2D3JA

Nmr structure of the wif domain from human wif-1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
157
structure length
157
Chain Sequence
GSHMLDQQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILQTPQNAIFFKTCLQAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Wnt inhibitory factor-1
publication title NMR structure of the WIF domain of the human Wnt-inhibitory factor-1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein inhibitor
total genus 36
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02019 WIF WIF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2d3jA00
2YGNA 2YGPA 2YGOA 2D3JA 2YGQA
chains in the Genus database with same CATH superfamily
1WRFA 2ARWA 4X9GA 3X3FH 1X5GA 5IROD 4D0CB 5AUMB 4NWUL 2BSRB 5DMIH 4A7QA 4N4YB 4ZG1A 3VFRA 4W9KC 4AK1A 5DCCA 3RVWC 4Y1AA 2OFQA 4JRYB 4DN4H 4QAWA 2ZG2A 5F97E 3T3MF 4HOXA 4K7PH 2A6KA 1GH7A 1OQOA 1ZE3H 4B0MB 1KV7A 2YGNA 4LLDB 1NDMA 2X38A 2YEQA 3T4YA 4BSWB 5ACZA 4HWNA 5EEXA 4PREB 3KZ8A 1DBJH 3A0OA 5D72H 3BWAB 4M43H 5MENB 5JA8B 4PBVC 2WCGA 4GSDL 2FHCA 2O61A 1BZ9B 3EO0B 4TLKA 3LS5L 3LB6C 2D0HA 3F00A 3TESA 1YEJL 5I8OH 1Z3GH 4UIMB 1ROWA 4A7VA 1IC4L 5TD4A 3ZT6A 3UGUA 4ZMTA 3SQOL 4YHLL 4HU2A 4EVNB 3AU1A 4A1RA 4YNYA 1AGEB 3C5JA 1YYCA 4RIRB 1H3GA 1QKZL 5I18L 3V4VH 1A9VA 1U3NA 1MFNA 5D6DA 4JZJC 1ND0B 4WW2C 3SDDD 1ZVHA 1AMYA 4OUUB 2WYIA 4OCRH 4KQ3H 4QNPF 4ODWA 2K4AA 2VSKB 3IMTA 4PJ5E 3Q1SH 3B7UX 3BLBA 3LZLA 1JZ3A 4ZUSA 1R3JB 1R3HB 4L9LA 3SIKA 2FJFA 1K72A 2WQAA 4KTDH 4IBTA 3SKUD 3IDGA 1OD9A 4KKBC 4NKIH 5T5NF 4B6ZA 3QUYC 4GBXB 1BD2D 2ZOUA 4WTZG 3MSPA 4PRAB 2VL5B 2ZCZA 3L13A 4LVEA 4ODXA 2IDTA 3HZKB 5IJDC 2PTUA 3HUJA 4QKXB 5I1GH 4RAUB 5FGSA 3CZKA 4N2MA 4NGHL 4FFYH 4OU3A 5F9OH 1LP9E 4FQIH 2YQBA 2EACA 4DP7X 1KTRL 3CN1A 3U0WL 4PJ5D 5HJGA 3BP7B 2R4RH 2CRIA 1AAJA 1EH9A 3AAZB 3NJLA 1GGCL 3OKEB 3KPPA 5FXCH 4XPGL 2BIOA 2GSMB 2C9SA 3BYTA 3TCLA 4NRXA 2EH8L 3IPBA 3GMNB 1GTNA 1JGLH 3LHPH 4HOMA 5IG7A 1QBMH 5D5MA 5C07E 1EAQA 2Q3XA 3JV6B 4Y7MA 2OAAA 2OMXB 3DVGB 4EN3B 4A2DA 2RD0A 3LNIA 2EYSB 4POUB 2VC2B 3QDHA 3V0FA 1S7VB 4EDWH 1J5DA 2WBJD 2JXMB 1M3IA 5FO9B 6FABH 1OCOB 3QK0A 3RFZA 2N1TE 1ZANH 1G0YR 1N0XL 4H20H 2PF6A 4LNVA 5E70A 1KCSH 1UXLA 2KC0A 5F7LB 3S3CB 1QFUH 2HVJA 1DUYA 4AGPA 4BD4A 2LQRA 2R1XB 4F58L 1YNTF 4MYWB 4BWTA 1C9SA 3UDWA 3AB0C 3DOHA 5ESAA 3IN0A 2MQCA 4QRSB 5C07D 3ZDZE 1O7DC 4XB3A 5DO8A 4HLZG 4YFLF 4D8PB 5IOKA 5E03A 4ZMOA 4JDZA 1Y0LB 4KQ4L 1JGDB 1PZ2A 4P4KC 3ARFA 3FO9A 1S9YA 3CTTA 3L3JA 2MPVA 5EOCJ 5CILH 1INQB 5GZNA 1YQVL 3PDGA 3O41A 1AHWB 4Y9CA 2QJDA 1LVEA 3DSNA 1DCEA 1CG9B 1OB1A 3HLAA 5B3SB 2NY5L 2VDLB 4IJ3B 4MJ6A 1UA6L 4QXVA 2Q8BH 3ILEA 3PGDB 1GYVA 3HI1A 1CBVH 2WK2A 3QO1A 3NZSA 5CJQH 1D5BB 4EUPB 2CJTA 5AG8A 1FQ9C 4Z23A 2VN7A 4IBQA 4KZ0A 4FFZL 1V7NH 5F9DC 2RFXA 3QI9D 4HCFA 5C6TH 4RA0C 3SGJA 3D3VA 2AV7B 3MCKB 5KBLA 4G3YH 2MCPL 1KIRA 3TM6A 2BPBA 1U8HB 1WQVT 1K8DB 1TLKA 4MRBA 1HOCB 1R47A 2FX9H 1FVDB 4R96A 1NGYB 3DBXA 2FK9A 1F1AA 4N0YH 2ZE0A 4RMUA 1HH9A 2WMPB 1DVFB 5LBSL 5ADPL 2VC2L 2IGFL 4TTDC 2W80C 4PS7A 2VOTA 3NFNA 5FOBA 2XDHA 1NANH 2R0ZL 3M88A 3AWFA 4MA7H 2WC7A 1R9FA 3ARVA 1YO4A 4OZ4A 3UPRA 1IFGA 1F11B 2K78A 1KCRL 5AL8A 4NRZB 2H1PH 5JNYB 2B7DT 4BXVA 1UT9A 2WWKT 3F7LA 3H9SE 3DVNA 3OM3B 5BXFA 2DQEH 3BPNB 3IXAB 2YMXH 4G5AA 3L3KB 5FC9A 1TETH 2DQHH 1OGSA 1NAKL 3QS2A 5EEZA 4OCNC 4GXVH 5E99L 1BYOA 4TQPA 3P3UA 5IBTH 2AK4E 3MLWL 1D5MB 1QFPA 2G5RA 3GXFA 5DUBB 1X3DA 1VKXB 1OE2A 3W9EB 3OHXA 4BHUI 4P2QE 4ZMXA 4Y4HC 5SWZE 1EXHA 1SZNA 5F7KC 1BQLH 3EJJX 3BT0A 3UBXI 5EO9B 4XOEA 3NPZB 5F3FA 1FO0A 2VDLL 3O9WA 5AW8B 3FXIC 1YDPA 4BA0A 4YBLC 2AV1A 5DS8B 2QLVB 2GCYB 1P5VB 4IGBD 2AXGB 2WY3B 3KVDD 4YHPB 4ADIA 1JMXA 1QSVA 5G5DA 3C87A 1IQWL 1I1CA 2J1WA 3UBXG 3FUHA 1KACB 4LLYA 1JZGA 5E2TL 4CA4A 1GGIH 2Z31D 3BAEH 4CADB 3F64A 4P2QD 4NQSA 1WWWX 4KITB 4HT1H 1MY5A 4YSPA 4AGOA 1QMUA 2JB6B 1OPGH 2KH2B 3KPLA 3F7PC 3WNLA 1UUNA 1UJTA 3TT1H 4G5ZL 3SJVD 3UTOA 2YJLA 4OM1L 2NNCA 5DJXA 4H0IA 1N5YH 1JYXA 3LIZH 4NQEE 3TZVC 3ATFA 1I9RH 5JZ7D 2Z4TA 4YHNA 2WINB 1RZGB 2XNAB 4XC1H 2Z93A 1U95A 1TQBC 1UB6B 1AYRA 2UXTA 2X4SB 2YEZA 2N01B 4LAJH 3UGXA 1ACYH 3C09C 5C09D 4LCIL 4X9IA 4M6MH 4RISL 2A73A 4XP9H 2P3YA 3L3OA 2IPTL 3U0TB 2AJVH 2BNQE 3WL9A 3VFVA 5I24A 1ZTXL 4XC3H 5B4MD 2EXTA 2CMRH 5A2IH 1BQUA 1ODUA 3OAYK 1VGEH 3TGXA 4K7FA 2B0SL 4KRLB 4PRPE 1WIOA 2VLLB 1OGPA 5CN3A 3PWPA 3FOMA 4FQ2H 2CU9A 3D51A 3N91A 1AOZA 2P44B 5DJZA 4WCYH 4LGPB 1BZOA 4M6AA 1VGKA 3VFMB 5DQDL 3HRZC 4X80H 3BESR 4X6CE 5IV2A 2IH3B 3T2NL 5D7SH 3GBNH 1Z2KA 1VAHA 1ZEAL 1E2ZA 3EZ8A 5I16B 5I5JA 1IT9L 3VD0A 2Q6WB 2ITDA 1CXEA 3A3YB 4POYA 2XPGB 1I1AA 1VEPA 4MQXC 1JXJA 1U4EA 4OCXL 1RK7A 1OM9A 3EYFB 1RPUA 3OKNA 4RNRA 3OXRB 4S1RH 1ITBB 2ZP0T 3WFBL 3ZHLA 4ZFGL 3Q7JA 1ZOXA 3EBIA 4W9FC 3U36B 3HBGA 1A47A 4MA3A 2V9QA 4TNWF 4F24A 2OP4H 1OCRB 4I13B 1FFQA 1FN4B 2EXYD 2XTJB 3CV5A 1HL9A 2Q86B 4Z7VF 3UJJL 4AGNA 1HWWA 3ZYZA 4XI5C 4ESKA 1PF3A 1ZHKB 1Z9PA 2P7TB 3QZWG 4LBEB 2LABA 4WU5B 2J43A 5E8PA 2NY6B 3CD4A 4M7LT 1KXVC 2ZUYA 1F90L 2ZX8A 4MGXA 5F1SA 4HKJB 1EX0A 3ZKND 4I3RH 4PJ6A 5I1CH 3IJ8A 4IQHA 