R3SB 2QQQA 1K3ZA 1XIWD 1P1ZB 2DKSA 3OX8A 5FYKL 2VO5A 3FZUC 3OSKA 3EJJX 3VXUD 5D7KE 1OF2B 1TPXB 1VA9A 5EU5B 4Z7NF 5ALCH 3KPSD 4OM1L 2VXQH 35C8L 3BIAX 3JWNC 1FAIH 1U8IB 2VLRB 1GOHA 3AXLA 2D31B 3BDYH 4PRHA 3QFDB 1KN2L 2WW8A 3RNQA 2ZNWA 4YC2C 3HZVB 3TYGH 2FLBT 5JNYB 4NCC1 2FECI 4KJYA 5IMKB 4PBWD 5AEAA 5HHXH 1S9VA 5FGBC 3G5XA 1XR9B 3EDJA 3ZE0F 4M3JA 4WI6A 1Y18B 2IC2A 4X6DF 5C0CB 1A3RH 2J8OA 4XNMB 4IMKC 5MEPA 5CIPB 4UDUB 4L8SC 1HILA 2P42B 5FKAA 2VXVL 1YY9C 2ZJSH 2ZSVA 3PGDA 3VRIA 2XPGB 4Y5YA 1F45A 4X99A 2DM2A 4J1UA 5FECA 1NMAH 3S88L 1TZHA 4MMXC 5FO7B 4ORGA 3RRQA 1EGJA 1J0KA 1MCQA 3NIDF 4YHNB 1IGIL 1OM3H 5EU3B 3DO7A 1BGXL 4DFIA 4DW2L 1KIPB 2DS4A 2QHRL 2GIYA 2DYPA 2IG2L 5T33L 1LEKA 3QEQA 3O4LA 2MCG1 4BELD 1KJ2A 4PLJD 1ZLUK 1SY6L 2UZXB 1FVEB 4XBEH 3RWIB 1DUYB 4IIQB 3VGDA 4G43B 1MFNA 3H8NA 2XZQH 3O2WL 4B50A 2FDBP 4BSWA 3INUL 2QADD 2EDJA 2H2PD 4HC1L 3EYSH 1JPGB 3L7FA 2BDNH 1E27B 2XN9A 4W4OA 3CH1B 2PW2A 4G80B 5DXWA 1S9XA 3BDBA 3DURA 4M1DL 1ACZA 1C1EL 5I6XC 3DUSA 1BBJB 2GTZB 4M7LL 5TFSL 4Z76B 2PNDA 3S4SB 1KT2A 4O2FA 5DVOA 2CIKB 4P4RA 1HXYB 4R2GC 1N2RB 3LEVH 2I60L 1AXTH 3DSNA 5D4QA 3C2AH 3KYNA 5ESAA 2AV1A 4MNQB 5MI0B 3SCMB 4CVWA 3AVEA 3VWJA 4XCYA 1U92B 4CN6A 4EUPB 5C0GB 1E0OB 4PJ8A 3SN6N 4OCMC 1YJDH 1G7JB 4PRIA 2A74A 5BRZA 3AU1A 1U3HC 3MV01 4ZD3L 5LGJB 1T1ZA 3MUGB 5KW9H 4RMTA 4F7CB 4KI5D 3X17A 4ODXB 4O9HL 4OCWL 1Z0MA 2VXUH 1Q9KB 4NQED 4U1LA 5IKCA 5ANME 4YX2H 1U8QB 4QCIB 3QWRD 3GSRA 3KGRA 3QG6B 5DJZB 1TJGH 1U8KB 4NN7B 3CDGB 2LU7A 2W60A 1ZAGA 3W39B 3T65A 3W2DH 4HQQL 2WBJA 4U1IB 5IJVA 5HGHA 3BN3B 1MFEL 1BQUA 2DDQH 4WDIB 3QIWA 1NC4D 3FFDA 3MREA 1T4KA 3B3IB 5KSVA 1OTSC 1QTYT 4N0YH 2ARWA 5DURD 2HTLC 4JHWH 1Q0YH 4RBPH 3WFCH 3BUYB 4I2XE 4M62L 1GJIA 4ZS6C 4HX1B 1NEZA 1Q9LB 3IAGC 5E9DE 2IBZX 4XBGB 3O3AA 2MTPA 4IOFC 1QFWM 3TZVC 5DO2D 4NDMA 4OIIL 4GS7B 1JMZA 3X3FL 3KPLA 4ZSOA 4JPVL 3QDME 1UCBL 3D18A 5ENWB 4EDWL 4G5ZL 5IFAH 5E95B 4J6RH 2QJDA 3GI9H 4KHTL 4MVBD 5E6IA 3ZE2F 5I66A 1MF2H 4JFZH 1NCDL 3HR5B 4LSQH 1YQVL 4KGJA 4GRMA 1I9JL 4OCSH 3LKNB 1R24B 3DUHA 2B2XH 1AC6A 4NC0B 1GAFH 4NNPH 3JUYA 1ZHLB 4ZDHA 1QSVA 4PS4L 4H1LH 4NKOB 1JV5A 3ARFA 3VRJB 4JO2H 4XXCA 1AR2A 2ADFL 4NM4L 2M26A 1BPVA 1ZGLM 1LK2B 2H9GB 2DKUA 1EHNA 5ETUA 4FFYL 4EDXA 4U6HA 4QXTB 4PGJA 4LMQE 3DIFA 5KSAB 4NQSA 3QJFB 3GBNL 1A0QH 5BO1H 2PXYB 1KB5L 4DUWA 4JJ5A 1MJUL 3LCYA 4ZO9A 4LSRL 1M7IA 1OGAD 2VAJA 3V4VH 4I1NB 1I1FB 4JFPB 1N26A 5IVXF 2LE9A 2A6KB 5CEZE 2NY1D 4Y1AE 2YPLA 1UEYA 4K7PY 3K4ZA 5E8OB 2R56L 5DWUH 2YC1A 5HHOD 4OGXH 5DRWA 5HI3C 1PY9A 2XTJD 5F8RC 2GJZA 2D4DA 4XNZC 1QO3A 4J23A 1JZ7A 2HJLB 1QRNA 4N0RA 1QLRA 3HZKB 3HAEH 1KNOB 4HIIA 5I18H 1MJ7H 1O5DT 4IS6B 1D5BB 3MV9D 1KLUA 2APFA 3FFCD 1HCVA 1EEYA 1UQSB 2D0GA 2IJ0C 1CDHA 1AJ7L 1UM6H 3BXNA 4X7EC 3MRPA 1ZLSH 3L3GA 4JRYE 3TNMA 4RFEA 1HXMB 4FQCL 3BPLB 2P44B 4FQ2L 4PJEE 1T20A 2W59A 4OFVA 3LKOA 5D72L 1WZ1L 3MJ7A 3G08A 1QVOB 4C56D 4RGMC 2RB8A 3MYZA 4U0RC 4U1NB 1G9ML 1KBGL 3V6OA 1XGPB 3SDAA 4WFED 2CK0L 5C9JB 2NY2D 3MXVH 4I4WB 5J6GB 2BVOB 4Q9CA 3QH3B 1UADC 3RX7A 5I75B 2BCKB 3H3KA 3CC5A 5E8DL 1BOGA 2BNQE 4WHTA 1UWXK 1CFVH 4KJQC 1OAYH 1RZFL 3NA9L 3THML 5D1XC 3UTPD 3V7AE 1M71B 1DN0A 2HFEA 4XC3H 1L9MA 1IARB 4N1EA 5H35B 1LP9F 4ZOAA 1U8LA 4MD5B 4D2NA 4WFHE 5ANMB 4PJBE 5I1JH 3T77B 1YPZA 3NIFF 4L29A 1PLGL 4JQIL 1MWAA 3PWNB 3QI9B 5FYKD 3OKLA 4N9GB 1DSFL 5F9OL 1XH3B 3IRZA 3VE0B 5CFHA 1H0DA 3TBYB 5DJCB 3NAAL 1KUMA 3ZTNL 3FRPG 3SKNB 2J2ZA 5B8CB 3V5KA 4I3RL 4ETQB 5GRUH 3PL6B 1NGYB 1RUML 1GGIL 1JWMB 3GRWL 3NCJL 5CILH 3OAZK 4H1LA 4PJ5A 4H88H 5F7UA 3QDMB 3H9YA 2V7NB 1AY1H 3GO1L 1CR9L 3WDJA 3EDDA 2W38A 1D7FA 4N90E 3W0WE 1RPQA 2HVKB 5EO0A 3VG0L 1EV2E 1FL6B 3D85A 4ZFFB 3EJZD 1S7TA 3P9MA 4YXLH 5DF0A 1Q9WB 5IB4B 4LOUC 3VGBA 1QSZA 1UH2A 5IF0A 1FZKA 5EC1A 2WP3O 1YN6B 5FDWB 4Z0XA 3OR6B 4WO4D 4HWBH 4R96A 3X13B 3VFVB 1LO3L 3TC9A 5IHUH 1E4XI 4PJHA 1RJLB 2P5EE 3WNLA 4AIXA 2QQNL 2VDRH 5FO8B 1YEEL 1FCGA 3RIFK 2XOTA 3VFTA 4JZJC 1CQYA 2N7BA 1CXIA 3P9LB 4RFNB 5JTWA 1QSFD 2PW1A 1JGEA 4J3UA 2PF6A 1VDGA 3QUZD 1NL0L 2AK4D 3DYMA 1YUHA 1BLNA 4UT9L 4RZCB 3W9EA 3E2HB 2NY0C 4Y5XC 4R26L 4DGYL 1KLGB 1HHIA 1WCBB 