5GISH

Crystal structure of a fab fragment with its ligand peptide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
211
Chain Sequence
EVQLQQPGAELVRPGASVKLSCKASGYTFTSYWMNWVKQRPGQGLECIGMIHPSDGETRLNQKFKDKATLTLDKSSSTAYMQLSSPTSEDSAVYYCTTHFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Heavy chain of Fab fragment
publication title Structural basis for multi-specific peptide recognition by the anti-IDH1/2 monoclonal antibody, MsMab-1.
pubmed doi rcsb
source organism Mus musculus
total genus 50
structure length 211
sequence length 214
ec nomenclature
pdb deposition date 2016-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gisH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gisH02
4V1DA 3SJVE 5MENB 4N0RA 4OCYH 4ZOCA 1BZQK 1IM9A 5L7XH 2C4XA 5J57B 5FYJH 1JZ4A 5AD0A 2KQMA 4KY1H 3OJDB 4P2RD 1FHGA 3EHBC 3KPLB 5DR5L 1JNJA 2B1AL 4HJJL 1MHHA 3D39E 2MFNA 1U8MA 2OI9B 2BVQA 1M7XA 2BDNL 1GYAA 2XA8L 4GO6B 1RZJC 4UUJB 3OKOB 4I77H 1NUGA 1AY1L 3KYOB 4TTGA 1B4JH 4TOYL 4MSWA 1DBJH 2PO6D 1OLZA 1RFDH 3VXUE 2V2TB 3DUSA 4DAGL 4D0BA 4HHAA 1ZSDA 2Y36H 3SKMB 5ICYB 1YJDL 1WITA 4OGYL 3IAQA 2NW3A 1PDKA 5GRVK 1P7QB 4Y2OA 4N8CL 4NN6C 5DFVD 2FL5A 3OAUH 4P2CG 5EU3B 4EIZC 1FZJA 1E28A 2G9HA 5GGSA 1KPRA 5I8CB 4HLZH 2NY1D 1N0XH 3NZ8B 1C1EH 3BKJL 3PWJB 2AAVA 4KKLC 3PDOA 1AO7E 2A6IB 4M02A 4L29A 4LK4A 4LKXA 5TH2A 1ZLVK 3MRPB 3SDAD 4LLVB 3WUZA 4PJIF 1DUYB 5HYJB 4WHYH 1KYOJ 3W9EA 1KJ2B 2RBLA 3HI5L 4OGXL 2W9DL 3FB6A 5CHNB 3WDHA 1VFBA 1YEJL 4Y5XB 3BESR 1RUKH 3GMRA 1A1NA 3LRHA 3SDXE 3G6DH 4G9FA 1UYWH 5DMJB 4O2EB 5E1AB 3H42L 3CAFA 4RBPH 5FYKL 3TZVB 5FHAL 4PJ5E 5DLML 1ZHLA 4TYUA 3L1OL 4UIKH 1A6ZB 4KMTH 3X13B 4RX4A 2XTJD 3MRBB 5LAXB 4AEHH 5JHDA 5EC1B 2E9IA 3HUJE 5LXGH 4UV7H 4MD4B 1IQDA 5KSVA 4WUKH 1Q0XH 4PJXF 5GIRB 5EZIH 5FGRA 1C5DB 4C83A 2YD5A 1T21B 5C0JA 5GS0H 2NXZD 3SDCA 3KLDA 3FQRA 2W59A 5BJTB 3HI6H 4LLMA 4HIIB 5HGBA 4PRID 1K4DA 3MRHB 2P5EB 3A67L 3JTSA 1N64L 1MOEA 3V9FA 4KK8D 1G9MH 3D18B 3DRTB 4KQ3H 4NQDA 5C7XH 3VFWB 4M1DL 4UOJA 1AP2B 4KZDL 4UZGA 4NKOB 4NBYB 5E8NB 3S35L 5ADPL 5E56A 3VFMB 4LRNH 5F7EH 1KPUA 3SQBA 1GZPB 1X44A 1WZMA 2K7QA 3BP6A 3KXFA 43C9A 3KPSE 4HMEA 3MRJA 4ZUUA 1Q9KB 4M93B 2QSCH 1U92B 5DMKB 2DICA 5B8CA 3K4DA 3VWJB 1SBBA 1A6WL 5IVZB 1W8OA 3S88L 1CVSC 5DD0H 1FL5B 2PW1A 4PREA 1VEMA 5DVKA 1NMBH 1LGVA 3O6FD 2R4RH 3WNMA 2W65A 1TVBA 3BH9A 1N4XH 1MCKA 4JFZH 3DSFL 1S9XB 1I9RH 5I1JL 5ALBH 5E9DE 3O4LD 4OCWH 3CLFH 2ZOLB 5EOCJ 4PJ9B 4PJDA 3LHPL 1LEGB 4I2XA 3U0PB 3UPAA 3MYZA 2F5BH 5F9JA 4UT6H 4Y4FD 5JMRA 1JRHI 1MNUL 4UUJA 3NCJH 3M45A 2X7LA 4XX1G 4UI2A 3VXNB 2ERJB 2DM2A 2FD6H 2A6DA 1R5IA 2E9BA 2EDTA 1DBBL 2XN9E 1C16B 1NGXA 1I9EA 1FFOA 4O02H 4APQC 3I84A 3O8XD 2V2TA 2N7BA 2I9TB 4L8BA 1I1AD 4WHDA 1S7SB 4H88H 3GFUA 5I8OL 5EORL 1Z3GL 2I07B 1JNHA 3WXVL 4GS7B 3GKZA 3S4SB 3SKOA 2QHLA 4NZUH 1MFNA 5B38A 2WUCL 1RJZB 4NSKA 3UTSD 3ZMRA 4DJMA 4WU5B 1BJ8A 3MRQA 5J11C 2BSTA 1A7NH 4K23L 1N5YH 5DD1H 3HFMH 3VMNA 5IVXE 3FFCA 1IEAA 2WZPD 4XVJL 3PWJA 4YNYB 5K9QG 1JL8A 2R1YB 5CP3A 2GCYB 2AXFA 3HZKA 4EUPA 3V5HA 4TRPL 5GS1C 1LVEA 1SY6A 3L95B 3CPLB 5HI5C 5ICZB 1M1SA 1T2JA 2VXVH 1FL3A 2ID5A 5INDB 3QEHA 1PY9A 4QCIB 1XGUB 2A1WH 5D1ZB 3ARFA 1SM3H 1TIUA 2OZ4A 4Y5XA 2K1MA 3V0WL 3DV4B 2F54D 3EDFA 3ARED 3MODL 4X83A 1HCVA 2VKWA 5E1AA 1KG0A 4L4VD 3BW9A 4O4YL 4P23B 4POZC 4XC1L 5ITFB 5FO8B 2CUHA 1JZ5A 4OUOA 3B3IB 4GOSA 5EWIH 3SCMD 3OX8B 4GXVH 3O4OB 4YIQB 4LIQL 5IFHL 4NCC2 2XKNA 4RFEA 3RVWD 4RNRA 1CIUA 2P8PA 5DK2B 4X6EA 2J88L 3TIDA 4MDJA 4TPRL 2DWEB 1MFDH 1AFVH 3VFUB 5JZ7C 1B90A 4WFEE 4NWUH 2XPGA 1XGPB 3MJ9H 5JW5B 2ITCA 3QI9A 2NY7L 3MJ6A 4M5YH 1HE7A 4L8SC 1XCQA 4OCLC 5ABDE 5DVLA 1CK0L 1MFCH 2BC4B 3IDUA 4ERSH 5E5UB 4I5BA 5E8NA 3D0LA 4XNMB 2XXCB 4DQOL 5IMKB 1T7VA 1DQLH 1FLRH 3OR7B 5FCSH 1MEXL 3T65A 2DMBA 1IM3A 4MJ6A 3JWDC 4NQEA 1YMME 2BHYA 1V3JA 3OXRB 1OP9A 3D85D 1I8MB 1J12A 2XQYK 3FKUS 3K74B 4BFEA 4F15C 4UQ3A 1MHEA 3MOBL 1VEOA 1A6VL 2BNUA 3ARSA 1TTUA 4E42B 4JKPH 1HQ4B 4M62L 3PJSB 1GAFL 1NCAL 4PD4K 3HUJF 1CTOA 2YWYA 5DQJB 1MY5A 4RGNB 1ES0B 3CXDH 1N26A 4MJIE 2R1WA 1IFHL 2E27H 5E70A 4GSDH 4D0CB 1CLZH 2HFGL 4PJHE 1J5OH 4BSVB 5DRXA 1HSAA 2PCPB 4KZEH 2IFGA 1BQHA 3KPRD 4GBXA 4LCIH 4U0RB 2VXQL 2YN3A 1M7IB 4X6DE 1GGUA 4PYGA 4Z0BH 4AIZB 3CDGB 3OPZL 1T7WA 2ADGB 4MAYB 1ERNA 2F8VA 4KI1A 4CAGA 2E7MA 3C9NA 4U1KB 2BJMH 4UBDC 3G5XA 5DJAA 3W0WB 1ZOXA 3TIEB 2W9EL 5AYUH 1D5XB 1K3ZA 3NACH 3RTQC 3SGDI 4EN3C 1H5BA 2NX5A 2ZCLL 3N9GH 3QZWA 1KV3A 5FOBB 1KEMH 1IGML 5D7IE 1CDBA 1CBVH 1UC6A 2WV3A 5KANG 12E8H 5KS9E 1ODAA 1IGFH 3C60D 1U8PB 4YDKL 2BCKA 3G04B 4IRJD 4HW6A 4OF0A 4L8CB 4EI5B 2VISA 4LSRH 5A2IH 2V2XB 3CDYA 3DX6A 3L3DB 2FATH 4HCRA 4JFHD 1CICC 4P9HH 2ZOKB 1NFDB 5GJSL 4WI4A 2JB5L 4Z77A 2FH6A 2VLLA 3ZKND 2UZYB 1LE9A 4LHUD 5IFAL 5EBWB 4P3WA 5D1XD 5DR5H 4Y4HD 2EXYC 2NZ9C 2B1AH 1BWMA 4QCIA 3U4BH 5HDBE 1RZGA 2X4OA 3RZCB 5C08A 5DJ6A 2QR0A 3C5JB 2XA8H 2ADJB 3QQ3B 4AQOA 4RQQA 3HI1B 1AY1H 1T4KB 4TOYH 1JI2A 2RIKA 4NGHL 2JELL 4ZFOB 4P23A 2W07A 2QBWA 4K55A 4R4ND 3Q48A 1ZA6A 4DAGH 5HI4D 1FVEA 1KTLA 3FOMB 1WEJH 1YJDH 4OGYH 3MO1B 1QYGH 3E6FA 4YC2C 2PXYA 