1NCDH 1DE4A 2EIZB 3RZCA 3QXUA 4LSPL 4YLQT 5TDNB 4HFUL 3CSTA 4L8SA 3IMUA 4MAYA 2EDQA 4R7LA 1ZLUH 2GT9A 1B4JH 1UWXK 1VFMA 1PZDA 3C5SA 15C8H 2VUKA 3D30A 2LAAA 2JB5L 3I9AA 2NCMA 2UVFA 3KNBA 4LPYA 5KVFL 2OK0L 5IB2A 1CB4A 2NNAA 4Y5YC 2P49B 3FFCA 3IJSA 1GZQA 1WTLA 4G82A 2ZJSH 1HK6A 1HCYA 4OKVB 4IOSA 4HOWA 3OG4B 3GGWB 4QOKB 1KELL 2EC8A 3HE7D 3OB0H 4JHBA 3VRLE 3M6DA 2XG4A 3C5ZA 3CBRA 3IRCA 5E0FA 5C0ND 3HG1B 2HTLC 2QR0A 1YYLL 4U0RB 5JPNA 2QKIC 4NAQA 2R2BA 2X1OA 3GXIA 1CFQA 5EEWA 5B3NA 2WO4A 4KVCL 1QSEA 4JJ5A 3G9VA 3DOSA 2CLRA 4MA8L 2MOQA 1G9NC 3G5XA 3TPUB 2K4WA 2XQYA 3AXLA 3PL6D 4N8CH 1JG9A 1IIIA 3IDIA 1XZ0B 4HMCA 3DPBB 2EEFA 1EAPB 2P45B 2YRBA 4PVMA 1J1OH 3I75B 3VO0A 4HW6A 4JGJA 1X5YA 4H8PA 3VXOA 5IHHA 4JDTL 1E4KA 4UV7H 5J12C 1QA9B 5HGGS 1O75A 4YSCA 1YPZE 1S7QA 1D5IH 4K07A 3ALWA 4EO5A 4AL8C 2IFFH 2J8UB 2K9UA 4TSBL 2JJWA 3QZPA 4V11A 4XN2A 4ATWA 1XCWA 3ZDXF 2DH2A 1Q9LA 2ENPA 4RA3A 2K8QA 3TEXA 1IGJA 2KERA 4LCWE 4HLEA 3CDGA 4L3CA 5F3BB 3ERXA 1KTCA 3H42H 2BFVH 5AW0B 3VI3A 2IPUG 3CCHB 2UX7A 4PRNB 4G43B 3IGLA 2C9UA 3NSYA 2DWEB 3MXVH 4R8WH 2QGBA 4W93A 2UWEE 4EMZA 3MV9A 1CLYL 2YBGA 3V4LA 4K2UH 3ROOA 1IAKB 5IFHH 3VWKC 3QJZA 3NAAL 3GIZH 5JUEH 3JTTA 4WK0B 1PG7X 2W07B 2Y2YA 3P9WB 2XPZA 2IQ9H 3RIAK 2PETA 4GMTH 4FOMA 4JFEA 2NXZB 4JPWL 4YX2H 3LZOA 4ZAKD 4F27A 4PG2C 1GPOH 1NCAL 2NX5E 5LCVA 4KJWD 2DI8A 2XXMB 4RSYA 1AR1D 1DYZA 3DXAA 3D9AL 4UYQA 3WOVA 4GRWE 2GUOB 5DUPL 5J57B 2GJ6E 2MQ0A 5IOPB 3RJDA 1BVOA 1NSNH 5CU9A 4JM2B 4NIYE 5DD3H 1UZ6E 3WEAA 1RP9A 4JE0A 4OQTA 1NOLA 3RDTA 5I6KA 3GIVB 5DQJB 1IBZA 4ZMWA 3L5XL 1K4CA 3BPOB 1FBIH 1LYQA 2JI2A 5CGTA 1ZE3C 3QJFA 1G4MA 4X98A 5ES4B 2H8PA 3TYGH 1U8NB 1XTMA 1CJYA 2ORBH 3MUUA 3CVHH 3STLB 5GS0H 4IYKA 4Q0XH 4LFHD 3B2MA 3GINA 3W2DH 2MOVA 3ES6A 3H3KA 3LKQA 4UBDC 1XV8A 5BV7B 3JWDL 1MJJB 1FRGH 1JZ5A 4ONHA 1FYTA 2V3DA 4JQIA 5AUMA 2BSRA 2E8YA 2K1MA 1BQ5A 5CJOL 1ZVSB 1HSBA 3NGBB 4JRYA 3ESNA 5EU5A 5KVDE 3HB3D 4O2CA 3QCTH 3S5LB 4CN6A 4WI4A 3HE6B 3L4CA 4V2BA 4HH9B 3SBWC 3FL7A 5ADOH 3OLGA 3G6JE 4PREA 4PS4H 3MJ9L 5GIRA 5MENA 3SY0A 5AYQA 1IUZA 4LSTH 5JHDE 4ZOAA 5EU4A 3QDAA 5B39G 4UQ2B 4G72B 2G3NA 3UERA 2Y7QB 4PBWD 4HV8A 3QIBB 3NCXA 3GUFA 2MIZA 1F8TL 4G8EA 4MXWH 3Q9QA 4JN2A 2PW1A 4EVNA 3U0PB 1AXSB 4W9DC 1PG7L 1A7QL 1AGEA 3HS0B 4N26A 5FUOL 5J3HD 2DI7A 4PI0A 4DGIL 4MCNA 4XAKE 3VTAA 3B1UA 2WM0A 3GBEA 1ND0A 5AW6B 5C6WH 1M1XB 1R3IH 1JN6B 4M3KB 2XBDA 4QYOA 4AZUA 1CICD 2QT6A 1MCOL 3WJLA 5KSVB 4EI5C 4M7JH 1SEQL 3FB5B 3LCYA 3RUGE 3VXME 5JHDD 4YHMH 1R3JA 1R3HA 4ZX3A 1A7NH 1YEGH 3T6XA 1KGCE 1E40A 3GSWA 3ROLB 3GSRB 4L1BA 3U1QA 4G6FD 5I1LB 1B6UA 4MASA 2J6WA 3DLQR 4GBXA 1K85A 4XMUA 2FIRT 3D39B 3ARGB 4BDVB 5KVEE 4QXGL 2VL5A 3MO1A 1SY6H 2J21A 4OGYH 5TE4H 2GBVA 2I32A 1C7TA 4OVVA 4QJ3B 3PRZA 5JR1L 3ABGA 1P7QD 1RIUH 1U4FA 4RAUA 1M7DB 2CM5A 1NPUA 2BSSA 3ME0A 3X1NA 2ZWSA 4FJ6A 4KDTA 2QVIA 4MNQE 1LWJA 3VXMD 2VR7A 4ZD3H 2VLKA 3OKEA 2CO1A 3C2AL 4FXKB 5C0GB 1KGCD 3M1OA 4JUSA 2CG9X 3GMNA 5G4OA 3A22A 3X14B 1N0LB 2C9RA 2HXAA 2IWEA 3QRBA 2XVKA 4E9VA 3JV6A 1KG0B 5PAZA 3DMMB 5EN3A 1KGJA 2OMXA 3DVGA 1FIGL 4HZLB 2DQGL 1MCSA 3G7TA 1U3HA 2NNRA 2RTTA 3WUWG 3CK0L 5GZOD 2FSEB 5HGHB 1KZQA 3A21A 5I9QC 1I1YA 3T5WA 1S7VA 4EOWH 1JZ8A 3HHSA 2JXMA 1NJ9A 1KENH 4MNQD 3CC1A 1A3RL 4BJLA 2OSLB 3L4UA 3PP3H 1UM6H 4NQTA 1B2WL 1T04B 1BFTA 3SE4A 2PLTA 1PY4A 3S3BB 4F2ME 4AYEC 4G70B 5D7JC 1EHAA 1XHHA 3K46A 3UTPE 1FORH 3MRGA 2IIJA 3RTQA 4LLUA 2FE0A 2J5LC 4R5TA 1CQYA 3UYRL 1MHEA 3B56A 3V2AR 2CKBB 4FL4C 3DARA 2WO3B 1CE1H 4RMVA 3IWVA 1KDJA 3LX9A 5J4MA 5FYLE 4O9HL 5I6MA 1INQA 3HR5B 4L05A 1AHWA 4KHXL 1EO8H 1IEBB 1TCRA 4G59C 2BOCA 3MGAA 1BAFH 2PCXA 1A8JH 3IU4L 5SV3A 5ABZA 4P59L 1QSFE 3PGDA 4WV1A 2YOAA 1NMAL 4DP1X 3UTPD 5D6CB 3CAFA 5FM5M 4XBEL 1GOFA 1UCTA 1D5BA 1HHHA 4QRRB 4HIEB 2VDKH 1H6EA 4OGQC 3KLHD 2WIIB 1Q1JH 4WW2F 2K9FB 3P2DA 4AC4A 1XAUA 3RVVD 3IS1X 2EZ0C 1IL1B 4K3DL 5CIPB 3SE9H 5FYLD 3LDBB 3O6KL 1R6VA 2WZPA 2J1KA 4Z7UB 3KD4A 1KCLA 3CQPA 3PHSA 4Z7NF 3WIFA 1I1RA 3MRJB 5FV2A 3PV6A 1U8HA 1TO5A 4WNQA 1FVDA 3WN6A 4W70A 5JXAL 1NGYA 3LPPA 1RVFL 4KJYB 2H41A 4TQIA 4PTUB 4C56B 4PLJC 1RZIB 2WUCH 5B1KA 2HVBA 2FCBA 2WSKA 4NLHA 1PAZA 1XH3B 2UUDH 2F5BH 5H4YA 3QHFH 35C8H 2X6VA 4D0DA 2V9TA 3ML8A 2J6EL 3CVIH 4WI0B 4XNXH 3MGOB 2F58L 3BUYB 5HI3C 3UADA 1M2VA 4GO8A 3UZEA 3ZTEA 1F11A 1OSZB 3HW7A 3P4LA 2BSCA 3E38A 4FMVA 3QRGL 1SOXA 4IRJD 3S37H 3WAKA 4GIPD 1HN1A 4RESB 1RERA 1BQKA 1ZY9A 4KXAA 2CKBL 3NCYP 3SDAB 2YN5A 1V3MA 3F04A 3WDJA 3C6LC 3K4AA 2H32H 3NRQA 2YGOA 5DUBA 4X7FC 1D5MA 2WCPA 3E6HB 4AV5A 3QRFM 1VKXA 1T5XB 2QHRL 4NZRH 3W9EA 2YWYA 1JFQL 4HDIA 4Z0BL 5F88A 5DD6A 4LVOC 5HYJB 4S2SB 2RCSL 4G7QB 1RUQH 3VD1A 3ARPA 2BIPA 3GHEL 3P30L 4U1GB 5AOLA 5ISZB 1H9VA 1T6WA 1P1VA 2BIIA 2A6DB 2AXGA 4PR5B 3V52L 2Y7NA 3NSCA 3TIDA 2W9DH 1OD7A 4J12A 2P26A 3LB6D 1M71B 5A2FA 3S97C 3OXSA 4BRJA 2B5IB 2BMKB 4XH2B 2D3LA 3KGRA 5ETUB 4ZJ9A 1J9CT 4HMDA 3PWUB 1JPFA 4IIQC 2ZUTA 1TENA 1WT5C 4OLZL 1U58B 2XN9D 2FR4B 2ZCLH 3QUZB 1CLCA 4YSAA 1T89C 4H8UA 4XMLL 1DR9A 4MMZB 1PEWA 3QXDA 1P4UA 1P53A 2UY7B 4DKEL 3CG8A 2E27L 4K15A 2UXFA 3LD8C 4X9FA 2JB6A 4ZMYA 2H1LM 