2WWMC 1OARH 2Q3ZA 1U8OA 1OCWL 2EDEA 4ZYKA 5GS1A 3HAEA 2A9NH 1EH9A 2VITB 2DQHH 3VXOB 4JEGB 5KVFL 5EO1B 1RJYA 3MRGA 1CD0A 4WEBH 4XPAL 4IMLB 3MLSL 4WY7H 3NCFB 3PGCB 3O2DA 3RWFA 3QNZB 3V6ZA 4NPYA 1KPUA 3QWOA 4XVJL 1BQSA 3VMOA 1BWWA 4WW2C 1A21A 2PTTA 1S5HB 2EE3A 2OI9B 1CK0H 3RJQB 4OZGE 4UNTA 3DV6A 3R06B 3E6HB 1X4ZA 4GRLB 3OKMB 3EDKA 3V2AR 5JHDA 1KB9K 5F7DA 1N5AA 4HUNB 1WFUA 1DQJA 2JCCA 3KJ4C 4PRBA 4JM2D 2B1AL 2EDWA 4JFOB 4RGOL 1X9QA 4J4PA 3EO1B 2Z92B 2XWJB 1KB9J 4WUUD 4XWGH 2PYEA 5HDQL 2A73A 1EEUA 1Z9LA 3LQMA 5GIRB 3VD5A 3AM8C 4P48A 1W0WB 1DTUA 4CMHC 1CLOH 4UOW1 2IQAB 3K1DA 1G7PA 3PQYA 1FIGL 3Q3GA 1FO0H 5AAMA 5TDNB 1NQBA 1R3KB 1I8LA 4GAGL 1BD2A 3VFOB 3WE6B 3S8WA 1TJIH 1EJ6A 1LEGB 3Q5TA 1W72H 4FFVC 3GSVB 3LH2L 1S7WA 3BKMH 5I1CL 4HW6A 4KHXH 5INCB 1MCPH 2ICES 2FEDD 3GFUA 3P3YA 3N85L 1RZKH 1EZVX 4XB7A 1GGBH 1KCKA 4Y4HA 1QZ1A 4KQ4L 4NGHH 4GRWE 1WAAE 1VADB 2ICWJ 3BT2H 5IESL 5I30L 2CSPA 3TBSB 1D5IL 1VESA 3RZCA 3CFCH 3R4DA 5SV4A 5DA4A 2EXWC 3L3DA 1L4IA 5DT1H 3HE6D 3P11L 5ITFA 3OKKA 4H20H 5E1HB 2EEBA 3H9HA 3KR3L 4K7FB 4CADB 5C2BH 4RA0C 1YC7A 3QYCA 1NCAH 1AGFB 5KVMC 1C5DA 4WFFE 4FXKA 3KHOA 1F90L 2O61A 4KRNA 1AQKH 4UUJA 2XICA 3KPNB 4Z95L 1NFKA 1R3IL 4XP4L 4QEGA 4YHZL 2EE2A 1WCQA 4LPWA 3M8OH 3ULUF 5D93C 4HWBA 4F9LA 4Y2DA 4JY4B 4R90L 4LSVL 2Q76B 3SDYH 1BVLB 2NCMA 5E2JA 3P4OA 1A7QH 2X4SB 4NKQB 4P2RA 1OB1A 4WFGE 5IVXA 5TJWK 1K5NA 5JDSA 1U8JB 3D39B 4H0GA 5C1MB 4PRPD 3MJ9H 4LARL 3LN5A 3FQNB 4ODVH 1I9EA 3LEXA 4F58L 1VERA 1BFTA 1HIML 3U46B 2OJEB 2W9DL 2CLRA 2OL3B 3MV7A 4HJ0D 1U3ZA 2NX5B 4YQXH 4P2OC 1EMTH 3CX2A 4DVBB 5DJYA 4DZ8B 3OKYA 4AT6A 4PJIE 3TJHD 3HB3D 3RY4A 5EIVA 4R8WL 4AH2B 1FH5H 4XAWH 4KROB 5EOTA 3MLZL 4GLRI 3C09C 2RAMA 4U3HA 3SDDD 2CIIA 4BKLB 4D0CB 2HT2D 1A1OA 1A2YA 2MCPH 2ADJA 4BUGA 4H25B 2ZUYA 3BZ4A 4FQPA 3RY6C 1X5LA 1E6JH 3PP4H 3FMGH 1P4LB 5CIPH 3QUXC 5L2JB 3FQUB 3UBXG 5L2KB 2EKJA 3P0VH 5IQ9A 1HK6A 4U1HA 2EDFA 2XG5A 4WGWB 3BQUD 4DKEH 3MTRA 3KJ6L 5CD5D 3JWOC 3WIFA 1FFNB 5BV7B 3D9AH 4K23L 2R0LL 5I1EL 3U9PL 1HZHL 1LDPL 4JFEE 5AZEH 3NFNB 5KS9A 1QLFB 5EU6E 5I1AA 2I27N 5DD6A 2PR4H 4L4TB 3MPCA 4HPYH 1HHGB 2BY2A 4PJAB 5HPMA 4MQTB 3CPLA 4FQQA 1ZTXH 2DQGL 3TFKD 4KTDH 5KN5B 2YD3A 1AD9B 4JFXB 4KUCF 2CLVB 1K2DB 3F7VA 3BGFB 4LLYA 4KDTC 4YO0B 4ZTOH 5D96B 4HHAA 5ICXB 4CJ0A 2F15A 3BISA 2QHLA 4MAYD 4OAWA 4TRPL 1T22B 1ACYH 3CLFL 4I9WE 4ACPA 4K3JL 4GSDL 5E94B 4MSWA 2W92A 3QDGB 4IDJL 5DHYA 3HPJB 1IGTA 4NWTH 4OI8A 4HJGB 1N7ML 1FG2B 5I1KH 1S9KC 1KN4L 5F1IA 1XT5A 1A5FH 1OSPH 1YY8B 5C0BB 5T3XH 3BKCL 2GITA 4X98A 1I7UA 3BAEH 3NN8A 1DLHA 4JPWH 1W72A 1JGVL 1UYWH 2RHEA 5GGRY 4EUPH 3WJJC 5EBGA 2IANB 4C4KO 5H37G 5CJXA 1RZ8B 4YHMH 1CF8H 4XC1L 1ED3B 2X09A 3S96A 4TNVK 2MHAA 3PP3H 2XA8L 4FZEL 5FGRA 3LB6D 3G6JF 3U2SA 5MHSE 4I18B 3MA7A 5MEQA 1SQ2N 2P5WD 4JQVA 1CD1B 3HC4L 2BHYA 4JFHE 5BVJB 4U1KB 2V2XA 2JJWA 5C0EA 3IFPA 3DGGB 2Q6WB 4ELMF 3DHMA 5C71A 2X4QA 4ZNCD 4X5XA 5E03A 1KXTB 1U8MB 2KDGA 3MXWH 1NBQA 1H3XA 5GJTL 4NN6B 4P46A 5EO9B 2NY4B 4GRWB 3GMMB 4XHJD 4POZC 1SMOA 1BZQK 3KPRD 4E41E 1KIUA 4GMTL 2X89D 5EN2A 4X0KB 3ZKMD 1FJ1A 3QXAB 4YUEH 1QEWB 3NH7H 1F11B 1HWGB 2JJTC 2FHBA 1MWAL 4KDWA 3UX9B 4TVPH 5DUPH 3Q1SH 1Q72H 2FGWH 2OR7A 5FB8B 1VFUA 3IJYA 1I4FB 4K9EL 1S7XA 3FT4B 2MPAH 1TZGH 4OZIE 4JKWA 3GBML 1GZQB 4YE4H 2YA0A 3MGAA 5EZJB 1F4AA 3HI5H 3DECA 5DVKA 1NAML 2EDDA 4JFDA 4N5EC 4JJHA 3MJ9A 1P7QB 3DMMA 3GJFB 4PRHD 1HSAA 4OZ4B 1ADQH 4M43L 3AY4A 3HI6L 1WZLA 5C3LD 3CXDL 4G8GE 5KAQF 1CGYA 7FABL 3CIQA 1DFBH 5E5MB 3OL2A 4HWZA 4UV7L 3T1FB 2AXGB 1HKLL 2VDKL 5DRZB 4YPGA 1QUNA 3BOVA 4Y0GA 4LCCB 3SE9L 4OZHE 4XPBL 5CEYB 5LAXB 3RL1B 3ET9F 5EU4B 1AKJA 1FNSL 3I2CH 4LRIC 1UJ3A 43CAB 4DEPB 5E08L 1CBVL 1T7VA 1XR9A 3E8UH 4H8WL 5FXCH 4ODHH 1Y18A 2UUDH 5C0CA 4JR9H 4LCWA 4Y4KB 5CIPA 4LSSL 1CE1L 1O0VA 2ZUVA 3LRSB 2DYPD 3LDBC 5FA3B 3QEQD 4Q9BA 4HIXL 4NUGL 4L4VD 2XPGA 5C0FB 1FZJB 1JPFA 1X44A 1OP5K 4WV1B 5F93C 5BW7C 5FO7A 4WTZA 4KGLA 4LIQH 3DV4A 5EDXA 5F96H 5DFVD 4OIAA 5IOPB 1NCWL 3SY0B 2VSDA 2IAMC 4NRZA 5I1GH 1JF6A 3QT2A 3TWCH 3V0AC 3PHOB 3RWIA 1FVEA 2E9BA 2PO6C 4YDIH 2YXFA 1KCVL 3K1KC 4G43A 4LFHD 4RMUA 2H26B 1WSST 5F3BB 3REWB 