2D3JA

Nmr structure of the wif domain from human wif-1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
157
structure length
157
Chain Sequence
b'GSHMLDQQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILQTPQNAIFFKTCLQAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Wnt inhibitory factor-1
molecule tags Signaling protein inhibitor
source organism Homo sapiens
publication title NMR structure of the WIF domain of the human Wnt-inhibitory factor-1
pubmed doi rcsb
total genus 36
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02019 WIF WIF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2d3jA00
2YGOA 2YGPA 2YGQA 2YGNA 2D3JA
chains in the Genus database with same CATH superfamily
4LRNH 2IPUK 1MFMA 5JHLL 1JZ5A 1OAUL 3S8GB 2BVQA 3BZDA 4MXQC 1GZQA 5DQ9B 4Z76B 3MV7D 3H3PH 3F5WB 2BSTA 5FDWB 3ARTA 3IU3A 3QDJB 4LCIL 4NUJB 5CF3A 4GAJL 5IM7B 1SXZA 1S9XA 3E2HC 1WLHA 3BKJL 1EZVX 4FNQA 3K81A 4XPAL 2DQEL 3BCFA 5LN4A 3NJIA 4PY8I 4OIAA 2C3GA 3HNVL 4OQ1A 4AEFA 3U4BH 2W8CA 5IJVB 4BZ2A 3TT3H 5I8OH 1JNLH 2AQSA 1F3DH 4NKOB 3ARFA 3MDJA 1S9YA 4D8OA 1BD2D 1OL0A 3V6FA 1FNEA 3SJVA 4BRVA 3QHZH 4D9QE 4TNVF 1IQDB 3F85A 1BJMA 4PJBE 1JAEA 4E42A 5IB3A 4AQEB 1RHFA 2GJZB 5DVNA 5DZLA 3H3BC 5BS0E 3LZQA 1F4AA 2NY1C 3FFDB 3S5ZA 1YUKB 4K2UL 1NBZB 5CEZH 4ONGL 2IG2L 3LXBA 3S7GA 1OT4A 1V8HA 2DDQH 4KKBD 4QRFA 5TK2A 2Y4SA 4GPVA 5ACZA 5J1SC 5CJQH 4KH9A 2R2BB 2EILB 1K8IA 3DI3B 4B50A 4DK6A 1T66D 1NKRA 2YXMA 3UJIL 1E3FA 2AK1H 3MXWH 5M7QA 3GXNA 3ZX1A 2BY3A 2GSGB 1XHHA 4XP6H 3HS0A 4QGYA 1HQRA 1I8IA 1G6RA 1W91A 3QIBB 5I1JL 4CL7A 4HJTA 3T09A 1TVHA 1D6VL 4D3CH 4ACTA 5FO8B 1KB5L 4LASH 5IHBA 2P4AB 3M1OA 1RHHA 4F27A 3EOYG 3HI1B 3O4OC 3NQKA 3SGKA 1WAAE 2HX7A 2OR7A 3LPFA 4DK5A 5EFIA 4YE4H 3ROOA 3OXRB 1I1YA 1QWHA 3RDTB 5EIIG 2ADIB 3FF7A 4KDTC 3FQWA 2VMEA 3O11B 4NN6C 3W3BA 2LV4A 2NZ9C 1NAMH 2E9JA 4GBXC 4WJ5A 4XP4H 5AW2B 5GGRB 1F6FB 3ZR5A 4ZW3A 2H1PL 3VFVA 4L3FA 4JDTL 4LEEA 5ANME 4RZCB 4OKVB 4MWFA 1U8NB 3MA9H 1ADQA 4WUKL 3AROA 4GI6A 4FRWA 5E4EC 2Q9OA 3QORC 4PUBL 1T0MB 2CQVA 4BJLA 3ZLQC 3WUWG 2F58L 2XBDA 4XP9H 3AY4C 3CVHA 4JFXA 1AGEB 5GRJH 4BUQA 1NA8A 3TYGL 3O8XD 4Y4HB 4L29B 4ZQKA 1DLHA 1ICTA 2DM2A 1P84J 2VUKA 1DP0A 2BNUA 1E4WH 2J71A 2YRLA 2P8MA 2K45A 4QOKD 4ZD3L 4MD4B 4N24A 3LH8A 4EN3C 1KGYE 2X1PA 3CG8A 1ZWIA 2EEXA 3CLFL 4LGRB 3U9WA 2XZQH 4AQ1A 3IRPX 2PXYC 4R2GD 2AAAA 1QSEE 4G7VL 3FSWA 3HN8A 2FT8A 2Y7NA 4GKLA 3BH9B 1U8IB 4OR1A 1E4XH 4JFED 1NICA 3VXUA 4AYDC 4AH2B 4ERSL 5IEKB 4PV1C 1H8LA 4LPWA 5D1QB 3RI5K 3SBWA 1MWOA 4AYBA 1WYJA 3MYJB 3MRQB 1MCWW 4GUCA 1UXSB 2DYPD 1TJHL 3O6LL 3X11A 1L0XA 3BH4A 4HFWB 4JN1H 1MCLA 4B9ZA 2B4CC 2ZXDA 5T1JA 1NCGA 2X4SA 3WY4A 3A4FA 4UAHA 1YNKH 1WUNT 2R69H 1BOGB 2UWEA 5DURD 3WXWL 2A9DA 4Z23A 1PQZB 4IRSA 4PJBB 2WTOA 4N0CD 5E9AA 4Q89A 4PRPD 1BZOA 1AD9B 2R83A 1LILA 1G7MB 3NSDA 