3NPSB 2X4OB 3TO4A 3P69A 4R5XA 4HCRL 2NY7L 1PY9A 5I5IA 1AO7D 3UTTB 2JKIS 2EUVA 3A6BH 2EDHA 2XWJB 4XNUH 4KKBD 2C9PA 3ECBB 3C8KB 3VB8A 3QUYD 5E4AA 2OTUA 5HHPB 2VXQH 3HFFA 2CIKA 2WINA 2XNAA 4WGKA 5KYXB 1UOVA 3RAJH 4Y7OC 4AIZA 1MCJA 2ADGA 3QJVB 3EJZC 4UB0L 2LGNA 5BVPL 5HVFB 2BVYA 5DA4A 5JIHA 5I5RA 1Q0YL 1E5CA 3FMGL 2XRAH 1A6WL 4FXLA 3B7RL 4D94A 1QQDA 1TZIB 4HKBB 1AZNA 1ZS8A 4H2CA 4K55A 3NA9L 3AS1A 5CUSH 3VXSB 1SJEB 5IVXB 4FABL 3LN5B 2EECA 5FKAB 4W9LC 5AG9A 4OZGB 1G0DA 1WAEA 4YGVB 3RHWK 1JMZA 1QPPA 1YEHH 1O7DE 4PV8B 2YARA 3PWVA 5CEZL 4DNLA 3I9GH 1NAMB 3KR3L 3LPFA 3LKNB 1DQJA 2JI3A 1DQDH 1SOSA 5INDB 4F7TA 1N6UA 1VLXA 4HK3J 5HYQB 4OZFH 3H9ZA 1RZQA 1T0OA 3FQ2A 3AG2B 1EFQA 2IH3A 3BX7C 3CWGA 4D3CL 3RE0A 4LPVA 1AKJB 1HINL 5JTWA 4I18A 1XH0A 2XETA 2Y23A 2Y7OA 3HNSH 2Q6WA 4B41A 1HH6B 2Y7SA 3IGAA 3CFMA 4NUGL 1P5UB 2XPGA 1AYOA 1FFNB 4IRZL 4YLCA 4GAYB 5T3ZE 3EYFA 4NSKB 5LBVA 1OT2A 4OIAA 1BAGA 1NFDA 1YEIL 3IFLH 4KUZH 3T1FB 5C0BD 3UO8B 3ZQWA 3TA3D 5ILTH 3LXAA 4Y5VA 3WTTA 4PEEA 2MHAA 2X4TB 4I9XA 3FRUB 1FN4A 2Q86A 3GMLA 1FNGB 1KJ2H 3V0VA 3BVXA 4GH7B 2BXYA 4LLWA 4RGOH 3RL1A 1UT2A 3NZUA 1ZHKA 3HBPA 5J56B 3A4AA 3MLZL 2Y07L 4WI3A 4WHYH 4WU5A 43CAA 3JQOB 3MRNB 2CHWA 2APWA 2YPKB 4YFEA 2C3VB 5T3ZD 4HKJA 1KN2L 1JXFA 3BKJH 5T3XL 2W95A 1CT8A 4ZXBB 5TGBA 2NY3B 2P5WB 2CNYA 4ZOCA 1ACXA 5E6IA 1A6PA 1DN0A 4JKNA 5TDNA 1AP2B 5SWSE 5KSAC 1QBLL 3DX7B 2HJKA 4XP1H 4KZEL 3FO1A 4ABWA 4TQHA 5H35A 2P8PB 4B53A 1A9BB 2H4EA 4QHNB 3VNZA 5D1XA 3STZB 4N86A 4KTGA 2XIDA 3EBAA 4H5SA 3L95A 3QE5A 3ZKSD 3ZL4H 2ZXEB 4P04A 1HQRA 1NAML 1GY2A 3FSAA 3GGWA 1GYAA 2WKLA 3AJ7A 3FT0A 4WGWB 2X1QA 2R1YB 1CD8A 3BKCL 4OSUH 1CS6A 1WIPA 3BGMB 3QAQA 4TTDD 4GSUA 2VDPH 5FFLA 5BS0E 4HHGA 2JVUA 4HUVA 1YLBB 3Q0HA 3LYRA 2HRPL 4K94H 1ZTMA 3P9MA 2ZXQA 5I0ZA 3CVCA 3TPUA 1PPIA 4PJXB 4L1LA 1Y07A 4BZYA 5BVJB 3ISYA 3BH8B 2ROXA 3DECA 4P49A 4EN2A 2W9EH 4F5CA 2YPLB 2D4DA 2C4XA 3T08A 2B4CH 4Y4HD 4CC4C 2QQNH 3UH8A 5BS0D 4M4PA 1QA9A 4OFVA 4TF4A 5D1ZI 1T03H 4Y2DC 1S7TB 1DP0A 3FT3B 4L4VE 4KROC 4ODVL 2J8UA 2WCSA 2YRLA 3ZKMC 1WF5A 2MNUA 2Q8AL 3OAYH 1HNFA 5KS9B 3N9GH 3Q13A 2VDNH 2Q1EA 4WSKA 3GSUA 3DHMA 1IAIL 1EERB 4JY4B 1AZBA 1ZA6A 4QTIH 2APTA 4AV0A 1PGRB 2CHXA 3CCHA 4IBZA 1SMAA 3SPCA 3CFCH 4F33B 5FCUH 1DVXA 3B8SA 4Q9RL 4QHKJ 2A2QT 4AKQA 3DX8A 3LZFL 3HG4A 3ABLB 2SEBB 4TNVF 4L4VD 4UIKL 3MUY1 4ODHL 3TVMA 1NC2B 4P9HL 3MLTB 3APCA 4UOJA 1KJ3L 4DGYH 3ZR5A 3BEWB 1EVTC 3AMKA 5EZJB 3FKUS 1BDYA 3GLDA 4X50A 4PJ8D 2ZP9A 2BVPB 3HNTL 3P4OB 4WFGD 4CDHA 4RDBA 3PS6A 4FNLL 3TZVD 4NB7A 2XZQL 4GKZB 2CGRH 4ZTEA 4P23C 4PV9A 5IVXF 4JM2A 4Z3IA 1LK2A 4OZGF 2BP3A 4OW6A 3B9KA 1FZKA 4RAVA 4PUBL 4UILH 3P54A 5JQ6H 1ETJA 2AVGA 3GIVA 4KX7A 3Q5TA 3A24A 4LLVB 3UAJC 4I0PC 3WFCL 4X99B 3X3FL 2WWOA 5LWYH 2H0FA 2VZ1A 5DMIL 4ZMZA 5AKRA 1X9LA 1U3JA 3Q2CA 2D31A 4MNHB 1E7VA 4JR9H 4N90E 3BIAX 3GRBA 3NCJH 4HLZH 1JPSH 2EJ1A 3CLFL 1E28A 3WIAA 5FB8A 5BQ7B 4P4RA 3EJRA 4Y19E 3RPKA 1SLWA 3ET9F 4WTXA 5D7LD 1IGCH 4G1EA 4MD4B 1F45A 1DBJL 1MJJA 5D72L 4M6NH 4HJ0C 3B7YA 1T5WA 4RMQA 1A3LH 4KC3B 2F7QA 1F13A 4LMQE 2HFFA 5D7KE 7PCYA 1ZVSA 1LP9B 4GPVA 5I8OL 1Z3GL 2BO0A 3OKMB 4U1LB 1N19A 1EHNA 5CP3H 4FQJL 4I77L 1I85A 1UWYA 3JSSA 3UCRA 5HPMA 4B9JA 5SX5H 3RA7H 3BQUB 4V1DD 1UXSB 4Z1PA 1DBBH 3QXAB 4N0RA 4OIIH 1R4XA 5GISH 4XE5B 2EADA 5L2KE 3IE4A 4WI7A 3MBWB 3PHQA 1SFDA 1AGCB 1J05A 2Y7QA 4G6JH 4WJ5A 3HR6A 3S3SA 4E42B 3Q1SL 4UQBA 4NM8H 4G1MB 5DWUH 1A4AA 5ICYB 1VEMA 5D7KD 1L0XA 1Q38A 3WFHB 2VE6B 3U0PA 1AXSA 4KTDL 4OJCA 3HS0A 2PPEA 3DDFA 4XI5D 5DS2A 3UTSA 4E9SA 5ID1B 1D9KC 3HVNA 3KPNA 4YO0B 4Z3TA 3MBXL 3ULUL 3N1MC 4O02H 4AQ1B 4N2BA 1CGXA 4JFPB 5I8KH 5KSVA 2FYVA 3FB5A 4DVBB 4YS4A 1OARH 2PP9A 3H4FA 3QDMA 4R4NC 1S7UA 4JZNB 5DJ0A 3SBPA 4UUJB 3ZDZB 5L2KD 4FQIL 1MJ7L 3SDYL 1BBDH 2NSMA 4NHUB 3ROLA 4NP4L 4YXKH 2A74A 5HVHB 5I1LA 4W4OA 3DX2A 4GKLA 2COVD 1HCVA 4JO4H 3GJFB 2VLRE 3D39A 4H26B 5DQ9A 3WDHA 4BDVA 3RI5F 1A14L 1JGLL 3EOTL 3BWUC 3WENA 4PJEA 1NINA 1QBML 3EYOB 5FR3A 4YN3A 1LLAA 5B21A 1NGZA 2WVVB 2DEYX 4ODUB 4TYUA 3STBA 3IDUA 5EBWA 4Z7OF 2R2EA 2F19H 5FWQA 4EDWL 2WZAA 3MNWA 4D9LH 4PGDA 2NTFB 1QSZA 2HTLD 4NNXB 4RFNB 1ZANL 3N42B 4WKXA 1PJ9A 3ATAA 4DFHA 1E6OL 3QZNA 1EXUB 4XT1C 2VLJE 2VLRD 2X12A 3K2MC 2I7OA 2R23B 2N4IA 3DMMA 3F58H 4GW5A 1RLBA 3FN9A 1HXYB 1HESA 4KNQA 1RUAL 4JVWA 5DJCA 3OF6A 5T5NG 5JHLL 2OI9C 3N44B 5LNGA 2FSEA 5HGHA 3RX9A 4FYQA 4Y4FB 1MFUA 4J3BA 2IQAB 3BP6B 3PXLA 4LOFA 4YE4H 3V7MA 4FNUA 4UQ3B 1TKWB 1MY7A 2R15A 3WO3B 1T1WA 1H8SA 4XX5A 2ISDA 3ZTDC 5E1QA 1YHPA 1WLHA 2EDNA 1AD9A 1U8IB 3V8CA 3L4VA 1LNUA 1MF2L 4E41D 4I88A 4XCNB 4U49A 1CBVL 5IW1B 1QWUA 4H13C 2A3TA 4F7CB 5K1NA 1RP8A 3FTSA 4WWKC 5E08H 3N06B 1FFRA 3H9SB 4OB5L 1MQKL 3W0WD 2FGWH 3EYVB 1JHTA 3OJMB 1JHKH 1RIVH 4P2RE 4Z7AA 4HWBL 4APQB 1V7NL 2E5EA 1G0XA 2DMBA 1IEBA 1TYJA 2G4EA 4NKDA 1S9VB 5C6TL 2VRAA 5T1DH 1E9PA 5I19H 4LDOB 4APXA 3I3DA 4YFLI 4HJJH 4R4FL 2AK4B 2WIMA 1I8AA 3RVUC 1NGQH 2H3NA 4G3YL 4KRMB 3S9DB 4B3EA 5ELIA 4P2QB 5SWZB 3VWKD 5D6CA 3AFLA 1I7ZA 1ZSDA 2UVEA 4N0YL 1QFWL 2XVBA 3A67L 2YA0A 5EU7C 2ARJA 2NRDA 2AQ1A 3VD3A 4P2RD 5TJWK 4RZCA 1IL1A 2F53E 