2D3JA

Nmr structure of the wif domain from human wif-1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
157
structure length
157
Chain Sequence
GSHMLDQQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILQTPQNAIFFKTCLQAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Wnt inhibitory factor-1
publication title NMR structure of the WIF domain of the human Wnt-inhibitory factor-1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein inhibitor
total genus 36
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02019 WIF WIF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2d3jA00
2YGOA 2YGPA 2YGNA 2YGQA 2D3JA
chains in the Genus database with same CATH superfamily
2OM5A 1KIRB 2A38A 4KTDL 3TVMC 4MQSB 1L9PA 5A3IC 1AFVH 1KB5H 2IGFH 3U6XA 1FVEB 3RZCD 2QTVA 2JCCB 2HVKA 3H6JA 4XVSH 4P8QA 1B0WA 2FGZA 3SPVA 1G7IB 4AYGA 2F8VA 3QDJA 3FCUB 5CJ8A 3W1ZA 3OKNB 3RZCB 2WXFA 2XTSA 3ZDYE 2BZDA 3MLYL 3FQNB 4Y2DD 4ZSOE 3LKSA 3ISRA 4N8VB 4KNQA 3KR3L 4L37B 1LNUB 2ZJSH 4M8VA 1CGSH 4NUGL 4ILDA 2HFFA 1G7PB 2ZP9A 1T1YB 2UV3A 5IHZA 2E7BA 4JHBA 3B9KA 1A6VL 5SWQB 4YHNA 4OZIA 1CF1A 5CCGE 3S6CA 3DRQB 5DZJA 4GQ9L 1OGTB 4I3SL 3OHMB 2NR6D 4XOAA 1PFOA 3Q05A 1N5AB 2D73A 3A24A 4R26H 2WJ5A 4GG6A 4LCYB 1S7SB 1MG2C 4FNRA 2BSSA 2WV3A 3O3AA 3MRKB 5FCUL 2OJZH 4TLSA 4ODSL 3GHBL 3L3JB 3CAFA 4WSKA 1KB5B 4FZEL 4ZMQA 4UI2A 5CGBA 5LHDA 4P4KA 5F88B 3A4EA 3DV6A 1V5JA 1P1ZA 1HFUA 3BQVA 3SE8H 5CF3A 3ULUF 2X2JA 1M05A 1BBJA 2EKSB 5HHXL 1SJEA 1Q90A 3WMSA 3IDYC 3U0TB 2WANA 5F6HI 1J8HA 1JGLH 1IL1B 4NM8L 5TTRA 5JUEH 4NS0A 4HMEA 3VXPA 3LRGA 3SIKA 5IFHL 2XQYA 1KGYE 4UV4L 2WOBA 3N9GH 3GBML 5HYSA 2NDGA 1KXQA 1OSEA 3NSDA 2BS9A 4AUUA 4I13B 3MBED 2G2NA 5D1XB 1UD5A 2BVQB 4YHKH 5DJXB 4MNHA 4IRZH 5CEZL 5E5MA 2WSDA 1KTRL 2AJXH 4M29A 3MGOB 4JREC 3ZPDA 3MBEB 3CN3A 3EO9L 2CE6A 3S98A 2FD6H 4MAZA 1S9VA 2DQJL 2VDRL 2YSSA 5CGTA 5EOCL 4A68A 3ZDYB 4Z3FA 4XVTL 2DLTA 3TL5A 4NNPH 2EO7A 4NXSA 4ZSOB 3AS1A 3WEOA 1G7JA 2QLYA 5JXAL 4EDWH 3PDOB 4R2GC 2WNXA 1BYOA 4CMMB 4FHBD 4DQAA 2JK5A 1E6JL 2BHFA 3D33A 4J2XA 1T5KA 1ET7A 2Q7NA 4KXZI 3KS0J 1HL8A 4G70B 5BPPA 4FNLH 2FSDA 2WTOA 3FRUB 2UUDK 2VITA 1HCFX 2YZ1A 1MXGA 4Y1AE 5BVPH 3NVQA 5DJYA 2XPGB 1BBDH 1EH9A 4XNZC 4YXKH 4PGBB 3WIAA 4PUBH 4PJGB 1WFTA 1HEZB 1ZVYA 3KW8A 2MOQA 5E2UL 2BOBB 5C0FA 2AQNA 2XZQL 1QPPA 3T6ZA 1GXEA 2DWTA 5AZ2L 5I6MA 4LE8A 4X5PA 3O11B 5D1QA 2B5IB 3KLAA 4GBXD 3UJIH 5KYYB 1KY7A 4OJFH 2DQDL 1Z6JT 4PJHE 4UM9B 4KPHH 2AJUH 2Q5BA 2Z3FA 4GBXB 5HDOA 3R1GH 1MJ7H 5DJ0A 4PJIA 3U7AA 3AT9A 3HFFA 2H26B 3TJEH 2NCEA 3D12B 4UIKL 2DEWX 3ARWA 3EJQA 4PJXF 3UYOD 5CEXA 2DDQH 4UTBA 1GY2A 3ZE2B 2BSRA 4K3JH 1RUML 1S7TB 1ZT7B 3TT3L 1U91A 3D0LA 4XBGA 4CN6A 2HH0L 1FVCA 2SODB 1IM3A 4F2MA 3AB0B 5ISZA 4XCFH 2Y7SA 3BAIA 3CHQA 3QUKB 1S8DB 1UOLA 4ZS7H 4YC2C 3GSXB 1U33A 4HKBA 5CCHE 3OSVA 5F1SA 5CEZE 5D96C 4JRXA 4J4PC 4K9JA 5C0DB 1QG3A 4Y4HB 5FF6B 5F9JB 4MBRA 2CO6A 1BEYH 3T77A 4C4KO 3TV8A 2J1YA 5JIMA 4HJTA 4NZFA 3MV7D 5EIIB 4YPGA 4UINL 5DDHA 3GM0A 4AQEB 5J6HA 2OMXA 3JWOH 2VLKE 3B9KC 3FCTA 3AQYA 1XGUA 3WUWB 4JPVH 5DUPL 4WEUD 3MV7B 2YAQA 5I1KL 4Y1AD 2AI0L 3AWGA 1VADA 3QHZL 3PXLA 2WQXA 3R06A 4JHUA 1WBYA 2VDMH 4KK5D 4Y1AB 4IIQC 1ZA6B 2BP3A 1T1WA 1OCWL 3O41A 5FLUA 1JXGA 1UD2A 3K0YA 4HV8A 4NQDE 2H9GB 2CSPA 4LKCB 3SGDI 1G6RL 1IBBA 4MNQE 3U6RB 3Q6GH 5F6IB 4IOIB 3A3YB 4RESB 3KBFA 1ZPUA 4YDKL 4PGZA 3PGDB 3TF4A 2OSLB 2P9RA 2VTFA 1KSRA 1NINA 1WD8A 1KIPA 2Z65C 5D2LA 3EBAA 3FF8A 2YMXH 1KJ2A 2IF7A 4LEEA 3ZT6A 1QFWI 2XTLA 1NCAH 4JM2F 4S1DC 2C7UA 4F7PB 2DL2A 2BXYA 5FR3A 4BEIA 5JA9A 1MN4A 1AGCA 2BNRE 1WZKA 2KQNA 2VDMB 1LWRA 3U83A 1NEUA 3SPGA 3NFSH 1F6AA 1J5DA 1KIUB 1HNGA 3AS2A 3P77B 5E8OB 1J8KA 2IANB 2EIDA 4LPWA 2QELA 2Y4SA 3KLLA 2Q10A 1D6VL 3KG5A 2ZAIA 4MJIA 2VLKD 4ABVA 2YXVA 5DC4B 1BQLH 5A7BA 5CBEA 2CIIA 2E7MA 3FN9A 4L29A 5D7JD 2ADJB 3KWUA 4UUJB 2XZCH 1NIEA 4ORGB 2EH8L 2MNJB 2VLKB 4LAQL 4TNWK 2LU7A 4R83A 5EA0L 5EOTB 5BQDA 1ES0B 3JWDC 1N70A 5D7JB 4ZUWB 1IVTA 3VUAA 1FL6A 1F13A 4N20A 4Y16D 4Z77A 3V7AE 5ABDE 4N3TA 2CDGA 3ZTJG 3H2PA 3DMMA 4Q58C 2HFEB 3QO0B 1SBSH 3N1FC 3OKMB 4BZ2L 3A4DA 4WJKB 1E2ZA 2Z7WA 4NQDD 3O8XC 2HP4A 3CGTA 4K23L 4OZHA 3FZUC 4MNQD 3QQXA 1ETZB 4X8JA 2XLLA 4NQDB 2OMTA 3QP3A 2QSTA 3EFOB 5TQ0L 4Z7QE 5T3ZL 4ONHA 4KI5F 1KCLA 2AJVL 1ZE3H 4HYTB 4MNQB 1ET8A 3OZKA 5GRUL 1UM5L 1FF5A 4OCYL 1RURH 5DRXB 1GYVA 4GXFA 4I48B 1YN6B 4PI2A 2P49B 2YQ2A 2G9KA 1SLWA 3B3IA 5C0AE 2BNRD 1RVFH 2PO6C 2ZXWB 3U4EA 2B1HL 2FBOJ 1DQDL 5GGTH 2WCGA 2VDKL 2BNRB 3PHOA 4A6YH 1NCTA 1BVLB 4YEFA 2N3JA 5FYJE 1EAJA 5E1GA 1ECZA 3EF4A 4B9CA 2EIZA 3GSWA 4LGSB 1ZVNA 1B0GA 3GXUB 5CS7A 1ITBB 3F6IA 1J0ZA 5JXEA 3WKML 1T20B 3Q8FA 1C7SA 3W56A 4ZQKA 2R27A 2L0DA 1UXWA 4MCNA 3HG1A 4DK3A 5HYQB 3AU1A 2BFVH 5IJDC 3MNZA 1FZJA 3CFJB 3CMOH 2VN3A 4HU8A 1Z9PA 3QXWA 3RWEB 1GIGH 1IFHL 2VDQL 3WTUA 4DGVH 1WDAA 3SO3B 5FKPA 2XRAL 1Z3RA 4WHYH 4YWGL 2CO3A 1MZZA 5EV7A 1EK3A 1E28A 2VDLL 5HDBB 4D2NA 1LDSA 3D5OF 4FTVA 2D9QB 2WW8A 4K4KA 5FYJH 2PYED 5JA8B 2O26U 3Q48A 4A6YB 2UYLA 4KJQC 3N43F 2OR9H 3ECBB 4J3TA 4X5RA 5J9PB 2PYEB 5JQ6H 3U1PA 2N7AA 3WIIH 5I74B 12E8L 