2D3JA

Nmr structure of the wif domain from human wif-1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
157
structure length
157
Chain Sequence
GSHMLDQQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILQTPQNAIFFKTCLQAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein inhibitor
molecule keywords Wnt inhibitory factor-1
publication title NMR structure of the WIF domain of the human Wnt-inhibitory factor-1
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02019 WIF WIF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2d3jA00
2D3JA 2YGQA 2YGPA 2YGOA 2YGNA
chains in the Genus database with same CATH superfamily
1TJXA 3CHXA 2BSCA 1ZMYA 3KPSE 3TJEL 4KJPC 4NZRH 4P9HL 1EEYA 4BBWA 1HH6B 2XY2A 3T6VA 1MCFA 3OAYK 3T71A 3K80A 3P9WB 4JCMA 2AQTA 2EP6A 2VAAA 5FGRA 5JPNB 2OPCA 4HUWB 4JFEA 5C0EA 4GO9A 2KBGA 5ESAB 3LB6C 2PTUA 1HHIB 1TFPA 2IAMC 3GDCA 3FUFA 5D7IE 4PGDA 2BZDA 1RURL 4DT2A 4G6KH 1NKOA 3SKMB 4P3CL 4JO3H 4GFTB 4PJAF 1IV8A 4BFIB 4LHUD 4ENED 4W9DC 1CLZL 1U30A 2MTPA 4WI0B 1G87A 2P28B 1MRDH 4EI5D 4ELDA 5K9KA 4HA1A 3WSQH 3BEWA 3ARTA 3ZYJA 1N59A 1TENA 2F18A 3PG2A 3KCWA 3R1GL 2P49B 4LU5L 3D51A 5FM5M 1YN7A 2AZAA 4ENZA 3EW3B 3VGDA 1FFPA 1MCCA 5DJXB 2QV2A 4V33A 3V4PL 2DDQL 4ORGA 3MV9E 3GRWA 2IXQA 1XZ0B 5C3TA 1U8KA 4I5BA 4HIEA 3L7EB 1CK0L 5KN5A 2OYLA 4UINH 2NT0A 2I9LB 3ORJA 1G7QA 1XB8A 4G1MA 3U2IA 1TF4A 3VU1A 4XP4H 1MIML 4X5QA 4M02A 1MNNA 2A7BA 3RTQC 3FB5A 4JPVH 2BFVL 4EAEA 4G43B 4L1HA 4ZO9A 5E5MB 4AH2B 3T0EE 4FJ6A 3C2SA 3FUEA 3ZIMA 4NQCD 1BZDA 4FD0A 2WWMC 4FLSA 1HH6A 2AJYH 4LEXL 2CDEB 1SMOA 1YPZF 3V6BR 3RWGB 3SZ6A 1B6UA 4BK5C 4BGDA 4G8FB 3KLQA 4LVOC 5JPNA 1K8DB 5IUCA 4HUWA 5E2WL 5SX5H 4POZD 3AWGA 2XN1A 1R5VB 4BQCA 4P5TD 2J6WA 15C8L 5ESAA 4XWOC 1HHIA 1KJVB 1NPUA 1EHLH 3QAQA 3GMLB 1EDQA 3CFKB 2ZP0T 4FQIL 4NN7C 1HVXA 3MCYA 3SKMA 2VKXA 2O6DA 4BFIA 2RCSH 4OZHE 5FDWB 4WI0A 2XRAH 4PS4H 4AKPA 3BDYL 3F6LA 4Q9QL 2FH6A 4U1NB 3C5ZC 3M07A 2NY7H 3MA9H 3HG1B 1P4BL 4PRPE 5I6OA 5GSRB 2OR9H 4KVPA 1N6UA 1X9QA 1QBLL 3K71B 3B34A 5DJXA 2NXYD 5CJOH 2AXGB 2VR7A 1IB5A 1HU8A 4Z7QF 3NK3A 4HEMA 5I8EB 1TVBB 1XZ0A 4JY6B 3L7EA 3LZOA 3AT0A 3L4CA 2I9LA 2GW5A 3WTXA 3DV4B 5LG6A 4YN3A 4K2UL 4G43A 3IPFA 4UILL 4ZRGA 4CN4A 2DTSA 4PWKA 5EULV 1AKJB 5E5MA 3ZDXB 4AH2A 3FO9B 1MDAA 4FABL 4Z8FL 3BSZA 2P4AB 1QWUA 4MA1B 2JB5L 3QNYB 1C5CH 3HC0B 2CDEA 1OZTG 2P42B 1HT6A 2R8SH 1QZ1A 3RWGA 1DYZA 3AABA 4GG8B 4K73A 4LPYA 4M6OH 5BQ7B 1GGIH 4A7GF 1OKEA 4G8FA 4N0YL 1K8DA 3E9TA 1E43A 2DB8A 5TDNB 5IM7B 1R5VA 4TQIA 4Y4KD 3KJ6L 3CWGA 1M3JA 2UXVA 2BCKB 3L13A 3X2QB 1KJVA 1UHVA 4JRWA 4KRMB 2AK4B 4FFTA 3GMLA 3CFKA 2AQ3A 4C8XA 4Z7WB 2ICCA 1JMZA 5EF0A 4KJWC 5E8DL 2HG5B 4HZ1A 1P69B 3Q2CA 4F7EB 1LM8V 1MY7A 5FDWA 1SVBA 1QKZL 4Q56A 1GHFL 1XBRA 1DJHA 1DVYA 2IAND 3IFNH 4U1NA 3R7QA 5BV7L 1LWJA 3GI9H 2V9QA 5T3ZL 1AKPA 3HG1A 5GSRA 5C97A 7FABL 3X17A 4DEPC 3BFOA 4GBXD 3D06A 3K71A 1YEIH 5IV2B 1ID5I 4MKMA 3GI8L 2AXGA 2VSMB 4P2QD 1D5MB 4CRPA 5I8EA 2UXFA 1TVBA 5A2LH 4JY6A 2AABH 4PJHB 3M7FB 3ULUD 2YGNA 4HEME 2JKWA 3DV4A 4NN5B 2VXVL 3MV01 1B2WH 1UA3A 1JSYA 4OM1H 1PD1A 2YSTA 1AKJA 2IDSA 3FO9A 4X6EB 1T0PB 2RALA 4HMEA 4ODTH 4IRSC 1TTBA 3DO3A 2ZTBA 1W8EA 1JNHB 3ARRA 3L4WA 4M29A 3KWWB 2RA1A 4Z7QB 1PVHA 3MBXH 4MA7H 3QNYA 2NXZD 1R3HB 3TNNB 3HC0A 3NPSB 2K78A 2ZKWA 3M88A 3SE3A 1LDSA 5C2BL 4GG8A 3O3EB 3WIIL 3Q6FB 5BQ7A 1FSKC 4JFZH 1RVFH 5HVHC 5E8NB 2JI1A 1KYUA 5TDNA 5IM7A 2AP2A 4NPYB 3QR0A 4Q0XL 2BCKA 4BXSV 5ES4B 1I75A 1JI1A 3CFMA 3HRZB 2AK4A 5GQBA 4AEFA 4Z7WA 4KDVA 1XF2B 3U1QA 3ZL4H 2HG5A 3I9AA 2BXYA 2WBWB 4F7EA 3HC3L 4TUOB 3DIDA 3RB7A 3DJ9A 4MXWH 1MOEA 1W91A 3DNKA 4Y16C 5D96C 3HZYB 4XNYH 1OEZW 1ZLSL 4OM0H 3QUZD 2HPOA 1ACZA 3O41B 4JJOA 1L9NA 4IEFB 3TH2T 3QORD 4M62H 4Y5XB 3I6KB 3HG1E 5IV2A 1JXDA 2AJSL 4N24A 3UEQA 4UQDA 1D5MA 1OPGL 3V7AE 3UROR 1EWHA 2A5UA 4JFWA 4FXKC 5FK9B 3UJTL 2VO5A 2DJSA 4XX1E 4PJHA 3S8WA 2C3GA 4XAWH 2ZOLB 1BFSA 4K8RH 1T7ZA 1T89A 3CLFL 4X98B 1BBJB 4GQZA 3BGFC 3V7AG 2PXYC 5T3ZE 1W0YT 3B7SA 4HPOL 3WNMA 4PJCB 4C4UA 4OH2A 3HKZA 2IH9A 2WVSA 3UZQB 4FLRA 4X6EA 2XN2A 1SEQL 1RUQL 1LNUB 1JNHA 5F7HA 2H32B 1PZ3A 3KWWA 1CLCA 3ZDXE 2NSMA 1DHKA 1R3HA 1UWEL 3A5VA 3TNNA 4P4KC 3U9UB 5IJVB 3U6RB 4OIIH 3O3EA 5AENA 3Q6FA 5A43C 4RA0C 2P5WB 5E8NA 2OMVB 3G6JF 4WGWB 2G3ZA 5JIDA 4LQFH 4H8WH 4NPYA 3VJ6B 3FFCD 3P0YH 4UNTA 2VRQA 2IAAC 3QP3A 2AC0A 1MCOL 5CN2A 5HDQH 3HRZA 4A7VA 1CBVH 1MLBB 1UXMA 1NFAA 5AVRB 3Q1SL 3P4MB 4KX9A 5IMMB 2DQIH 1USZA 5IHWA 3KL0A 3PHQB 3WAJA 3B2MA 1XF2A 1HZKA 3GSNB 5LBVA 4HGKC 4TUOA 2AK4E 4RISH 4HJUA 4BA0A 1IGFL 4Z7WE 1C7SA 4B9IA 4DGVH 3LDBB 3FU8A 4NXKA 4XMLH 4G3YL 5DHVB 1BBDL 5D8JL 4JREC 4R0LB 3ZDYF 3HZYA 5IB3B 4OF5A 5CEYB 2I69A 2PYFB 3QAZC 4BSJA 2FSEB 2NZ1A 2FWUA 4W68A 3O41A 3CFCL 4C56D 4NZUL 4XCCH 4DQOL 5ENWB 4IEFA 4EO5A 4J7RA 1ONQB 4Y5XA 3AG3B 3BE1H 1YC7A 3I6KA 3GUTB 1RMFH 4HALA 2HRPL 1WQVT 1Y0LB 3E8VA 5FK9A 2X89A 1G9EA 3T2OA 3LYRA 1U2YA 3DLQR 3KDPB 3MCG1 5B1JC 3O4OC 2VR9A 2ZOLA 4FFVC 1BBJA 2YKLH 4PJHE 3QYNA 2IDUA 2Q8BL 1FVDB 5LKNA 4FE9A 4PJCA 2R2EB 3CFEB 3SQRA 3WIHH 1H6TA 4NAQA 2QQKL 5EWIL 5T5NG 2YMXL 3UZQA 