2AZAA 1U36A 4ZUVB 2H2PC 4FXGC 2CO7A 3NTCH 2YC1B 4JFZH 3C60D 3F62A 1NGXB 3PUCA 4MA7L 4KFZC 5DJ2A 1U9KA 1E5YA 2E7LC 1SLUA 1SUHA 4ZFZA 3GTTA 5LNDA 4BK5C 2H1PL 4LHUA 3U2JA 4C56A 4KJYA 4UT6A 1RZIA 4R3SA 5E4EB 2DQEL 2YMXL 2WWMC 4LCYA 1TETL 3QDGE 5EIIB 2HPTA 1NIAA 3SCMA 3KPQB 1ZGLM 1ED3B 4HWUA 2AJ3B 3O4LE 3UO1H 3WNIA 3WTSA 3BUYA 4Y5XB 4TNEA 2DYSB 1NBYA 3WHXB 3LSOB 2F54D 4NQEB 1EFXD 5D1QA 4FEIA 4UBDD 3P4MB 1ORQB 5JIQA 4H8WC 2FSDA 1I4FA 3RX5A 4LSVH 3VFPA 1IC0A 3KPSE 3MUJA 3ORJA 5EZOH 2MMXA 1UATA 3IJHB 4LE8A 4JLRB 4ISVA 2BNQB 2DBLL 5IR1B 1TJHH 3O4LD 4HJTA 2BNUB 5HD8C 5HYJA 1LDPL 3IDXL 3Q3GB 4S2SA 4WO0A 5BZXA 1R5WA 3D4GA 4HUXA 5I1JH 2I24N 2Y24A 1KB9J 4PRPB 4R97B 4A2MA 4HT1L 2A6DA 3K80A 3A6CH 3R1GH 4PR5A 1RZ8A 2R4SH 4R83A 5LAXB 1FSKB 5IB3A 1XIWA 2EUXA 1M71A 2BFGA 3EJPA 2B8OT 3KPSD 2ERJC 3NIFF 2NZ1A 1AS8A 4L29B 5ETUA 4A38A 3QG7H 1N5YL 4MJIB 1CBJA 5T5FA 1U58A 3CPLB 4P2AA 4WFFE 4YSSA 3O0LA 2QSCH 4PTTA 5J13C 2HUEA 4PS8A 5TE6H 2C5DC 4IM8A 1EGJH 2WGNB 2EEXA 5F1IB 4EI5D 2YAEA 4PY8I 4M6ML 4POZC 2X4OA 1U8CB 1LWRA 2QZ5A 1QX1A 1UC6A 2FBOJ 4DF9A 5G4MA 5K33A 2AJVL 2WBKA 1SHXA 2NPLX 1H9DA 1KDIA 3UTTA 4XC3L 4NQXA 3TBCA 2IH9A 2CMRL 2YKLH 3KXFA 3C8KA 3PV7A 3U1SH 4PSPA 2J55A 5HHPA 1VGEL 4GMSH 1IAOA 3K7UA 4QXTB 1FNLA 1SRDA 1CDCA 3FT4A 4UTAA 1EZSA 3TBBA 4W9ZA 3CFKB 4M61B 2CXGA 4FQ2L 5AAWC 5BZDB 1TZIA 4QIRA 5D4QA 3ETBJ 1JUFA 3MODH 4BH8B 4AJ0A 1MDAA 5EOCH 3SO5A 2DQTL 4MSWB 4X80L 1SJEA 3CHOA 4NO0B 4JREB 3EZJB 4G8FB 2Z92A 5DD5H 1XVSA 1JFHA 2LHAA 1X5IA 4YGVA 2MCG1 4N0UE 3KWUA 2E74C 3CSGA 2VRKA 3SDXA 1F97A 3BRGC 5GHWL 1C5BH 2XV0A 3LKNA 3EADA 4AZ8B 1NCIA 4M9PA 3I74A 5HYQA 3VFWB 4K3JH 4S1RL 2Y7MA 1GYUA 1NKRA 2LFEA 2ZPKH 2D9QB 1A9EB 3MV7D 3E8VA 1ASPA 2OP4L 1AKJA 1DQVA 3OZ9L 3U4BL 1XR8B 4U4IA 5I73B 5DDHB 1ZHBB 1TF4A 1P5UA 2VW7A 3CFIC 3JYCA 4JG0L 1FFNA 4MYPA 4MA1C 2FT7A 2OW6A 2ZYHA 5D7JD 5DK0A 4N8VA 5I1KL 3WN5B 4GAYA 4FZEH 1QFOA 3P3YA 2Y6SC 4CN1A 2F74B 1XX9C 3ZO0A 2HT4C 2EE2A 3CFEA 3ECQA 4OLVL 4I3RL 2X4RB 4MNGE 5I1CL 3US1A 1Z5LB 3PQYD 2X4TA 4HF5L 1HDMA 3FRUA 1F4XL 1BCIA 1C8QA 2GC4C 1P4BH 3OKLA 5E6ZA 3BAWA 5I6XC 4KXBA 5MEQA 1RHHB 3Q6FB 1SXNA 3SN6N 1UEMA 5B38B 2R29A 2F1AA 1WYJA 2XQYK 3MFFB 3MRNA 3OGCB 3T3PE 4LRIC 4OJEH 2HZHA 3G5YB 2YPKA 1U6AL 1URIA 2C3VA 4UZGA 5AKVA 2EVGA 1B0RB 5E4IA 5DEFB 4LL1A 4NC1E 4YDVB 2W8CA 3NQKA 1C08B 4Z8FH 3EDDA 5D55A 1YPZB 3EIFA 2IADB 2ZJSL 2YHGA 4ZUWB 5AYUH 1QABA 2HTKC 5DVKA 3WIIH 4DESA 3P1VA 1B2YA 4PJDA 3T9WA 4I3SH 4U1KB 2FUTA 5TQ2H 3VGAC 4K94C 4LCWB 1JS4A 2PP7A 3BUBA 5KTEH 1A9BA 2G3MA 2RB8A 4QHNA 5E5LA 4EUPG 4DUXA 1TMQA 2FBRA 4JAMB 2NT0A 2CUMA 1WC7B 4PLJD 1DBAL 3V4PB 5CP7A 3D87B 2HWZL 1THAA 2EE9A 3PHOB 4TM9A 4UTCA 4JKPL 2VXSL 2R1YA 1A21A 3PNWB 3T0EB 3GZOA 4YDJA 3NK4A 3L81A 3AITA 3AREC 5F1NB 5C0FB 4GG6E 4FTVA 1W0WB 3MGTB 3ZK0A 2H26A 1JWSB 1PL3A 2NX5B 3IEAA 3MN8A 4IBWA 1RZKL 3KPTA 4UV7L 1B6DA 2YJQA 3L1OL 4DKAA 5DC2A 4GRWB 2GJ6B 3CVBA 2PPFA 4JQVA 2X6BA 4QCIB 2GBAA 2FX7H 2C7UB 1LD9B 1EO5A 1VESA 1QI3A 3C6LD 3HA0A 5IB4B 2H3XC 5ANHA 5IROA 4AT6B 3DO3A 4Q89A 1UWGH 3H54A 1JD9A 4J23A 1M05B 4LB8A 4UI2A 4LQFH 3UAFA 2YLHA 2JJUA 1HZLA 4R0LB 3MXVL 4R8WL 1S7TA 3FT3A 5KS9A 4DPBX 1BG9A 4AQAB 1HX0A 5TE7H 3BO8B 3S96B 1DQIA 1R3KB 3MOQA 2MQ3A 2RJMA 4YX2L 4GMTL 3BP5B 4AEIL 5TK4A 4ORGB 3PAYA 3BFQG 2AJYH 4LFHG 2MEJB 5B8CA 1KN4H 1QEXA 2VDRH 5DTFA 3CH1A 3VFTB 2GIMA 1G9HA 2SEBA 1NSNL 1M56B 3WY1A 3NCFB 3F01A 2MOGA 4C4KT 5EZJA 4XP5H 1ADQA 2NDGA 1FBIL 2BNRD 2BVPA 2WXRA 3KPMB 3TNNB 3E2HB 1P7KB 1UG9A 5J11C 4RLDA 4W6XB 5E95B 4NAMA 4KXCA 3TYGL 5C9KA 4QXUH 5KVGH 2WBWB 1A22B 4I8DA 3CVHL 3PP4L 5GS0L 2OW7A 5DFTA 3L1FA 1U3ZA 2XWEA 3WFEH 3CN3A 4A37A 4MHHI 1XR9A 1I3UA 1UWFA 2GTQA 5AZEL 5K39B 4B9CA 5E8OA 4YXLH 4GQ9H 4LKXA 3M7OA 4IBVA 2D7OA 1EO7A 1WBZB 3PWJB 4QHMB 1A6ZA 4F37K 4PJ5A 4I0CC 3QUMB 3RUGB 2YK1L 4M6OH 1E4WH 5F7DB 2H2SC 4DQOL 2NLJB 4ETQB 4ZFFB 3RJOA 4MHHG 1D3CA 4RRPG 2IOMA 1CK0L 2IOIA 3GMQB 3GXTA 5BQ7A 3O6FD 1AY1L 4AM0Q 3UMNA 1J18A 2E76C 1DBKH 1BXVA 4Y16D 3KYMB 2VO8A 4MD4A 4YZFE 3NJFA 3VTMA 1C5DB 4LSTL 1F0LA 1HL4A 1INDL 1MFEL 5DI8A 4BFIB 5H4ZA 4W9EC 4PGJA 2WBJA 4U1LA 1T83C 4MNQB 3MRBB 1XBDA 2Q5BA 2EEAA 3MRCB 2OYLA 3SKNB 5J6HA 1XB8A 1GS7A 2O5XH 4W9IC 4N5EC 3O11A 1JI1A 4MZRA 5FDYA 3BQUA 1H5BB 2ZUXA 2MKWA 3ATDA 4HXAH 3K1KC 3S36H 4IEFA 3D2UD 3Q6GH 5C07A 5FYKL 4S1SL 4RBPK 1AANA 1I7UB 3BFOA 2J56A 3U2SA 3BGFC 2X9XA 4FKEA 4ENEC 3LZRA 3MBEB 3PIQA 3KLSA 1CDIA 5IJKC 5ID1A 4FEMA 5JHAA 4F20A 3P11L 3F2LA 3HZVB 4HJUA 1P69B 4NCDA 3VFSA 3GSOB 1MNUL 5F9WB 3APFA 2RAMA 1QLEB 1K3ZA 3X3GH 1CZ8L 4S1QH 3LTVA 4GUOA 3NOIA 1SY6L 2CJ3A 4OGYL 5HDQH 4F2MB 4HC1H 4BFBD 3RNQA 3RIFK 1T0NB 3KS0J 1G1CA 2CO3A 1X5AA 4JZNA 5FIEA 1KPVB 2OXGB 2X70A 3TA4D 4Y2NA 5CLWA 3FTXA 4AW7A 1FLRH 3EJYC 4ZD3L 1RJLA 1NCUA 4ONGH 4ERSH 3SDCB 5JOEA 3QI9A 2AGJH 3MRRA 3WYRA 4J6RH 3GJFA 2PYEB 4H26A 5KJ7E 2FB4H 4WK4B 4LCUA 2A6JA 2BLFA 1M4KA 1QRND 3EYOA 3ZYOA 1MFCH 2EQDA 5D93B 3U6RA 3C6EA 5F6HI 2OKMA 1QSFB 2WVVA 5GRVK 3ZL1A 1WZLA 2X2JA 5HYSB 4PN6A 4CVZB 3BZDA 5EWIL 1ZA3A 3V6BR 5JPMB 2VDMH 2XA8L 5I17A 5JOFB 1GIGH 5GGRB 4JPIB 5EC1B 2QEJA 4L18A 3T6VA 