4ZNEE 3GXNA 3O0RH 3SZKC 3MCKA 2PPEA 2UVEA 4HF5L 3PP3K 2ARJQ 3UJJL 1T1ZB 5IGXH 2WNGA 3K2IA 3VQMA 4Z7QB 5T3ZE 4GSXA 5IW6B 3K81A 4WW2F 1NUNB 4KV5E 1KTCA 2A9NH 2DF3A 3NPSB 4Y2DA 4JFXB 4ADIA 4A55A 2Y7OA 3LVTA 5C0AD 3QEUA 1ZGLM 3BZEB 3T6WA 4NPKA 4HKXB 2CLRB 2HT4D 5C0AB 4AYFB 5IQ9B 2DQGH 2EIKB 4AGMA 1FA4A 2P45B 3H2WA 3HN8A 5FYJD 4GT7A 1EFQA 4BV1A 4AIEA 2GJZA 2NR6A 2JB6A 3J07A 3QQ4B 5DJCB 3CVIH 2JIXB 4CN1A 4E36A 5KUKA 2BY3A 4GUOA 4TVPE 3IVKB 1O6VA 4ABWA 2DICA 2OMYB 3ELAT 5HVWA 4Q9QL 5GRVL 4LSDA 2X5PA 3OKKB 1ZVHA 1VGEH 3T2NH 2OXHA 1HIMH 5F71A 5B21A 5EN3A 1BJ1H 3PWUA 3UH8A 1NFDA 1S7QA 4XP9L 4LCWE 2GTWA 4QEGA 5MP6H 5AW7B 4YDLC 2XWXA 3TJHD 2BINA 2VRAA 2R1XB 3HRPA 3QZLA 4L3EA 2EILB 4AYEC 4JANB 3D50A 2MH4A 2RACA 5CHNB 3X1FA 4KO9A 4NM4L 2UZIH 3PP3H 3CXDH 1X5YA 4ZUSB 3WFCH 4JDZB 4D0CB 1JWMA 5GSVA 2F53A 4JGMA 2OTWA 4XNMB 4M93C 3NRFA 4Q8BA 3HZMB 4WNJA 7TAAA 1UB5B 2R1WA 3MRQB 3QBTB 4M6NH 1JHKH 1BF5A 1Q94B 1PX3A 3U1SL 2RIKA 1T7XA 3AVEA 4EEEA 4JKPH 3HZVA 4HUWB 3IXTA 3CK0L 5C9KA 4TVPH 4N26A 1DSWA 1W15A 2WC7A 2R2EB 3BP4B 1RZJH 4Z3HA 2XN9A 1X5ZA 4M1DL 5CSZA 5K1NA 5C2BH 1N6QH 4K2UL 4EI6B 2YR3A 2HB0A 4LDEB 2FQDA 5T3ZD 4PRPE 4ZZFA 5L2KE 4QGYA 3I02B 4OGYL 1UD4A 1KTDA 3D0AA 4AE1A 5F9WC 2EDHA 3C5ZD 3F6LA 5K9QG 1MPAH 2AXFB 3PDOA 1FFRA 1CF8H 1KCUL 2WMPA 2IWKA 1N8ZA 4OCRL 4XX1E 1PS3A 1W72H 2PW1A 1Z0NA 2Q2LA 1MH5B 3C5ZB 3FDWA 3ZBMA 3VD9A 3QS3A 4KKCC 1BDYA 2W9EH 1TTRA 3FKUS 4TRPL 2ZG3A 1ED3A 4R4BA 5ADOH 4TUOA 3K80A 3SHSA 1T2JA 4XMLH 4XP5H 1XF5B 1LQSR 3DETC 4RLDA 3T0XA 4ALAL 3O9WC 1BQUA 4TVPD 1UG9A 5KAQG 2E6QA 4PGBA 2XIDA 2J2ZB 2V2TB 4TNVK 2C3HA 3AM8C 5DJAA 3VTMA 2WINA 3KLKA 2HMID 1NCIA 1IEAA 1NFAA 1OK8A 3GMMB 5I19L 2EXWC 4ZFOA 2ATAA 2CLVA 5GGVY 4LCWD 2RMNA 5AW3B 1IFGA 3N06B 5KS9F 2E9BA 4JE0A 2NXYB 5I1CH 1GCFA 2CIKA 3BUTA 1KB3A 3U0WH 4LCWB 4PJ8B 4Y5YB 4GBXA 4H8WH 2P3YA 4N5UA 3TEZA 4UT9A 1K4DB 1AS8A 1WIOA 4P3DB 4C83B 2WWMD 5BCAA 1LHZA 4XCYB 1QSFE 4R97B 1KV7A 1KT2B 1W0YT 3D34A 1VCAA 2Q87A 2F2HA 4HGWB 3UBGA 1JGVL 4K3GA 4OLUH 3VRIB 1PNDA 1RUKH 4ES8A 1I7UA 2IQAB 3LZFH 4JFEB 1NJ9A 3LKOB 2VXSH 1RSFA 3QJTB 4HULB 4I89A 1WIPA 1MIEH 1FH5H 3BGMA 1KENH 3BVXA 5D7LE 4TSCH 4PRPD 5DD6A 5L2KD 5I18H 3N40P 2GBAA 2QSCH 3QCTL 1JYVA 5F1OB 1DFXA 3RZCC 5C0DA 1OTTD 1VKXA 1E4XH 5FF6A 5F9JA 3ZO0A 4D0DA 1HCZA 4JW3A 4KQ3L 5GJTH 3UAFA 5KVGE 3T0VA 4Y19E 4XNDA 2Y3AA 4AQEA 4U1LA 3D09A 1CDYA 4X7SL 3W5NA 1F3DH 1PD6A 1SJXA 3IJ8A 5FW6A 5H35B 5F7NC 3NACL 3VXMB 4CBPA 3E2HB 1JJUA 3D69B 5A2IH 1CGYA 2MNUA 2A77H 1MFMA 1BAFH 2WIIB 4GB9A 1AMXA 4DQOL 4XXCC 4UT6L 1JXJA 5IWLA 4PG2C 3RBGA 3FTXA 1LQBC 4MKTA 2NR6C 2BVOA 4FI8A 5IESL 3DURB 1IFRA 1JWUA 1R46A 3L3IA 3SZ6A 4AY0A 4ZXBD 3DVIA 4IOIA 5E24E 4PJHA 2EYTB 4A2FA 5J3HD 1PZ5A 3JWNE 3PGDA 4MCZB 5AKSA 3VD2A 4ZXBB 4AT6B 3GWJA 1PAMA 3OSKA 5AB1A 1OEZW 4O2CA 4GI6A 1XBRA 2Z9TA 3T3ME 3ESMA 4OI9A 1DDHB 1PLAA 4HDIB 2LVEA 2Z4QA 1JGUL 2ITEA 3VFNA 3ZLQC 4LSRL 1X4YA 4J6IA 2H45A 5L8LB 5D7LD 1FFNB 1VGKB 2ADYA 3ARFD 5D1XC 5FDWB 2WVTA 4FQIL 1GAFH 5J6GA 2YGNA 5E8OA 3GUFA 3CZKA 3MBEC 1I3UA 4ODUB 4U1GB 3UZEA 1A4KB 4GP4B 1AHKA 3HHSB 2DIEA 2Y23A 2I27N 2VMEA 2A99A 4Y19D 2QGBA 5IQLA 4I77H 5J6SA 5KVDH 2V5YA 1RZ7H 2XNAB 3C08H 4PPTA 5HYJA 1H3UA 1RIUH 4UUJA 2UZXB 4Y19B 2RD0A 1U8KB 2VLKA 4NJ9H 1YQVH 1INDL 2FJHB 5D7JA 5E8DL 4ZUWA 1BLNB 1EWHA 3HZYB 3U30B 1S3KL 4HWZA 1E5YA 3N42F 3WDHA 1XGQB 3LZOA 3RPIA 4K7PY 3ARDB 2B39A 5EU6E 2VIRA 4KHXH 1M2VB 3WNKA 4P5SA 5F9DC 4Y16A 3WEXA 4X6CE 5EU5B 4OFYD 3MRPB 4QYAA 4RFNB 4OKVA 5TH2B 3VFTB 2NSMA 3ARGA 1MIML 4NQDA 1SY6A 2B5IC 4NLHA 3VSQA 3EFOA 4GMSL 4KOBA 4NBYB 4MNQA 2PCPB 2G3ZA 4BFEA 1IKNA 1J0IA 4LIQL 4XO3A 4H7VA 3ROLB 2VT0A 3VDAA 4GBXC 2IMNA 2Y25A 2Y06L 4OCWL 2VABB 1EJ6A 3BD4A 4RWYH 3HUJA 4Z18A 2ZX8A 3TBSA 1KNOB 5K1JA 4HWBH 5G4MA 1ADWA 2DTMH 3BAXA 3H56A 3BH9A 3SE9H 2R4SH 3H2QA 1K5NB 5ELIA 1GS6X 3T3MB 1H8NA 3OD3A 5AOKA 3MYZA 4QNPE 4IOFD 5F1IA 4FJZA 3AB0C 2QFRA 2OAAA 1A9BB 1LO5B 1BVLA 1KB9K 1WCBA 3FFOA 5IKCA 4N3UA 3QDAA 4HIIA 1K6QH 3H7LA 1KLGB 4K3HA 3GXMA 3MR9A 4Y4HC 4YDVB 2JXMB 3SKMB 1KELH 2VR4A 3BH8A 5JDSB 1I3GH 4A37A 4H5SA 5A6IA 1IGTA 5DO8A 3ZE0E 5FXCH 2XWBA 4ZJ9A 4XE5B 3K2MC 5CFAA 3V0VA 5E8EB 4Q9CA 1DEDA 1JFQH 1A4CA 4GKSA 5EU6D 3K71B 4P05A 8PAZA 1HQ4A 1OARH 2C9QA 4I7ZC 2BVUA 3C9NB 5DK0B 3IGUA 1JE6A 1E4KA 5EU6B 2X6VA 4N2CA 4UIMA 3QFDB 1K2DB 4PYGA 4XO8A 3UO1L 1MW3A 4KK5C 4X6CB 5PCYA 5F3HB 4GG6F 2K9UA 1AIZA 1A6AA 5EEVA 5J9PA 5HHQB 2WKLA 1BD2E 5K9OB 5KJRH 2IG2L 3IKCB 4AXWB 4IKKA 4Y0GA 1N7ML 1G6RA 1X5KA 5F6IC 3AW5A 2LAGB 3D7PA 1YMHB 5LG6A 4JFXA 1WRFA 4GMTH 4M5YL 2IJ0C 3U79A 1RMFL 2FJUB 3JWOC 2WKGA 4HKXA 1WHPA 4KY1H 1ADQH 3ZMNA 3IN2A 4BE5A 2D03L 1SM3H 2I5YL 1JPSL 3LAFA 2PTTA 4MMXB 2BSBA 4MQ7A 5CINL 2HX7A 3FQWB 3TLRA 3KPQB 3FUIA 3P73A 3MRJA 4M7ZB 4LBAA 5I30L 3V4VH 4JFDA 4CVZB 4IRJB 4X4ME 1P6WA 3QRFM 3RVTD 1U8LA 3PV6B 4PTTB 2Y22A 2M83A 3O6LL 4N0CD 3SQOH 1U8PB 3SDDA 3IU4H 3K7UA 3UZEC 5KVMC 4ZDHA 3OL2A 3OMZA 4WI7A 5ALCH 1AD9B 4AYSA 2VDNH 1KB9J 3MNVB 4NKOB 2WZ5A 3GIZL 3KNBA 3MODH 3MX0B 4GAGL 5EIIG 5FS5A 3W9DB 2R0ZL 2ZP8A 4DEPB 4JANA 1M6OA 3IGKA 3D87B 3WUWG 2XZAL 4PVLA 4W93A 1IGML 