4M6NL 1A9EA 1LO3L 4PRAB 5CSBA 3TCXA 5D5MB 3VFUA 4HT1H 4XP1H 1NGYB 1U3JA 1OGAD 5KJRL 3BKJH 3ULUC 3GSVA 5C0CE 2P7TA 2C1OB 4IM8A 1XFPA 1XIWA 3X3FL 3BQUB 3TBTA 4JPIB 4MB4A 5SWQB 2HN7A 1SVCP 3FHAA 3RUGA 2PW2B 4GLRI 4JFOA 1JK8A 1WUNT 5MEPB 3SGDH 3HI5H 1EFXB 4J8RB 4OGXH 5H35B 5F7YC 2W9DH 3BMWA 1YEJH 4YHYB 4QXTA 4HS6B 3RIAK 5C0DB 1JZ3A 1B6UA 1PKQE 3H42H 2YA0A 1EVTC 4MA3B 4AIXA 1UM6L 3BSZL 5FYKH 1OP5H 5EZJA 3F7PC 2XKSA 1QPXA 4E42A 5AG8A 1HQ4A 3MA7B 1CLYL 4HGWB 1DZBA 3P11H 4K2UL 4MA1B 2Y7QA 4ELMB 1N2RA 4CADB 5B39A 1AXSA 4D0CA 5IW6A 1T66D 5LJYH 32C2A 1FFRA 1I7ZA 3UTZB 2AEQL 5IHBA 1MIML 3U82B 3A67H 4JY6B 1N64H 2AABH 1OAYL 1KNOB 3P9LA 4GRWB 4NOFA 3V8CA 1HDMA 3EOTL 1RD6A 4HQQH 2VLRB 2CUIA 4HS3A 1HN1A 3NPSB 4NBXB 4KZDH 4LFHD 5E99L 3S35H 1TVHA 1DL7H 4I9WE 3TPUA 4CMMA 5C0FA 4N5UA 2YD3A 2VAAA 5HHMD 5DHXB 3L3GA 4PJCE 3UMTA 5SWSB 5DSCA 3T0ED 4OBSA 5BMFL 1NGWB 5DTFB 2EIDA 1KCLA 4C4KO 3MQIA 3ET9F 5F6IC 2D0FA 4J23A 5C2UB 4YGVB 3TJHD 1U8PA 2PNDA 2APBA 4ZS6D 4L8CA 1YY8A 3IFNL 3C6LD 4Z7UF 1ZWIB 2AVGA 3EAKA 4DW2L 1A6WH 4BK4A 1E0OB 4QYOA 1EX0A 4F7PB 2JCCA 5IEKB 3VXSB 1G7JA 3QEQA 1IKFL 2RB8A 5FKAA 1KJVA 5L2JA 4OIBA 3IDMA 3RL2B 4HEPG 3BP7B 1S7VA 5DJCB 4JZJA 1NAKL 3DSFH 4U3HA 3TWCL 1P4LA 3T08A 1D7FA 3Q6FA 1DN0A 4Y19B 2G5BA 2VDLL 2KL6A 3LZFL 5DMYA 3MBEC 2EO1A 3LHPH 5FM8A 4Y16A 5BVPL 2AQ2A 3RZCA 1WT5C 1MNUH 3GMPB 4BFIA 4MVBD 3BPLB 3UTQB 5K9KA 3H9SA 4FQXA 1P9MA 4CRPA 4YHOL 3P4NB 5HGHA 1IGYB 3E6HB 3SOBL 1DBBH 1DE4A 5D6DA 5J12C 3QAZB 3CU7A 4P2OA 4N0FA 5I8OH 5EORH 1HH6B 1Z3GH 3OKEB 4NBZB 3WXVH 3SJVB 3QCUL 4YBLB 3HE7D 2WUCH 2PYEA 4FHBD 4K23H 1MHCA 4EEEA 4UMGA 4D2NA 4DGVH 4IRSC 4MQ7A 4R26L 3WKML 4XVJH 1CGXA 4OI7A 1O0VA 3VWKD 3D39B 1OQOA 3BGAA 1I3VA 3NN8A 4YPJA 3PL6A 3PGDA 1G7HA 4TRPH 4L3EB 5FV2A 1A02N 4ZAKD 4JPIA 4BSJA 1LMKA 4H25B 2XFXA 4UQ2A 1K5NA 3OGCA 3TO4C 1EFXA 2VQUA 4GAYB 2DI9A 4NFDA 3EYOB 5IMOA 5IHUL 4PR5B 1Q9OB 5CCKL 3RWIB 2E7LC 3MODH 4GW5B 3CD4A 4PUBL 2NR6C 1KB9J 4JRYB 4F9PC 2ED9A 3L3JB 3PV6A 5EUOB 3SGEI 4PGCB 1LEKA 4XC1H 4O4YH 1A1MA 2XWJB 3ARDB 4FQIH 3MRGA 4PBXA 3GO1L 4LIQH 5IFHH 3TNMA 1Q94A 3EOAB 1UJ3B 4KTDL 1I3GL 4PV9A 3CC5B 5E6IC 4DOHE 3ARGD 2J88H 3A6CL 4TPRH 3DX7A 3EDJA 1Y6NR 3OL2A 1LP9B 3GMQA 5CSGA 1VA9A 5ID0B 4MWFA 5ACZB 2NY7H 4OF8A 4ZXBC 5F7NC 1A6AA 3EYSL 1CQYA 3RWFB 1BJMA 3QUMA 4M3KB 2I27N 1CK0H 2VLRA 3BP4B 3MRFB 1INDL 1WLHA 3AAZA 1T2XA 5BCAA 1L0XA 1DANT 1IGJA 2JIXA 4DQOH 3PWVA 4K71C 1CTNA 1AIFB 2VLJA 4PRHE 3MV7E 4L1HA 3IAGC 1MEXH 4KJWD 2DQJL 1AKJB 2IALA 5C07E 1Z0NA 3P9MB 1MH5B 1RJYA 1MI5A 2EDXA 4RAUB 4RMRA 1TQBC 1VHPA 4AJ0A 4UT7H 3MOBH 1A6VH 5K9OA 1O7SA 4PJGF 4OLYL 1DANU 5FO7A 4M62H 1GAFH 4NQCE 4Q58C 1NCAH 3ZLQC 3ELAT 4DZ8A 5BVJB 5I1LB 5E0QA 3K7UA 1IFHH 5D2NE 2FJGA 4K94L 4Y4KA 5FKPA 4ODXB 5I1AB 4R8WL 3IDYC 3R06B 3MLUL 4PJEB 4F7MB 4OAWB 3WUWB 4LU5L 3VD4A 1U8KA 4KROC 5KN5B 3BP7A 2DYPD 1SEQL 4PRDB 2JF1A 3HKFA 4BFBD 4JKLA 3UYPA 1S5HB 3OPZH 4JM4L 1A5FL 3D3VD 1J8HE 3CH1B 2EXWD 2H6PA 4X9GA 1W8NA 2GJ6D 1MUJB 1FSKB 1FYTE 1HHHB 4IOFD 1WBZB 4U2YA 5D2LB 3UTQA 2W9EH 4WW2F 2FEDD 4P5TC 4AZ8A 1CXHA 2VLKE 1IBGL 3P0GB 5MERB 5B21A 3Q3GB 2ZCLH 5E94A 5EH1A 1IAKB 2DM3A 3PXJA 4ZODA 1QSFD 3LKRB 1IGMH 5T5NG 2AV7A 4FXKB 3FT4B 4GRLA 4YDKH 3RX5A 1GZQB 1UWEH 3BXNB 4FOMA 4WV1C 1XEDA 4YK4B 4FRWA 1XGYH 2JTDA 5DRWA 1A1OB 3MR9B 4F8TA 2VQTA 3MTRA 3BHBB 3TBYA 3IDGB 4JO3H 3V0VB 5E9DB 4NM8H 2QJDA 2OTUA 5T5FL 5E8DL 4MDIA 5GJSH 2ENYA 4JDVA 2NY6C 1K2DA 5EZLA 4DWHA 2H41A 5HYSA 3S5LG 2JB5H 3D39A 3ARPA 5DUMH 2VDNL 4DZBA 1GL4B 1CFNA 3DSNA 4LPXA 1BQUA 5KZCD 1CGVA 1K8IB 2O5ZL 5EU7E 3I6LE 1OB1B 5HD8C 4QHNB 1TETL 2XY2A 3IT8D 3L9RA 4LSUL 3VXUA 4U1GB 2ZUQB 1BF8A 1FGVL 5LVEA 4JN2A 2ORBL 4KMLB 5EC2A 1KOAA 5C0EB 4CN6A 1UVQA 4LFHG 1Z5LA 5T1MB 4L1DA 4J1UB 2B4CC 4NGHH 2JELH 3CSPA 5H2BA 2HG5A 1QHOA 2IMMA 3PF2A 3W11C 4XVUD 3ZKXC 2J7LA 2N1KA 5T1KA 1HOCA 1AO7A 5HY9B 1ZEAL 1DLHB 5ERWB 3E2HC 5ID1A 1LO3H 3QHZL 3BO8A 1VFUA 1ZXQA 3O2VL 3VXQB 3QDJE 4TNWF 4Q6IC 2V7HB 3BD5A 2YC1B 3VXPA 1JGLL 4DN4L 1UXSB 5KJRH 4HX1A 4XNQB 3D25B 3K4AA 4H0IA 1HNGA 3GSQB 3DXAE 5D1QC 1BVKA 4FN0A 4NO0A 3U83A 1A7QL 3E8UL 3T8XA 3X3FH 3SDXA 3MRFA 3VXRD 3AY4C 1ULVA 5CGTA 4AK1A 4LCCC 1I4FB 3H9YA 3RIFK 4AQ1B 1AQDA 2ZSWA 1U8NB 5IEHA 5I66B 4FXGB 1FAIL 4PB9H 1HZHL 5C0BE 3ZE2E 4PJ5A 4KKAD 4FS0A 3QWQB 5HI3C 4OZFA 3HUJA 1CVRA 2OMNA 3MRLB 4FFZL 4J4PA 3UPRA 1FPTH 4LRIA 3CX5K 4XRCA 2BSSB 1K3IA 5J3HD 4UDUB 4LVNC 1UM6H 3BSZH 4HLJA 2CUMA 2CK0L 1J18A 4XBGB 3VH8G 1A7BA 4AMKL 5F88A 2ESVB 1FVDB 1CLYH 5E7FA 3QDGB 3LKOA 4KRPB 2FX9L 2VIRB 2BNRE 3HB3C 5M95B 4R3SB 3BGFB 4I0CC 4ODXA 5I1AA 4NRYA 4XXCC 2AJ3A 3IJSB 1RK1A 2AEQH 1U9KA 1JJUA 4PJ8B 1MIMH 4PRDA 1CXIA 2EDLA 2FX8L 5I71C 3QR2A 3EOTH 2C1PB 3KDMB 3LKSB 5HYQA 4QF1A 3ROLA 4X99B 3CH1A 4PG9A 4XVSL 1AXTL 3KPSA 5E99H 1YUHB 3HMXL 4L9LC 3PQYE 4ODBD 4XP4L 2I60L 3C08L 1QP1A 4KDTC 3TC9A 1QEWA 4G8FB 4EXKA 3FRPG 1MJJA 5E8OB 3VRIA 3O3BB 4M7LT 1EXUB 5BMFH 2DQDL 3PHOA 2BOBB 2IF7A 2P5WE 2C3XA 4MCYA 3I3EA 3W5NA 2CRIA 3P77A 3G5VB 4YDLC 2XACC 1ZLWK 1GZQA 5HXMA 1IEBB 1FDLH 3LAFA 4M48L 3IFNH 5EOCL 4U7KA 3FMGL 4U4BA 1S9WB 3VDAA 5CS7A 3UTTD 5E9DA 1A2YB 