5JORA 1JD7A 1ONQB 3HZKA 4H1LH 5EU5A 1UM6H 5E9DA 1V5JA 4L8SA 1X7SA 3FDWA 4NM8H 4GW5A 4GXVL 1U2CA 2CNZA 3HMWH 1GR7A 4M4PA 3C60B 4WY7L 3WFDH 3E8UH 2XC8A 1YUHA 2XRAL 3MX0A 3K6NA 2DN7A 5E8OB 4PWKA 2CM5A 4UT9L 5DD5H 4IKJA 3REVA 5C7XL 3S2AA 3X3FL 4MBRA 3K72A 1AFVL 4JFZH 2E59A 3QQXA 2E7HA 1DBKL 4OW6A 3AADB 3RRQA 1R5IB 4H7VA 1AR2A 5AW3B 1CD9B 2E7BA 4ZUVA 4MRCA 3ARRA 2HRGA 3QIWD 4RQQA 3MRCA 1ZA3B 4KKAC 4G7QB 1CE1L 3ECQA 1ZANH 1B6UA 2GAZB 4FJ6A 4XMPL 4PGCA 3NSYA 4LEBA 3DO7A 4KV5F 4X5XB 2GT9B 2E7DA 1LK2B 2YQBA 1AR1C 3EJZD 3KXFA 4XNAA 5A7BA 2IV9A 3B43A 1SLVA 2QQLL 5DEFB 3SKNB 4DP0X 1VPOL 2HAZA 2JKTM 4ORGB 1UH2A 2DM4A 4RMSA 3TJEL 4NZFA 1E27B 1WT5C 2Q87A 3BKYH 2WAQA 3DTXA 1X5LA 2AEOA 3O6FD 2Q20A 1WHPA 2BSED 2VERA 4HAGA 2E0PA 5F93C 4NC1E 2GCYA 2HLFC 4DSYA 5E1IA 4MMYB 2NY5H 1KTLB 2QQNL 5FWRA 4LDCA 4NZTH 1EEZA 3SE8L 1I3UA 3IDGB 4HUMB 4ZUTA 1X5IA 1UENA 3SGDI 3WXVL 1ZLUH 4PWHA 4UNVA 1S9VB 2FO1A 3E6FB 1KBGH 4NNPH 1CFQA 2EYRA 5D4HA 1AKJA 3K71A 1MI5B 5I66A 1KTJA 3WIFA 1Q9WB 5IMOA 1GIGL 2I7OA 1AY1H 3IFLH 2AV1A 2PYEA 2X4RA 4FYSA 4X6DF 3UZVA 1URIA 1F3DJ 2VDML 1NH6A 3DYMA 3FSVA 3WNMA 2TRYA 4WV1B 5I2IB 4J3TA 1FO0A 2IXQB 3C5JA 5B38A 2IPKA 4UDUA 3EJZC 2XA8L 4TUJB 1IIIA 3CFBB 1VADA 2MH4A 4K7PL 4PGDA 2GSMB 2IAND 5EUKA 5HYEA 1GC1H 2VABA 3N6YA 2F53A 4KI5D 2VDRH 4M29A 5D9SA 4CVWA 2PCPA 3NCFB 2GQHA 4HXAH 2OSXA 4C83B 2CLVA 4XXDA 4MQ7B 4X5XA 4PJXF 4ISVA 1NCDL 4YR6A 4FAAB 3QCVH 4A7GA 4PW4A 2EE2A 2V3FA 4PS8A 4UQAA 1GVIA 5E6IA 1QW8A 1XEUA 1MAML 1O9VA 4TVUA 4UZGA 5DZPA 2WGXA 4CDHA 1PAZA 3G5YB 3L5XL 4OF0A 3OG6B 4S1RH 5AB9A 1XBDA 1XFPA 2MRYA 3DHJA 1AS8A 4CSTA 3RPIB 2PN5A 5SV3A 3S6CA 4OCLC 4Q0XH 2XI9A 1F4XL 4L1DA 4NT6B 2Q3ZA 1RZ7L 5GRUL 1IU1A 1DBJL 2IMNA 2FIKB 3TM6A 5F7NC 3ZHKA 1AH1A 2NX5E 2YWZA 5AW1B 4A7QA 5I1JH 1XSOA 2DKSA 1ETZB 2MKLC 3BE1H 5DEGB 3CDFA 4JDEA 1D2OA 1F41A 3QQ4B 1UA3A 5AOIA 5J8OA 1KFAL 4U0RB 4MDIA 1ZHBB 2YAQA 2YPVL 1JZ6A 4K5MA 1JPFB 3N85L 2X6UA 3CDZA 2H45A 4WTWA 1H8NA 1B6DA 3TIEA 2X87A 2Y23A 2EXYC 2UWEB 1SJEA 2X1QA 1MUJB 1IM3A 2IDSA 1ZT7A 3E8VA 1KXVC 4XP4L 4Q56A 4ZDHA 2IPUG 3CX2A 1YMMA 1N6QH 2NXZC 1A7NL 3OKYA 3NYKA 1PG7L 2WNWA 4G6MH 2IAMB 3L48A 5AB1A 5A2JH 1I1FA 1SDYA 4FE9A 4C83A 3NMEA 4X6FB 5CGTA 2XKNA 3A6BH 4I3RL 1XR8A 3WFHA 4H26B 43CAB 4YL4A 3VXSD 3Q8FA 4L0PB 4KVCH 3QC5X 3LN9A 4JO1L 2VOTA 4XN7A 1U8JB 3SPIA 1OAXL 2WXIA 3MJ9L 2J72A 4GH7B 4UV4H 1FYTB 4BZ2L 2ZCKH 2IXQA 3C5JB 1FO0B 4Y9CA 5C07E 5B38B 1SQ2N 2I85A 4JPIB 4UQCA 2FYVA 5K5YA 4WDIB 5GSVA 1CICC 1FIGL 1AXTH 3DMMB 1J9TA 4XMUA 5IROC 3TN0B 1T21A 1DJWA 2H3NB 2HT2C 2YQGA 4U3SB 2Z8RA 4ERSH 4PIBA 4MXWH 3TONA 3QJRB 3WIFB 1UB5A 4WI0B 1U91B 2WKOF 2YXFA 2H41A 4XN4A 4PLKC 3DBXB 1QI5A 2XPGA 5DSCA 3UC0L 3V5KB 2YWYA 1RFDL 3CX5J 5CINH 5KYWA 3RB7A 1J5CA 1Q94A 3CFUA 2IMMA 3MN8A 5BZZA 3G08A 4QMEA 2IBGA 1TQCB 3FCBA 4PRDA 5IJDC 4WTQA 2VC2H 4P46A 1H3XA 