2D3JA

Nmr structure of the wif domain from human wif-1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
157
structure length
157
Chain Sequence
GSHMLDQQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILQTPQNAIFFKTCLQAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the WIF domain of the human Wnt-inhibitory factor-1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein inhibitor
molecule keywords Wnt inhibitory factor-1
total genus 36
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02019 WIF WIF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2d3jA00
2D3JA 2YGNA 2YGOA 2YGPA 2YGQA
chains in the Genus database with same CATH superfamily
3BEWA 2BIPA 3T0EE 3T08A 5GRVL 4ES9A 3FTYA 3NZUA 4TS6A 3U9PH 1MCLA 3TT1L 2UY7A 3TZVD 4PP2A 3MJ8A 2JKTM 4J27A 3SDYH 3J07A 5D4HA 2AZUA 4PJXF 4L9LA 4E0RA 4J39A 4TPRH 1BQLL 1UJTA 4UV7H 4M02A 1INEH 5DR5L 3W0WA 3STLB 2XTLA 1GGBH 3CDZA 1FLRH 5E4IA 1A6ZB 2WHVA 1XBDA 4UYQA 4D2NA 4EDXA 3OKLB 2QZQA 1ANUA 3RB7A 4P3DB 4JFYB 3EG9A 4AL8H 3QDJA 5DD1H 5MERA 1MH5B 2HX7A 3CDCA 4H1LB 3AG4B 2J2ZA 3D09A 4PD4K 1OTSD 5ITFA 5DWUL 1GCYA 3CZFA 2H32H 1UWEH 4IRSD 1JGLH 1MZYA 1H3UA 1QBBA 3UTQB 5HJ3B 1I9IL 2P49B 1LO4L 4P2RE 3HHMA 3KPPA 4RAHA 1FFQA 1U6AL 1CBJA 1GZHA 4ZFGL 3TZVB 4K7FB 4UMGA 4D8PB 4WEMB 1B6UA 3HG4A 1FNGA 4DEWA 2H32A 5DD3L 5E00B 3BZFA 2VGLM 3BT2H 4R5XA 2WZPD 1HOEA 1QSVA 1VENA 1AQKL 1F42A 1REIA 2CNZA 1QRND 2ZXCA 3DHMA 4X6EA 5D5MA 4C4KT 3UBFA 1KBGH 1KEML 2ADGB 3ELQA 1LO0L 3GSVB 2YPVH 5KANG 3SEPA 4AQAB 4JAMA 3R4RA 5AAMA 1LMIA 1GAFL 5LBSL 2YK1L 2LLLA 5I30L 3GBML 1UEYA 3SQOL 1HCVA 1YJDH 3QWOA 1I3RA 3EGDA 2ODIA 3MBWA 1DVFA 4PV8B 3MLVH 4P4KB 5K5YA 4ISVA 4ZMAT 1TVHB 3Q0HA 4U4IA 4HEME 5DZOA 1LO3H 1PX3A 1VFUA 1SLVA 1ZEAH 2ADJA 2F53A 5C0ND 3TYGH 5AWNH 2AKRA 3O8XB 4DAGH 5EU7E 5IW6B 3RB5A 4RESB 1NGZA 3ES6B 3R8QA 1S7XB 1UKSA 2OSYA 5FO9B 2VR5A 4P04A 3UTTA 3B8SA 2BSBA 4WKZB 3ARTA 1LDPH 1MJUH 2H2PC 1JD7A 4LARL 3OGOE 1N59A 2E7BA 2WLKA 4M6AA 4HZLA 2L0DA 3DGGA 1QI5A 4HHWA 3KLKA 4XPAL 5D70L 5F7HA 1NA8A 3OL2A 1WFNA 5D9SA 1H6UA 3PWPD 1H5BB 1JNHB 1L9NA 4A7UA 1DVTA 1T3FB 1A6TB 4C55A 5GZNA 4NKIH 4YXHL 5I1IH 2BMKA 4AUYA 1YEDA 4KK9C 4OF0A 2EC8A 4Z78A 5AYUL 3I75A 2F74A 3GBNH 2ZXEB 1IZKA 1T83A 3ISWA 3GXPA 1ZLSH 3DSNA 4DGWC 4R96B 4MXVF 3VTMA 4GB9A 1MWAL 4Z18A 3SYAA 1MUJA 3QPQD 3I9GH 4R7LA 2GBVA 3CHSA 4IDJL 4QRSA 2JQMA 1BZ9A 3D4YA 1IGCL 3VQLA 5IVXA 3EJCA 1CLZH 3GM8A 3K6FA 5C6TH 2E9BA 4RMVA 3VD4A 2Y4SA 5H4YA 2ZX7A 5TH2B 4EN2A 1LWHA 4NT6A 1P1ZA 4JN1H 3CBRA 1SXCA 1DJGA 4UDUA 2OPCA 2V5RA 1P7HL 2YWZA 2Q20A 4JRXE 2UZPA 1NMBL 4GLRH 3T3MB 4XO8A 3MFGB 2YKLL 3QYCA 3BUBA 2C26A 4JFDD 4OLYH 3X3FH 1PL3A 4LLAA 3T6ZA 3LEYL 5E8PA 1S7SB 2XN0A 5AYQA 4NN5B 4LBEB 2D03L 4DVBB 2QT6A 1XSIA 2H2PD 4NKIL 2EIKB 4OAWA 5E8NB 2ICCA 5JQHC 4N68A 4KC3B 2FGWH 5J11B 1MLCA 1NDMB 4TNVF 2GT9B 5IMKB 2LU5A 1AYOA 1IGTB 4G9DB 4FYQA 4QTHA 2ORBL 3RGHA 4Z95L 4KXZH 4U1IB 1JGDB 5F0LB 2YPLE 4K9EC 1EMTL 2QSCL 3O11B 5JIKA 1L5GA 3ZE1E 1IM3D 1OPGH 1MREL 1AZNA 3C9NA 3VI3B 3O3DA 5IK3A 4HKJA 2R1XB 2WOBA 4GW5B 2R2EB 3EUDA 3MGOA 5IW3A 3RPKA 4BSJA 4F24A 1DEDA 5D5MF 3WXVL 2DIAA 3LKOA 4Z8FL 1KNOB 1D6EA 1NBCA 3FSWA 5KVFE 3JV6A 1FG2B 3EO1A 3KLAA 3QR0A 2RGSA 1E6JL 2IPUK 2X2YA 3SKMB 3B56A 1EZUA 3AADB 4GMSL 3AABA 3TTSA 3W82A 2FH8A 3CX5K 3WFDL 1F90L 3V4UL 2BDNL 5BNXD 5E8PB 4L4VA 1U3HA 2BVOB 4X2UA 1MCWW 4I9WE 4KQ3H 1IBYA 3LXAA 3TBVB 1RFDH 3KPQB 1EEZA 3BWZA 3OAWA 5AVSB 3ZYZA 1L7IL 2DPKA 2JJWA 1EAJA 2YA1A 5I1IL 1KJ3H 2V7HA 3MA7A 2R29A 3A6BH 1KEMH 3HC3L 3S3DB 2VDRB 3BUYA 3T2PA 1B4JH 1U3YA 3QDMD 4WCYH 3RX8A 5DK2B 4A2MA 1TEFA 1YNLL 3WJLC 2F5AL 4OLUL 2VUYA 3VFSA 3IK2A 4ZMZA 2DI8A 1HHIA 4ZQKB 3SOTA 2ARJA 2YAFA 3V6FB 2Z31D 2NY3C 5I28A 3QIUD 5GISL 5KBMA 2EUXA 3HKZA 3X3GH 2JIXB 3RDTC 3UIZA 2BP0B 4TLTA 2Q86A 2RJMA 1P4LA 4FN0A 4IGBD 5FFOA 4DAGL 3K71A 3DX4A 3CQFA 3OLIA 4RBPK 4ANXA 1CBVL 3BZDA 2OW7A 4S1QH 2VZ1A 3H9SE 1UVQA 4JFQB 3GSRB 2HFFB 4NI3A 3FULA 3RTQB 4Q4EA 3C5ZD 2DTMH 3EW3B 4KKAD 1YZZA 4OT1H 3ZHKA 3V4PL 4YFDB 1KCSH 5EUOB 3AWFA 5GRUL 2I25N 3OBAA 1OCWH 3RVVD 4N2OA 4RGNC 1WTLA 4ACPA 4Z7AA 2A1WL 5AW6B 3WFHB 1K8IA 5DUPH 3PWPA 2Z31B 3WJMB 5H35B 4QYOA 4M7LH 4LAQL 1AQKH 3R0NA 5IHHA 4PY8J 1JF5A 2CMRL 4PS8A 4FFTA 5ESQA 5DD3H 3MRPA 1Y6NR 2AJZA 2XZQH 4N2EA 2IANB 4ONHB 32C2A 1G9HA 4I77H 5HYJE 4BWUA 3KWXA 4OLVL 3KWWB 4OCWL 2YGOA 2A73B 4PY7A 3OX8A 3SPHA 1F4HA 1Y18A 2A83A 3EYQD 4OJFH 4AH2A 1GS8A 1KLGA 3GB7A 1UT1A 5B38B 4NHCL 4JPQA 4GKNB 4KQ4L 4X5RA 4IBQA 4FQXB 3FQWB 2IV8A 2A6IA 1T4KB 1WS7A 1OLZA 4F2MA 3LZRA 3HE6D 4AEFA 2WJ7A 4OR1A 3O0LA 2OAAA 3TO4D 2Z1PA 4U05A 4Z1PA 4NUGH 1AZZC 4PIRF 4AJWA 5C92A 1RV6X 4K3EL 1DVFD 4XE5B 1G6RB 2YAHA 4PJHA 3LRSB 4A04A 3MBEA 3S4SB 3D12B 2EUWA 2PTVA 1JP5A 4LQFL 4X5WA 2GJ6B 4OLZL 3BKJH 4ONGL 3VXRD 5ENWB 2EXWC 5HGGS 5EIVA 3RX9A 2F5BL 4MCZA 5JMRA 3CFMA 2GPZA 5J56B 1SJHA 3U48A 4C56A 1TPXC 3ESPA 5HJ3A 4Y9EA 2F68X 3RRQA 4R0LC 2CO3A 3C6SA 3B9VA 3KZ8A 4RGOL 3VTAA 3R4DA 5D7IA 5SX5H 4I3SL 4U1KB 3K8KA 4I2XA 3GHBL 3HPJB 3CFJA 1L0QA 3IWUA 5G55A 5E9DD 3MOAH 1CIDA 2AITA 1PY4A 2VSKB 4KZDH 2BP0A 3HZVB 5EBLB 