2DLFH 1ZT4B 5FGBA 2BOBB 4JFEB 4LAQH 3MMEB 1JPGA 4DGIL 5F89B 5EU6B 3FCTB 5FHBL 5D5MA 3CH1A 1MCJA 5I8KL 4XH2A 3RUGF 5E4EB 5TF1H 4LSTH 5DDHA 4Z9KB 1UWXH 4PB0H 4ODUB 1ETZB 1HXYA 2PN5A 5SV3A 3O2DL 1HH6B 1LO2H 5DJDB 3SCMA 1OAXH 1T7XA 1J1OL 4PG9B 1IFHL 1PEWA 4OLYL 2IGFL 3NFPB 1R5VB 1BBDL 4S2SB 1CLZH 1NUGA 4X9GA 1J9CT 2HT4C 3CCHB 4PJCB 3PGFL 4UDTB 3MUGA 2VDQH 4F7CA 4M9OA 4ODXA 3QNXB 4QYOA 3UYRH 4XB8A 2WBJD 3PWUB 2FZ3A 1WZMA 1NDGB 5SWZE 4ZS7H 3WL9B 4ODWA 4MNGE 3QIWD 1QYGH 3QG6A 4DZBB 1GVIA 1NCCH 1QBBA 3ARGC 5LGHH 5L88H 3CDGA 2OCFD 2WM0A 4HIEB 2C3XA 1U3JA 3QQ3B 1MY5A 5FYJE 2C4FU 3L6FB 1AGCB 4U1IA 4MQ7B 1U9KA 2EDKA 2NR6D 2EDYA 4WDIA 4KXZI 4WTWA 2WIMA 1RZKC 2UY6A 3LHPL 3GHEL 4GAYB 5JXAL 3KPSE 3B3IA 4P57A 4RA3A 2X4UB 4G7VH 3C60B 5E6ID 3TBVB 5IW1A 4WW2F 5J1AB 2QSTA 4E41B 3RFZC 1MFBH 2FBJH 1V7ML 4XBGA 3CSPA 3GM8A 2Q3AA 1RULH 1GOFA 3MROB 5HYJB 2YRPA 4JGJA 1B0WA 3ARFD 5J11B 5JW4N 2HT3D 4PUBL 4PTTB 4RGND 3OB0K 1KGCD 1S7VB 4G3YH 3HR5A 3HE7C 1CFNA 1NLDL 2BX5A 1ZVSA 1Z9OA 4N8CH 4YAQB 1KOAA 1NBYA 4Q0XL 4GKOA 4NFCA 3WUWB 2C3VB 3IGAA 1KJMB 4G8GB 2BY1A 2VXTH 1JGLL 4AQ1B 2Z0BA 4BSVB 4KJWD 4YDVB 1NMCB 1LK2A 2H9GA 3W11C 4GMSL 2AK1H 1RZ7H 1DBML 3DHJA 4FQLH 3UTSE 3T0AA 4HS8L 4HBCH 3TA3C 5GISH 4K8RL 2YPLD 3QJFA 3K2UL 5J9PA 4HH8A 1RY7B 4JDVA 1KTDB 4KAQL 4JGUA 2ZKHH 2RJMA 2HH0L 1IAIL 4HKBA 3V6FA 4AEHH 3FHAA 5IQ7H 2IQ9H 4LU5L 5F88B 1JF1A 4P5MB 3H7BB 4TUJB 1A22B 4YEEA 2W1NA 3QHFH 3LN4B 1GPOL 5CJQH 2Q7YB 2J8UE 4GG6F 2FJGA 3F6IA 1QRND 1G9NH 3DLQR 2Y1VA 1QQDB 3BWAB 1GGTA 3FOMB 1SBSH 4GQ9H 2J7LA 3MRMA 5L0QB 2HWZH 5GGUB 3VFGH 3L5XH 3ME0A 4OGAC 1QD0A 4O2EB 4LQFL 1KENL 1DQQB 1UKTA 2AJZB 4YHPA 2F19H 4UILH 2B5IB 4UT6H 1V7NH 2EC9T 3QRGL 3VFRA 3LZFL 5D70H 2B4CL 5DEFA 5D7IE 3B5TA 1A1MB 4OV5B 3SDAD 3DGCR 5AZ2H 6FABL 1IAKB 5JA9A 4BK5A 2VMFA 1QA9A 1X6NA 3ESVF 3GNMH 4FMKA 4JO1L 1YEFL 3TN0B 1YEHL 4HT1L 5BXFB 4B53A 5DMKB 1QVOA 4L8DB 2HAZA 5FO9A 4C55A 1YEDB 4PGDB 3GGWB 1XGPA 3SQOH 4JN2B 1CDCA 4KRMB 4P5KB 3F62A 5J6GA 2BVOA 4HWNA 1H3PL 3QH3A 3RAJH 1MOEA 1KPVB 3A6CH 3UDWC 1NMBL 4MJ4A 5KZCD 4Q74A 1UA6L 4M3KB 5DSCB 4UBDD 1FDLH 1M71A 2VDPH 2DQCL 4HF5H 1RURL 3MNVA 5GJSH 3LKPA 1JZ8A 2AI0L 2ED8A 3SE8L 4N0FB 1D5MA 3ZL4H 1IL1A 5H35A 2GT9B 4QRSA 2P48B 4M7JL 2KQNA 4MD5A 2XKUA 4HUUB 3QQ4A 5ANMA 3HPLB 3ROOB 3L5WB 4MJ6B 1ZA6B 5FUZH 3WLWD 3TYFB 3DYOA 1KG0B 2X1QA 3JWDH 5F7WC 4JPKL 3UROR 3UEZA 2A6JB 4LDEB 3GKWH 5DQ9A 4N9GA 2ZG1A 2Y36H 3O0RH 3DWTA 5GGSY 4UAOB 5JQ6H 2HJFA 1XIWB 5DJCA 3QB7C 1T6VN 3VXUB 2HFFB 5DJ6B 1OL0A 4PJ5D 3L1OH 4KRPB 5EFIB 4OLXL 4IRSC 1N0XH 3KPSB 4G6JH 2N7AA 4HKXA 4NQVB 3S3PA 3MLYL 4FQHB 4LF3B 5CBEA 4I2XA 3LSOB 3ILQC 3PABA 4OKVB 4MX7A 4JM4H 3UO1L 2R8SL 5T1DH 1GZPB 2IPTH 2ZPKL 5E9DA 5D1XA 3NIGE 3WIIH 3PL6A 5J89A 3GMLB 3MLVH 4JFQB 1N59B 1QBMH 5IBLD 1IBGH 1N5YL 4MXQC 4UV4H 4NQDD 3C5JB 3QDMA 1A8JH 4X7FC 1E28B 3IKCB 1A4KA 5DMIL 1FSKB 3MLXL 5KVDH 4GW4A 2V7NA 4WI7A 2OP4H 2HN7B 5SWQA 3DBXA 3U36A 1NKOA 5C0RH 4PTUA 2B1HL 5FM5M 4EN3C 1IAOA 4K3EH 1H8NA 1WLHA 3IS1X 3S7GA 1IGYB 3DARA 4KRLB 3QXDB 2JELL 5B3JE 2VZTA 3SDXF 5IB4A 4NP4H 4M6NH 4OCRL 3WJLC 4LLVB 4RX4A 4KMLB 2ZNXA 2AJVL 1N4XH 1OTUD 2VNCA 5FDWA 3OR6A 3UZEA 3MBEA 3LPWA 4HPOL 5FO8A 2QV2A 4ZUSB 1R3LB 1SJXA 2QADB 2WUCL 3FFCE 2AJXL 4QHLA 1H9VA 5GZOC 2EIBA 1TTFA 2JLLA 4PLKD 2OL3H 3RGVA 4ZXBC 2VYRE 4PJ7B 5F7EH 4RZCA 4F33A 1F13A 3NVQA 2PXYC 4Y1AA 1NKRA 4CVXA 2X40A 1H5BC 3B9KC 5CZXC 1WCBA 3OAUH 2BC4B 2KL6A 1OSZA 1BZ9B 2R1XA 2HG5A 2ILLA 4PJGF 4U6TA 3KAAA 3PWVB 3B83A 4ZUTB 4KY1H 4YDLB 5CINH 4IMLA 4ZO7A 3FRUA 1IT9L 4P9HC 4WRLA 5HVHC 4QNPE 2AP2A 3EHBD 3MRNA 2W9EH 3PGCA 1KCSH 2VKWA 4LAJH 3UTPE 1ZKAA 4PIRF 4OCYL 1GC1L 3TJEL 2V2TB 1JNHA 3JTTB 3P2TA 1MAML 5JHDD 4X7SH 3PDDA 1R3HA 1F97A 1Z6JT 4NQEB 32C2B 2NW2A 2G60L 5MERA 3QJHB 4J4PD 1A9EB 4ISVA 4GW5A 5BV7H 4KKAD 1ZV5A 2I07A 5JIKA 1YNTB 4LGRB 1CWVA 4JRYA 3EYOB 2PYED 4J3VA 2NYYD 3LKQB 1ZOXA 5FYKE 2EICA 2NY6D 4PJEA 1OAUL 3U1SH 2G2RA 1MH5B 4QF1B 1XF2B 1CZ8H 3OKMA 3I3BA 5T1LA 3BEWA 2JIXB 2IADB 5ALBL 3PQYD 4OTXL 5IW6B 3EO9H 4P9ML 5A3ID 4OZFG 4ZNEE 5TE7L 3VG9C 1XF3A 1NC4B 2GW5A 3FAXA 3VXSE 3V0WL 1BD2D 1VGEL 3J7HA 5E5UB 1IGML 