1CLVA 2ZSVB 4NAMA 2VN7A 3H7BB 2IH1A 1PLGL 3LNEA 3Q1EA 1DUZA 5LG6A 2PP7A 1RZFH 2A77H 2X3BA 4PB0L 4B41A 3DX9B 2FJUB 4PTUB 1ZGLP 4KO7A 1M42A 1MHCA 3RVWC 3UTSE 4W68A 4Y2DC 3AVEA 4RZKA 3HMWL 2QGBA 5A2LH 1MJJA 4NUGL 2LW3A 3LRKA 1JNNL 5FYLH 3F7YB 4I5BB 4Y2OB 3RZWA 3ZXAC 2Q76A 1EFXD 1I9JL 2FSEA 4N5UA 4QEGA 4MKMA 4AVIA 4MMXA 1CGXA 1DBKH 3QWNA 3MLXL 4KOCA 5IVXA 1AGFB 1V54B 3EOTL 2VDOH 4NP4L 4NO3A 4ODTL 1PFCA 4YIQA 2MPAH 3ZTNH 4KRPC 1JZ4A 1TYJA 3BPLC 5CAYB 5E5RB 2DS4A 5CIPA 1IM3D 3MX0B 4JG5A 1BZ9A 3FQUB 2BNRA 3MA7B 2LFGA 3NUKA 4W70A 1ED3A 3MCKB 1WFNA 2GJZA 5T1LA 5HDLA 3RNKB 3ET9F 2VLKA 5DJXA 2R1WA 1ZOXA 2A2QT 2CK0L 4N6RB 3QUGA 4HJEA 3ZBMA 4JFPA 2VMFA 2WUCL 5CUSL 3S0PA 1IJNA 1T6WA 2YC1B 4PRBA 1JI1A 2WTPA 4M9OA 4NHCL 1OE3A 4DP5X 3OGCB 3SQOL 3ORJA 1FFPA 3EDEA 3TX4A 1ID2A 1OP5K 4EQ3A 5MEOB 4BK8A 3NIFF 3L4VA 4CMMB 2WCSA 3OKEB 4C56E 1UD4A 4KKCD 3NIGF 4MB1A 3JWDH 1SLUA 4WWNA 3ZVVA 4DUXA 4TUKL 1ZJBA 2J8UB 4L8BB 4LOUD 1NGPL 3QHTC 1LYQA 4X8JB 5D1ZC 3IRCA 1AO7B 4M62H 1HAUA 4U05A 1MFBL 4I48B 2BSBA 2DQIL 3HOGA 1CGUA 4KY1L 1U2YA 2Q8BL 4F3FA 3IGUA 1WWBX 4PJ6A 4RMRA 2CNYA 3V0JA 5DMKB 1TZHB 2C26A 4IKLA 1F1GA 6TAAA 4XMXA 1WEJH 4J6RH 3GNMH 4OZHB 4LPYA 1MLCA 4TSCL 4QGTA 5I74C 2BY0A 3WJLC 3O9WB 3P11H 1BAWA 4M4RB 3HC3H 1OARL 2YMOA 1BXXA 5DMGD 4IRJA 1FYTE 4KQ3L 1HHHB 4U0RC 5HYJA 4NJAH 4F2FA 3H0TB 3RBSA 3EO9H 5I1LB 1FH5L 4OV5B 1CFVL 5FA3B 1AD0B 1IKNA 4L1BA 3V0HA 1IE5A 3V7AG 5IEHB 3L7FA 2HPTA 5IW1A 3SPVA 2YMXL 4JZJB 3KD4A 4PCKA 4LRIC 3RTQB 2HFFB 4ANKA 1JZJA 5ABAA 4FQPA 4GSDL 5DJDA 1U8OB 5EEVA 1WBZA 1H15A 4AGNA 4YLBA 2OJ1A 1PY4A 4N8VG 4G9DB 2IF7A 4X9BA 1H3TA 1LK3L 3N2JA 1RZIB 1IFGA 1A7RH 2X4OA 2OAAA 5MI0B 5CD5C 4LL9A 3D0AA 2A9NL 1EZLA 2AF2A 4ZUWA 2WXPA 1VGEH 3GK8L 1CBVL 3POCA 3W0WB 1SOQA 1AYOA 1PNDA 1JPSH 1UT1A 2D3JA 2DI8A 2OYLA 4PJIE 3ZSTA 1IGYA 1CDBA 1S3RA 3A4AA 3PNWB 5C09B 3ILPB 4HKJB 3NRQA 2HLFD 4GNKB 1Q1JH 1KN4L 2HG5A 5FHAH 2ICES 3LZNA 2VAJA 3HB3D 3U7YL 2HFFA 3RDJA 4XMVA 2AI0L 1OO2A 2VXUH 2P7TA 1KFAH 5SV4A 1CDUA 1JK9A 4PJHB 5D7LE 2YOAA 3MLUL 4P5TC 1KENH 3Q3GA 2FBJH 2DQFB 2EO9A 2OTUA 3ATFA 3M8OL 1YPZA 3O9WA 2IVFC 4JHWL 2A99A 2EH8L 3BQUD 1M57B 4XNQA 4Y2DB 5DJ6B 4YAQA 2NPLX 4ZFFB 2WQXA 3CSTA 3D48R 1C5BH 1N6QL 1A7OL 1KOAA 1L0PA 3BZFB 4PWIA 4AEIL 1A0QH 4LQFL 2A7BA 4NWTH 2Z93A 3U83A 3KLHC 1JUFB 5E8OA 4Y4FC 4JFDE 4PU2A 1DQKA 5BVPL 4GUPA 1IL1A 1IAII 1QFWM 2NSQA 4B3EA 2HTKC 4KNSA 1T3FB 3ZOAA 3RTQD 4GKZA 5G5DB 3Q0HA 1WP6A 4ZS6C 2MCPL 3UEQA 3K6SB 1IILE 3IF1A 4URKA 5IFAH 3WS3B 3OKEA 2AXFA 3VD7A 3MLTB 3GLAA 3MOAH 5EU6E 1EO5A 3T0XA 3L4CA 1CFNB 2WD0A 3NN8B 3KVDD 5I75B 5D7EA 3TEZA 1M3IA 3FYIB 5DVKA 2W60A 1YNTF 1HXMA 4PRAB 4KNQA 4FG0A 3QFGA 1T1WA 3TN0C 5D7JB 3RBGA 1PNCA 2ZOLA 3S4SG 2G5UA 2BSRA 4I2XE 2Y2WA 4GG6E 5CZXD 4F80A 2F61A 2AANA 5CLXA 3AUWB 4AQ8A 1YVLA 4KKRA 4CKVX 5FW7A 4F9PA 3IKCB 2WKGA 4DESA 4F2MB 2OI9C 