1T6VN 4X6DB 1BX2B 3DUUB 4BH8B 5EU6B 2DTSA 3U36A 1U91A 1RZ8B 3VXMB 2HFEA 3BPNC 3VE0A 4S10A 5JTWA 5HYFA 3CVHL 2YBRA 1NAKH 1A3RL 2DKMA 4WW1A 3AXLA 3TWCH 4IDLA 3ROOB 3BRDA 4JZOB 2LU7A 1G7QB 2VDLH 4OCNC 4OM1L 3LZFH 4ZS7H 3SBWA 5TE6L 1WWAX 5BVPH 2XN9A 5D93B 1A47A 4G42B 4ZOAA 2MKWA 3MZGB 4M6ML 4C56D 4YHOH 4ZUVA 1DDHA 2DM7A 4HGKC 1TFHA 5IFJB 4K3EH 3SOBH 3D69B 4K7PL 5CP7A 5GGRY 1F00I 4PP1C 3IXAA 2C26A 1ZGLM 5JPMA 4FMKA 2B1HH 2BMKB 2MCPL 1OF2A 5E8PB 4YR6B 5IVXA 4Z5RA 4X6CF 5T1LB 3QCUH 2NY3B 5DC4B 2P24B 2X9XA 2E7CA 25C8L 3QUXA 4M1GL 4YE4L 4PJFF 1AQKL 3TBSB 4GW4A 4MQSB 4RIRB 4R26H 3WKMH 1DQTA 1HILB 3KPQA 4ODHL 3KS0H 3ILPB 2PTTA 3LQZB 1FNFA 4LF3A 3T77A 3WFCL 3BKYL 3I6GB 1ZLUK 2Y72A 3CFBA 4Z7WB 3MRNA 3F58L 1R24A 2CKNA 5I66A 1MLBB 1FBIL 3I85A 2R1XB 4U1HB 3DETD 5IHUH 1JPFA 5CCKH 2HYMA 1BFTA 4RMSA 1RZIA 4IBLT 4PUBH 2FWOA 3WFHB 2Y4SA 2JJTA 3GSRB 3NIGE 4QRRB 2D4DA 3TA3B 2DLIA 3GMNB 3QIWA 5JXEA 1UQSB 3BT2L 3ARBD 3GO1H 4XBPB 5I9QC 3U46A 2HLFD 3I2CL 4JR9L 4KTDH 3PGFL 1I3GH 4OF5A 2QLVB 3MXWL 2Y9RT 3A6CH 3QEUA 4WI3A 2CIKA 1EO7A 2NY0B 5FGCB 4L4JA 3X14A 2P48B 2OJEA 1S9VA 1CDGA 5KSAA 4JJHA 3EYSH 3UTPD 5F7DB 4LLWA 1JIBA 5C09D 1FCGA 1YEDB 4JFEB 5I19L 4UU9A 4S0SD 1YMMA 3NCFB 2ZSVB 4Q9RL 3EFDL 4HKBA 3ALWA 4HIXL 4GG6B 3B8YA 3DIFA 4XT1C 1GH7A 2EIEA 4LLQB 2DQJH 1KCUL 2ZNXA 1EZVX 4QRUB 1NBQA 1XF4B 4TNVK 3T2PA 5IM7A 2XRAL 2UUDK 4I0KA 1NAML 4MJIA 5EUKA 5BV7B 4YPGA 3T1WA 4PJHA 5HHVL 1S7WA 4OLYH 4L4TE 3BAEL 3V79C 5CZXC 4CW1B 1NDGB 4ZOBA 5F7MC 1AGCB 1T83A 3JTTA 3RDTB 3MRIA 5D7JB 4AEEA 1V05A 2VOTA 3X3GL 3VD9A 4X6DA 4K94H 3C5ZA 4BH8A 4R8WH 5DD5L 4UNUA 2UVFA 3MLUH 2WQRA 1AE6L 4LU5H 4XAWH 4LSPL 1CE6A 2GKIA 4XTRD 1X5LA 2HFFB 4PRPB 5SWZD 4JM4H 3SDCC 5ANME 1EHAA 3ABZA 3GSXB 3NGBC 1BJ1H 4KKCD 4XGZB 4GAJL 4L5FL 1CT8A 5D7IA 4DEPB 4XAKE 1NC4A 3RNQB 3TN0A 5KS9A 5E2VH 2DQEL 1C7SA 1M7DA 6FABL 2HVJA 4P2RB 2UYLA 2SEBA 3K0WA 1D3CA 4LCUA 1NL0L 4Z7OE 1YPZF 4OF3A 4XCFL 3FN9A 1TNNA 3WN5A 3WFDL 5JMOC 4K3GA 3OKNB 4Z7VF 1V7NH 4PRNB 2KPNA 4OLEA 4N1EA 5CJXA 2DJUA 3MV9D 5B3JE 4JPVL 2PO6B 5C0AE 5KVMC 1UH4A 2OR9H 4LAQL 1T1WA 1TPXC 4X0KB 5T5FH 5B8CC 5HHXH 4HULB 4WENB 3NABL 5FF6B 4QHMB 2WWMC 3INUL 5DVNA 2VDNH 1EO5A 4G80A 4N1CA 3S34H 2HJKA 3LQAC 4FTVE 1T3FB 3KNBA 2ICCA 3KYMA 2O5ZH 3V6FA 3TEUA 1T0NA 4X4ZA 4PG2A 5CKAA 4A6YA 4TULL 1JGUL 3MGOA 1TETH 3L5IA 4LCWE 4LSUH 3UBXB 5DK3A 1HHKB 1I1YB 3SDAB 1FGVH 1LO5A 1P4BL 4N0YL 2ORBH 1PSKL 3JXAA 5I73B 5SX4I 3FN0L 1NLBL 2EYTB 3CFJA 4PJBB 1FN4B 4H8WL 2UVEA 3F8UB 3TA3A 3L5JA 4P4KD 1X4YA 1SYVA 5IWLA 3AU1B 2APVA 4WNQA 4XBPA 4F9LA 2LVCA 2ZZUT 3GSUB 5C0CA 2IAND 1KJ3L 1ZEAH 1CDYA 4YFLI 1IGIH 1T1ZB 4QNPE 3QHZH 1IC1A 4MD5A 3SEPA 35C8L 5DJZB 3O2VH 1WCBA 4QRSB 3WO4B 5DD6B 2XTJB 4F8QA 4DN4H 4PV8B 1VACB 3VFRB 3IVKB 4H1LG 1A7QH 3E8UH 4HDIB 4MS8C 1MCPL 3EHBD 3JV5A 2NXZB 1SMAA 1QRND 1S78C 2I25N 1PKQA 3HG1D 2V17L 4CU8A 4PRIB 3BI9X 3S37L 4MXVF 3O2WL 1EEUA 1JV5B 1FAIH 4LOUC 3QSKB 3M17B 1KTDA 5I76A 3QPQC 3ULVE 5F9WB 4ZQKB 4QRUA 3SPVA 4AY0A 5KOVC 3LRSB 5LQBH 4FA8A 1W0WA 2EDDA 2ARJA 3ARFC 5IW3A 4NUGH 2CK0H 5D7LD 5IQ9B 4Y5XC 5D96C 4AMKH 2WK2A 2D03L 4X8XA 3OV6A 3NA9H 2FBOJ 3CZFA 2FX9H 3B9AA 5BZDA 4JGJA 3WLWC 1CR9L 4PTUA 4HWUA 5HVHC 2J5LC 3F5WB 4MMXC 3V5DB 1IGCL 4N0UE 1X4XA 1INEL 4OD1L 2VDOL 3HTLX 3JV4B 2EEDA 4KKLD 4XPHL 5BO1L 2W92A 1QSFE 3FL7A 2V7NB 1FFNA 4XHJC 2FX8H 2Q6WB 1PAMA 2HFFA 4PJCA 4LHJB 4NQTA 2ARWA 2NCMA 5F3BA 3O6FB 5FCUL 4CVZB 3RVTC 4Y5YB 4YHML 4XVSH 1G7IA 4TUJB 1INQA 3ARQA 4UIMA 5EIQA 3QI9C 3HMXH 4M5ZL 5SX4H 2VDPL 4XP4H 2I60H 1WZ1L 3S7GA 4M61A 2DIBA 4F7CA 3O4LB 3FO0L 4QRPD 4MX7B 1T03H 5DVOA 1ETZB 2X9YA 2DQDH 1H3PH 1A21A 1Q8MA 3KLAB 2UWEF 4D3CL 5EBMB 4Y4FB 3O3EB 2I5YL 2YPLE 4ISVB 1P1ZB 2D9CA 5LGJB 4W4OA 2P42B 3OQ3B 1ROWA 3KPPA 4OFKA 3DBXA 3ARYA 2DIAA 5IBLC 3Q0HA 4M48H 3IDIB 4JDZB 5EOCH 4PJ7B 1WV7T 4U6YB 5FO9A 3PGCB 2B5IB 2ZWLT 3FMGH 4QO1A 3BEWA 4FQHB 3O8XB 3FRUB 1I1AB 2BOCB 1JWUA 1PG7X 4BM7A 4UV4L 4IDJL 3MLZL 1MREL 3NCBB 3B9KA 1MY7A 2IH3A 2IPUK 3CVHH 1X5AA 1MCSA 3UZQA 2IGFL 3BPCB 1YECH 1A3RH 2J3SA 3QUYA 4Q6YA 3UTSB 1QBBA 3MROA 1T3FA 1EEZB 3QO0A 3OSKA 4PBVC 2RCSL 3P4OB 1I7UB 5L88L 4NYLA 4OM1H 3UJIL 3EGSB 1H3VA 4MHHG 5TE6H 3C09C 1QG3A 4NKDB 1M05A 2NTFB 4GBXC 5L2KE 2X4TB 4M6MH 1IRAY 5E95B 3EJZC 1C5CL 4KFZC 3RGVA 5A1AA 1FN4A 4YHIB 3KYKL 1X4ZA 4EDXA 4K7PH 3RL1A 1E6OL 2CMRL 2A74A 5HJ3A 1D5MA 3ECBA 3AU1A 2F54B 4FQQA 3AREB 1H5BC 2OBGA 5DGQA 2CKBL 3CMGA 2D31A 3BP5A 4L4VB 4MGXA 5K33A 1T1ZA 5DEFB 1X5KA 25C8H 4M1GH 4MJ4A 4YE4H 2D7NA 4NQSA 5BQ7B 2VL5A 1AQKH 3G5YA 5DD6A 1T5XB 3SCMB 1KACB 1M71B 2HA1A 3W82A 5AAMA 5C9JB 4DKEH 2XWTB 4K9EL 2H2PC 4M7LL 4ODHH 2FGWL 3LDBC 3WFCH 3BKYH 4DKDC 3SE9L 4RMVA 1LD9A 4NPYB 3CGTA 2M1KA 1FBIH 1UH3A 4I4WB 2NNAB 3WIIL 3UTOA 1KT2B 3RVUC 2F53E 2Z4QA 4U1NB 3ULUF 3T1FA 5JA8B 4APQD 2YD2A 4JE4B 5HHPB 1I1CA 5HHOD 2H3NB 1LEIA 5E8EA 4LPYA 3BT2H 4O58H 1VFOA 5BW7A 4OGAC 2EE9A 3I2CH 4JR9H 3DXAB 3D85B 1XGQA 5EO1A 1U8LB 4YQXL 3MXWH 1X5XA 4P23C 4QNPF 2F58L 3GMMB 4R6UA 3EFFA 4G8IA 1IT9L 1AD9B 2GAZA 1NBZB 3FONB 4KWUA 5CJBA 2PXYC 4PRHA 3ULSA 3MV7A 3VGAB 5HI5D 5C07A 3NCYS 3S3SA 4WO4A 5I19H 1MLCA 