2CHWA 3LVTA 2BY1A 2R7EB 4KX7A 1LNUA 5GS0H 2H32A 3U36B 3KNBB 1HDMB 3RX7A 3LS4H 4WWPA 2NY4D 2HT3C 1MJ8H 3I85A 1NKGA 4JKKA 5AZEH 2X88A 4R2GC 2H1XA 5E9DB 2A83B 1NC2D 3U9UA 5IJVA 2MCPL 3U6RA 2FIKB 2I27N 4Z9KB 1M4KA 1S7UB 1UM6H 2P5WA 2OMVA 5B39B 4MFHA 2BNQB 1KBBA 2NY2B 3CFUA 4Y88A 3VJ6A 5FHBL 2YN5A 3QWQB 3S48A 4E41B 5AYUL 1MLBA 3IDJB 4CMMB 2Z7UA 3P4MA 3WELA 5IMMA 4TM9A 3PHQA 4X4MA 3AG1B 3GSNA 3J07A 4XWGL 2UZYB 2ZSWB 3MJ9H 2K4WA 5DHVA 4R0LA 5IB3A 1ML0A 1CL7H 1KCBA 1DQLH 2JJTA 2PYFA 2Z34A 1QRND 2FSEA 3NT0A 5CEYA 1GCFA 3BOVA 1KBPA 1SYSB 4FS0A 5GGSB 9CGTA 5I1EH 1EAQA 3MBEB 5ENWA 3G6JB 2B0SL 1ONQA 2EDXA 4L29B 1CWVA 2IPTH 3P2DA 1YYMH 2ADFH 3GUTA 3EDKA 1TTFA 4QRBA 4W9JC 4OFYA 1Y0LA 1H5BB 1JPTH 4DZBB 5IJKC 1G9HA 1H3XA 3PWJB 5ADPH 1WUZA 3B37A 1TMQA 4WFGD 4Z1PA 1QRKA 4XZ4A 5AYQA 4TNWF 1ZEAH 2ESVB 1CXEA 1FVDA 2HLAB 3D07A 2R2EA 2NW3B 3CFEA 4LLMB 4XPGH 5KJRL 1JNLL 2VE6B 3EGDB 2PMZA 1PZ5B 4PJCE 2BW5A 2R7EA 2D3JA 4IBSA 1ZSHA 1ZIAA 3DIVA 3U36A 3KNBA 2ALAA 3WE1A 1HDMA 2VMCA 1XIWC 3P0VL 3IAPA 4BQ9A 3S37H 1GGYA 4K8RC 3TBTB 4HSCX 5E9DA 5C3LD 2VR5A 2A83A 2FIKA 4UZUA 1KIQB 1YEKH 3K6NA 3L45A 2PPEA 4F58L 1S7UA 2V3EA 4YSEA 4WI8A 4YPJA 5B39A 1DJIA 3EYSL 5CEXB 1BZ9B 2PPDA 2BNQA 3K8LA 3NZUA 5GJSH 4IBWA 2RQEA 1IE4A 2P5WE 3IFLH 4E41A 3IDJA 4CMMA 3N0PB 2DM7A 4PY8J 5CCKL 4QTHB 1CC3A 2X1XR 4LVHC 4AV5A 2UZYA 2ZSWA 5FHAH 3MCLL 4CVUA 4NNPH 3OMIB 5DMGC 1XL4A 2BIHA 3RFZB 3BWAB 2N56A 5E6RB 3BRGC 3F7KA 4HS8H 5GGSA 1SYSA 2CA3A 1MFCH 4BH7B 3BEVB 3OVUB 1Q4NX 4H8WC 4PRNB 3MBEA 5DDHB 3G6JA 1GJWA 1MI5D 4L29A 2J20A 4OIFA 4R4FL 4LHJB 1YVLA 5JHLH 4H13C 5E95B 3JVGA 1H5BA 4XVTL 3S0PA 3WV0A 2LT9A 4U6VH 4DZBA 1YMMD 4GAGH 4GMSH 2C4FU 3PWJA 1NCHA 3WUZA 5JHMA 2C1OB 5FYJH 4F15C 5MI0B 1FNSL 3Q9QA 4UT7H 3GRBA 2YD6A 3GFUA 3O2VL 5AWNH 3RE0A 3T09A 3T2QA 5DLMH 1GVIA 3OXSB 3ARWA 5TE4H 5GZND 2ESVA 2HLAA 4I0PB 2VLKE 4LLMA 2NW3A 3DTXB 3TTYA 2VE6A 3D5OF 3EGDA 4U0RC 1KENH 1N6QL 1AFVL 4UDTB 1PZ5A 3BUYB 4AVJA 4WV1C 5CFAA 4G82A 4ZFGL 3AWFA 3MO1B 3GM8A 3EFOB 4TSAH 3K74B 1A7OH 2ZUQC 3VG9C 2QEJA 3B56A 1Y6KR 3TBTA 1U6AH 2WLIB 4YFLI 1KIQA 3UAFA 3VXOB 4PB0H 3QBTB 5E9DE 1PZDA 2FO8A 5CEXA 4TPRH 3CFDB 2ED6A 1BZ9A 5KSAD 2Y7QB 4UTAH 3IYLW 1W0VB 5GS0C 2ZYHA 4KVCH 3V7MA 2VM9A 4PBVC 1E7VA 3X13B 4QTHA 3BRDA 4E41E 4G9FD 4HCFA 1DDTA 2J43A 3ZKND 3MRHB 5B7MA 4FL4B 5GHWL 1Z9SB 4NCC1 3RVVC 3I9GL 3U46B 3RFZA 3BWAA 1G43A 4YBQC 1IBGL 2AQ1A 3OZ9H 4XP9L 3OWRA 4ACPA 4BH7A 3BEVA 4PRNA 5DDHA 2Z8WC 2CCWA 3Q2VA 4R90L 3V0WH 5I1CL 4P9MH 4LCCB 4U1GC 1RQ5A 5EO9B 1S7SB 2IDFA 1P1VA 3C9NB 3DOIA 5HHMD 1WISA 3CLEH 4PG9B 4DO5A 1YNLH 5T1KD 4HIHB 2C1OA 3G6DH 1JK8B 4ODSL 1THAA 4G6AD 4YDLB 3MXVL 4O4YH 3OXSA 3FF8A 4PB9H 1WAAA 4MLIA 3EIFA 3FK3A 5ITFB 1JWMB 3HE7D 4I0PA 3B4NA 3DTXA 3HB3D 3UTOA 4GQRA 4HCRH 1WFMA 4OTXH 2VDPH 3DSFH 4UDTA 2HVKB 3BUYA 4F8NA 4QXUL 5DGRA 4N87A 3FTZA 3ZY7A 1T66D 4Q6KA 4BD4A 2BSBA 3MO1A 4O58H 3EFOA 3D7PA 1E5AA 4ZS7L 1R34A 4TNGA 4J23A 3NIFF 1QTSA 4HPYL 4NXSA 5JQIB 2WLIA 4LRIA 3SDCB 2P26A 5GGQH 2AAVA 4FP8L 3VXOA 4Z7UB 1CXKA 4JDTL 5DTFB 1G7MB 2VDQB 4N6QA 3CFDA 3NJMA 4JPKL 3QEHB 4UYQA 4NO3B 3HUJB 2Y7QA 4HWEL 4ENEC 4B0MM 3L4UA 3LS5H 1W0VA 3UG5A 2XA8L 4EXKA 1KOAA 1UUSA 2ZXGA 3CMGA 3X13A 4LLQB 3TZVC 3X11B 1L9RA 1NCDL 3CDYA 1A4AA 5AKTA 2B20A 1XGYL 3MRHA 4CDGC 3WUWB 1Z9SA 1ZWIB 2ZKMX 4IYKA 1WWCA 4P59H 1S7XB 3U46A 2EACA 4QXGL 4W4OA 1MQ8A 4L3ED 5TQ0H 1UM5H 3EOTL 3LPGA 2K4AA 1NL0H 5L9DH 1VEMA 4F9LC 4LCCA 3T4AB 4ZTOL 5EO9A 1S7SA 4FMKA 1IAOB 5TPWL 3TBCA 1OE1A 3C9NA 4AVKA 4AJWA 4PG9A 1G0YR 4KTEH 4OW6A 2CQVA 1J9QA 3CN3A 1PY9A 4KO6A 3GMOB 5A2JH 5IZ7A 3O2WH 4HIHA 4P2YA 4GQ9L 4PEEA 5C7XL 4WF7A 1JK8A 3BX7C 5D4QA 2AEIT 2QLVB 1SM3H 3V4VL 1F3RB 3QUMH 4XNZB 5H4ZA 4Z7VE 1UKTA 3A6CL 1JWMA 1OAJA 5ITFA 3SPIA 3UFIA 2I07B 2JH2A 5FM5O 5B22A 5HSFA 1T7WA 1WAAE 2QFPA 2HVKA 2WD0A 4S1QH 1DZ0A 4KOBA 4JFVA 4L1SA 3L54A 1FIGH 2EO9A 3EHBC 4Q4IA 3T3MB 3NZHL 4POZC 5JXAH 1AC6A 3SDCA 1KBWA 4JGMA 2EUWA 1MFAH 3D50A 2HYMA 4Z7UA 3ULSB 5DTFA 1G7MA 1BVOA 2B4CL 2EYTB 1IZKA 1WVZA 2OJ1A 3FHEA 5IQOA 1KGYE 3QEHA 5JDJA 1BM3H 4NO3A 2BS71 3HUJA 4LLYB 3CZFB 4RFOL 5E4AA 4Y1AD 1XR8B 1JHLL 2VLJD 4JO5A 2Z31B 3IRZA 1R3IH 2ED7A 2W9EH 2FBJL 3GLZA 4LLQA 3KDMB 3X11A 3WUWA 5C70A 1JZHA 2ZXDA 2UUDK 1ZWIA 1KV7A 4L8DB 4YHOL 1S7XA 1E6JH 3FB8B 1JGDB 3H9SB 4PS7A 1ADQA 3TT3H 4YC2C 1AVAA 4UT9L 3BN9C 3T4AA 1TQBC 1IAOA 2A2QT 3GZQA 4K7PY 5JYMA 2XQBL 4KMTH 1C5BL 3F85A 3K2UL 2KPWA 3QIUB 4KKBD 3GMOA 1WP6A 3CXFA 2DWDB 2RIKA 3JWNE 5DT1L 4KUZH 5HJDA 1L5GB 1UWGH 5BS0E 1DQQB 3UAJC 3NH7L 3ME0B 1A7NL 5CZXD 4UT9A 1XWVA 1XZWA 3B7YA 2A38A 3LD8B 2H6OA 3AREB 2XZCH 2ZWKA 1CTNA 4AGMA 2I07A 2V8MA 3S4SG 3ZHNA 4G8GD 1KPVB 2DBJA 2V9TA 2LABA 2F8XC 3WNPA 4B7LA 1FA4A 5E99L 4ZMLA 1OCWL 4LFHD 3U0TB 4YBHA 5KAQG 1CDYA 4WI5A 4NO5B 4Y4KC 4AIEA 1YEFL 3DJZA 5CWSB 1CUOA 2YPVH 4O00A 5IWLA 3ULSA 3OAUH 4P5KB 2EYTA 5HGHB 1E6OH 4LLYA 5AL8A 3KWUA 3CZFA 2P5ED 4Z7UE 5E6IB 1TZAA 1XR8A 1A7QH 5FKPB 4MVBC 2Z31A 1ZVSB 4MD0B 2OLDA 3HUJE 4N2DA 1OXYA 4KRNA 5BOJA 3KDMA 5A7BA 5IVXE 2YK1H 3Q8FA 3BJ91 3KYAA 4L8DA 5F9OL 4OFIA 5JHBA 6FABH 1TLMA 5B21A 2XIDA 3FB8A 