1A7OL 4Q9CA 1C5CL 1QZ1A 3MU3A 3MRMB 4TULH 2IV9A 3W37A 3IMWA 5DSCB 1T21B 2DZEA 2Z8SA 3GT6A 3O2WH 4NKOA 5A16B 5ERWB 5LXGL 5KJRL 4OLYH 4XN7A 5FGBA 2B1AH 3KJ4B 4Y4FA 2DQDH 4E9YA 3UYPB 2Y0SA 3EGDA 3WLWC 4MB5A 4A2GA 1CE1L 1CU4H 1GJUA 1FNSH 1TKWA 3V7AE 1YNTA 4YE0A 4LSUH 4IKKA 3EFFB 1L9MA 3TT3H 5BRZD 1S8DA 3BVTA 2I9TB 5A2LH 5A2JH 3KBFA 2G3XA 2DW5A 4AV4A 1BAFL 1U8IA 3FJTA 4OCSH 1IV8A 5D96B 3DRTB 2H1XA 2BVEA 4KROD 2OMUB 3ZKMD 5IW1A 3IS0X 1QLEL 4N1HB 5GS2H 5AWNH 3K6IA 3H9SA 1OY3B 5HYFA 1BQSA 3EYVA 3LEYH 4BE5A 4NM4H 1SQ2N 2UY6A 2XN0A 3QULB 5K93A 4A2EA 1Q1JL 4PFEA 4DPRA 5MEOA 2CJUH 3AM8C 5E5MB 4GRMB 1S9VA 4JG9A 2FX8H 4Y8AA 4JHAH 5KSBE 5L4FA 4OKDA 3BYYA 3MI6A 3VQLA 2AK4A 4XXWA 3GLEA 4QRUB 5K9KA 2ZAGA 2Z31A 2J1YA 4R26H 4P2QA 5CZXD 3WD5H 4ILDA 1BFSA 4NUPA 3R8QA 2Z64C 5GGVH 1WBXB 3INUH 1HJCA 3AWEA 2WUCL 3HMXH 4XMWA 2XWBB 4AQZA 1AIFB 4HK0A 2E7CA 3MRPB 3V8OA 5GS0D 12E8H 4OUOA 3QHFL 4PVNA 2YC1A 4DETA 2GK0B 1NGXA 3CVIL 4NJ9H 1MRDH 1CTNA 4C57C 4S0HA 4P23D 4HSCX 2GABA 4PYGA 4NX0A 1CO1A 1S78C 3NIGF 3RB7A 1ZT1A 2EYTB 1GZHA 3EYQC 2RQEA 1UD2A 1W72A 2IF7A 4AOFA 3UAJD 5EIIA 4I0PD 3MV8E 3BWUF 1Q94B 2JNZA 5F7EH 4IMLB 1E27A 3TBTA 5AL0A 2CDEA 2XXFA 4H44C 4NZRL 3WHXA 4Z3JA 4IDJH 4PJ9C 4NQEA 2ADIA 3L2NA 4LEBA 4P5RA 3WAJA 2YMOA 1C16A 3IB4A 4BFFA 1RUQL 2WAHA 1G9EA 1ORQA 4HJ0D 1AJ7H 3V5KA 4JFSA 5K59E 4WI6A 3QNXA 1PQZB 3JV5A 5HJDA 1GMIA 1KCVH 4LOUC 3UP6A 3AT9A 3FRPA 3IJHA 1H3XA 1TVHA 2A6IB 4JLRA 5JW3H 2IDCA 5IJVB 2FR4A 3HG5A 2BNUA 1G5AA 3L6FB 3QFJD 1QVOB 3PABB 4HPOH 3MPCA 4NOFA 3QPKA 3UPCA 3N40P 5AZUA 4GKNB 1QFHA 2ZCLL 1G9MH 1BVLB 3PYCA 5IQ9B 3AACA 4B9ZA 2JTDA 4PRPA 1I82A 1R3LB 4BRVA 3TO2A 2CIIB 3HOGA 4RGNB 2BVOB 2YN3A 1ES0B 2NCEA 1YC7A 3D85D 3DJ9A 3FU6A 5LAXA 3GC3A 4KRNA 3S5LG 3H6JA 3V0WH 5JQHC 3AUWB 4KY1L 2FBJH 1OSEA 5I30L 1N7MH 5K9JH 4X9YA 1O7VA 1KB9K 3LXBA 4P4KB 1U42A 3JV4A 4L29A 3ISWA 3T77A 3WJJA 1OK8A 2YD2A 5JORB 1WFNA 3NZ8A 4X6CA 1D9KD 3CPLA 5L6YH 4PJGF 1MH5B 1TZ8A 2WLMA 2EILB 4A63A 4XCFH 2QGEA 4M8QA 1OAQH 1RZFH 2WXQA 1NFIA 3BCFA 4K9EL 2DJUA 1B4RA 1D5RA 2HA1A 1U8CA 2XWDA 5I0VA 1WUZA 3OD3A 4ZW5A 1BEYH 2VR9A 3Q06A 4U1JB 3X1BA 3CFDA 4ZPTA 2XKSA 3GSNA 1QUPA 2MWCA 1BX2A 3BP4B 1T2QH 2JIXB 5CUSL 2KBGA 4F8TA 2DQIH 3MLXL 4BQ9A 1KBPA 3GZKA 2DQUH 1R46A 3QWNA 4L48A 1YEHL 5HHMD 2FIKB 4B9YA 1TZHB 2OMVB 3I9GL 3CFKA 4WHTA 1MFAH 4PVLA 2VM4A 5AOIA 5BZDA 3M45A 1X7SA 1U8OA 2NNXA 4HIXL 3U46B 2XLLA 3ZZSA 4MX7B 4BH8A 5JMOC 3TYFA 2V3EA 4MSWA 4FNTA 4ANXA 3HE7A 3NIDB 4G8FA 2OR7A 3FBKA 2DTSA 2GTWB 5J7CC 2N7BA 1KEMH 3UEZA 1I9JH 3GLAA 4FFVD 5SWSB 4R7NA 2SODB 3HNSL 6PAZA 1CDHA 4J3OG 3P73A 4M48H 1CVRA 1QATA 1UZ8B 3GRGA 5L4IA 3D18B 4AZ8A 1QHQA 5FYJE 2RBLA 4F15B 2QQKH 2V7HB 2J2ZA 3C12A 4JRXB 3VFWA 1FO0H 3PL6A 2XFXB 3ESPA 3D1MC 1M7IA 5KANI 4Z95L 4OV5B 4FKKA 1TYEB 2OSXA 5IEKB 4TVPE 4N5UA 1HI6B 2BHFA 4GT0A 1J87A 3N50A 2CPCA 5CZVH 1LEIA 1XEDA 3H53A 2H0PA 5DDHA 1C12B 1ZHBA 3IPEA 3WFHA 4CMHC 2OMWB 3D7PA 4JVUA 3DJTA 5KANG 3RVXD 3WN5A 2M2DA 5KYYA 1G84A 4OD3H 2B2XH 1IO4C 1PSKL 3VQ1C 2JJSC 1GJWA 4OZIF 5CCGE 3DPDA 4WWKD 4KI5C 5EU7E 4KMTL 5FYJD 1ZT7B 3WEBA 2X4RA 3BKJL 5E8NB 1DDHB 2ZKWA 4GSXA 4NQCE 3HAEA 2Q76A 5FHBH 3L5WB 3TJPA 2OYPA 4OIBA 1H3VA 1RHHA 3Q6FA 3K6SB 5B38A 1LK3H 4XP1L 1MCEA 2WNXA 3QWQB 5EG6C 3D07A 4EIBA 3OGCA 3UROR 4P46B 3LH8A 4K7PY 1XCTB 1HIMH 3VI4E 4DJMA 1C08A 4JO1L 1FFPB 1YPZA 3CPUA 2R0WH 3N3EA 4JG1H 4PRHE 2PWHA 1CTMA 3SEPA 3NG5A 1AQKL 1LEGB 1TSHA 4KQ0A 4U1KA 2Z34A 3H56A 4NQCD 3UC0H 2O5NA 1YEFH 2Q20A 4LCWA 4UT9H 2GAZA 2F7PA 2WJ5A 2W0LA 2WLIB 2CDFB 2YUWA 2JK5A 4JAMA 1TQBB 2WZ6A 2UWEA 3V4PA 5LN8A 1UCBL 4K71C 3C09B 3QPQC 3PHOA 1JRHL 1TZGH 3ARSA 3COOA 3L4XA 4UM8B 3ZT7A 4PRHD 2BS9A 4JEGB 4WSJA 3GWJA 1OM3L 2CA3A 3QYCA 3OKOB 2Z65C 4BSJA 2YRPA 3MGTA 1IJNA 1E5AA 2CHNA 3R19A 5FUZH 2G30A 5C0RH 2V2TB 1NGPH 2B4CL 4M56A 1G7QB 2NX5A 4MFHA 5CS7A 6CGTA 3JVGC 1USQA 2GJ6A 4XNZB 2PXYC 2YKKA 1CDJA 1UJ3C 2OTWB 3ESMA 1A2YB 3N9GL 3DROA 4O58H 4PWFA 3IYLW 2TSAA 1F58L 2OM5A 5GXBB 2UYLB 1CI5A 1I3RA 2A99A 5HD8D 3BZFB 1MCPH 3VFUB 2GVYA 3GFUA 1OW0A 3LN4B 4R0LA 5DHYA 3G08B 5FCUL 5AVWB 4WEMB 1U93B 2DV6A 4GLRI 2ZWZA 3OHMB 4RMSA 2DJMA 2OCJA 2XZAH 1I53A 3TOPA 4DP5X 4Y19B 3B9DA 1X5ZA 4GAGL 1XD0A 4LSRH 3REWB 2PWFA 2ODIA 2VO5A 2YSSB 4AJVA 3BD3A 1EK3A 4XPTH 3ARBC 3DGGB 4P2OD 3TWCH 4P5TC 4HEPG 3LV3A 3OLEA 1XF5B 3B2PA 4F92B 2BWQA 2RACA 3ZGIA 3GNMH 5E2WH 3S3PA 1NC4B 3K5SA 4QPEA 1MPAH 3ZO9A 1SLXA 2CGRL 1FVCA 4M9OA 4N2IA 1HWGB 1OTSC 4QYAA 2FD6L 3AWGA 4CNIA 3N41F 4E9LA 3G6JA 4POZD 3EJQA 4UILL 3D12B 4YHIB 4BKTC 4XPHH 3MV11 5IHUL 4NUJB 1T1ZA 2VITB 3HI5H 3V6FA 2GC7C 4X6DE 4OF8A 4PGBA 4NCC2 5JHDA 5FGCB 3DGDA 5LWYL 4NQVB 4PJIB 3RY4A 1EUUA 3UTZB 2F1EA 2KLRA 3NIDF 4GUCA 2ZIDA 4GXUN 4HUWA 1JPSL 3IMSA 3ULSA 3VGEA 4CVXA 4KXZI 4WFEE 3MUZ1 2JJVA 3OR7B 3QJXA 3SKJH 2HFGH 5CINH 4JB9H 5CGMA 1KGYE 2O30A 4IHOA 1IGCL 5K39A 2IAMB 5GS1C 1P7QA 4M6NL 1WBZA 3PWJA 2E9WA 4QHMA 2VR6A 2YS4A 4NFCA 5L0QC 3RUGA 3QUMA 3VXMA 4L2YA 5DZ9A 1S4IA 3FONB 4H7VA 4ETQA 1IRAY 4ZFFA 3L54A 4LGRB 3X1EA 1X7QA 4MWFB 2AXFB 4F1SA 2W5PA 2IANE 2QKIB 5FW8A 1J12A 1DVYA 3RA7L 4K3EH 3GXPA 3KYMA 1A6UH 