4HSAC 2WCPA 4HAFA 4JG9A 3K72B 3MOQA 4X9HA 3LQZA 5IHWA 2H1XA 2ZUVA 5D7JC 1F6LL 3IETA 4JPSA 4K9EH 2XN2A 4M7LT 2BNUA 2EH7H 3LN5A 1P4BH 2XG4A 4DZ8A 3BGFB 3OBAA 3BP4A 2FWLB 4BZ2A 1BD2D 3V4VB 4AW4A 4UBDD 4YXHL 2XQYK 5LCVL 1R3LA 4HGMA 3KE0A 1IC4H 1BD2B 2K45A 4NI6A 1T1XA 4ZNEA 2UX6A 1PMYA 2IDQA 5KJ7E 3QORD 2VDNB 3NDZE 2AXFA 3OKLA 1FIGL 1U8OB 1UYWH 5JR1L 1UZ6F 4YHML 2AQTA 3OLDA 1MH5A 3QORB 1NUGA 2F54A 4TS6A 4KX8A 4F1SA 4XVUC 5DK3A 1XMWA 3QXVA 4Z7AA 5IQOA 2EE0A 2BSDA 4QXTB 4PJIF 4TNFA 2AV1B 5LO7A 4HLEA 1XCXA 3ZTNL 1AAJA 2CGRL 5LAXB 3BIBX 4DN4H 4OGXL 4BUQA 5F7WC 4DP4X 3VH8B 4FA7B 2VW6A 5I8EA 3SY0B 1KCVL 3APDA 3FTUA 4XNBA 2KI6A 3V5HA 5BW7C 3DK2A 2HKHL 1N59B 4RMUA 5FUZL 2JLLA 1FG9C 1WH0A 4G8EA 4XBMA 1FUNA 3EO1A 1HESA 3B7YA 4F9PA 1D6EA 1AI1L 4H8UA 5CILL 1R1CA 1YEHH 3MV01 4FRWA 4E9RA 1BX2B 2W9DH 1B6UA 3HE6D 4XCEA 3D3VE 1R17A 5KYXB 3TA3D 3VVVA 1A4JA 4LRIA 1ZANL 3SO3C 1F8TH 1MLBB 2F68X 3CZNA 3VAEA 1T2QL 2A5UA 3STZB 3CFIC 1OT1A 1FPTL 3TA3B 1Q0YL 2BSTA 1QMUA 1CT8A 1IBYA 4MA7L 3KVDD 4OJAA 4WFGE 2EP6A 1FL5A 1OOWA 5B3SB 2CDEB 2R69H 1HH9A 1QEWA 3QIBD 4XCNB 5FM8A 5JHDB 4JAMA 1P7HL 2PNDA 5I74C 4GRWH 5DRZA 2HN7A 4PRPA 5L2KA 3T3PE 5BZDA 2COVD 2BP8A 3B6SB 4X9IA 3QIBB 3RNKB 3ZR5A 3CFKA 4K15A 5BO1H 4M1CD 1XMEB 1OAKL 4ANKA 3NPSC 4IHOA 2MCG1 4YDJB 5ICXB 2CXGA 1S5HB 2FJGA 3EKCA 1NGQH 2HJKA 3GGWA 5DS2A 1A7NH 3AXHA 3S3SA 1SYSB 4XXDA 1PX8A 2GT9B 2YC1A 1YJDH 2XXCB 5CU9A 2HJFA 5DVMA 3ABZA 4JHWL 3QI9D 3W39A 5BQ7A 5D2LF 4L18A 2Z92A 5DUML 1Q72L 5ANME 1NLDH 3PE9A 4JY5H 2HT4C 4P5KA 4CL7A 3BEWA 3G6AA 3CH8A 3QI9B 1U8QB 4PG9A 4NKIL 2EVGA 3QR1A 5C7ZA 3VMPA 43CAA 3W9EB 2C3XA 4PJBF 3L9RA 3O0LA 1IJ9A 1JF6A 1OTSD 3K91A 4DEUA 3G04A 4FXTA 4LOEA 2TRYA 4NFDA 4YL4A 4P5TD 3FUFA 2F74B 5JPMA 1E43A 4L9LA 3D3VD 1N2RB 2XHNA 1BREA 4MCZA 4WHTA 5JO5B 4ZXBA 1EXUB 5LNGA 4L5FL 2DJUA 5D6CB 4FYTA 3D3VB 3TJHC 1NGZB 1KBGL 3I3DA 1JNJA 1V8HA 4Y9CA 1QSFA 1UASA 3L5WB 1BVKB 5I9QB 3IGFA 4QRPA 3WLBA 4ISVA 2QVMA 2VKWA 4WFGD 5CKGA 1XIWA 4OJDH 1NM4A 1O7DE 2D4FA 4B6ZA 2X1QA 2DEYX 4W9EC 3ZL4L 3X12A 3VFSA 1AC0A 3QUZA 4FULA 4NFBA 4QXGL 1CIUA 5A16A 2R4RL 4PFEA 4WVRA 5E94B 4G9FE 1OANA 5D7LA 1OGAE 3ARFA 3N0AA 4XPHH 3SYPA 4JM0A 1A4KA 2W5PA 5F97E 5IROD 4LLQA 1IIKA 3TV3L 2C34A 1DR9A 2OYMA 1X3DA 1YYMH 3CPLB 3T3PB 3U36B 5HPOA 1DJWA 1IGYB 1ND0B 3QXDA 2HKFH 3BVUA 3US0A 2N7SA 2XNAA 3DPBB 4LO9A 1EJOH 5E6ZA 3BGAA 1U8KA 3C5ZC 4X80H 3BZFB 4HU2A 4PJ7F 2WXRA 1E30A 4XMKH 1JGDB 5EBLB 1IBFA 2HYMA 4M5ZH 4NJAL 1IUZA 4WHYG 1OP4A 5FHBL 1CD9B 3HS9A 1TYEB 2K8QA 1E90A 4UOQA 5ANMB 4GO9A 1R19A 2F7OA 4HFWB 3D51A 5MENE 5DMGD 1SGKA 4NB7A 3PXHA 2DWEA 4DP9X 1G94A 3GBLA 4NC2B 4PN6A 3MMEB 3TURA 1P5VB 1RZJC 1JSYA 5SX5K 5B22A 2Z8VC 3VXNA 3PHAA 5F7EL 2HFTA 3ZK0A 3V6ZB 2CNZA 4X0KA 3PQYE 4FEMA 4J1UA 2HMIC 5GS1B 1QYGL 3KYOB 4PJ8C 1T0PB 1RUAL 3L4CA 4Y5YC 1U21A 4F7MB 2WO3B 4EZLA 2PWEA 4JMXA 4CC4A 1JVLA 5E6YA 3TT1H 3P4NB 4HEME 2NY7L 4F37F 3UTPE 1H8OA 4LRIC 4R97C 2RFXB 5CP7B 5E4EB 3FSVA 3V0WH 2VLJA 1X9LA 4GINA 4KGLA 4HKJB 4E9SA 1KBPA 4HJIA 4ZPTA 4DN3H 2WWMC 3MJ7B 1EEYA 1KPVA 4GSRA 5IFAH 4JQVC 4D9LL 4G9FD 4F7TB 1MHPH 1OGAD 2ZUTA 4CC0A 2EO1A 2HRPL 2WSKA 2UVFA 3BESR 5B39B 4RGOL 4JKNA 5E1HB 5GS3A 4KO7A 3T0DA 4G9FB 3MZGB 1LE5B 4XNUH 2IFGA 2G9HB 2ZCKL 1HEJC 1ZOXA 1FJ1B 1NZRA 4FG6D 3SKMA 1J5OL 3WJMA 2Z35A 1J0KA 4P5MA 15C8H 2BP0B 4GH7B 5JORA 3SE4A 2LVCA 4L3CB 1OTTC 5SX5H 4NKDA 4KK8D 3IXAA 4U3CA 4KVPA 5LBSH 4G6JH 2QVIA 4H8WC 1R47A 4EVNB 1AD0A 2QGDA 4JKKA 5FGCE 4WI9A 1A6TB 3MFFB 5IEKB 3EO0B 3E2HC 2EE6A 2FL5A 1OALA 3K71A 1LWJA 1F4YH 4L8CB 4IGBA 5MEND 4XGZB 3VI4B 5F21B 4EF3A 4M02A 3UAJA 4UT6A 2G30A 2P7TB 5EU6A 3H9HA 4K3DL 4FTDA 3QO1A 4QTFA 4RAVB 3PP4L 5MENB 1U8MB 5T1KA 2AK4E 2EE3A 4JKMA 4NWUL 3E8VA 2O6EA 5IB4A 2V5RA 3DX4A 3PQYD 5F7AA 2VISA 1INQA 5GS0H 4XVOA 2DM2A 2VXVL 3UTSE 1KC5H 1E7VA 3CSGA 2BIHA 2P5PA 3PQYB 4BUHA 4PRAA 5I28A 4I9WE 5IQNA 5KSAA 1R24B 4ETQB 1FFTB 3UTPD 3AREA 4O02H 1FORH 3CLEL 4ZXBC 3FYEB 3OWEA 4LB8A 1JV2A 1XZ0B 2EIJB 5J3HC 1D5MB 3GSOB 3SKUD 1Q9LB 4KZEL 4JLRA 4JHVA 1U3YA 5D6DA 4WEEA 5L8JB 3TN0D 1B3IA 3NCXA 2HPTA 1OAXH 2C26A 2MSPA 4H0IA 4L48A 4HC1L 2B3IA 1C16B 3ALPA 4HUCA 5K33A 5K9JH 4YX2H 1CFSA 1BFVL 1NIDA 5E95B 2AKRB 4JN1H 4P3CL 2I7SA 3SPIA 1TQTA 5GS0D 3K1DA 4IEFA 2B20A 3DDGA 4U1GC 1SHWA 1U3HA 4F8TA 2WHVA 1EAPB 1QW8A 2AITA 3MNVA 4NQUA 3QVAA 2YA2A 2Q2EB 3CZLA 4HIEA 5ACZA 4G82A 2XXFA 4XHJD 4Y89A 5FM4A 2X89D 2D31B 5DJZA 3N0PB 3ZDYF 5AAWA 5B4MD 2BIPA 5E8PA 5ABZA 3EGSB 3WFHB 3P2DA 4O02B 5IUCA 3IFOA 5HYFA 2FK9A 5FGCB 2R83A 1VFUA 3U30C 3X3FL 4RFOH 4I1NB 1FC1A 4GUPA 4B9PA 3WFDH 3ARDC 2QADD 3ZRFC 4PVBA 2AK4D 3HS0A 4HAKA 3SB3A 3LEYL 1NCHA 4HS3B 2NMSA 1G1KA 4WAFA 2BLFA 2QADB 1P2CB 1QSZA 3U9UB 1NC2B 4RFNC 2AK4B 3UTSD 3GKWL 1CFBA 3L2MA 2DLFL 4I87A 1X5FA 1CE1L 1FFOB 3MRCB 1OSZB 4I9WD 3OLEA 4GAJL 1WTLA 5AEAA 1E9OB 1NAKL 5I0XA 5IMLB 4XAKE 4AQAA 4YBHA 1L5GA 5E5RB 3RDTA 1DZ0A 4QHLB 1O6SB 2WP3O 1DQIA 1U8OA 3U46A 3P0YL 2PLTA 3JWNC 4UQCA 4YJZL 3OVUB 4J23A 1BXUA 5DQJA 2KHAA 4CAGA 3FPXA 1ZLUK 2HPOA 3UADA 3RVUD 3WIHA 3DGCR 4QCIA 3BJLA 1V7MH 5EU3A 4I2XE 4DPAX 1E6OL 3D4ZA 4JG0H 3IGAA 2BNQE 