4NC0B 1JGDA 3H9SA 5KVMC 4WWOA 2YAOA 4DP5X 3GBDA 4PRAB 1O0VA 4B5ZA 2Q9OA 2YEZB 3RGVB 1JGUL 1SHWA 3PGFL 4WLCA 3U7WL 3OJMB 3DGCR 1VEOA 1RULH 4BE5A 3QIUA 1NFDB 1L5GA 2DWDA 5IHUL 1DQQA 1G7PB 2OMXB 3RVTD 3ME0A 4OJAA 4X83A 1E0OB 5J6HB 4JQXC 3WMPA 4XNUL 1H15B 3AREA 3LMJH 4OCRH 1TJGL 5D4IA 5I5JA 2APTA 3RWDB 3TJHD 1UKQA 3DVNB 5JOFB 1KPVA 1ADWA 2R23B 1NEUA 2XWDA 4I3RL 5EZLB 2YAEA 3B1UA 4L9DA 3GIZH 3OC8A 4XX5A 2QR0B 3COOA 3U0TA 1ZTXH 3HJ0A 2EC8A 1V5JA 2WCSA 5L0QB 5CP7B 4JFED 1AR2A 4NO5A 4X9BA 1FVCB 4K3DL 2CRYA 4H0GA 3FU5A 3KPPB 3ZMNA 2WTPA 5FAAA 2X4QB 5CWSA 3T3ME 2WVUA 2NY1C 2KLSA 4OQTL 5CZRA 2HTKD 35C8L 3SE8H 1QUPA 4P5KA 5HGHA 4ZMWA 4A2LA 1DJGA 4AY0A 2XV3A 4X7CC 3RAJL 1A14H 5E6IA 5FKPA 5BVPL 2I9TB 1T0OA 1ZVSA 3QCTH 4MD0A 1RP9A 4RFEB 1P4IL 1HIML 4LIQL 1HWHB 1KPUB 2O5XL 4MXQD 1PNCA 3CHSA 1D9KC 1CXHA 1DSFH 5F96H 4Q6IC 1U8NB 5ECJE 1I3UA 2X4UB 5DZLA 1KT2B 5FECB 4PRAA 5JW3H 4M7KL 1HYSD 1QSED 3H9SE 3K6OA 4J4PD 4E9VA 3MFFB 2YD4A 2YEZA 2Y3AA 3RGVA 4NC1E 4RWYL 2VXQA 4Z7OF 2AXFB 1NFDA 2ZXCA 1G1KA 5E5UB 1EDHA 1MPAH 4HU8A 2TRYA 3GUFA 2P8MB 2EDRA 1G7PA 1BECA 2MPAL 2OMXA 4JB9H 4N2FA 5K9QI 1UWXK 4XGZB 3INUH 3NCCB 1UZGA 5J6HA 3GSOB 3BT2L 4FTVB 1H15A 3RWDA 2AGJH 4XRCB 2YGQA 3TESA 4EOWH 5AFAA 3DVNA 2WXIA 4AENB 3F62A 5JOFA 4OAWB 4J3WA 5D93B 2O26U 1OTSC 3B8YA 5HHPB 2R23A 5EZLA 1Q1JL 2EXSA 2QPSA 4HFWB 4IQHA 4TXVB 2J5LB 4P2RB 4ZMZA 2QR0A 3BDXA 2R0LH 3P30L 5C0AB 3U7YL 3EKCA 3O9WC 5CP7A 2XFXB 1IO4C 1FVCA 5D6DA 4JHBA 4OCNC 1JHTB 3KPPA 3RIFF 2X4QA 4JG1L 4MGXA 4YLBA 3UXFA 4F37F 2ZICA 3D18B 1OLZA 1JVKA 1WBYB 5EOCL 1FNHA 4TRPL 1NEPA 1M1XB 5F89B 2VCOA 3VH8G 4TSCL 3AGVA 4LDEB 1JXGA 2I9TA 1TKWB 4RFEA 2A9NH 2YOCA 1S3RA 3T4YB 2IGLA 1KIRB 3IAQA 4HIPA 1KPUA 1VB9A 4WUUD 5DUJA 2YD9A 1AG0A 3J27A 3L3OB 1A3RL 3MYZA 4FHBD 1CTMA 2CJUL 4AYSA 4K7FB 4MA3B 1U8NA 2VGLM 3D52A 1ZXQA 2X4UA 4XOBA 3SODB 1KT2A 2DQJH 5FECA 3WO3B 1OGAB 2FJGB 3MFFA 5KOMC 2Z9TA 1ZVYA 4JM2F 3OHXC 4M9OA 2AXFA 2OAAA 1JZGA 1E90A 1V7MH 4B3VA 2B1AL 1FNEB 2P8MA 3RIKA 2N4IA 1NFDE 4KY2A 1FO0H 4XGZA 2WZPD 4ZX4A 3BLBA 1IGYB 5HXMA 3GSOA 4FTVA 4MQXD 1QI3A 5B7EA 4XRCA 5AW6B 1UJ3C 4ONFH 4AENA 2QSCL 2WIIB 2XKUA 2PP9A 2YD7A 3PAVA 3RPBA 4E9XA 4OAWA 1X7QA 4GRLB 5FLVA 3AZUA 5IVNA 1AOZA 5HHPA 3K5RA 2WKOA 2B77A 3QDJD 4HFWA 4LSQL 4J3XA 4M1GL 1E4JA 5DD6B 5DJ2B 4P2RA 5I74B 5KJ4A 2JI2A 5C0AA 4M3KB 5IBLC 2QGEA 1OAZL 2XFXA 3FCSB 4LMQI 5CGYC 3V0HA 1ZLWH 2I5YH 3ZXAC 5I1KH 2HB0A 5AALA 5ABZA 4JCLA 4XODA 1JHTA 1WO2A 1YN6B 1AD9B 4QTIH 5T5FA 1G5AA 1HL5A 3D18A 5F0PB 3V9EA 7PAZA 1WBYA 3M1OA 5KVDL 1M1XA 4RDQF 5F89A 1CR9H 4PP1C 4UMGA 5C09B 2YN3A 4BFFA 1TETH 5JA8B 2R0KL 1K9TA 1TKWA 2DH2A 4JO2L 5JR1L 3T4YA 4ZJ9A 1KIRA 4FNQA 2OULB 4QNPF 2DOCA 2YPKB 2ICWI 3L3OA 3PPSA 1OAXH 2NNXA 3CZNA 3T0VA 4ZW6A 2CAKA 4K7FA 4MA3A 3V2AR 2MRYA 4Q8BA 4XP6L 1CLYL 1LWRA 2YOAA 4JZNB 4HXAL 4UB0L 3T8XB 4NOBA 4H8QA 1OGAA 4A39A 4ZMTA 2FJGA 4OZFG 2XQ0A 2QVFB 1JZ5A 5JORB 2XG5B 4PCTA 3FBKA 5FFOA 3HNTL 3BUPA 2FEDC 4PGBB 1M7XA 1FNEA 1ZGLB 4MX7B 4FLQA 1GL4B 4PJIF 1QHOA 1MRFH 2KT6A 1IGYA 2JK5B 4U6XB 3VXSE 2R4RL 3UO1L 1MREL 4W6XB 2VNCA 2IGFL 3GXDA 3QWRD 4NO0B 2WIIA 3Q8BA 4FTVE 4GRLA 4EBQH 4DW2L 1I7RB 1ASQA 5DD6A 5DJ2A 1SXNA 1G7IB 1MG2C 1INEH 4JM2B 4FDWA 3QPXH 4F7KA 5HHXH 3GD1C 2B9AA 3FCSA 2ZKHH 2XTJD 2DIAA 4WI9A 3JWOL 3TIEB 5C0AE 1YN6A 4C47A 1AD9A 2XPGB 5C08E 3UGEA 3BPOB 4DKFL 5B3JE 4UDUB 4JKLA 4MAUH 5C09A 2YJLA 2OZ4L 3C60B 4OJDH 3U9WA 4RRPM 3MRRB 4WSGA 5EEYA 2YMOA 1XB6A 4YXHH 2O5NA 2R9HC 2E46A 5DUML 3LN9A 1WD9A 4KNQA 4JHAL 5D1XB 2YPKA 3NOIA 5KVGH 3RKPA 1F8TH 3LEYH 3MGOB 2AI0H 2WC7A 5D72L 3GHEH 2D8KA 4BELD 5KUKA 2XZAL 4XBEL 4JZNA 2CGZA 3T8XA 2EH7L 2P47B 5DD0L 1ZS2A 2AJXH 5GS1C 5CCHE 1IC5L 2FX9H 1MSPA 3JV4B 5CEZL 5JORA 1BQSA 2XG5A 1OGAE 4A6YB 5I0DA 1MCKA 4G5ZL 3D1MC 1JHKH 3EUUA 4FG2A 4PGBA 2FX8H 3NSYA 2F19H 1ZGLA 4MX7A 4XB7A 5GRUH 3FO2B 4EIZC 2VW6A 4AK2A 2JK5A 3IJSB 1UH2A 5DEJA 2BDNL 2ITFA 1A6WH 1Y18B 5J3HD 4U6XA 5IFJB 1OSPL 2BW4A 2FB4H 4NO0A 3ZTCC 3WO4C 4AEEA 1MEXH 2CRIA 4X8XA 4M7LT 2E7DA 1I7RA 2LW3A 4AQ8A 4OD3H 3QHZH 3SBWC 1G7IA 2XG4B 4JM2A 4ETQB 4JFOB 3VSQA 4FQ1L 3BN3B 4L8BB 3FCBA 5EU6B 4J3BA 4E9TA 4P5RA 3U4AA 1VLXA 5KSAC 3SJVD 5KSBB 4KOCA 3TIEA 3M45A 2DJUA 3D85D 2XPGA 4PJIB 4ZOCA 1J5CA 4L37B 5G4OA 4FI6A 3MV8D 4QRRB 1WEJL 1IFHL 1ZANL 4P06A 1NBQA 4UDUA 3UTQB 5D2LF 2X9XA 3WTSA 3C60A 1AQKL 3PWLB 5IF0B 3MRRA 1J1PH 2FEEI 5JDSB 4N9GB 1FRGL 3GKWL 3OKDB 4TLKA 5FLUA 4WCYH 5C09E 4JQIH 4Q97A 4WHYH 4CADB 5B1KA 5D1XA 4BINA 1OVZA 2FD6H 3QUGA 3T6QC 2F58H 3MGOA 3HNSH 5H2BB 1N4XL 1Z0MA 4M7JL 2AEQH 3AY4C 2PLTA 2ADIB 3FQ1A 5B7FA 1AACA 1UB5B 5ERWB 2X2UA 3VTMA 2VC2B 1DBML 3MV7D 1PAMA 2KLTA 4CJ1A 3JV4A 2QADC 3JT0A 4A6YA 3PYCA 1UXWB 4WQOA 1M7DB 2BSSB 1ZE3H 2X6BA 1TEFA 3AB0B 2ENPA 4NWTL 3KPTA 2ITEA 2IFFL 3BAEH 3BISA 3DDGA 3FO2A 4E42B 1GTFA 4N1EA 1GYWA 5KW9L 3IJSA 5HDRA 2EDWA 5IFJA 1Y18A 3CGTA 4X9IA 3T8VA 1TIUA 3EJRA 1FYTD 1L9TA 3ZYIA 1JRHI 4F7TB 1J7VR 1EXUB 2GIYA 4W93A 1ASPA 1G7LB 4RLDA 5AVVB 5AB1A 3UIZA 2XG4A 3O2DA 3OKOB 4JFOA 4KK6C 4ETQA 3WKYA 4YX2H 2HX8A 4YFEA 5EU6A 4L8BA 4O2FB 3NIGF 4GQQA 4LDCA 4YZWA 1ZHLB 1VZHA 