5DURB 5GIRA 2BNQA 4D0DA 5KJRH 2P45B 2VLMD 3RVTC 5J13C 3S97C 3U7WH 5ITBL 1DVFC 3OHXA 3WEXB 1CGXA 3MBXL 1FGNL 1RZGA 4NO2B 3OPZL 3IXAB 3MGOB 3CSGA 4AK1A 5DD5H 4Y4HD 1R3KA 1I1AC 1JHTB 1JGDB 3GEWB 4ZFZB 4FFWC 4NKDA 4PJBA 4RMVA 3RPKA 3CVIH 4NHCH 4Z7WE 3RZCD 4DN4H 3GSVA 6CGTA 3VXPB 4I0PC 2AABH 5INCA 3K8MA 4EVNA 1G9EA 1RMFH 1HINH 3ROLB 4DTGH 3AB0C 1VADA 5GXBB 1HQ4A 3BEVA 3BSZL 4FNLL 5C0NC 3QI9C 3P30H 2CKBL 1JZ5A 5KBNC 3P0YL 5IR1A 5I8OL 4MA8L 4K55A 1J5OL 2GFBA 4M5ZL 4XHQA 1OPGL 2V9RA 3AM8A 3T2PA 1RK1B 3MZTA 5IHLB 5F21B 5FKPB 4YR6A 4Y2DD 4XMPH 1DQDL 5T3ZD 1CFSA 4GRWH 5IT2L 1AGFA 2YPKB 1HOCB 3PXJA 1OGAB 3MLRL 5BOPA 1QFPA 4OM0L 5D7LD 1T7YA 1CI5A 1EDQA 4HWEH 5KVEH 1LO0H 2FATH 1L6XA 1JNNL 1LVEA 3W0WA 2DIAA 1MRCL 4JDTH 4G9DA 5ADPL 4F57L 1DQMH 4F2MB 4WU7B 5GGTH 5HHOB 4Y8DC 2X4SA 5CCKH 3MV8E 2VC2H 3GHBH 3WFDL 5IHBA 2XTJB 2I5YL 3GJFH 5A40E 2Y9RT 3O4OC 3LN9A 3AROA 1RUKL 1A6TB 4XP1L 1MRFH 2OL3A 5F9WB 3PV7A 3MZGB 5I74B 1K8IB 4S10A 4UQ2A 4LVNB 4Z7VF 2P5EA 4JKPL 3RX5A 2R4SH 3TIDB 3M17B 5JOEA 3IJSB 1VEMA 4LLMB 2VXSL 3MV9B 4LCUA 3FFCB 5F3HA 1CCZA 5JIPA 1EXUA 3V5HA 2UZIL 4ERSH 4X80L 5KTEH 4PYGA 1YEGL 2EDTA 3T08A 2LABA 1CICC 3UTZB 5ICYB 3DX9A 4GXVL 3TF7C 2BVUA 4DAGH 3PE9A 4QXGH 4Z7UF 4HEPG 2CXGA 2B0SL 5DLMH 3C6LD 4J3WA 5CWSB 1MJ8L 3HFML 2H8PB 1ZA3A 2NY2B 5EUOE 5F7FA 1YEJH 2MNUA 4JLRB 4JANA 1L0XA 1AO7E 2Q1EA 5GZND 1FFNA 4ONFL 4LVEA 1EO7A 1ZE3C 3WD5L 4XCCL 2ATKA 5IUSA 1F6AB 3EDEA 3NFNA 5E99L 1D5XB 1A6AB 4YHLL 4CNIB 1NGWA 3L5IA 2NY5L 2VDOH 3KWWB 3CZJA 3D0VB 5KN5A 4OF3A 5C0JB 1CG9A 2Q8BL 1BREA 1MI5E 3REVA 2ADIB 1JN6A 4MS8D 5ICXA 4KKCC 1FL5B 4PRNB 4MXWL 1MRDH 4OZGA 3QAZC 3BPOC 2Y7QB 2FLRT 4L3AA 4N8VB 1MHHA 3LRHA 2R69H 2Z93B 2LAAA 2XA3A 3HPJA 4HCRA 3JV4A 5E6YA 4MB4A 3QUXA 1QHPA 4M6AA 2DB8A 4KC3B 4KVCH 1UXSB 3T3ME 2X4NB 3WFZA 4IEFB 1C8PA 4XZUA 4NCDA 2EE9A 1I3VA 4FZ8H 3DROA 3ULVC 1I9IH 1FFQA 5E8PB 3M07A 1BQHB 4L5FL 5LXGH 2R0ZH 3LQAH 5ACMA 4JFYA 3H3PL 2UVFA 3K74B 4P46D 4HD9A 3TO2A 1F5WA 4FTVE 4KWUA 3FO2B 5GGRB 3TH2T 5IMMA 4Z7WB 2DWEA 3SGJC 2A9ML 5BVPH 1I75A 4YH6A 4UQ3B 1U8MA 3TNNA 2UWEE 1AD0B 5LCVL 1WAAA 4IOIB 3OB0H 3BPCB 5J3HD 4X0KA 4M8QA 4GKSB 3QXAA 4JFDD 1QEWA 4F8TA 4X7TA 3DMMD 1F11A 1ND0A 4XX1G 4DVRL 4WO4B 3EYQD 3UC0L 1ZGLP 5BJTA 3RNKA 5K59F 3P4NB 8FABA 4QT5B 2ZSWB 4JREB 1NLBH 4KK6C 1OP3K 1BVKA 4W6WB 4RDQG 3FT4A 1I7RB 3HC3H 5FV2A 1GZQA 4P5TD 1QSFB 4DKAA 2EO9A 3NACH 2LQRA 1CGSH 3QUZB 2AK4B 3GJFA 1AKJD 4OZ4A 1FBIH 4Z78A 1FNGA 1HHJA 1NDMA 3T1FA 1C16A 5C0CD 1I3RA 2X10A 5GGVL 1H8OA 1J8KA 4MNHB 1CLYL 3BFOA 4HWUA 4TSBH 4LCWD 3MGTB 3RL1A 3S5LA 3K8KA 1EUTA 3RVWC 43CAA 2DQIH 3TPUA 2GSGB 1KTLB 2X4OB 4QXUL 2D7PA 3SE4C 3IDNA 2AJSL 2JJTA 4Q6YA 4XCFL 3FZUD 3M1BB 4KTEH 4OJFL 4PJIA 4Y4KA 3KPMB 4X7CC 2VERN 2O5YH 2OTPA 4PYHA 5FA3A 2H1PL 1JFQH 5C0FA 4U1MB 4X6EB 4X8XA 1LEIB 3QHZL 1G7IA 2W0LA 3VFPB 1IC5H 1WC7B 3O6KL 3BPNC 1F6FB 5BQ7A 2IFFL 4JM2B 2H41A 3G9AB 1F4YL 5EUOB 3MRBB 3CMGA 3L3IA 2DQEH 1A6UL 3UP1A 4GG8B 1IKFH 5JHLL 1YY9D 2YSSB 3MC0A 5CEZL 4LVOB 3O9WC 3REWA 2GJJA 2X42A 1ZT4A 1NFDE 5E00B 2BOBA 5DC0A 4JFEA 3PWLA 3MMEA 1L0QA 3VW3H 2AJ3B 3BGMB 5EU6A 3SCMD 1JBJA 4J3TA 5JXEC 2YD4A 1WWAX 4CU7A 2X4RB 2NQCA 2V6HA 5MP6H 1VENA 1WBZB 1MI5B 2NY3C 4RFOH 4N1HB 4ODUA 4KKNA 3JXAA 2DQFA 1AI1L 4GW1A 12E8H 1K4DB 1HH6A 2BFVH 2JF1A 3HMXA 3HRPA 1CXKA 3JUZA 2KZWA 2CDFA 4R7NB 2V17H 4FMFA 3NFPA 1Q0XH 4GKZA 4KKLC 4KKBC 4UI2A 3CCHA 4XNUL 1EK3A 4YZFF 4F7EB 3S37L 5DRXB 3FO1B 1A7NL 2PO6A 2COQA 2A77H 4YGAB 4OLUH 3BD5A 1KB5B 4HLZH 5FUCE 2N4IA 4LHUB 3QNXA 2ENSA 3AAZB 3NPSC 4HIHB 2ARJQ 2ORBH 4R2GD 4BZ2L 4ZFOB 1J18A 2ZJSL 3CVHA 1UVQA 1E4XH 5D2LB 2ITDB 3WL9A 3S37X 4Q9RH 3ZYZA 4TVPD 5TDOB 3MUHL 1YECH 2V2WA 4Y4FB 1NMAL 4HEME 1ZANH 1A7OH 1PYWA 4NYLB 4FTVB 5DD3H 1PDKA 4PY8I 1RHHB 3L6FA 1BIIA 2VIRB 3RWJA 4RMWA 1OVZA 5CBAA 4GAYA 1IEAA 4OD1H 2HKHH 4WHYG 1BJ1H 2D7TL 4MDIA 3SGKA 2ENYA 3TBVA 4EQ2A 1TZIA 1T2QH 3STZA 1MLBA 4PRPB 4E41A 1MHEA 3R1GH 5HJ3A 2AVGA 1EHAA 2CRYA 3VJ6B 4HMEA 1V3JA 2YR3A 3NGBB 3MROA 1JGUL 1J0HA 5HYSA 3U82B 4FABL 4HFUH 1JJUA 1FGVL 5D7KD 4PRDB 4M7ZC 2N56A 1IGFH 4OZIA 1T3FA 4UIKL 1UKQA 3PNWB 4TSCH 1JTOA 3MFGB 5D1QB 1IEHA 