4QRSA 3MV11 4L3AA 2PR4L 43C9B 1QLFA 1CFTA 1PLBA 4CVWA 4B9YA 4IOFC 1XSIA 4X4MA 5ENWB 3OC8A 2WUBH 3FULA 4ZAKA 4DKFH 1BQSA 3FB8A 3Q7JA 4PWEA 2I60L 4LHUA 5F0PB 2QQNL 2GBUA 1A21A 1TVHA 3FH7A 4HBQA 1TNMA 1X7QA 3T6VA 5ANHA 5EIVA 4C47A 4Y2NA 2FT8A 1RZ8B 4OTXL 3MREA 1KTLA 3D08A 3FN0L 3HNTL 3OXSB 2WZ0A 3KXFE 4PRNB 3FO1B 3RY6A 2K4AA 1UZGA 2BC4A 2X6AA 4PRHE 1KJ3L 4KRNA 2KZKA 1MLBA 3HE6A 2WLZA 5AKRA 3PUCA 4OM0L 4DTGH 3MBWA 4WENB 2JLPA 1TJGH 5FYKU 2UY7A 3TPUB 2H4EA 5FKAB 4RISH 3VA2C 5IJVA 1EUTA 2LT9A 1SVZA 2GITA 5F7BA 2A73B 4F33B 4YZWA 2L8AA 4FI6A 3SD2A 1C8PA 2V2XB 2WN3A 2GTQA 2Q76B 4XAKD 4PRIB 4NWTL 3TP4A 4JCLA 4OT1L 1T4WA 3AT0A 4GKZA 3RNKA 3GMLA 1TENA 4PJFA 1YQ2A 2X4TA 4GKNB 1KY6A 1A7OL 1FYTA 4IBTA 3BN3B 1FWXA 3TIEB 4L1DA 5BV7H 1CD8A 1T03L 2FO4B 3D4YA 4G8IB 2EACA 1BGXL 1IKFL 1DQML 3QJHB 1MOEA 5DXWA 2X1WL 3RWJB 3HZKB 2BNQD 2FLBT 4PJHF 2BDNH 3G5XB 4AQOA 5KN5B 4I2XB 3MRIB 4HK0B 3WTVA 4MMXC 5C3TA 5IBTH 4M7ZC 1JHLL 3OPUA 1XX9C 4KO6A 4IRJC 4NZDA 3QI9A 1U8QA 1WLHA 3K5RA 3CX2A 2VH5L 3FTZA 3W9EA 4PY7B 1ORQA 1KG0B 2D7QA 3H9SA 2IADB 3INUH 4U1NB 3KPNB 3IJEB 3VCLB 4XPTH 3S37X 2ZPKL 1UWEH 2BMKB 3RVTC 4QHMB 1TKWA 3TH4T 3KXFD 4JB9L 5HVGB 4XOBA 4N0CC 1U93A 3Q2WA 4AENB 2H3KA 4XWOD 2DYRB 2P52A 1RLBA 5FK9B 4DEPC 3T0EA 3BAJA 4NUJB 4PRHD 4P5TA 2YN5A 4KTDH 5TE6L 3EGDA 5E7BA 3UZVB 4MCYB 5MERA 4G42A 1NGZA 3NK3A 3RNQA 1GCYA 4PRHB 2APSA 2EYSB 1CXHA 5AYTA 3VGDA 4FG0A 3IMWA 1YHPA 1UQSA 2ZSWA 4QOKD 4U4IA 4AK1A 1GZQA 4JPIB 4XP6H 3BGFC 3L6FA 4YXLL 1IC1A 3CHOA 5CJOH 5E94A 1S78D 4QOKB 3IJYB 4W9HC 3I6GA 3PU7A 3KR3H 3S8WA 3QIWD 3WJLA 3WS3A 5I5IA 4JE4B 3G5VB 3GBNL 5LCVA 3Q13A 4YSRA 2AXJA 4NO5A 1NEPA 3QIWB 5BNXD 3ESUF 3NSXA 4TQPA 4BSWA 1IGYA 3LNIA 1AXIB 5IROA 4J39A 1FAIH 1PSKL 3COOA 3DX7B 3NCEB 3GMRB 5BVJB 2QQKH 1UXSA 1UA3A 3DPBA 4KH9A 4OFKA 3UYPB 1U42A 1N0XL 4WTZA 3ULVE 2OCJA 3BZFA 3QORC 3MLRH 4G7VL 2Q3ZA 5TD4A 3SEPA 2X87A 2MCPH 5EBLA 2YD1A 4OZFH 3FFDA 3SCMD 3OR7A 5CZRA 2V7HB 4CN4A 4N0YH 5AW4B 5I8CB 5CCKH 4HAGA 4G5AA 2ID5A 3NEEA 4H8PA 1WWBX 1AH1A 1S7WB 3SCMB 5KSUB 3NPZB 4U3SB 1H6UA 2ENSA 5E99H 3ZRSA 3GSVB 1RULH 5EBWB 4Z1PA 3OAUL 2J4WL 2A4CA 2ZF8A 1GGCL 3MMEA 3WJJA 1AC6A 4XPFH 5C07E 3QH3B 2H6PA 4DFIA 1HH6A 1ID5I 4NM8H 4I3GA 1AQHA 5DMKA 4OIAA 2N4IA 4WO4D 4MB3A 5JYLA 4F7MA 4LEBA 4S2SB 1DHKA 1ZCRA 3MRDB 3RY6C 1JZ2A 3LH2L 4PGCB 2KZWA 5DYOA 2JKNA 5H2BB 5H37H 5AUMA 1U4EA 4WO4B 2G5BA 2GK0A 2CUIA 2RFXA 3EGXA 4OQTH 4Y7OC 5CP7A 3HE6C 4AIZB 2QDWA 1KTJA 5F3FA 3S88H 3TA3C 4OZFB 3TWCL 1S7XB 2NOYA 3APMA 4YK4B 3O45A 4GQPH 1FYHB 4G6FD 4ZW7A 1BOYA 2CCLA 4WZ9A 1JZ8A 4YFDB 1DUYA 5AVTB 2NY4D 5T33L 1J05B 3H53A 3GMQA 1TEYA 2ITDA 1U8CB 3PAZA 2FECL 1CFVH 2DW5A 1OGAA 4G6FB 4MJ6B 3JTSA 3OR6B 5JXAH 4L4TA 4Z3JA 4GXUM 2X41A 2NY4B 3VWJB 1C1EH 5GGVH 3MA9L 1RFDH 3L16A 3QIBC 2VE6B 2H3NA 3CN2A 2GFBA 3WE6B 3ULVD 3AITA 3S37L 1T4KA 1BQ5A 1AG6A 1RERA 2XQBH 1LE9B 1YNKL 4FGMA 5DUBB 1JK9A 1C12B 4O4YH 4LLAA 4M1CC 3QNZA 4E9YA 1UADC 1I3RB 3I9IA 5DVPA 5IEKA 3UMTA 3UC0H 1BJMA 3DI2B 4WK0B 4QHKJ 2F5BL 2O5ZL 5HGGS 1KDJA 1HXKA 2X09A 5HHNA 5JHBA 4Y4KA 1OZUA 4KKQA 3TS8A 4JVUA 1QTPA 2ZOLB 5AZ2H 3VH8G 2K7QA 1NCCL 4WKZA 5A2FA 2QZ5A 3QI9C 5TDNB 5EOCJ 5MENA 5C07D 2FO1A 4G80B 2BFGA 4ERSH 2IDTA 2LLLA 2DBLH 3QXTA 4MMZA 5E4OA 4UB0L 5K39A 5C07B 4R90L 2N1KA 5IJBC 4WEMB 2Y1VA 5GHWL 3ZW3A 1C5BL 4XODA 2ARJA 1OTSC 2E59A 2J3SA 3QC5X 4ETQA 1MELA 4I0PD 4XPBH 4XWGH 3OF6D 5I2IB 1CDJA 4HEMA 3H9ZA 2P24A 3NA4A 4R5VA 3UBFA 4I0PB 1DN0B 2ZWLT 3DUUA 4C4UA 5I9QC 4N8UA 5AVQB 3DHUA 2P5WE 3TBTA 4IMKA 5IJKC 3UL4A 2GTZA 4P23B 1YJDC 4MDIB 2AV7A 4PY8J 1JN6B 3TN0A 3L7FB 4DKEL 2VERA 3MLSL 4BH8A 3MRBB 4JFQB 4ZMXA 3RZWA 4ENED 1EXHA 5IQ7H 1NAML 3NMEA 1X4ZA 4HX1B 3KJ6L 3WJLC 3L4YA 3N2JA 3ZT5A 5GRJL 2V5SA 5KYNA 2XVGA 3RI5K 4AV5A 5IROC 2XQYG 4IKJA 1P1VA 1L6PA 4KTEH 3QHFL 3C5SB 3RG1C 5HYSG 5ID0B 2Q7YA 3CN0A 4YUEL 3SKJH 1D5IL 2YPKB 4PREB 1CC3A 4G43A 5IBLD 1SJHB 3SE6A 3EOAA 2H8PB 4B95C 4KZCA 3OPZH 2G75A 5GGRA 4YIQB 2GUOB 4NO3A 3CVBA 2VJ0A 5EORH 3KCPA 1CDCA 2ENYA 3VGHA 2L7JA 4WO0A 3EDEA 3P0GB 2AVGA 4HS3A 4N2LA 4PJDE 3MUHL 1JPEA 3IFNL 3FOMB 1P2CA 2IGLA 4MFHA 4K5PA 2AK4A 1W0VB 4AQ1B 1ONQA 2XX0A 5I6XB 1L4IA 1ZT4B 4YGVB 3ZE1F 5DMGC 2A9DA 4ONGL 4NQED 3UTSA 1E9OA 2LFEA 1ZV5A 3EOBB 5GS1C 4B0MB 5TPWH 1R5WA 4AJVA 1NGWB 5DHVA 1RHHB 4DETA 4QHLA 1MJUL 1O6SA 3HBQA 2D0GA 3MU3A 2X12A 4NQEB 1NGYB 4XRCA 4O2FB 2JTDA 3M46A 3D18A 1CD1B 1OM9A 5BMFL 2Z0UA 4I88A 4R6UA 5E4EC 4Z8FH 2OCFD 1XR8B 4WY7L 1YN7B 3NZ8B 1SMAA 1VFOA 1JF1A 1QFHA 2B4CH 2X4SB 4XP1L 2YUWA 3VI3A 1YUHA 3LSOB 1O7DC 4G71B 4M7KL 4DIXA 1PYWB 4K7PH 4FD0A 1UUSA 2UZPA 3MOAL 4G7SB 1VACA 4MB4A 1NDMB 3KJ4B 4OD3H 4WWOA 2WD0A 3B2MA 3DA0A 1DCEA 5T1MB 3CHRA 3T8XA 4G8FA 4TTGA 3TC9A 4M1GL 3AY4A 3E9UA 3V6BR 4BE6A 5T1JA 4F15B 1IAMA 4CW1B 1CL7H 4ZD3H 1INEL 1A5FL 3T09A 4JO3H 1JZ7A 4M8QB 1UB6B 4AZ8B 1PY0A 5FGRA 3K8MA 2CJUL 3SDYL 4CVXB 4PD4K 1A3RL 2X4OB 6TAAA 1MAKA 1GKOA 4OI8A 1A1MB 5B3JE 1L9MA 1FNGB 1YMMA 4UDTB 3A6CL 3DECA 3IDMB 4KJYA 5CZKA 3TTSA 4D0BA 4EZMA 4KRPD 1Q4NX 1WEJH 2FCBA 1SFHA 3V0AC 5K1VA 4PW3A 5EC2B 2A73A 3UP1A 2EZ0C 1MHCB 1I9JH 4JZOB 3UTQB 1NEZB 