3QZOA 4X6CF 4JL2A 5FW6A 5KSBA 3MV11 3CSYB 4W9GC 4PJIA 3WTUA 4L37A 3D39B 5HJ3B 4QRRA 3N5AA 1HHHB 5JIQA 3MUZ1 1XQ4A 4F24A 4F8OA 3NA4A 5BO1H 4YSTA 2ADJB 4L3AA 3UTQA 3PWLA 5IF0A 3QG6B 4M48H 1MCRA 4JMXA 4N9GA 5JDSA 4X7DC 3TV8A 4BZ2H 3OKDA 5A2BA 2CBPA 1F1DA 3ARDC 4UQ2B 1VIWA 4CADA 2CHNA 2WXHA 4NQEB 1VRSA 3ATEA 3U1PA 5H2BA 3OL2A 3R4RA 3OR7B 2H6UA 1EBPA 4HAGA 3TH4T 5D1XE 3TT1L 4OB5L 2ADIA 2YO3A 2PWDA 4OFYD 4FN0A 4YUEL 5KBLA 5KYYB 1UB5A 3QIBD 4U6TA 5ERWA 3OG4B 4HH9B 4NAJA 5DU7A 1AE6L 4OGAD 4N2MA 5D2LB 3RKDC 25C8L 2ZOUA 3FN0L 1CB4A 1ZGLM 4P3DB 5E24E 1UXWA 1WZ1H 1M7DA 2BSSA 4IOIB 3UZEC 2BJML 1PLCA 2VDLB 4FFZL 3BD3A 3EBIA 4HHGA 1EEUA 2ZX8A 4X5WB 5EU4B 3AQXA 4E42A 3QK0A 4PSPA 5G5DB 1QR1B 3UYPB 1KY7A 4NNXB 5J8OA 4L0PB 3AUVA 1HC1A 4ZUWB 4HDIB 4F7TA 4ELMF 4X5RA 1EXUA 3WHE0 1MKFA 5CIPB 5IOKA 4R4ND 1YJDH 1G7LA 3QCVH 3OKOA 4OJEH 4WVRA 4O2FA 3OB8A 2G5UA 4YH6A 5HJBA 1ZHLA 3GRWH 4TVPD 2BNQD 2FECI 1WGOA 3CSYA 1KJ3H 5EU6E 1NOAA 4XP5H 1WFUA 3D39A 5HJ3A 3UTTD 3QUKB 3B9KB 3WIAA 1HHHA 4F8PA 5KSBE 4Y7OC 3NP4A 4UV4L 1AY1L 3FSVA 2ADJA 3TN0C 3AWEA 4KV5F 5IQLA 4B9JA 3QG6A 4Z76B 3ZU8A 1CZ8L 1F86A 2FHBA 2B1OA 3FCTB 1DVZA 4HQQL 3ET9F 4P2OB 4LEBA 2LVCA 5FW8A 2PR9A 3Q8AA 4UQ2A 4PJ5D 1HL8A 1F4YH 3KPLB 4JZJB 3RVXD 1EXHA 1T1XB 2WWKT 4NQEA 4EZMA 3NIGB 1RJZB 2ZX6A 1I8LC 3OR7A 4Z95L 2YSSB 4UT6A 4YSDA 1CURA 3QUHA 3H8NA 4KKBC 1PJWA 1G6VK 1U3HC 4PD4K 5KYYA 3OKNB 4IRJC 2FQEA 1KCLA 4HH9A 3SDYL 2GBVA 3VMNA 3W57A 1TQSA 3FT9A 5D2LA 3B7UX 2W80C 4AOFA 4P3DA 1YECL 2DQGH 4IOIA 1RK0B 2ESVD 3GBNH 2NY6C 4F7CB 1NCWH 1A47A 4X5WA 1UFGA 1SFHA 5EU4A 1E40A 2FATH 1JD9A 4QGTA 4NBZB 5G5DA 4MYPA 3SO5A 5AEAA 3UYPA 1QR1A 5M7QA 5IUSA 4NNXA 3VRJB 2QHLA 4G70B 5LQBL 1E9PB 2XTLA 3Q7JA 4MHHI 4ZUWA 1MCPL 4HDIA 3FT4B 3PWPB 5DZ9A 5CIPA 1B9ZA 4D2NA 2XYBA 1WFNA 4K94L 2OMYB 4G9DB 4X2UA 4XCFL 1ZE3C 4JQVC 1CFVH 5CSZB 2KI6A 2VLMD 2WANA 3UPRB 1GPOL 4FF9A 3WMQA 3RG1C 2DQUH 3QEGL 4NUGH 2MPVA 1WAEA 3SKNB 3IDNB 4FCAA 3CVDA 3QUKA 3B9KA 4KGLA 2MMXA 3MYJB 4G6MH 2NYKA 4AQAB 1I9RH 4K3EL 3WDHA 9PCYA 3TWYA 4JRYD 4Z76A 2C9UA 3MODH 5SX5K 4J2XA 3FCTA 1G9MH 3F6IA 4UQ9A 2GK0B 2WQXA 4P2OA 5HP5A 4L18A 3HMXA 5CUSL 4FKEA 3KPLA 3QRGH 1K3IA 4JZJA 3BSZH 1T1XA 4YR6B 3ZOAA 5EIIB 3ZUNC 1RJZA 1ITCA 3QDGB 4LARH 4S1RH 5CZKA 3PPEA 4E9LA 4ABQA 4W9EC 2YSSA 1XGRB 4G6JL 1SLUA 3TA3B 3LV3B 4UZSA 1CICD 3OKNA 1IM9B 2D7NA 2GUOB 2MTAA 2ERJC 3CVHB 3KW8A 1X5MA 3GXNA 2N7AA 3QCUH 4XXCC 2IBBA 2E3VA 4JZOB 3AG2B 1TJMA 4E9YA 2BPBA 1RK0A 3LCYA 2B16A 3DVFA 4F7CA 1CGVA 1I9JL 3D2UD 4RDBA 3W3BA 3SCMB 5I73B 4TULH 3WFBH 3VXUD 1ACXA 2NY5H 4NB7A 3VRJA 4AV0A 1E9PA 4D0BB 1I9IH 2F5AH 4JHUA 1OHZA 1NLDH 1WFTA 3FT4A 3PWPA 1MCLA 3MR9B 2X3AA 4IGBB 2A77H 2PWHA 5I5IA 2OMYA 4G9DA 4P05A 1U8HB 2JJSA 5CSZA 2YZ8A 3WE6B 1FCGA 4KKAD 1NIFA 3QARA 3H55A 3UPRA 2D7PA 3GKZA 4M1CD 3V0JA 1JPGB 3GXIA 2CJ3A 1QTYT 4I3GA 1I3VA 2HLFD 1TCRB 1LILA 1WE5A 3SKNA 3IDNA 4RBPH 2C9AA 4ZTPH 1U92B 4OGZA 2X9WA 3MYJA 3THML 1ASOA 3ZMRA 4AQAA 1GZPB 3WTYA 1YJDC 1E4XH 4Q58C 2G4EA 2GK0A 1N8OE 3P0GB 3MRCB 1NGPH 5K9QG 1TUPA 5C0CB 1HINH 4YR6A 5I66B 5EIIA 5CLWA 1RHFA 4WK2B 3QDGA 4NRYB 5DO8A 5D7SH 3FB6B 1IC7L 3FU0A 2EIKB 1XGRA 3NRQA 3TA3A 3LV3A 1J12A 3S5LG 1DQVA 1UH3A 1IM9A 2BVQB 2GUOA 4R8WL 3CVHA 3DMMD 5F6HI 4C54A 4MD4B 3EYQC 2SEBB 2LAAA 3MNDA 4ZNEA 5JIMA 4JZOA 2DQCL 3ETBF 4AKOA 4WU7B 2N01B 5HD8C 2VLRB 3WNIA 2W59A 4KO9A 4Q4EA 4Y1TA 3L2MA 1QOKA 3EXLA 3SCMA 1XBDA 4F9PA 1MIEH 4HJJL 2YRBA 4HKXB 2W0FB 4Q74A 5HHOB 5B1BB 2VDML 3CHOA 3HI1B 2ZXBA 1V55B 4D0BA 1OQXA 3GSRB 4M56A 5E1GA 3FU9A 5JPNC 2EVGA 3BIBX 4KFMA 1A7PH 3MR9A 4IGBA 2J5WA 4N2AA 4OLXL 4W6YB 1IE5A 3WE6A 2FTAA 1K6QL 1E65A 5B1CA 4HLZG 1KGCD 1OCRB 4JG0L 2CM6A 1JPGA 1I1FB 5JTWA 1XHHA 1TCRA 1N64H 2ROYA 4P46D 1IEBB 5LN4A 1U92A 1VGEH 3Q3GB 2NCEA 4X7EC 1RUAH 1OWRM 1J5OH 1KGJA 1GZPA 1RK1B 1I1CA 2W07B 3OTTA 4J27A 3S9DB 5BXFB 1RZFL 2OP4L 4PGCB 3FYEB 5IBTH 3MRCA 4I77H 4ZW8A 5C0CA 5KG9B 5I66A 1BDYA 7PCYA 5LXGH 2ZCLH 4NRYA 5E2VH 3FB6A 2Y4SA 1EFXB 4M03A 2LLLA 2L7JA 4HP5A 3ZE2F 1CDIA 3EJPA 4LAJH 3RGHA 3QDGE 5DC0A 2VYRE 2BVQA 4ONHB 3QJUB 2ADGB 4D94A 3DC0A 4MD4A 2SEBA 5T1LB 1G9MC 5C1MB 5L6YH 2WINB 1IT9H 4ZMYA 3BIAX 4WU7A 1YQVH 2VLRA 3EO9L 4KV5E 5DHDA 3VRLF 2Q5BA 2GBTA 4ZNEE 4KKCD 5LLIC 1WS8A 4ZK8A 1K72A 2VZ1A 4HKXA 2W0FA 1N7ML 4WI3A 5HHOA 3HI1A 4ZS6D 3ULVL 1NIDA 1WCBB 2IG2H 3FAXA 3GSRA 4P04A 4YDZA 3S35X 3NEEA 1QLEL 3F64A 3V79C 1G7JB 1MJ7H 1CLOL 4GP4B 4PJ7F 1MF2L 3TPUB 3US1A 1NGYB 4ODHH 5GZOA 1V54B 5DMYA 5DA4A 1VFBB 2QTEA 4GG6B 1RIUH 3LNDA 3BI9X 1HSBB 3BQUD 5C07E 3U1SH 2NY5C 3NACL 1I1FA 2OSYA 4IMKA 5IMLB 5HHVL 1IEBA 1SOKA 2E9JA 4AMWA 3Q3GA 3I74A 5BMFH 2Y25A 1SRDA 3UJIH 1F45A 3D4GA 4RMQA 1RK1A 4PJ9B 2W07A 5KANI 1ZGLP 5IROD 3VXMB 5BXFA 2XU9A 2I25N 3LY6A 5LGHH 2ZCKH 4PGCA 3SD5A 5GRZA 1QYGH 4KMLB 5KG9A 1E5YA 1JPSL 3NZSA 2H32H 4DJMA 2FEEL 5DK3A 3ARPA 3N1PC 1JPFB 4GLRI 1U21A 2G60L 1EFXA 1CJYA 3D9AH 3AY2A 2CGRL 4ZMVA 1KIUB 4ONHA 1Q9WB 2ADGA 1NAMB 4PLKD 3TCTA 3F83A 3DRQB 5T1LA 1PQZB 1MXGA 2V3FA 4KQ0A 2WINA 2DEXX 2WWOA 5IFHL 4BM7A 3NGBB 1X4XA 3DROB 4UM9D 3ARED 3VXRD 2EH8H 5FDYA 5D1QD 4OD2B 4GUOA 