5GISH

Crystal structure of a fab fragment with its ligand peptide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
211
Chain Sequence
b'EVQLQQPGAELVRPGASVKLSCKASGYTFTSYWMNWVKQRPGQGLECIGMIHPSDGETRLNQKFKDKATLTLDKSSSTAYMQLSSPTSEDSAVYYCTTHFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy chain of Fab fragment
molecule tags Immune system
source organism Mus musculus
publication title Structural basis for multi-specific peptide recognition by the anti-IDH1/2 monoclonal antibody, MsMab-1.
pubmed doi rcsb
total genus 50
structure length 211
sequence length 214
ec nomenclature
pdb deposition date 2016-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gisH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gisH02
4LPWA 4AL8H 3L7EB 2E6JA 2NY4B 3OAYH 4JDTL 5BW7C 5EZIL 4EBQL 2WWMD 3ROOA 1RUKL 2WQ8A 3QDHA 1MI5B 3UZVB 5HPMA 1D5BA 1EAPA 5AZEH 1OQXA 3IVKA 3EYVB 5C6TL 1Q9WA 4FMKA 2XN9B 1AC0A 5SWSA 3UTSB 3QAZC 4WI3A 2D0FA 5IG7B 4PJGF 4D3CL 5F7NC 3S5LA 5LXGL 3IAGC 5KVEH 4HWUA 1JYWA 1L6ZA 3TF7C 4HMEA 3PP3H 4JAMB 2MCPL 2IMNA 3QCTH 1FP5A 5D7IF 2AXHA 1MJ8H 5T1MA 1CFQA 3OAYK 4U1HB 4I18C 1DDHA 4EI6B 1UZ8B 2X7LA 5E9DA 1ONQA 5FA3B 4S10A 3BEVA 1KG0B 2R0ZH 4PREB 4ZTPH 2DQHH 1MHPH 1IGCL 2NY5H 3OHXA 4L4VB 4XP1H 1KB9K 1QHPA 3EJZC 4XMKL 3GHBH 5CUSL 1HI6A 5GZOC 1A7OH 4HPOH 4XHQA 4E41E 4OLEA 4DTGL 5BVJA 4LCWB 1YA5A 1QRNA 5DVLA 5JPNA 2A77L 1JNHB 1RMFL 5F89B 1MRFH 1HCVA 1WT5C 3L3HA 5FEBA 4ZXBA 3A67H 1UWEH 3GGWB 4XMPL 3O3DB 5C6TH 2HTKD 4X6BA 2VLLA 4CRPA 2QSVA 4LSRL 1CE1L 1QVOA 2A6JB 3MLYL 5DHXB 1SBBA 4TPRH 1B4RA 3V7MA 4EQ3A 5DUBB 1RIVH 1T3FA 2EXWD 4P5TA 2R0LH 2NPLX 1PLGH 2DYPD 1X5XA 4GRMB 4H1LA 1HCFX 2J1KA 1E0OB 4GRWE 4BQ9A 3X3FL 5DC9B 4ETYA 1CGYA 2NW3A 5C2BL 1MVUA 3UJJL 3SCMD 1AGCB 1J05B 3QEHA 4QLRA 1IGYB 2HFTA 3RWEA 4YHZH 4Q9QL 3DVFA 3OKOA 1D7FA 5T33L 5C07E 3VWJC 5D9SB 1S8DA 4PJGB 2IPUG 2VTFA 3MXVH 3T2PA 1DSFH 1N5AA 4LPXA 4N8PA 1KIPB 4K8RD 5AD0B 3QDJB 3PV6B 3T8XA 3D69B 1NEZG 3MRIB 2IEPA 1AGBB 4KUCF 2DQJH 3V4VH 4NNPH 1XGRB 1EVTC 4NQCA 5GGUB 3AVEA 1BQHG 1MY7A 1T7WA 3VWJA 2O5ZH 4RWYL 3VE0A 5EZLA 4NFCA 2AEWA 1HZHH 2I9LA 1MCEA 5F7DB 1YPZE 3N9GL 4WEMB 5EU4A 2PXYC 1MHEA 2VE6B 3JV4A 2VDMH 3QO1B 2BY2A 4LVOC 2HT4C 2VXUL 4XWGL 4P5KA 3PGCB 3BP4A 4X6EB 1IM3B 3G08A 4PJBE 2ADJA 3B9EA 5F7FA 1AQDA 4EI5A 4JO3L 3OKYA 4IOIA 3MOBH 5ALCL 3GJFB 5IHLB 1ZLUK 3I9GL 1B0WA 1EEYB 2SEBB 1L7TL 2PYEA 3F7VB 3E8UL 3OR7A 4ISVB 3SKNB 1D9KC 2C1OA 5BZWA 4ZFGH 2YEZA 2V5RA 1IBGH 1JZ2A 1T0MB 3MXVL 3KVQA 5MEQB 4KJPD 5GSRB 4GS7C 1ZLWH 4JFYA 5D6CA 4XCCL 4CDGC 3PWUA 5J56B 1IL1A 4Q9BA 5GRXG 3TN0C 3S9DB 4Y4KC 1NC2A 5JIHA 1EO7A 2EDHA 5C6PB 4JRYE 1KB9J 5CZKA 1TZHA 3MNZA 4GW4B 3WIHH 1V3JA 4R6UA 2CGRH 2I07A 2WUBL 1QHOA 4Z5RB 5DURB 1DBJH 4DEPC 1MCDA 3KPNA 2R8SH 3QAZB 4WUUA 3ZKMD 4H20L 3KYOB 3GMQB 4U6XB 1QRNE 5JQ6L 4TSCH 4Q6IA 1LE9A 3HZMB 2PO6A 3V52L 2A1WL 3E3QC 4TUJB 4QGTA 2OCFD 4LHJB 1OPGL 2VDLH 4K7FB 2X4QB 4MA7H 4HIHB 3RVTD 1NKRA 3NH7H 1PG7H 4PJFF 4WDIA 2I5YH 5IT2H 4U6VH 4QHMA 1AO7B 2EXYC 1JGUL 1HXMA 4DZBA 4GRWH 1AI1L 3T4AB 2VLME 4FQXB 4RIRB 4ZD3L 4M3JA 4NM4H 3VFMA 3U83A 2FGWL 3HC0B 2LFGA 4UOJA 4EN3B 5EBWA 3MGOB 1X5JA 3RVUC 1VHPA 2VABA 2ADGB 1U8JB 4NM4L 3BWAB 2R23A 4Y4HB 3ETBF 1N64H 4FQLH 1C5DB 3ARXA 4HCRH 4DN3L 1Z9LA 3KAAA 4K3DH 4XXDB 3QHZH 3RKDC 2Z0BA 4JPVL 5ENWA 5FYLD 4L3AA 3UPRB 1DBMH 2KZWA 1HH9B 4NUJA 1LP9B 3VXSB 1T03L 5C0GB 4NKIH 2D9CA 3ILPB 1S7RA 4G9DB 4GAGL 4I18A 4M6AA 5F88A 5D2LE 1MWAL 2W91A 4PRDB 4OD1H 1INDL 3HAEB 4OBRA 1VADB 4G6AD 5LJYH 1A4JA 4OQTA 1M1SA 3JV6A 2XKNA 3M17A 2QQNH 1X5KA 2VH5H 1ZLSH 2FCBA 2VDML 3DIFB 1FZOB 4ZOBA 1F45A 2AXFA 3QJHB 1G9MC 4WFEE 3BXNB 1KELH 4HQQL 4OFYA 4JN2B 2CXGA 1I9RH 3TM6A 1YPZA 1HYSC 3L3GA 5ID1B 2ZCLH 1BPVA 5F1IA 3MLSL 3KNBB 1EUUA 1QFWI 2FZ3B 2IH3B 4NP4H 5E8NA 4X6CA 5DJZA 1ZGLP 1DUZA 5C0AD 3BPLB 5EH1A 1N2RB 1DUYA 1W72H 1AH1A 1I7RA 3OF6D 3BKML 3TZVA 2ADFL 5IWLC 3KPTA 2IPUK 4ODBD 1OTSC 2F53A 3FQWB 3MFGB 4Q74A 4MJ5A 5D71H 1CD0A 1FZJB 2IFGA 3GSOA 3BGFC 2ADFH 5T3XH 1MJ7H 3MRMB 2J6EL 1UWGL 4UINL 2VIRA 2IPKA 2MFNA 3UC0H 4PD4J 2R2HB 3QULA 4F8TA 2OXGA 3AS3A 4K3DL 4HFUL 3KXFB 2E9WA 3T77B 1NLDL 4APQC 3TNNA 2VAAA 4NCDA 5JORB 2DMBA 1WZ1L 2ADIA 1ZSDB 2Q8BL 4JFEB 4LEXH 5ENWB 3P4OB 3F62A 3HUJF 3TV3H 2ADIB 4X7FC 1SYVA 5DC0A 4PJ5A 5GGRB 2NX5E 2VAAB 2VXSL 4TTDD 1LEIB 4Z7UB 5L9DH 2DYPB 3ARFB 4MQ7A 4FQ2H 5L7XH 2ICEA 3X11B 5KVFL 4X4YA 3CX2A 1Q94B 4MVBD 3JWOH 1U58B 3BUYA 5I8KH 1D9KD 5FKAA 4HLZG 1D5XB 3IT8D 4ZDHB 3DX7A 4X4XA 3SCMB 3BIBX 4JKWA 4FZ8L 3VH8A 5ACLA 2VYRE 5GRWA 3BMVA 2XA3A 1J1XH 4HZLA 3RPIB 4JPVH 4UT7H 5ESQA 2FO4A 4PTTB 3R1GL 3NVQA 4LARL 4HKBB 2PO6B 4HMCA 4XP9L 1VFUA 3IJSA 1RJLA 5I71B 5F6HJ 3QFJD 2BZDA 3GIVA 3H8NA 1N6QH 3LN9A 1R5VB 2AV7B 3TA3A 4KFZC 3CLFH 3ORJA 1E6OL 5L0QC 4WEBL 1T1XA 3O2DA 4Z0XA 1FBIL 4U33A 5KBNC 4Z95H 1TZHB 3MBXL 3MNZB 4GW4A 5GHWL 3GBNL 1P7QB 4ZO6A 5SX5K 2OR7A 3CVHH 4XP4L 1DQQA 3GHEH 4HIXL 2B20A 4WVRA 3VFWA 4X6DF 4TOYL 1MCPH 3BE1L 3GB7A 3BSZH 3AY4C 4HIIA 2YSSA 4KKCC 4L8CA 1DBKH 4E5XA 1CF8L 5C08A 3LDBB 1QFOA 1EUTA 5K33A 4L29A 2IBZY 3CMOH 3WXWL 2ATKA 4JFDB 4CJ1A 3BEWA 5GS1C 