4ODHH 3TH3T 4OCSH 4HCRL 4FXKA 3F62A 4R97C 2P5WA 4FXLA 3MJWA 4FZEH 4XHJD 4Y19B 5D1QA 5C8JA 4QD2E 4JM0A 4F5CA 2RTTA 5GZND 4AH2A 5HHOB 3EHBD 4NQVB 4YXHH 1G9ML 1TNNA 2W95A 5CSZB 4JKMA 1SDDA 2VISB 2P1YA 3V9FA 3NT0A 2GVYA 3EJQA 3HG1B 4FNLH 3T0EB 2R4SH 3ZDYF 2VJ0A 4Z7UE 5C7ZA 4D8PB 3WEMA 1MJJB 1X6LA 3FHQA 3T3MB 3BSZH 3VQ2C 1UZGA 3U2JA 4I0KA 4IJ3B 3NPSC 2ZOLB 3D30A 4KTEL 1U6AL 1CXFA 5J0BA 3RVUC 2R1YA 5EIVA 1E67A 5KSBA 5AOZA 2H1XA 4XC1H 5KVFH 4GRWF 2I60H 1YEHL 3GI9L 2OLDA 3JQOB 3FU9A 2X05A 2J55A 4DVBB 3E38A 2A6JB 3HHRB 3HI6H 3MLWH 1ZRUA 5ISZD 1CQYA 3QPQD 5DD0H 3B8SA 1A3LH 4G6JL 1UWEH 2GJJA 4JPVL 2ADJA 1L9QA 1BREA 1G84A 1OCWL 3Q7JA 1GMIA 4WWKD 1G9MC 1IGTB 3UO8B 3QXVA 2IANB 3ZKSD 1EBPA 3TXAA 2RJMA 5D1QC 3FO0H 4Z7VF 3ARUA 1FI8C 4JY5H 1MFAH 1U91A 1OM3H 1KEML 3UBXG 4GQQA 4YXKH 4F7CB 2ICCA 3O3AB 3QDAA 2PCXA 2H3NA 2BLFA 2IBBA 2O5NA 2BOCB 2G3XA 2Z0UA 4BQ9A 4DEWA 1HOCB 4PIRF 5C6TH 2ITDA 4N0FA 4YHML 5FR3A 2YPLD 2Z8VC 4KPHL 2EO7A 1SYVA 4JPIA 2OMWB 1BX2B 1NJ9B 3L4WA 1Z9MA 5E4OA 3QS3A 4X5WA 4QUOA 5DFTA 1ORQA 4H25B 4PREA 5E7BA 1WAAA 2KLRA 4JL1A 1J9RA 1T66C 3NAAL 4JCMA 4WLCA 3DX6A 3LKOA 5D5MB 1LO4L 2G3ZA 3OKDB 5TQ2H 3L17A 1MEXH 3FO9B 4X6FA 4GMTL 4F58H 1Z6JT 2XX1A 3FUFA 4IGBC 5LVEA 1I4FB 1SLXA 5TK4A 3DDGA 3MNDA 5MHSD 1FLRL 1OPOA 2HT4D 3EW3B 3DXAB 4OQTH 3C5ZA 1VEOA 3GIZH 2W1NA 3TYFA 1C5CL 4Q4IA 1ILUA 1AXSB 2M1KA 5E6IC 3T0WA 2BY1A 2ORBH 2P5EE 3L5HA 2AKRB 1KT2B 3J7HA 2H32B 2GG1A 3RIAF 5E51A 5CGBA 4WENB 1NDMA 4O2FA 4UCFA 2ZCZA 5TH2A 3BGFB 3RWHB 2X4OB 3VI3E 3ZK0A 1CD0A 2HJFA 1CE6B 1AGCA 2XHNA 3B9KD 3LKPB 1C9SA 3SBQA 3FN0L 5I75C 2EDHA 1FZKA 1MCFA 1A6VH 2DTML 2FNWA 1U8OA 1E2ZA 1SJHA 5ICZA 2FGWH 3T5WA 4NUJA 1K8DA 3QIBD 4OTXL 1MCPH 3WY1A 3OR7B 3WMSA 3KR3L 1P4BH 4IIQB 2CRZA 1MW0A 3I9GL 2X1OA 3QRGH 3V6OC 3HNVH 3CSYA 4DKTA 1EDYA 3FQXB 1FN4B 2X5PA 4Y4FB 5BZXA 3K6DA 5HYJB 1P53A 1QHOA 3BESR 2YQ3A 3OL2A 4NT6A 5DMGC 4YNYB 1T20B 1KWGA 3RX5A 3F84A 2J6EA 3KLAB 4UIMA 5D7KE 4B9GA 4ECNA 2FZ3A 3BW9B 3RDTD 5KSVB 3ARWA 1NAKH 5JHDB 3BGFC 4M5YL 3MACH 4R2GB 1OWWA 3ULVE 1TJIL 5JO5B 3VXNB 4GRLC 4I1RA 1P84K 1EHXA 4Z3GA 3RVXD 1ZA6B 2Y0SA 1D5IH 1MRCL 1NBCA 5E6IB 5I16B 1UEYA 2DJUA 2Z0BA 1YEEL 2YXVA 3GYRA 4LSVL 2XWZA 3UJTL 4DZBB 4PRID 1YY9C 4PR5A 2ZUYA 4Z3TA 3LRMA 4LSQH 3V6ZB 3EUUA 3EYQC 4P23B 4TVPE 3AWFA 1IBZA 5E4IA 8FABA 5F1IB 1YEKL 3RE0A 3STBA 2C1PB 4XR8C 2O30A 1KCSL 2NTFB 4PRHB 3UTSB 5HHPB 1JXJA 2V7HB 4X6CE 1K3IA 2NY4B 3I6LE 1BAGA 1L3NA 5MEOA 1U36A 5BOZG 5D7LD 5C97A 2VKWA 5MP6H 5D7IF 3ILDA 5HJGA 2AVGA 1YYLL 2QT6A 4G8GD 5F0LB 1ND0A 4LMQI 5HD8C 3IFNH 3QGVA 1NLDL 3Q13A 2PLTA 5HXMA 4L4TE 5BVJB 1MVUB 3GJEA 5E8PA 2GBAA 1QSED 1U8QB 1E9PB 2VDPH 4HFUH 4NYLA 1XAKA 2OMXA 4UQDA 2R2EB 4QHUA 4PLJC 1A0QL 3A0OA 4JFEE 3E1ZA 3VXPB 5C71A 1N5YH 4U6VL 4HWZA 4HX1A 3VFGH 3FO1B 1WSST 4PGBB 4GS7C 1BZ9B 2Y07L 3MNWA 5F21B 1UCBL 3E6FA 3UTPE 