3JWDH 1UC6A 3C75A 4MA1C 1RV6X 4KK5C 1N18A 1INDL 3GSNH 4OLWL 2VLRE 4Y5YB 4ORZC 2G2NA 3Q43A 2W95A 3RIAK 3SE3C 4E9RA 1E4WL 3PL6D 4YGAB 5H8DA 2V6HA 5T33H 2F54D 5DHVH 1WCBA 3J2PA 1YEGH 3ZE2B 1OP3H 1G7JA 1EZLA 5HHOE 3VYPA 1JN6B 3TPUA 1BW8A 1NGYA 5DYFA 2HFFB 1VFBA 1L9PA 3EGSB 1GY1A 4HK3J 4KZEL 4GG6A 1JRHL 3I2CH 1Y7VA 3OKMB 4YDJB 4J5VA 4XHJC 3P11L 3FU3A 3LQAH 1HSBA 2XWTB 2IPKB 3VWJB 3IDXL 1BQHB 4BHUI 5IMLA 2VUKA 3GC3A 5DZAA 1REIA 2OMWB 2Y07L 3Q1EA 1G5GA 3WHE1 1XAKA 3HAEB 1ECYA 2WJ5A 4NUJB 4GUQA 3IBOA 1F4WL 2X1WL 2YAMA 3NMEA 4PJ9A 1E9OB 1LQBC 5LNDA 2IOOA 3VXMA 2NOYA 3HI5H 2EDTA 1LQSR 3AS2A 2OSXA 2D9QB 4PW9A 4NQDD 4YFDB 2BLFA 3EYUH 3IN2A 1JPFA 4NHUB 2XV2A 3NQKA 4HISA 5EORL 3RGVD 2V9UA 3VYOA 1T89C 4NN5C 4BQ6A 1BCIA 2BVYA 4POYA 1KIUA 4KKLD 4XMPL 1Q9WA 2ZPKH 1NAMA 3NJJA 3WIFB 2GI7A 3JTBA 3DRQA 3WD5L 1PQZA 1X5HA 4NT6B 3RX8A 1XSIA 2DS4A 3QS2A 4XPHH 5AZ2H 3GSXB 4WFED 3DROA 3GK8H 4MXVF 5C0DB 4Y9BA 3H42H 1UM4L 4OD2A 4KO5A 4DP7X 2WKLA 3N9GL 4DGUA 1U95B 4Y5YA 3NPSC 2L4OA 3KMDA 1C1EL 2E74C 2XHNA 4EN3B 2C7FA 3ZRCC 1LEGB 3K8MA 3BWSA 2Y2TA 4FTDA 3QB7C 1KEMH 2W0LA 2MH4A 3C87A 4GI9A 1JN6A 3ESMA 2HFFA 3TV3H 3PNRB 2XN9B 3EGSA 3HRZC 5TK2A 2CO1A 5E8PB 1UCBL 2J88H 3OKMA 3CC1A 4YDJA 4C4BA 2PNDA 4FG6C 1SEBB 2XWTA 2IPKA 1T4WA 3UC0L 3VWJA 3GF8A 1BQHA 1JAEA 4GG6E 3QWNA 3IKKA 5CU9A 4S11A 2OMWA 1CL7I 1MN4A 3CSPA 3H3PL 3TFBA 4GEIA 4MMZB 5E2JA 4KI5F 3WFEL 1A3QA 3HAEA 2FECL 4NUJA 1HZLA 2VSDA 2OJZH 4N2IA 1E9OA 2QVIA 1ZAGA 4Y5XC 1U3YA 1OALA 4Z23A 5CD3B 2W8CA 4IDJL 4XO8A 3VXME 2VDRL 5KVFH 4KHTL 3A47A 4A2HA 2IFGA 4MS6A 1OK8A 2H26B 4NHUA 5E8OB 2UZIH 4LOFA 4CA4A 4LSVL 3KEHA 3OJVC 5GGVH 1B3JA 1D5IL 4M5YH 1TNNA 1N12A 1CGXA 3ILDA 2E8YA 2PPAA 3WIFA 4YGVB 1AQHA 5DD3L 3N85H 2G2RB 5JZ7C 2YXVA 4NT6A 5MHSE 1SXZA 1L3NA 1ZLDA 3GSXA 4NYLB 4XC3L 4XVSL 3ETTA 4NCDA 4PRIB 2Q6WB 5GGVY 1AGEB 4JN2B 3C6LB 1JYWA 1RFDH 4J1UB 1NGZB 2EDLA 5F9WB 1U95A 1PG7X 1F0LA 4S0SD 2NYYC 3TP4A 4EN3A 4YHIB 1LEGA 4NZRL 4P2RD 4I9XA 2XN0A 4TTDC 4FFYA 5LJYH 5SWZB 4JKPH 2CJTA 4IOFC 5BUPA 3HVNA 1QSFD 1ZT7B 4AMXA 3ZE2E 2XN9A 2BS9A 4LF3B 1WGVA 2ZIDA 3GO1H 5E8PA 1T7VA 5EH1A 3KJ4B 3JWDC 1BQUA 1FL6B 1Z66A 1SEBA 1DVUA 4R5TA 1PJ9A 4WU5B 1DL7H 5DJAB 3L08A 1KFGA 2BVUA 1J9SA 3LDBC 4G6KL 1E5BA 3JXAA 3O45B 4N0CD 4OR1A 4R0LC 2JJTC 4MMZA 4GIOA 4KROD 4DK5A 4JO3L 3DOSB 4DO4A 1RPUA 5H37A 3IEAA 3QZBA 2ZYIA 3G5WA 5J13B 4X9GA 1QNIA 3N1GC 1G7HB 1MRDL 2OYKA 2GCYB 1IIIA 3GS4A 4O02B 1ETZB 2NYZA 1BQHG 2EIEA 3WSQL 5CD3A 5IJCC 1V3LA 3LQAC 4DTGH 5GRXG 2DLIA 3IJHB 3OLGA 2D3VA 1O5DT 5DLLA 2H26A 3MACH 4FC3E 4AMKH 5E8OA 4XVUD 3WTVA 4N8CH 4G7SB 1KTLB 2VQTA 3T0XA 4UINL 3E8UH 1S9YB 1J88A 3GXUB 2X70B 3HN8A 4YGVA 2PW1B 2G2RA 2Q8AH 4XP4L 5ACZB 4LCYB 4NYLA 2P52A 1BVNT 2NNRA 4JPVL 1CFNB 4PRIA 2Q6WA 1AGEA 3F5WB 4JN2A 2ATKB 3C6LA 4J1UA 4HGWB 1NGZA 2Y6SC 3EH2A 2L7EA 4Y19B 1S9KC 4R4NC 4Q7DA 1XCQB 3QR1A 3T5WA 5I16B 5H4YA 1QHQA 1N0XH 5HPMB 4MSWB 4HIJB 5SWZA 3AMLA 2AJYL 5D1ZD 3GHBH 2NY2C 3ARFD 1YEDB 4BCYA 1ZT7A 2EXWD 2UWEB 4LF3A 4NNYB 2FYYB 3DPBB 1OWWA 3JWNH 3OD3A 2F53D 5T3XD 4PVNA 1FL6A 1MCIA 2L3BA 3ELAT 4PREB 2XN9E 2J2ZB 4MZ3A 1E42A 1FNGB 4WU5A 5DJAA 5E0QA 5B1AB 3HG3A 2CK0H 3E38A 4JDEB 4KJQD 4AGNA 3KZ8A 1H8NA 3D33A 1EHLL 1O7SA 3O45A 3UDWA 1V8HA 5AD0B 3MJ6A 4GXFA 12E8H 1Q0YH 3DOSA 2RCSL 4LOUC 3K5SA 3S8GB 2QJDA 2QSQA 1CFBA 2XRAL 3CVIH 3MBEC 4PS4L 2ITCB 1G7HA 2APSA 3TYGH 1Z32X 2OJEB 4JW3A 2GCYA 1KB3A 2FUTA 1ETZA 4O02A 4N20A 1A1OB 4BKTC 2NY7L 3MA9L 2QQLH 3L2LA 4YSUA 3JVGC 1H5BC 1MQKL 2OR9L 3IJHA 4QHPA 5AW3B 1T6VN 5TGBB 3OGCB 3L5XH 4MHHG 3KVPA 4FHKA 5CJOL 4PLJC 4XP1H 1KTLA 1AHWB 2YUZA 3ALXA 1L6PA 1S9YA 1OSEA 3BZ4B 2X70A 2MKWA 2VDQH 2PW1A 1GZHA 2XWJB 1IJNA 3GBMH 2KYIA 5ACZA 4LCYA 4YSPA 3H9HB 4Q9CA 3V6FB 3BIKB 5TJWK 1CFNA 3BVNB 4TQEH 1CXIA 4WFFD 3F5WA 3N91A 3QNZB 5CP3A 5F1SA 2ATKA 4KAQH 3VFOB 1EEZB 4HGWA 3FQ4A 1J5IA 4Y19A 3FZUD 2QPDB 4ZFFB 1XCQA 5I16A 3L7FB 5HPMA 3VD9A 4JM2D 4MSWA 2A74B 4HIJA 3FOLB 3KS0J 1C5CL 4X6BB 2A9AA 4M8RA 1N5YH 1MCJA 1YEDA 1ADQH 2R8SL 1QLFB 5IB1B 4WEEA 5SWZE 2UWEA 4M6OL 2GJ6B 1GGIL 3S3SA 3CH8A 4ZOAA 4NNYA 2FYYA 3DPBA 2R83A 3QEUB 4PREA 2J2ZA 1FNGA 5ELIA 5I1HH 4JDEA 4S1DC 4FQ2H 4MXVE 2AF2A 1DANT 4PJXF 1KYOK 3RFZC 5AD0A 2JNZA 5KYNA 5SX4H 1FL3B 3VW3H 1N70A 4PR5B 1ZT4B 5DD1H 2ITCA 2XUWA 5I0YA 1JS4A 2OJEA 4TUJB 5FGBA 3MTXA 3IFNL 3B5GA 4NN6B 1A1OA 3GI9L 4W6WB 1NMBH 5K1VA 1T83A 1OTUC 3ZJAA 2PUQT 1IAMA 2X4TB 2ZT9C 4WGVB 5TGBA 3OGCA 3PQYB 4HJIA 1YEIL 1G1YA 5CILH 2MCG1 3ZT5A 2MIZA 5MI0C 1A1MB 2JI3A 3ZRFC 4PJ6A 5A2KH 4K5OA 3I6SA 5DUPH 2PO6D 2AABL 3QIWB 3QI9D 1AHWA 2WBJD 2VMJA 3BZ4A 4I0PC 2MOGA 1FFTB 1TNMA 2XWJA 3SYQA 3ZDZB 2X0UA 2XETA 5EEUA 1EO8H 3WFHB 3H9HA 3FTUA 3V6FA 3BIKA 1B2WL 2Y3NA 3FQ2A 4OM1L 5EEXA 3BVNA 3QNZA 4GKZB 3VFPB 3KW7A 2HWZH 4IKNA 3VFOA 1EEZA 3EH5B 4DP4X 5HYQB 4DN3H 4ODTL 3AXIA 4ZFFA 4LRIC 2WCGA 4J3OF 5D7KD 3RZWA 2KUTA 3C8KB 3L7FA 3OHMB 1P7KB 5DK0B 2F5BH 2A74A 4KKAC 3MBXL 4MA7L 3FOLA 3ARGB 4Y19E 5SWQB 4X6BA 3C12A 1QLFA 5I9QB 5IB1A 4UNIA 2GJ6A 4JFZL 4YFLF 4NKIH 4ADIA 1RVFL 4PG2A 3K2KA 4J6RH 1U8CB 1D6EB 4QRRD 4ELKB 1VGKB 2UWEE 3QEUA 5HBBA 1IL1B 4JL1A 