2ZUUA 3OB0H 3BD4A 3O41A 5C0GA 1QR1B 5EUOA 3M1BA 4NC2B 1NFDB 2ZSWA 4Y19B 4Z95L 1ORSA 3TFKC 1HQRA 3T3MF 1TTFA 2HLFD 2CLZA 3X13A 1QFPA 4JB9H 3U0TA 4NHCL 4J3OC 4XI5C 1FRGH 5IVXB 4RGOL 1ZLSL 4O2EA 5AZEL 3UC0L 4W6WB 1JRHI 2JB6B 4KQ4H 2WINA 3QDMB 4PD4K 3DXAD 2QSQA 2C3XA 5J57B 4H26A 3D6GA 5D1ZC 5TE4H 4F9LC 4EVNA 1UXSA 1MCWM 5E8OB 3TJHC 3KHQA 5BOZG 1O7VA 4KJYB 3SEPA 2PXYA 5GS1B 3GJEB 4AT6B 3HZYA 3MRQB 1NGZA 1OD7A 1Y0LB 1J05A 2R0ZL 2X9XA 3QA3B 4E9LA 3GMRB 3GMQA 2NW3B 5DK2B 4NWUH 4KY1L 2CKBL 4DQOH 4LCYB 2I07B 5B39G 5KW9H 1XF2A 1Q0YH 2EDNA 3VFSB 4PRPD 3RP1A 4FG6C 1P7KB 5HHVH 3HAEH 4DVRL 4Z7WB 3KPRB 1X6NA 1TJGL 3PG2A 2X05A 4HUXA 2YN3A 1QNZH 2X1OA 5IBTL 1FFNB 4Y5XA 3HN3A 3SDAB 2QHLA 3M07A 4YGVA 5K9QG 3QA3A 1M05A 1SBSL 1B2WH 5BV7B 2BNRB 3F12A 5HHQB 3GBMH 1NBYA 3K7UA 3RKPA 4UIKH 1YYLL 2Y06H 3KPMB 4QT5B 4XWOD 5C0JB 4QHUB 1H3GA 4KH2A 2EXYD 2H1PL 3VWKD 1AQDB 2GYSA 4YE4H 4OM0L 2YD3A 3WO3B 3PWPB 5KAQF 2ADJB 5TDPB 4JCMA 1EIBA 4PG2A 2DOCA 3BP4B 1S7TB 3QUMB 2CSPA 1MCBA 3VXUB 1CGSH 4L4VA 5LQBH 3RVUD 3TT1L 2Z31A 1G7HA 3SGDH 3L3JA 5C0BE 4HKZB 1K8IB 1V3LA 1HHHA 3GSWA 3UO1H 3JV5A 1AI1H 4PJ9C 5DK0B 3DWTA 4OFDA 5EULV 4K3EH 5K93A 4YGAB 1WK0A 5DJ2A 3DX8B 1I1CA 3GRWL 1RHFA 2R69L 4PGBA 4PG9B 3G6AB 2W59A 3D69A 2G9HA 4G43B 2QSTA 4YR6B 1JI1A 4R4NC 5FYLH 3BPCA 2FEDD 3DNKA 3EYSH 4G7YH 4QHNB 1AO7D 4P3DB 4ZTPL 4U2YA 4XP6L 2PNDA 3GSUB 5DC4B 1CR9H 1X5AA 5MEPB 1CZ8L 4PJIB 2EEAA 3NFSL 2VXUH 3RTQD 2P46B 4XZUA 2UWEE 2PTTB 4IRZH 3T0AA 5GIRA 1QFHA 2W0FA 4TNWK 4HG4K 1NSNH 2HJFB 3S3SA 2ED8A 4HSQA 1MFAH 4AEHH 2DQTL 2I60H 1N2RA 5BS0A 5D1QB 5GISL 4LSDA 4X6CB 5DJZB 2H2PD 1VEMA 4Y2OA 4TSBH 3KNBA 1OW0A 4S1RH 2GCYB 3FN9A 4WCYL 4IIQA 5I1KH 1C1EL 4Q97A 3L5WB 3NAAH 5C09A 4YC2B 3TJEH 4HXBH 4KK5C 4PRIA 4M1CC 1NMBH 1NMAH 3H0TB 4Y1AB 1MHCA 5KN5B 3S36H 1YQVH 2PTTA 4N5ED 4HH9B 1BJ8A 2UVFA 5E6IC 1QRNB 5EC2B 5JPNB 1MF2H 1T1ZA 2GITB 4M7LH 4JJHA 3DGGB 5FGRA 5KSAC 5JA9A 4NQXB 2NZ9C 2UY7A 5EDXA 1JPFB 1XT5A 2DJ4A 1DN0A 4L1HA 1KEML 3DYOA 5GGRY 2J88L 1A14H 3RNQB 3OZ9L 4GRWF 4H20H 5HHOE 5E2UH 1OOAA 3TZVC 1I9IL 1LO4H 3BW9A 4NUJB 5A16B 3CVHB 4FQJL 1MAJA 3NPSB 1JGLL 4Z77B 1H5BB 4MAYA 1IEAB 2D03H 3BFOA 5DZLA 3MZGB 1NUGA 4WU5B 3QCVH 2FDBP 2O61B 1ZA6B 4MDIB 3U9UA 5SWQA 1NBVL 1BREA 4MSWA 1ACYH 1ZANL 3BW9B 4PV9B 4QRRD 5HJ3A 4RGNE 2FX7L 3W39A 1WT5A 1CDUA 1U8IB 4KY1H 1ZE3C 5TDPA 3GSRB 1NGQH 1AXIB 3TO4C 2JB5L 1H3PL 2JCCF 3KPOB 4RA3A 2M8XA 3X12A 3ROOB 3GHBL 5CUSH 5BW7A 4WDIB 5MI0C 4L8DB 3LKPB 5D1XC 4LU5L 1CDCA 1B6UA 2CUHA 4Y4FA 5CEXA 2DLHA 2GIYA 2VLKB 5DD5L 1JFQL 1LO3L 1Z0MA 3P77A 4EIGB 1RZJH 2JCCE 4XNYL 4MYWB 1DUZB 3ROLB 3BI9X 5KVEL 3MJ7B 5TF1L 2VNCA 3QUYC 2V7NA 4JM2D 4LLQB 4Z5RA 3RA7L 1JGUH 3T0XA 1KJ3L 3GIZL 1T20B 4XC3L 4NZRL 5C07B 3WO4C 2D03L 5D6CB 1YN6A 4JG0H 1BQHA 1KN4H 1NAKL 1NH6A 2XQYG 5E6IB 3HMXH 2VDKH 4M7KH 3TC9A 5D7IB 3P4LA 3U1SH 5GZOD 1KBGH 4XPBL 1U8MA 1AHWA 1VADA 3WL9B 4WFFE 4PRDA 3MJ9A 3EBAA 2ZKHL 4AIZA 3VXMD 5DDHA 4ZFFA 4RBPK 2E7HA 5FXCH 4QRPE 4Y8AA 4IMLB 4XCNA 1G7LB 4JZJA 1HSAA 5DGRA 1JTTA 3EJYD 2PW1B 1S5IL 2GT9A 2HH0H 3QDMA 4PJHF 1YQVL 3PJSB 4PJDB 1KFAL 5F9OL 3R4DA 1KCVH 2P5EE 1GPOH 4R90H 1UH2A 8FABB 4LP4A 2A6IB 1NAKH 4KROC 2Z31B 2A6IA 4Y4HC 1T1YB 4J2XA 4KRNA 4HGKC 3RA7H 3VWJB 1SJHB 2VDNH 5CLTA 3VA6A 5I2IB 3GKWL 4PJEB 3EFDL 1FN4B 1HSAB 1MRCL 5E94A 3OJMB 5EUOF 4XBGA 2Q6WB 4N90D 1S7QA 4XNYH 3RTQC 4BFGA 3H6JA 5DMJB 2F8VA 4NJ9H 4P2YA 4FFVD 3SGKA 1VGEH 3MLZH 2DWDA 1NCAL 1YEIL 5E6IA 3TBVB 1F4YL 3MRFA 3L3OA 4PGDB 1OQOA 1HN1A 1H15A 4U1NA 3VMPA 3B9KC 5CJOL 3N85L 5I1DA 3NCJH 4Z7VF 5FOBB 3V4PH 1AGDB 3QPQC 1U8PB 3WXVH 1IT9L 5KTEH 5CMAB 3WD5H 4XPAH 1Y0LA 4OZ4A 3MBEB 1PG7L 5DMGC 4P23A 4PRIE 2ZUYA 1H3XA 2BJML 1IAII 3Q5OA 2W0KA 5T1LA 3VI3F 2I24N 3HC3L 1PLGL 1WSST 3MGAA 5DT1H 4U0RB 4CAGA 5L2JB 4LSTL 1ZAGA 5DLML 1DBJL 3MGTB 3A6BH 5ACMA 3WDHA 2WINB 3DPBA 5DJXB 4K94H 2HT3D 5F9WC 2FRGP 1JPTL 3V6OC 5DR5H 1OP5H 4QOKD 2EIZA 3SQOH 2YUWA 3IDMB 4Q0XH 2GJZB 4JRXA 3EOYG 3KPRD 1GJIA 3UPCA 1ZHLA 4OB5H 7FABL 3IDGA 1LK3H 4YBQC 1DQDH 4C56D 2A77H 2DQCL 2OX5A 1XR8A 3KPQA 3LZFL 3BHBB 5DJCA 3K0WA 1GZQB 1LK3L 3DBXA 1CDGA 1XF5B 2EE6A 5DMIL 3ZKND 4AEIL 3PV6A 1YEKH 1GGYA 2NX5D 4K2UL 4HUWA 3HC4H 3EO0A 4BQCA 1OP5K 4F2MA 1QRND 2A73A 1Y6MR 2GSIB 4WWKB 5AZ2L 3HI5H 2QADD 5DJAA 3RIAF 5AUMB 3HE6C 4UUJA 4JHBA 4BQ8A 2PW2A 4PRIB 3LKNB 2M1KA 4GRMA 3OWEA 5J4MA 3FO9B 1M7DA 1JHKH 4NOBA 4PY7B 2F5AH 1DQMH 1BQLL 4PUBH 3JVGA 2Z4QA 3AB0B 5I1HH 2X89D 5ID1A 1BHGA 5LAXA 5CP3H 4KJWD 4X7TA 3MJ8B 4LCUB 4WTZG 1MFNA 4HKBA 1DBBL 2FB4L 1JL8A 1MCWW 5CJ8A 1KTDA 2EYRA 2VQTA 4Y2DA 1RUPL 3QUYA 5DUPH 1YEHL 2HRLA 3HPJB 5IB1B 4IOFD 4MNQD 5F7YC 3EYUL 3X3GL 2IQ9L 5IW3A 1J0JA 1NLDH 3FB6A 1NANI 1J1OL 3NIFE 3EW3B 4W4NA 3ZDXF 3V5DB 2QLVB 4M48H 4YR6A 4WI8A 3ZHDA 5HHME 5MEOB 4LFHG 4M62H 1A7NH 4HF5L 4QTHA 3GSVA 1KG0A 4CVXA 4MA1B 1MF2L 5DVMA 5GGRA 1QLEH 5DJ2B 1GAFH 3QWOA 5CBAB 1UZ8A 1IEAA 5D96B 4HS6B 5T1MB 1WVZA 5DJYB 3BZDA 3MPCA 4OT1L 4FQQA 5JQHC 1L7IH 3CVHA 2EIBA 1JWUA 2CDEA 1H3WM 4ERSH 5SX4H 4PS4H 1KCRL 3NFNA 4P9HC 3C5ZD 4L8BB 3Q5TA 4U6YB 1E28B 1JPSL 4JGMA 4UT9L 4FQJH 1DVFA 3OJDB 1FNSL 1I3RB 5I1CH 4X99A 