4Y5XA 2KH2B 3ULVL 1UZ6E 1XF3A 2GSIB 5KVDE 4LSSH 5GQBA 4KI1A 4XWGH 3FB5A 5I5JA 3RX9A 2CALA 4WUKH 2OMYB 2ZKYA 4AK2A 2AS5M 3SBWC 1CCZA 3GKWH 2CRMA 4J1UA 5EZIH 5I18L 4FYQA 5HHNA 2BWQA 2RQEA 4U2YA 1MCDA 5C0IA 3MRLA 3CPLA 3EGXB 3HN5A 3RWIA 4L8CB 4UTBL 2DLFL 4YX2L 4X7FC 5LDUA 4QHKI 1CDJA 4QXUL 2UVEA 2HKHH 2P8PB 3QIUB 4P2QE 5EHFA 2FVNA 2K9FB 4RAUB 5A40E 3UC2A 4M7ZC 1LTXA 2CA3A 5C0EA 1G9NL 1FCGA 3AT8A 2K3HA 1S7UA 2JE8A 4O9HH 2E4TA 2Z7UA 3CQFA 3LD8B 4IJ3C 3W2DH 3GGWB 5BOJA 3PQYA 3X12B 5D7IA 2DKMA 1K3ZA 4HLJA 3M7OA 4N3UA 4R7LA 1G5AA 5DRWA 5J06A 1TQTA 5B8CA 4WWKB 3DSNB 4M6NH 3SGDH 4RQQB 2EIKB 1WPCA 3L6FB 3MGTA 5A2FA 5TGBA 3EIFA 2MCAA 1PCSA 1AOHA 4HOMA 5LLIC 4HJJL 2VLRB 2CHZA 3DX8A 4WW2B 4PRNA 2OMYA 1CC3A 1DBAH 1U58A 4HS8L 5BQ7A 4P04A 4OGQC 1N6UA 4R97B 4OM0H 4MS6A 4Y5XC 4P4KB 2XWDA 4XCEA 2DYPB 2OI9B 4XCYB 4ZYKA 3US1A 4MQTB 3AY2A 3C5SA 2CDGB 4YDZA 4AG4H 4BFIA 1FG9C 4JDVB 3F7PC 4RMWA 5DDHA 2VE6A 3VXPA 1DVFC 5BO0D 4KITB 3M17B 2BZ7A 2RB8A 1H0DA 3IS0X 1ZLVH 2WBWB 4HGWA 4R0LB 4BK5C 4KXDA 4FFWC 3DMMA 1KCBA 2PYED 3ARED 1AD9A 1K5NA 2WUBH 2VMJA 4GP8B 4NRYB 6CGTA 3STLB 1MH5A 1IEAB 1I53A 1QR1B 2CIIB 5IQ7L 2BOBA 3NCCB 3QUML 2ZNXA 2DIBA 3FNKA 3FRPA 2D7QA 4S1DC 1TMQA 4ABQA 4HIJA 4ZFOL 1F4YH 5K9JH 4JHBA 2RA1A 2DQGL 2JJUA 1XGTA 3FZUD 4OCYL 1KXTB 1XWVA 4YDMA 3FHAA 3O8XB 1SNRA 3INUH 3MRFA 1TG8A 5B8CC 3IXAB 1WA1X 2WYIA 3EXJA 3HZYA 3LVTA 3X14A 5IIEA 1AZBA 1L0YA 5D1XB 3X3FH 1BHGA 4GT7A 5BZDA 1QLRB 3LRSA 1LO2H 3L3OB 5DC2A 1MCOH 3LEXA 4FLQA 1JZFA 2CE6A 4RBPK 4MA1B 3W81A 1LE9B 4GO6B 2F5AL 1Q9KA 4JLRB 3QPXL 4RDQG 1FYTD 3SIKA 4K9EC 1JL8A 3VFTB 1H3GA 4AVKA 4BCZA 4XMPH 4WKZA 3JZ7A 5KUKA 4G83A 4P9HH 1IO4C 3FJTA 3DARA 2BOBB 1HL8A 1XMEB 4UU9B 2YD8A 3CDZB 5K9KA 3CH1B 3OKKB 3C12A 3CMGA 1BD2B 5J6SA 2GHWB 3G9AB 1RZJC 3OWEA 4N2HA 2R9HD 5J6GB 1FBIL 5EF3A 4U4IA 2I25N 1ZS8B 5D7SH 3SE9L 2XXMB 2OW6A 3QA3B 1TQCC 4HKBB 2VDQB 4LRIA 5HYSG 4XXWA 3GRWL 3QJFA 1FZOB 4GSRA 4HKXB 3VGDA 4KKLC 3L81A 1HL9A 2BCMA 5ALCL 3E2HB 2J2ZB 5DUML 1KPRB 2J6EL 5EBMA 3SO5A 5BV7L 1ZTMA 1MHEA 2WBJB 1HZHL 5HGDB 5F9OH 1AGCB 5LN8A 2GC4C 4WI7A 5ILTL 4BCYA 1KBGL 3L9YA 1A21A 2BVTA 2QGCA 3FQWB 4JO4L 1H6EA 5GGQH 5C0AA 3RWDB 3U0PB 2JB6B 2R8SL 2VLRE 4XPBH 3FTUA 2OSYA 3OTTA 4MVBD 3LPWA 4P59H 4IHBA 1X5XA 3PPEA 1E9QA 2JK5B 2WCPA 5JIMA 3NEEA 3C6SB 3PHAA 3VYOA 1UHVA 3VNYA 3OPZH 3SYAA 4KI5F 4MGXA 1B0RB 8PAZA 4AIOA 3T65B 5F6IB 1IM9D 1OEZW 3RTQC 4U6YB 2WQAA 3PHOA 4L4VD 1KJ3L 3AREC 3IM1A 1ZTXL 3AQDA 2VLJA 4QJ3B 3RJOA 4JQXC 3B56A 3EG9B 3RWJB 2YPLE 1D5MB 1BYNA 2V17H 4IJTA 1XF5A 4HHGA 4JM4L 2NXZB 3FW6A 4HJUA 3KHQA 5IVXF 5T1DL 3PGCB 3RL2A 3RTLA 4A04A 2EDBA 4ELMB 4FKKA 5TDNB 2ENJA 1FORH 1NBZA 1WFUA 1IBDA 1D5IL 1JVOA 4NGHH 3AJ7A 1ZV5A 1AZZC 1TT6A 3JUYA 5I1AA 1KTCA 1ROWA 1Z9SA 2DWYA 1KIRA 3GS7A 3UP1A 3I9PA 5FPIA 3BD3A 3HHSA 4M61A 1T4KA 4X6BB 5IBLC 1RKRA 1URLA 1AJ7H 