2WSDA 3U82B 4DPAX 3JZ7A 2APBA 3POHA 1OGSA 3MRLB 3MSPA 4FL4C 2DWEB 2E59A 4N90D 4XE5B 5E2UH 4KVNH 2RB8A 4AEHH 4ODUB 2HFGH 4W4OC 1FL3A 1A6VH 3ZL4L 1E8YA 3G08B 4XN4A 2H0PA 3A21A 2AJ3B 5ALBH 4PR5A 1ZT4A 5I76B 2VL5B 5DXWA 4MXWL 5JLZB 4LCCC 1GCYA 4TUJA 1NSNH 4XNYL 1FV1B 2KL6A 3JWNC 4OM0L 1BFVH 4HSAC 2X4TA 2I60H 4AUUA 4M62L 4WW2F 3PQYA 5JHDB 2X1QA 1PD6A 4X9YA 4CVWA 4YDLC 1A1MA 2WGNB 3W2DH 2J6EA 3INOA 1NBVH 4PJDE 4OY9A 3QIWA 4Z7IA 4PJXB 1SHMA 5DURB 4CILA 4DUXA 4XAWL 4OU3A 4K8RL 4S1SH 1SQMA 3GTNA 3RILA 3D48R 3WFHA 2GQHA 2O6FA 4K9JA 2JKSA 2A4CA 4MJ5B 4GKZA 3VFPA 3RUGB 5HYQA 4EKJA 2EUZA 3KL3A 3EYOB 4YSOA 3SDCC 2BCMA 4PV9B 3C8KA 3M7OA 1COBA 1P7KA 2EZ0D 2EDKA 5DK0A 4ZG1A 3ARGA 1AYRA 1HHJB 4MB3A 5SWQA 3U4BH 1H3WM 4KDWA 4BV1A 3IKCB 2NPLX 4OIIL 4B97A 4NM4H 3A4AA 4HJ0D 3D39D 1U8CA 1D6EA 2IIJA 2X87A 1E8XA 2XZZA 3CSBA 4KTYA 4QD2E 4LQFL 1VGKA 4ELKA 2X3CA 2VXQH 1IL1A 2GJ6E 4H8WL 3NCWA 2A1WH 3P0YL 2LHAA 3MRLA 2B4CC 2DWEA 1CBVL 5HDQL 3PFUA 1UGNA 1FHGA 2DQIL 4ODUA 5K69A 3G08A 3B9VA 1TU2B 2AJ3A 4RISL 4PHXA 5I76A 3FSZA 2VL5A 1HNGA 4O2CB 1HAUA 4NQED 3GTTA 4DGVL 4XMLL 5JLZA 1KC5H 3FT1A 3T4AC 1FV1A 2EVIA 4TLSA 4QOKB 3WFDH 1A64A 3GS7A 2OMZB 3ZZ1A 4XCCL 3VGHA 1INQB 1KNOB 5KWYC 3BE1L 5JHDA 1KELH 4MAYB 1RMFL 2ENSA 5ILTH 3KVQA 5ESQB 3HC2A 4UQCA 4XI5D 3HCVB 3PQYE 2FGWH 4XNZC 3VFWB 3VYNA 4PJXA 1QFWM 2VWEE 4GY4A 3E6HB 3JVFC 2PP7A 1E3ZA 5ACLA 2YKLL 2QDWA 2HKHH 1H3PH 4HZLB 5EZIH 4N2HA 3VSTA 4MJ5A 3WIHL 3KXFD 3ZDZE 2J4WH 4X7TB 3FTXA 3RUGA 3W9DB 4NZ8A 4LLDB 2XJLA 3EYOA 4Q6YA 4I85A 5AW2B 4ICWA 5GS0L 2HTLD 4PV9A 5KS9B 5KANG 3IGKA 2F68X 1UZ6F 5D2NB 2CIIB 3LS4L 2AEOA 5IWLC 4PH8A 1MJ8L 5AZEL 1HHJA 1I8IB 2CKBB 2F61A 2GTZB 2VH5H 5CJXA 3IKCA 5FYLE 2Z31C 1UM6L 4LHUB 3QH3B 3EH4B 3B9KD 1LLAA 4EI5B 3RTLA 1HK6A 2OK0H 2HVJB 1HFUA 2V5TA 3LNFA 2YAHA 3OAWA 5IQ7H 3VXNB 2XQYK 2CPCA 1TZ8A 1H3GA 4IM8A 3T2PA 1TU2A 4NX0A 1HXMB 3MJ9L 4O2CA 5I17B 3O6FD 2BX5A 1JP5A 4WK4B 4Y4HD 4JRLA 3MRDB 3IFPB 4UUJB 1CL7L 1DQLL 3QFJD 4ZO7A 5E9AA 4A7SA 4QOKA 3QR2A 5I1EL 2OMZA 5ITBH 3V5DB 1OGTB 3QIUC 1INQA 1KNOA 4F8QA 1XT5A 3EOYG 2DIEA 1JERA 2IPTL 8CGTA 4HH8A 1YYML 2ADFL 4MAYA 4ZOBA 4ZD3H 3WNLA 3QC6X 5ESQA 5EMYA 4N6RB 3HCVA 3VD2A 1R3KB 1JPTL 2XBDA 4NO2B 1F90H 5JHDE 1KCRH 3VFWA 4HZAA 3LD8C 3AREC 5ADPL 1CIDA 1KBVA 1NMAH 5T5FH 2D7TH 3E6HA 2P7TB 4Q9RH 4WJKB 3V6ZB 1SBBA 3VI4E 1A02N 2H1PH 1ZEAL 4HZLA 1IJ9A 1X5IA 2NDFA 2XWRA 4XPGL 1UATA 4X7TA 2WJ7A 1VZIA 1Q1PA 3LHAA 3MRIB 4HKBB 3W9DA 4C57C 1RJCA 4K7PX 4LLDA 2RMNA 5KS9A 3RUGE 4KFZC 4P5TB 3KM1A 3RVUD 5D2NA 2CIIA 1F1AA 1JZ3A 1NKRA 4QF1B 4NFCA 2VR8A 1I8IA 2CKBA 3S37L 2YR3A 2GTZA 3S2CA 5EEWA 2EABA 5E6IC 1YEKL 3AACA 4MRCA 4LHUA 1LVEA 4PS3A 3QH3A 4WTXA 4EI5A 5GJSL 2BNUB 2HVJA 3IFLL 4LOVA 1B0GB 2UXTA 1I8KB 3VXNA 2FJHB 1ZLWK 3P9MB 1MJUH 2HZHA 1AZCA 2NXYB 3ZMEA 5CFHA 4LP5A 5FCUH 4H88H 1FORH 5FHAL 1HXMA 4H1LB 3W39B 5I17A 4JN1H 1B4RA 4NNPL 4PLOB 3MRDA 3IFPA 2NY0D 4UUJA 5EO0B 1A3LH 1MY5A 4HS8L 3RGVC 3FRPB 1MFCL 1I4FB 3V5DA 1OGTA 3T1WA 2FLRT 5EU5B 2DQHH 1R4XA 3NCBB 1GOHA 2WXJA 1QSVA 4QXTB 3QNXB 3Q13A 5JHLL 3FKUS 2AAAA 4N6RA 2Y5TB 5DD5H 4U6VL 4NO2A 4GAGL 4GMSL 5AW4B 1R46A 5FYJL 4FQXB 3RQ3A 2P7TA 1AC0A 4O51B 5AWNL 4UT7L 3V6ZA 5AB9A 4DFHA 2HT4D 2VN7A 3SCMD 5DLML 3OQ3B 2Q20A 4LVNB 1SMDA 5TE4L 2P44B 3VVWA 4RWHA 2HRHA 4JE4B 3P3UA 4U49A 5ICUA 2YD5A 4HKBA 4M5ZH 5L0QC 3MRIA 1KENL 1KJMB 1WF5A 5FOJA 4PQXA 3BFWA 1K4DB 3KGTA 4PMEA 4GUPB 4B53A 3VXQB 5D6DC 1N19A 3LNGA 5BZWB 4P5TA 4TSAL 3HBPA 1A7OL 3DRTB 3ARXA 4QF1A 5KS9E 2YQ2A 1U6AL 1P7QD 4HULB 1URIA 4PB0L 3Q6GH 1N0LB 2X4OB 4TPRL 2F9BT 4JFUA 1QPXA 4NS0A 2BNUA 1MCWW 2IANB 5IBUB 2CO4A 1UENA 2D0FA 3CZKA 4UTAL 1PIFA 4JUTA 1D2PA 1B0GA 5EF2A 1ZT1B 4FZ8H 4GKOA 4KVCL 3V8OA 1I8KA 2FJHA 3P9MA 1T2JA 1HNYA 2E7HA 4GBXB 4IMLB 1JPEA 2EEBA 4Z0BH 3W39A 4H1LA 4P2QB 4AV4A 4X7SH 3M86A 4NC2B 3SPGA 3DO7B 3SYOA 4OLYH 2O6PA 4UTAA 5EO0A 5GGRB 3OZ9L 4M1DH 4CNIB 5AAMA 4UOW0 2DM2A 3FRPA 4WFHD 3MLSH 3I02B 1I4FA 4JAMB 4PS8A 4R7VA 1NEZG 3V0WL 1EH9A 4P9ML 1YUHB 3BP4B 5EU5A 4AC2A 4QXTA 3QNXA 4PCYA 3IWVA 4RAHA 3CLEL 3U2JA 5FFGA 1YNLL 2WPGA 2Y5TA 3NK4A 4FQCH 5EOCJ 1AR1D 1UB6B 3ZE0B 1Y6NR 3FL7A 1U33A 3G6DL 3RWCB 4FQXA 1IQWH 2X1OA 2WSPA 4O51A 3CIAA 2E27H 4O4YL 2GT9B 5D93C 4PWFA 2NXZB 1KTJA 3S5YA 4NQCE 4PB9L 3ZK0A 4DOHE 2J5LC 3MAWA 3PWNB 1HTYA 4RH4A 1DEDA 4LLWB 3BZEB 3AS3A 4U05A 1KTCA 2HX7A 3MGAA 1G9NH 3ZR5A 4ANUA 4HCRL 5IFAH 4OTXL 4W9IC 1KJMA 2VDPL 3DSFL 1K4DA 4GUPA 3VTTA 1KXQA 3VXQA 4BFBD 3NEXA 5BZWA 3AADB 4O58L 1ZPUA 3DRTA 2HH0H 5FO7B 5EFIB 3ILQC 2CCLA 4B6ZA 1CYXA 3FN3A 5GGQL 3G5ZB 4RIRB 3TF7C 1N0LA 2X4OA 5E94B 4G7RB 2EE9A 2AVFA 2CMRH 3D08A 4NEHB 4A6YH 2IANA 3CFTA 3MKGA 4QYOB 5DJ6B 3FOMB 3LS5L 4AIOA 3QUZB 3RHWF 1LE5B 3TX4A 4KGJA 1ZT1A 1M53A 2X7LB 3L3OC 4ORGB 2ODHA 3U48A 3QORB 4GBXA 4IMLA 2ZE0A 4B96A 5HYJD 4FKKA 5IESH 4LVEA 4P2QA 2C1PB 3CQFA 1UGKA 3V4UH 4AYEC 5CF3A 1XH0A 3DO7A 4N86A 1E9QB 4P59L 1DJSA 5GGRA 1MHPH 1EFXD 3BZFB 4CNIA 4KZ0A 5TQ0L 1UM5L 4PGEB 4MJ6A 1TSRA 2UZPA 3I02A 4JAMA 3L3GB 4X4YB 3AITA 1NL0L 5L9DL 1YUHA 3BP4A 3O2DH 2HRLA 3UTPD 2XX1A 1AZZC 2FRGP 2BERA 4XMZA 4FQLH 1PZBA 1A6ZB 