3FTZA 1SEBB 5HHNB 5AVWB 2UZIH 2QPDB 1IM3B 3QEHA 3P77B 4AK2A 4Z7NF 1KGIA 5I5MA 3QUXD 3ZKXC 3VXSB 2XRAH 5I1EH 1W0YT 2FL5A 2Q3AA 4M3HA 4IU3A 2FE0A 1FNHA 1XZ0B 2QQNL 3NVQA 3FZUC 3IXAA 4GAGL 5C09A 4Z7OF 1U8NB 2DEYX 5BS0B 5FGRA 5MENB 4N86A 4QF1A 1G0DA 2QGBA 1HCYA 3WDIA 3FN0H 4R7VA 4WJ5B 1GGIL 3RGVC 4G72B 4BQ6A 3NJHA 4NO5A 2QADB 3C2SA 3LQAL 4LLVA 3SD5A 4HXAH 3EFOB 3S5LG 4RLDA 4DN4L 4NDMA 2J2ZB 1T2JA 5C0AE 1E4XI 3T3ME 1ITBB 3C6EA 4GIPD 1JDDA 3BVWA 2MEJB 3PRZA 1XDTT 1CYWA 2K7PA 4PJ9D 1BYOA 5E0QA 1YNKL 5B8CA 5F6HI 5I1HH 4FDWA 5JW4R 4LFHG 3JV6B 1JHKH 2D0GA 3QUZC 5TE6L 3VJ6B 2OL3A 3UC0L 2YUXA 4ZZFA 1KB9J 2L8AA 3F04A 4V11A 3L4WA 3VRJA 4MX7A 1RULH 1U8IA 3CFKA 4UQDA 1G84A 1CL7H 2E4FA 4UIKL 4G6JL 4OUOA 3EJQA 3STZB 3X1GA 4AGMA 1IC7H 4AVJA 3QA3A 3DRTB 3QNYB 5E94B 3I3EA 4HPHA 2HLFD 2A4ZA 3MDJA 5K9KA 5C6PB 3CVDA 1FL3B 1YEFH 4O51B 1A6AA 3DUSB 1EANA 1DBML 2B14A 3QQNA 4KHXL 5ANHA 5L6YL 2K6WA 3OWEA 5AUMB 3ROLB 3UYRH 2YIHA 1FZOA 4G9FA 4DGYL 4OTXH 1PDKA 3GLEA 1VGKA 3IGKA 2RBLA 3R0MA 4QOKA 4B7LA 5CR1A 4W9IC 4BE6A 1JNNH 5D2LB 2DJMA 3SQOH 1Y7VA 5CSBA 4Q14A 4XMLL 3BH9A 4IOIA 5E2TL 2B20A 2CDEB 1WBYB 1INQA 4FCHA 4D0CB 5F0PB 2X42A 5C08D 4OIFA 1GGUA 3CSFA 4P2CG 1UKQA 3QFDB 4I0PC 4LEOB 5DO2D 5AAWC 2VLRB 1KJVB 2KT6A 2DBJA 1D5XA 5GQBA 3WELA 4Q9QL 2YARA 3P11L 3MUGA 2MCAA 3TTYA 4KPHL 1KIUB 4CC0A 1MIEL 3HAEG 5HHOA 3EFFB 2XBDA 1O75A 2RCSH 1OF2A 3ERXA 1E5CA 5HY9A 2GSGA 4HULB 3TOPA 3VRLE 4PP1C 5E2WL 5FEBA 2NUPB 2DH2A 3POCA 4G59C 3ULVC 3WMPA 3Q2LA 4HFUH 1U2CA 1B2YA 4JO8A 4CADA 1JGLL 3BVNB 4RNRB 1YDPB 4HC1A 4ONGH 1V7NH 1WLHA 1NFIA 3ZKQD 5DZ9A 5T1LB 2NNRA 3TVMD 1NAKL 1J1PH 4XHQA 5AOIA 3IXTA 3TWCL 1QEWA 1FL6A 1YJDL 3WFEH 1IZJA 3TBWA 4YLCA 5D9SB 3DVNA 2AEOA 4Y9GA 4UV7L 2DQFB 4ELMB 5EC1A 3ARRA 1C8PA 1RXLA 4LRNH 2CJTA 3ML9A 5DRWB 4OJYA 4XH2A 5F9OH 2O72A 1IQDA 1MRFH 1CFTA 3PWUB 1RURH 4FOMA 1R3LA 1U8KB 3HBGA 1KBWA 4F7EA 3D18A 1ML0A 4DZ8A 1G5GA 3DTUB 2EADA 4ZPTA 1N26A 5GS0D 3UPRA 2XV0A 1PKQB 4Z7WA 4GG6B 4AZ8A 4D3CL 4GXUN 2I9TA 4JFPA 5INDA 4ZMXA 5HHPA 2AKRB 3O8XA 2D3VA 3IT8D 2FZ3B 2LU7A 2BS71 3F00A 4X6FB 3QI9D 1IBBA 3U2IA 4N8UA 1IAIL 3FCBA 3H0TA 3ESOA 3V0AC 2FHFA 1JHLL 3AWEA 4JFZL 1ZPLA 2ZUVA 2GSMB 2WQ8A 4CVXB 4MRCA 4YH6A 2V2TA 4LGRB 4M6OH 5CEXA 2NYYC 1RZGB 3KHQA 1G0YR 2WOYA 3MMEA 4K3JL 1XO8A 2NZ1A 4QCIA 4KFZC 4ZFFA 2R59A 4H5SB 2X09A 3LRKA 3NRQA 4ZNEA 5DJZA 4U1SB 4MAZA 2L7UA 4R2GB 3BOVA 1QSEA 3K8LA 1URZA 2A77L 3LQMA 4F7CB 2EVGA 3D3VA 5LHDA 3VYPA 2IG2H 3VXQA 1A1MB 1GS6X 5F9DC 3H4HA 4ZUSA 3MR9A 3W39A 1RMFL 1ZHKA 2EYTB 3MNDA 3UTTE 4MLSA 5E99L 4NENB 3ISYA 1IUZA 1N3NA 2FEDD 1FCGA 1KV7A 1MREH 4UZUA 1U30A 4QRBA 1INDL 2CBPA 1QI3A 2NTFB 4GSRA 2R69A 2X1WL 2BCKB 1F00I 1P4IL 5EU3A 3P11H 4BFFA 5CP7A 1LEGA 2J5WA 3TBVA 4M7LT 5I1HL 5IG7A 4HDIA 3SCMD 3L2NA 3RVTC 4LPCA 4ZX6A 2DQMA 3O2VL 1BP3B 1PZUB 3ZN6A 5DD6A 2HYMA 2N0MA 3FQ2A 3ILEA 1AGDB 5K59E 2CLRB 2JI3A 1RFDL 2AABL 2C4FU 4X80H 3TA3C 1TSHA 3C8HA 3A47A 1HQRB 3F84A 2B1OA 3SY0A 3BDXA 3NSXA 2NXZC 3GTNA 3HR5B 3V0WL 2M26A 4Y19B 1SY6H 5AW0B 2XWCA 4H0HB 1IAOB 2FJGA 4MAYB 4YGVB 4ZOBA 2BVEA 3S4SG 4K5MA 5K9JL 4NENA 2CRIA 4UOW0 3WKMH 3D3VD 4Z3EA 1S7RB 2LLNA 5EU6B 2VLRE 2N56A 2PYED 3MV7D 1XCWA 4N25A 4ZO8A 4L1SA 5KVDE 1DDTA 1CLYH 2BIIA 4DEPB 4HLZH 2VXTH 2WV3A 4ODSL 4JCMA 1PG7W 2CA3A 2FLRT 1EBAA 2XI9A 1NOAA 2LTQB 1I4FB 3VFNA 4FQJL 4FG4A 4XHJD 1IFHH 3N42B 4MNQA 5CJQH 2ICWJ 3GMPA 1AS7A 1T7XA 3MRNA 4X8JA 5DI8B 2BNQA 4YR6A 4AI7A 5I1JH 5JPMC 3QRFM 3MACH 1ECZA 1MPAH 4TUJB 5I16B 4MA3A 4Q97A 1MFBL 1HCFX 4EI5A 1BGXH 1TZ8A 3N50A 1MF2L 4I5BA 1V7ML 4TNWK 4AY0A 1DQVA 4GAAA 4QXGH 2XTJD 4H13C 2W0FB 3CH8A 4XAKD 3PCYA 4RAUA 1BVKA 4GAYA 2Q6WA 1CDHA 5CZVH 2YMOA 5I1AB 4NZFA 3ZK0A 2R8SL 5HDLA 2HA1A 3MV11 4Y8AA 3BT0A 1ZLEA 3QIBD 4MDJB 4LU5H 1KSRA 2E8YA 4JZJC 4YGAB 4IIQB 5BZWB 2WZ6A 4NZUL 2APBA 1U91A 1LP9E 2AJZB 1D2OA 4IRZH 3DDGA 4C56D 1UD4A 4J3VA 4KJPD 2JI2A 3BSZL 1U8LA 3HG3A 2DKSA 3WNOA 2DL2A 1AI1L 1FNEB 4NKDB 1YECH 1CFSB 4X5WB 2B59B 3ES6A 4KI1A 2H47C 4YEFA 2UX7A 5D7EA 3EOAA 3RG1C 2B2XH 2WQXA 1IAIH 5LAXB 5KBDA 4QRSB 3UACA 3TURA 4JPWH 3MLWH 1PZSA 2EO9A 3U6RA 1M3IA 3FSVA 1A4CA 4G71B 1SBSH 2D0HA 1BFVL 2WVSA 4L23A 3L3OA 3TNMB 1EHKB 1QLFB 1MFMA 3NSCA 3V4VL 1IL1B 3OHXC 5GSRA 4CL7A 5JW3L 2CMRH 2Z7YA 2D7OA 3Q8CA 5MEOA 3PJSA 1ZTXL 1S8DA 5TE7H 3X14A 1KCRH 4KJQC 3VUAA 3OMIB 1R19A 2X2HA 4H2CA 3FJTA 2P3YA 3TCLB 4FQLH 3HR5A 3LAFA 5AOLA 4JRLA 2VC2L 3KMDA 3ZW3A 4W68A 5SX5K 4Y4FB 5D6DC 3GYRA 5C6WH 3EH4B 1CGSH 2JSFA 3SGEI 4KHTL 5C0RH 2XQ0A 4U1NB 3MOBH 4FI8A 1L3NA 4LGSB 5B1CA 3RY5A 3EHBC 3FCSA 3PABB 4X6CB 1TQBC 3MAWA 1QFOA 4NHCH 2APXA 1MFAL 2NQCA 3O6ML 3TH2T 2MIZA 2WXLA 4QF1B 1AQDB 2ZTBA 1JF6A 1YA5A 3EBHA 2C3XA 3IDNB 3V4VH 3VYNA 3RX7A 4YHKH 1CIUA 1IKNC 2WXMA 4CAGA 3N55A 1YEIH 2P46B 4NWUH 1ZTXE 3VRIB 3VW3H 2MHAB 1DVZA 2E8ZA 4AQAA 3NCCB 4BFJA 4MKMA 1VHPA 1U8NA 4IHOB 4N0UA 2IOIA 5H94B 4BSWB 3QFJA 1E3XA 2D3LA 1JG9A 2H7WA 2HJKA 2WUBH 4MXWH 3SGKC 3THMH 1RZJC 3K6DA 4KFMA 4K3GA 2HT2D 2AEPL 1LEKA 4BK5A 1FFTB 3CVHH 5SWQB 4QRRB 4FQ1L 2CNYA 3CG8A 1XH0A 3CDZB 3VXUA 1HS6A 3ZHFA 5JNYA 1X5ZA 4JGUA 4V1DA 5EPMA 3L2MA 1I1CA 