3QEQE 3ARGA 1EAPB 4JKKA 1OTSD 2R23B 2YBRB 5E56A 5HYQA 4L4VE 4M61B 1G7HB 4K3DH 2F74B 4ZS6D 3SDDB 4MLSA 3VFSA 4YAQA 3IYLW 5C3TA 3MYJB 3NPZB 1UWEL 4NZTL 3EKCA 1JNLL 2C3VA 1C5CL 1QBLL 2NNAB 1QFUH 4IOFD 1KJMA 5C7XL 4G8GA 1P2CA 3LMJH 3TZVD 4TTGA 1WQVT 1MELA 1UZ6E 1IC7L 5C09E 1DJSA 4HSQA 4PGBB 3A6OA 2UYLA 1PG7H 5KSBE 1WUNT 5FFLA 1E6OH 3C5ZC 4OZHA 3BQUB 2X70A 1JHLL 3RHWK 3SOBH 2HKFH 2XRAH 2ZUXA 2NXZC 3ZO0A 3TT3H 2QQLH 5HD8C 1AR1D 3HR6A 4BFIB 1D9KA 1DL7H 1FVDB 2DQDL 3OV6A 1TVHA 5F88A 3NCEB 3W2DL 4TUJA 4PV8A 1KJVA 3O6MH 4KUCD 2BOCB 4XGZA 1AE6H 5T1KA 4WNQB 2VOTA 1A1NB 5FM5O 4NC1E 1IC4L 2E27H 3UPRB 1L7IH 2FO4A 3QZWB 3BWAA 3MODH 3FOMA 3BYYA 3DX8B 4MAYB 1AFVH 3KLAB 3BP5B 4K71B 5GGUA 4XI5C 5I1LA 1OY3B 3OB8A 4RNRB 3OZ9L 2GSIA 3RGHA 3PG2A 4NZUH 3MCLL 2P8PB 5E2VL 1EBPA 4PY7A 1EA9C 3GI9L 4XP5L 4XBPB 3CFDA 2CK2A 4OF8A 1R5IB 1FZMB 1NFDB 1CL7H 3BIKB 4PG2C 4D9LH 5I15L 4JHAH 3FQRB 4X9IA 2O26U 4G8EA 3RIFF 4Z18A 5B39B 4WTXA 5HI3D 1FPTH 3JV6A 4QRTB 3BN9C 3SJVD 1DBJL 2VQ1A 1N64H 2P5WB 3TN0A 4BH8B 4BZ1L 3L9RB 4L8DA 3GGWA 1KIRB 3A6BL 4JN2A 3VI3F 4KZDL 4GXUN 1KPVA 2OQJA 4ELKB 4GBXC 4LLDA 4QRRE 4RAUB 1NEUA 5HHPB 4YDKH 1BX2A 3KXFE 1KLFA 2DLIA 3KPRB 1FG9C 3VRLE 4Y8AA 2EDXA 5HY9B 1CGTA 2IALA 2W91A 5D2NE 2RBLA 2DOCA 2K7PA 4N0FA 5C0AD 3EZ8A 1IGCH 5SWZA 4LSPH 3W82A 1B88A 3HC0B 4F15B 4QOKE 4MNGA 3L5WA 1GHFL 1ZA6A 4HCRL 2ZCKH 4M02A 4GQPH 1DBAL 1LDSA 2AXHA 3AXLB 5J6HA 5EBWB 1ZT1B 2E7CA 1IVLA 4PRHB 4UTAH 1HNFA 3RNQB 5E9DD 5TDPA 1I1CA 5D1XD 5CJBA 1KEML 2VDML 3JWOL 3MRHA 2DLTA 3MA9H 3G5XB 3BZEA 1MCOH 4MCYA 3QDMD 1W8NA 3UDWA 3KPSA 3ARDC 2HP4A 4QY8A 3K80A 4NQVA 1MJ7L 5MEPB 1LK3L 3MJ8B 3HNSH 4LF3A 5F8QC 3LSOA 1RUPL 4OKVA 4ORZC 4MA3A 3FN0L 1S7RA 3H9SE 4Z0BL 4NN5B 5FKAB 4YIQA 3HN3A 5JW3L 1XGRB 1LILA 1A7PH 9CGTA 2AKRA 4X99B 4J1UB 5FECB 1TZHB 2JB6B 4ODSH 4KZEH 2A83B 2PTUA 3OKNA 1I8MA 3D5OF 3VDAA 1EO8H 2YN5A 4RMSA 5DS8A 4RX4D 4HKJA 1LEKB 3QEQB 4NC1C 1NCBH 1BAFL 4WHDA 4BQ8A 1KJ2B 3MBED 4L4VB 2BRRL 1NBVH 2BSSA 4LFHG 4I48A 5JQHC 3I6LE 3ULVF 1P7KA 2WUBH 3LAFA 3DXAE 4LASH 4BSWB 3H7LA 5HVWA 2ESVE 4AENA 1AXSB 1HH9B 2ZCHH 2VQUA 4JN1H 4XMLH 3E3QE 4IRSA 3UTSA 2PW2B 5KSBB 3RGVD 4Y16C 2AJYH 3EUUA 3DUSB 1OD7A 1MCDA 3WFBH 5CEZD 4Y1AD 1RU9H 4JZOA 4M5YL 1KT2B 3FONA 3ARTA 1R3LA 4O2FB 3U4BH 5TGBB 2FD6H 1XCTB 3VGFA 3ARBC 5IROC 5ESAB 5F71A 4APQC 3KYNB 4HUVA 4LBEB 2DQTL 1G0XA 1RIUH 4FP8H 5IFJA 4M7KL 4XCYB 4KMQA 3UTOA 1AIFA 4HS6B 1VPOH 4ZFGH 2ICEB 2WQRA 2J8UA 3AU1B 3WXVL 3T3PE 5IB1A 3S34H 2VDNH 1T1ZB 4EN3A 3TH4T 2F5BL 3OBAA 4ZUTA 2DI7A 4U1LB 5IKCB 2L4OA 3F5WB 1YA5A 3WJLA 1FL3A 3B2UC 2VR5A 4NZRH 3ARSA 4HBQA 4YBQD 4K3HA 4JRYD 1SJHB 2FX9L 5F1OB 2EECA 3H0TA 3MNZB 3QISA 4YHYB 5D2NC 3C8HA 3MLTA 3U4AA 1JPTH 5DJAA 3JTTA 2NY0D 5AUMA 4G6MH 1N8ZA 5D7IA 2WBJB 2WWMD 4XTRC 5DTFA 5T1LD 2FH8A 4YHKH 32C2A 1J7VR 3QJHA 4FN0A 4XVUC 4YXKL 5IB2B 3KS0J 3QIWB 3I02A 1MVUB 3MREB 1QR4A 3FFDB 3GBLA 1YNTA 5KSVB 2NW3A 3MRKA 1L7TL 2BXZA 4ZXBA 1S7UA 3LKQA 2H32A 1X4YA 2BNQD 4LVHB 4TQEH 3GK8H 3V7MA 1A3QA 2VKXA 4GUPA 4QF1A 1QBAA 1H5BA 1NEZB 3B9KA 3ECBB 2BNUA 2JIXA 3QCUH 3O3AB 3V0VA 1KTRL 4Z7NE 5TH2A 1F2XK 3KPLB 1FRGL 4ZSOB 2AERT 5IHUL 3ZDZF 7CGTA 3HCVA 4OT1L 4H5SA 2NZ9C 3SKJL 3I6KA 4WFHD 5B38B 5TE6L 5FYKH 5E6IB 3RI5K 2Y06L 1BP3B 3LPGA 5I66B 1KELL 2XXMB 3ZE0E 4OM1H 4X6DE 35C8H 3IU4L 2KH2B 4NKIL 2YD2A 4JFFE 4NQDE 1JV5B 2V5MA 3ARFB 5FA4A 1JHTA 2R0KL 5DJXA 3HMXL 4XVSH 2A0LC 4QOKB 3BH8A 3MJGX 4X9FA 5I71B 2A9NL 2E6JA 5ETUB 1IQWL 1H3WM 4U6HB 4EDXB 5M7QA 4G6KL 5E2UL 3DIFB 3B8YA 1ZLVH 5CLWA 2C7UA 1BFSA 4JJ5B 3AREC 3GSNA 1OP3H 5ESVB 2VXVH 1M7IB 3N1PC 3QA3B 3E3QC 4XVTL 2OZ4A 5GS0C 5I73C 3QPXL 1ZGLA 1MCBA 2R2HB 2MMXA 3RWHA 3S88H 5SWSE 3I9GL 2YPLB 1IGIH 4N90D 2C1PA 2OTUA 3W0WD 1BGXH 1AXIB 4DW2H 2NTFB 1DVFA 2QHRH 3BJ91 2IG2H 2MJWA 1CK0L 2YC1B 3LKRA 1SY6H 2X1PA 1E4KC 1I1AA 1XF1A 5CAYB 1ZHNA 3O2WH 4TSAL 4TNVF 5E4IA 3INUH 5F7HA 2NLJA 4HC1H 2EXWD 4I0PA 4OLVL 1QRNB 5FM4A 5A2JH 2P5ED 4L3EE 5GSVB 1C1EH 4HIIB 4AJ0A 4M7LH 4X9HA 5TFSH 1KFAL 2YUXA 3L5JA 1EEYB 1FLRL 1KSRA 5IW3A 5FYLL 2I60H 2ZG3A 1ZEAL 3IDYB 1MREH 5HGAB 3LKOB 5E7FA 4XWOC 1KPRA 3MJ7B 4AIZB 3G08B 3IJSA 1FC1A 4YPJA 