1QW8A 1DO6A 5ABAA 5IM7A 3N04A 3CX2A 1DBBL 4ZW8A 4OIIL 3U1PA 4K8RH 4JM0A 1ZV9A 1QPKA 2KQMA 5GZOA 5F0LB 4G6JL 1TTBA 2J8OA 4NWUH 5DLML 4NM8L 3MRLA 4MNQA 4EIZC 5DWUL 3H8NA 3MRBA 2OZ4A 1SM3L 1FGVL 1M57B 1YY9C 4NQQA 2ZXWB 5DRNB 2PPAA 1SQMA 5IKCA 1QNZL 2ZX6A 4EF3A 1NFAA 2AQPA 3FU3A 1D6VH 2I69A 2Y6SD 3VRIA 3AT0A 2GI0A 3N43F 4O02L 1K2DA 2VLJB 1JVKA 1B0WA 1SNRA 1CD1A 5CBEB 3VACA 4GSDH 1I7UA 5FO7B 3E6FB 2XC8A 5F93C 2JFCA 3P77B 5C2BH 3RGVD 2UXGA 1YEJH 4JJHA 3FQRB 3GO1L 2IWGA 1YUKB 1RHFA 1E8YA 1IC4H 4RFEB 3SQOH 4PCYA 5IWLC 2AJSH 2M26A 3S98A 5LCVH 4ZT1A 5IREA 1S7WB 4F2MA 5GGTA 2Y1AA 2CBOA 2ZX5A 3IFPB 3Q9PA 1IE4A 5D2LE 4H1LB 2BVQB 1T0NA 3S35X 4QDGA 3LNEA 3DGCR 1IAII 1FYTE 4U3CA 3CFUA 3O0RL 2XPYA 3PFUA 1YMHB 4OQTH 1U41A 1J8HE 5FYKU 1G7HB 3B3IB 4E9QA 4I3GA 5EU6D 1OAKH 1B0GB 3AG4B 4ZUTA 2JCCE 5BW7C 1HOEA 4KPHL 5T1LD 3V5DA 2B9AA 1O0VA 2C1PB 5IQ7H 2HT3C 3F58L 1QSFA 2QADB 4YSRA 4NN6C 1VIWA 4FQPA 2V7NB 4MZIA 3WHE1 1BVKA 2CUHA 32C2B 4OTXL 2HFEB 1CD9B 1JTPA 2E7MA 3O4OB 3W11C 3LH2L 3QARA 1ZLWK 2G5BB 5GGRA 3ARED 1SVZA 4JPIA 4QRTB 3W57A 2GFBB 1GGCH 1J8HD 1TEYA 2BXZA 3MRMA 2XV6B 2ZYRA 3JWOC 4WU7B 5KZCD 5DJAB 2F53B 2VDQB 4WKZB 5DSCA 2EH8H 2CRYA 1T21A 2JWYA 3HC3L 4KRPB 1WFTA 3MTRA 5F8RC 3AQDA 4NO5A 4L5FH 4LP8A 1O9WA 4IRJA 3I02B 3L16A 2ZOWA 5DHVA 2FEDD 2EDRA 2Q0ZX 5IBLC 3UYPA 1ODAA 5DC0A 4Z18A 5E08L 3Q2VA 4FA8A 4LPUA 3OAUH 1BXAA 4HU8A 2FGWL 1KTDA 1RIVL 3EFFA 1WA1X 3D25B 4GW1A 1HXMB 2MTPA 2NY4C 3QDGB 3LZPA 2Z35B 2I9TA 4EI0A 5I1DA 1YMMB 2RR3A 5T1DL 5I19L 4F58H 1FI8C 3MJGX 1BVZA 1NGQL 2OMUA 2WXOA 3MRIA 1G7IA 3IETB 4HMEA 1N3NB 2W92A 1MHPL 4AGMA 2WQXA 5J1AB 1AXTH 2ZQKA 4GRMA 3S35L 3QA3B 4J2XA 3MNZA 4L1TA 4Y8DC 1KB5B 3CUPA 1RUKL 3NTCL 5EBMB 2W81C 5E2JA 4Y4KC 4F7PB 2J4WH 2NQDA 1OB0A 4GRLB 1AQDA 3HG2A 3TBWA 4PJIF 2Z91B 2VB5A 1JZ4A 1L9SA 4JZJA 4FERA 4WW2A 1XAKA 5IF0A 1WBXA 4OZHE 4QRPD 4ZS6C 1ZT4B 3BSZA 1E6JL 4X83A 3MRPA 1WVZA 4Y0GA 1T22A 4FFZH 3RFZC 1ZGLA 5EIQA 2P8LB 1AO7A 2GK0A 1DTUA 3QUYA 2VDQL 2MCPH 2MNWA 2Y2WA 2EYTA 3FFDB 3C75A 1CURA 2K7PA 4UDTB 5F7BA 5ITFB 2GEQA 4R7DB 2R8SH 2YIHA 3DA0A 4XWGH 4AEHH 1WSST 1SMDA 5E1IA 1J5OH 1U8JB 3ZE2F 3P2BA 5E9DE 1CI3M 1RMFL 2HKHH 3JTSB 4I4WA 5LBSH 4JY5H 3ALPA 3GI8L 5EZOL 2VC2H 4PJCF 4UTBL 4NZFA 5FFGA 5ADPH 3QNZB 4FS0A 1EEUA 3BAIA 3IFNH 1A0QH 4UQ9A 1TJHL 5INCB 1NPJA 1MCQA 2GJZB 1CIUA 4NEHB 4D9QE 1KCRH 2DQFA 3R18A 5C3IA 3WFDL 1G94A 5I1JL 4I1PA 4I7ZC 3FTGB 3U83A 4OM0H 3L3HA 2ZOKB 1PQZA 1TJIH 2DYPD 3QT2A 3A6CL 3R1GL 5ANME 4KKLC 4LPTA 2A0LC 3ETTA 1NAKH 3QQXA 1JYNA 2GTZB 3LKPB 2APXA 2EUWA 2E6QA 2A6IA 2MPAL 5E99H 1RZJL 1BMGA 3MLWH 1J0JA 4N5ED 3ZXAC 1DL7L 1FNHA 1VACB 4GKNA 5CSBA 5AVSB 2X6CA 2YAPA 1I31A 2L7EA 5MHSD 2NY1C 2FYYB 3K1DA 4P2CG 3IAQA 3QIWD 2B20A 2CIIA 5L8LB 1WGVA 2Z0UA 2VDLH 1EGJL 3MZGB 1V05A 1ZSHA 3MROB 3QJHB 1IX2A 4BGDA 4XNQA 4GO6B 3GBMH 7FABL 5C0BA 4PS3A 1TR7A 3MLVH 3NESA 4P4KA 4EUPH 5HSFA 1IQWH 2V5RA 4GNKB 5JORA 2QFPA 1CCZA 3ZTJG 3VWJD 1H3UA 4PJHB 1UXWB 3L3DA 2YQ3A 5DK2B 3RBGA 3U1SL 1SXAA 1Y1DA 2VQUA 2XZZA 3ESOA 4GMSL 1L5GB 3T1WA 4BE6A 5BZWA 4HS6A 4D9RE 2JF1A 4KZDL 4DGUA 5FWRA 3FCTA 3BD5A 3L4ZA 5TFSL 5LAPA 5ID0A 1NEPA 3UACA 3C08H 2OMNA 1CFTB 4U1JA 2YBRB 1E50A 3HJ0A 3MA7B 4AH2B 3EJYD 2DWXA 1IMHC 3L7EB 3BP4A 4K0OA 4FN0A 5A7BA 1FG9C 5EOCL 1J5HA 1F4HA 3L1GA 3GQFA 5JDSB 1QTSA 4M7LH 2F8IA 2OQJA 1XDTT 3VD5A 2OLDA 2DF3A 3ZN6A 4DP0X 5D1ZC 2EDXA 4WNSA 3L5HA 3HMWH 2YUZA 3NJJA 1QFWI 2XFGB 4D9RD 1Q8MA 1C5BL 4Z76B 4LCIH 1ZRUA 4HJIA 4PP2B 5IW3A 2VXVH 4MX7A 4UAHA 4NPYB 2WD0A 4Z7QF 4M62L 2IPTH 5CCJA 1NANI 2ZPKL 4PRBA 1BF5A 2ESVD 43C9B 3BIKB 3FQNB 4F9PC 3ZYIA 2CSPA 5SWSA 2PO6B 3ALXA 5CGBA 3WGVB 4JPVH 5E1AB 4FQQB 4I2XA 1Z9MA 2Y36H 3D18A 4XPFH 2DM2A 4FZEL 2XBTA 1NQBA 4YAQA 5CD5D 3LPOA 2V7HA 3IRZA 1WFUA 4DP8X 2XFXA 1IBGL 3E7JA 1IGFL 2R7EA 5DRWB 1OGTA 2P24A 2ZKMX 4RGMC 4AIXA 1IBFA 5DQDH 3FQUA 5BMFH 5HGAB 1W91A 1ULVA 4FG2A 4I5BB 1AACA 2X7LA 4IRSB 3T2NH 4ZDHA 2QPDB 1SDAB 4XHJC 5E94B 1ZMYA 1IT9H 1EEYA 4Y4HA 5BS0A 4GG6B 4AMKH 4HETA 2FO8A 4XZUA 2DJSA 3RWIB 1MXDA 5C97A 5JYMA 3PDOB 4OCXH 5EPMA 1PYWB 4HUUA 2CUAA 1O6TA 4UZUA 5EBLA 1QR1A 3SDDC 3WFBH 4J3XA 4Z8FL 5AYUL 3WI9A 4X7CC 3WIIL 2ZUWA 1J0KA 3L5WA 4ELMB 1FGNH 1Q9KB 1OP3K 1YEEL 3HC0B 4UM9D 2IDQA 4LO9A 4WI5A 1WFMA 3UJJH 3SOBL 1MFMA 3DETD 3ARQA 4NPJA 4IIQB 4XGZB 2AQ3A 5KTEL 1XGTB 3N5AA 4YK4B 1XCTA 2ZT9C 3Q8BA 3QR2A 5I82A 1F90H 2VR5A 4WWOA 1J5CA 2P47B 4L4VA 5HHOB 5F1KC 1MDTA 5B1BB 1L6ZA 4AE1A 3DO7A 2JKRM 4L2LA 5ESVB 3ZQ9A 3L5IA 2CBPA 4BEIA 4A66A 2H7WA 1CTOA 1UUSA 3KW8A 2CO2A 1F4YH 1EAJA 4HFUH 3ZIYA 5FEBA 2WLIA 2WBXA 3TZVA 1XF4A 2FWSA 4HK3N 4A6YA 2JB5H 4PJ7B 4KVPA 5I71C 3EYQD 2ED8A 4QKTA 1BZ8A 2OK0H 4ODSH 1XF2B 4CILA 3FT2A 2HLEB 2Y72A 2IVFC 4GIAA 2R56L 4UM8A 4JPKH 5E5UB 2FX7L 4B50A 3KL5A 1R5VA 4W68A 4KO9A 1N2RB 1TZAA 4WLCA 3TBVB 3OKOA 1TU2B 4L3EB 4U6XA 2JV6A 3MCG1 2V2TA 1S7SA 4LQFL 1G7QA 4GAJH 3KCPB 1E4XH 4PRIE 1Q0XH 2G2PA 3QG6B 4NBXB 3FCSB 3QEHA 4MA8H 4NXKA 1VERA 3FUNA 1SEBB 3D33A 1TZOA 1YEWA 4LOUD 2E9GA 1F56A 2OXHB 3BISA 3HRZA 4LEEA 2ZOLB 1B88A 4OGZA 2EDFA 3QGVA 4XNYL 2AJYL 1L7IH 1ZKAA 1U93A 1KN4L 3GXUB 4JDTH 1F00I 