2ZYIA 1XF4A 4OCYH 5GRUH 1A25A 1EO8L 1YEJL 2XA8L 4I0CC 1JVOA 3HRZB 2EABA 1OCRB 1LYQA 3P9MB 4P59H 5B8CB 3ECWA 4DK6A 1XF2A 3MCYA 3FCSA 4PWHA 1RHFA 1H0DB 4P99A 4KVCH 3EADA 4TLKA 3WCYA 3M88A 2OXGB 1JYNA 2X40A 3CHSA 1Z7JA 3QE5A 3G5XA 5E2WH 4EOWL 1U58A 1WC7B 4I2XA 2HRLA 4EN3B 1CR9H 4NX0A 2BNQA 5B39G 1PL3A 4IYKA 1B2WL 1KDIA 2OYPA 2EQDA 3AMLA 3QPKA 2HUEA 4HC1A 3RX7A 1IEBA 3C87A 1AQDB 1SMOA 4PY7A 1PQZB 3A67H 2IADA 2Z93B 2VQ1A 2FJFB 2F1AA 4LQFL 4PP1D 2F7PA 5I15H 1U92B 1UVQB 3BRFA 1FZKB 4FJYA 5GS0C 3OXRB 1ZVSB 3EYSL 1M9WA 4HXAH 4OLZH 4Q6IB 3KXFA 2Y7NA 3FB5A 2VDLH 3FONA 4G1MA 4KFZC 3HAEH 5I0DA 5D7SH 5EUOE 1OAQL 1YDPB 3UZVA 1OE2A 5D7IA 4OLWL 1P9MA 3KL0A 5DD3H 3BKCL 5B4MC 2EEBA 4IK7A 1AACA 5K69A 5JLZA 4I18B 3P4OB 4FQCL 4WI0B 1HILA 5C6PB 1FO0L 1ZHKA 4N1HB 4N0UB 1EO5A 3MJ8B 5DRWA 4PD4J 1MW1A 2H1PL 4OCNC 5EBMA 1WUNT 2QADC 4P9MH 1GYUA 3KPOB 1AG0A 1VESA 2OL3H 3HPJB 5IVNA 3F7KA 2Q6WB 3TONA 3AUVA 1ZLWH 2RHEA 4IU3B 2PP9A 3HI6L 5EZPA 5I1HL 3UG3A 4A1RA 7FABH 2X42A 3WFEH 3IPEA 2P80A 3HNVL 4U3HA 5BVJA 3D4GA 3ATDA 1BMZA 4IBYA 5L7XH 1NC4A 4ADJA 4M43H 5TF1H 1XCQB 5A7EA 1JRHH 4FQXD 4GKOA 5JQHC 1DBML 4H20H 4Q4EA 3IEAA 3FTVA 2R56H 2YWZA 4FQXB 4JFUA 3MLUL 5E0FA 3T1FB 4ABQA 4Q9QH 4H0HB 3RVUC 3AY2A 3ZYIA 1KN4L 3UJTH 5DS8B 2WAHA 1U2YA 4N22A 1NBQA 3T3MF 1F3JB 5GGSA 2IPTL 1JYXA 3I9GL 4XP9H 3L95B 1DBBL 2YMOA 2AS5M 5L2JB 3VX1A 2QPUA 2ZZUT 4OF6A 2BCKB 2GJ6A 4UZSA 2O6PA 4QO1A 4MSWB 4AH2B 3FQXB 1XR9A 3E1ZA 2X3BA 4A38A 1KACB 1MJ8L 3HB3D 3F58L 4KMLB 4AOFA 1UKQA 1KBWA 2O61B 4PJAB 3V4PH 2Y5QA 5EUOB 3V9EA 5FO9B 2FIKB 3HB3B 3PLYA 4X5LA 4AEHL 4ES9A 3JT0A 4G2AA 4N8PA 4OD1H 1HQRB 5DMYA 4PP2A 1ESOA 2CBMA 5LB1A 2CKBH 1PLGH 3ETBF 4LHJB 4EI0A 4K2UH 5H94A 1LP9B 1YEDB 4LLDA 4YFLF 3FRPA 4NPYB 1JBJA 2IBZX 1GZPA 2KZBA 3ZY7A 4FFWD 5LG1A 1TZHA 3PWVB 5D5ME 1S2EA 1TPXB 4N9GA 5CU5A 3C5JB 3V52L 1UWXK 3V6FA 3GMPA 4FA8A 3Q5YA 5IT2H 2RALA 4D7PA 1T22A 4QGTA 3DI3B 1Z32X 2WN2A 4NHUB 5F3BB 4OCRH 3LKNA 1XFPA 5JW3H 3DO3A 2P8LA 1XGPA 1Z0MA 2MPAL 4FXKB 4AWJC 2ROYA 4X6DE 1WBZA 3QUYD 3L3HB 4TRPH 4LSTH 2DQHL 3FFCE 4Z7VA 2L4OA 3W57A 4JPWH 1JZIA 5I8KL 3SYAA 3WTTA 4RBPK 2ROXA 1I3RA 3TZVB 2I25N 3NG5A 4FE9A 3V4PB 1VFAB 2PWFA 3D30A 1H3PL 3QEGL 3MXWL 1OP5K 4AM0B 4L8SA 2F1BA 1O0VA 5DZLA 1M71B 5E5LA 3RTLA 3VRJA 5CR8A 2C4FT 1KOAA 4CU7A 2CKBB 1DJXA 2F8XC 4AL8L 2ZOKB 3O6FA 1D5ZA 2R2HA 4BXVA 1IE4A 2F19L 2APXA 4MJHA 3OMNB 3NN8B 4QNPF 2ATKB 1RP9A 2ZKHL 4FLQA 3NZHL 3UPAA 4HUVB 3PWJB 4ZQTA 2J5WA 2JJSA 5C07A 2VNCA 3JV4A 1TNNA 1IQWL 4CADA 4CA4A 1JGVH 2WUCH 2IALA 1J8RA 3O6MH 4XWOC 1G43A 5E6ID 5T5NF 3CFBB 5C08E 1Z5LA 5C09E 4KXZH 2LQRA 5B7MA 1WBXA 2QQLH 4I0PA 3EDFA 4BQCA 1J12A 3ZE0F 5E6IB 1E4XI 1P4IH 4LDCA 4HUNB 1UXLA 3B37A 3CBKB 4WWNA 5AW9B 2GI0A 4RBPH 3QPQD 3OWRA 1CB4A 2GSIB 4YHLH 1VIWA 1DUZB 2JKTM 3FYIB 3LQAL 4JFQA 1R4XA 4KQ3H 1J0YA 2FRGP 3FC8A 4TULH 5D5MB 4NZUL 4N0RA 5DTFB 1N19A 1MVFA 3APFA 3DVGB 3WD5H 2F7RA 1S78C 4J3OF 1C08A 4FJ6A 4GRMB 2YGOA 5FO2A 1MCWM 2D9CA 2HVJA 4Z7IA 1DO6A 4RA3A 3QIWC 4FDWA 3BZDA 4WNQB 4RWHA 1Q9KB 4FZ8L 4Q89A 5DQ9B 1N9PA 4MA3A 4BZ1L 2I9LB 4HIHB 4MA1B 3LN4B 3NJGA 4MVBD 4K0OA 4TNEA 4YIQA 1PLCA 3FK3A 1IC7H 1CQYA 2BSEA 3JVGA 1UM4H 4HS8L 2ZCHH 1ILSA 1TZIB 1UM6L 1I9IH 4L1BA 4YDIL 5DJDA 4D7BA 2DMKA 2G3XA 3SCMC 3KDPB 4ZOAA 5DC9B 5HY9B 3BN9D 1XO8A 2X4QB 5IV2A 2IAMD 3BE1L 1GOGA 5TQ2L 1TTFA 1W6WA 2XWCA 2MMXA 3I50H 1FZMB 4XO4A 3H3PH 3HPLB 3VXRE 4DP5X 1HWHB 2IAMB 3ETBJ 4RA0C 3UCRA 1T5XA 4PLNC 4DAGH 1P7KB 1PZBA 1NGWA 4KJWD 3EZ8A 5A43C 5G5DB 3O3DA 1XTMA 5C08D 5C09D 3IJSA 3BD3A 1D5BA 3G6DL 2RH0A 2DV6A 2NNXA 1XTLA 4WO4C 4FKHA 2NUPB 1ZTXE 5C08B 5C09B 3GFUA 5DI8B 4APQD 3PWNA 1UA6H 1UTDA 1HE7A 1YN7A 2W65A 3NZ8A 4MS8D 3CDGA 1XWVA 2P5WA 4MJ5A 4B3VA 3LSOA 1S9YB 4M6ML 4YK4C 4APQB 1PYWA 1XDTT 5EU4B 3IDUA 3T1WA 1G9NL 1AZUA 1DSFL 1RZQA 4NENB 4OW6A 3STLA 3VXUA 4XH2A 1TTUA 4RSVA 5IB5A 3HC0B 1UGKA 4UANA 2VW7A 5HD8D 3DHMA 5C0BE 4NQSA 3MDJA 4FEIA 3VTAA 1CDBA 1RU9L 2NY4C 3VWJC 4JX0A 2YFNA 2FGWH 1ZXQA 1DDTA 4KMTH 4PB0L 3LDBB 2ICWB 2OZ4H 4JJ5B 4GSUA 5AVRB 1UB6A 5GJSL 2ALAA 5GGUA 4NQXB 3V0EA 4N2EA 2Y36L 2X6CA 1S7VB 3RPKA 1ZTXH 3ULVC 2D7OA 4Y5XA 1Y18A 3CFTA 1FLTX 4GI8A 3FNKA 3GXPA 2K0RA 3MRRB 4JO2H 4PS4L 2GHWB 3WS6A 1VEMA 4NNXA 5JQIB 2C9AA 1JZ4A 4K8RH 5L4MA 4KKPA 2DI8A 5EZLA 2XN1A 3W2DH 4ZTOL 4X5WA 3N5AA 4PJDA 1JHTA 2GABA 2R29H 4ODXA 5DMJB 5ES4B 3T6QC 2RR3A 2LU5A 1DP0A 2YKKA 2CBPA 4OCWH 5B38A 2OBGA 2P4AB 4JQXA 4IBLT 1CDGA 1E27A 1HSBB 1GYCA 5B8CA 1YZZA 1UXMA 5EO1A 1YY9D 3P30H 3FO0H 5EDSA 1B0RA 1H0DA 3NTCH 3QB7C 1TO4A 4LLWB 5HHPB 1E65A 3BIKA 3BVVA 4PB9H 3MRHA 4NUPA 1IAKA 2B08A 3CHPA 5KYWA 4FMFA 3X14A 4DJMA 2JMRA 4M3JA 2Y1ZA 3CDZA 3FT3B 1FL3A 3FB6B 4WU7A 4I0PC 4OZFG 2VKXA 1WC7A 4K8RD 4P23C 1YNTB 1T89A 4ZNCD 1MAMH 4JFYA 5GSRB 3GZPA 1BF8A 5KEZA 3MRLB 4BD4A 5C0BD 4NRYA 3MLZL 2ETWA 4ODWB 1EEUA 4KGJA 5HPMB 1EZVY 3I9AA 3QRGH 3QUXD 3KLQA 5F96H 5C0BB 1RUQL 1NAMA 2OW7A 2ORBL 2OK0H 4M4RB 2ZOWA 3OKDA 1FZKA 3N40F 1LGVA 3IAPA 5DYFA 4G8GB 3OXRA 1ZHNA 2YD0A 1D3CA 5FA4B 4YNYA 1MDAA 2IDUA 4UU9A 1TVBB 4DF9A 5E8NB 3FU0A 5H37G 1QLRB 4BH7A 3L5XH 3T3PF 5DZPA 5BO0D 4LF3B 4P3WA 