4NRXA 3IS1X 2WLYA 3PABB 4TUJA 3WIHL 4Q9RH 3EFDH 1ZGLA 3GEWB 2R0LL 3TYFA 3KPRB 4D9RE 1EHXA 1EZVY 1FNEA 4HIXH 3REVB 3U9UB 3B2VL 5TF0A 2AGJL 5I1HL 3RFZC 4PB0L 1XIWC 2YSSB 4JAMA 3ULVF 3I6KB 1PKOA 1KCUH 3E3QC 4NQCA 4MZ2A 4KHXL 4Z8FL 2WSKA 5EBLA 2ICWJ 4PJXB 2XRAH 5CAYB 1NAMH 4POZD 2A83B 4ODUB 5D2NA 3VFOB 4QOKD 3PP3K 3FO2B 5J13C 4N1HB 3TNNB 5HHVH 4JDZA 5JOFA 5JNYB 4HV8B 1X7QB 4QTIH 3X3GH 1YEFL 1VPOH 2DLFL 5JZ7D 3C60B 3L7FA 5DD5H 5HDLA 5F1OB 5J1AA 3STZB 4IRJB 3KWWA 1NGZA 3BOVA 3Q6GL 1J8HA 3PWUA 1UXWA 2P44B 1AE6H 3QUKB 3NBNA 5CBEA 1FYTA 2J6EH 2EIZA 2PYFB 4FQ1L 1JZ7A 4HFUL 1L4IA 3RWCA 5IIEA 1QQDB 1EEZA 2VLKA 1I8LA 4X5WB 3VU2A 1XF3A 2CH8A 4WWKA 3RWHA 5HTSA 4L5FH 1FLTX 5JR1H 4CN4A 2DQEH 1A3QA 2X4TA 3VGGA 5DHYA 4JFPB 6FABH 4M7ZB 5F8QC 5I6XB 5D1XB 4Y4HB 3G6JE 1TXKA 2PR4L 1NL0H 2VERN 1XGTB 2EDKA 1SVZA 2FX7L 1T0MB 2ATKB 5CSZB 3RWDA 1JGEB 4ZG1A 2EH8L 2IFFL 3HPJB 4N5EC 5GZNC 2H26A 3L5WB 1DTUA 4H0HB 2YUVA 1G84A 1BM3L 4JPVH 2WWKO 4HXBL 3W81A 2OSLB 3V7AG 5CEZD 1T89A 1T1YA 4HWBL 1F11A 2GQHA 4HIJA 1WIPA 5IBTL 3NABH 4G8GD 4U33A 4UNVA 4XC3L 5FUOL 1U2CA 3CVHB 1KTKE 2JK5A 5TQ2L 3GSNL 1OGAB 3DURB 2C3VB 1KCRL 3A6OA 3O9WA 4TULH 1JGUH 3B6SA 1FQ9C 3EYVB 3MXVL 1ONQB 4JO4L 5DZLA 1SEBA 4UBDD 1QSED 2R56L 4JZNA 4JZJC 2Q87A 3N06B 4R96B 4CKVX 2VC2L 1HSBB 4XCNB 2UY7A 1P4BH 3RTQD 4EN3D 2NNAA 1PSKH 1U8IA 3FN0H 3QB7C 1KT2A 1NLBH 2ATPA 4XCYA 1UM4L 5C70A 1YZZA 2XWBB 1AHWA 3RKDC 4Y16C 3TO2A 1U8HA 4R7NB 4H8WH 3RZCC 2H8PB 3LN4B 1K6QH 4EQ3A 3QDJA 4OZHE 3VFSB 4FQXC 4MA8L 1P9MC 1BBJA 3GIZL 1UZ8A 1CQKA 3DXAA 3KLSA 1KJ3H 4RMTA 4IMLB 3AM8A 1NBYB 5D6DC 1CICD 5FA4B 2AJXL 35C8H 2CJUL 4IOSD 1XAUA 4P2OC 1YEIL 3QIUA 1NC2D 5F8RC 3VCLA 5JOPD 4JFDD 2LQRA 3IB4A 2RFXA 1HXYB 3S5LB 3FN3A 5C0BA 5HPMA 2R2HB 4LVEA 1BD2D 5DJYB 1MCPH 3FTGA 4IHOB 3DRQB 2EXYD 3T2OA 3SDDA 4F7TA 2NZ9D 5IMLB 5C0GA 1XF2B 1R0AH 4HJGB 3CFCH 2V17H 4LSDA 3S37H 1OVZA 3O2WH 1YYLH 1HXMB 2CXGA 3U9UA 4OV5B 4YJZL 3ARXA 3PL6C 2XNAA 3Q2CA 2CDFA 2WQ8A 4BZ2L 5F21B 5D70H 2WMPA 2BNRA 2K9UA 4OUUA 2VKXA 5CEXB 4AG4L 4XWGL 5HHMB 1JUFB 1OAQL 2BSRB 5I2IB 1AD0B 1JPGB 5IV2A 3FO2A 2X4PA 2BVPA 4CBPA 4XXDB 3S36X 2D03H 5HYEA 3T0EB 5DEZA 2EKJA 4OTXL 43CAA 3CFEA 4U1IB 2IQAB 3L6FB 4PD4J 4KRMB 4WHTB 1CR9H 4LVOB 5GGQH 1A4JB 2GEEA 4EIGB 1OTTC 2QTEA 2QHRL 2I9LB 1IGCH 1Q9LA 4G6ML 4P2QE 2RGSA 4HK3N 1INEH 3ZDXE 4OD1H 4ZUTA 3ULUD 3H0TB 3C6LB 3VFTB 4XPHH 5F96L 3ZDZF 5BO1H 5FB8A 1M4KA 1YEHH 3D0VB 4MA1C 3PQYA 4NCDA 2X4NA 4UTBL 1QQDA 3QXAA 2YRPA 1YMHA 4LQ1A 4PLNC 4R97C 4XMKL 3FQXB 5IB4B 5HVGB 3DVGA 5ESVB 2A77L 3KYNB 5FCUH 4U6HA 4YHMH 4H5SB 1H8SA 3MJ7B 3MLSL 3CCHB 2VWEC 2Y6SC 5T3XD 2P5WA 1BZ9B 3D87B 4M5ZH 4ZPTB 2VDPH 2HT2C 1RY7B 5IROA 3DLQR 3WYRA 3S96B 3FO0H 4HK0B 1MCEA 3QXUA 5JQ6L 4M9OA 2BNQD 2MKLC 5H37H 5A2KH 4D3CH 1KULA 5MEQA 2I5YH 1B0GA 1NAMB 4O9HL 1JTTA 1N8ZB 3BKML 3ARRA 1TZIB 1WC7B 1UFUA 2IMNA 4ZD3L 1EO8L 4N0CC 3MRDA 4FP8H 1G9NL 2NZIA 2C7UB 4P3CL 1TITA 2Z91A 1R3LB 2GSGB 3QQ9C 4UV4H 3OTTA 3MLZH 1MREH 2H32A 4OZGF 5ELIA 1ZT7B 3S6CA 3NIFF 1CD1A 3HE7B 2V9RA 3VDCA 3FQNB 5AAWA 4GKSB 1FFPA 1XR9A 4HWZB 4Y4KC 1ZKAA 2RCSH 2VZVA 5L88H 4BQ9A 3EJJX 4YDJB 2ARJQ 3DURA 4XP6L 3RNKB 1TMCB 4HKJB 4GXUN 5I0ZA 1QLFB 4JHWL 3DMMA 3VWKB 4RZCB 3ZSTA 1I9IL 1CL7I 3RWJA 2F19L 1B0WA 3I02A 1ZMYA 1WFUA 4ZAKB 3O3DB 3DNKA 4NO3B 4YHPB 3KYKH 3JV0A 2AQ3A 4WJ5A 2X4SA 1RZJL 1E6OH 3DARA 2N4IA 2LTQB 4OFVA 1T1XA 3BPLC 4M03A 4P4RB 3GMOB 2Q86B 5F44A 1LDPL 1OGTA 3O6KL 3TV3L 2QQKL 4YBHA 3HG1E 5DT1L 4M4PA 4S2SB 4WGWB 2GTZB 2CKBH 4JFFD 5DJ0A 5KW9L 3N1MC 5C0IB 2JJSA 3PWPD 4B7IA 2Q1EA 1BAFL 4GRLC 1EGJA 1MJ8H 3LIZL 1JYVA 1MFBL 1T80A 5GS3A 3MRMA 1HHGA 4F7EB 2FYYA 4K9EH 3RJQB 4L8DB 4LCWB 1FG2A 4M7LH 1DQQA 1SJXA 3STBA 3ARGB 5SX5H 2CR6A 4J3WA 5DJYA 5KSBF 1MCRA 2FGWH 1MCDA 3DHJA 3QWOA 4GUPA 3MBED 3SE9H 3OKMB 2FECI 1J0HA 4P9HC 3PNWB 4HD9A 3QDMD 4P59L 5HGAB 8FABB 5I75B 1CGYA 4WUUE 1RUAH 4I18B 3QFJE 2O61A 3NFPA 1WBYB 3WIIH 5F7FA 3F7YA 3RIAF 1TTGA 2AEPL 5BS0D 5E5MA 1FIEA 1A6TA 2HLAB 3MV8E 5BXFA 4HZAA 3D48R 3V95A 3GMLA 4JFQA 2CLZB 4KV5E 3G6AB 1YC7A 3F6LA 2DD8L 4ELKA 3D2UD 4YQXH 2EDRA 1RJLB 2EYRB 4U31A 3HAEB 2F58H 5CJQH 1QFPA 1DUZB 1UH2A 4IRSD 2J2ZA 2ICES 3CUPA 3MRKA 3VFTA 1IT9H 2ZUYA 2V5YA 1C08B 5K9JL 4QRQB 4PY8I 5IB4A 1CLCA 4B50A 4Z76A 1EEYA 4LBEA 3UPCA 3TO4D 2UWEA 1I8KB 3EO1B 2Q76A 2Z31A 5GGVY 2DYPB 4HMCA 3BYTA 3B2VH 5I1HH 2GK0B 4LPCA 4PB0H 3UYOD 3U7AA 3QNZB 4ZSOE 2VAJA 3BRFA 2V2WB 4P57B 4S1RL 4W4NA 4L4TA 5H94A 3V6OE 3D3VB 4Z8FH 3PIQA 4KHXH 2NR6D 2J8UE 2GJ6B 3TJEL 1NJ9A 4PRBA 1F4YL 2EICA 3IS0X 1BFOB 3MUGA 3REWA 3GB7A 5J06A 1WBXA 3VH8A 3QJFA 2C9AA 4C54A 3A0OA 4ZOEA 4J4PC 1QSFB 4LRIC 4KUCF 4MNHA 5E6ID 1G6VK 4LCYB 3VI3E 2OXHA 1YEFH 2DLFH 3T4AA 2IAMA 5ANMA 5TDNA 4MVBC 3Q6GH 5JDJA 3U4EB 1W0VA 1BVZA 1JGVL 3CXHK 4ZXBD 3NFNB 2Z0BA 3RPIA 4HFUH 1H0DA 2J6EA 1PQZB 1RQ5A 3MOAL 1RIVL 1Q1JL 4U49A 4YDJA 1JI1A 4G9DB 4E41A 1ADQL 4NZDA 1QLFA 5IB3B 3HZVB 2YPLB 5EO9B 1S7RA 4BKLB 5KZCB 5LGHH 4WY7L 4Z7UB 1J0IA 3IKCA 3PDDA 1J0YA 1J10A 3LKPA 2PR4H 2X70B 1UB6B 1ZAGA 1BVLA 1I3RA 2LABA 5C0AA 2FX7H 4LLDB 2AXGB 4KVCL 3FT3B 3TVMA 1S9YB 2DMCA 4NUJA 2IFFH 3S3PA 