3I3EA 3FFCA 4KHXL 4ZD3H 1TETL 2HRPL 2K3TA 4LPTA 1RZKL 2YXMA 1BOGB 4OCWH 1J05B 4X5WA 3TVMC 1L0YA 1FNEB 4XRCA 3CFCL 2ZUWA 2X4TB 3QEGH 1DN0B 2HFEB 2X9XA 1GGCL 1ZLWH 2WNGA 5GRZA 1PGRB 3SQBA 5HHNA 2Z4QA 4H20L 4JLRA 4R4BA 5F7LB 5KZCB 4HQQH 1T5XB 1YPZB 4X6BB 1MFEH 3QULB 1B2WL 1V05A 1MWAB 1J12A 4GAFB 4HUKB 4Q2ZA 1D5XA 1A6AA 4AM0A 4X8JA 1HEZA 1U91B 3KWWA 3M8OL 3D0VA 4M62H 5C0JA 5F6IB 1IEBB 4H1LG 2EDQA 3QUXD 4RRPA 3ZE2E 4WUKH 3MSPA 1FP5A 3RL2A 1NAMB 1PZ5A 5C6TL 1JZ3A 3HRZA 4OIIH 1A7QL 2E6PA 4JPVH 3WXWL 3VGAC 1UCBH 1CICA 3V5KB 5DUML 4EDWH 4G5ZH 2PCPA 1W8OA 4ODVL 2V5SA 4KHTH 3EYUL 5DA0B 1NCDH 4E5XA 1YQVH 3LD8C 1SHMA 1I9JH 4ZNEA 3O2VL 3P4LA 4PJ5B 1UXSA 1OQOA 2X4NA 3ARUA 2XQBL 2O5ZL 3VXSA 4J8RA 2YHGA 4PS4H 4RBPK 2F5AL 3GMOA 3ZDXF 1DBKL 1BQHA 1WICA 2LFGA 2ADFH 4NM4H 4ZAKC 1WTGT 3HG1E 3X3GL 2APTA 4FFYH 4X6DB 4OUOA 3NZ8A 1S7TB 2JK5A 3QUML 4NQDB 3ILPA 5D7LE 2Q8AL 3SKOB 1BWMA 3FQXA 4AEEA 2P43B 43C9A 3GBNH 3PP4L 1KB5H 4N5UA 1MJUH 2J4WH 3BKJH 4PREA 3VGEA 1IJ9A 1T83C 1FZKB 4JG0L 3VXTA 5EC1B 4NBYB 4LSRH 2X2YA 1FYTD 5JLZB 5DO2C 1BFOB 4KI1A 4WWKC 4UQ3A 3BUTA 3S98A 4OSUL 4PJHB 3TM6A 3BO8A 2Y25A 5FAAA 1H15A 1RVFL 3HAEG 5DI8A 2EXYC 4Q6IC 1MY7A 3IETA 2E8YA 3BPCA 1NANH 1SY6A 3J8F7 1JGEB 5CJOL 2R56H 5F7MC 4GKSA 2C9AA 3D3VD 1ODAA 1YUHB 3W9EB 4U1GB 1D5ZB 3MLUL 3WFEL 5A2FA 5K9KB 4HC1A 4Y5VC 2ZSWA 4J3SA 2ICWA 1B3JA 1U8OB 1MCFA 2CR3A 2P8MA 2Y23A 4ZYKB 5GS1B 4FQXC 4WFGD 1UZ8B 5L7XL 1OAKL 1RJYB 4UINL 3MRGB 1RUAL 4POZD 4CVUA 4NWTL 2D3VA 3CFIC 3WNPA 3RWFB 2QLVB 1AJ7H 4AZ8A 3V6ZB 4BFEA 1KPUB 3MR9A 4FQCH 3QWOB 4JGMA 3MV8A 4FQ2H 4Y4KD 1P7HL 1UYWL 1OWWA 3MGTA 5D72H 1WZ1H 4IBLT 2FX7L 2NY1C 4PJCF 3B8SA 4E42A 3Q0HA 2VQTA 1CF8L 1G9MH 1EEQA 1KBGH 2X4OA 1FAKT 4N5ED 4PGCA 2CK0H 1OQXA 4HLJA 5EBMB 1P9MA 5E8DH 1LP9E 5JHDB 5F7DB 2XTJC 1DQJB 4M1CC 4PRBB 5CHNA 1RZFH 1G0YR 2XI9A 3NA9H 5CMAA 5AD0B 3NIFE 3THMH 5E2TL 1CVSC 2X9WA 1QACA 3L7EA 2K7QA 3MLWL 4M8VA 1KIQB 2PYEB 4EI5A 2A73B 4I0KA 3DYPA 3G04A 2NY6B 3GMRA 3VFPA 4JVWA 4JO4L 4K94C 4KJPD 4NNYA 4QTIL 4HGMA 1PLGH 3TEUA 1G1CA 4JQIH 3V5DA 3ZYIA 1SEBA 4LMQI 5EUOA 4JG1L 5DUPL 3EIFA 3Q3GB 1DSFH 2DMCA 5F9OH 5IIEB 1AGDB 1A6WL 1BD2B 1INDL 1AO7A 3H9ZA 4GG8A 4P4KC 2A2QT 4M48L 4MDJA 5FF6B 3NAAH 5DR5L 2L7UA 1T89C 3MRJB 1S7WB 3ZTNH 2AJ3A 3BGMA 4I9WD 1ADQL 3AS2A 4OB5L 2PYFA 2F58L 4Y4HB 1V3LA 4I3RH 2RR3A 1CU4L 4CKVX 4UNUA 1MI5A 5KVGL 4O4YH 3FOLB 3IFLL 3QIBC 3RZCB 1RUMH 1GGIH 2PO6D 3GRWH 3NCJH 4WI8A 5E6ZA 1G6RL 3L3DB 1FNAA 1K4DA 2MOVA 3LQZA 2VB5A 1EEZA 4OFKA 5ITFB 4R7NA 1YNLH 1XMWA 3H9HB 5CGMA 1P6AB 3GO1H 1CR9H 2VN4A 3FO9A 1PW3A 2XXCB 4FXKB 3VG0H 4F7MA 2O61B 5DRXA 1RFDL 5DMYA 4JR9L 3OJMB 3QG7L 5MHSD 3HMWL 3PIQB 5JW4Q 4FRWA 4LHUA 3U48A 4J3OC 4YK4B 3GB7A 3ZKNC 4GO6B 3MRLA 2BNRA 2OYPA 1FE8L 4Y2DB 1UENA 3GJEB 3I84A 5TDOA 1F6LL 5IJKA 4A6YA 1W0YT 2E7LA 5JXEA 4R97B 4Y4FA 5DJ0A 3P4OB 5D7LB 5IVXB 1LO3H 1K5NB 3OKOA 4FTVA 2QQNH 5ADOL 1YEEH 5F96L 1PVHA 3LN5B 1WJ3A 2E9WA 2HT4D 2BVQB 3TV3L 3VD7A 3LEXB 4JRXD 2VIRA 5F1NA 4P9HL 4R9HA 3TWCL 3RDTC 4YDJB 3OXSA 1MCHA 1NL0H 2UWEA 3G9VA 1QFWL 3VD4A 3UBXA 5DJYB 1FZOA 4UT9H 4LCWE 4AT6B 5FYLD 4DKFL 4J7RA 3VFUA 3KPQA 4ZG1A 5DMGC 4ZOCA 4DGYH 3ARGD 4NO3B 1OCWH 4Y2OA 2B39A 2CIIB 2VL4A 2XY1A 1A2YB 4ONGH 5JR1L 2M1KA 5KVFH 2ADJB 5IWLA 2A1WL 4NO0B 4PJFF 5IV2A 4PB0L 3BZ4B 1NCUA 4XPAH 2EKSA 4WEUD 3MLSH 3T09A 1MLCA 3GSNL 3PNWA 2D9CA 1T03L 1VSCA 5D1QA 4H0HB 2R23A 5IQ9B 4C83A 1T0MA 4U1HB 1F4WL 2F74A 1MEXH 1P4BL 2OZ4L 4OFYD 1X5YA 3NABL 3BW9B 1JTTA 2C3WA 1R0AL 2NNAA 5D7JC 4PRAB 1CS6A 1D9KD 3CX5J 5IB3A 5DD6B 3C6LB 1X6LA 4PGBA 3ZDYF 5HHME 5HPMB 2ICCA 3WNNA 1KJ2H 3NCBB 5DEGA 1I9RL 5HYFA 1KCRL 5T1KD 1Z0NA 8CGTA 3BQUA 1UM4L 3MOQA 2VLJE 1VFBA 5HI4C 3F7VB 4F7PB 4LLYB 4NUJB 5DJ8B 1NCCL 4HHAB 2B1AH 2CUHA 3O6FC 3QQNA 4RGOH 1MCIA 1G1YA 4BFIA 3S3JA 3BP4A 1FVDA 4TPRL 4MJIE 3LIZL 4HH9A 4DJMA 1QRKA 1LP9B 1MAJA 5HDQH 4MSWB 2L0DA 1IGTB 1U3YA 4EIZC 4WNQA 3W11D 1HE7A 4JCMA 5F1IB 3UPRA 1PEZA 2VDLL 3F58L 4DUXA 4YFDB 1I7UB 1DLHB 1QNZL 4GAGH 3OXRB 1UWGL 2A38A 4BQ9A 3B2VL 4FXGB 3NFSL 1IRAY 3QUYB 4MLIA 3LH2H 5I1CH 4I0CC 5JUEL 2OR8A 4KTYA 2MHAB 3KPPA 5AYUL 4BQCA 3N85H 2CUMA 3MA7B 