4L9DA 5CNHA 4QRBA 4UB0L 3V4PH 1S9VA 2AXJA 4KZEL 2A1WH 2G5BB 1D5ZB 5I5IA 2VL5B 1J10A 3GHBL 5DCCA 2X0WA 3C5XA 3EYVB 3GSNL 3PWVB 5ALBH 1GSKA 1XGRA 4HUWA 1GW6A 3ROLA 5CEZD 4X5RA 3DHMA 1RCYA 4F15B 5I1HH 4J5VA 2ZOUA 1MAKA 1L5GB 3F5WA 5C3LD 4PJFE 1Z32X 1CG9A 1E7VA 3O2DL 43C9A 4HKZB 4AUYA 2NNAA 2Z4QB 1I1CA 1KY7A 1BZ7A 3L4YA 3K2IA 4J8QA 2KMWA 4FEMA 2FHBA 1ZTXE 2DMHA 2CBTA 5GJSL 3VXSA 4R26L 2BC4A 2CLRA 3FAWA 5IK3A 3BGMB 3E6HA 4IMKC 2CBQA 3QUXA 3RFZA 4TRPL 5F88A 3LH2L 1AVAA 4Q9RL 1BMWA 5IUSA 4ZW7A 2GC7C 3W9DA 4WTXA 3FFCE 3FPXA 3ABGA 4IOSA 5CSZA 1SOSA 4MDJA 3WKYA 5DJ2A 2C8NA 4FXTA 1MDTA 5AL0A 1DCLA 2DQHH 4RESB 2OBGA 4LLQA 1HC1A 5EORH 4I18A 1KLGB 2E6QA 5HP5A 3FQXA 3NP3A 4H0IA 1BIIA 1WIPA 2BIIA 4JO5A 1N7MH 5IT2H 4RDQF 2DZEA 4Y8DC 3D33A 4KVCL 2VJXA 2JQZA 4UUJA 4ZI8A 3MV7B 4U31A 3U1SL 7FABL 3FCTB 4JKKA 1S7RA 3LMJH 4NRXA 3CZSA 4OQTA 1EH9A 5E9DB 2H8PA 1WBXA 2FJHA 3IGAA 3ZQWA 4GO9A 4NIKB 1RU9L 4QTIH 1OQOA 2CXKA 2V5RA 3LV3B 3FB7A 1BPLB 1RUPH 4IK7A 1ZLWH 1UWGH 4MD5A 2JJTA 2PWGA 2X4SB 4Z8FH 4AGOA 1KGXA 3UIZA 3NEXA 3Q01A 1MI5D 4DGYH 4JFVA 3UC0H 4JM2B 5JHBA 2EDDA 1OWRM 2G3NA 1A5FL 4MXVF 2XA3A 2CUAA 3SDCB 1E5UI 4JRXB 4MJJA 1KB3A 1XGPB 1G7IA 1R5VA 3MLVL 3UGEA 2V5SA 2DIEA 4WHYG 1EGJA 4N5ED 4FTVE 5F89A 3QZWA 4O2CA 3SDAB 3FQNA 3LN5A 3IFOA 4PD4K 2WXFA 2X2JA 4Z3FA 3OR6A 2VO5A 1YEWA 4MQXC 2D9CA 3V0VA 5CEXA 2WWKT 2YD9A 3VWJC 5BRZD 2Q2EB 4OKDA 5IBUB 2P47B 4PSRA 3VM5A 5I30L 1WZ1L 2DL2A 1Y18B 4IBQA 3VQ1C 4OJEH 3PIQA 1CYXA 3O3AA 4HKZA 4KRPD 1AIFA 1ACYH 2I26N 3DROA 4FERA 2NY6C 1OE1A 2RCSH 4EDXB 4YHZL 3D09A 3QXDA 4HIEA 1FAIL 1S7SB 3JVGC 3BMVA 2F53E 3S3SA 2XG5A 1IEBA 3EYVA 1MAMH 1QZNA 3TJHD 1JHLL 2FX9H 2YFNA 2VKXA 4Y9BA 1JPTL 2XG4A 1FG2A 5I6MA 5JHMA 3QUHA 1X7TA 2BS71 1QYGH 5I6KA 5DSCB 4LKXB 2XPGB 4JS7A 4Q2ZA 1J8HE 1I1YB 2PO6D 1T1XB 2CK0H 5EU7E 4LHQB 5L2KB 5E6SB 1LMKA 3JTSA 3S2CA 4YQXL 1DQTA 4I0CC 5GRUH 5I1AB 5EEWA 3GSRA 2CDFA 4IU3B 1KTDA 5EG6C 1H15B 3FFCB 2AJXH 1WFIA 2B1HL 1CGVA 3EGSB 2XICA 1NCAL 4UV7L 3MUJA 5I1DA 2GIYA 2AQQA 1TCMA 2PTTB 1WK0A 2YBRA 1FVCB 2Z1PA 3L4XA 1QBLH 4QOKA 2QL1A 2XOTA 4GSUA 1NFKA 2J20A 1UB6B 4MMZB 1ZXKA 4DZ8B 4X5PA 2EDQA 1ZLSH 1ORSB 5IHUH 5ACZB 3MBXL 3BQUB 1MFBH 4TF4A 1DSFH 5K9QG 4GRMA 1E5CA 3HFML 4JO8A 4NNYB 3SN6N 5KSUB 4F2MA 5K9OA 4KZCA 4XP5L 3ULUE 5ID0B 4FQHA 2V9QA 4OZHA 1TTGA 4ZO7A 2DB8A 1MCSA 4YOKA 2BXYA 4WWOA 4E42B 2BNQB 1WZLA 3OMZA 5BS0B 5IB3B 1QLEL 2EDXA 1T5XA 3GBMH 1V3LA 1J18A 2XLLA 4UTAA 4AXWB 4GAYB 5I8KL 4HUUA 3S37X 1GAFL 3GMQA 4WFHE 3FB7B 4KQ3H 3SDXE 1JN6A 4YSQA 5I17B 4G59C 3SEPA 4K8RD 5LXGL 2VDKH 1DLFH 5KTEH 2QVIA 4DP7X 1LXMA 3DKHA 2DAVA 2WLIB 5IQ9A 4HWBL 4IOFD 3WS6A 4BHUI 2OULB 5A2KH 4JDZB 4UZUA 4BSWA 4RWYL 4PRPA 4GO8A 4HLEA 3ZTEA 3PXLA 3K6SA 4PVBA 4XPGL 1N8ZB 2H0PA 3FUMA 4JEGB 5HHVL 3D1MC 2YUVA 5BMFL 4B9JA 1U92B 4FTVB 2QQKL 1K4CB 1U4FA 4RAHA 2ATKB 4F9LC 3OB0H 