1CFBA 4BJLA 4Y1AD 5FYLD 5TDPB 3MFGB 4G43A 4IIQB 4YBQC 4DUXA 4JPKL 4PJAE 9CGTA 4CL7A 1S7TA 1GVIA 5CFHA 1OAKL 3SQOL 1BM3H 4OFYA 5C0IA 5MENE 3KPOA 4HXBH 1DQML 4FTVA 5J6HB 1UG9A 5JDSB 2X89A 1J8KA 1RHHB 1AGBB 1BLNB 1H15A 1Z9SA 4KROD 2X6MA 5IBTH 1YEKL 4OV6F 1AGEB 4L8DA 4LCWA 5K59F 4XC3H 5FUOH 4F57H 5KVEL 1KIPB 2Z92B 1OSPL 5TQ2H 3GSNH 2AP2A 3PNWA 4EBQL 1KCRH 5ADOL 3O6LH 5DHVA 4BK5A 2FJHA 3MXVH 3MMEA 4JO4H 4NWTL 1R5VB 2KZWA 3IFOA 4XMPH 4P5TD 1Q9WA 3P2TA 5BOZG 1HINH 3EYFB 5D9SA 1NH6A 5JPNA 3SO3B 1OAUL 3VXRB 2H2SC 1UM4H 4AT6A 3FZUC 5EU5A 3QUZA 4JREB 3PHQA 5GPRA 1YDPB 3ZKSD 5HGDB 3IXTB 4MA8H 3NCCB 5GGSY 1YN7A 3GIZH 3G6AA 1L7IL 3TCLA 2MQ0A 1IC7H 1GC1C 2BZDA 4KKBC 3HNVL 5ETUA 2EYRA 2HKFL 2CKBB 2EDBA 2VE6B 2P8MB 2CJUH 3OKLA 5DRNA 2NY6D 1YEIH 3OG4B 1IVLA 3FQTB 2Y5TA 5F7LB 5HYJE 4JHZA 5JLZA 1UWGL 2FIKB 3RX8A 1CGWA 1Y18A 4X5XB 3DX8B 1GGTA 3QUXC 1JYXA 4YDVA 4NFCA 5HD8D 1W72A 1MCHA 2MHAB 1IC4L 1WFNA 1QTYT 1I7RB 5JO5B 5IP4A 5FA3A 2KQNA 2Q3ZA 3ZZ1A 2GK0A 1GJIA 3QFDB 3QWRD 3F12B 2W0FA 3BVNA 4BZ2H 3MA9L 5IHZA 3C87A 3BIAX 5J6GA 1D6EB 4ODSL 4ORGB 4TTDC 3ZT6A 1SJEA 2CGRL 4AG4H 4XWGH 1OAQH 5HDOA 3W11D 3JWDL 1SHMA 2AK4D 5ENWA 5IVOA 4N0UA 2VXSL 3GI8L 3U6RB 2VNCA 4OTXH 4FABL 2APXA 5J56B 4MD0B 2RHEA 2JJTC 3WLBB 2P5EE 2QHRH 2X41A 4OKVB 4D8PB 3S9DB 2MTPA 4G6MH 3QIWC 4R9HA 5JXEC 4I3RL 1Y0LB 2VJXA 5F96H 5D1QD 4QHUB 1WWWX 4NT6B 5LCVL 3ZHDA 4G8EB 4UTBH 4KU1A 1QA9B 3UTTB 4H1LB 4XMKH 1BWWA 4OLWL 1GPOL 2MQ3A 4BZ1L 2HAZA 2IADB 4BUHA 3TBVA 3MLSH 4AH2B 5KSUB 2VUYA 3H7BA 3KJ6L 2COQA 3W39B 5KSAC 2YPLA 3HRZB 4NDMA 3IU4L 4PJGB 5ICXB 5HI3D 1ZS8B 3IF1B 1XMWA 5DMIL 5JQ6H 1U8QB 3VFPB 1U8OA 4P9ML 1YN6A 3MNVA 1PZUB 5EIIB 3OAZH 4YUEL 3WS3A 3BKMH 4JM2A 4Q9CA 4WDIB 5TDPA 4C56B 3ALPA 1FC1A 4ZD3H 3HB3D 1TTFA 4MNQD 1ORQA 5F1NA 1F4WL 4ZDHA 2FB4L 1R5WB 3ARWA 5HHQB 2AJZB 1D9KA 5BRZA 1BHGA 3PWNB 1G9NH 4P3CH 1RHHA 2ICEB 4Q74A 3C6SB 3VFNB 5EOTB 4OD2B 2E7HA 3DV6B 2AI0L 1B4RA 4NO5A 4P5KA 3P9WB 1T83C 4WW2B 1N6QL 3VG9B 5L2KA 4LKCB 5CWSA 4ACPA 2Z92A 2ZUSA 1DSFL 4RWYL 3C5ZC 3DVNA 1CCZA 4JY5L 4KUCD 1JF1B 4XP6H 4ETQA 2OQJB 4B41A 4JRXD 4TVPD 3GI9L 2X1PA 3K80A 4JHWH 1CFSB 4NCC1 1I9IH 4GKNB 3IDNB 3CIQA 5DC0A 2F19H 1T5WB 3UEZA 1ZHBA 4YHKH 5GRVL 5ESAA 5MI0C 5F9AC 4N9GA 5DEGB 3FQUA 4KAQL 3WJJA 1J88A 2VYRE 4NNYB 4X7EC 1XGRB 1KJMB 3TN0C 4UDTB 4ODVL 4LLYB 4RA3A 5B4MC 1JF5A 5CJOL 3HE6A 1LDPH 1F3DJ 3O6KH 2QQKH 5E2UH 1L0QA 2GFBB 3RWGB 2VZOA 3EO0B 4QT5B 3TBWB 5KW9H 2Y23A 4X4XA 4JY4A 1JNLL 3WN5C 2IQ9L 1BAFH 3BIKA 1K8DA 4KXZH 5GXBB 3LIZH 3ARBB 1MFBH 1NGPH 5ISZD 5CJXC 4PJDF 4U1JB 1F58L 4X5XA 3BX7C 4QKXB 3ULUL 2EKSB 5DRZB 4GAGL 1CF8H 2H1PL 4HKXA 2ZUTA 2MHAA 4K8RC 2F53A 2XQYG 3BZFA 3CSYA 3QQ4B 3RIFF 5FGBA 3GSNB 3TM6A 1HK6A 3VXOA 4NHUB 4ZYKA 1T0PB 3QO1A 3V0AC 5C09B 3KG5A 1EJ6A 1V8HA 4Y2DA 5I1IL 5T3XL 1G7MA 4PG2C 4IS6B 4UT9L 5IR1B 4G6JH 2P1YA 2AEPH 4PP1D 2Z93A 3CX5J 1J0JA 5IB2A 5C86A 1U93B 1D5ZA 3L3IB 1TQCC 4ONFL 3UX9B 5E6YA 4X4YA 4JEGB 1X5FA 3ZTNL 2DD8H 3QPXL 1A9BB 1XCTB 3TA3C 2CIIA 2NXYC 1SJHB 3WSQL 2Y07H 5IWLC 1PX3A 5I15L 4F9LC 5GZOC 4YXKL 4JJ5A 4QHUA 1KIRB 1J05A 4X5LA 3N1FC 3IJYB 1Q0YL 4CU7A 2AK1L 1PZ5B 1Z6JT 3FB5B 4J3OC 3P4MA 2QL1A 4FG6C 1BBDH 1F5WA 1G6RL 3MGTB 4HFWB 1F90L 3BZEB 4D9QE 1FNLA 1IM9D 4Z95L 3DOSA 4EJ1C 3HPLB 3ZDYE 4ZO6A 5SWZB 1ZS8A 4S1RH 3CJJA 3TT1H 3UP1A 5F7HA 3IFLL 3TJEH 4IOIB 2X5PA 4ONGL 5D7SL 2XIDA 1F4YH 4RGNE 5CKGA 2Y5EA 4Z7QF 3IETA 3GIVA 4JN1L 1MQ8A 5J9PB 5KBNC 1ZHKA 3MUY1 4XI5C 2AJZA 2ZKHL 1QFWI 4PGEA 2FR4B 5F71A 3IRZA 2FSEB 4D0DA 3M1BA 3N1GC 2FH8A 3IDJB 1FV1A 5I1GL 1N59A 2DQUL 1JGVH 1TJHL 3MV9B 4EVNB 2VLME 1YYML 4OCSL 4E0RB 4FQPA 4AL8L 1QFWM 2XI9A 1X6LA 4PLOB 4RFNC 3W0WE 5EOQL 3MOAH 1RIVH 1WAAE 1BP3B 3G6JA 1ADQH 4YLQT 4HUVA 3HZYA 2X2YA 1QLRB 3IDNA 2PETA 1ZVSA 5IVNA 3IJHB 2AV1A 4NKQB 4WY7H 3OKDB 5E4EB 4GQ9L 2PUQT 4ZUWA 1JHTB 4OFIA 4NNYA 2O93L 2GI7A 1A3LL 1KJMA 4KVCH 1BEYL 3DTXB 1YY9C 3ZTJG 3P0VL 4XPBL 4WTZA 5FGSA 4G9FD 2OL3L 5CZXD 4CMHB 1NFDE 3LEXA 4JPKH 4MYWB 1DVFA 1OAKH 5T1DL 3SQOH 5GSRB 1DQMH 3BH8B 1IL1A 3MGAA 4P4KB 1BOGA 5AUMA 4QEGA 2ZG1A 4W4OC 5A16B 4NQXB 4RX4D 2Q7YA 5JHDD 2YOCA 3G5ZA 4ZFZA 4Y88A 4ZFFB 1YEKH 2IANB 5EU4B 1LK2A 1RVFH 4B53A 1PYWA 1HIML 4M6OL 4M6AA 3HCVB 1WTLA 4Y5VB 3SDCD 1FJ1B 1OSPH 3GM0A 4EBQH 2XZCL 1R3KB 3B9KC 1VFAB 4NWTH 1E4XL 5DJ8B 4N90D 5GJTL 4YXHL 3QUYC 5CMAA 5JHLL 5EO0A 5E6ZA 4OZHA 2X05A 4NQDD 4X6CB 4X9FA 3MCKA 3U2SB 1OAUH 1QRNB 1UWXK 1QR1A 5IR1A 1F3JB 3OAYK 3X11A 3LKQA 3HG1B 2PTUA 1CXEA 1J7VR 4P46A 2VH5H 2VTFA 1YA5A 4OLUL 4X80L 4U6TA 2CDEB 3TH2T 5J7CC 4X8JA 2G60L 5D5ME 1OPGH 1QFWH 3P73A 1G7LA 3RGVC 3KXFD 3WHE0 1L7IH 3CK0L 3C8KA 4PP2B 4QXUL 4X7TB 3HNVH 4NRZB 1ZA3B 3VJ6B 2HKFH 5D7LB 1WZKA 2Q3AA 3H8NA 3WFEL 1X5JA 4KPHL 2WWMD 5CZVL 3OXSB 1UWGH 3IJYA 4NN6B 3T0WA 1F6FB 3OHXA 5TPWH 3CSGA 2BVEA 5F89B 5I17A 5GGRB 1IC4H 4HH9A 1AI1L 3BGMB 1X6NA 4PTTB 5D8JL 1EHNA 4MLIA 2OCFD 2X4QB 3DGGA 4JKMA 3QRGL 3FFDB 2R4SL 2GHWB 3MA9H 1P2CA 3WUWG 5KVFL 3F6IA 4QY8A 4ODSH 1HWHB 4R4BA 4TNVF 3GJFH 2OR8A 2CGRH 1TJGL 4MNGB 4U1SA 1S7UB 1JN6B 3N85H 5CINL 4ELME 4P2QA 2VXSH 4QRPB 5F9WC 1DBAL 4GRMB 1KFAL 4BSWA 5IG7B 1VGKB 