3CZGA 5IIEA 3IJ9A 4Z76A 3IDIA 2IPUK 2A1WH 3UO1H 5CBAA 3CD4A 5KVFE 3O2WH 5FA3B 5I1AB 1A7QL 4WI0A 5IBLC 2ZSVA 4M61B 4XP4H 5L4FA 1EHLH 3QFGA 4LOUD 4ELDA 1JZGA 1KUMA 3WY1A 3QJUB 2VQTA 3ZZQA 1N7MH 2SEBA 4APXB 3QZWB 1M4KA 4CNIB 4AQ1C 1U9KA 1DVYA 2YAPA 2HLEB 5I6XC 1JPST 4KKLD 5CP3A 4H40A 4RETB 3TBYB 2FUQA 5FYKE 1J86A 3U7YL 1N67A 5ETUB 4UYPA 4RDQF 5AW8B 4ZOEA 4C4BA 2V2WB 2PN5A 4QHNA 1IAIH 1UKSA 4N2FA 4AYMC 4TM9A 4YE4H 3QQ3B 4XVJH 3L3DA 3W38A 4WGWB 4MMYA 2AFNA 2H1LM 3FQ4A 5I1LB 1THAA 4P2AA 3LEVL 4XNYL 3BLKA 2GIYA 3DK0A 1X6NA 1VENA 3FSAA 5CLTA 5ESQB 2WZPD 1DQQA 5IHLB 5MEPB 1ACYH 1MQKH 3WIFA 1F4WL 1RZGB 3H7BB 4DVBB 2UWEE 1CZ8L 3KJ4C 4Z7OE 5A6LA 3DVNB 1YEFL 1CFQA 2R51A 1G7HB 4PRBB 4XNXL 1IGMH 1TYJA 4DO4A 4ACTA 3OJMB 4K71B 4WGVB 4F15C 1GH7A 4AH2A 3KPLB 1IGIH 4AZUA 1NBVH 5EEYA 5KG9A 5DLML 1M6UA 4N2HA 1TQUA 3PWPA 3T6XA 2O61A 1X5MA 2PR9A 5FO9A 2K8MA 4J7RA 3NQIA 2CHDA 2GCYB 2XYBA 3M1OA 3IMBA 2YPVH 4LP8A 1YEKL 1R3IH 3FQRB 2Q8AH 4YAQA 1IAOA 3MGTA 4AVIA 3EG9A 2ATPB 3LKRB 4OCSH 3CWGA 2EDWA 1JMZA 2B4CC 3SKNB 2LU4A 2X2HA 3QDGE 1NGXA 3IDJB 3TBWA 2YGVA 3PJSB 3SJVA 1QEXA 1AP2A 1CWVA 1P6AB 3C5JA 3QFJE 3NJKA 3ZO9A 5J1SC 5FYKD 1BIIA 1UZ8B 1I85A 4YHMH 2YD9A 4J8RA 4ZS6C 2GKIA 3VXQA 2HX8A 3HRZC 1ZIAA 1YNLH 4ZUUA 5B8CC 4G83A 1L0PA 1L9NA 2NY0D 1Q9WB 5FYLH 1QP1A 3U7WL 4JN2A 1WFJA 6FABL 3QUYA 1NUDA 2NY0B 2CGRH 3A0OA 4U6VL 1MVYA 1PD1A 1KEMH 2AABL 2C9RA 2H0FA 1I31A 4OGXH 4U1SB 1NCBH 4UNIA 2V3FA 1KYDA 2A9CA 3WY3A 1FRGH 3VFWA 4EN3C 2J71A 2GQHA 2H32H 3HMWL 4JPKH 5F93C 4R96A 4IDJL 3ASNB 5E9DD 3W5MA 1J10A 1G5GA 2IBGA 4GFTB 3ORJA 2M26A 4G6ML 3SYCA 3VO0A 1W8NA 3BP6A 2VM3A 1EZSA 1NWOA 2W07B 2UWEB 5ADPH 3GUTB 3VJ6B 4Z7OB 5E9DB 4HIXL 1T0MB 3WLWD 2QSVA 2VLRB 1IBZA 4DT2A 1AY1L 4WUKL 4QXVA 4XC3L 2JNZA 5AB9A 2JKLA 4PP1C 4OVUA 2CGYA 5B1CA 3VM5A 1E3ZA 1T2QH 4OLYH 4Q6IC 1KV3A 5E70A 3L5JA 4U6XA 2J1KA 4S1QH 2Z7YA 5J11B 3QYCA 4NZTL 3QK0A 4BFIA 4JFPB 3SYQA 5I73B 3RKPA 1SDDB 3GZQA 2PETA 2Z31A 6CGTA 1ZHBA 3BAWA 4I5BA 3TWYA 4N6RB 4I18C 2YUVA 3MVSA 4BKSC 1ETJA 1PG7X 5E08H 3PNWA 2YXFA 4NQVA 1ZLSL 1FO0A 3QFJD 4FFYL 2H32B 2ESVA 3UYRL 3Q5OA 3CVDA 4Z7WE 3M6DA 1RJLB 2ZOUA 3RTQA 3OJ2C 4YHPB 3QFJB 5AYQA 2VRQA 4JFOA 1OAKH 3O2VL 3PWLB 3EJPA 3FSZA 3ME0B 3LZLA 4DKAA 4GRMA 1UATA 5E2TH 4XB3A 4MAYA 2QMKA 3IGLA 9CGTA 2X4RA 3ARPA 4NN6B 3I85A 1ZWIA 1MFBH 4X6DA 3DJSA 3FU7A 1QLEL 5FWQA 4EPSA 4JHWH 3WTSA 3FFCA 3WKPA 3AQZA 4WQOA 7PCYA 5K9KA 2DLIA 3FT2B 4MXVE 1X6LA 1Y1DA 4AGPA 3PL6D 1TQSA 2DYPB 4LEXH 1QRND 2GK2A 3ILPA 4PYHA 5DEGA 3OX8A 4NRZB 1AE6L 1I8IB 4MNGB 4FQXC 1ICTA 1FV1A 1NCDH 1OF2B 1QRNB 2QHRH 4J27A 4ZUTB 5D72L 4RAUB 1W80A 1YYLL 4HFUL 3HI5H 3B2UD 4YSCA 4BBWA 1T3FB 2WGNB 3RFZB 3K4DA 4KH2A 1DVTA 1I9RH 3FT4A 3WAKA 2J8OA 4OSUL 3PHSA 32C2B 5EWIL 3S4SB 4BUGA 3HTLX 2YA0A 4F93B 3ASOB 4FQHA 4KO5A 1EVTC 4WI2A 5H4ZA 1NCWL 4Y9EA 4OIFA 4A7UA 1KBGH 4HA1A 2XDHA 3GMNB 4OM1L 4AQ8C 5HI5C 4XOEA 1MDTA 2VDPB 4IU2B 4KDTA 3B9EA 1NDGA 3NCYP 3AADB 4LSSL 4C59B 1A66A 4YE0A 5DR5L 1YEIL 2P8PA 4QF1B 1XGRA 3B7UX 1CDUA 3P3YA 1QWUA 5C08A 1HZKA 3T2OA 3HB3C 2CG9X 1M7IA 4UQ2A 5EUKA 1FG2A 3RWDA 3MXVL 4O58L 3F7VB 2QQQA 3N55A 5IVXA 1QSEA 1TR7A 1BFOA 3L2NA 1YEGH 1JAEA 1F4AA 3CFDA 5CEYB 1AGBB 2WO2B 1A1OB 3QZBA 1Z66A 1AGEB 1TPXC 4Z7WB 2UZYA 2VL5B 1EAQA 3WEAA 3MCG1 1RK0B 4TSAH 2JKSA 3RGVD 4RIRA 1OAUL 4QTIL 2YAOA 4R7XA 1I85C 3P0VL 2GSGB 1J0JA 4LXFA 3FAWA 2Q86A 3CSBA 4FXKC 1HCVA 4KHTL 3GZOA 3RGVB 4OZGA 2E8ZA 2FE0A 1A8ZA 5DEFB 4UQ9A 4MD4A 4NOFA 3DTXA 2RJMA 5INDB 2XA3A 1DBJL 3HAEG 3JVFC 2WXMA 1NMAL 3V0JA 1IGFL 4MX7A 3KL5A 5SWZB 5EOQL 1A7BA 3TZVC 4HPOH 1PCXA 2XC8A 2YD4A 5FUOL 4X9FA 2JF1A 3HFML 5ESVA 3CSYA 1HAWA 1CLVA 1UFGA 3QNXB 5LGHH 2X1OA 2YFOA 2VCOA 2KS0A 1X9UA 4GW5A 1MFDH 1PG7L 2X1PA 3G5WA 3MRNA 1GGIL 3ABKB 3LB6C 4DGIH 3VXRA 3NFNB 1MFEL 3GNML 1I8MA 2NLJB 4FC3E 5FECB 4IOSA 4PBDA 4Y1TA 4LLWA 4PGDB 4YVUA 3NJXA 4HVBA 2WNWA 3IJ7A 1MFAL 3MI6A 4OY9A 4OLXH 4ZTPL 2J6EL 4POUB 2BH0A 4LSUH 2LFGA 3O3BB 1YY8A 1BOGA 5JIPA 4QJ5B 5E6IC 3WV0A 1X5XA 2M2DA 4B53A 5GZNC 2FEDD 2QVTA 1WICA 3OKEB 3RYMA 2YGPA 3K8LA 3S0PA 3TEUA 1VAHA 1A3LL 4JHAH 1ASPA 5IMOB 1PFCA 4OAWA 3CZFA 4H1LH 3V0GA 3ZMRA 3BZ5A 3S5ZA 3UACA 3MROA 4H2CA 3DX8A 1YPZE 4QTHB 1U8HA 3ZDZB 4WWKD 4XCCH 1EA9C 2KDGA 3SPCA 3C6SA 3CFUA 2CXKA 4PV9A 1AZNA 3KWXA 5AVUB 3QUXA 4WWKB 1M2OA 2ZWYA 4GG8B 3WFZA 2MQCA 5FB8B 2K7PA 4K94H 1TVBA 2R0LL 4MA1C 1Z9MA 2MOGA 5ILTL 4BZ1A 4J3VA 2BZCA 1KFAL 3LIZH 2DYSB 1HHIB 5DLLA 5I66A 3CCHA 1BXAA 4XNAA 4DZBB 4C8XA 1G6VK 3EIFA 4MVBC 3ZTDC 4NCC1 5HGDA 4M61A 5C0EA 1LO0L 4NCC2 4G5ZL 4ZTEA 4L0PB 1AO7D 3MV8A 2FATH 3LKPA 4LVNB 3K4ZA 2EADA 2XWDA 1FBIH 2AF2A 1XXFC 5EEXA 3GI8H 2ADFH 2L7QA 2F58H 1AO7B 2EEFA 4U1IB 5E1AB 3QT2A 4PHZA 3C2AH 2NNAB 1XXDC 3TBYA 2IAMC 3BLPX 4Q74A 1SLUA 2ZKYA 1XAUA 3GSRB 1NGPH 1RPQA 3BP7B 1LLAA 3H0TA 2YAEA 4R8WL 3NIDE 3QNFA 2R7EB 1ZS2A 3BWZA 3JV5A 4KJWC 5D7KE 4E9TA 3DIVA 3PHQA 3W11D 4ZPVA 3WHXA 1B90A 3EJRA 3RAJL 5I1LA 4JG1L 4WEBL 2YIHA 5EZOL 4S1RL 1KCWA 4APQC 2XETA 3T9WA 1RCYA 3VYNA 4MS8C 3EFFB 4R0LA 3LV3A 3BAEH 5IG7B 3BWSA 1TEGA 2NY5H 5F89B 2WZPA 3BKYL 1CLCA 3P54A 5IR1A 4NO0D 2FYYB 2WWKT 