4IDLA 5MEQB 3TN0D 4ZUWA 4XBPA 5EWIL 3WIHL 1YMME 2Z35A 4KQ4H 4IJ3C 1R5IA 1NFDA 2V2XB 3BIKA 4OLWL 1F8TH 5C0EB 5I30H 4JM2C 3U83A 2X4QB 2RIKA 1D5IH 2AJUL 4X5XB 1EHXA 5B39A 4JY5H 4OGAD 3P11H 1NBZB 4P46B 4QRTA 3ZYOA 2L7JA 3KR3H 3FT3A 3ULUE 3WDHA 1RZJC 3L9RA 4LCIL 3U30B 4R0LB 4QRPE 1F90H 1O7SA 1HWHB 3I3DA 3CK0L 4ELKA 5SWZD 1HSBA 4Z95H 4XP4H 3MNWA 4L9LC 4YHZH 5HHPA 1S7XB 3VXQB 2B8OT 1S5IL 5AG9A 5IQ7L 3DI2B 4PV9A 4M93C 4R90H 4LSVH 4JFDB 3TIEA 3DMMB 3X14A 2HTKD 2OBGA 5FYJD 1MQ8A 4TOYH 5J1TC 5HYIA 5EOQL 4LARH 3CNKA 3HC0A 3GSWB 4HWZB 4F58H 5SX5H 1JRHL 1HIMH 4P2CG 4KRPD 2W9DH 4YPGB 3SEPA 4P5TB 4PJ9B 4PJ7F 1IGJB 3HE6C 5EBWA 1ZT1A 1AKJB 3MO1A 3NMEA 3FTGA 1UJ3B 4R8WH 3L3OA 2V5RA 4WTZG 3K8LA 3IFNL 4L4JA 3IVKA 3MLZH 3I75A 5F6HJ 2QQKL 2ZCLL 3DETC 4OCXL 4ZUUA 4YBLC 4GBXA 5JIIA 3MJ8A 4IHOA 1TNNA 4LCWB 4V1DE 3QXWA 2OJZH 3P9WB 2ZUQC 3E6FA 1U95B 1B4RA 2J88L 4P23B 1XGRA 2FIRT 3IFOA 1KCUL 5EZIL 1ES0A 1JPFB 4KI5F 3WNOA 3BRGC 2ADGB 4L9DA 4NIKB 1MVFA 5B3NA 5F44A 2JB6A 3T2NL 2A83A 4KUZL 3FN3A 2BSTA 3GMQA 3KJ6H 3DV4B 3KLHC 2QEJA 4R4FL 3O3EA 4K23H 2R0LH 5I1EH 4IRSD 3U9PH 3UTSD 1LDPH 1LO5B 4HJ0C 4NRZB 1I7TA 4L4VA 3RIAK 3S4SG 3ILQD 5DHVB 4D94A 2DQGH 5DGRA 4YC2B 3VXME 2EE6A 3ULVL 3HB3C 4NSKA 1EERB 1FDLL 4EUPG 4MXQD 1AXSA 1HH9A 2GJ6E 5C09A 5D5MB 5HHMB 5KSBA 4XH2B 4TRPH 1UJTA 4X6CF 3SDDC 5DQDL 3CLFH 5DDHB 4K3JH 4L8SB 4GSDH 3VA2C 4IDJH 1CXFA 5FUZL 2YN3A 4G6FD 5TGBA 4EN3D 1N7MH 1XCTA 1KN4H 2VE6A 4LBEA 4HGKC 2BJMH 1MCLA 3BKCH 2CDEA 2KPNA 3G6JE 1NSNL 4WI3A 3P4MA 4HS6A 3ZHKA 5CD5C 1TJHL 5E0QA 2ICEA 3SJVE 1JGVH 2YK1L 3NZHL 1QPXA 3QCTH 4NZJA 4WI4A 4DGVL 3ULUC 2F53E 5E5RB 1N0XL 3GSXA 4JVPA 4ELME 2O93L 1REIA 4XC1H 4NJ9L 3ETBF 2FYYA 2XA8H 4FZEH 4QYOB 4JM4L 3LEYL 3GMNA 2FZ3B 3TFKC 4NC2B 5E2WH 2G9HA 3F5WA 3HC4H 4U6VL 3ZMRA 2NXYC 2HJKA 3MLVL 4ODWB 5CEXB 1JMXA 1XR8A 2BXYA 1U2HA 3U0WL 3ABZA 4UV4L 5KG9A 4ZXBD 5I6XB 1SJHA 1T04A 1GIGL 2AQ2A 1S7QA 3MNZA 1TQCC 4PJDE 3IXTB 2OP4L 3B9KD 5CZXD 5CP3A 5C0AE 2JIXD 2CLZB 4R2GB 4GMTH 5IB2A 4K3EL 1MVUA 2JJSA 15C8L 3WLBA 3W5MA 4P57B 2EZ0C 2MQ0A 3PP3K 1MWAH 2QBWA 5IW1B 5CJ8A 5I2IA 1U3HB 4JPIB 4K9EH 3ECBA 5IMLA 1BFVL 1N4XL 2DI8A 2V9TA 4OQ1A 3PWPE 1KF9B 4PGEA 3V52H 2FX8L 1NAMH 4DKDC 4KMTH 4QRRA 5B22A 4HXBL 4M43H 4OD3L 5B38A 2EDBA 3QDHA 1CGUA 3KXFA 3CXDH 2RCSH 3SO3C 3WMSA 4UV7H 3B5GA 2C5DC 4O5LL 1CFNB 2X41A 1HKLH 2YUVA 3RJDA 2AEQL 5D2NA 4LGPB 1ZVSB 2NY5C 3F7QA 1AGEB 1NBYB 3QO1B 3SE9H 3BZDA 3IGAB 4XPBH 1FNSH 4O02L 4QOKA 4XHJC 3BRFA 4X9BA 5E08H 1CBVH 4AL8L 2Z8SA 4H8WH 1YEIL 4I8DA 5CKGA 3BZFA 4JKMA 5FCUL 4RWYL 5J9PB 1UH4A 4JDVB 3RVTD 4C58B 3CJJA 1DVFD 3TZVB 5ESVA 4HKBB 3V6FB 2VZVA 4HIXH 2CRMA 1KC5L 3MRRB 4NUGH 3BVNA 3QA3A 1I1AD 2AEPL 3WNMA 4A6YL 4LCYB 1JF1B 4X7SL 4XP6L 2R2HA 4V1DB 1FVCB 3LVEA 3T1WA 3EOTH 1IAMA 3OKDA 2DBLL 3H9SA 1NGZB 3VU2A 2DTML 2FJGB 2NTFA 2WINB 4I0PD 4PD4K 4A2MA 4HXAL 1T7ZA 3HI1A 1NCWH 3CFEB 4MQXC 1RUQH 2UUDK 4U3XA 5DFWH 3MRMB 2XQYG 1KCVH 3DRQA 3RUGE 4PD4J 3KDMA 1BOYA 4YHPB 5C0ND 5I9QB 1HHHA 2BZDA 4FHBD 1ZMYA 4Y5YC 4DGIH 5FHBH 3UZQA 3VFRB 5I8KH 5MEOB 5GSVA 5J12C 3DXAA 5DEFB 4M7LT 3K4DA 4YGVA 3U7WL 2ESVA 4KK9C 2AS5M 3RKPA 2P24B 1Z9SA 5A16A 2FECL 5DC9B 1UH3A 3O2DH 1QA9B 5ISZE 3WFHB 1J1OH 2B20A 5HGAA 4HS3B 4OLYH 4QTHA 4NQUA 2IGFH 3ZE1E 4AIZA 1BBDH 5BS0D 4AYFA 5FO9B 1IKNC 3UTQB 5DFVC 2FL5A 4TNWK 3PGFH 4W4OC 1UKSA 4G6AC 4JVUA 3E0GA 3G6JB 5D8JL 1EHLL 1A7RL 1J05A 4XNZB 5ID1A 3SJVB 3UYPA 1FNEA 2WSKA 3SDCC 3PWJB 2RQ8A 4JCLA 2X4TA 3UAJC 1OAZL 1KCLA 3MNVB 2XQYK 3LKPB 3VWJC 4OI7A 1NCNA 5INDB 1D5MB 1IL1B 1XZ0A 4PJ8C 4QRSB 1TDQA 1CTNA 3QQ4B 4F9PA 4MYWB 4X4ME 1T5XA 4X6BA 4O2CA 3QULA 2ED7A 3RA7H 3OJVC 1CFQA 1NGQL 3LHPH 3GHEH 5DQ9B 1CICD 4BFGA 5IEHA 5D9SB 5JXAH 1DP0A 1P4IL 4IRJC 4LSUL 1EFQA 1U91A 4PJXE 2HJFB 5CP7A 5C0AB 4RGMB 4U0RB 1IEBA 5F9AC 1DQML 1V7MH 1NAMA 5FOJA 5L6YL 5GGTL 4P59L 3VXSD 2CR6A 4HKXB 4YHYC 3RP1A 1EJOL 5CBEB 3TVMA 4I2XB 3PABB 2FHFA 3MRDA 4MX7B 3EJYC 5DC4B 5E9DB 4NOBA 5D1XB 3D0LA 4B0MM 5C08E 4HK0B 1NLDH 4RDQF 5DRNB 4BUHA 2DWDB 4QO1A 3CMOL 1OW0C 1A4KB 3ALWA 3O41A 4Q0XH 5EC2A 4GW4B 3NA4A 5D6DC 4JY6A 5SWQB 3DBXB 3U36B 1JGLH 4P49A 4PTUB 3TBTA 4QGYA 4NNXB 