3KAAA 3BZ4B 2AJUL 1WIUA 3U9PL 4MJ2A 2MOVA 5FYLL 1T04B 3JWOC 3L3KA 4MB5A 4GRWE 4W68A 3MNZB 4I3RH 1JTOA 5MEOA 2A73A 3U7WL 5BW7C 3LMJL 5LCVH 3VDBA 3GRWA 4XMLH 3RUGF 4PGBB 1FZKB 5EFIB 1J1XL 3RHWK 4MS8D 1S78D 4OLWH 1GPOH 4BZ1H 3FFCD 3LEYH 4CVXB 2APTA 2J8UB 3ILQC 1QUNA 1FNSL 4YZFF 3S35X 3KJ6H 4LOUD 3O45A 3IU4H 3FT2B 3QPQD 4Q2ZB 1G7PB 5IKCB 3GZKA 1ZT1A 5DMIH 4WO4C 5EN2B 3FQWA 5B22A 1IAOB 1RI8A 4Z78B 1VENA 4R2GC 4P9MH 1GOFA 1U3HA 4F33B 4KJQC 3ARFD 4WI7A 1IGTA 1Q38A 4U6XB 2FZ3B 3NCYP 4YHLH 4TUOA 4U1MA 3VXSE 4X4ME 3MUHL 3WLWD 1OW0A 1F4WH 1CGSL 2P8LB 2FB4H 3AVEA 3P40A 4JANA 1HEZA 3QNXB 4YHNA 5D2NC 3DX9A 3LVEA 1F8TL 4W70A 1ED3B 4YO0B 2AI0H 5CIPH 5LG1A 4Y19E 2HT3C 3OJ2C 5EU4A 4RAVA 5F1IB 5JORB 1N6QH 1EBPA 4XHJD 1NKOA 1RUML 4F3FB 3C5SB 5GRWA 1DSFH 4RWYH 4PLKC 5JW4N 4JY5H 3JBG7 4NKMA 3RVTD 1YPZB 2DF3A 4K94C 3QI9D 3GI9H 2OXGA 4HUNB 1FO0L 2IBZX 4ZTOL 1ORSB 3V7MA 1S5IH 3VRLE 4Z7VB 3LCYA 3HLAB 3U2SA 4XBEL 2CLRB 4PJAB 4WWKC 3HG1A 2WBJB 4KAQH 3CFDB 5FDYA 2AQ1A 4WI2A 2FEEI 5GRXG 2CDEA 2DM4A 4ODVH 3NCMA 3HR5B 2B4CL 2ADFL 4N8VA 5IBLD 5DI8B 3P0YL 5CJOH 2JCCF 4NQED 3O11A 5DUPH 1ZLVH 4GG8B 3QH3A 3RWEA 3QJHA 3SKNB 2D3VA 4OZ4A 1MAJA 4UAOC 4APQB 3B43A 1JNLH 4X6FA 2IQ9H 4OCRH 5I1DB 2A2QT 1LWRA 3NZHH 5HHOB 2XKUA 4L3EE 4WU7B 4R90L 3FB8A 3OXSA 1F4HA 3TH4T 4WUUA 4B7LA 3B2UC 3NAAL 1OM3L 5J11B 3QFJA 3LN5B 2KDGA 4OQTA 4GAGH 2H1PH 1T89C 5GRZA 5EU7C 2CDGB 5D7KD 5F89A 1QFUH 4GBXD 5HVWA 2VITB 4JRYE 4K7FA 4HZLA 2W60B 1N7ML 2X4UA 3MV8A 5EUOE 5GS1B 3EJZD 4OFPA 5IOPB 5I1IH 5T3XH 1VADA 5F6HI 3FCTB 1NSNL 3O9WC 4F2MA 2QADC 1QACA 4R0LA 1DEEB 3FAXA 4JQVA 3KLHC 1R3HB 4ONFH 2DQFB 1JWMA 2X4RA 3U0TA 4HWNA 2NX5D 1LP9E 5T3ZD 1AHWC 2H9GA 3ZTNH 3FO9B 1AXIB 2VSDA 3GSWB 2VMFA 4LPUA 4QOKB 4QGYA 3FO1B 4XHQA 2F9BT 4EI6B 4NNXB 2H2PD 4MCZA 4NN7B 3ALXA 4O2CA 5DJDA 3AS2A 4NZRL 2R8SH 2IPKA 1Q0YH 3AM8C 2WIMA 2IH1A 1S7XA 2X40A 4ZSOA 1XF1A 3BPOC 5E03A 3QIUC 3V6OA 4WFHD 1PG7W 4LLUA 1G6RH 1T22A 1F90H 2F74A 3RBGA 4L8SB 4Z95H 3VD3A 3FOLB 5IF0B 1FG9C 3VGAC 4AENA 3RVUD 3O2DL 3L5HA 3WE6A 3T2NL 3SDDC 5FYKE 4O2FB 3ES6B 3NIDE 5E2JA 3IFLH 3X12A 5GSVB 4ONGH 2D2OA 5D7SH 5ITBL 5C08D 3JUYA 1KB5L 3GJFB 3ZE0F 1BIIA 4Z0XA 5INCA 1HHJB 2C3HA 4OGAD 2DQIL 2QSQA 3HC0A 4UILH 2E8YA 1FVCA 4PJEE 1TZHA 2ZKHH 4F15B 1EV2E 4P23D 1AGDB 1JWSB 3T3PF 1XT5A 3KPMA 2WP3O 1JYWA 3MRRB 1QLEL 4YO0A 1KGCD 5FXCH 3VFVA 5I1GH 2DQUH 1TJHH 3BJLA 1F6AB 2BP3A 4LASL 3UJTL 1YYMH 2WIIA 2PXYD 4OCSH 5C6TH 1I8IA 3PXHA 5IJVA 4OZIB 4KGJA 1JMZA 5D2LE 5EOQH 5F9DC 5DUBB 3BD4A 4HIHB 2VQ1B 1N5AB 3L7EA 1KSRA 4G8GB 3STLB 1S8DA 3HZMB 1JMXA 1ADQA 2NLJA 1II4E 2E6JA 1XIWD 1QBML 1P7KB 1CFTB 1SYSB 3MLYL 2EDOA 2YK1L 1B0RB 2R23A 4PJAA 2WBJA 3WEXB 1WFOA 1LDSA 5AZEH 3CFDA 5MENA 3WDJA 1QSEB 1A3LH 1BEYH 3OF6A 5IROC 3RTQB 4EN3B 2CXKA 3O3AB 3P0VH 1G1YA 4XPBH 3OJDA 4XP9L 2OL3H 3KPLA 5C1MB 2R2EB 3LEVH 5T1DH 2DKUA 4BH7B 3EO9L 4APQA 2K3TA 4HKZB 3OR6B 4YAQB 5DGRA 4DCQB 2GUOB 3OKOA 3V52L 3WXWL 1NCCL 3MREB 2JB6B 3KYOA 4M6OH 1HIMH 2WWKT 5CIPB 3V4UL 1CICB 4DVBB 1RUQH 1NC2B 2XZCH 4JFDB 2ADIB 1X5HA 3SKMA 5ICYA 1E4XH 3G08B 1FNGB 3BN9C 5GJTH 1FP5A 3ZO0A 4XPFL 4YXHH 1JNNH 5FM5O 5JHLH 1HI6B 3QXWA 1P7QA 2R0ZL 1GXEA 4AIOA 5EU3A 4NKIL 2EH7L 5I8CA 3NZ8A 1A7PH 3DMMC 4EUPG 1CDJA 2A6IA 1NEZB 3CFKB 4OLUH 4X80H 4WCYL 2AJSL 1J1PL 3MRPA 4LLVA 4N5ED 5GZND 4Z18A 3M8OL 4HUWB 5C8JB 1DUYA 1FIGL 3R0NA 3FB7B 3CK0H 5HYJA 3GSOB 1KJ2A 3FO9A 4HEME 5CGMA 1HNFA 3EJYC 2YD4A 5CHNA 3NVQA 2XXMB 4ODWB 3WFEH 1QVOB 1G1CA 4KPHH 4KH2A 4UB0L 5CZVH 2FO4B 3TFKC 5IK3B 4O2EA 2DLTA 3MFFB 5KOMC 2O5XL 2ZUVA 2O5YL 3TZVA 5AZ2L 2DMKA 4PLJC 3QEQD 5KG9B 1A6ZA 2HMIC 4LMQE 4PGDB 3X13A 3MRBA 5LAXA 2VXUL 5EC1A 1AI1H 4ONHB 2GSIB 2GY5A 4MD4A 5D8JH 4PY7B 4RISL 5GIRA 3M07A 3QRGH 2R4SH 1C5DA 3LSOB 1T21A 5GRJL 5BJTA 3RKDD 4Y16D 2ESVE 3RZCD 3QDGE 3HS0B 4HIIA 5GSVA 3HR6A 4DK6A 3MRHA 4GRWH 5DYOB 2P5EA 4LIQE 5CINH 1UKTA 3H9SD 4FQXD 3FJTA 1HHJA 2WAHA 1EK3A 4KI5E 3RX7A 3D18A 1DBAH 3DRTA 1H3WM 4J3SA 3VFWA 1AP2A 4NKOA 4HUXB 1T20B 2AJUH 4NFBA 3U9PH 2GIYA 4JRWA 3VFMA 5FYLH 4P2OD 4M7KL 1GZPA 1KB9K 3AB0C 3SDXF 3DVIA 3W9DB 2CSPA 2PYED 4W81A 5F3HB 1MELA 4R7DB 1Q9KA 1U92A 5DMKA 2BSED 2ICWB 3LD8C 4CNIB 1QFOA 4HIHA 1EAPB 1U95B 2HJFB 3VWJA 3QULB 4OCXL 1KCVL 4XCEB 3HA0A 1FNSH 1MVFA 1G6RB 1A7OL 3PL6D 5IVZA 1FL5A 1OOAA 1MPAL 1B0RA 1BQHG 1WIOA 2E7BA 4LARL 4RDQF 1AJ7L 1M6OB 1EFXD 3EZJB 2Z31C 3WJLA 2NYYC 1S9XA 3CNKA 1NGQL 5E5RB 5EPMB 3OBAA 1XF5B 4Z7NE 2ZOLA 3MRCB 2IWGA 5EU6E 4PJ9A 1KLGB 3SY0B 3VXME 1LEGA 3VMPA 3U0PA 1OTTD 4OIAA 5F6IB 3UDWA 4N90E 3UBXG 3BDYL 1F8TH 3QZWG 4YH6A 4RMWA 2QV2A 1NCNA 5GGTA 3VXNA 4JFFB 5CIPA 2CRZA 4LGSB 3PWPB 1C16A 4KJYB 4HK3J 5DA0B 2IBZY 5D2LF 2I9TA 1S7SA 2IAMC 5MP6H 2I07A 4G6FD 2Y6SD 3THML 5CLTA 5E2WL 2HT2D 1FO0H 3S4SA 1NUDA 4ZTOH 3B9VA 1RJZA 5MHSE 2G75B 2YD6A 4WU5A 3MBEB 4GW1B 4XBEH 1QNZL 1KPVB 2HVKB 2VL4A 3VFGL 3QDMB 2JIXD 1KLUB 4YNYA 3QIBC 3GJEB 4CN1A 2OR7A 1OTUC 5D6CB 2VLJD 3ZTJH 2R1YA 5J4MA 1JBJA 4WFFD 2B4CH 2ADFH 2GCYA 3P0YH 3L95A 1UZ6E 3CPLA 4LP4A 4N0CD 5ICZA 2OL3B 1B88A 1MI5D 5INDA 5J12B 4HJJH 5BS0B 1OARL 1XGUA 5D1ZA 3Q5YA 1IAIL 3TVMC 2FJFB 3QQ9D 4TSAL 