4KTEL 4HV8B 4DERA 2TSAA 1UB6A 3O2WL 4YSQA 2HT2C 1S9VB 2W60B 4OVUA 3RWCA 3OLDA 1A6TB 3N43B 1FNFA 3FPYA 5EUOF 1SM3L 2GT9A 4GRLC 2X4RB 2VZ3A 1KEGH 3QUML 4H4NA 5I74C 3L8QA 3PWNA 3SKUD 4LLWA 3BJLA 3BGMB 4CGTA 3BZEA 4N1HB 2N1KA 5AOMA 1FBIH 5F8RC 1VEPA 4NFDA 4NZTH 4S1QL 4OGYH 1AXSB 2EXWC 1YNTB 2DPKA 4AVIA 1FIGL 3FFCB 4P4RB 3OSVA 1VERA 2L0DA 2A6KB 1UD6A 1KXQE 5FO7A 5JXAL 5EFIA 1AI1H 4QI3A 3FXIC 3ZPDA 1E67A 4GB9A 1MFAL 3G5ZA 4RIRA 4GS7B 5FGCB 1OARH 3TNMB 1LMIA 3LZLA 3VFSB 4PAZA 3VSUA 2VC2H 5E94A 1S78D 3TO2B 3UG3A 1BM3L 2VN3A 4QYOA 5DJ6A 3FOMA 3BKCH 3JQOB 3QUZA 1LE5A 2BWIA 4W4NA 2DRUA 3PY9A 4C56B 2X7LA 2VM4A 1EA9C 1A22B 2B2XH 3B2UC 1R3IL 2IANE 2W9EL 3G5XB 2R2HB 4JE0A 1X6LA 3QORA 4OZGB 4AYID 1M9WA 5IQNA 4QUOA 4KMQA 3ARVA 3GSVB 1YY9D 1DVTA 4QKXB 3CDGB 2C1PA 3KLDA 5ABDE 5L4JA 1E9QA 1AAJA 4GRWF 1E6JL 2J1WA 3BZFA 4P2QE 5BZDB 4PGEA 1SLXA 4NPKA 2ORBH 3D3VD 3TT3L 3L3GA 4X4YA 3RZCD 3L5WB 5ECGA 1BAWA 3ULUE 1WZKA 1A6ZA 1KZQA 1HL4A 1LXMA 2CBTA 4HV8A 4IHOB 4KMTL 3U4KA 4FOMA 1LHZA 2WVVB 4XPAH 1S9VA 1IKFH 2BVTA 1UWGL 2W60A 4HEPA 4KUZL 5GSVB 1A6TA 2OW7A 1J0KA 3ZE0E 4ODWB 3TU6A 4OZ4B 1BYPA 2H0FA 2PCXA 2X4RA 2ATPB 2NY4B 4W81A 1DEEB 3PWVB 4AQ8C 2WTRB 2XZCL 1NC2B 2DM4A 4JM2C 4CN1A 3BGMA 4CL7A 2G3XA 1BWWA 4ZT1A 2W91A 1PEWA 1KDIA 3SE9H 1JG9A 5L88H 1AXSA 4ABVA 2WXMA 4PSRA 1YNTA 4P4RA 3FFCA 4OCXH 5EU3B 3VGEA 1PSKH 2A6KA 3WLBB 3BPOC 4UT6H 2PYED 4K4KA 2NY3D 4G72B 4KWUA 3C60C 2YPVL 5EUOB 5SV4A 2DAVA 3OAUL 3TNMA 3VFSA 3CDCA 5AG8A 1IAKB 3ECUA 1G9NC 3FSAA 4TNVF 1E6OL 3BVUA 2RJMA 3RWIB 1RZGB 4ZFOB 2DL9A 1TO4A 5FEBA 4IBUA 1QRNB 2E7CA 1A7QL 1CDUA 1OHQA 5D1XC 3EG9B 2VDLH 1X5LA 5HVGB 4C56A 3G5XA 1Z5YD 4OZGA 3N1QC 2R2HA 2XY1A 4WO4D 1EO5A 1WIOA 2Y69B 4PGJA 1OZUA 3GSVA 4ZXBD 3AQDA 4D9QD 3CDGA 2YK1L 5DZOA 1QBMH 1JXKA 2CG9X 3VE0B 3L4TA 4JGUA 4PWEA 3FMGH 6FABL 3DBSA 3SYPA 1LE9B 3WI9A 5BZDA 2J8OA 4FG4A 1PNDA 2ED8A 2IEPA 3I84A 5CIPH 4BSVB 1I53A 3HG4A 5DJYB 1MFEH 3L2NA 3L5WA 2H4EA 5AZUA 4OIBA 1PY4A 2GTQA 2RHEA 4BZYA 4F7MB 3CZLA 3TEXA 3B43A 4WWKD 2J8UF 3GSWB 4IHOA 5JXEA 1RULL 4N1CA 4KI1A 1XGZA 4F1SA 2WVVA 4MAZA 2V7NB 4NBXB 1BYOA 5GSVA 5E5LA 3ABMB 4XPFH 4FI8A 1J1OH 1NH6A 4HKJB 4WZ9A 5DFVD 3BRFA 4KRPD 1X5YA 4ODWA 3KAAA 1X9LA 4OZ4A 4WTQA 1WA2X 2ATPA 3J7HA 1DEEA 5HDWA 4OCRL 2WTRA 3LMJL 4GRWB 1NC2A 4XCEB 4ADJA 4XVJH 3CN2A 1XMEB 2D0GA 1V3MA 5F7UA 3F58H 2Y1ZA 3FUKA 3HMXH 1QFOA 3GIZL 4JPIB 4YZFE 4ZI8A 4IDLA 1ZTXL 4ZYKB 2ZQKA 1QUNB 5EU3A 4ZFOL 5DQJB 5F93C 3BWUC 3WLBA 3FQXB 4N25A 1JXFA 5DVNA 3FFCE 5JW4M 1PDKB 3B9DA 4HT1H 5EUOA 2XWXA 1A8ZA 2DD8H 3F3HA 3SE8L 1IAKA 1NCUA 1X7TA 1PFCA 2EC9T 3RWIA 1RZGA 2XKSA 4OLUH 1A14L 4ZFOA 5FGCE 1U3ZA 1QRNA 3WY1A 5C0ND 2CRZA 2WY3B 2XWCA 3BMWA 1DLFH 3EG9A 4QLWA 8PAZA 4RZKA 2ATAA 1IZJA 3F84A 3QCTL 4AYBA 4Y2DD 5I5RA 3ZSTA 2V2WB 4C56E 3L3HB 4IRZA 4HLZH 3QWOB 4OZGE 4JUSA 1DSFL 3QEQD 1YMMB 5F96L 3VE0A 3LEVH 2ZX9A 2EDQA 2VTFA 5T1DH 1LE9A 1CTOA 5C6TH 2IQ9H 4BSVA 3OPZH 5DJYA 5JW3L 2MWCA 3FH5A 4IIZA 4PJFF 2DW5A 3AB0C 4QRUB 4ZMQA 4F7MA 3C2AH 2N3JA 3GSWA 4KNTA 3CJJA 1MPAL 2V7NA 5J1TC 4GIAA 4PRID 4HIIB 3HLKA 4HKJA 4JB9L 3SDAD 6PAZA 4KITB 5KSUB 3P2BA 4F57H 5AOZA 3INUL 5JOEA 2I32A 3ARQA 1DBBH 4MKTA 1PL3A 1J5DA 2AGJL 4XCEA 4EOWL 3A22A 1I1RA 1RZQA 1YYLH 4LSSH 7TAAA 3KD4A 4PN6A 4BUGA 2CXKA 1QATA 1G6RB 3CZJA 1EGJA 4JPIA 4RX4A 5CD5D 4ZYKA 2R0LL 1QUNA 3M1CA 5A3ID 5DQJA 2NMSA 1HOEA 3UMTA 5TK4A 1O5PA 2XJKA 4G5AA 3FQXA 4U7KA 5JPMB 1EXGA 3NJIA 2V2TB 4HJ1A 1PDKA 4G9FB 3DHPA 3CVHH 4MZIA 3GHPA 4MNQD 3DX1A 2VISB 3O8XD 1YRKA 5DZVA 2H2PC 5B38B 2XICA 4PVMA 1AJ7H 2XSKA 4QHNB 4G11A 2A9NL 3IMTA 4JFHD 5JQHC 3CFQA 3WEXB 1ET8A 2V2WA 3L5IA 5HHMB 3L3HA 4Z3JA 3QWOA 3HA0A 1SJHB 4K5PA 4RBPK 4HX1B 3OMNB 1YMMA 5T1KB 4QHLB 3KH3A 4GXVH 4U1SB 2AQPA 1DVQA 2DQJL 3IU4H 3I6LD 4Z7AA 1BF2A 5GZNA 4QRUA 4KI5D 4WFGE 2EEFA 3HE7B 3HB3B 3SOBH 2D3LA 4HCGA 2DIBA 1PBYA 3O0RH 1RL1A 1V7ML 4LEEA 4P49A 3ZTJH 2Z0UA 3FQUB 4HIIA 3ZZLA 3I50H 1TFHA 1JZJA 1E50A 5KSUA 1FO0L 2P24B 4XH2B 4UOW1 2B9BA 4YHPB 4U3XA 1A5FH 4N22A 1DCEA 5F7BA 3E9UA 4AL8H 4FFWC 5GRJH 4ONFL 3TFKD 2XXMB 5HGDB 5K1NA 1X5FA 4FQPA 1RUMH 3L5JA 3MJ8B 4K9EH 5DQDL 3EJYC 1G6RA 3WY3A 3G5VB 3Q5TA 4PJFB 3T0DA 1TQTA 3X14B 4LPUA 4BCZA 5F6IB 2Y23A 4APQD 3B9KC 4LCWB 3V52H 3OKYA 1B88A 5I1KL 5JPMA 2I5YL 4UV7H 4YO0B 1U4EA 4PIBA 2V2TA 3A67H 4FCHA 1Z9MA 1AHKA 4QTIL 4G9FA 2AQSA 1E4XI 2UYLB 3R18A 5D7JD 1TMCB 4NQUA 2OS7A 1DBKH 2VISA 4P2OC 4NIKB 1CR9L 5AUMB 4JZJC 4L3EB 2VZSA 3T2NH 5B38A 1TETL 1AOHA 3IS0X 3VFTB 3ETSA 4X50A 4NZFA 4QHNA 4CC4A 3WEXA 4QJ4B 3APMA 4OJCA 3IWUA 3K46A 1MI5E 1SJHA 1ZCRA 4HX1A 4EE2A 5HHQB 4PY8I 1OAXL 2OTWB 3MROB 3IDMB 3QXWA 5T1KA 3TIDB 4QHLA 1WV7T 5K9OB 3IB4A 4U1SA 2Z0BA 1YMME 4LXFA 2XQYG 3AVEA 4BUHA 4N3TA 4DGIH 2A6JB 3HE7A 3R7RA 4HK3N 4BRJA 5D5MB 3GEWB 4ZBJA 1XH2A 3O3DB 4Y4FD 5HTSA 1Z3RA 2YXFA 3NJVA 3FQUA 2HRGA 4KXDA 4MNHB 5DRWB 2VZVA 3GXTA 2P24A 4XH2A 4Z6AT 1MRFL 3UCRA 1GJIA 4YHPA 3K6IA 4JKNA 1IGCH 2WTOA 3QJXA 1GJUA 2H9GB 3DJTA 4RMTA 2JJSC 3MRNB 2MQ3A 5HGDA 2P8LB 4JNXA 4EBQL 5A16B 4Z7NF 3MJ8A 1SJMA 3D0LB 4X0NA 2IPUK 2VLLB 2DQTH 3G5VA 4PJFA 4EQ2A 5K5YA 4ZUTB 1INEL 