1K2DB 4FQXA 1KOAA 3IDNB 1UC6A 3KPPA 4RIRA 3VXTB 4XCCH 2LAGB 2ZZUT 1PEZA 4HGWB 2VUYA 3VGDA 5BXFA 3W81A 1R5IA 1OL0A 4YC2C 2QR0B 1I9JL 3FB5B 1H9VA 1IGCH 4QF1B 3C8KB 3I2CH 5IVXF 2J8UB 1I1AD 2C3WA 3KR3L 2IH1A 5CEZE 2Y36L 2R2EB 3EDKA 4HX1A 4OCXL 5HD8D 1NCNA 1DUYB 4MA8L 4BA8A 1FFNA 4Y5XB 3DHMA 1TJHH 1EEUA 2DLFH 3HB3C 3QUXD 5FYLL 3RVWC 2ZJSH 4NN6C 3STLA 4NRYB 3EHBC 4P2RD 4JKLA 3WN5A 1SM3L 1NJ9B 5C0CA 2EDBA 4MS8C 5INCB 3O6FA 5LGKA 4WI9A 3FT4A 4JRYA 2A74A 4I77H 1X5GA 1H0DB 1RUML 2XT1B 1NSNL 5IB3B 2XKNB 1MFAL 3L5XH 3BZ4A 3PGFH 1HWHB 2UV3A 4EI5D 3BPCB 1LDSA 5F88B 5JUEL 4FFYH 1UXSB 4PP1D 5E8OA 5HGDB 2GTZB 2DMKA 4C83A 1UB5B 4H1LH 3MYJA 4ELKB 4KHTL 1KPUB 4C56A 3BRFA 3QDAA 1B0RB 4ZPVB 4DVBB 3IGAB 4YHZL 4LCCB 5D1XA 4I0PB 2ESVD 1UQSA 4G3YL 1RIUH 1YEDB 1R24A 4NKIL 4GG6B 3MRKB 3QO1A 3ZYJA 3Q6FB 5EU4B 2J8UF 4YDVB 3DI3B 4WW2B 3U0TB 1OAXL 3ARGD 3IAQA 1KLGB 5ADOH 3VFMB 4OGXH 2WAHA 1QACA 2K7QA 3WFDH 3JZ7A 2HFEA 5C08D 3DARA 5JOEA 4ONHB 3CZFA 3DETC 1KELL 4CUCA 4GQPH 5HHOB 5I16A 2JJSA 2VL5A 5F97E 4KPHL 4KK9D 4CNIB 1OSPL 4WU7B 2UZIH 5DD0L 3HNSL 1MCHA 4HBCL 1Q9OB 1NKOA 3HUJB 5CD3A 3GB7B 1KN2H 4V1DA 1JCKA 2GJJA 5IV2A 4FQXD 4J4PD 1MCNA 1AY1H 4TRPH 4I2XB 4ZS6C 1BBJB 5J6GA 2JJTA 4EN3D 3TIEB 1OGAD 3FN3A 4KJWC 5F96L 1NEZA 3E2HB 1ZOXA 3F5WA 1SVZA 4Z0XB 3MLZL 1OAZL 3UTOA 3RU8L 5HGAB 4M93B 4YAQA 4KWUA 2E7CA 3DYMA 3CLEL 4JDVB 5F3HB 3MRNB 1T5WB 2D0GA 5HHVL 1J5OH 4OLYH 1FV1A 4EDWH 3ZTJG 1Q9LB 4CN1A 1P2CA 1INQA 3ARDA 1UWXK 3SDCB 1JGDB 4N0YL 2P5WE 3WIHA 4EVNB 43CAA 3EOTL 4K3JH 2VDOH 5D8JH 1XF4B 3NIFF 5DQ9B 4LCCC 5F96H 1KSRA 4PBWD 4NT6B 1JNNL 1SMOA 1OT2A 3F58L 3SDDB 3DI2B 1CLZL 5JO5B 1NAMH 3OPZL 1C12B 3K81A 1G7JB 3B4NA 4QRTA 4LMQI 1CCZA 1LEIA 1WC7B 5E00A 1YPZF 5IQ7H 1ZGLA 5HGHA 5CAYB 1CLZH 2XZZA 1N0XL 1MQKL 3BP7B 1HHIB 1MCIA 5TQ2L 4DCQB 1LGVA 2W92A 1FFRA 3LS5L 1MPAL 3MACH 4Y4KB 2F54A 2B4CH 2R56L 1QBBA 2W9EH 2VDOL 5D8JL 3P2TA 4GAFB 3S88H 4PJGE 3VCLB 2ZNXA 5IMLB 2P5ED 3ZHKA 3MRBA 1FC2D 3HCVB 2I27N 3CLFL 4M5ZL 4JCLA 1KFAH 3I3EA 5D93C 4RMQA 3UTQA 5KSVB 3KLAA 2IALB 2CD0A 2A73B 4F80A 5ISZA 3S88L 1PSKL 1N5YH 4XB8A 2NNAA 4GJTB 5JPMB 4EIZC 1EO8H 3WBDA 1N0XH 3RU8H 1W0VB 4PYHA 1FVCA 1ZVSB 1CL7H 1U92B 1MWAH 1RJYB 1S5HA 3MV8B 5CP7B 1NCCH 3MV11 4UIMB 4D8PA 4X98B 4LAJH 4YHKH 1R3KA 1C16B 2DLIA 2YD5A 1AGFA 4Z7VE 1RZ7H 5KANG 5K9QI 3DV4A 1HHJB 5FM8A 3FMGL 3ULSA 3L3GB 5SX4I 5F1NB 3EOTH 2A0LC 3L5IA 1I9RL 5IIEA 5KS9B 2FO4B 4PTTA 4TVSa 3L3HB 3K8MA 5SWSD 3UX9B 4YDLB 4ZYKB 2HFGH 4YFLF 5DQ9A 4HZLB 2CKBH 3CC5B 4PV8B 1FSKB 3VH8B 1U0QA 3NZHH 4WWKD 2IANA 2WUCL 3CFBA 3A6CH 4MA3B 4Y5VA 1QBAA 4XP5H 3T0DA 2NY2B 2AJUH 5I17A 5EWIL 4YDJB 5HDQH 2IBBA 3QXWA 5E99H 1VCAA 4Q9QH 2G5BA 4OZ4B 1KJ2H 3KJ6L 3W11C 2WIMA 1GL4B 3BH8A 3QFJB 1SYVB 4EI6A 1FL3B 4K23L 3P4OA 3MUGA 4GLRH 1I7TB 4OI7A 3MMEB 3CXHK 1A1OA 4R7NA 3UJTL 4HBCH 4KQ3H 5HSFA 2XZAH 4U0QB 4RFOL 3WE6B 5ICZA 1F3JB 1YNLH 1N5YL 1U8KB 2XQBH 3H9SE 2JK5A 4GW1B 5CGYD 3SE8H 4GSDH 1OVZA 3S36L 5HY9B 4D3CH 4TVPE 2H26A 2ZUQC 3DV6B 4Z7UE 3NGBC 1BBDL 4X0KB 3FO1A 2CH8A 3L7EA 4Y5YC 2OTUA 1HKLH 4HIEB 2AK4B 3G9AB 4P2OA 4JFDD 5FOJA 2K7PA 3IDJA 1MFCL 1GPOL 4R90L 2LABA 4PJEA 1HINH 3V6OE 5ID0B 4JY4A 1ZVYA 3ZDYF 4HT1H 1A6AB 1OAQH 1G7JA 4FXKB 3CU7A 3RVTC 3MRLB 3RWJA 3RY5A 4NYLA 3NZHL 4WI5A 3SBWA 2CIKA 3MV7D 1R3JA 4ALAL 1X6LA 4FFZL 4I5BB 4MXWL 3UPAA 4M7LT 2M26A 1Z0NA 1IEBA 4HK3J 3E3QE 5DDHB 1MHHA 3N06B 5B22A 4G8FB 1IM9A 3TH4T 2V5MA 1U8MB 2DQCH 3BN3B 2YD2A 1NGPH 5T1KA 4ZNEE 3CUPA 1HNFA 3QWRA 3NABL 1JYNA 4BH7A 2CDGA 1NDMB 1N8ZB 1F58H 2X4TA 1INDH 5D2LF 1MCRA 1QO3A 3PGCA 2E9IA 1YDPA 4MCZA 2FYYB 3JV4B 1A7PH 3D48R 1BD2A 4MB5A 2BY0A 6FABL 5I8OH 5F7DA 1JPGA 5CZXD 2NXZD 4PJ7A 4EN3A 2BRRL 2KBGA 4YUEL 3WEXB 2G2RB 2BSRB 4QRPB 1ZT1A 4H25A 4OSUL 2R2EA 3QXDB 5A43C 5FECB 5DD6B 3D39B 5C0BD 3T4AA 4UAOB 1MCJA 2X10A 1LO0H 2VLKA 4XAKD 4R2GB 3NN8A 4XTRD 3VXNA 2W60B 5EU6B 2A9ML 2EC8A 4JFXA 2VZ1A 2VL5B 3KLHC 2EKJA 3RBSA 1JF5A 4HLJA 1F3DH 1KPRB 3ILQD 4S1QL 4I9WD 5EB9A 4PRHE 2WWMC 1BVLB 3WIIL 4J1UA 3EUUA 4M6OL 1J8HA 4FG6D 2BSRA 4KTDH 4U6XA 3QUZB 1T22B 3D0VA 3DJ9A 1BFVH 3H7BB 1I8KB 2DQFB 2WWKT 3VXUD 1U95A 4OSUH 2O61A 5DJ8B 3W9DB 1F4YH 3C60D 2F8XC 2YUZA 1UCBH 4DZ8A 1N6VA 1Q9KB 4LCCA 32C2A 4WFGE 1H3TA 4F37K 1FAIH 1XIWA 1NUFA 1PKOA 1T5XA 5H2BA 5DI8B 5E2TH 3C87A 3NACL 3QEGH 5HHOD 2R15A 5DGQA 3INUH 3V9FA 4K3GA 4PJ8A 3ZE2E 2P5EB 4IEFB 1J86A 4PLJD 4ZUWB 3VGEA 4E42A 5D1QC 5ICYA 2JF1A 4YJZL 3CC5A 1ZHNB 2XYCA 5IQ9B 1KIRA 4FFVC 1VKXB 4XT1C 4JRYB 4LDOB 2BSTB 3OXSB 4D0CB 5EZIH 3QG7H 4NYLB 4Y1AA 1MJ7L 1QSZA 1JWMB 1VFMA 4LCUA 1V7MH 2DKUA 2UYLB 4WEUD 4XMKH 5F70A 3T2NH 1P6AB 5F7WC 5TE7H 5FDWB 4X6FA 5I8CB 4B41A 1JF1A 4K94L 1S9XA 1PZ5B 3QUKA 3THML 1RJCA 4H88H 4U4BA 5IWLA 2YPLB 1FL5A 3QG6B 4PGEB 1MCLA 3EGSA 5CKGA 4B50A 5LCVL 3I6GB 3RJDA 2BHYA 3MRDA 1KTKE 4YFLI 1F13A 3FO1B 3K2MC 5GRYA 3R8QA 5SWSB 3EDFA 5BRZE 2B1HL 5FO7A 5EZOH 5MEPA 1VPOH 3O9WB 5D2NC 4E41D 3V6ZB 4HDIB 3KLAB 3QEHB 1MPAH 2GEEA 4MJ6A 3OJDA 4U3CA 1A0QH 2B1AH 1MVUB 2AJ3A 1R0AH 3FT2A 2C4XA 2GKIA 2P1YA 1TENA 2EXWC 1ZEAL 2ITDA 2PYFB 3IXAB 3TA3D 1RI8A 4QXGH 3QWOB 3BKJL 1HHHB 3C5JB 1G6VK 4F57L 4UDUB 