3T9WA 2OQJA 3MSPA 3ZMEA 5CKGA 3ESMA 4D9RE 5KSBB 1ADQA 1KXTA 2XYBA 3N42F 1TPXB 1QG3A 2EDWA 3DHUA 1GGBL 1DJYA 1QR4A 3RWEA 1G6RL 2EDTA 3ZTCC 3EOBA 5F7AA 5BO0D 3MV9D 5IHZA 4LP5A 3TASA 4UIKH 1E2VA 3DVNB 5GGVL 1KGUA 5JW3H 3SBWA 2DD8L 3WFBL 4M6NL 1WAAF 4JLRA 4M3KB 4WFFE 2YMXL 4PJBE 5ECGA 4CMMB 3MLSL 1L7TL 1EZVX 2JJSA 1YN7B 4LL4A 2EIDA 3WIHL 4EMZA 4W9JC 3CDFA 4HKXA 4ZNEE 3KVDD 5E1AB 4ZT1A 3B5GA 4HZAA 5DA4A 5J0BA 5K9QI 3EF7A 3IJYB 5MEOB 2CDFA 1KZQA 4OCSL 4FQIL 5HGBA 1UJ3C 4OF6A 3TCLA 2BVPA 5C0FA 1TQBB 2J88L 1PNDA 4KNUA 5EIIB 2DQCH 1M6OA 3V5DB 3QYNA 1AS6A 1G9NC 3A67L 4DOHB 1CC3A 1EZVY 4N2AA 1UA6L 2NY0C 4EI0A 2SEBB 3ILPB 3S5ZA 1PJ9A 1L0XA 5EZIL 1MVYA 5SV4A 3L3OC 5I74C 4P5MA 3FB5A 1JNLH 3OKKB 4B60A 4DK6A 4DGUA 3MGTA 4Y16C 5GRYA 3DKHA 4Y19E 3OG6B 2LW3A 4JGJA 4QI3A 4PBDA 1QFUH 3JWDH 1MWAH 4QLRA 1Q1JH 4C56B 2EXYD 5CWSA 2H1PL 3FT9A 4OSUL 4QT5A 2CBTA 4BFGA 1JWSA 3OKOA 2HB0A 4M8RA 5J12C 1BECA 2F7IA 3KGTA 3TCXA 4WEBH 5DLML 3OPZH 3CFCH 4P23A 3PWPB 1KYAA 1C12B 2FIRT 5F1OB 3WLBA 1F58H 3HS0A 3BN9C 4YAQB 3RPBA 1QLRB 3A6CL 1ZY9A 2C9SA 2G9KA 1S9YA 3IDIB 2X4QA 1IX2A 2VJ0A 4G6KH 4H8UA 3WHXA 1M57B 4N9OB 4ES8A 1I7RA 2JCCA 3NT0A 3AITA 5ABAA 3LPGA 2WXQA 4N2HA 5I6XB 3QJOA 5F6HJ 3IFLL 1QBAA 1THAA 2N7SA 4HBCL 3RWDB 3VWKA 1A8ZA 2C8NA 1NIBA 4NCC2 5L2KD 3N9GH 2D7TH 1LEIB 1GW6A 5FYJU 4QYOB 4AUJA 5DHVB 1OOWA 1D5MB 3RY4A 3TA4D 5IT2L 1WWAX 4FJ6A 1PMYA 2XZCH 1SHMA 1DVSA 3GI9H 3LEVL 2W65A 1J5OH 2R56L 2OXGB 2H45A 5FUZL 5F3HB 3QZWG 5AW7B 3U4BL 2OTUB 3MX0B 2F8VA 3P2BA 5IVNA 3KHOA 5FKPA 1JHTB 4JVUA 4HXBH 4KROC 5J06A 1OW0A 4YSDA 4HH8A 5DK0B 2I5YH 3O6LL 3ISRA 4NN6C 1A9EB 4Y16B 1MWAA 2EH8H 4MD0A 5D7LD 3VFGL 3FUJA 3HG5A 3MR9B 3AUVA 4DESA 4EAEA 3HNVL 5DRZB 2AXJA 5CGMA 2O5XL 3QWRD 1YLBB 2IAMC 2J5LB 2VE6B 2WVVB 4U6TA 4M5TA 2WSDA 2JELH 2EDKA 4WNQA 5KSBE 3DIDA 4HKJB 1V3LA 2OMUB 3K4AA 4FNLH 4RFOL 1OEZW 4TMPA 1SN2A 5DRXB 2GW5A 1I9EA 2OX5A 4H4NA 5D7HA 5T1DH 5AVQB 1KFAH 3FUDA 2Z8VC 4IMKA 2ITDA 3VFRB 5IJVB 4LO9A 4TOYL 2OP4L 3VI3A 3U46B 1R3JA 4QRPB 5M94B 1AMYA 1U42A 2WYTA 2FZ3A 1I1RA 3MODL 3RVWC 1MFCH 5LG1A 4D9LH 4KK6D 2OSWA 5C0IA 3MXVL 1IC0A 1IILE 1U3HB 2BVOA 1NIFA 3IMWA 1T21A 3TVMC 2G60H 3HZKB 3N41B 2XWBA 4K94L 5BS0A 5MENA 1EAPA 1ZSDB 4Y4KD 5FB8B 1BAWA 5DFVD 1MW0A 1CGUA 1VIWA 4O2FA 2FEJA 2NX5D 2BHZA 2J12B 1J11A 3BDBA 5TQ0L 1A6ZA 4NWUL 2ED6A 5C09E 1AXSB 4HWNA 1IM3A 2X6CA 1SN0A 1K2DB 4BA8A 5HD8C 2YA2A 4NS0A 1MCSA 2V4LA 4R90L 3ARFC 4QLWA 2GJJA 3E8VA 3EGSB 3UBXB 4BWTA 2HLAB 2P43B 3DPBB 5AOZA 2ARJQ 4JFHE 1KJ2A 3TNMA 3PQYB 4YUEH 4WSKA 4PRPA 5CO1A 3S6CA 2NY1C 1P7QA 5DEGB 2OFQA 4HJTA 3FO2B 2AMUA 4GMTH 3QEGH 5DGQA 5F1KC 4A1RA 1WCBB 3HC2A 2XY1A 3ARDD 2PO6A 1S7SA 2C9UA 3BXNA 3X1FA 4NN6B 4AL8L 4OW6A 5HVHC 1TZOA 2D9CA 5EB9A 2NCEA 3E6HB 4DO4A 3FU7A 4DCQB 4O58H 5J13C 1KIRA 2WSPA 3KJ6L 4WI0B 2P26A 3J7HA 1H19A 3IJSB 1JYNA 3LH9A 4BWWA 2CK2A 5KJRH 2GK2A 1WFJA 3VMPA 3AREB 3NBNA 1CLOL 1KCRL 4PWKA 2AQNA 1HDMA 2JWYA 5JIIA 5MHSD 3D50A 2EO7A 5EBWA 3BO8A 3MLRL 2GVYA 3L17A 1JYXA 3TZVC 2HFGH 2G4EA 3KLDA 2EECA 3ZHDA 5BQ7B 1VJSA 4HGMA 4B9JA 1FUNA 2VXUL 2ADIB 2WXPA 3L5IA 4WSJA 5CEZL 1KPRA 1UM6L 2LABA 4Q6IC 4ISVB 1ACYL 4KUCD 4IIQA 2XXMB 4E41B 5ICYB 1IFHL 1EUUA 4GKNA 5HBBA 3FW6A 3NPZB 15C8H 2GSIB 1ZLWK 2QV2A 4F80A 4YEEA 1VKXB 3CZSA 1J5HA 2YO3A 3MBXL 4NKMB 3SDCA 5DUBB 3F12A 4XMTA 3GI9L 5HY9B 4UV4L 1G7HB 1R3IL 3FT2B 1A7RL 2DYSB 3I6SA 4WV1B 4AH2B 1UOKA 3ZQWA 6CGTA 3VX1A 3RIKA 2WXJA 2KZ1B 3DI2B 2Y23A 3OMZA 2W59A 3BI9X 3QE5A 4AEIH 3BUPA 1CD1B 1EUTA 1R3HB 3QUYB 5EORH 4U7SA 2KZKA 5FOJA 2FBOJ 2J6WA 3N0AA 4HX1A 4ZUUB 1QBMH 2CDEA 2L3BA 2NY1B 2VH5L 3MV7A 4JRFA 1BZOA 4OCRH 4FJYA 2AABH 4JB9H 5JHDB 1BGXL 1DQJA 1P6FA 4ZS6C 4Z95H 4XWGH 1Z0NA 4LSTL 3QNXA 5AEAA 4AYGA 3OMNB 3HMXH 2AJ3A 1BQHG 4P9HL 2CRYA 4M5YH 3IBOA 1LLAA 4FCAA 5IBTL 3BSZA 5F71A 5CEZD 1H5BC 1PGRB 1K3ZA 3CFEB 4JZOB 3BLPX 2QQLH 5CSZA 2XA8L 5FLUA 3MBWB 5DVPA 2A0LD 5AB2A 5CLXA 5CJ5A 5KJ4A 3G6AB 1AHWB 5JQ6L 4W9HC 1AGBA 1TMQA 1DUZA 4H44C 3UTPE 1XD0A 2D3JA 4OFYA 3VI4F 3ARWA 2ZPKL 1IB5A 2B8OT 1CDUA 2NTFA 3AACA 3EJJX 4WHDA 4C54A 1JZ5A 3W37A 4ZG1A 3SJVE 5KVEE 4O58L 1M71A 4I48B 5BVPH 3MUY1 3MLXH 3JTTA 1OZUA 4IKLA 1DE4A 3S37H 3GM0A 4TRPL 4GUQA 4OCXH 4FG0A 1HL5A 1KLFA 4XN2A 3VSUA 2GTQA 3EJRA 4GI9A 3RA7L 2A9DA 5ITBH 4BDVB 2GKIA 1KGXA 3JUYA 3PGFL 4IU3B 4XHJC 4JG9A 3E1F1 1N4XL 2FLMA 3H2PA 4MAUL 3UEZA 2Y69B 5IQ7L 3OHXB 4U1LB 1T04B 2G75B 4KXDA 1DTUA 1RI8A 2C7UA 3VXMD 1UM6H 2VQ1B 3PL6B 3FUFA 4JM2B 4PJAE 3R19A 2QVFB 3E6FA 1NBYB 1ZHBA 3T1WA 2OMYB 2FSDA 5C2BH 2PABA 4IJ3B 1UCBH 5ENWA 1MQKL 3PGDA 4RAVA 4P2AA 4UTAL 3ML8A 4UNVA 3HRZB 5HP5A 5DUBA 2QPUA 2TRHA 1NCTA 3R06B 4FKKA 2NZIA 5FECB 4YVNA 1I9JH 3EH2A 2AXFA 2B08A 2ICEB 3NZSA 3CZEA 4AM0Q 3DOSB 2AK4D 3RZCC 1E9PB 5GGSA 1EO8H 2LFEA 2IQ9H 4JZNB 4R26H 3U0WL 5HXMA 1AANA 4NPYA 1A7QH 1NEUA 3V6OA 2XPGB 1C16A 2Q1EA 1TO4A 3ARGA 3MRKB 3I50L 4M48L 4OFKA 4M6OL 3U36A 1RK0A 3QC6X 1TZHA 3FFCA 1G9NH 1NDTA 4YLBA 2ESVA 1QP1A 2ZCLH 2HLEB 4PJDF 1MY7A 3V52L 1DBBH 1BQLH 1PZAA 5CGYC 3SPGA 1N64H 4HJGB 1KENL 5DQ9B 3NCEB 1ND0A 3QIUB 5E6SB 2O5ZH 1NCHA 4MNGA 5HI3C 1N0LB 2KI6A 1URLA 