4GRLD 4LPCA 4GP5B 1X5IA 3ABMB 1XH3B 5HD8C 1I9EA 1HHGB 3LDBC 5EPMA 3IFLH 2BY2A 4P46D 4X98A 3KGRA 3MRGB 3A5VA 3OZ9H 4WNSA 3X3FH 3C12A 8FABB 3U6XS 3L7EA 4JMNA 3FT1A 1IIIA 4R7NA 4ABUA 1A2YB 5TGBA 1Q0EA 2CM5A 2WLKA 4JDVA 1MJJB 1IZKA 2UY6B 1KN2L 1IM9A 2G5RA 1Y0LB 2DZEA 3GSQB 3QS2A 3A4FA 5AYUL 2Q1EA 3F85A 4UM8B 2LLGA 3ULVF 1MRFH 3FTWA 5E6SB 2ATPA 2ZXGA 4JDEA 3GDBA 2DLFH 4NRXB 5AW6B 1CE1H 3V5KA 2FX8H 3SKNA 1ZS8B 3GT6A 1OVZA 2B77A 1B2YA 5JOFA 2XX1A 5C0CE 3DRTA 1CTNA 1GSMA 1MF2L 2C4XA 1V3KA 1GGBL 1HSAA 1TG8A 3PGCA 3GRBA 1G7LA 2NDFA 2PPFA 5KTEH 4LSPH 3WE1A 4F58H 5C0JB 1L9RA 5D7KD 3K6DA 1G7QA 3RJOA 3IDXL 4WJG3 3DOSA 4Q9RH 2BIMA 2BS8A 3NIDB 3RWGA 1EPFA 4PJ9A 2AQRA 4LARL 3V6OC 5L4JA 1WZMA 1KPUB 4JY4A 5KVEL 3LS5L 1KIQB 2CLZB 3W0WE 1BM7A 4B7IA 3IAGC 4Q0XH 4W9KC 2GUYA 3UP6A 4ZFFA 1RK1B 3LRSA 5DZAA 1QABA 4K8RC 3RWFA 2CRZA 4EUPA 1TO5A 4K5MA 2I07A 4OTXH 4L23A 4BK4A 4F5CA 4U33A 4BJLA 4LNRB 3GIVA 3OZLA 1AANA 3RX9A 2L7EA 5EO9B 1CS6A 3DWTA 1JPTH 3QUGA 3WL9B 1ZSDA 4NNYA 5A2JH 3Q06A 5T1LD 3C75A 3MV9A 1TZGL 1KJ3H 1BW8A 5JMRA 1MCKA 3BWUC 4DGYL 1S5IH 3SOBH 1X4XA 4OLVL 3N85L 3S9DB 1FVDB 2EDEA 1V3MA 3Q01A 4NZRL 4F9LA 1YA5A 5I16A 1K4CB 4JGNA 4JFPA 1PKQB 4OV5B 3IF1B 2WXGA 4NO2A 1J9SA 1HKFA 3QEQD 5J57B 4FFVD 2QGCA 5J06A 1I7RA 2WKOA 5DVNA 2AEOA 4M3KB 2WWNA 4JM4H 1MREH 5D2NE 1LEIB 5C0CD 5T5NG 3QEQB 4JRFA 1OAZL 3QDGA 1OCOB 3FQUA 5ESAA 1RIVH 2R8SL 3IRCA 4MRCA 3S96B 3FOLB 3K2UL 3OB8A 5C0CB 3R4RA 3DX6A 3PWLA 5I6PA 3ENEA 1SOKA 3DXAE 4M6OL 2GC4C 4ONOA 1FCCA 4QRUB 5EZIL 2DRUA 1FN4B 2P1YA 5EF3A 3Q0HA 5EEWA 4XZUB 1I1CA 1O7VA 2PMZA 3QUML 2HLFD 3PF2A 4PVMA 1JNLL 3F7YB 3CUPA 1A7PH 1MWOA 2PP7A 3B2PA 1I7ZA 1IKOP 1J8SA 2BRRH 1HKLH 4ZW6A 1UURA 2I26N 3W0WD 4WCYL 3HW7A 2H41A 3VD7A 1MCJA 1LO4L 3HI1B 4X4XB 4F2EA 2VH5H 1VEOA 1UWYA 2VUOA 4R2GD 5DVLA 1CYGA 4M62H 3PL6A 5DJ2A 4C57C 2HLAB 3B2VL 1NQBA 1DQKA 4AX3A 4LU5L 1JNNL 2NUTB 4LP4A 5ALBH 3PIQB 4N8CL 4B27A 2ZNWA 3L3GA 3WN5A 3JWDL 2ADIB 4MJ2A 1GW6A 2XY1A 2CO7B 1HYRC 4BDVB 2ZAGA 1E9PA 4X6BB 5IK3B 1UACH 4K71C 3DGGB 1JZ5A 4PV8A 2X4UB 3HR5B 3LMJH 5CJXA 4GSDH 3EDKA 4UNVA 1A6ZB 4NAQA 2Y07H 3T0BA 3QWOB 4FN0A 2ENPA 5CUSH 1RIHH 1SLXA 1ZLEA 4DSYA 5AVZB 5IQMA 5L6YH 4U05A 1JDAA 2A4EA 4W9LC 1NBYA 4FABH 2ILLA 5D2NB 3FTYA 1EZUA 3ZRCC 1IT9H 2ZCLL 1UT9A 1RJZA 3DXAD 4AQZA 1PSKH 4ZX3A 3ZYZA 2HJLB 4ZFGL 1FE8L 1I7TB 2PPAA 5JIQA 2VAAA 4PJDF 3DXAB 1SQ2N 3K8KA 2CPCA 3RIFF 3RGVA 4PIRF 5E9NA 3SDXE 3F00A 1BM3H 5A6MA 2J44A 2A74A 4N86A 1DLHB 1T0NA 4FG2A 5L8KB 2NY0C 1QD0A 2VDOH 2CM6A 1G4RA 4BSVA 1IX2A 3VD1A 5I1DB 1JPFB 4XC1L 1MI5E 5C0IA 1A9EB 3SSGA 1GGCH 2F0CA 1GTFA 2VJXA 1RPUA 5IF0A 3D39D 1RUPL 2PW2A 4TSBL 4I4WB 3Q2LA 3QNXA 3NA9L 2N0MA 4J6RH 5DK2B 2JI3A 4GQRA 2Y7MA 5AVXB 3FQTB 2Q8BL 25C8H 3D39B 2V9TA 1FZOA 3MJWA 4P2OD 4KRMB 4YZFF 3WEBA 1SXSA 1NBZA 3HMXH 1SDAB 3FUHA 1X5JA 1U6AL 3VXTB 4FNPA 3WLWC 2ED7A 3U4KA 1HZHH 2DIJA 5HI3D 3VGGA 1IGCL 1LO2H 4N5ED 1OXYA 3SKOB 1PDKA 4HOXA 5J11C 4F9LC 3TIDA 1X5AA 3WEMA 1NFKA 5I73C 4FL4B 1IILE 4KXAA 4WW2A 4A67A 1KBKA 2VDOB 4QMEA 5BZWA 1VB9A 2OTUA 3WTWA 2IWGA 1GR7A 2D7MA 1L7TL 3OKEA 1EHNA 3DSNB 3RILA 4GT0A 3ZX1A 1U95B 1OB1B 2B59B 3KBEA 4CSPA 5B3JF 1CLYH 1NMCB 3UO8B 2IPUG 1S9WA 3MJ6A 4HJSA 4FFYA 2E7LC 3N6YA 1QBMH 3C60D 4NIKB 4QTHA 4U49A 1EEQA 3CFNA 1HCYA 2C1PB 5ICYA 2DB8A 1QASA 4KAQH 3VE0B 4OLEA 5I1IL 1U2CA 2FR4A 2O5XL 1ACCA 3C60B 4GW1B 3UIYA 1UA7A 1CMOA 2VMDA 3UTTE 2KH2B 2OMUA 2O5YH 4NN6C 3P4MB 4PY8I 3UZQB 4O5LH 5DWPA 4B9GA 3S35X 1IQDA 1MCSA 1HL5A 1G84A 2FX9H 1HHKA 2QPSA 3VXSA 5EMYA 1MI5D 4YHZH 5DHYB 4K3EL 3CBRA 5IVZA 4C4KT 4DKTA 3BO8B 3MAWA 4G72B 3UPRB 1P4LB 4TUKL 4H8HA 1MI5B 1UWGH 3GXTA 2AJYH 2C9PA 2P48B 4Z0BH 4KQ0A 1W9XA 3AWFA 3RFZC 4BINA 1RJYA 4ZFZB 5EO0B 2ZKXA 4B5ZA 4WTZG 4U4BA 3B2UC 3MYJB 1SHMA 4BWUA 5FPIA 5KSBE 4BFFA 1JXDA 1UCBH 4TOYH 3BEVB 5I1EH 3NCJH 3T04D 2E56A 3GSRA 1XBDA 1KJMB 4RAHA 1C5DA 2D0HA 1N64L 1VLXA 4L05A 1CBVH 3TEXA 1FFPA 5CJXC 1BZ7B 5FO7B 1H5BA 3ZHKA 4AJWA 5BXFB 5I8OL 5DHEA 5AVYB 2I9TA 1LVEA 1L0XA 4QRRE 1FGNL 1MWAH 5FO8B 4LCCA 3GK8L 2GIMA 1KJVA 2J8HA 1F58H 3BMVA 1YECL 1WAEA 1HOCB 3KJ6H 4XXWC 5EUOF 5EFIB 3K1KC 2WLYA 1OQOA 3ESNA 3QR2A 2ZX9A 4E9QA 5DVKA 1S4IA 2HAZA 2OJEA 2PO6D 3SDAD 1FHNA 1MCQA 5TE4H 2JB5H 4F3FB 4OF0A 4DGUA 1YPZA 4HPYH 4E41E 2WVSA 4HJUA 4QY8B 3D2UA 2JWYA 2X2UA 4H26A 2X4PA 3T4AA 2HVBA 3SDAB 2K78A 4FP8H 4HLZH 4O51B 3BVNB 3RBSA 4QYOB 2XICA 4WFEE 2NNFA 3ARRA 4N0FB 4NO0A 3LS4H 4GRLA 4R5XA 2R0KL 3RGVC 4LRNL 3GRWH 3ABLB 1N0LA 4MXQD 1LDPL 3Q44A 1G9ML 4P46A 4DCQB 3QG6A 2NY6D 2C9SA 1EFXA 4NCDA 1Y0LA 4WDIB 4X8CA 2J57A 1J5CA 1MWAB 4PJEE 3FCBA 4P2RE 1JWSB 3GSNL 1S7UA 3JZYA 2XVLA 2NY6B 3HC4L 3P40A 1UD6A 4AGNA 4LEOB 3TNNA 1BFSA 4IRSB 4UQBA 3S4SG 2F6AA 2PXYB 2CDFB 1LK3L 3NZSA 2KT6A 3LHPL 4LVHB 2QV4A 5LLIC 2VL4A 1MJUH 1R3KA 3L3OA 4LAJH 4NFCA 2ED9A 2DWDB 4GXVH 3SGKC 5KSBB 4MD0B 1QR1A 1XGTB 1UWFA 1PZSA 1XF3B 1ORSB 1TQWA 2OP4H 2IQ9L 2YRLA 4RMVA 5HGBB 4QRRD 4X6EB 2AK1H 4Z78B 1DYZA 2KLTA 4LASH 4YO0A 2V8LA 3IDNA 4QRRB 1DVXA 3A6BL 3U9WA 4WGKA 2J6EA 5A16B 1KPUA 3K5SA 2VXUL 1NIBA 2DD8L 3H42L 3L4XA 4R4ND 5DRNB 3KH4A 3SGEH 3SBRA 4Q2ZB 