4P2CG 5L2KB 4FQPA 5LGJA 1QZ1A 3U6RA 4Z7NE 3TT3H 4QRQA 1RZKC 2EIDA 4ZUUA 3U0PA 4I8DA 3BWUC 2AXJA 2MPAL 5IMOA 1XGYL 5HYJE 3QI9B 4WHTB 3KPSA 3AB0C 1XGUA 2Z91A 5I66A 1J0IA 5IVZA 4LEXL 5LGJB 2VLRE 5D7JD 3QIWA 5D5MB 2QKIB 5CGTA 2BSSB 4S1SL 1RUKH 1MLBB 4NBXB 3UEZA 1NCBL 4U1HA 3KPRA 2E7BA 2H3NA 2CDFB 3GNML 1H15B 4EUPH 1K8DA 3BKJH 4S1DC 4WY7H 5LBSH 4JFZL 1E4XI 1TVBA 3QQ9D 1I8LC 3L3IA 3T3ME 1S3KH 1A7BA 3BP6A 4BZ1H 1RUPH 1FORL 2X1PA 3U4EA 1VGKA 2DIJA 3AXLA 5JDSA 4M1GH 2ZUXA 5D7LA 4GOSA 3W0WD 2Z31C 3OAUL 2V7HB 3VXNB 4OLZH 4ONHA 1RU9H 4NFDA 1YZZA 2AGJL 1GIGL 1LDPL 2EC9U 1SEQL 1M71A 3D39A 4XNMA 3IRPX 4PP2B 1TZGH 3ARVA 4DCQA 1S7UA 3CCHA 1KCSL 3I9GH 1CDHA 5I2IA 1CL7I 1XGPB 4R97B 3GSQA 1A7NL 4HF5H 2BOCA 3UBXA 5EOTB 2YBRB 5DD3H 1JF1B 3LV3B 1ZHKB 2O26U 1BAFH 1QYGH 1R3LA 4DKAA 2X4SB 4ZODA 3MRKA 4KTYA 2J8OA 4NPYA 1ZKAA 1HEZB 3GO1H 5IGXH 2DWEA 2DD8H 5JIIA 2NY0D 3HC3H 3ULUD 5IHUH 1U91B 2E9JA 1LK2B 5EUOB 3S6CA 4DFHA 1LD9A 5EZJB 4HJGA 4OCWH 5C0BB 3DECA 3C08H 4PJ8D 1YC8A 5EU6D 4N0UA 4PJEF 4MNGE 1J0HA 5F6IC 3PWJB 4U1KB 3U7YH 1BOGA 4NQDB 4RFEA 5I1HL 1TXKA 4K8RH 2KZ1B 2YSSB 1RD6A 4L8CB 4CW1A 1HE7A 3QHZL 5MHSD 5LGHH 1BFOB 4NHCH 4EDXB 1TETH 4ODSL 5CMAA 3T0EC 1QD0A 5J11B 1IZKA 3D87B 4NO2A 1SJVA 4KK8D 4YHIA 1N4XH 2Y25A 2ERJB 4L4VE 2NY3B 4OZIA 1NEZB 1P69B 2APXA 4OCYL 3QH3A 1TCRB 4BSWA 3S35L 3CLEH 3STLB 4AM0B 1HXYA 3DVIA 3VG0H 4P4KC 3E6HA 4UT6H 3LDBC 4ONOA 4AZ8A 1OLLA 1EX0A 2XWJB 3CXHJ 2ARJA 3KPRE 2OR8A 1TQCC 1G84A 4S1SH 4NQTA 3GMLA 4P9ML 3V5HB 3RPIA 2KKQA 2Q6WA 3RWCA 3QRGL 3KPSE 3QZWG 5DFTA 4JPIB 1FNGB 2HFEB 3C5ZA 1MI5E 4AJ0A 4OGAD 3R0MA 1I3RA 5JLZB 3CDGA 2WM0A 4NQEE 1WCBA 1KJVA 5MP6L 3W5MA 4UTBH 3HR6A 1K5NA 3L3KA 1ZV5A 3DTXA 2NLJA 2D4DA 3MMEA 1EGJA 5E1AB 5DQDH 3RX7A 5HYJB 4Q9RL 3OKEA 1KXQE 1FL3A 1NCAH 1RVFH 4HG4J 2DL2A 1VEOA 1NDMA 2VC2H 2Y06L 1KPUA 5E03A 2YPLD 4JZJB 5AAMA 1MEXL 4C56B 1CFVH 1RUAL 3IFLL 2ARWA 4ZS6D 4CW1B 4YDJA 4Y4FC 5HHMD 3V8CA 5BVPL 2Q1EA 4LSPL 4RMTA 1BVKA 1TNMA 2CMRH 2OTWB 2IANB 3NAAL 3H9YA 2VXSH 1NFDE 1XF1A 4Y19E 1WAAA 4OKVB 2VQ1A 3FQTB 2BNUB 4ZYKA 1Q0XL 2H8PA 1RPQA 2E27H 3FFDB 3QUZD 4NQED 5EOCL 3BZEB 1VFBB 5FYKD 2DQEL 1RV6X 3CFCL 1X3DA 3JWNC 3UO1L 1ZLUH 1NJ9A 4FQIL 3LN4A 2NMSA 3L5WA 5EBLA 3G6JF 4UNTA 4IIQB 4BZ1L 1Q1JL 4NGHH 4RFNC 5AYQA 1ZHKA 5FYKE 1A14L 4PJDF 3GFUA 5E5RB 1I8MA 2H6PA 3MUY1 1A3LL 5TE6H 3TYGL 1IQDA 2HVJB 2CMRL 5JXAL 1NL0H 3RWIA 1EZVX 3TO4B 4LNRB 4G6JL 1ZWIA 2YK1H 4A6YA 1IILE 2AXFB 3KWWB 3O6LH 4P59H 4LBEA 3O45B 3RAJL 5F7UA 3M17B 5KOMC 2AQ2A 4O5LL 2EDLA 5CKAA 3SDXA 1KIUA 3CU1A 3UTQB 2FX7H 4UQ2B 1FRGL 1XFPA 4GW1A 4P57B 3OX8A 1MIMH 2C3HA 4PV9A 2C5DC 4FRWA 3G6DL 2EDRA 2JLLA 4IIQC 4MDIA 5GRUH 3U9UB 1ZA6A 4S2SB 1WZLA 3FQRA 4XAWL 2A9MH 2XFXB 4LEOB 1CGSL 5LQBL 5E4IA 5FUCC 4I3SH 2XZCL 4Z8FL 1QSFB 4JFED 4ONGH 4RFOH 5KSBA 2NW2B 1KJMA 5DD5H 4LARH 3HE7A 4P5TD 5EIIB 4ZFOB 1FCCA 4TSAL 3MGTA 4X6CF 5SWZE 1B6DA 5FKPB 1X5YA 2YRZA 1BP3B 5C2UB 4GH7B 3JWDH 5L2JA 4TRPL 1ZLWK 2VLMD 3O9WD 3WN5C 4QXTA 3ZE0F 1D9KB 1V3MA 1EHAA 4DZBB 3PWVA 1ADQH 4LLDB 1AD9A 1HKFA 2B2XH 4QHUA 4BZYA 4PRHA 2CO7B 4OGYL 2JE8A 2BNQE 2WIIB 3LB6C 1DQLL 4G7VL 1CXKA 4IRJC 1JZ6A 5IB4A 3A6CL 4TSBL 1KNOB 3AUVA 3F8UB 3NACH 5DEGB 2V5SA 1G9NH 2P43B 3C5ZC 2UZYB 4HH8A 5I1DB 4WWKC 2YPLE 2EO9A 3ET9F 1WGOA 4D9RE 4XX1G 3BDBA 4OCLC 3VW3H 3DURB 1OB1A 2Z93A 1IBGL 3OB8A 3LKNA 4HFUH 3MLVH 4NOFA 4G80B 1R3IL 2DJSA 1FZMB 5D1ZD 1U92A 3P9MB 4V1DD 1P7QD 4X5LA 3R06B 3MOAH 4ZPTA 4KC3B 4ZOEA 3RX8A 5GGTL 4GXUN 1WBXB 2XY1A 4HDIA 4MJIB 4KRPB 3ULUE 4MX7B 1ROWA 4P4KA 4ZO9A 2IALA 3JSSA 4WTXA 2IWGA 2X09A 3T08A 1D5ZB 3I6KA 5L9DL 2BC4A 2HN7B 4BSJA 4LGRB 1MI5D 3VWKC 2UWEA 2DBLH 1OCWL 3MV9A 2EEDA 3ARDC 5EORL 3VU2A 4IOIB 4NQDD 1CK0L 5FK9B 2V2TA 4N68A 5F9WB 4F58H 5J13C 4HFWB 4IRSC 2ZCHL 1OTSD 1EA9C 1F42A 1QSFE 1RZGA 5DHYB 3E6FB 1UEYA 1LO4L 3AGVA 3QHTC 1N7MH 3QUZC 5KANI 4NNXB 3EO9H 3T2QA 1WBYB 1KCKA 5IVXA 2VE6A 2ZCHH 2NY3D 1G7HB 3EYOA 4ALAH 3Q6GL 1NCUA 1C12A 2DM7A 2DM2A 2EE3A 1A1NB 1C7SA 4LSVH 5DJXA 4KI1A 4MAUL 3WMSA 1P84K 4LSSL 4QHLB 2XZQH 5DD1L 4JFPB 4LU5H 3H9ZA 4OAWB 1VKXA 4L4VD 5BRZA 2EE9A 5DD3L 3RWGB 2VKWA 2A83B 4C83B 3F58H 1D5IL 2V9TA 1KCLA 2W0LA 2X40A 4J8RA 5I1JH 5JDJA 3CSYB 4KVNH 1INQB 3ARDB 4E5XB 1CVSC 2J12B 4F8QA 3RUGE 1NDGB 1XF3B 4BH8B 1RIVL 5EU6E 3WS3A 4TN9A 4KDTC 2A6DA 4PJHA 1M7IA 5FGBC 3SDAC 4YIQB 3MV7E 1UG9A 1EBPA 4HWBL 2Y9RT 1K3ZA 2D3VA 1SY6H 4XBEH 4GMSH 5HDBE 3VFUB 1AP2B 1FAIL 2VQUA 1O0VA 4JPKH 3P0VH 15C8L 1GSMA 1VFAB 1MIML 5JMOC 1IGFL 2J88H 1QVOB 3HG1B 4HIJB 1FE8L 1V3KA 4X5XA 4BH8A 2O5XH 5I8OL 4MNQE 5IFHH 4ETQB 3O6MH 1T2XA 4LFHD 4Y16D 4LKXA 4GG6F 4MD5B 5E6ID 1URLA 1EJOL 4HWNA 2BNRD 2GSGA 4HK0B 1M6OA 3ZTNL 1PBYA 2CK0L 1MLCA 3PP3K 2YKLL 4JHZA 4CJ0A 1WWCA 4P46B 3CZFB 4PJBF 4FTVB 5E94B 4IRSB 4AG4L 3P0YH 1FN4A 1NCWL 4S1DD 5GJSL 3WS6A 4X5WB 3FO2A 3WIHL 1A6ZA 1B0GB 3RGHA 4HJJH 4DAGL 3QEQA 4EUPA 3CPLA 2XQBL 1X4ZA 2Y7QB 3CFDB 4LLMA 5IMMB 5EIIA 1NGWB 3B83A 1HK6A 3O8XA 1DDHB 4U7SA 4MAYB 4OGYH 3U7WH 4IOFC 1ZSDA 2Z92B 4JFEA 3WUZA 2OXHA 1OCWH 4PGCB 2Z8VC 2ICWA 2AXGB 1JHKL 4Y4KD 3OKKA 1BECA 3KJ6H 2X4UB 5JQ6H 5C0RL 1MHHB 2K1MA 4EOWL 2R1WB 