4JFFE 4B41A 5HYEA 2NNAB 4X6CE 2ZJSH 1BXUA 1F6FB 1AXTH 4BRVA 2Q76A 1LK2B 2J3SA 4Q9QH 5JPNB 1U93B 1U8CB 2APVA 2VQTA 3HBZA 4DO5A 5ICZA 4UCFA 3WNIA 1MCBA 1O6VA 3MUZ1 4MXQC 5E1QA 1BAFH 1L9SA 3UG4A 2KC0A 2GY5A 4M7JH 4OM0L 5IB1B 5BXFA 4IHBA 4LNRB 1P7QD 4MSWB 4LSRH 4ODVL 1J1OH 4HKZB 4KZ0A 5EC2A 2DQHH 4KH2A 4UBDD 4M48H 2JKSA 1WJ3A 2QLVB 4RETB 4I3RL 1AFVL 3SBPA 3SQBA 2EDRA 3M7FB 1QVOB 3VDCA 1V3JA 2WBXA 3W5MA 1JZIA 2FQDA 3OV6A 4GUOA 2ADGA 1C12A 1YEGH 1ZA3B 2J73A 5EEUA 2ZWLT 1INEL 2OK0L 3QP3A 1EZLA 2R2CA 2H0FA 1OARH 3B7SA 4Y1AA 1SF5A 3VFVB 3WS3B 3JYCA 5HDRA 4EIZC 4PY8I 2QSVA 2Q8AH 3O2WH 4NNYB 2JXMB 4LLDA 2FSEA 2BNUA 2R7EB 3KYKL 3I2CH 1BV8A 2I69A 1QKZL 3QI9B 4UINL 1YQVL 1A4KB 3FT3B 1HOCB 3CD4A 4RX4A 1T89A 4NBYB 4QRFA 5AW4B 2XV2A 5IBUB 3QVAA 4KNQA 5EOQH 1BBDL 1RJLB 4ZJ9A 2PXYD 2R9HD 1LEKB 1UENA 1EXUB 5EF3A 4IIZA 1SXAA 2CZNA 3SYQA 4BE5A 2VB5A 3DSFH 3FOMB 3ZBMA 5D1ZA 4AC2A 4Q9CA 3LS4L 1SRDA 2GITA 1DANT 5DJYA 3UAJA 4OCYL 3VXUD 5I1KL 4JFED 5IOKA 2WUCH 4XXCC 1NGYA 3HUJF 1XQ4A 4NQDA 1AD9A 4N2KA 4O9HH 3ZDZE 1BEYH 1JWUA 4G7SB 5FHBL 2CIIB 3PPSA 3QFJD 3KW8A 2J8OA 4D7BA 4KTEL 4Y16D 4NBXB 4QRRD 4Z0BH 4YPGB 43C9A 3UBXG 5C0EB 1N5AB 3A67H 4JY5L 3ESVF 2J44A 4U1JB 5H37H 4FG6D 3LKPB 3MV9B 5C09D 3CC5B 3LNFA 1EJ8A 2DWEA 2OMTB 1QATA 1S78C 2EIJB 3SDXF 3AU0A 2BVTA 4C56E 4KKBD 2C9RA 5DJ6A 1XF5A 3GMMB 3L8QA 4EZMA 3RGBA 5ADPL 5SX4I 1EXGA 2F8XC 1AO7D 3PG2A 3QRGH 2H1PH 3B37A 4CKQA 4J3OC 2ZWKA 3QJTB 3US1A 2YEZA 5GGRA 1CFQA 1QNZL 1SYSA 4JR9L 3TWYA 3IAQA 3NQKA 1FA4A 2W80C 1XH3A 2R0KH 2XETA 1IIKA 1CTNA 4JJHA 1RHFA 4QTHB 5GSVB 3ZT5A 4LRIC 2Z4QA 3GSUB 3QI9C 1CT8A 4XT1C 3WTYA 1FGVH 4XPGH 5KYYB 1GYVA 4NQXA 4EJ1C 1PZ3A 2OL3L 1UD6A 4QRUA 3FQYA 2IAMA 4JK0D 1I85C 4IBZA 3FDWA 1RUKH 1AOZA 2AVGA 4X4XA 3A3YB 4LCYB 5GRWA 1N7MH 4GMTL 3KPSA 4X98B 3X12A 3FQRB 3UJTL 1EGJL 4KZDL 3ECUA 5FPIA 2VNCA 3RDTA 1AO7B 1U8LB 2WIMA 3NEOA 2BNRA 1YMMA 2CUAA 1VEPA 3QIWA 5GRXG 1OALA 4Q52A 3L45A 1QKZH 1T0NA 2XN9D 1G4MA 3QXUA 4QHUA 4H20L 3S5LA 5IQOA 3V4LA 2XVBA 3D51A 4Z7VE 2ZCHH 1OSZA 2C3WA 5F7LB 4KKBC 3S96A 1NCUA 1HWWA 3LNDA 3SJVD 3Q7JA 4MS6A 1IU1A 1HH9A 3UAAA 1A6TA 3FZUD 1CDBA 1CI3M 5CSZB 3X11A 3BFWA 5AVTB 1KGWA 4ZUTB 2Y06H 3U30B 1CGWA 1TOXA 4NB7A 5BZXA 1ICTA 2VDLB 4UNTA 3SODB 2EINB 1W6WA 1H8LA 5LB1A 4ZO9A 4B9FA 2R1WA 4E41A 2BIMA 3EYOA 2J1ZA 1T89C 3PDGA 3PS6A 2GCYB 5BRQA 2DDQH 1ZK9A 4N87A 3MUGB 4JHBA 4QXVA 5I24A 1KYUA 3G6DH 1HHKA 2EEDA 6PCYA 1AZRA 1J86A 1XEDA 2OCFD 4S2SA 5D1XE 5CU5A 2Z65C 4X6DA 1TETL 2PW1A 2WB7A 3SD2A 2YPVL 2G5BA 3RGVA 3RIFK 2MPVA 4Y9BA 3MREB 4PJCB 4NQQA 4TYUA 2Z8WC 2ZWSA 5D7SL 1R3KB 3DUHA 3LKNB 3AZUA 4R2GD 4LCWE 1MIML 5E7BA 5C0CE 3RKPA 4B9KC 5FYJD 2Q0ZX 3AM8C 4U3SA 5IJCC 2K45A 2W0KA 4M5ZH 5H2BA 1SQMA 3ABZA 5CXPA 2BFVH 3BZ4A 2CUIA 1BJ8A 2YBRA 1NDGA 3NGBC 3LN9A 1SEQH 2DLGA 3ZE0E 3QG7L 3FH8A 3A6BL 1JGUL 4P0DA 1JPFA 4QRRA 3AG3B 3KYNA 4Q74A 3U0TB 3VI4A 3ABKB 2RHEA 3DGDA 3H1ZA 1NPNA 4YDIH 2G60L 3QXWA 5LCVL 2AAAA 3VXSA 1UWFA 4LK4A 2PMZA 4UYPA 5F1IB 4PW9A 2FBJL 1WBXB 2A9ML 2WBJD 1M1XA 1YMHB 4ADJA 3ZY7A 1QRNA 2ZT9C 4Q6IA 1TTRA 4F7KA 2H41A 1A02N 5GHWL 3RURA 1MAMH 4FFYH 1OGAA 1VA9A 1I1AC 5LBGA 2YPVA 4EF3A 4K0OA 1M1SA 2X88A 4AYID 1HXMA 1W8NA 2PCPB 5IOPB 4GSXA 3DTXA 4X50A 1YAIA 1JK9B 5DJCB 3SDAD 1BG1A 1O7DC 5EH1A 2B0SL 3DVGA 5L4MA 4TVSa 2DQEL 2EEBA 2OMBA 4PS7A 2KS0A 2AC0A 2PTTB 1I8IA 1OK0A 3TC9A 4BQ8A 4GEIA 3K81A 3BAYA 1T22B 4FQHA 2QGEA 1G7IA 4M61A 1AYRA 4ZFFB 4JPWL 4XBPA 5KBPA 3CH1B 2QKIA 2YQGA 5HJDA 3WE1A 2DTSA 1W8EA 3IDJA 2NZ9D 3F58L 4I48A 4FTVA 4KRPB 4WV1C 5CKAA 2YPLD 1AJ7H 2J57A 2HJKB 5G2NA 1MLCB 5IVXE 4R8WL 1BXAA 3GGWB 5I9QC 1P5VA 3GI8H 3PYCA 2EC9T 2O26U 2WMPA 3DX0A 2J55A 4GBXC 2Y2WA 2CKNA 4W93A 1KYOJ 2AP2A 2XZAL 4TQ8A 3UZQB 5FHBH 1PZCA 2VAJA 3EJZD 5IB3A 1E4XH 4GQQA 3HJEA 1TZIA 1XMEB 4RFEB 1X4XA 1EGJA 2BZ7A 4FNSA 4BM7A 5BJTB 3FFDA 2CGZA 4NZDA 5DEZA 5I6PA 3T6VA 3RNKB 2E9WA 5CILL 1NCJA 3HS8A 3MREA 5IQ9B 2UWEB 3O8XD 1E5YA 4TL4A 4XNQB 3LQZB 2UWEF 4AK1A 4R4FH 4R5TA 5C0AB 2YPLB 3ARZA 3ALWA 4NO3A 2DYPA 1H3XA 2MQGA 5A6MA 3MLPA 3HZMA 3LYRA 1J9RA 5FDWA 1FYTD 3C2AH 2VLKD 3EIFA 4MQ7A 1FIGL 1JPFB 4PRIB 1T1YA 3H9SA 3MLYH 1D7BA 2FECL 3MLSH 3TN0B 5MI0B 1F0LA 1KLGB 2DH3A 3A4AA 3CIQA 4DKTA 1VKXA 4HEMA 3TA3B 3GSWB 3DMMD 3KH3A 3QJUB 3Q8AA 4J3XA 1FHNA 4JS7A 1JK8A 4P2YA 3ZTJG 5EIIA 2EEAA 5J6GB 1T4KA 5E8DH 2X4NA 2WXKA 5TE4H 3GRWH 3BLKA 1QWHA 3S3JA 3UTSB 3DV4A 2PWGA 1ZA6B 3MI6A 1RUAH 1WH0A 2EABA 2DMGA 5CIPB 1TCMA 3O6FA 3WLWC 1Q9LA 2SODB 2AQPA 3BD3A 3L3JA 3AQDA 4YR6B 5DI8A 5F0JB 2H26B 5FM4A 4GUPA 3QIWB 4IRSC 4GKZA 1S7XA 5FO9A 2APWA 5K1JA 5FUOL 1CDYA 4P4KC 3MRMB 3UTSE 1FLTX 3B9DA 1ZVYA 2F7PA 3RILA 4FNUA 4U6YB 4CC4C 4G8EB 3E8UH 4GH7B 2E46A 3KL5A 2P8PA 3O2VH 5IW6A 1I1YA 4Z0XA 3K4DA 4Y9CA 3T65A 1SMOA 5I76B 1D5BB 4NQVA 4WTXA 1URIA 3KXFD 1JK8B 2P44B 2BFVL 3VH8B 4HEPG 2VDRL 3BXNB 5GGQL 2ICEC 4UM9D 1LQBC 4KDVA 2YRLA 5A2LH 3HNSL 5EOCJ 4QHKI 5JIPA 4KKNA 4JFDB 3SE9L 5LN4A 2ZXDA 3FSAA 3K2MC 3QAZC 5C0BD 4PB9L 5CAYB 4OU3A 2O4EA 4G1EA 5J3HD 4YAQA 1P9MA 5I73B 5LXVA 4E9YA 2VUOA 2X40A 3QQ3B 5JOEA 4NQEB 2IEPA 1TETH 3P9LB 4ODWB 1CFQB 3D0LA 3GWJA 5D55A 