5JNYB 2W81C 3GSWB 5HI3C 2DD8L 5EULV 3WG7B 2OFQA 2VR7A 2BNRE 1H6UA 3RPIA 2HVJA 3ZTDC 3GSUA 1ED3B 1BJ1H 2AEPH 4BZ1L 3WTSA 2F0CA 4AC2A 1RURL 2K6YA 4WCYH 2XN9A 2GTZA 3P54A 4FQXC 4G8FA 4UQ9A 2O6FA 4RISL 3SKMA 1UH4A 2M2DA 3VCLB 1S2EA 1AKJD 4AWJC 3A3YB 2NY3D 1OPGH 4WW1A 2YD3A 3DETD 1A66A 5CEZE 1TTBA 4U6XB 2P5ED 2AQ3A 3CMOH 1GGBL 4MMXC 2W0FA 1A7QH 2IAAC 5E08H 4KKCC 4M7LT 3K2KA 4K94L 4K5OA 4OD1H 5LXVA 5C0FB 5IJKA 5KSAA 3O2VH 5IW6B 4BFKA 3Q8AA 4W93A 5FYLE 3FYEB 2CIIA 2CHNA 4Z7AA 5IGXL 4FQXD 1UXMA 3VFRB 4X6EA 4XE0A 4LKXA 4OIIL 5DT1L 2C9AA 4AX3A 3OF6A 1I7RB 4TNWK 1JTTA 1F58H 5KBKA 4NHUA 4OZIE 3PHQA 5F1SA 3BVXA 4AQ8C 1R17A 1WC7A 4DGIH 2JKXA 4UINL 2D31A 2OPCA 1H3UA 1JP5A 3PJSB 4JCWA 1JGVH 2CO7B 3OMNB 4N9GB 1S7XA 4M1GH 2H2SD 4O2EB 1MFEL 5GGTH 2D7MA 4NERA 2R4RL 3BQUC 3UAAA 2PO6A 3HW7A 3K2MC 5AZ2L 5D1ZA 4IQHA 5ANMA 3FB8B 4UBDD 2YK1H 3I3DA 4HJIA 4PVMA 5B1BB 1BP3B 3G6JE 3GI8L 3ME0B 2F8VA 3PLYA 1A4KA 2VLKD 4G7RB 2VN6A 5KVEL 1RZKL 1CXKA 3T8VA 4LEOA 3ZKMD 1G4MA 5J11B 1BEXA 1OE2A 1T04B 4PJXE 1CFMA 3QZNA 1AG0A 2YKLH 1XGPA 4AMKL 3K80A 1HEHC 4XBPB 2DLTA 2QR0B 1JV2A 1NOAA 3FT4B 2J4WL 3GC3A 1IKNC 1A64A 4UIKH 5HHOD 1PKQB 2HKFH 3MJGX 4JM2D 1HDMA 1A6AA 1XSKA 2K8MA 3B1UA 4MLIA 4KKQA 3QZBA 3CN1A 3ULVC 1FF5A 1K2DA 1SBSL 2QZ5A 1T03H 1U3HA 4G7YH 3OAZK 4N90E 4BM7A 3BSZL 5IKCA 2YPLB 3Q8CA 3GXUB 2J1XA 4A2MA 3NFPB 4X7SL 4XMLL 4KNTA 3V9EA 5IJBC 4WI2A 4ANXA 4IEFB 3ZHFA 5JHLH 3CLWA 4HVBA 2HFGH 1JGIA 3I2CH 5CP7A 3US9A 3WENA 1AI1L 3WNIA 1AP2A 1F4HA 4DCQB 4ES8A 5LBGA 1T5WA 4M6MH 4EZMA 3I50L 4S2SA 4BQ6A 3ZQXA 3L5IA 4XO3A 4FCAA 4NO2A 2UX7A 4A7VA 5E4EB 1EAQA 4FQ1H 3MREB 1YN6B 3C6LB 1AHMA 5A43C 4OLUH 4Y5VC 2P24A 4ELKA 3A4DA 2A9NH 1D6EB 5AEAA 1XIWC 2NW2A 4N2OA 5L6YH 5GS1B 3L3IA 4G9FB 2X70B 4B96A 3WGVB 4F8TA 1EHAA 4DZBA 2VDQL 3D4YA 5F88B 5KSBE 3VXRA 4LLWB 5EDSA 2WZPA 4ZX5A 2VW7A 3FCSB 3S98A 3BZ4A 1QFUL 4JGMA 5DHVA 5T3ZH 4EIGB 3O3UN 1MFNA 4XOEA 3KDMB 3D07A 2XQBH 4A2DA 3PWPD 1JV5B 2V8LA 1FPTH 1CUOA 3Q05A 1FGVH 3TZVC 1OGAE 2CK2A 2F7RA 1YEIL 3RWCB 1NCUA 3Q6FA 3TBBA 4OLXL 3UJIH 1VFAB 4NQDA 2F74B 4FCHA 3LY6A 4OIFA 4B95C 3UADA 2FLBT 3NAAH 5C07B 2AXWA 4K7FB 1JYXA 2ZCLH 3OB0K 5IHUL 3EOBB 1HKLH 1IBGH 2KPNA 3W82A 4QHNB 1G9NC 5BRZB 4FI8A 4DVRL 4YSDA 2ZUVA 3P0VH 3BO8B 1I82A 1FZKB 4K3EH 2ZX7A 2EADA 2IDTA 1TITA 3QULA 1MHHA 4E9SA 5IMOB 4PRNB 4LFHG 4NENB 4PWGA 4BWTA 5EOTA 1FRGH 3APDA 5G55A 2Z31D 1NDMB 4O2FB 4QRRE 1VB9A 3CFJB 1OV8A 2W65B 1BAFH 3MROA 3DSNA 3BIAX 4L3ED 3OXRA 3PGCA 4WAFA 3ROOB 3BC9A 4ZG1A 4UM8A 4KKZA 3N91A 4FFZA 2FLMA 4ALAL 4UQ3B 4XN5A 4K4KA 1H3PH 1U33A 4KTGA 2YRZA 1ZPLA 2B0SH 4LIQH 1KYAA 3OZLA 4N0UA 3I75B 3C8KA 5F96H 2FEEL 4POUB 2R1XB 5GXBB 1AC0A 5B38G 1PKQE 2XX0A 1JVLA 3ULUL 4PBWD 4I1NB 4LB8A 3RWIB 2K4WA 3EGXA 3KXFB 4QTFA 5F7WC 2UZXB 1ZLUK 1A4BA 3ZT7A 1IAIH 3MRIA 1R3JB 2EIEA 2OTWB 3EJYD 5L4FA 3LKSA 3OKNA 2CO6B 