1E27B 2BDNH 4HSQA 3DV4A 4M8QB 1DQJB 2N7AA 4Z7WE 1CI5A 1UKQA 3D2UB 3NAAH 4Y4KD 1NQBA 1OM3H 3T3ME 5FO8A 2AJVL 5ITFA 3PWLB 4IRSB 3B3IA 3LPGA 4DFHA 2FCBA 3OX8A 4YIQA 3V6BR 2R2BB 4ONHA 4OF6A 1ITCA 4L3CB 4XX1E 3AMKA 4PY7A 1MCOL 5DK2A 2AKRB 1N7MH 4QRRE 2DWEA 5DS8B 3LSOA 4N8CH 2HRLA 3TO4B 5IVXF 1XGPA 4N68A 5JW5A 1SY6L 5I75C 4DVRL 3WL9B 5CBAB 1ACZA 3LQMA 3SHSA 2BC4A 3FFCE 5FGCE 2OZ4L 1H8OA 1QR4A 4XNMA 3QUZC 5IMKA 4GRLD 3OR7A 1RIUL 1RZKC 3P3YA 3S98A 4CDGC 1YQVL 3JV6B 1UB5B 1P6FA 1FGNL 2A9ML 2NY2C 4JFEE 2AEWA 5F7WC 5BV7L 3U30C 3OXRA 5E6IB 4NZRH 1U8JB 1I8MA 4GG6E 1EUUA 1KIQB 1GHFL 1CD8A 3BUYB 5FHAH 5DLMH 3L1OH 2HJLB 1H3UA 2NY4C 2HJFA 5TFSL 3PJSA 4FNLL 3D39D 4ZXBB 1G6RA 5DQJA 3SGKA 1ES0A 1T7XA 4I13B 1JZ6A 3NFSL 3BZDA 4HMDA 3ULVC 3O2DH 4HUMB 4LP5A 3T2NH 4BSVA 3DO7B 2PCPA 4W6YB 1KENL 4K71B 3VXUD 1KB5H 4F37K 1TCMA 3EOBB 1M7IA 4AIZA 3CDGA 2DQIH 1J9CT 1JYNA 4M1DH 2ADGA 4MAYA 1TQBB 5ADPH 3MLXL 1XR8B 4U1KA 3W0WA 3IGAB 3TIEA 1EJOL 4QHLB 1WAAA 1D5XA 1MRDL 1QLEH 4JO2L 8CGTA 4PRPE 4Y1AB 4LMQI 5T1KD 1AO7D 3LS5L 2Y25A 3ZT7A 5C71A 1GRWA 2OMBA 3ZE1E 3MLPA 4LASH 5FOBA 3UJTH 4X6BB 1UEYA 2IG2L 3S3JA 3IDYB 3IAPA 3P30L 2FBJL 3QNYB 3G04A 4P2RE 5I0DA 4KROB 4EI5A 5F9OL 2YUZA 4NO0D 1JP5A 2V2XA 3S88H 3L3DA 1QBMH 1R3JB 4NQVB 2YK1H 2ZOKA 1RMFL 3SDYL 4PJHF 1NFDA 1VKXB 3DO3A 1TCRB 2CLVB 3GJEA 2E9JA 3ZYJA 2EZ0C 1NCDL 4PJ5D 1CFVL 4P5TB 3WNNA 5E08L 1I1FB 5I1JH 5EBWA 4OZGB 3BEVB 4X6DF 4KJPC 4J4PD 3SN6N 5IW1B 3H3KA 3EO9H 1C7TA 1WZLA 4E5XB 1NCUA 1HHIB 2D0HA 3AC0A 3C5JA 5D72L 2A9NL 5T3ZL 4UINL 4WV1B 2ADJA 3DGCR 2ENSA 3QQ3A 4JHAL 3H6JA 4JM2C 3V52H 3ZYIA 1NCCH 5CUSL 3HI1A 2YPVL 1T4KA 3V4UH 3SKUD 1D9KC 4H26B 4JGMA 4ZFOA 5D7IF 1AGFB 2BVTA 4JVWA 1MAKA 5J89A 5KS9F 2Q20A 1A14L 4XNZC 3FOMA 1RZFL 1CLOL 2YPKB 4HCRL 4QRTB 2MSPA 5TGBB 4PJBE 3MO1A 3V5KB 4XPFH 1YQ2A 5FDWB 1FO0B 4PRAA 4HPOL 5D5MA 3F7QA 4NKIH 1NGYA 2BY3A 4RFOL 3KPSD 2G2RB 3CLEL 4RWHA 4NC2B 2GT9B 2C1OA 4JQIL 4KY1L 2AJSH 1URLA 1O5DT 3M8OH 4YBQD 3BQUA 4WFHE 1FIGH 5SWQA 2XTJE 5D71L 3WKNA 3MV11 3WJJC 2PW2A 5KSBB 1A4KB 4LGRB 5HDBF 1WICA 5MEPA 4XVTL 4J8RA 3LPWA 5H35A 2AK4B 1RSFA 5GGUB 5IHLB 2KKQA 3ZKXB 3V0WH 3HE6C 4HS6A 4UB0H 5CEYB 1B4JL 2BHZA 4LVHC 2BRRL 5C0DA 5DURD 4AYFA 2NQCA 3E2HB 4P3DB 1RFDL 2VUOA 1U8JA 4PRIE 2R0WL 2O5YH 1LE5B 4MA3A 4Q6IB 5AZ2H 4WHCA 2OX5A 5IB1B 4HWEL 1YEGL 3MYJB 5E00B 2QKIB 3MA7A 4BQCA 2VXUH 3KPNB 4HGWA 1P84K 5D1QB 2X44D 2MMXA 2FHBA 2DB8A 4RISH 2VABB 4ELMA 4CADA 2BERA 2H2SD 4LCCB 3R8QA 1C12B 2BVOB 1C1EL 5GRJH 2YEZB 3FZUD 2XN9D 3DROB 5FGBC 3UTZA 5HVFB 4GKOA 4JY6A 3MJ9A 5JXAL 1KNOA 2EYSB 4PBWD 4LEOB 2IPUG 3GGWB 1NFIB 4Y2DC 5D4QA 2YD8A 1F45A 3QHTC 2DQTL 3N0PB 3C2AL 3H7LA 4KKBD 4LVNB 1EDQA 3VD7A 2ZG3A 2NW2B 4LHUG 5LGKA 2GTWB 5C6WH 2XG5A 3O41B 4M7KH 4ZUSB 3G6DL 1ND0B 1UYWL 3ZKMC 5SWSA 2A6KB 3QT2A 4MNQB 1NGWA 1UENA 5EBGA 3CXHJ 5DTFA 4X6BA 3S97C 2LVEA 3QUXD 3P4LA 4KMTL 2GYSA 3HNSL 4YGVA 1YC8A 4AEHL 3K2UL 3O4LE 2HT4C 1OD7A 1MVUB 1OSZB 4OCXH 5IB5B 1IAIM 1KCVH 1PY4A 4C59B 1G9EA 4LQFL 1ZWIA 2EDHA 4OI9A 5I71B 2HP4A 1A7OH 2WINB 3H9ZA 4LNRB 4F7PA 1MPAH 3L3OB 3EDEA 5IEKA 1FZOB 2HFGH 3VXSA 4X4MA 4TTDD 1AJ7H 2JLLA 4JRXB 5BZWB 5DD3L 3RL2A 4PJ7E 5DJCA 3MV01 1MCWW 2VXQH 3RP1A 1NGQH 4O5LL 2A6JB 5A3IC 1KB5B 5K9QI 1HH9B 4Y19A 3BDXA 4MXWL 5TDOB 3V6ZB 1I75A 3QXDB 1NUFA 3BDYH 2H45A 3UTSE 3QIWD 4YDLB 3GMPA 4WFED 5JXED 1E4JA 1S7QB 2OJZL 4PJCF 3QCVL 3QA3B 3P4NA 3OG6B 4ZTPL 2YXMA 1IGYA 5FK9B 5BOPA 1KXVC 3E6HA 2ITDB 3DWTA 3I75B 3L3HB 3G9AB 3BPNB 4AEIL 2OTWB 1FZMB 4Y89A 2FRGP 1HH6A 3OKEA 2E3VA 2YPKA 3THMH 5ISZB 2BFVL 5KSAD 1FL6B 3SJVA 3ZYZA 1F3DH 5E1HB 3KHQA 4G5ZL 2WANA 3QXVA 3T4YB 4KHTL 2PF6A 1JGDB 4KK9C 5HYSG 1YMMD 5DK0B 1QNZH 2F54E 3ESUF 4K7PX 4L4VE 5T33L 4OCWL 2BVUA 3CLFL 1I1RA 1MFAL 3MJ8B 5DQ9B 1UA6L 5IFAH 1GCFA 15C8L 4L3EA 1OAXL 4H25A 4YFDB 4MJID 1MCCA 4UT6L 1OARH 4GKZB 4GAYA 1IAIH 1KTRL 4HG4J 1I7TB 4TSAH 3EYOA 5HHNB 4PR5A 1Q9OA 3RWIA 4U7MA 4WEMB 4GW5A 5IMMB 3VRJB 1DVFC 4JRYA 5J0BA 1NANH 3L3JA 4GMTL 5EUOA 1REIA 3C5ZD 1HQRB 4PGCA 3UZVB 4F80A 2AJVH 2XWJA 1KEGL 4JQXA 3ARDA 5EB9A 4I0PB 1BREA 3EOAA 1UJ3A 1MCOH 3B9EA 1FCCA 3CC5A 4M6NH 3HFML 3SE8L 4P99A 1LP9A 3AS1A 4EUPH 5ID0A 1SY6H 5ACZA 1NC4D 3TN0D 4DVRH 3X17A 3RWFA 5AD0B 2BX5A 5B4MD 1U58B 2EYSA 4PJIE 3LH2L 2VXVL 3BP4A 3TLRA 1MHHB 1WISA 4P46C 1U8MB 2P49B 2BVQB 2NW2A 1AIFA 1RIUH 2HTLC 4OZFG 4HXAL 2EDYA 1YQVH 5KVGL 5IJKA 1AKJA 1FGNH 5I9QB 2ZCKL 2R69L 1F97A 5BV7H 4MSWB 3P9MA 1MH5A 1KIUA 2M2DA 1UADC 4EZMA 3KPRE 1A6PA 4RAUA 3DUSB 5DQDL 1GHFH 4D0BB 4HHAB 4K8RD 1ZSDB 4HPYL 5FOJA 1OQXA 1IZJA 5KANI 4FNLH 2NW3B 4PJXE 1ZLWH 5BVJA 4K2UH 5I1LA 3NFSH 3RY6A 2FL5B 1FZJB 1E28B 2G9HB 5GGSB 1KPRB 1FZOA 1KLFA 3R06A 5DFTA 4U1LB 1KCKA 4PJEA 4NC1E 4BELD 4F7MA 4OAWA 3QUML 3K2MC 1O7VA 1AR1C 3WUWA 1KENH 2EE6A 4M5YL 5KN5A 3WHE1 1C8PA 1CWVA 4OLXL 4L29B 4LKXB 5TH2B 2LE9A 5HSFA 1OAYH 1V3KA 3RVXC 1JRHL 1S5HA 2NTSP 1PFCA 4QHKI 3W9EB 1MUJA 1FLRL 3FB6B 1N3NB 3MLXH 3TA3D 1HHHA 2NXYD 1WBZA 3CVIL 1VFBB 3GMRB 5D2LA 1EJOH 4JFHE 2W1NA 4G9FB 5GZOD 1VB9A 5B3NA 5MERA 5C0CD 3Q3GA 2HTKC 3LS5H 3MSPA 1IAKA 1QD0A 4PFEA 2ZNWA 3LKRA 3I75A 2IG2H 1ZHLB 4FXKA 