4IIQC 3OZLA 5EBWB 2YGNA 4MB1A 5IJBC 3FUKA 1NWOA 4ZFOA 2VXSH 2F7OA 1BJ1H 4EUPG 5F88B 3O9WB 4A66A 2DQHL 3B2MA 2VLJE 3CFQA 3FU5A 4A6YA 3T6QC 4XVUC 3L9RA 3VCLA 1WYJA 3O3BA 3BAKA 2FQGA 3QUKA 3ZDYB 2QTEA 4JHWH 4HAFA 1JE6A 4RFOH 4XNQA 1RK1A 4NQTA 2EVJA 1JTPA 4OGXL 1SUHA 2ERJB 5FCUL 4ACTA 1XX9C 2JKNA 4JBSA 2HKAA 1G94A 5K93A 3MRIA 4M9OA 5AZUA 4C83A 4RMUA 1YEIL 1AGFA 5B7EA 3ARBB 1G1CA 2ZIDA 2WLNA 3LNGA 4NERA 4N85A 3QIWC 2PPAA 5BRZD 1HK6A 1DE4B 4XNYL 4GFXA 3VYOA 4RAVB 3RP1A 2XPYA 5KG9B 4LDEB 4DUXA 1M4KA 3IWVA 1IV8A 2V5SA 4JJ5B 5SWSE 2YN5A 1BQKA 1EGJH 4F8OA 5IR1B 4MX7B 4I9XA 1CVRA 4LLWB 3L3KB 3FKUS 3BZEB 5DRXA 3K0YA 3K2UL 4JPVL 4JANA 3ZE2B 5LBSA 2B77A 4ZMPA 3PREA 3CPLB 4JY6B 5T3XL 3JVGC 2PP9A 1UTDA 1ZVHA 3QI9A 4PH8A 3S88H 3LN5A 1ZIAA 4OZIE 2AJXH 3G08A 4QXUH 4WNQB 3MV8E 4WO4A 1DJSA 2CK0L 2BMKB 1T22A 2JK5A 4ABUA 7PAZA 1XF1A 4HCFA 2OZ4H 2X0WA 4LVNB 5KSVA 1ONQA 2EEXA 2K3TA 2WKGA 3HMXA 2F7RA 4L8DB 4GO6B 3JTTB 4HG4J 4J6RH 2Y5TA 2KHAA 1PNCA 5HHXL 5I73C 4AIEA 1JGEB 4HAKA 1DCLA 3BPCA 3LSOA 3UYOD 3S9DB 1PIGA 1PJWA 3AC0A 4X4YA 1GCFA 4OUUB 1SBSL 5ID0B 3LRLA 2IBGA 1T66D 5DHVA 2OMZB 3WN6A 3DO4A 2VN5A 2RD0A 4ZTOL 3MRLB 3T4AB 4OQTH 4OZGE 3U0PB 4IRJB 5C9JA 3B43A 4LCWB 4N28A 1VFOA 4UTAA 3FOMA 2YLHA 3F12B 2CDGA 3HG0A 3L1GA 5CD5D 4XMLH 5E2TH 5K59F 3MV01 1AP2A 3GXMA 4ZO6A 3Q2CA 4BKTC 3TONA 1E9QB 1H3GA 5JW5A 1YNTF 3V79C 4B0MM 3WEOA 1YO4A 5L4JA 2GTZB 2A9NL 5D7JC 1JL8A 1MHEB 1CDGA 4WEEA 1ZIBA 1MI5A 2JF1A 4PJIF 1S5HB 3B4NA 4YZFF 3DGGB 4H8PA 4Z7UF 3UADA 1G1KA 5B3JF 4K15A 2QFRA 1KBVA 3S5YA 1WRFA 4FP8H 3PP3H 2X3CA 2O30A 3Q9QA 2X1QA 1OP3H 5IHLB 4W9DC 2P80A 3W2DL 4E9RA 5H35A 1E43A 4PCYA 1G1YA 3CXFA 4TULL 1CTMA 1JMXA 5I75C 3P69A 4RISL 2WXRA 3U4AA 3P3RA 2MWCA 4S2SB 4WI0A 4GQ9L 2EE2A 4OJEH 4IS6B 3K2IA 5IGXH 3UTSA 3V0JA 3FSOA 3B83A 2Z31C 3FB5B 4N26A 4YS4A 1BLNA 4W9CC 5CEZH 2XN9E 1S8DB 2ADFH 1IGYB 2DOCA 3KR3L 3OWRA 4X7TB 1I3RB 2QQQA 3EGDB 2HFGL 4OKVA 5FYLE 4OCRL 3Q06A 2NXYB 4XNZC 4NGHH 8FABB 3F64A 2Z4QB 2VIRA 1I8KB 2IANE 4V2CB 4XX1G 4LSVH 1RMFH 3ZTNH 4JREB 5A6LA 4HUXA 1IC1A 2E86A 3GB7B 1AR1C 1QLEL 4BZ1L 3GD1C 4FQXC 4TUJA 4NO0A 2R4RL 4S1SL 3LKRB 1N8ZA 4XC1H 2K8QA 4WHTB 5ISZA 1N12A 1XGQA 3DX9B 3T4AC 2XRAL 5HSFA 3EYSL 3V95A 4ATTA 1UM5H 4AXWA 4Y2DA 5I1EL 2EDQA 3K6NA 4DK3A 3DHJA 5D1XC 4F7TA 2H1XA 3AFLA 3BWSA 5EMYA 3H7BB 4JFOB 1KMGA 3LNEA 4X80L 5E1AA 1SHSA 5L88L 4I8DA 2E5EA 2C7UB 5I26A 4OCSH 1Y6MR 1KGCE 3FN3A 4HIIB 5IQ9A 2D4DA 4YSEA 1J8HA 2X4UA 1LO0H 5BUPA 3GSXA 1F4YH 4ZAKD 3FQNB 1O6TA 3B9AA 2IAAC 3L5JA 4X9FA 2WYZA 3TP4A 3GK8H 3BPLC 4POUB 5E56A 5I18L 1DQLH 1OY3B 1UOVA 4ALAL 4RVBA 5I8EB 1TQVA 4L4JA 5E6UB 1FF5A 4YVUA 5FGCB 5D96B 4PGEA 2YEZB 3MJ7A 4KVCL 3FTVA 4AG4H 2KPNA 1G9MC 2C3VA 4N0YL 3VGAC 2PKDA 4WWKA 4XVTH 3IGFA 1MDTA 1NC2B 1UWEL 4OFIA 4X6FA 2DWEB 1HQRA 3TPKA 2EDXA 1GHFH 3DVIA 1BLIA 1DVQA 5EULV 1A9EA 3HG2A 4K9JA 1QLEB 3P4LA 4FL4B 3ARBA 1P53A 3IMTA 5IY5B 4D94A 1L3WA 3ZKXB 1KC5L 1N6UA 1XB6A 3GSXB 3KPPB 3OAUL 4LLMA 3UCRA 4LSUH 2Y07H 3T8XA 4PJ8D 2F54B 2Z93B 4FQLL 4FMKA 3T5WA 1OP5H 5D93B 4AOFA 4KKCC 1NMAH 2ED8A 3QDMB 4O00A 5KYXB 3D34A 2Y36H 1GY2A 4NNYA 4XNYH 4YDLB 1H8NA 4QJ4B 1HEZA 4JRWA 4PM1A 1ZMYA 3L81A 1OSPL 1S6NA 5TD4A 1AZUA 3IKCA 3SPJA 1R0AH 3KG5A 1OGAE 5EHFA 3OF6D 2A6KB 1A3LL 3MKGA 1KNOA 4X9YA 1QW8A 1RZ7L 4XC3H 4V1DE 4YFLF 5DHEA 1X5IA 1K9TA 4QRPD 2XWJA 2C3GA 2EUZA 1EXUA 4EVNB 4DFHA 3ZPDA 5C08E 4XOAA 5EO0A 4U6XA 1MCCA 3M86A 1JOIA 2NY6D 3Q48A 3QNXB 2CLVA 1B0GA 4AGLA 5CM1A 3B9KA 4WUUD 1IKFL 4WU5A 1A7QL 3W9DA 4XI5D 4OLWH 4BFNA 1EO8L 4XCEA 5EUKB 4EI6B 2B1HH 2YD8A 4H88L 4Y8DC 3VFVA 1CFTB 4UWQB 2FHCA 3HB3B 1JPGA 3D07A 1RD6A 1IEHA 1JWSB 5D96C 3GRWL 1I1AD 2ZYSA 1PKQA 5GZND 5B39G 4MNHA 2V8LA 2J56A 2VMFA 1PVHA 3WKNA 1K4CA 4NJ9L 2F15A 1YNTA 4P23B 4IBWA 1DJIA 5DS8A 1ND0B 2NY5C 1OPGL 2O5XH 5HJBA 1Z32X 1H8SA 4YC2C 5HDOA 5C0CB 1LNUB 3BIKB 3RI5K 4HUVA 3II1A 5I1GH 1PX4A 3S3BB 2MCMA 3FFOA 2WKOA 2RQ8A 1P6AB 5DUMH 4F57L 2HAZA 4G8AC 1X5HA 3PDOA 1TJHH 1JUFA 2WIIB 4IJTA 4OF5A 3ZZLA 2GTZA 5I9QB 3NJIA 1TQWA 4N24A 4G5AA 1DFBL 3UJIH 3FAWA 4XOBA 3LIZL 5DF0A 5KYYA 4FTVE 3OR6A 2ZXWB 1OSZB 2ITFA 4JDEA 4P2QA 2GAZA 3UZQA 3FCTB 2PPEA 1PD1A 4XCYA 2ZCKH 3RUGF 3ZUCA 3ARDC 3IN2A 4OZFA 2JI1A 5FUOH 1NAMB 4B9PA 1RJCA 4LCCA 4OB5L 3U82B 1XH3B 1J8HE 4O2EB 4JL1A 3LZNA 4ODUA 3APFA 4XP9H 1GKOA 2Y1AA 5HVHB 2HG5A 3H3KA 1UZ6E 4JM2A 4JPIA 6PAZA 4G3YL 2G0LA 2XFXA 5I1KH 2WGNB 2XV6B 4FERA 4I13B 5CGYD 2B39A 3MRFB 1KCUH 4PGZA 4W9EC 4X4XB 1FE8L 1CDCA 3HMWH 1J9SA 5F93C 3IPBA 3PFUA 4NQSB 4FXGB 4GKOA 4WWID 5HYSB 3L4YA 4FLRA 1WFTA 2QMJA 4J5VA 1FFPA 4Y4KC 2X0VA 2XQYK 3ROLA 2CRMA 4KTDH 5JXAL 3OSVA 1DQQB 4Y5YA 1A0QL 3CLFH 3WTXA 3DIFB 4DK5A 2PP8A 5FO7A 4Z3GA 3GSRA 4LRIA 2DWTA 1RUQL 1RIVH 2IBBA 4ELKA 5K69A 3I6GB 4HKBB 4NSKB 5D72L 1D6EB 4LCIH 2ESVE 2YMXH 1BZDA 1EEYA 4JO4L 4DKEL 3BE1L 5I5JA 1AS8A 1PY9A 5KYUA 1MOEA 5EF1A 5IEKA 5F7EH 2DLFH 4JE4B 1AG0A 3HZVA 4Z77A 1Q0YH 3APDA 3OKEA 5BVJA 2VDPB 1NCCL 4M9PA 3UO1H 2EIZA 4F5CA 5ANMB 1G7IB 4M61B 1FZMA 1RZ8B 4TVPD 1FN4A 3BFQG 1UOWA 4U6VH 4D7PA 1NH6A 4QD2E 5D4IA 3BZ4B 5ETUB 1EVTC 3HJ0A 2UWEE 2IGTA 1ASQA 1U8MB 