1DJGA 1LO3H 4DEWA 2DH2A 1AHWB 1RZFL 4V2BA 2Z1KA 3UFIA 5CSBA 1CL7I 2NNRA 4JY6A 3M1BB 3MJ9A 3BVWA 2DM3A 2WBXA 3NJJA 4GJTB 4PTUA 3RX5A 4E41D 2FEDC 2VZVA 1A0QH 35C8H 1QKZH 3MRFB 1XGYL 4LNRA 2PABA 2IIJA 4WFED 5EO9A 1TJIL 3ZYJA 3MNMA 4E41B 4ZI8A 5IHUL 3X3GH 3N1GC 3SDYH 2VZSA 3MLVH 3MNWB 2QKSA 4WWKC 3U9PL 5D5MF 5BS0A 4IMLA 1OY3B 2EIBA 1F90L 2AJSH 4ZRGA 2G60H 4TMPA 1AFVL 3ZTCC 4GAYA 5T1LA 5I0WA 1KB5L 2IGFL 5CZXD 4K55A 5C6TH 4B60A 4XNQB 4XVSL 2AJZA 4P2RD 4NDMB 1ZEAH 3DBSA 4X6DF 2A9MH 4XI5D 1T6VN 5DT1H 3UEQA 2RQ8A 4LKXB 1KBVA 4AGQA 3PAYA 5EEUA 4W9DC 3CC5B 2HX9A 3EW3B 4K7FB 2ZJSL 1CGSL 2C1OA 2D0FA 1EO8H 3P3TA 1NMBH 1PD0A 3I75A 4LVNC 1F56A 3X11A 3VFUB 1FNSH 3S96A 3F01A 1JV5A 1AGFA 2EEXA 3K6SA 4E0RB 1M7DB 4PR5A 5J8OA 4HD5A 4QRUA 4L2YA 4EDXB 3BX7C 4RFEA 3D85D 3KPPB 4R26L 1REIA 1HE8A 1T6WA 1T04B 3EH1A 3LEXB 3NIFE 3OGCA 4NKMA 5TDPB 3D85B 3EYUH 3OB0K 4OJEH 3CX5J 4NQCA 1W0WA 1BIHA 4K94C 5JPNB 5C2UB 1QVOB 1GHFH 3HI1A 4X4XA 1T21B 4UILH 3SE8L 3I6KB 4H88H 5AW2B 3W11C 2F8OA 3W0WA 2K70A 4JCWA 4FLSA 3U4BH 2WZ6A 5GS2D 4QRQB 3V4LA 3VQ1C 1BQHB 4HUKB 1JGLL 3EYVA 2HWZH 4GY4A 5IM7B 2X38A 5C8JB 1JDCA 4D3CH 5JUEL 3QA3A 4JQIH 4UV7H 5DD1L 2ERJB 3KDMA 4X6BA 5T5FH 2KYIA 3DJRA 4RMBA 4U1JB 2WBKA 2Q3AA 3N9GL 2IPKB 1AVAA 1J9CT 2DWXA 4JDTH 3DO7A 4HCGA 1OAJA 2X4UA 3IE4A 1PW3A 4C56E 2WBJD 4A7GF 1RP8A 4FQCH 2W0KA 4YHKL 4IRZL 4NERA 2J1ZA 2AJXL 1A6ZA 4IM8A 4LFHG 3L2LA 4K5LA 3U2JA 1KBBA 2WBJB 3S35H 2FD6L 5HVFB 3AS0A 3OB0H 2B9AA 5ITFB 3I3BA 5D7HA 5IMMB 3GSNB 3V10A 2EC9T 1CDIA 3L9YA 4H1LG 5D71L 4ZT1A 1N3NB 4EDWL 2X88A 1MEXH 4G3YL 3DUSA 2RGSA 3G6JB 2Z7ZA 4FQQA 1L9TA 3HNVH 1ZHLB 3GSUB 2O72A 3A23A 5A40E 2JJTA 1JRHI 4PWKA 3U2IA 1I7TA 2NY5C 1HVXA 4WTWA 1QTSA 4YBLB 4FNLL 4IBWA 2B1OA 1JNHB 4Q6KA 2ZG2A 1J48A 5BVPL 1OM3H 3LPOA 5CLZA 5D1XE 1BBDL 4YXKL 5ID1B 4O00A 3NIFB 1T7ZA 5IB1B 4PUBL 3TNMB 2VR8A 2CBTA 2ISDA 2MHAA 3I84A 3L17A 2GSMB 3S5LA 2A6KB 2WNKA 2J88H 4W4OA 3DIFA 4HD9A 3FO9B 4J4PA 5JIHA 1TJHH 4YPJA 4B5EA 3REWB 2IPTH 3MQIA 3O6KH 4HS6A 2JI1A 4GW4B 4QT5B 5D9SA 1ZRUA 3GS0A 3UJIL 4X5XA 5HJ3B 4OJFL 3AMKA 1HXYA 1ZJAA 2FB4L 4KPHL 1MNNA 3P9LA 5EN2B 3R1GL 4W70A 5E9AA 1S7RB 3GBDA 5AENA 5CAYB 2XVBA 1LL1A 4GEJA 3TJEL 3TYFB 3TCLB 4TN9A 2MQ3A 2AVFA 3CFCH 4F7CB 1MJ8H 2XV6B 1PY9A 1I1FA 4K3JL 3QQ9D 1VSCA 4C56D 2YQ3A 5AKTA 2FSEA 3ARBD 3MO1B 4P2OA 2G0KA 5IFJB 1AMYA 4IIQA 3BYYA 1IB5A 4ZO8A 3WNJA 4PJGE 5K5YA 4C56B 1UJ3B 4JFHE 3ARBB 5IEHB 3GMOB 4ELKA 3F12A 2BIIA 1DE4A 3D8MA 2RB8A 4QPEA 3IS0X 3V52H 1BZ9B 2PPDA 3REVA 1BEYL 3LXAA 5KYUB 1OB1A 4GUQA 3QXAB 4WJ5A 4U6YA 1N6UA 4FFVC 3NCMA 3RP1A 1X7TA 5E6UB 3IJHB 3JWOL 3HC3L 4ODTH 1V10A 2EICA 3KS0H 3OTTA 5JDJA 1A6WH 3ZE2E 3O4LA 3FB7B 5D1XD 4ELMB 4NOBA 5I8KH 3UEZA 2VDML 1MCPH 4R84A 2D7NA 5JW4N 1HS6A 3V0FA 1LEGB 4MD5B 4AJ0A 4UDUA 1TDQA 3SDXA 4N2KA 3GI9H 1BJ8A 3QUMA 3PABB 4PI0A 2KUTA 4FYQA 1DVFB 1I4FB 3QRBA 4AL8H 2HLFC 2YK1L 3BDXA 1OW0C 1X5LA 1G0YR 3DOIA 4Y1SA 3BQUB 2XYCA 5DZNA 1PCSA 3Q6GL 1AHMA 4HH9B 2XG5B 4L8DB 1O75A 2HG5A 2NTFA 3GJEA 3O3EB 2YD6A 3FUMA 3MRMB 4MWFB 2BHZA 1BVZA 3MV7E 1AYRA 2VUYA 3P3UA 3OGOE 1CYWA 4NC0B 1K8DB 3PFUA 1JGIA 4JFHD 4N2DA 1JK8A 2W94A 5I6KA 3BP5A 5IB3B 2HFGH 4Y8AA 2W9LA 4AKPA 1I53A 5A1AA 2O4EA 1X7SA 3Q1SH 3NFSL 4J28A 5CLXA 3BSZH 3O8XA 3V0DA 2EYRB 4JFZH 1SY6L 3MACH 2ITCB 4UM9D 4X6FB 3VFRA 3LQAH 5MEOA 4QLWA 2FH8A 1AIFB 1H3XA 5E00B 4XB7A 1IGJA 2A6JB 1BQLL 2VAJA 4WW1B 1E8WA 2Y72A 5D2NC 4FFTA 4RZKA 5H8DA 1V55B 2Q7AA 4PBVC 2XZCL 4ZYKB 3B34A 2VRKA 5LDUA 2YQGA 4R7DA 2JJTC 2YJLA 3F5WB 3ULUH 2PO6A 4W6WB 4BK8A 2NZ1A 3GJFK 4BFGA 4O51A 2BK8A 4UQ3A 4LSQL 1QAWA 2WQSA 2YPLE 3OAZK 3PGFL 2P8MA 3BPOB 5DZVA 3UTTA 3VYPA 4MDJA 2DTSA 3VFOA 1EDQA 5FCSH 1SBSL 2ADGB 3QIUD 3JTTA 3Q6FB 2H6UA 2UUDH 4Q6YA 4WFFE 4Y4HD 2IANE 4LP5A 4W4OC 4B41A 4Z5RB 5C86A 2Y69B 2ZXAA 3PDGA 1UOKA 3C8DA 3QIUB 1DLFL 4EMZA 4EQ3A 2FDBP 3WSQL 3FO2B 5F1NA 4O2EB 4DW2H 4KMQA 2ICWI 3I9PA 1HXMA 1PU0A 5J12B 4HUUA 3DIDA 3F7LA 1TCRB 2Z64C 1RURL 1T80A 2A6IB 4E5XG 3T2LA 5HBBA 4GYBA 1DCLA 1CTOA 5KBDA 1U3JA 2X7LA 2YOAA 1JYWA 5B1KA 5EF0A 1KLUA 5FM5M 1RVFL 2DWDA 1ZA3A 5C0RL 4NN5B 4GAAA 1L6XA 2VSDA 2UWEF 2ZXEB 3HZ3A 3KLSA 5GGTL 1TTCA 4P2OC 3QG7H 4Z7OF 1MW0A 1NKRA 4HUXB 4A6YL 1TTBA 4Y5VB 3E1F1 1KPRB 3D0VA 3GJFH 1A6PA 3MA7A 3EJJX 1E9QA 3MBXH 3BPNB 3OKOB 4HCRH 3OAZH 8CGTA 4QRRA 2PCFB 4OUOA 5HI3C 3SDCB 4FL4C 4MJJA 4N5EC 5CWSB 4GIAA 3EHBD 2QSQA 2EEDA 2WLLA 1EEZB 2RTTA 2I24N 2VLLA 4N2BA 2BFVL 4HQQH 1GGYA 2JTYA 3EHBB 4QKTA 1NMCC 1DSYA 1URLA 3CMOL 5CD5D 1JPGA 1XQ4A 2NX5B 3IE9A 1GIGL 4PB0H 1LILA 4W9IC 2WKOF 5I23A 3BW9B 3AAZB 2YPLD 1R3JA 2VZ1A 2Y3NA 2Y36H 3G5YB 3C60C 3QQDB 3L08A 5TDOB 3HS8A 1W6LA 3Q8EA 4PJBA 1D9KD 2YPLB 4FCAA 1U8IA 2WJ7A 2G5UA 4WFFD 4KKAD 2IAND 5FYJL 4AV0A 3LVEA 2EDJA 5FX3A 1D9KB 2GY5A 3KW7A 1L7IL 2FBJH 3MUGB 1U8JB 2OR9L 3MUY1 3EBGA 4NDMA 4QRTA 5KJ4A 1DQVA 5KANG 5JQ6L 1B4LA 2CA3A 3WIIL 4U1HA 2QKIB 1R3HA 4YSTA 2VC2H 3O0RL 3NT0A 3BCFA 4PJEA 3Q5TA 1E50A 4P2RA 4W9JC 5IGXL 1GY1A 1A14H 2WQAA 3CC5A 5I6LA 4LLYA 2OMWA 3GO1H 1MLCA 5CD3B 2YN3A 5TK2A 1D5XA 4AV4A 4A63A 1HX0A 2HRHA 3IDGB 5HGHA 1WYJA 1ILUA 4WUUB 2DQIH 2JKRM 1NSNH