3X14A 4BKLB 3QPXL 1OTTC 2DKSA 2VLJB 4Y1AB 5HHXL 1C8QA 4LCWA 2BO0A 3MLZH 2ZKHL 1QEXA 4N5UA 4YO0A 2J56A 2EDMA 3QUYB 2BIOA 3WJJA 4Y9FA 2WN3A 1TQWA 2GG1A 5I19H 4WI7A 2MNWA 2UYLA 3GINA 4HLJA 4NGHH 3KE0A 2OM5A 4P5MB 1S7TB 5E5RB 2YFOA 1K5WA 4G9FE 5AUMA 4MAUL 4L3EA 4TF4A 2ZNWA 1BZEA 1ZK5A 1J18A 3IPBA 3SDDD 3VFTA 1JNJA 4YXHL 5AOLA 4E9SA 5LAXB 4JO1H 2DKUA 4JS7A 2VZTA 3TA3C 2GUYA 4QHKI 5GS3A 3WBDA 5EEVA 2G9KA 5KVGL 1F8TL 3LEYL 3MLTB 1OP5H 5HHQA 1JCKA 1GC1H 1LK2B 2OTWA 2AI0L 3QHTC 3MROA 1LD9B 3D12B 3IDMA 4I4WB 5HHME 3TIDA 2YHGA 3GHEL 5K9OA 5B38G 2XBZA 1JTOA 3CK0H 2BP3A 4MQ7B 1QLRB 5LO7A 2YA1A 3LZQA 5G4MA 2AJXL 5LCVA 3GEFA 2CM5A 1XB3A 2A6JA 1GS7A 3MOQA 4RGND 4QMEA 3RPKA 2FX9L 1IMHC 5I1JH 1BFOB 1F56A 2HT4C 1S7RB 2FBOJ 2WQVA 3KGSA 5D5MA 3SCMC 4F9PC 5I73C 4G8GB 5HI4D 3O3DA 2A0LC 1JHKL 1ETA1 5C86A 2XCMC 4GIPD 4QRAA 2FX8L 1NTDA 2F19L 4MNHA 5DRWA 5GRUL 1TYEB 1JGEB 2R1XB 1SFDA 3BUBA 4AEIH 4AGLA 4IGBC 1A6WL 1X5ZA 2H9GA 4A04A 1HCFX 2FB4L 2LU4A 3MRNA 4Y9GA 1MRCH 2P8LA 3LSOB 1MEXL 1VENA 2JKNA 3CN1A 1DJXA 5A16A 5AVZB 1EAPB 1Z0NA 3D0LA 4OD3L 3US9A 3QHZL 2VLLA 1H9VA 4UZGA 2FWLB 4F5CE 4OZIB 2R29A 2BINA 4ZUTA 1KPRB 5I6XB 2P5EB 4U1MB 4BKLA 2OL3B 2VLJA 4N68A 4Y1AA 1ZDSA 4NPJA 2OR7A 3S97C 4GW4B 1ZS8B 1HSAB 4L1BA 4ZX6A 3QUYA 4IK7A 2QT6A 1FHNA 4AL8C 1NAMH 1OP3K 3RBGA 3NVQA 3ES6B 4P5MA 5DZPA 1S7TA 3VI3F 5EDSA 5EV7A 4K9EC 4KKPA 4MQTB 1S3KH 1J1PL 3KS0H 3HZ3A 2QSTA 4WCYL 5LAXA 4JQIL 2F7PA 4L3EE 4BZ1A 4U3SB 5E00B 3CFIC 2Q7NA 4Y0GA 2FD6L 2F58L 3MLTA 3HNSL 1LK2A 1OCCB 3S34H 4I4WA 3AC0A 1LD9A 2AEQL 2NT1A 3CZEA 3H9ZA 3EOAB 3RP1A 3LPWA 4MQ7A 5LVEA 1QLRA 4MJJA 3E6FB 3M6DA 1WHOA 4X5XB 2Z64C 1OOWA 3UJJH 2IMMA 4MNGB 1BFOA 3B9AA 4YDKH 1S7RA 4RETB 2AHIA 4ZUUB 2CKNA 5H94B 4G8GA 4ODVH 2W94A 5IW1B 2Q3ZA 1P84J 3C8DA 4LCVA 5D5ME 5FO9B 1HILB 4Z0XB 1CF8H 3VDBA 4R83A 3BAEL 4PJEF 1B4LA 1QBAA 4P3WA 1JGEA 2I7OA 2R1XA 4H20H 3WGVB 4DN4H 3HAEH 2AANA 1XF1A 1I8MB 2P43B 5GZOC 1AHMA 3BCFA 3A4EA 1F3DH 1G94A 5CCJA 2LLGA 1NIBA 3LSOA 1EAPA 5BCAA 1LO4H 4OZIA 4AW4A 3HPJB 1KPRA 4IMKC 2P5EA 4IKLA 3APNA 4U1MA 4YX2L 5C08D 2OL3A 3CQQA 2OX5B 4FNLH 5D7HA 4TUUA 3UGXA 4GW4A 1ZS8A 5AVSB 1HSAA 1CN4A 2YPLD 4P0DA 4PGZA 1ILSA 4AT6B 1DQMH 2VLJE 4Y1AE 4OLZH 1LO3H 1E2WA 2CO2A 1NUDA 3ZL1A 3ES6A 4J3OD 5BO1L 4RMRA 5TF1H 3N41F 1GXEA 1WD8A 4URTB 4NKOB 2CH8A 2CUIA 3KPOB 1PKQB 4M48L 4BZ2L 3HLAB 4JEGB 1A9VA 3N3EA 1RUPH 2DWTA 1WYJA 1QSEB 4U3SA 2EADA 5E00A 4QOKD 2EKJA 5IR1B 4YPGB 1NWOA 4FFYH 4R97B 1ORQB 2PN5A 1HE8A 1OANA 1DBAH 3QQXA 3EJUA 3EOAA 3MXWH 2J1ZA 1I1AD 3ECWA 2ZX5A 3VWKB 3E6FA 3VI3B 4X5XA 5C0RH 3OLEA 4OSUH 2DLHA 4MNGA 3BZ5A 4H5SB 1CGTA 4ZUUA 5H94A 1WZ1L 3LZPA 4IU2B 5IW1A 2EILB 3OM3B 5FO9A 3DYPA 1HILA 4Z0XA 4A7TA 1GC1C 4JR9H 4XNXH 1L0PA 3EZJB 1ECZA 4G8GE 1F58H 4JO4H 4L9LB 1S9WB 4WHYG 5FWQA 1ID2A 1UXLA 3MLWH 1I8MA 5H37H 4Y2LA 2WXFA 3H6AA 1SVCP 4ZODA 5AVUB 5HI3C 1JF6A 1ET7A 2HA1A 3GTVA 4AIXA 2WXLA 4BUQA 5KBPA 5AKSA 1YJDL 3QCVL 3DTDA 4P23D 3LXAA 3HPJA 3HC4H 5I18H 1UEYA 2OX5A 2WXGA 3RVWC 2O5YH 4OZIE 2BIIA 3GRWL 4AT6A 2W9LA 3ZTEA 2P5EE 5B8CB 2AJVH 1IM3D 3S35H 1KJ3L 4K0OA 4PJ9C 4XP5L 3UBXB 2HXAA 4WUUB 1NGQH 2K6YA 2X09A 1RPQA 1BOYA 3FUIA 1HXKA 4KXZH 1QW8A 4NKOA 3W81A 1MLCB 3KPOA 1A4BA 1PKQA 4Z77B 2VZOA 3HLAA 1XV8A 4TUKH 1QSEA 4J4PA 4RQQB 5F3FA 1F4YL 3SPVB 4OT1H 3PV7A 3UL4A 1OAUH 1OLLA 3B9EA 1OPOA 2KZKA 3P3RA 2VQ1B 5IR1A 4YPGA 1ODAA 3ZRSA 2GBUA 1ORQA 1JF1B 1RAMA 3WENA 3VWKA 1NLBH 3NGBC 5HYEA 1R6VA 3VI3A 1KCKA 4M7ZB 3N41B 4FLHA 4H5SA 1QI4A 2DQGL 4Y5YC 2EIZB 4CVZB 4HKZB 4IU2A 3GBNL 3QDJB 1NCWL 1BP3B 1XGUB 3DK2A 5DC9B 5TF0A 2IDTA 4I1RA 2FATL 4LCIH 5D4HA 4L9LA 2E4TA 1S9WA 2GTWB 3DX7B 5CEZD 1T1YB 2X9ZA 3CTTA 5HY9B 4CSSA 3DX4A 3NJKA 4ZFZB 5MP6H 4ONGH 2QKIB 3QULB 1SVZA 4O02H 4JFEE 1BF8A 3VWJC 3ARUA 4JGJA 4N2OA 2JWYA 1CFVL 4ZSOB 1DO5A 2ZWZA 2JE8A 1KB5B 5KYXB 3K4ZA 2DQUL 5B8CA 3HVDA 4EUPB 4M93B 2D73A 3FTVA 4NUGL 3UBXA 4WUUA 1W72B 3R4DA 5DJ8B 5I6KA 5J11B 1MFVA 4G6ML 5L2KD 1I9RL 1WC7B 3UTSD 1MLCA 3H0TB 3MKKA 5AOJA 3MODL 4GSDH 4Z77A 5CP3H 3O4LD 4TLTA 3U25A 1G9ML 4RQQA 2J21A 4JCWA 3QRGL 1PKQE 3SPVA 5ADOH 3U6XS 4HJEA 1S2EA 3BSZL 1EVUA 4PJAB 2VQ1A 4OFQA 2ALWA 1QSEE 3EBAA 1YMHB 4LARL 4S1RL 3TO4B 1JF1A 2ZOTA 5C7ZA 3FF7A 5HI5D 5CINH 2WZPA 1WDAA 3S37X 4XPTH 1P4LB 3UP1A 3IMBA 3GPSA 4BQ8A 3QCUL 5DFVC 1RP8A 4FQXD 2DLEA 2J72A 1O6TA 3CXHJ 1OAYH 3VI3E 2EIZA 4CVZA 4HKZA 3T04D 3NJGA 2FT6A 4EN3C 1L6ZA 3QDJA 3KWXA 3AXHA 1XGUA 3IDUA 4V2BA 1MDTA 4TULL 3WFBL 2NY5L 2GTWA 1KN2H 3CBJB 3DX7A 3QJZA 1R5WB 1T1YA 5HY9A 1KTKE 2XTJB 2UY6B 2WXNA 4ZFZA 3ROLB 1I9IL 3D09A 2F5AL 3FO1A 5DF0A 2NSXA 3ZVVA 1VCAA 1NLDL 2QKIA 3QULA 5DZJA 1NM9A 1QASA 2KZ1B 2A77L 3PAYA 4KK9C 5DEGB 4ZSOA 5BRZD 2ZXAA 3II1A 3P73B 4W9ZA 2VL4A 2WNWA 1KB5A 4MMYB 4MMZC 1YAZA 1YPZB 4AZUA 5KYXA 4EUPA 1JTTA 2PTVA 3NSDA 4G71B 4BCXA 2X6AA 1W72A 5DJ8A 4ZTPL 2FAUA 3CPUA 4GH7B 3UACA 4A2FA 1JOIA 3LNIA 2R59A 1QFWH 4WUUE 2VDNB 1WC7A 4F80A 3H0TA 3CN4A 4GAJH 1E4XL 3EGXB 4BGLA 1T7YA 1XX9C 4OKDA 4LOEA 1NGPL 3D8MA 4XTRD 2FUQA 4OFVA 4FG0A 2G0KA 1HINL 4PJAA 2J73A 3KWTA 1YMHA 5D7SL 3DXAD 4XOAA 3TGXA 3TO4A 3VD7A 5DJDB 1NQBA 2C9PA