1S9VB 4W6XB 1BQRA 1DFBH 4QKTA 1F6AB 5E03A 3D3VB 4PVBA 4XC3L 3RQ3A 5L0QB 2HUEA 2CIIA 1A3LH 1WWCA 2NY2D 2VL5A 3Q1SH 4ZFOB 3O6FC 4LVHB 3ZXAC 4HWUA 3UZVB 1J0IA 2BOBA 5C71A 3LRSA 1U8JB 1G7HA 3GHPA 4GQRA 3OMAB 3MJWA 4BFRA 3MRCA 5D2NB 3ULUH 4JFSA 4OD1L 5HHXH 1F1AA 1MRFL 1FYTB 4PLOB 2BERA 2K9UA 3U7WH 3WYRA 3KWVA 2V9TA 5IG7B 4Q8BA 4U3HA 1NANI 5F89A 2WO4A 2WP3O 3UXFA 4KTYA 2AQRA 4KZEL 1NUGA 3KJ6H 3RFZC 1J9CT 2FSEB 2BZCA 3ZDXE 3BP6A 4XMPL 2LV4A 4R7XA 1EHNA 1I8LA 4MMXC 3F7QA 5KS9A 5L4IA 1K3IA 4D0BB 3MVSA 4NO5B 1XGZA 4HUMB 1T0MB 4TQEH 4PRIA 1W91A 3SIKA 3MRMA 4JM2D 3FH7A 2WQWA 3G5XA 3HHSA 4JDTH 1YHPA 3QORD 3TV8A 4WKZA 3HB3D 4MJ2A 3SKOA 2WWKT 3K46A 5FC9A 3SDYL 1ZDSA 3N41F 5D1QC 1KG0A 4QY8B 1D9KB 1U8QB 3DV6B 3OKOB 2JIXD 2VDNB 4XNDA 2FUQA 4XAWL 3PLYA 3PL6C 4LSDA 4JRXB 4CBZA 4RFNB 3L3JB 3RJDA 4DPBX 1N19A 3BSGA 1OGTA 3BPNC 4WU5B 4PJ5A 1NGQH 2BRRH 3ABGA 4QNPF 3VAEA 4UB0L 5KS9F 2BK8A 3R7RA 4ZD3H 1NM4A 2LE9A 1TZIB 3ZGIA 4GAYB 1YYML 4ZI8A 4AWJC 2D7NA 3ROOB 4JHWL 3W11C 3CZJA 1T2QH 3GJFH 4MDJA 5H8DA 3U4BH 5BV7H 4EI5B 5C0BB 1IGYA 3RWIB 3IVKB 1RIHL 3NZHH 4RSVA 4TRPH 4MJHA 4OGAD 2DDQL 2OS7A 4MA8L 3E38A 3H9YA 5E1GA 1IM9B 2LU4A 4NQED 5EN3A 4Z3JA 2ZKHL 4P2OD 5EO1A 1OM3L 4M93B 4F7MA 1UD2A 3LZFH 3N9GL 3QFDA 4KKAC 4LEOA 4FNLL 2FWOB 4L8CA 3BMVA 4X4YB 3G5ZB 3H3BC 4Y7MA 5FA4B 5JXEA 4HS6B 1B4RA 2GUYA 1QTSA 2ZQKA 3ZTNL 3B8YA 1N5YH 1QA9B 5B22A 4MHHI 1F3JB 2B4CL 1DN2A 3ULUL 4PRHB 5LUMA 5IKCA 1A1NB 1PDKB 2BIOA 4L0YA 1RPQA 3CNKA 5CR8A 3DPDA 1GS7A 3S34H 5D2LA 1G87A 2X89D 3WEXB 5HI4D 3NEXA 1QPPA 2VDOB 1BOYA 3NCFB 2EE9A 2YD4A 1NMCB 1MXDA 3V4VA 1J05B 1HL8A 5G4OA 3MCLL 3GSWA 3WL9B 2DM3A 1QSED 1F18A 1NFDE 3K1KC 4HCGA 2A74B 1ZLVH 2GIXA 3SKNA 4KK8C 3UYRL 3VSVA 1E4KA 2RA1A 3EO9H 2HUHA 2XJLA 3JV0A 3PAYA 5B8CB 1KYDA 2AEIT 2VSCA 4KGLA 4GAGH 2QHRL 2KKQA 2OULB 4KJPC 3VXRE 1TVDA 5L4FA 3O41A 1GA2A 3N43F 4RMSA 3QPKA 2HKFL 3FU3A 4K07A 3F7KA 4NGHL 5GZOD 2XWBB 4YE4L 5GGRY 1BD2D 4N5ED 3W0WE 1HKFA 4NX0A 1GGYA 1M9SA 2K9FB 4K71B 2ATPB 3TEZA 4F2EA 3F7RA 2PPCA 4MYPA 1NKGA 1MCJA 2X12A 2PCXA 3PABA 2UYLB 2OTUA 3MX0A 4J3UA 4QHPA 4WW2F 1O9WA 3T71A 4PUBH 1IT9H 2W9DL 2NY7L 4R5VA 4FQJH 1T1XB 2ZAIA 4N0UB 5H94A 2DQUH 2YSTA 5A16A 3CVIH 3WDJA 3WEBA 1OOAA 1OIOA 4HS8H 1ZT7A 5I5RA 4Z0BL 4CSZA 4OV5B 2HXAA 3OR6B 2JB5H 2LVCA 5DA0B 1P2CB 1QSFA 4L4TD 1ORQB 1G7QA 5D7JD 5B38A 1JFQH 4S1DC 2KL6A 3LZFL 1ESOA 1F6AA 4NWTL 5I15L 3C60D 5SWZE 1YEGL 6TAAA 2MKLC 4UBDC 5K9OA 5EZIH 4EZJA 2C4XA 2WKOF 4CNIA 2LLGA 1II4E 3TL5A 5DHYA 5G5DA 2BNUB 2BS9A 2R7EA 1J8HB 2CPCA 2ZUQC 2AQTA 2DWSA 3FTUA 2I9TB 1XGPB 3JV5A 1FFRA 1HZKA 1E4WH 5J89A 2ENQA 2YK1H 4P5RA 4WI3A 3KCPB 4PJDB 3MOAL 1W0WB 1RZKC 2XXCB 1Q1PA 3SE3A 1FBIL 2ZOKA 2V2WA 1MELA 2Y1YA 3H9HB 2YRBA 3BQUD 4KXZI 4EPSA 2JV6A 2PWFA 1QRNB 4FXKA 4UOW1 4ZX5A 1TVHA 2WLLA 2BXZA 1CDIA 5JO5B 4EN3D 5F1NA 4A7GF 2OJEA 1PLAA 3KPOA 5ALBH 4MZRA 1LDPL 1OF0A 3KYMA 1LD9A 2EH7L 1A1OB 4E9XA 2IOMA 1ZLDA 4LAQH 1I8KA 4J12A 5KBNC 1JPSH 1Z9LA 2NY6B 1WTGT 4G9FD 3LKQB 4BK4A 4UM9A 4TQPA 1BM7A 3VXOB 3A4EA 5E8NA 3IFNH 4QXTA 5IVXF 4DWHA 4N2NA 1U8KA 4F7EB 1ZD6A 2ZKHH 3GHEL 3HAEA 3P30L 4XVJH 2V2XB 4F3FA 4E9WA 3B2PA 2ITEA 4GS7C 2BVPB 4ZSOA 4M3JA 1NAKH 1SFHA 2DQFA 4ELMA 3BIKA 3PY9A 5CIPH 4LDLB 5HJGA 1T3FA 4OH2A 5AKTA 3VFNB 2WNGA 3TNNA 2WO2B 3GEFA 4FNPA 4Z3TA 3DI3B 4L8BB 3MKKA 3O3EB 3VB8A 2V17L 4FXKC 2EEFA 2NW3B 4X8JB 2IGFL 1GC1C 3WN5A 2Z91A 3S8GB 2DZEA 1A4AA 5C0JA 3SDCD 3QHFL 2R2HA 3C60A 4BKSC 1Q9OB 2Y7SA 3ZOAA 4LCCB 4L1DA 3TU6A 1VAHA 1BVKB 4UQEA 3FRPA 2G3XA 1VEMA 4UNUA 2MQ0A 3IRPX 3AGVA 4P49A 3MPCA 5FW6A 4LPWA 2Z35B 3QUMH 3RVTD 4MAUH 4GPVA 4X7CC 4XWOD 2IQAA 2ZWNA 5FYLL 1AP2B 2WCSA 3W9DB 2IH3A 1HE7A 2DRUA 1AOHA 3QCTH 1OGPA 3ZTDC 1N7ML 5C0CA 4R4BA 1CF8L 1BVLB 2FEEL 3ILDA 5GGUB 3EOTH 4ZQKA 5GZNC 1RUKL 5E6YA 4QAWA 4PFEA 2OL3H 4KITB 5T1DL 3F85A 2WQUA 1Y6KR 1FNSH 1Z0MA 2D7QA 3CU7A 3MRNB 2W95A 1N5AA 3N85L 2BNRB 2H0JA 5DD6B 4W4OA 5CCJA 4J4PA 2MHAA 3D2UA 1KLUB 1EERB 5KYNA 3BQVA 2G5UA 2M1KA 2WNKA 1G7JB 3VNZA 4FGMA 2F54E 5E95B 3W9EA 5HHQA 4YDMA 3RWFA 4UTAH 3CDGB 2WTRB 3ZDYE 4BH7B 3GS0A 5AVYB 3NABH 1YQ2A 2A6DA 3PV6B 3SGDH 1NJ9A 2NY3B 2YGPA 3V8OA 4FULA 3O9WA 4GS7B 1JF1A 1ZS8B 2J71A 3MNVA 4OQ1A 1JPTH 2CO6B 4PUBL 3BKYL 4L3EA 4WI2A 1RUML 2VLKE 2GQHA 2FIKA 4ZXBC 3SOBL 1OB1B 5DK3A 3PGFH 1QR1A 1M53A 3HC4L 2YRZA 1I8AA 4NFDA 3SBRA 3G6JB 1KUMA 4HXAL 1NBVL 5SV3A 3U9WA 4DN4H 3E3QC 4JJ5A 4YZFE 1DQIA 3VXNB 1JDCA 1JZJA 2OV0A 3LRHA 3GMLB 3GXUB 3B1UA 2OMVA 4YDKH 1GMIA 1RHHA 3BUYB 2V5MA 2QPSA 2K7QA 3BWAB 1N0XH 4JQIH 1TG8A 1OTUC 1Q72L 4LEEA 3SDAB 4RZCA 1W0VA 2IH8A 1ZT1A 3CQPA 3X14B 1PYWA 1NAML 5CP3A 1BXXA 1QO3A 3Q5OA 4LEXL 1HSBB 4KDWA 1KYOK 3CZUB 3L3HB 4L0ZA 5I8CB 2A6DB 3TPUB 3ZO0A 4G6JH 1HSAB 4QRRE 1T1WA 5KSAB 4HWZA 2RH0A 4BH8A 2UZXB 3V9FA 3OJDA 4QXGL 1NLBL 1WE5A 1WVZA 3MJ9H 4DPRA 1E4JA 1U3HC 4LCUA 4N2FA 1IT9L 1JWUB 3W38A 3NSJA 5E6ID 1C9SA 3NP4A 4ELME 4ZTOH 3CMOH 3CHRA 4WWNA 4HLZG 5DT1H 4NFBA 5B1KA 5BPPA 4B7IA 1U93A 4X6DE 4P3CH 4XCYB 1JRHI 2GYSA 2NY5L 5CZRA 1SJEB 5J9PA 2OI9C 4W6YB 4BHUA 2PO6B 2B7DT 4OKVB 5BO1L 3QDGA 3UYPA 2X9XA 4UANA 5DD5H 1J88A 1KJMB 1QQDA 