4FNLL 2VIRB 3BKMH 4IRJD 3RIFF 3VXMA 5I6XB 5IB3A 4HXBL 4G6MH 4YEEA 1P1ZA 3MV7A 3HPJA 3LOWA 1XCTB 4LF3A 3WFBL 4MA1C 4ODVL 4U2ZA 5K59E 3NCMA 3O4LB 2E6PA 1P7QA 1OAUH 4WJ5A 1YJDL 2AEQH 3DMMD 4K55A 4N0YH 5KSUB 1OB1B 2Z93B 4KUCD 12E8H 4XPHL 5FO8A 3BT2H 4YO0A 1QFWM 3SE8L 5I1EH 4AY0A 5F93C 4K3HA 4ZSOA 3OAUH 2E27L 2NY1C 1QSFD 2IG2L 5EORH 1UWEL 3UZEA 2DICA 1CICA 3P77B 3LEYL 3L95B 4P2OB 1N59B 5GGSB 5A3IC 4KGLA 4K07A 1S5IH 3D0LB 3DUSB 4GW5B 4FQHB 1IQWL 3QG7L 5H94A 3TYGH 1W72B 4KMTH 4NQEB 1UH3A 2P24B 4IHOA 2FLRT 4JJ5A 5A2KH 4LVEA 3PWNB 3GM8A 2ZCLL 5ICZB 4R26H 3ARFA 3QCUL 4M7KL 2CDEB 4UDTB 1P4IL 3OG4B 3MUZ1 4DGYH 2BVTA 1PY9A 2VR4A 2JTDA 4D9QE 1PKQE 4ZXBC 1RZ8B 3A67L 2AJVL 4PJCA 4XMPH 3PQYD 1YN7B 4N5UA 1UZ6E 4U6VL 1YMMB 2FL5B 5EOCJ 5EBWB 4RGMB 4GKNB 5GJTL 4QRRB 3RNQA 1CT8A 4L8SB 1DFBL 5I9QB 3S4SB 4X5WA 1I7UA 4YHKL 4ENED 3TYFA 5EBMB 4J3VA 1FNGA 4GQ9L 3AAZB 4LKCB 5C0IB 3K8LA 5KG9A 4OZGF 4KRPD 5FV2A 5T1LB 1H8NA 3VFVA 5IFJB 3QUYB 1MCSA 4EUPG 2IAMC 3V0WH 5IIEB 5KS9A 1KTDB 2EYRB 5ADPL 4TUKH 1ZT7A 4ETQA 5HGGS 3FQUB 1CGUA 4NQDE 2V17L 2AK4D 3TV3L 4OCSH 5D1ZA 5K9OA 3GJFH 3WJJC 2GCYA 4YDKH 4U6HA 3HG1E 1HYSD 3GEWB 4TVPD 4UOW1 1P7KA 1UM6L 3QXUA 1RIHH 4R4FH 2D31A 4FN0A 4R4BB 4LAQH 1S5HB 5IT2L 1EO5A 3LN5A 3L3DB 1YYML 1VFBA 1UKQA 4WFFD 3MRFB 3F7YB 5I71C 4PJHB 3B6SB 3ULUF 1YEFL 3MV7B 4AIXA 4H8WC 5F7LB 1LO2L 2G60H 1D6EA 4M61B 2VZ3A 2ILLA 4GRLC 5DR5L 1QQDA 2C1PB 5DYOA 3G5XA 3ARTA 4M9PA 3U46B 1ZS8A 2FR4B 2VKXA 2P5WB 2WUBH 1A3LH 2ZUSA 4N8VB 5TE6L 1T0NB 1D5MA 2Q86B 1DBML 1BMGA 3GNMH 1GOGA 1HNGA 3MJGX 5B3JF 1A7QH 1YY8B 3UTPD 5JHDD 5T3ZE 1N3NA 2NQCA 2MNUA 4YHYC 1F4AA 2COQA 3V7AG 3DTXB 1TZGL 1A5FL 1MHEB 4A6YH 3SJVD 1WBYA 2Y6SD 2V5TA 1CK0H 4I48B 1WCBB 4Z7OF 3GSQB 5E70A 3PQYE 4NFBA 5MENA 5DMKA 4EN3C 2VZOA 5E7FA 2QQKH 4Z7QF 3C5ZB 2DDQL 1ED3B 3VGAC 1HQ4B 5CJOH 1FYTB 1AO7A 3X14B 5EPMA 3C2AL 4ZOCA 5M94B 4R2GD 4QT5A 5A3ID 5MERA 1MRDH 2NY1B 3MYZA 1U42A 2VC2L 2IBZX 4PLNC 2VLRB 3DX9A 3JBG7 5E08L 1G6RA 5D7IA 4HIIB 1FIGH 3CX5K 1I9JH 4N0CD 5J9PA 4HEPG 1CICD 4U6TA 5F3HA 3U82B 3ALPA 3C09C 4JFHD 4OZHE 2B5IC 5HGAA 3S4SG 3L3DA 1FZMA 1TDQA 4L3EE 1MUJB 2EDFA 4Z76B 3I3BA 3VRLE 5K9JH 4QRSB 2JJWA 1L4IA 3MV9E 3WFDL 4F7CA 2BNQD 4CMMA 4POUB 1QSEB 1PY4A 1MQ8A 1EFXB 3PGDA 4HXAH 1S78C 2E8ZA 3VMNA 4C4KT 1XF3A 2DWDB 2VLLB 1JUFA 1CE6A 4OCSL 3BKYL 5I74B 4Y4FB 1LO5A 5F89A 4HKJB 4M8VA 5FAAA 3AU1B 1OSZB 3CFIC 5KG9B 3C9NA 4JFFB 1JE6A 1KENL 2MSPA 1I3GH 4EI5B 1DANT 4GMTL 1KB5B 2VWEC 2X70A 2VDQH 4K7PL 2QL1A 3S4SA 5L6YL 5FYJU 1B88A 1P6FA 1RURL 3BGFB 4OLWL 5GGVL 1YEHH 1P5VA 1FCGA 3JXAA 1SJXA 3O3AB 5EO0B 2ZG1A 3BEVB 3BH9B 4TNVF 1A6TA 4Y5VC 3RFZC 1UJ3B 3SKUD 4WI6A 4I0PA 3AROA 5FGCB 1R5WA 3E1F1 4QTIH 1ORSB 2RJMA 4CKVX 3S96A 4WHYH 1QSEE 5BO1H 2DTSA 3DRTB 3RY6C 3ZE2F 5DJ6A 3BEWB 5I73C 3MV9B 3VWKA 3QDJA 5D7SL 1A7QL 1XGQA 3QULB 4MJ6B 4L3EB 3DROB 4YH6A 1W72A 3RVVD 4P9HL 1JMZA 4FABL 3D39E 3GSOB 4WY7L 2OSLA 3B6SA 3O2WH 4XBPA 1KENH 4ORGA 3MCG1 4PJAB 3BE1H 4R4BA 3QNXB 4JHWL 1JNNH 5ITFB 4KZEH 1WICA 2ZUTA 5DUBA 2VAJA 2W9EL 1QRKA 1A7RL 1WFNA 4GXVH 5D1QA 3ZSSA 3H3PL 5M95B 1FNEA 2MTPA 3QNXA 5EBLB 4PGZA 3PQYB 4KZEL 2A2QT 5IB4B 5I66B 3O3DA 2W0FB 5DMYA 1YMMD 1KC5L 2L0DA 4R96A 3ARSA 1KGCD 3RVXD 3WLWC 3V6FB 3P11L 4HHAB 4EDWL 4F7EA 1RURH 3PWVB 5BVPH 3QUXC 1BZ7A 3X12B 3ARED 2XWBA 5IBLD 1A4JB 1D5XA 3EHBD 4XP1L 1U8IA 4NHUB 3W9EB 3GMMA 1PG7W 3VWKB 1JYVA 5F3BB 2AXGA 4O2CA 3BRGC 4OCMC 1X9QA 4GLRI 4KKBD 2NW2A 3I50L 3GBLA 1BZQK 4P49A 43C9B 4HWEL 2NCMA 4UDTA 1Q72L 2OR9H 4JKMA 2ADGA 5E8PB 5LGHL 3VGBA 2EYSB 2AK4E 3T0EB 1CQKA 4PJXF 5J11C 1JHTA 2DQGH 3HPLB 3UROR 5KVMC 1ADQL 3V5DA 2CK2A 5GRVL 1DQML 2NYYC 2KL6A 2AJZA 4OF8A 5CILH 5D7KD 5JHLL 3GMNB 4JPIA 3IFNL 1F6LL 3RWCB 1I9IH 3AU1A 4YUEH 4LNRA 1INEH 1IC7L 2AI0L 1N59A 2HWZH 3W0WB 4ONGL 4R0LB 4X7TB 1RFDL 4P3CH 1WWWX 3KYKL 2F5BL 5TE4L 1A8JH 4ZSOB 3B2VL 4QNPE 4KHXH 4HS8L 3VFTA 5DRXA 1G9EA 1E4WL 2OI9B 3FT3A 1FJ1A 4NQVB 4OF0A 4U1IA 4MAUH 1HILA 4S1QH 3WJLA 5JOPD 3B3IB 2YXFA 1QSVA 5C0DB 1G7IB 3D3VB 4HWEH 2EDQA 3F65A 1NC2B 4JY5H 2RR3A 1YMHB 4HWBH 4M1CD 4XNUH 4EDXA 3OBAA 2NY0B 2Q8AL 4PRHD 5CSZA 4GT7A 2A38A 3JV6B 5E2UL 2X4RB 2PR4L 2DKMA 3KJ4C 3FOMA 4P3DA 5HHXH 5I75B 2ERJC 1T83C 5IEHA 4MWFB 3DSNA 3QHFL 4OUUB 3EFFA 3PWLB 3CK0H 4Z7WF 3QXAA 4HEME 2LTQB 3QHFH 4OZIE 1A4KB 3ARYA 3BISA 1I9EA 3G08B 5TGBB 2Q3ZA 3UZQA 1Z5LB 4NPYB 4PJ5D 3MA9L 5DK0A 4UV7L 4XXDA 3RL1A 3WIFA 4JE4B 2E7MA 1K8IA 4Y4HA 2CUMA 2UUDK 1E27B 4UZGA 5EOTA 3I6LD 4OFYD 4X80H 3E6FA 3MROB 2QADC 1S7SB 4O00A 3REWA 3FB7B 5JLZA 1P4BL 2VISB 3QWQB 4XPTL 1F8TH 2GW5A 1KPRA 3TN0A 4Q0XL 3ULVF 2G5RA 4LVNC 2GUOA 3I50H 2F5BH 1RZJL 1F6AB 1JVKA 1WQVT 5CINH 4AG4H 5E2JA 3K8KA 2DLEA 1TCMA 3RWEB 2GY7B 5J6HA 4B7IA 4X4ZA 2EDEA 2UUDH 2JK5B 4YEFA 4DKFL 4JFOB 3ZYIA 3MLTB 1EZVY 1MFCH 3VFUA 2X4PA 1W0WA 4MLIA 1U3HC 2DRUA 4YNYB 2VLKE 4AYFA 5CEZH 2W07A 3MUGB 4DK3A 4PB0L 3DUUB 2WSKA 4N0FA 1RHHA 4YIQA 2HTLC 3QFJA 5HYJD 5ETUB 4NO2B 4DN4L 3CAFA 1MRFL 1WZKA 1TPXB 1QR4A 3CUPB 5IW6B 3VFNB 1P4LA 5I1EL 2YEZB 2W9DL 1PYWA 4XPTH 1QP1A 3SKNA 1UYWH 4LOUC 2HH0L 4LLDA 1X5FA 3FONB 4QXUH 1J0YA 2GI7A 4PV8A 4JPWL 4G9FA 3UJTH 