3OMZA 3WN5C 2NR6C 4P0DA 4GMSH 3CSYA 1V8HA 1DBMH 3BE1L 1IAOB 3TT1L 4X6DA 1JYWA 3JZ7A 4UTBL 4HS8H 4JFFA 4NQDA 3SKOA 1GXEA 4C57C 1F3DH 4K8RH 3K2UH 1QFOA 3PHSA 4KAQH 2XFXB 3VXRD 1T80A 4QXGL 3W9DB 4GG6E 1WIPA 2HH0H 1MFAL 1IAIH 5JLZA 1BFOA 5L9DL 3MBEB 4LU5H 5T3ZH 1B0RA 3ULVD 3CD4A 3W81A 5TQ0L 4EBQH 1GPOH 4JM2F 3D2UB 4G42B 4RGNC 4CVZA 3PF2A 1JCKA 4QHLB 3FO0L 3BYTA 1KV3A 2DMBA 3RGVB 4S1RL 1F02I 5SWSA 4F33B 4Y1AB 4XP9L 3N06B 1D5ZA 5K9KA 1UG9A 4CVXB 4LQFH 1JWSA 4BSJA 3WDIA 1T5WA 5DD1L 1OSZB 1UZ8A 2R1XB 2HG5B 3MV8D 2JJVA 3QRGH 4ZODA 2YRLA 3RUGB 2KZ1B 3LZFH 2B4CH 5JW4M 1LWRA 3ZKXC 2P8LB 1MNUL 5JOPE 3FRUB 3TBWB 3TO4C 5IVNA 3MRNB 5EBLA 6FABH 4KVCL 3DRTB 4WWKA 4AG4L 1I8KA 4L3EA 2UZYB 1JNHB 3QR2A 4OZFA 4JO1H 3AC0A 2DL9A 4JZJB 4KK6D 1R3HB 1YEFH 4Y19E 1AHWC 2NW2B 2YD6A 3A67L 4BH7A 1YEHH 4HT1H 5MERB 3N1MC 1U8PA 4ISVB 4GW5B 1UT9A 3DO3A 1VEPA 3NOIA 1Y6KR 3VWKC 2I07B 4JRYB 4EI5D 1JK8A 1H3PH 5EBMA 4PJEB 4KV5F 1NMBH 2G2RB 3V7AG 2NY0B 4Y5VA 2K9UA 4JKLA 4NO5B 1EBAA 4Y5XB 5D2LF 3RVVD 3VI4F 5TE4L 4IRZH 1UA6H 5T1LB 3BEWB 3O8XA 1OGTB 5AD0A 3LV3A 3HNTL 5EG6C 4FQXA 1YNKL 1M1SA 1XF3B 2DQCH 1DQLL 2Q20A 1RURH 1YJDC 1KIQA 4LPCA 2AI0H 1AO7D 3SE8H 2BNQB 4D0DB 2EDRA 2DIBA 2FWOA 4M7JH 3RVWD 4UB0L 2V9QA 5ESQA 3OHXB 3QDJE 3V6OC 3SDAC 4JPKH 2ATPA 1RZGB 4LLQA 5IM7B 3V95A 3VMNA 5IIEA 1AGDA 5D1ZC 1MI5D 4NKDB 4PJBB 3ZT6A 3O3BA 4WW2B 1EX0A 3RTQC 4LLUB 5FF6A 3RHWF 4OGYL 3MRJA 3UJJL 2Y4SA 4OLXH 4W70A 4EVNB 3CZFA 1LO4H 1INQA 4G8IB 3MLYH 2AGJL 1WITA 4QWWC 2BVEA 5JORA 1YMHA 3UO1H 2R8SH 2IMMA 3FOLA 1HQ4B 3BEVB 4XT1C 1T1WA 2X1WL 2DJUA 1WFOA 4TSBL 1N5YH 5IR1B 3UPCA 1ITCA 1FYTE 3EDFA 4LHUD 2GFBB 1CL7I 4MGXA 5JPNB 1PX4A 2BMKA 3O9WD 3FQWA 3EOBA 4M4RA 1QHOA 3HUJF 1JIBA 2BNRD 2GCYA 3MLXH 3UTTE 1CE6B 4CMHB 3QFJD 3SDXE 4YR6B 2OTWB 2W9LA 1ORQA 4I3SL 1CFSB 3GDBA 5CJ5A 3SPVA 5JXED 4Y4FD 3WLWC 3ZHLA 3S6CA 5ABDE 2BVTA 4FTVD 3D3VE 3HLAA 3PIQA 4I77L 5I19L 2EEDA 2NY3D 3JV5A 2JELH 4OCRH 3W0WB 5IBUB 1BF2A 3HG1A 4G9DB 3GJEA 2AJVH 3CFJA 4H26A 2R39A 5K93A 1GCFA 5D7LA 5GRVK 5T1MA 1FFPA 3T0EE 3V4UL 1UC6A 4HPOH 4KKLD 5JMRA 1INEL 2BVQA 3OKEA 5A1AA 4LNRA 2ERJC 2Y07L 1LQSR 3QIBA 4U6XB 2WUCH 1JPSL 2AJXH 3ESUF 4YDJA 4UQ2B 1NJ9A 2DI9A 3BKYL 3HNVH 1FORL 4TULL 4PJGE 2P5EB 3GM0A 2CMRL 3D69B 1D6EA 4LCUB 4K7PL 5D1QD 5F3HB 4NO3A 1EXUB 3V5HB 3SGDI 4MJ2A 4XPTL 3PDOB 1I7ZB 1HHKB 5K9QG 2LVEA 4FFZL 4NO0A 2R29L 3DX9B 1JYNA 1H3TA 4K7PX 5D93B 5T5NG 5EORL 4X83A 1IT9H 4N0CC 2DL2A 4OBSA 12E8L 4KVNL 4HUXB 1JUFA 1FCCA 1ZA3B 4OCYH 1OTUC 1GC1H 3TJEH 4PP2B 4JANB 1MAMH 2R1YB 3T4YB 3BW9A 3D87B 4RWHA 2D9QB 1UEMA 2G60H 4PRAA 3RWCA 1YYLL 1F58L 2ATKB 5ID0B 1SEQL 3TPKA 1J87A 3RDTA 2BY0A 2JTDA 2KBGA 1R6VA 2CO7B 2ZZUT 3C6LA 1NGWB 5I8CA 1BJMA 3G6AA 4LKXA 5FGCE 1WIOA 1UB5B 2CUIA 4Y19B 1CG9B 5DHVH 1RIHL 4QLRA 3SKUD 4Q9RL 2XT1B 5CZKA 1TQBC 2WBKA 4F7PA 4NUJA 5DJ8A 3REVB 1JN6B 5ALBH 1AP2B 4P9MH 3C09B 4FQJL 5TE7H 3CLEL 4OZGB 5JO5A 5GS2D 3V0WH 1VGEH 1LP9A 2XZAL 5CSGA 3EO0A 4MA1C 1MHHB 1IGMH 1U93A 1CD8A 3JV4B 1T2JA 3QUXB 4WI2A 5HI5C 5ITBH 1R5WA 5EA0L 2HKHL 3DSFL 5GS0L 1FGNH 4BYHA 3OPZH 1Z3GL 4XZUB 4WGVB 3CUPA 3DROB 1BEYL 2NXZD 3OXRA 1T2XA 5K9JL 5HD8D 4FXGA 1R3JA 3QUYA 4J4PC 4HDIB 4BA8A 4JFYB 4OLZL 4HFUL 3TO2B 1MFCL 3P73A 4UOJA 1IGFL 1MHCB 3L3JA 1B90A 2H6PB 2D0HA 5IMMB 4JRWA 4X4ZA 2R4RL 3ARQA 2DWEB 3O6FA 4Z5RB 4H0IA 2ZOKA 3BSZH 5GRJL 4FNLH 1VCAA 3WKMH 1GL4B 3P0YH 3TNNB 3WS3A 1WEJL 2BK8A 5I8OH 3OAYH 4XI5D 4MA8H 1J5OH 3C8DA 4M5ZH 3RBSA 1NBZA 1OPGH 1QFUL 1A6VH 3T0EC 2F54E 4EXKA 5A2IH 1VFAB 4JRXE 4EXPX 1DQDH 4M8QB 5IT2H 4R0LA 3MLRH 3BWUC 4D0BA 1FYTB 4X7TB 1ND0B 4OM0H 5JZ7C 5BJTB 1NUNB 4PJDF 3RNKB 8FABB 4AMKL 2DF3A 4PPTA 3R8QA 5FYLE 1BVKB 1JNNH 3VXQA 2AXFB 2QQLL 1MRCH 3N9GL 4JQXC 5ADPH 4F57H 4ZMAT 3S5LG 3BN9D 1YQ2A 3T2OA 3D3VB 3RU8L 5IBTL 4Z78B 3ARWA 4Z7VE 2D03L 4LL9A 2R2EA 1FNGB 2EDNA 1HHJB 3ZZ1A 1X7QB 1U6AL 3WFDH 4NJAL 2I5YH 1RQ5A 3GSWA 3SHSA 1NDMB 1C16B 1MFDL 1DN2A 1RUKH 1TLKA 4K3GA 4XP1H 3RWDB 1I3RB 1QOKA 3IF1A 4P5TA 4PJ9A 2EDLA 4GBXD 4YHOL 1IGJA 2VZ1A 2DM4A 3IS0X 1PKOA 4U0QB 5FYJU 5DVNA 4XCEB 4JKPH 3STLB 3MOAL 1JRHI 3S5LB 5M94B 4M1GL 4MB5A 3TPUB 2VXSH 4F9LC 5F7KC 1PY4A