1VZGA 4TQIA 4FHKA 5AWNL 3RL2A 1A2YB 5IFAH 1DSFL 3B7UX 3PQYA 5BUAA 1JZ4A 4MKTA 4ZMTA 1W72B 4WENB 4U1HA 3PWPE 1N59B 3AREA 5JHBA 2XC8A 4LCUB 4K5NA 4BKLB 1GC1H 2WVTA 4JRXD 4JO3H 5EDXA 1XB8A 1AKJD 2MH4A 4Y2DB 3ORJA 4XBMA 4G8FB 5EC1B 3FU7B 3H42H 4AQ1B 4DCQA 1UGNA 1IM9A 3V6OC 4QOKB 3M1CA 1Q0XH 5CINL 1BAFL 5A2FA 1F3DJ 1TZHB 4O2EA 2GC4C 3I02A 1EPFA 1K4CB 1YYLL 3FK3A 1INQB 5T1KD 4QXTB 2OYLA 4D0BA 3QO0A 5AG8A 1SOKA 1M6OB 3D33A 1M7DA 3H9SD 4BEIA 2BVQB 1FFOA 1B0GB 1WFIA 3MU3A 4FNQA 5J6SA 3QQ4A 1U3JA 1ZJBA 4ZMOA 1HYSD 5KSBA 1KTJA 1QSFE 3PWNA 3ATDA 4Z7QF 4ZMQA 4M1GH 2TSAA 2XWJB 4HMDA 3P3YA 4YJZL 5EZOL 3BX7C 3VMOA 3CXHJ 3D4CA 2H5UA 1RHHB 1OPOA 3RZWA 3BC9A 1I75A 2UUDK 5EO0B 4NM8L 1U8CA 4KGJA 4UQBA 4YDJB 4WRLA 3T2LA 1XTLA 4P59L 5EIIG 4HUUA 4NHUA 3V0VA 2BSRA 1A6VL 1MCDA 3RVVC 3OF6A 3PXLA 5EWIH 5D1QB 3GBEA 4HWZB 5ESVA 5DSCA 5EOCH 4OY9A 3OHXA 4FXLA 1D9KC 2BP3A 2DQIL 4IU2A 2NDFA 4K5OA 2OI9B 1YYMH 4KXAA 1IGJB 4F58L 1X6NA 3HC0B 3QUZB 3FMGL 5TDPB 2NNXA 4NZTL 2H4EA 2Z7WA 4FF9A 5ANMA 1TLMA 5I18H 4Q9BA 3MNWB 1L4IA 3B1TA 1H6FA 3A21A 1Z1WA 3G6AA 5I0VA 4HF5L 4TUOB 1QWUA 1GR7A 5CEYB 1F4YL 3VXUB 4QPEA 3ET9F 2DY2A 2QQKH 2Q3XA 4F8LA 4XB8A 5E0FA 3RWCB 5IMLB 4EO5A 4W9ZA 3DJSA 4YX2H 5AVRB 3Q01A 4PTUB 1C1EH 1VF5C 5A16B 3W81A 3A23A 1BX2B 2IV9A 3PAZA 3Q6GL 1M7IB 4I18B 4ZODA 2WC7A 4M00A 4RWYH 4FEMA 5B3JE 1C7TA 3C08L 4QTFA 2HVBA 3T0VA 1CBVH 2RALA 3WFCL 4HFUL 3CN0A 2RIKA 4PRHA 3R1GH 1XR8B 3NCJH 3PXJA 5TTRA 2R0KL 3SBQA 2VDNL 4F91B 4XP1L 3WY2A 2MOQA 1KT2A 1Z5LB 2W94A 1HXYB 3EAKA 4LBEA 3DX8B 4XCCH 1Q94B 2EXYC 3L7EB 5GGQH 1J8SA 5JOFB 3FTSA 4K8RD 2D7MA 1NMCC 3MLTA 3QNFA 1YNLH 2XVKA 1EEQA 3AQYA 4HQQL 1LVEA 1L9MA 3LV3B 5HYJB 1B4JL 4UAHA 2GI7A 4W9LC 3C5JA 1KBKA 3O3DB 2E9IA 2EDFA 4NBZB 3N1QC 4K5PA 4XE0A 4JFEE 3A5VA 3O4LA 4H1LG 1FC1A 1NAMA 7PCYA 5IEHB 4Y2OB 4QKXB 3QNZA 1MCPH 2GHWB 4M8VA 5DO8A 5F21B 5B8CC 1M7XA 1HNGA 4PJAA 1RZKH 5JHLA 4Z7QB 4I4WA 4RWHA 3WNPA 1ASOA 1HHJB 3CN3A 1MLBB 1SXSA 4WWOA 5ALCL 3PJSB 3SDDD 3BP5A 4RA3A 4FQQA 1OE3A 2BP8A 1E5AA 3KPOB 4JCWA 4K4KA 4XNAA 5IT2H 2P8LB 1E5BA 1KELL 4P8QA 3JWOL 3IM1A 4LEXH 4GY4A 4Q2ZB 5MEPB 4AM0A 5DU7A 3W56A 1UC6A 4QMEA 1ZE3C 1NCBL 1L0YA 4MWFA 2RFXB 3P0YH 3EFFA 3SHSA 5FA4A 1QPXA 4K71C 3CBKB 3IMRA 5JO5A 1TTCA 5T5FH 3ULUD 4U6YA 1EHAA 5KZCD 1KTCA 5DC0A 2EDEA 3KWWA 3BZ5A 2BVUA 4HS8L 3MCYA 1EV2E 4UT7H 5AOMA 1JV2B 3RUGB 4AE0A 3BPOB 4G6KL 3MUUA 3VFMA 5DS8B 1NCIA 2AI0L 2VLJA 4FQ2H 3T4YA 4LHJB 4YE0A 4PJFA 5IM7B 5K9OB 4P46D 4OQTL 3HZKA 1TJHL 12E8H 3KBEA 3D1MC 3TBYA 1ES0A 1MI5D 4M1DL 3CFBA 1KCBA 1TR7A 3VFTB 5JUEH 2JCCF 4LNRA 4IBUA 5I16A 2XYCA 3DK0A 1CLYL 3CX2A 4P05A 3SGKA 4L5FE 3ZL4L 2BHUA 5DZNA 1UVQB 4QUOA 2ZKXA 2VAAB 3MRDA 4F33A 3CFIC 5FDWB 2QMKA 4YK4B 5BW7A 3ATBA 4FLHA 4XP9L 2GIMA 3LS4H 1T80A 1X5LA 1TLKA 4Y7OC 3GI8L 5DHVH 1X5JA 5I0YA 3SPIA 4I9WD 4A2HA 8CGTA 5EZLA 3ZT7A 5CJOH 3ALPA 2ESVD 4MNQE 4DW2L 5HHOE 2A9BA 3QO1B 3SKUD 2F0CA 5JORA 1WF5A 2JKIS 5CIPA 1Z9SA 3AG2B 5E6RB 4A7VA 2VKWA 1P84J 1IFGA 5JW4M 2YQBA 4S0SD 1RK7A 5ILTH 4EE2A 1NICA 1U8MA 2XPGA 5IMOA 3UPCA 2X41A 5ADOH 3NSFA 1MVUB 1UWXH 1VGEH 1GTFA 5D6DA 4BGDA 1EEUA 5LWYL 3LB6C 3BP7B 4OLXH 4XNBA 3D0VB 1A7NL 2B0SH 5D5MB 1TZGH 1MFDH 3A22A 5E99H 4ENED 1MFAH 3O6MH 2VABB 2VDNH 2DYRB 1NFDF 2VDKL 5KAQF 4LHUD 3WE6A 2O1AA 2GJPA 4LSPH 4JDVA 4WY7L 1WSST 2ATPA 3OAUH 4A7TA 2YZ1A 3WS6A 1W72H 2AF2A 3WSQH 4ZMLA 3VXMA 3MJ8B 2XICA 4Q6KA 4CU7A 4U33A 3RDJA 3Q2VA 3QO1A 1XCQB 2DKMA 4L8DA 4NN7B 2OXGA 4MQXC 2LTQC 3ABLB 4LSRL 4ODVH 4Z7NB 2AEPH 5L8KB 1AO7E 1TTBA 1Q9KA 3NTCH 4NQCA 4U1JA 3MV8A 3SGJA 1HIML 3EYVB 4TTGA 5JIHA 3PGCB 4DVBA 4L4TA 3VFUB 5EO9B 4IRZA 4WTZA 2EVIA 3EJSA 2MSPA 1W8OA 4OVUA 3GXDA 4XGZB 3ZE0B 2CJSA 1SDAB 4X6DF 1R0AL 1FN4B 2PXYA 1UXMA 1ZA3A 3GZPA 6FABH 3WNJA 4ILDA 1TKWB 5FGBC 2ILLA 3UOAB 5IK3B 1QEWB 5F9WC 3V7AE 3FXIC 3ZHNA 1AC0A 4P5SA 2W07B 4KO9A 3SPVB 3LKOB 1MCEA 4NP4L 2X4QB 4TSCH 2NZ9C 3EFDL 2P5EB 5ID1B 4DF9A 5TPWL 2Y07L 4P2QE 5ABDE 4AGQA 1JZFA 2C4FT 2VN4A 4I7ZC 3X2QB 4D9LL 1NL0H 5J1AA 1MCFA 2C1OB 1UXSA 4QIRA 7TAAA 5DFAA 2E59A 2EKJA 5EEXA 5IQMA 1A3QA 1GOGA 1X3DA 1J8KA 4E5XA 2NLJA 1ACZA 3LCYA 4HWBL 3W3BA 3GRGA 3HLKA 2YHGA 4L8BA 3NIDE 2IWGA 3MLZH 4PJCE 1RPKA 4YL9A 3NCMA 4P3WA 3A0OA 4AYMC 2BHFA 5HDBB 1JTOA 4MB4A 1FSKB 3IDGB 4PBVC 4H8VA 1CQYA 1E27A 2NY2C 3P3SA 4HS6A 4NUMA 1MIEH 1WAAE 3HAEB 4PRHE 4ZXBB 5LWYH 1P0SE 1T0MA 4HU2A 1BVNT 4DKAA 4DTGL 4M1DH 3QDGB 3V4PB 2MFNA 2NUPA 5J11C 12E8L 4MJ5A 1E90A 4BK8A 4NLHA 5ACLA 4PHXA 3FF8A 1DQDL 2W92A 1T5WB 3QWOB 1YDPA 1DBAL 3GMNB 4HISA 3WGVB 1GTNA 1AZBA 4ZFZA 2QKSA 3WIIH 2EYSA 4YXKL 4XN7A 1AI1H 3A6OA 3MJ9L 3UDWA 7FABL 1I7RB 2JCCB 1LYQA 3ZKMD 3MRGA 3L16A 3F5WB 4R7DB 4HT1H 1MHHB 1IAIM 5BVPL 4Z7VB 4PG9A 2CO7B 3MRLA 3T4AA 3QG6B 3CGTA 1C8QA 3U30C 5JHDE 2OW6A 1RIUH 4NXSA 3F6JA 1XD1A 2CDGB 2WUCL 1A14H 2E7HA 4HIEA 2OJZH 4JO2H 5F8QC 4KUCF 3TV3H 3UTOA 2QGCA 5TK4A 1XGUB 3SN6N 1HEHC 2CA4A 5IB5B 4NRXB 2VJXA 3KPQA 1NPJA 1PZBA 2DM7A 4YHYB 4NEHB 3WD5H 4M1CC 4P06A 3AY4A 3E7JA 4M4RA 3EH1A 3SYPA 2AEQH 2C9VA 4PREB 2GEEA 4AV5A 1DBAH 3M46A 4GXVH 3NZ8A 4HJEA 3B6SA 5J8OA 2DB8A 5LCVA 1C5BH 1Z9PA 2YZ8A 1Y1UA 