5DVNA 4H26B 1LNUB 3AY4A 2EZ0C 2N4IA 3BN9C 6FABH 3C5SB 4KROD 4TVPH 1Q94A 5GGSY 1A1NA 4OI9A 1JZ5A 4TSAH 4HULB 4YPGA 3WUWA 4LQ1A 3P9WB 4JY4B 5ICXA 1S9WA 1EO8L 2R0WH 2X89A 3LEYH 5HGBB 5IM7A 2BY1A 1MWAA 3RHWK 4BFEA 5JXED 1VESA 5DFVD 3TEUA 1T0PB 1FL6B 4PRPE 1KIPA 1IC4L 3QPQD 2AVGA 1OM3H 5IMKA 1QA9A 4JZNA 4LGSB 2VXQL 2G75A 5DMGD 4P4KB 5FHBH 3WFBH 4D94A 1IM9D 4MJIA 3OAZH 5FUOH 1QFWL 4X6CE 5I1GL 3W11D 3MRHB 4U1JA 5K9KA 2GJ6E 1KULA 1UCBL 2IGFH 4LSPH 4ZG1A 4QOKE 1I8IA 1UXWB 2Z8RA 5A40E 2JB5H 2RBLA 5DHVB 4Q6IC 3QUKB 5DZOA 3IKCB 4P4RA 3BKCL 1SQ2N 4YO0B 2A6JA 2BSSA 4OLZL 3M8OL 3JUYA 5CGYC 1RJLB 5KSUA 5FHBL 2P8MB 4WO4C 2NY5C 3LN4B 3MV9D 5GRZA 4M6ML 4G8EA 4TQEL 2BSTA 3OXSA 3FN0H 5ESQB 2P42B 3QI9A 4TYUA 3MBED 1CBVL 1AKJA 3BQUD 4N9GB 4NQSA 2ZOLA 1T21A 3BPLC 3UJIL 2BVQB 4G42B 2F53E 3FN0L 3KS0J 4NKQB 4YBQD 4JFZH 5BQ7A 3RDTA 4WI7A 1C08B 5D6DA 3BUYB 4KTEL 4LQFL 2CO6B 4BYHA 2ICEB 4KMTL 5F1NA 5HVFB 1CD1A 6CGTA 4UDUA 5IJKC 3BIAX 3VXME 2DIAA 32C2B 4Y1AE 1D5IH 4YAQB 3UTTB 1JNLL 3PWPE 5IROC 4NN5C 5E8EB 4CU7A 4LEOA 3O8XB 4D8PB 4RQQB 5IW1B 3W9DA 4PRBA 4UNUA 3SDXF 4WO4B 3W82A 3RIAK 3O9WC 1KTRL 1JBJA 2X2YA 5GGQH 2VSDA 3VRJB 3CZJA 2NY4C 2IG2H 3IB4A 5C0NC 4Z7VA 2W38A 1R3HB 4TPRL 4DGIH 5JPMA 3CDGB 1PGRB 2FGWH 5CEZD 4HC1A 1FNFA 5D72H 1U36A 1QBLL 1E4XL 4XB7A 4F9PA 5T5NF 2QQQA 4D0DB 4TUJA 1FVDB 2C9AA 3L95A 3O2DL 4FZEL 2HKHH 4UTAL 3U2SA 5ISZE 5INDA 4RGMC 2OJZL 1MSPA 3BP7A 1CWVA 2LU3A 3HI1B 1J11A 1FO0L 2O5XL 3MJ9H 4NZUH 1NFKA 1S9XB 5HGHB 1TLKA 5ACZB 4LDEB 1BM3H 3ZKMC 3HMWH 4WFGD 1A64A 2UYLA 1GGCH 4LGPB 3QUXA 3QP3A 4M3KB 3UJIH 2VLJB 1T7VA 3LS4H 2FLBT 5HDOA 3MXWH 4CVWA 2A6DB 5JNYB 4NWUL 4NDMB 1KJ2A 1DBAL 1I1AA 2XOTA 1SJEB 4YDLC 4RAVB 2EDXA 5KJRH 3CSYA 3DUHA 5J89A 2X4UA 4M4PA 1TITA 4QTIL 1RUQH 3I02B 5F1SA 5I19H 2E3VA 3T0WA 3P4NB 1F90H 1T4KA 5C08E 4NDMA 1BM3L 2NY2C 4D9RD 4UQ3A 2BNRE 4NM8L 1YMHA 3A0OA 4NN7C 1MELA 5B8CB 1F00I 4LHQB 5D7JB 3N1PC 3N0PB 3N1QC 4P5KB 1F97A 3RWJB 2Y5EA 4LPUA 3IJYA 5HD8C 1B3JA 1YEFH 4OCXH 4ZNEA 2YPKB 5E2WH 3ZMRA 3ARBC 2Y7QA 3FZUD 2BOCB 1I1RA 4ZAKC 3UBXB 2F9BT 1J8HB 3WHXB 3FO2B 2H9GA 1QPPA 4IRSA 2BVUA 4P99A 3W0WA 1BGXL 2P8LA 1HYRC 3KYMB 1UA6H 3EAKA 1CFBA 5C8JA 3QDGD 1I1AC 5I1CL 1UVQA 3IDIA 5C0FA 2K9UA 3WFEH 3QQ4A 4RZCA 5IHZB 3HRZB 4WHDA 1MFDH 3MNVB 1IGYA 3CJJA 1UACL 1L7IL 1AE6H 3IETA 5B8CC 3WEXA 3R06A 1A9BA 1BD2E 2OP4H 1LWRA 1N26A 2A1WH 3CNKA 2Y36H 2XACC 1GGTA 4JR9H 1IAIL 5IW1A 4QYOA 2ED9A 5E8EA 4LASH 5B8CA 2AABH 5HI3C 1V5JA 5FM5O 1OGAA 3ZYZA 2ZUWA 4F7PA 5I1IL 1MRDL 5AZ2H 3BPOB 2RAMA 2FBJH 4RMWA 3WDIA 3WHE1 3FFCA 3GJEA 4XAWH 5DRZA 4F7MB 2FJHA 3H9SA 3Q48A 4ZXBB 1W2KT 4KKLC 2VLJE 1JNHA 4JFDE 1IE5A 3CFBB 4F3FB 1YEEH 2R2BA 2FHFA 1BX2A 4ZUUB 1FVEA 1SM3H 4RRPA 5BV7C 4M5YL 3FT4B 1IM3A 1U6AH 2CIKB 3RAJH 4JHWH 1IMHC 3RZCB 5C0CB 4POYA 5DTFB 2R4SL 3QPXL 4PJIF 2CKBA 1IGML 3DMMB 4PLOB 2X7LB 5E9DB 4WHYG 1ACZA 3O3EA 1KXVC 2VDPL 4J12A 1M7DB 1OD9A 3DRQA 3S35H 3EYUH 3RNKA 3FQRB 3CK0L 4HX1B 2ZSWB 1BOYA 1T2QH 4FXGB 1U8LA 3ARGC 2BCKA 2LQRA 1AGBA 5E8DH 3BVNB 5EN2A 1RZKH 1KCSH 2EIEA 4P57A 2FATL 3NCEB 5C08B 4G9FD 4WWKA 3C6LD 5GZND 1E4KA 3O6KH 3WNPA 2XKUA 1NFIB 3V6ZA 1YJDC 5E8DL 2MQ0A 4Q2ZA 1NFIA 1K4CA 1NFDF 5IESL 3MODH 3DROA 1U3YA 5KSVA 1U3HA 3WD5L 1DVFB 1KCRH 4Y2DC 4ZPTB 3UBXG 2KH2B 2FJGB 1GOFA 5EN2B 3TZVD 2HG5A 5D71L 4KMQA 5ALBH 3WE6A 5FUCE 3OKLB 1K9TA 3PXJA 3QIBB 3CFKB 4JY6B 4W4OA 3R8BB 4XXCC 1WBZB 5FUZL 4P46C 1YEJH 3SGEI 4KI5D 2DM4A 2IAMA 4X7SL 1ZHLB 1INEL 1R5VA 5EUOE 3TA3B 2AI0H 2HWZL 2R4RH 3GIVB 5EO9A 4HUUA 4TSCL 3VFRA 3IDMA 2JIXD 3MREB 4K9EC 2EDKA 1KNOA 2DS4A 1U8HA 5EA0H 1JTPA 2V2WB 5CJBA 4IBLT 1OAYH 4AIOA 4YXKL 2IFFH 3FB6B 1ERNA 1SBSH 5DVOA 4ZFZB 2B4CL 3P0GB 3ARBB 3SDCD 2ORBL 3VXRE 1A3RL 4NO0B 5BJTA 1LQSR 2IC2A 3FCTA 3P9LA 4K9EL 1OSZA 4X9BA 2OBGA 3V95A 5I1LB 4XPAL 4XC3H 3GK8L 2IAND 4PJ9B 5L8LB 5T1LD 3CVIH 3K2UH 3QI9D 1CE6B 1B4JL 2P8MA 5H2BB 5IW6A 1DE4A 1ZTXH 3NH7L 3MX0A 5FV1L 5EZOL 3LAFA 1U8PA 5KSAB 4BUHA 4N0FB 5FIEA 3OKEB 2IBGA 4LSTH 4M8QB 4PY7A 2E6QA 4KK8C 2CR6A 2HJKA 4KU1A 3TVMD 4Z76A 1XAUA 4K3JL 2PW2B 3LIZL 4XRCA 2YPVL 2EZ0D 2Z8SA 4KXZI 2MQCA 4I2XE 2R0KL 4XH2A 1RULH 3TBVA 5TQ0L 4DGYL 3KYNA 3RVXC 5JW5A 5ALBL 1KT2B 2BHUA 2XA8L 2V9RA 4XCEB 4HD9A 4PJDE 1AC6A 3ZO0A 5L8JB 1EAJA 2F53B 2VDNL 2FWOA 2NX5A 4MDJB 1JGLH 2YN5A 2F54B 2P5WD 3U48A 1FL5B 4UV7H 3RNKB 1LO0L 1T04B 1M7XA 3NA9H 5T3XL 3REWB 1CXHA 4JQIH 1VFOA 3JTTB 2WLZA 1ZGLB 5CSBA 1FAKT 4LK4A 4PTUA 3KYKH 4L4JA 1T89A 2CKBB 2BDNH 1O7SA 2PN5A 4LHUG 5D1QD 5DD0H 3KLDA 3UYRL 2QQLH 4KPHH 3SDDA 2APWA 4XCYB 1I4FA 4QOKA 1OGAE 1N8ZA 3VW3L 1HZHL 2HFFB 5D6DC 4M43H 2R4SH 3QPXH 3RBGA 5HHPA 1DL7H 4IMLA 4X8XA 4LLWB 4HS3B 4OF3A 4OTXH 4OZFB 5DWUL 5HGDA 4YHOL 1FYTD 3EFFB 4MGXA 5I6XC 5MP6H 3PWJA 4U1KA 1GGUA 4NZTH 4F58L 1JZ8A 4PJ8B 2VDRL 5GRJH 1YECL 3QDGA 2X4RA 4HS3A 5DSCB 4P23B 1FNLA 1SJEA 3SKJH 4P2RE 5I76A 3NCJL 5TF1H 1RK1B 3INUL 4FHBD 1U8NB 3BPNC 3QNZA 4G6JH 1TQBC 4DOHB 3IFLH 4JQVA 1JHLH 4NCC1 5CS7A 4PJFE 1HHKB 2ED7A 2X4PB 5T5FL 3FAWA 3ZSTA 4LRIC 1NGYA 3FZUC 4R9HA 1CGXA 2YMXL 5HYQB 3GI8L 5JIPA 1EFXD 2CGRL 3OJ2C 5DQJB 2OMBA 3HRZA 5F1OB 4KJQD 5FUZH 4N0CC 