1JWUB 1AGDB 4PJHF 3TBYB 4CBPA 3L08A 2XXGA 4OF7A 8FABA 4Y19A 4MMXC 1TJGL 2QZQA 3LKOA 4PB9H 2WKOF 4XR8C 3I3EA 5EO1B 1UACH 4FFWC 2DQMA 3REWA 2YSSA 3F6JA 4QTHA 3UJIL 2GHZA 1KXTB 2ZOTA 5ALBH 5DLLA 4XP5L 3DGGA 5LDSA 3C5ZC 1R0AH 1YVLA 3PJSB 2ZD0A 4KI5F 4LPXA 3VXUB 3PREA 3WO4B 1ECYA 2BOBA 4QXUL 2MQGA 1IB5A 2DH3A 2ZWLT 3A4FA 3QORB 4LP5A 1HC1A 1CLYH 2LU5A 5LG6A 3WFEL 5I0DA 1KXVA 3BEVB 4WI2A 1N10A 5JW4Q 4R2GD 4Z7WE 3WNMA 3ZYJA 1MI5D 3LIUA 2JLLA 2PYFA 2VITA 5CD3A 4GQ9L 2CBMA 4NQDD 2BX5A 2YGVA 1FP5A 5L2KA 4CRPA 4XHQA 1J1PL 3IJYB 1S46A 2YQ2A 5KSAB 2LTQC 1E4WL 3NCCB 4FQXC 3D06A 4X6BB 4OBRA 5EIVA 4MXVE 2CLZB 4ZS7L 1SJHB 3O8XC 3CHXA 3QS3A 5KWYC 3MRFB 4U3XA 1A65A 1OGAE 1T1YA 1OOWA 2X5PA 3T4AB 4EIUA 1M6OB 4Y5YA 4ACPA 4OY9A 3TIEB 2ICWA 1LO0H 4RH4A 3VAEA 1DJHA 2EICA 5EOTB 3ESVF 1VRSA 1L0PA 3IXTA 1TXKA 3ZPDA 3L5XH 4BFEA 4B9GA 3EW3B 4JRWA 3FONA 3LN9A 1W0YT 5F0JB 3MLPA 4MWFA 2AXFA 4DAGL 1LQSR 2QKIA 4IU3A 2ALAA 2O5XL 3MOBL 2A6KB 1MRFL 4XPBH 2WUBH 2VLRA 5EORL 2ED6A 2NXYC 2OL3B 1NDMB 4KI5E 5ACZB 4XNMB 1FG2B 2WLZA 3JWDH 4XMTA 3Q6GL 5FAAA 3T71A 1OHZA 2OMZA 3FUIA 4K4KA 4H8HA 4IGBC 4XN5A 2O61B 1EAOA 1IM3D 1EDYA 3RHWF 1KFAH 1NBVH 3ZSTA 5JMRA 3GJFK 5HGBA 4PWGA 5CJOH 2QMKA 5KYWA 2NUPB 5DRNA 5DK3A 4ELMF 4QHLA 1AXIB 2YR3A 5EUOF 4A39A 4JFXB 5AYTA 1JWMB 3AU1B 5IESL 1INEL 3PWLB 4YNYB 3C5JB 5MEPA 1H6TA 3GZPA 4OJAA 4Y2DB 2VLJA 5AD0A 4DHLA 5HDQL 1CGYA 5CBEA 4KI5D 2IV8A 2DQJH 1IBYA 1ETB1 3E6FA 4E5XG 1AZZC 3P77A 4ODWB 1TOXA 1A4JA 2XY1A 3ULVE 5AALA 1FLRL 1F8TH 3FTWA 4U2YA 1DSWA 4L9LB 3QIUC 4ERSL 1PFOA 2KPWA 4X8CA 1WDAA 5DHEA 2QPSA 4KZCA 3FPXA 4L0ZA 3IDGB 2P5ED 4J6RL 5FUOH 4PWEA 3VSUA 1F3RB 2PR4H 3B9EA 2FB4L 3IFPA 5JZ7C 5E4OA 4H1LA 1MW2A 4GFTB 1P9MC 2GB2A 4N85A 1YRKA 1XXDC 4CC1A 1MCOH 3U82B 3KPRE 3FO2A 3B3IA 1B0GA 4P2RA 4PG2A 5IEHB 2DEWX 2P8MA 3DC0A 4TVUA 3KPPB 3IKCA 1G6RA 1UFGA 3QQ9C 4TULL 1MHHB 2KT6A 3NVQA 4JVPA 2VQ4A 2XN2A 3B5TA 5KSBB 4F7MA 2YD7A 1KGIA 5DRZB 3OLDA 5D5MB 3VNYA 2EIBA 1ID5I 3QPQD 5J9PA 3Q5OA 4FZ8H 2O1AA 1HNGA 5BV7H 4FHJA 3KWTA 2G5BA 3TF4A 3NH7H 5CR8A 1CU4L 4QRTA 5AW1B 4FLSA 4QEGA 1VHPA 2L04A 3ZY7A 1QEWB 5DJAA 2Q3AA 4ZO7A 3HN8A 4WKZA 4PJBE 3IDJB 2WZ5A 2UZXA 4X2UA 2F54A 2HVJB 1DUYB 1KEGH 2CALA 1QUNB 1EFXA 2D9CA 3I02A 1TCMA 2JI1A 2PXYD 1NPNA 5E2VL 1ILUA 5ESAB 1FIGH 1MELA 2DM4A 5IVNA 2DQGH 1XSKA 2FEEL 2X9ZA 4F8QA 5AWNL 3ZE1F 4M7KL 3CK0H 3EH4B 2IMNA 3KJ6H 3QDGA 1LE5A 2Z35A 1A3RH 3MV8B 3L3IA 3ARFB 2CJUL 3FO9B 3VDAA 1S9YB 1ZK5A 2NY5C 3V4VA 1B2WH 4JHAL 1OCWH 3CNKA 3DX1A 3O4LA 1NEZB 5C08D 1CXKA 4PJEE 3SBWA 3DSNB 1QBAA 3HLAB 1A4KB 4R26L 2QL1A 4DW2L 4MJ6B 1DHKA 1G6VK 3UYRH 2XICA 1N3NA 5GGVL 2BK8A 5CFHA 2FO1A 3QO1B 2EVFA 3ARBD 1EZVX 4MDIB 4HH8A 2L7QA 2DLIA 1PZUB 2G60L 3KPSA 1KB5A 1UH4A 1XGYL 4KHXH 2RFXB 4F7PA 4NP9A 4NJ9L 4IOFD 3D3VB 2Z91A 5DVLA 3AT8A 1OTSD 4FFYA 2JKLA 1NMAH 5IHBA 1SGKA 4EN3C 4XBEH 5C0AD 3GEFA 1ZT4A 3KLKA 1EDQA 5D8JH 5HI5D 1HSAB 5F7EL 1KYOJ 4J3OH 3SPGA 3IDMA 3UZVB 3QH3A 2EDJA 3O6KH 1DQML 5C0NC 1FAIL 2FWLB 5HDWA 2L7UA 5FOBB 4A68A 4IDJL 3P0GB 2R1WA 4J6IA 1HE8A 3FFDA 1AKPA 4OZ4B 1EMTL 3RILA 1CR9H 5ITFA 3APNA 4R7DA 5E7BA 5I6LA 1AZVA 3CC5B 4BH7A 4GSQA 5JXAH 4J27A 4W81A 3DTUB 4JFDB 1KUMA 1NDTA 5ACMA 4UQAA 3QJUB 3WUZA 1U8JA 3IT8D 4JFHE 4QT5B 5CAYB 4TPRH 1OEZW 1PLBA 1O6SB 3DKHA 2XG5A 3WXWH 2QDWA 3HZYA 4ZSOA 3ZX1A 2ILLA 3QNZA 5DT1H 1V27A 5HYEA 5C9JB 2J6EH 4M3JA 5INCA 2GJZA 4HPOL 5I74B 4IJ3C 1XCXA 5K9OB 3D8MA 1NCCH 2NW2A 3OHXB 1MLCB 2CUIA 1G9ML 3FB6A 3BRFA 3VW3L 3VGGA 3IU3A 4UQEA 3S5YA 3O9WB 1F3JA 4MTMA 1YDPB 3UIZA 2GTZA 4YSEA 3LKPA 2CKBH 3A47A 1E4HA 2ICCA 3F3HA 1PD1A 1YNLH 3VDBA 2DQ6A 2IH1A 3CU1A 1E43A 2QHRH 5AB1A 3T0BA 1XQ4A 2B39A 3QWOA 4UANA 4N1EA 5IBUB 5L6YL 2RCSH 2FYYA 1NMCB 5D7JA 3U48A 4N0UA 3GHEH 1BZ7B 3FHAA 3P30H 1P6WA 4NQSB 1X5LA 1KBBA 4WZ9A 3V52H 1DVFC 3VU2A 3C9NA 1FFTB 4WEBL 4NNPH 1BEYL 3HUJF 3GMMB 1C1EL 4KKRA 1T2QL 1UXWA 3I85A 1H8OA 5DK2A 5DJXB 4ZAKC 5CIPH 3G04A 3RNKA 1L5GA 4OLZH 3O2DA 4KJWC 2VWEC 1L7TL 1VZGA 2DQUL 5EZLA 1AR1C 3CX5J 5C0CD 4XMLH 2KLSA 4OBSA 4YHNB 3BPNC 5FPIA 3QUXD 5G55A 1TTUA 3IAPA 2FJGA 5A6LA 3U9UA 2E27H 2XY2A 5B1JC 2ID5A 4PJFF 2YBRA 2EUZA 2QQLL 3AS3A 4AH2A 2Y1ZA 8PAZA 2A73B 3L7EA 2NY7H 5AZ2L 4MNGA 2RHEA 4Y1AD 3VFVB 4C47A 1NOFA 4PHXA 5JDSA 3R0MA 4NN7C 5H37G 4E36A 4JFFE 4PWHA 2Y06L 5D7IF 3FQXA 4AEEA 4K7FB 3ZE0F 5AVTB 2HT3D 2OS7A 3RZWA 4YBQD 4DTGH 4M48L 2IEPA 3KVPA 4Z76A 5BVPH 3DTXB 4PP2A 3U79A 3PWPB 1CQKA 3FMGH 3FOMB 4NPYA 3V0DA 5DJZB 1FO0L 5BOJA 3AQYA 3VI4B 4G83A 3E1F1 5HJBA 2HP4A 1I8UA 1VGKB 4AG4H 1Z9LA 43C9A 3NA9H 5GGSY 3MXWH 3GXDA 4HGKC 5IV2B 3ZDYE 1BV8A 2DKSA 1Y6MR 5HYSG 4WVRA 5AVVB 4FQQA 3HB3C 2EDEA 4X0NA 5GS2D 3BCDA 3RP1A 4JFFD 2A4EA 4PCKA 5CEZH 5T33H 3GB7B 1KGXA 2BSTA 4OD3L 5JLZB 1NIEA 1I1AB 3KR3H 4FULA 5TPWL 1KBGL 4H0HB 4JCWA 5IBLD 3MRKA 5DFVC 4U31A 3VXRD 4XVJH 3UPAA 4M1GH 2G9HA 4I5BA 3C6LA 2NY4D 3NT0A 3RKPA 3RFRA 3KXFE 5FHBL 4J3SA 4G6MH 3O3AA 3IM1A 4L4TE 4PJAF 4XCYB 3PAVA 5F7NC 5CLYA 3DYOA 1RL1A 3E1ZA 2YAHA 1XSJA 4PJFE 1PG7W 2JJTC 1MCWW 4KY2A 5DVOA 2DL9A 5F7FA 4GG6A 2L8AA 3FNKA 1HJBC 3ELQA 4NUGH 3RWIA 3PDDA 1T3FA 4IRZH 2XA3A 5J3HC 