3ZE2F 1DCEA 2CLVB 1UA3A 4WDIB 4HV8A 4OSUH 2C3VB 3TLRA 5CZXD 3G5WA 4JY4A 5IB3B 1ZCRA 5GS0L 3JWDL 4JVWA 2OMUA 3QJHB 2H32B 3S7GA 3N0PB 4F37K 2NY2B 5IEHA 3E2HC 2IC2A 1PLBA 3QUYD 4LCVA 3LN4B 2P5PA 1NJ9B 2VSDA 1WICA 4JRYA 5K9JH 3JV4A 3NSDA 3HUJB 2F58H 4P5TB 5A6IA 3JYBA 1J1XH 2H3NB 4RGNE 4MA8H 1UA6H 5IV2B 4ZOAA 4ELKB 4LLDB 2CAKA 4NKOB 2JKRM 4G7RB 3MV7B 1GAFH 5LBSH 4HALA 5I30H 3IDMA 1PFOA 4X0KA 1QD0A 2PUQT 3HUJE 3EFDH 5C0EA 3FHAA 3U7YL 3AQXA 1MFVA 4AGOA 1PF3A 2ZSWA 4Y4KB 4P9ML 5CN1A 3I9PA 4P4RA 1MH5A 4KKPA 3DTXB 3DXAE 5TF1H 2OQJB 2IOOA 4HGWA 2R2EA 4JFOA 2CCWA 1U2HA 3OLGA 4YN3A 3UGUA 4JKPL 3WTWA 1N6QH 4NNXB 2VERN 4QRTA 3QQ9C 3DSNB 4JPIB 4Y2LA 1KFGA 4F58H 3FB8A 1F41A 3APMA 3QXVA 2IH3B 4F3FB 4OGXH 2WQSA 5DUPL 3CBJB 1CWVA 1QHOA 3QRBA 4JM4H 3V10A 3ARUA 1U2YA 4PJBA 3DMMB 4WVRA 2C34A 5I6LA 1CICB 5GHWH 5LAXA 5GRUH 2HJLA 1F3RB 1TTGA 4H7VA 2F74B 4HEPA 3TN0D 5JDSA 1U8HA 4OGZA 2B5IB 1XGRA 2NW3A 2CBOA 4P4KD 3KD4A 1KV3A 4YSOA 4F8TA 5PCYA 1V5JA 3Q44A 3HC0A 3GHEH 3MYJA 4XVJL 4X99A 1HOCA 1YNTB 5D7IE 3US0A 1UG9A 3VA6A 4NQVB 3CSPA 3KYOB 2WNXA 2IDSA 3FNKA 3NA9L 1U8OB 4G9FE 2YN3A 3RJOA 1P6WA 1NGQL 2EACA 3X13A 25C8L 3QORA 1LGVA 4K23L 4NT6B 4AL8C 1U3NA 5L0QC 1CF1A 1N6QL 4HIJB 4G6FD 2K6YA 1K8IB 2PTUA 4K3DH 4YIQA 3CCHA 3GSNA 1TQTA 2Q6WB 3WEMA 3TEWA 1J0ZA 4P5KA 5DMJB 2H6UA 1BXVA 4UMSA 1HYSC 2JJTA 1MIMH 1U6AH 1YPZA 4DGIH 1BVOA 4YO0B 5EC2B 2ATAA 1FFNA 5D1ZI 1PYWB 2BY2A 5A7BA 2H2SD 4HETA 5IROD 1R1CA 1OE1A 4FD0A 1Y18B 4WHCA 4A2EA 1CFMA 5FECA 3DO3A 3LS5H 4X7EC 4Y19A 1L6XA 3EYUL 3DPBA 3Q9PA 4OCNC 1L0PA 4TQEL 4LCWA 2CKBB 1ES0B 5CJXA 1D9KA 1EK3A 1R3KA 1YAZA 1XSKA 1JN6B 4XRCB 3H85A 4OF3A 5AB1A 1DLHB 1SXNA 2QFPA 1SZNA 2AW2A 2OSLB 4Y4FD 3C5ZC 3X13B 4E68A 3NDYE 1AE6L 3L7EA 2ZXGA 3H7LA 2G4GA 5DJDA 1VADB 1OB0A 2XUWA 4YIQB 5C70A 3MRJA 1JF1B 1MI5B 1EO7A 1ZS8A 4X8XA 3NIFB 3KPNB 4NQCB 1UB6B 2CXGA 4YPJA 2IAMB 2J5LC 4BQ9A 4XBEH 5HHQB 5JHDD 3ZKNC 2X05A 3ALXA 3VXQB 1USQA 1X5YA 5I71B 2X53A 5KANI 4L3CB 1KJ3L 4NUJA 1KTKE 3EDKA 4XODA 4GXFA 1GIGL 3FB6B 3KPLB 4FTVD 5M95B 1SJEA 5J9PB 5FM8A 1AGBB 4WJKB 1P84K 2DI9A 3K5SA 1I53A 3L4ZA 4QHUB 4TULH 4UT7L 5E5MB 1A6WH 3DDFA 5F7MC 1XCTA 5EU3B 4JFWA 4GLRI 4N9GB 1K8DA 4MQSB 4DGYH 2DEXX 3JT2A 1EDHA 3TV3L 4G11A 5JTWA 1HZHH 3K72A 1AO7A 2I85A 5IFAL 4HKXB 4RDQF 4CKVX 4PRHD 1S2EA 4LU5L 1E4XL 5I6MA 1AGEA 1IBDA 2GJZA 5CN3A 1BJ1J 5EU7C 3U79A 1B9ZA 3RI5F 3NJXA 2QKIB 4HJSA 1GSMA 3GJFB 4JKNA 3ULAB 2F8OA 3ZL4H 4B96A 4YLQT 1ZV9A 4URTB 1HU8A 3W9EB 1YVLA 1Z7JA 3UC0H 3O2DA 2BY0A 4A6YB 4U0QB 4C47A 3C6LA 2FJFA 3JVFC 2KERA 2IF7A 2WBJA 1R5IB 4A2LA 1CFBA 2HRGA 3HG1E 4KI5E 4MJIE 3SE6A 3STLA 2BW4A 3V6OE 3W11D 2QJDA 3PIQA 1F58L 1AGCB 2FQEA 4KRPD 1X5XA 4D9RD 5ES4B 3WO4B 1K4DA 4WJG3 4XWGL 4N9GA 1LO2L 2ISDA 3S2AA 1E0OB 4XNMB 3PGDB 1NLBH 3ZR6A 3OHMB 2APSA 1EWHA 2E7LC 2H8PA 2B3RA 5FR3A 4RBPH 3N44B 2JKJA 2ZOLA 1UACL 3RIFF 3GMRA 2E75C 5CU9A 1GXEA 5E1IA 2G3NA 3KLQA 4I0KA 5E51A 5HGAB 1RJYA 4Z7OB 2AJYH 1QLRA 4ANUA 1SUJA 2CO4A 1WGOA 1HL4A 5GJTL 5C8JB 4MCZB 1CR9L 1D3CA 3MCKA 4PJ5E 1NDGB 1P5UC 3EDFA 4HC1H 2AJSH 2Z64C 4P2OC 4PJIE 3P0GB 2C9AA 4FKEA 7FABH 3OKYA 3BD5A 1B0RB 1U58B 4Q6IB 4LPTA 3X1BA 4FADA 5KZCB 3VVVA 4BCYA 3D5OF 3T09A 1ZV2A 1JGUH 4JN2A 1EFXB 4Y1AD 1UH4A 2KLRA 3GXFA 3QQDB 4JO1H 3PWJA 2DWDA 2NY4D 2E56A 1DL7H 2VUKA 3E6HA 4DNLA 5CLTA 1I8LC 5IMMB 4LSSL 1SXZA 4XPFH 5GS2D 4L1TA 4M6NH 2XZQL 2GK0B 1JXDA 5I6NA 1LE9B 1BYPA 2FVNA 2G0KA 4P9HC 4E9SA 4U6HA 4DVRL 2ATKB 3CFDB 4FA7B 2Y36L 3QZLA 2J1WA 4BFBD 1MCWM 3EBAA 2BM3A 4A6YH 5TJWK 2HPOA 3JXAA 1HIMH 2IG2L 1RERA 3N06B 2NYYD 3QNZB 4KKQA 2YLKA 4XVSL 1P69B 2A77H 2XN9A 4OZGB 1AH1A 1G7LA 3QUYC 1X4YA 4WTZG 2F6AA 2A83B 1NWPA 4NC1E 1TKWA 1KPRB 1NSNL 1A4JA 4XO4A 4PRAB 3IRZA 5JXEC 4Y5XB 4V33A 1DEEA 4JN2B 2Q8BL 3ZZQA 4LXFA 4CDHA 3B34A 4NC2B 3LHAA 1BIIB 1XF4A 1AQMA 4PB0H 1IVLA 5FX3A 1WBZA 3I6KA 2NNFA 3REWB 5IJKC 1WCQA 3EJZC 4BFKA 5KS9B 1JD9A 4DGIL 1OSEA 2CUHA 2XIDA 1NQBA 5F9WB 4E36A 4JHAL 4YHZH 4ZW8A 4YBQD 4G9FB 3JZYA 2J1YA 2VXQH 5DO2C 5IUSA 4HIPA 1V27A 1HT6A 2UWEA 2IMNA 4BFIA 2EH8L 3IF1B 2J8UE 5LGJB 3BVNA 4RNRA 1P5UB 2KLTA 3SSGA 5EA0H 1N64L 4KXCA 1ZRUA 2AJVL 1XIWA 4NM4H 1XV8A 2A1WH 1BG9A 4PJAB 3V52H 2CLZA 5INCB 1AIFB 2PW2A 2VT0A 1A65A 3JWNE 1E4WL 5TFSH 3OLEA 3T77B 1T1YB 5GGRB 3LEVH 3AU1B 1CR9H 2VZTA 4TOYH 1JPST 3KEDA 3UBGA 1EXHA 3K91A 4PVMA 1SLUA 1MVUA 1O9VA 4J23A 1IIIA 4K7PL 5CJXC 3WTTA 4XN5A 2YEVB 2DYPB 1IEAB 4S1SH 3IFPB 3UGEA 4DT2A 1NCCH 3F7VA 2ZG3A 1OSYA 1HEZB 4MQTB 3WUWB 2ZPKH 1NC2D 5F7YC 4HCIA 3GUTB 2W81C 4NNPH 4UUJA 5C0NC 3BVUA 4LOFA 4NRYA 2OTPA 4WF7A 3QUKB 5ETUA 4NPYB 4CN4A 4DKEH 3O8XC 2IPTL 3UCQA 5D1QA 2DQUL 2XKNB 2ADFL 3OXSB 1EJ6A 3AT9A 4X9BA 2OCCB 1SM3L 4RFEA 5HDQL 3E3QE 4WFGE 3K72B 2XXFA 5H37G 1OAZH 3VMNA 3QQ3A 4L37A 1QWNA 5CEXB 4U2ZA 1HJBC 4P5TD 2RAMA 4YSPA 3BEWB 3BIAX 3PE9A 3VGDA 1T5XB 3Q1EA 2XQBL 1KPVA 4ODSH 4B5EA 1QSEE 4ZMWA 5IHUH 5F1IA 1H8OA 4MS8D 1WC7B 1O9ZA 2EDHA 4QO1B 3RFZA 5I8EA 2HRHA 3GXTA 1XF2B 4U1LA 1UH3A 2J4WH 3MNZB 5EBMB 4MYWB 3BMWA 4HPYL 3QH3A 1BMZA 4UILL 1IBGL 4WEUD 2CBQA 4J4PD 3U4EB 3T0EA 1BWWA 3X1NA 4BZ1H 1WISA 4NRZA 4HUCA 4ZX4A