5IFJA 4G6FD 4LSRH 3FQXA 3WXVL 4YBHA 1JGVL 3P40A 5DQJA 4YHNA 1YNKL 1JZ7A 1CFNB 3VXTA 3GSRA 2XIDA 1Q72H 2OR9L 5F8RC 1M4KA 3WO4B 4WFED 5TPWH 2BVOA 2MWCA 1TVBB 1SJHA 1S9YA 3QZWB 2C3GA 3VRJA 2R0KH 3S35X 1I85A 1JPGB 3PUCA 4MSWB 4PP1C 5EOQL 1MFEH 5C2BH 1VACA 3EZ8A 5DT1L 4RQQA 2C4FT 2X1WL 4LVNB 4P2QB 1QKZH 4LQFH 1EEZA 4N8CL 4KZDH 1G6RH 1IC5L 5CINL 4LHUA 5EFIB 1CGWA 5TH2B 4DKEH 5BMFL 4JO4L 3QDGB 1HDMA 4RFEB 1KJ2L 2GHWB 3MUJA 4L3CB 3O0RH 1WEJH 5HHMB 4WHTA 1F8TL 5F9AC 3FOMB 3T1FA 4OV5B 4G42A 2NXYB 3GJFA 4JVPA 5KZCB 1EK3A 2ICWI 4F7EB 5E56A 4WWID 3QEQE 1NQBA 5HBBA 4NC1E 4S1RL 3BP5A 1DVFD 4BSVB 3ZL4H 3Q2CA 1FSKC 1OTUC 1T20A 3IRZA 5A2FA 1DBAH 3LKRA 2X4SA 4M43L 1HILB 2GTWA 4LOUD 3ULSB 4IM8A 4JO4H 3L9RA 2UWEF 4OD3H 3VFGL 2GJ6D 2Y07L 3ZE0E 5C9KA 5DA4A 2R1YA 3U4BL 2VSCA 4MQTB 2VDQL 2DQDH 5INDB 2Z31D 3BZFA 1HOCB 1FO0A 2H2SC 2ITDB 2PYFA 4O02H 2XTLA 1QKZL 3O4LA 4WJ5B 5C0RH 4M1DL 3MTRA 4XPFH 3T8XB 2FX8H 2ZOKB 2AJXH 4J6RL 3JWDC 1NCBH 4WTWA 1P1ZB 3VD9A 1R5IB 4YHPB 4Y16B 3ZL4L 5T1DH 1IC1A 2W9DH 4CBPA 2R1XA 4HBQA 3KDMB 2VZVA 3ARBD 5FO7B 1R3IH 5IMKB 1XGQB 4I3GA 1UKSA 3ARWA 3QDME 3PDOA 4LCWE 5I30H 1S9VB 5TF0A 1SHMA 4XPHH 3RWDA 5CJXA 1A6WL 5JW3H 4I9WE 2JKXA 3BHBA 3Q0HA 2FSEA 3Q3GA 1G9NC 1QLRB 4D0BA 4DKEL 4ZNCD 2NZIA 4H8WL 4LIQL 3IDXH 4LLUB 5GGQL 4LSUL 4OM0H 2EH7H 5FDWA 3WLWD 5EO1B 5A16A 1RSFA 4QRTB 5D5MA 3J8F7 5JIKA 2DBJA 1MCKA 3TVMB 5B39B 5IVZB 5JXEC 3MLXH 3RZCA 3FOLB 3OPZH 3RI5F 1TQBB 1QBML 1YUHA 4UILL 4MA3A 4Y5VB 1JHLL 2VERN 4HUNB 5CEYB 3P9LB 2BJMH 1RK0B 3DSFH 4P46A 4AMKL 1BZ7B 3UTSE 1QNZL 4ZFZA 5L7XL 1AKJB 1ES0A 1LO5B 5DEFB 4GAYB 3FOLA 5IVNA 1GXEA 3K74B 3WLBA 1E4KC 3OXRA 3TVMA 3G5ZB 2Y6SC 3TT1H 1T5XB 1RZJC 3DHJA 1CDJA 1ZA3A 2KQNA 4JRYD 1UA6L 3RKDD 4F7PB 3PNWB 4JDVA 3JTSB 3C08L 1ORQA 3QUMH 1PQZB 3MRCB 1UT9A 3R1GH 1P84J 4QYOB 2ZCKH 4U31A 4Y4HD 3VFSA 1K85A 5DFWH 1TTUA 2GQHA 4OF7A 1ZVSA 4OGAC 4F33B 3D3VD 1M7IB 2WLYA 5AUMA 4XZUB 3QJFA 3HHRB 3PDOB 1FGNH 1NC2D 5IKCA 4V1DB 1U3HB 4MQXC 3RTQA 1CXFA 4NO0D 1ZXQA 4X6DE 3QFJE 3TBWB 4BELD 3VD5A 1OAKH 2XPGA 3K4DA 1ZLVK 4KUZL 2HKHL 4JPKL 2QQKL 3BYTA 4H5SB 4JKKA 4Z7NF 3GHEL 4HIXH 3G5YA 1JZ3A 2D7QA 4PGBB 4NP4L 2W65A 4PGEA 4Y4KA 5EBGA 3QXDA 5FECA 1FO0B 3MCLL 5IM7B 1IGJA 2XA8H 1RZKL 3H9HB 4R26L 4PRID 1E27A 4OLUL 1LILA 5IJKA 5J1AA 1UB6A 3C6SB 4X6FB 1ETZB 5I8CA 3K4AA 2HP4A 2OJEA 3MRGA 3VXPA 5CFHA 4OIBA 1IC7H 1X5IA 2X9WA 3W2DH 1P7HL 3ECBB 4ZAKB 2PW1A 2I26N 1U41A 1LVEA 3B9KB 2BFVH 2V2TB 1IAIH 1QR1A 4XMLL 2IGFL 1IGMH 2UZXB 1U93B 4NNYA 4JQVC 2GTZA 4MJ2A 1P5UA 4V2BA 1FGNL 4WNQA 3FQNA 3D1MC 3L6FB 4M7JH 5H37H 5BS0E 1NBYB 4WENB 4G6FB 2C1PA 3UTSD 1F3RB 2X1XR 4W4OC 4U1SB 1G7PB 4RAVA 2F54D 1IT9H 1OTUD 5FCSH 5KTEL 3U7WL 4EJ1C 2ATPA 3IF1B 3LRSA 4HUXB 4HWBA 3F7YA 5ETUA 4YWGH 1QSEA 5BCAA 4P2QA 3LH2H 1SEBB 2D0HA 5INCA 3EOAB 3Q5YA 2CIIA 2CQVA 5E5MB 4NKMA 5TDNA 2OZ4A 3P0YL 3QIUD 4K7PH 5SV4A 3DO3A 3LSOA 5ANMA 4YDIH 4FNLH 4U6HB 3FRPG 2I5YL 4YZFE 1CGVA 4G6KL 4GBXB 3ARFD 4TTGA 4O9HL 4MXVE 4R0LA 1NAML 2IH1B 1H3PH 4GO6B 2VLRA 5IHZA 4CNIA 4HK3N 3KR3H 1U9KA 2A6KB 3WSQH 5JTWA 5I8KL 3D25A 2DDQH 4NZRH 4JFXB 1NMCB 2VUOA 2PKDA 3QEUB 2ZWLT 4WEBH 1A47A 1JGEB 1RUQL 1YNTA 3WFEL 2MHAB 4PR5B 1U58A 4MNHA 1IKFL 2PO6D 3Q1SL 3X11A 2JCCA 4Y0GA 4Z7UA 4YK4B 1PJ9A 1IAKB 4FQQB 5I1IH 3IJYB 3WIFB 1C5BL 3UTTA 5CBAA 1XZ0B 4WI2A 4XI5D 3NMEA 2GJ6B 4S2SA 1RK1A 3BPNB 3GSVB 3M1BB 3SE9H 4CVXB 1CZ8H 4ZS7L 2RFXA 4NJAL 2YWZA 5HI5C 4A2LA 4FS0A 3ULUC 1FH5L 4ZFFB 4XNZC 3U36A 5T3ZH 1TMCB 4NN5B 5HHNA 5IHUL 3G5XB 3RDTB 2FEDC 1DP0A 4NZUL 3BQUA 4D9LL 4U1MA 1U6AL 1IZJA 5CSZB 4AENB 3GKWH 3N50A 5EC2A 4N9GA 3RRQA 3OV6A 4Y2DB 3PABA 3C60C 4O58L 3RI5K 3TO4A 4K2UH 4OZGB 5DJDB 3MR9A 1UENA 4PJCF 2B1HH 2D7TL 3OKDA 4RISH 4Y19D 5MENE 1J18A 3O4LD 5ANME 1TIUA 4O58H 1JWSB 5CJQL 5AWNH 5FYJL 3VFTB 3V4VL 4V2CB 4OLYL 1OARH 2VXTL 5GS0H 2VH5L 5ADPH 1MJJB 4F7TB 3ABZA 4QXWA 4Y5YB 1WJ3A 4M9OA 2AK4A 4U05A 4QWWD 4IDLA 2CPCA 1KB5H 3PABB 4Z0BH 3B2VH 4XBPB 4LF3B 1I1FB 4NM8H 2NNAB 3ES6A 1A6UH 2APTA 5IK3A 2DF3A 3OTTA 1NUNB 2NXYD 1FH5H 3WFHB 3GSUA 5I1KL 3P3YA 1W72L 1CLOL 5FYJE 3FTGA 2QTEA 2IMMA 5IP4A 1U8KA 5E1HB 4IDJL 1TFHA 2EDWA 4EEEA 5FYJH 1E28A 5HDBF 1C5BH 4X4YB 5KOVC 3BDYL 4L8BA 1IKNA 1FG9C 5D7KE 1XR8B 1K4DA 3C60A 3QO0A 2QHRH 3MNWB 2XWTB 5GGVH 1H5BA 4YFEA 2PTVA 4FQ1L 2CLVA 5KSAA 1C5DA 2DBLL 5IHBA 1YY9C 3IXTB 4PRPB 4HKZA 4UT7L 2GAZB 5F8QC 2IQAA 2WBWB 5EO0A 3MRJA 4N8VG 3MGOA 4WO4D 1CYGA 35C8L 3QDJE 1S7TA 4M6NL 5CP3A 1B0GA 9CGTA 4NT6A 4K23H 3SDAD 1TJIH 4YXLL 2XXCB 1KB5A 1CFVL 5I1LA 1X5ZA 3DGGA 2E5EA 3C9NB 4JFFA 1MAML 3PL6B 1MHPL 4FQ2L 3D25B 3NBNA 2ESVE 4YDIL 5B38B 2OS7A 4X6DA 4HIHA 3O11B 4HV8A 1F4HA 3NCCB 1CICC 3LQZB 2XZCH 4Z8FH 1HHJA 3HC4L 1MOEA 3B5HA 3LSOB 4WUUB 3C8HA 1WV7T 1YMME 1RUMH 4RBPH 4Y8DC 5DS8A 4ZD3H 5F1IB 4PJ7E 4R2GC 5E2VL 1A0QL 2VR5A 2VXVH 4OZIB 1FFPB 3ARRA 4PJBB 3OKLA 4RX4D 1CU4L 1A7RH 1SEBA 1FVCB 1MAMH 1CLOH 2F15A 2R4RL 1KACB 4I2XA 3BXNA 3S7GA 2FJGA 1QOKA 4KI5E 5C86A 1MCOH 4ZO8A 1MY5A 3ULVH 2EH8L 2GSIA 3BMWA 5CD5C 1YQ2A 3HLAB 2BXZA 3C6LA 4U1LA 4ZUSA 2R1WA 4MD4A 2WBKA 1CL7L 3TWCL 3UBXI 3OR7B 3VG0L 2XZQL 1RJZB 3STBA 1VSCA 4XP4H 