5CEYA 5CF3A 2WSDA 5CJ5A 3PDOA 3SGDI 5E8PB 1HIML 1XZWA 3I6GB 1WISA 1YEIH 1CICC 5D7IE 2R0WL 5AQ0A 5I0XA 1BQHA 4IBUA 4CSSA 3LIZA 1KCWA 3RL2B 5TDPB 2GJJA 1AQMA 3F12A 1ICTA 5FOJA 4MQSB 4N2KA 4DIXA 4P5KB 4L4TD 4G7SB 1N64L 2NZIA 4XGZA 2V4LA 4IIQA 4L8SB 3HKFA 1WT5A 1XGTA 3I6KB 4MAYB 1NDGB 5E9AA 3SDXE 3MLZH 5I0YA 3II1A 2AHIA 4YDKL 5BJTB 3C5SB 2D0FA 3EG9A 1T89A 2PPCA 4GINA 4OLXL 3KNBB 4KXZH 5DC4B 5LGHH 4ZS6D 3K71B 1K4DA 5DURD 4HALA 5T3XH 1TTAA 3SKOB 1SYVB 1TZGL 1GZQB 3IJSB 3LS4L 5B1AB 3DJRA 3WELA 1F41A 4U1IB 4N28A 4D0BA 4N0FA 1AC0A 1QBLH 3GRWA 3TBSB 4GQZA 5A40E 1QBBA 4OF6A 4U1MA 1U3YA 5A6IA 5C0RL 3MRQA 2QR0B 4L8BB 1ZPUA 5JPNB 3QB7C 4BELD 2XU9A 4G8GE 4RX4D 1BAWA 1XF2A 1AI1H 4PIBA 3I6LD 1MZZA 1QSEB 2VQTA 1EV2E 2Y2TA 3ZT5A 1NAMH 2CLRB 5G4NA 1PLGL 3G5XB 4KNTA 4PYHA 3TBVA 1MXGA 4XP6H 4LDCA 1TU2A 3PPEA 3BKCH 5KG9B 1REIA 5GZND 2XTJC 3OAZK 4W6YB 4X6DB 4BFNA 4MAUH 5B3JE 1T7ZA 5IJBC 1EQWA 4P3DA 1UKTA 3T6ZA 3VXOB 2HX9A 1H3PL 4GXFA 3BIBX 3II2A 3FCSA 4X5LA 2AABL 1S7QB 1SEBA 4KKLD 1W0VB 2A0LD 2DAVA 4KMQA 2ZCKH 4LSRL 3VH8A 5SX4H 2GITB 3HG3A 2ICWJ 4JO8A 4XPTL 2X2HA 1QAWA 4YIQA 5F7MC 5BNXD 2IALA 1XTLA 3CDGB 4L3CB 4IDLA 4CSPA 4KKAC 2Y3AA 3VI3B 4Q8BA 4XPAL 3GNML 5E2WL 5BRPA 5BUPA 4OZFG 3WJMA 4UF7C 2NY1D 1AGDA 2DMGA 1UOKA 1HXKA 2EDOA 3NCEB 4ODVH 2IANB 3MV9B 4HIJB 2FH6A 2CK0L 3LQAL 2Q8AH 4DPAX 2QDVA 1X5XA 1KJVA 4XPHL 3JTTB 1KXTA 2VXUL 1B4TA 3HI5L 4M93C 1RCYA 2KL6A 3RWDB 4E9XA 2AS5M 1J86A 3H6AA 3PJSA 2DLFL 3FQYA 2FVNA 3KLHC 2ZXCA 4JFEB 3SB3A 4JE4B 2XHNA 5KBDA 1L9RA 1ETZA 4FG6C 4JRFA 2HMID 3DXAB 3R7QA 5T8IA 4FP8H 3BEVA 3SKJL 3CVDA 5CINL 2HCZX 4JB9L 3WLBA 1OP5H 3MRHA 4AXWA 4UIKH 4ODHH 4JHVA 2PCFA 4GAAA 4P9HH 1FL6B 4PP1D 2XWCA 4LRNH 1CF1A 4XCCL 1K4CB 1T1XB 3HNTH 5KSAA 3BVVA 4Z0XB 4X98B 2EC9U 1NKOA 1KXQA 5CKGA 2H8PB 1VFUA 2DMCA 2D03L 5D1ZD 3ZHNA 5C7XL 1W2KT 3JWDC 3CLWA 4AYBA 2Z8WC 1M6OA 1YN7B 3L3GA 4K3EL 1A6UL 3TIEA 2Z4QB 2NR6C 3CSPA 3KDMA 1JHLH 4K8RL 5EOTA 2BHYA 3LKQB 4FYTA 2BJML 4ONHB 2E47A 4XN4A 1FYTB 4E9RA 3WBDA 2DIJA 4PLKD 1VA9A 1P84J 2WYZA 2AJXH 3ECWA 1J8HB 1HSBB 5EU5B 2NYZA 5DUJA 3CLFH 4O2CB 1SHMA 4OD2A 2JCCB 1W8EA 2OL3A 1JRHI 3O6ML 5F9AC 1D6VL 2EIJB 4XNMA 1FG2A 5CLZA 3U7AA 5GIRB 2WQRA 4YL9A 3SY0B 3L2LA 5EU4B 4YFDB 2GIYA 1AMXA 4H2AA 5C2BL 1M3JA 4HV8B 2NUPA 4FA7B 4G8EB 1IC5L 4XHJD 4N2FA 2WSPA 4JN2B 4JFXA 2PW1B 4FQJH 4I77H 5H94A 3TN0C 4CC4A 1JWMA 2I25N 4F7EA 1BD2E 1A6VL 1CGSL 1PZSA 1UWEL 2AJSL 1S9KC 3PWLA 3BPCA 4JM2C 5LCVL 1A64A 4Y2DA 3ZVVA 3KEHA 2AAVA 4QYOB 3KDPB 3TXAA 3BPOC 4MJHA 4QXWA 1RY7B 1XEUA 3L9EA 4OQTL 5C7ZA 3WTYA 2VSDA 1TVDA 1K5NB 4YOKA 4FCAA 3QQNA 3ML9A 1OAKL 1ADQH 4JFYB 4YSDA 2F8XC 4OT1L 3GSWB 4MMYB 3HG0A 1XL6A 4JFVA 1KIUB 2VT0A 5J1SC 5E56A 3MBXH 5IQ7L 3RWCB 3ULUH 4RFOL 2ZNXA 3MO1B 4ZYKB 2LVEA 1NCWH 3CMOL 1ETA1 4MB4A 3T3ME 1IE5A 1BLIA 1ECZA 4GKSA 2BSSB 2YD9A 3ME0B 5DJYA 1MJ7H 1F1DA 3SDYH 5DGQA 3WEOA 3NGBC 4QRQA 5IEHA 4JQIL 2VLKB 4NP4H 1RK0B 5J11B 1NEUA 3HE6C 1ZLSL 1A1NA 1KB3A 1MHHA 1GYWA 1YECH 2WLNA 2OYMA 5KSBA 4P23A 4ZQKA 3HN3A 1A14H 3ZR6A 2YFOA 1H3TA 3EOTH 5DRZA 1ET8A 2ZKXA 4IKJA 1RH8A 4L5FL 3QC6X 3JUYA 3VCLA 3EH1A 3HVDA 3QYNA 3QIBC 4D7PA 1U3HB 4DZ8B 3UAJA 3D4YA 2DIBA 4I0PA 4OZHB 4ENZA 3OAUL 4XX1E 2DLTA 1I1YB 3HHSB 3QQDA 1NJ9B 1QEWA 3HS0C 4QNPE 1NLDL 3H55A 1D6EB 3WIHA 4F1ZA 2ZG3A 3IDJA 1E6OH 4K3GA 3HPJA 4YSOA 2W9LA 1QUNA 3EJTA 3VI3F 5IFAL 2JKNA 4XCEB 5DVPA 1RUAH 3MRGB 5JHLH 1VADB 4LLUB 3RTQB 3CGTA 2W65B 3ZTJH 1MHEB 2D7PA 3RZCD 1AG6A 5AVYB 3APDA 2P43B 4MZ2A 3TA3C 4DK6A 1AXTL 4UOZA 3MV8A 3LEXA 3NFSL 5E9DB 4ZTOL 1S7RA 3Q8AA 3UCQA 1ASOA 1NEZA 2ZF8A 3ARGC 2FGZA 1MJUL 1TCRB 3ESUF 3FSWA 3W3BA 2BOCB 2J4WL 4X4XA 3MNMA 1A4KA 3FH8A 3NABH 4HXBH 5T1KB 1MF2H 3FFCD 3VFGL 4DZBA 1FF5A 3ISRA 3HI6L 4WV1B 3SBQA 1ILSA 4FFWD 4BWWA 4J3OC 2V17H 3D85A 4UOQA 3SPJA 4OB5H 1MQKH 4MDIA 5DYFA 1HHHB 4BM7A 5KSUB 1JGIA 4EI6B 2OPCA 3BAJA 3B2XA 2XIBA 3C5ZD 1EVUA 3D05A 4HWBH 2AF2A 3BW9A 4EDXA 4FXKC 3BGFB 4JGUA 1KLGA 5D70H 1CGUA 1NIFA 1U8KB 3QCVH 1D9KA 1YYML 4AUUA 1LM8V 4PIRF 4R4FH 4Y9BA 3GJFH 4GYBA 3WIFB 3H3PL 2FQEA 2H3KA 3PV6B 2R8SL 2VW4A 3PPSA 4WNQB 4XWGL 4JG5A 2AEIT 4AEHL 3ARWA 4G7VH 5FUCC 1QFWH 3A67H 1T66C 1J5OL 2N1KA 1HSAA 4LF3A 4X5WB 5IVZB 2HKHL 4ZFQA 3UZVA 4JY5L 3LEVL 3EOBA 4FQXD 4NIKB 3IFNL 4D0DB 1A0QL 3H7BA 4K8RD 3INOA 4BGLA 1M2VB 3O8XD 1SDYA 1KYOK 3QUKB 1GSMA 3C8HA 3CC5A 4XMKL 5C0IA 5JYLA 1DSFL 1LMKA 3N85L 1MIEH 2WQ8A 4OM0L 3PUUA 5E00A 4QT5A 1TJIL 3SQBA 1WA2X 4WF7A 1O6SA 5J1TC 2DI9A 4H0GA 3V0HA 5DWPA 3K81A 5C9JA 2B1HL 5GRVL 2NYKA 4KJPD 1GOGA 5DXWA 5K9OA 1JGVL 1MLCA 5F7HA 1LO2H 2DWDB 4HDIB 5F88B 5DD6B 5AW3B 2W0KA 5LDUA 2NXYD 2FJHA 3HPLB 3R0NA 1CXLA 5EA0H 4F37F 2BSED 4MJJA 2WQVA 4MLIA 1HNYA 4X7TA 3THML 4PLNC 3GBML 3BWSA 3SJVE 3TIDB 1SF3A 4PWJA 5E6UB 3MLVL 4JBSA 3S7GA 3PHAA 2XYCA 3RX8A 5L8KB 1PCXA 3FUEA 1HYRC 3OXSB 5TK2A 2DBLH 2HFTA 1LDPH 3IDXH 3ZZLA 3EUDA 1WS8A 1DFBH 1JPFB 4N1CA 2F7OA 2VN6A 4QI3A 2VM9A 2X10A 1IIKA 1IJ9A 1BZ7A 2FL5B 4JFDE 5T1MB 5I75C 5C09E 1JV2A 2C4FT 4U7KA 2V5SA 2ZOOA 1RPQA 2WXJA 4JJOA 4Q6IC 5H2BA 2VMJA 2DIEA 2C3WA 3QXDB 3G5WA 4WWKA 4AK2A 1SVCP 3C08L 3ZBMA 2Y7LA 2JQZA