4FG6D 3DYOA 3FT4A 3P30H 2BRQA 4OLZL 4JKPL 1FZMA 5JHDB 3PHSA 2KBGA 3BXNA 4WI6A 3CXDL 1FL6A 1IQDB 5F9OH 5KSVB 1I9JL 1A1OA 3MR9A 4DW2H 1DJSA 4JCLA 5F1KC 3BHBA 4C83B 5C0JB 3IDGA 3SDCB 3V0VA 1XH3B 3FQRB 3NGBB 4QWWC 4XP5L 4LLMB 1RMFH 4W6WB 4FZ8L 5HGBB 1IKFH 1K4DB 3RY5A 3BIBX 1IMHC 3JTSB 1NCDH 3KPTA 1CFVH 5E08H 5C0RL 4NQDB 3MJ8A 1K8IA 4S1DC 1W0YT 1KBGL 2YN5A 1OB1A 2XY1A 4XI5D 2KZ1B 1U3HC 2YKLL 4QHNA 1ZLUH 1IQWL 2DOCA 4ENEC 5ESQB 3MBXL 3BRGC 1KPUB 5AYUL 3U48A 1UM5L 5D72H 5T3ZH 4UINH 3BP6B 3VW3L 4JHAH 5C0EA 1IC5L 3VXTB 3KXFB 43C9B 2FIRT 5CUSH 1OGAE 2YPVH 1KEML 3MRJB 4ZUUB 5T1MA 4J1UA 2X1WL 3NOIA 1TPXB 3RVVC 5TE7L 2DL9A 5B8CB 4S1SL 1A14H 4FQCL 4I0PA 1RZFH 1CLOH 4NOBA 4I9WD 4OJFL 1D5IL 3U1SL 5HY9A 1OWWA 2PW1B 1DLHA 4P9HL 4PREB 5ERWA 5F72S 3EW3B 3HAEG 4O51B 2I26N 4HPOH 2WBKA 3QDHA 3VXQA 4AEFA 2V7HA 2YC1A 4RFOH 2W65B 1TVBB 1UXSA 4TUKL 4XNQA 3CLEH 3BH9B 3D25A 3V2AR 3GSQA 4JQIH 1YY9D 1LO0L 1U58A 3KYAA 1KN2L 4MQTB 3OB8A 4PJDB 2VXTL 4I2XB 3U4BL 1I4FA 5D71H 4KK5C 4ODTL 5F9JB 4XVTH 1U8NA 1AR2A 4FXGA 3BN3B 2YXFA 2DLGA 3KJ4C 2X7LB 3RRQA 4G6KL 5H8DA 1UACL 2A6DB 1R5IB 2BRRH 3MRLA 4X7DC 1NGXB 1FFOB 2R0WH 2BSSA 4UDUA 4IJ3C 4L8BB 2UUDH 4XBGA 4HF5L 4HWEH 1JNHB 1YEGH 1WEJL 3B9KD 2F8OA 2ESVA 1FVDA 3D6GA 1JFQL 1QYGL 3QDGA 3SKOB 2B20A 5B38B 3V8OA 2VIRA 3QUYD 4NSKB 3S37X 4R3SA 3MRQB 2BSTB 2EDEA 5HHME 4HT1L 4XP1L 2D0GA 3WFBL 3FFCB 1IEAB 4POUB 4U1LA 5CGYC 3T0EE 5JW4R 3IJSA 2XZQL 3IFPB 1BF2A 2DTML 4PJ8A 3HZKB 2AXFB 4EUPB 3V5HB 4TN9A 5FEBA 5JXAH 3NCEB 2C1PA 3KDMA 3LKSA 3RGVD 1MSPA 1FL3B 1INDH 3QEHB 4X99A 2DQTH 5CD5C 3C2AH 3ARFB 1N3NA 1YUHA 4R0LC 4JQVC 4X7FC 2EECA 2BHUA 5D96B 3ZE2F 4G8FA 1MFEL 4GFTB 5E8OA 5A2FA 3O3BA 1EXUA 3ARVA 1KG0B 5HVHB 2J5LB 2BOBA 3BW9B 2LAAA 2APFA 3G5VA 3HNSH 3K2UH 2NY5L 3BKCL 1B6DA 1IEBA 3P11L 2XKNB 4P2YA 4RFEB 4RNRB 2P8PB 5DMGC 4LQFH 4X6EB 1Z9MA 3TIDB 4MDJB 7FABL 1S9WA 1XH3A 1A2YA 5DF0A 1BX2A 3DUUA 5EU6A 3V6OC 2XPGB 1RZ8A 3VXMA 2ITCB 3QI9B 1EIBA 1X5IA 3R1GL 5DD3H 1XCQB 2AABL 3QHFL 1SEQH 3V4PL 5DXWA 4X7CC 2ED8A 4HQQL 4O5LH 3ROOA 1OT2A 4JZOA 1G7QA 4MXWH 1VERA 1A5FH 4I5BB 3D0LB 4NN5C 1DL7L 3N1QC 3B5HA 5ESQA 1U2HA 5JIHA 2XQBL 3T65B 4G42A 5I74C 1IM3B 1UT9A 3K46A 4MJ6B 2OJZH 4RBPK 3MACL 1IBGH 4NQEB 3QCVH 4QLRA 3VXTA 4ZTPH 5IFJA 3D69A 4UQ3B 1MHEB 4CGTA 1N6VA 4GH7B 2BNUB 1WF5A 5TJWK 4AEIH 4JFXB 2BMKA 4KUZL 2CRMA 5E8PA 5FV1L 4YR6A 3ILQD 1BGXL 2AXJA 2BFVH 2EE2A 4XH2B 5T1LA 2OYPA 2R1WB 4PRHD 2P24A 4G5ZH 3LB6C 3MV7D 4O51A 4KHTH 5C07D 4WO4D 4K7PY 3TBSA 5DRXB 4R2GD 5E8DH 5HDQL 1HSAB 3C09B 1BQHB 2XG4A 4KJQD 4RIRA 4GBXB 3RZWA 1FFQA 1HILA 4YFLF 4B0MM 1RIHL 5T33H 3ILPA 5C0NC 2YUWA 3LQZA 3T0BA 1MFAH 1UA6H 3I6GA 15C8H 4NQCD 2UY6A 4Y8AA 1OAXH 4Z7WA 2WBJC 2NY1B 2IJ0C 3C9NB 3RGHA 3G5XB 5DJAB 1MLBA 4KDWA 2R1XA 4U1HA 3WNLA 1H5BB 2JJUA 4H0GA 1X5GA 2NX5B 1GC1L 2HT3D 4B5EA 3QZWB 1FYHB 3KHOA 2GW5A 3WFHA 4GMTH 4PLKD 3GSRA 5J1TC 4QRRA 2BCKB 1KEGH 2OI9C 1J8HD 3GMNA 1UQSA 2FDBP 2VISB 4ORZC 1FYTD 3DX6B 3K8MA 4OQ1A 3LDBB 4J3TA 2VLKD 4IEFB 1X3DA 5T5NF 4S1QL 4DGVL 4RGMB 3SE8H 1L6XA 4WWKD 1JGLH 4Z77B 1QBLL 2VLLB 3IFPA 1L6ZA 1F6LL 1LE9B 4I8DA 1J87A 2ZUWA 4KKNA 5F7DA 3VG0L 1F3RB 1YEDA 1W2KT 1UEMA 1CS6A 3LH2H 4JFEA 2ZSVA 1RZGB 2X4OB 4MMZC 2DI8A 5C08B 5DJ6B 2QR0B 4GG6A 1HZHH 4HXAH 4RQQB 4TVSa 5KVGH 4LLQA 2ZCKH 4XPGL 2R69H 1XF4A 4FFZH 3B2UD 3GBLA 4KMQA 5DQDH 1ZA6B 3NIGF 3RHWF 4FQIL 4NO2B 1FVEB 3I6LD 1KTLB 4HPYH 5JIPA 3D3VE 4NN7C 1NDGA 3E6FB 4CW1A 3HC3L 1AGCA 2GJ6E 3BWUC 2PXYB 5D7JA 3RDTA 1A9EB 1QKZL 4YXLL 5AEAA 3TZVC 4BQ6A 4ZMAT 3O9WD 3GSVB 2QADD 2P7TB 3QUMH 4OLXH 3KLHD 5JIIA 2OK0L 1XIWB 2ED7A 4PRPA 3TBTB 1JRHH 1J11A 2HN7B 4KDVA 3RUGB 3GSXA 4JFOB 1JK8B 2QSVA 1AXTH 4XGZA 3CVIH 3RNQA 5J13B 3QDJD 3C08H 4QXTB 5LBSL 4P2RA 3VGBA 3DXAD 4LEXL 1CDCA 4UT7L 2EEAA 3U4AA 5EZJB 1FORL 1L7TL 2WP3T 1CGTA 4FMFA 4OLZH 3QIUD 4JFXA 3OKNA 4EOWL 4PRNA 2J1KA 4Z7UE 2EE3A 4XH2A 2Y7QB 5C0BD 1I9JH 3O6ML 1N2RB 5B39B 1AXSB 2PO6A 4M93C 3QDAA 5IW6B 32C2B 3SDDD 4XP5H 2L7UA 4X0KA 1I7ZB 1QRKA 4FZ8H 4RRPG 2AW2A 3VWJC 5FF6A 1U3ZA 4QHMA 1UCBL 3P9LB 1HDMB 5C0RH 4QTHB 4DKFL 4HS3B 1KBGH 2BNRD 2EDNA 2YKLH 1TVHB 3TPUB 1IQWH 4CMMB 5C0FB 4NHCL 3UJJL 2VAAB 3MBXH 3WJLC 1JHKL 3L3GB 3K1KC 3UBXA 1HHKA 1I1YA 1UM5H 2E6QA 5KAQF 4OM0L 3SDAA 1FRGL 5DSCB 4CVUA 3VW3H 1IC5H 4PJ9C 1G0XA 2Z8VC 4DGYL 2EYTA 4PJBA 4Z7OF 2RJMA 3UDWC 3BDBA 1SBSL 3HNTL 4HS8L 5HBBA 5TE7H 4S1SH 3ME0A 1UWEL 4FQCH 1YY8B 1LHZA 2MCPH 4M1CC 3VXRE 1V5JA 4ZNEE 1XGYL 1P69B 3GSUA 2ERJC 3PQYD 4OJFH 1D5IH 3U1SH 5B3JF 4Q0XL 4JO3L 1RUPL 4QYOB 5HYIA 4K8RL 4NM8L 4U7SA 2JCCB 1G7JB 2W0PA 4DN3L 5DJZA 3QEQB 4QRSA 5FKAB 1KJVB 5L2JB 1V3MA 3IDMB 4TUKH 2P5WD 4GS7C 1S7VB 5DUML 4JZJB 4PV8A 2AXHA 2DBLL 1VACA 2PKDA 3RA7L 3VFRA 1P4LB 3UO1L 3IVKA 3Q6FB 2BY0A 1DN0B 1LO0H 2J4WL 4A6YL 2G5BB 1KN2H 4HDIA 3WNPA 2VXTH 4Y16B 2R9HC 4ODTH 3F58H 4PRIA 2YMXL 1ACYL 1P53A 4BFIB 1JV5A 5K9KB 5I1CL 3H9SB 4FQXB 1OP3H 2XICA 2HRPL 3M17A 3MPCA 4G6KH 4ZQKA 5HGHB 1UACH 3LRSA 1DE4B 5IGXL 2KUTA 5D1ZC 4NO2A 4P2OB 4N0FB 5IQ9A 4HF5H 3I50L 1WCQA 3PP3H 1JFQH 1ITBB 3BN9D 2PYEB 2P46B 3PGFH 1A22B 1JZ2A 3F5WA 1MHCB 4PJIB 3WFBH 3TT3L 3V5DA 4MQ7B