5IMLA 2APFA 3OR6B 1BZ9A 4KQ4L 2PO6C 2A83A 2RFXB 3HR5A 4J4PC 4XNZB 3L5XL 1WIUA 3UPRA 3LB6D 3MLSH 4JKPH 1HEZA 4X6EA 2IJ0C 3MROA 3MLPA 5ICXB 2XRAH 3GSWB 3NGBB 4ZSOE 4YPGB 1R3LB 2GJZA 4JRXB 2OM5A 3BRDA 4FTVE 1NLBH 4LLMB 3W5NA 5F72S 1UB6B 3C6SA 4HC1H 4O5LH 3TCLB 3CMOL 3PJSA 4OFPA 4OLVH 2IADA 4MHHI 1B0RA 4ZPVA 3CXDH 4PJXB 1G7LA 2NR6D 3K46A 25C8H 4XTRC 2Y4SA 1N5AB 2EH8H 4D2NA 3AREA 4QWWC 1IC5H 3ZKXC 2RCSH 3BDXA 3TH2T 2VXTH 2V5YA 4F7MA 1AHWB 4MNQA 4M62L 2YZ1A 3BP6B 3HLAA 3HZMA 1D6EB 1F4XL 4M61A 5DQDL 3TGXA 3O6FD 2LAAA 2VXVL 3RPKA 3SDAA 2NY2D 3SGDI 3U9PL 3QJFB 3HZKA 4NN6B 1G7QA 4B7LA 3LN5B 1OTTC 2WBJD 3ESUF 3QEGL 3EDJA 4LSQL 1U8QA 1BF2A 5HYFA 2OL3B 1T1XB 1WWAX 3EYQD 1BEYL 4S0TD 5HYSA 2M2DA 2AV7A 1DQJB 3WS3B 4G8GE 4BKLA 5D1ZB 5K9OB 5CD3B 5J6HB 2DLFL 5ITBL 1FQ9C 4C59B 2ENYA 4ZQKA 2DIBA 2PXYB 2YWYA 3LD8C 3A6BL 1T6VN 2VRAA 25C8L 4MMXC 3WKNA 1JNJA 4ZXBD 4F9LA 1AD9B 4DKFH 2XQYK 2P8LB 3KYMA 5IBTH 2AP2A 4EKXA 4Z78A 1HQ4A 2DD8L 1JPST 3BGMA 4X4XB 3E0GA 2VISA 1G1CA 1J1PL 5F71A 2JIXA 5C3LD 4JANB 5MENB 4XBEL 3DXAA 3O4OB 5B39A 5FYKU 2HJLB 1J7VR 3O8XC 3HE7B 5C09D 3QIUB 3SKOB 2I9LB 3MLRL 4GG6A 1QSFA 2XFXA 1XIWC 3WHE0 1HQRB 3VXQB 3RGVB 3FFCE 3MNWA 4KKNA 3SGEH 3T4YB 1CDIA 2E7LA 1S9VA 3U46A 4TUOB 3UCRA 5TFSH 4MWFA 3U7AA 2R2HA 1F02I 3O3BB 4I4WB 5H94B 4NQXA 3C6LB 1T1WA 1FNHA 4JREB 4U1LB 4ZUSB 4KHTH 2MKWA 1T03H 5KAQG 2VL4A 5IB1A 3D0LA 3FQWA 5AYUL 3VDBA 4R96B 3SOBH 1UJTA 3PGFL 5C07A 3DVGA 4XVUC 5FHAL 3IJHB 3QG6A 4JDZA 1Z9OA 2LVEA 4XCFL 2Q8AH 2YPLA 5JHLH 1FNEB 1NMCC 4NRYA 5BS0D 4DAGH 5HPOA 2FD6L 3LQAC 2BVEA 2ID5A 1JWSA 1V05A 1AXSB 3QDMD 4KVNL 1CGTA 3LKRB 1L7TH 3MV01 1DSFL 3WNLA 1WISA 4W6YB 2BVPA 3LD8B 4LLVB 5GIRB 1EVUA 4QRPD 4GAJL 5AWNL 3FB8B 5EUKA 1IEHA 1FZOA 1UADC 1Z9MA 1RFDH 4P3CL 1BQSA 3L7FA 2ZG2A 4PJIA 4JM4H 5ICYB 1AXTL 2OTWA 5HYIA 3KLSA 5KVGH 3UYRH 4QHNA 1BVKB 4P2OC 5ECJE 2YRPA 4MXQC 2HLAA 1HDMB 2AQ1A 3MRJB 5CILL 5DJ0B 1LO2H 2G60L 3RY6A 3D2UA 4WO4A 5C92A 2DMCA 3IXTA 4LPTA 4WU5A 5J12C 1XZ0A 4LLUA 1FFOA 5D2NB 1JPSH 43C9A 2AKRA 4OZHB 2AJUL 1BJ1J 4G7VH 4J4PA 1K4DB 3C60B 3OL2A 2VABB 4Q9CA 1B90A 3CPLB 1J0ZA 3DSFL 3HMXA 4GUPB 4AMKH 2LU7A 1A2YA 3MC0A 1EHLH 4FA8A 5DLMH 2BVQA 4XC1H 2GITA 4KAQL 1I1YA 2AJXL 2D7PA 4RAHA 4YE4L 1ZHBB 2VN7A 3DUSA 3BYYA 1NCDL 1AO7E 3QQ9C 5KVFH 4H1LG 3PWPD 4OQ1A 3V6OA 1ULVA 3GMLB 1ZWIB 1F4WL 5T5FH 15C8H 4G8EB 4LLVA 4LPYA 3GSXB 1QFWH 1YYLH 4LSUH 3UXFA 1MCQA 3PQYA 3HNTH 1AXSA 3IS0X 5HHXL 1EFXA 2E7LC 2FIKB 3KYOA 3TP4A 2RQ8A 2NY0C 3VD4A 4P3WA 1V7ML 4TQEH 4G6AC 2WBJA 3EDEA 3TBTB 3ULVD 1GYAA 4JN2A 5GGVY 2R69H 4WRLA 2XICA 2ZNWA 3PHQB 3U7YL 5DO2D 2X4TB 1ZMYA 4XPGH 5FF6B 3F6LA 2CDGB 4ONFH 4XWOC 2I60L 2ZJSL 2HTLD 4XNXH 5EU7C 3P4MA 4C56E 3CX5J 1KV3A 2EO1A 2H45A 1QA9B 4JZNB 2J6EA 1BLNA 3B5GA 5HHNB 4L3CA 2Y23A 4YX2H 5JW4Q 2Y07H 4NBZB 1FYTA 1WIPA 2GK0A 3BO8B 3LQMA 4M93C 3C2AH 4G7YL 2QADB 2DL9A 4OAWA 5C0AA 1L9MA 1KBGL 4EQ2A 2YA2A 1R3JB 1MRCH 5DMKB 4PRAA 3LHPL 4WUUD 3PL6C 2YD9A 3EFDH 1F2XK 5E1AA 4ZTOH 2D7NA 2NXYC 3MRGB 4FZEH 4FXKA 4ONFL 1FYTE 4QKXB 3BWAA 3EYOB 4WCYH 1UCTA 4F15B 4NNPL 5J1AB 8FABA 3JTTA 4G8IA 3HC0A 1AGEB 1SYSA 1T04A 1XGYH 4R97C 4KHXL 4HS8H 1QPXA 3B9AA 5HI3D 2ATKB 4JFDA 1Y18B 1ZS8B 4JFQB 3RZWA 2EICA 2JJUA 3AXLB 5JDSB 4UTAH 1Q38A 2DN7A 3KPMA 3OJVC 3BN9D 4QRRE 4PJFA 5CHNB 1JUFB 2AK1L 4QGYA 3L3IB 4Q9RH 2XTJC 4FP8L 4YHML 1PFCA 5D7SH 1VFAA 1UYWL 3PHQA 5MEND 2NYYD 1DTUA 4XPGL 4XNQA 1LEGB 2GY5A 2YC1A 1U8QB 3JWOL 4QRSA 2HJKB 5DUPL 1I85C 4GRWB 4UT9H 2ITCA 5EWIH 1LEGA 2YC1B 4KK5D 4YWGL 1MUJA 4PJ7F 5HTSA 3L3OB 3P73B 5I30L 1FORH 1CFSA 4MQSB 5IB2A 5MEQA 3QIWB 3VI3E 1T0MA 1WFOA 1EDQA 4DQOL 3FQUA 4TULL 4C4KO 4X6BB 1KPVB 1ZT7B 2NZ9D 2YS4A 4DTGH 3BQUC 3QXTA 3HNTL 1EEQA 2V17H 4LCWD 4KK6C 4NN7B 1CTNA 1JRHL 2VZTA 3H42H 1P53A 1D9KA 2YUXA 5ELIA 3U0PB 1BQUA 3DX7B 2AV1A 2VOTA 5GZNC 2EH7L 2YD8A 4OD2B 1A2YB 5DRNB 1S7SA 3W39B 3ZE1F 4N1EA 4UU9A 1DFBH 4KROB 4MQ7B 2PUQT 2OZ4L 3ISWA 3TBYB 4K7PY 3SY0B 2OK0H 4NNXA 1MCPL 1RZ8A 5C07D 1CFQB 4PJDA 5E95B 2CLZB 3OG6B 3PXHA 3LMJL 3X13B 4D0BB 3IFOA 3IXAA 2YRLA 5FK9A 5DJ0A 3O41B 4PG2C 4N8VA 3PE9A 1KCVL 1YEEL 5F1KC 3PWLA 3OX8B 2H32B 3FRUA 4HQQH 5IEHB 1DN0B 4DFIA 1KT2A 3KDMA 5DZNA 3QDJD 2BOBB 5FM4A 4U0RC 5JXAH 3D85A 1FZJA 3L5JA 3V2AR 4PFEA 5F7KC 5FF6A 4O4YH 1TVHA 3DXAE 2VR9A 4HUVA 4LASL 3EYSL 1MHCB 4CMHC 3D3VA 1CICB 5E7BA 2HVJA 5C09B 1I7RB 4FOMA 1KYOJ 5C0EA 1T3FB 4MHHG 1U2CA 3AM8A 3CFEB 4KDTA 5J1SC 3JTSA 2ZUQB 2GTWB 4I3RL 2RHEA 1DE4B 3IJSB 1JN6A 4OFIA 4S11A 3LQZA 1QSED 4NIKB 1P9MC 4JO1H 5ESVA 2XY2A 4HV8B 2CR3A 5DEFA 4RGND 1T80A 4GMSL 4PJ9A 5EG6C 3ZDZF 5CGMA 4RFNB 5BZDB 3MQIA 2VQ1B 3DIFA 4OQTL 3LKPA 1IKNC 1KIRB 4MXVF 4BK4A 3O2WL 3DX6B 4OLWH 4UV4H 5GXBB 4UBDD 3LKOA 5CIPA 4NC0B 4U1MB 1BFTA 1WLHA 3D9AL 4Q6YA 1OWRM 1P2CB 3SDCA 4HPYH 3IDUA 4DKDC 5J7CC 3BAEH 1FPTL 5EFIA 2Q87A 5EO1A 3MCKB 4HUUB 1AFVL 4JM4L 1IAMA 5KSBB 4BFBD 2EC9T 1OP3H 1FNSH 1I7ZA 4M6OH 1KXTB 3QIBA 3D18B 5E9DD 5IMMA 1F90L 5F3BA 3REVA 4YLQT 1RMFH 4PLKD 4X7EC 5SWSE 3VXUA 1JTOA 2HLAB 3DLQR 1WZ1H 5TDOB 1Q9OA 3HUJA 2IPKB 4G5ZH 4HZAA 1U3HD 4FTVA 4APQB 1G0DA 2X1QA 3PF2A 4FQHA 1MH5A 1T66D 5B4MD 1S9KC 4QCIB