2ZNWA 3FKUS 5TD4A 3SKMB 3HG5A 2ZICA 5JXAH 3JV0A 4UOW0 5G4NA 4AITA 1TQWA 3T04D 3MROB 3CX5K 3TWYA 3VRJB 3KPSE 4HF5L 3QRLA 5I6XB 1IM3B 3BPCB 2UUDK 2WQSA 4B27A 3QZWG 4X4MA 1BECA 4KX8A 3STZA 3HE6D 3TCTA 1MRFH 4YHLH 2EYSA 3MO1B 1MHEB 5FK9A 3APNA 2SEBA 4TM9A 4NBYB 4M02A 1A3RH 3ZE2E 3SDDB 5C0BE 3W5MA 1K4CA 2EKSA 2Y5TB 1SHWA 4OCMC 3HB3B 1AAJA 2ZCHH 1N12A 3MNVA 3W37A 1AQKH 3V5DB 2OMZA 3BD5A 3KS0H 3QUYB 5EO1B 4L37A 1EGJL 1KJVB 4JDZA 3WXWH 1KYUA 3BAXA 1S9XB 2KHAA 1MQ8A 1R3IL 3TU6A 4H1LG 2V7NB 3BPOC 1YEFH 2G60L 2A6KA 3Q6FB 3OZ9L 3BSHA 5HHQB 1CLZL 1JN6B 2CO2A 5I17A 5KSBB 4BQBA 4AYID 1JF1B 4RBPH 4WEMB 2R0ZL 3ZE0E 4OJCA 5I6XC 1JCVA 4AXWA 4KVNL 4R9HA 5C70A 1DQJB 1TLKA 5J12B 5DS1A 1PZDA 1RJLA 5F7EL 2FQGA 3CCHA 5DD5L 2NOYA 4X6DE 2YBGA 2WIMA 4R7XA 3RGVD 4TSAL 3MRQA 1RJYA 4JQIA 5HDBB 4QPEA 2AJYH 4YXKL 5HGAA 3QUZD 1Q0YH 3C6LA 4MMZA 5IMKA 3U1PA 4J39A 4LFHD 1AANA 1N64H 4LGPB 5E2VH 4QXUH 1ZWIB 4IIQA 3ES6A 4H4NA 4QOKB 3AS0A 3DRTA 4P2QB 1UT2A 1YO4A 2GFBB 5DQJA 5IHZB 3VWJA 5EUOA 4WRLA 5MEPA 1P1ZA 1QHQA 5D96C 3EGSA 1LVEA 4ETQA 3WIHL 5IWLC 1JZGA 2C9SA 3TF4A 2EDKA 3S88L 2CGZA 2GITB 2XZAL 3SCMC 4IBTA 1Z0NA 3LNIA 25C8H 2NY7H 4MB3A 3AT9A 1N2RA 4N2MA 4TS6A 2X9WA 1EEUA 4FJYA 4HBQA 3IGLA 1LE5B 1GZHA 3D39B 1N59B 1LEKB 2PTVA 2H9GA 3UMTA 3GT6A 1ZIBA 1I1AC 3CFDA 1GKOA 4HMEA 4KOBA 5FO2A 4LLUB 5CR8A 1QVOB 2R2CA 2E3VA 4YK4B 4A2GA 2DICA 5CM1A 2HRPH 1OB1A 3QO0A 1HEJC 1TENA 4G7YL 4Z3HA 3CXHJ 4GIAA 3O6KH 1D3CA 3RNQB 3TNNB 3QXUA 1M05B 3OC5A 1LO5B 2QKSA 2B1AH 4HZ1A 4G5ZL 4YHIB 1B90A 4NQUA 3HBPA 4ODVH 4B5EA 5A2AA 3GIVA 3RIAK 4YAQB 1BJ8A 3DK2A 2EEDA 3DJSA 3QCTH 3OAYH 5I0DA 1G7LA 3D9AL 1KFGA 3UTTA 1BWMA 1JZ8A 2EH7L 1GOFA 4QWWD 2PR4L 4X4KA 3DI2B 3DIDA 1KBVA 5LBSH 4EJ1C 5B21A 1N8OE 5EBLB 3TO2B 1HWGB 4WWID 4ZMWA 2VQ4A 1T2JA 4OU3A 4R7NB 6FABH 2XDHA 2Y3NA 1TJIH 2ESVD 4R90H 4N0YL 3TNNA 1JPGA 1X6NA 4DKAA 2PCFB 4LXFA 1BW8A 1HN1A 2EAEA 4P2OD 4TLUA 5F7BA 4ZPVA 4OLZL 1UURA 1MFDL 4HMDA 1F97A 2AEQL 2WHVA 5DFWH 3DUUB 1RERA 5GS3A 4XVTH 1NLBL 2Z35B 4KTYA 1QUPA 4IKIA 1LEKA 5JW4R 1ERNA 4G8IB 3EH5B 1S9YB 1SHSA 2E6PA 4L1TA 4L8SC 3GJFH 3O3EA 1A47A 2V33A 5AVZB 1KCSH 4LP4A 2QV2A 4G9DA 2X89A 2ZYRA 4D0BB 1NOFA 1G1CA 4AENA 1GY1A 3IDJA 4WQOA 5EBGA 2GFBA 3IFNL 5FDWA 3QWOB 4DGWC 3I9AA 3QUYC 3HRZA 2WZ5A 4ZAKC 3X11B 1MY7A 1GPOH 4O02L 2DIAA 2VYRE 1I8UA 1EXUA 2EIJB 2EIMB 2Y6TE 3AREB 1TZIA 5JOFA 1QFWL 2W0KA 4QRQB 4MAUL 5AENA 4G8FB 1O0VA 1Y6KR 1M6OB 4NBZB 4P2OC 3F00A 1MLCB 1GGTA 2J25A 2KI6A 3R1GL 4B0MM 1IKFL 4GS7B 4WEEA 5AAMC 5JPNA 3E6HB 4MAYB 1CBJA 2FZ3B 3BW9A 4KHTH 3IVKB 1TO4A 4AVHA 2YGOA 1ZHNA 1QLEB 1DQJA 1KN2H 2L04A 2JKRM 3AG4B 3B3BA 4O5LH 3AB0C 4J23A 2ICWB 4PRIA 4NZJA 1C5DB 5IB2A 2W60B 1DQDL 3M7FB 1R5WA 1TFPA 1Y1DA 3VXUD 3HRZB 2V8MA 1AGEA 1RUAL 4MQXD 3GRGA 4PP1C 3RU8H 4O9HL 4E9YA 1XGQA 1CVRA 2COVD 4OB5H 1YMME 1KGCD 2X2IA 4RZCA 2OMZB 3QUYA 4YDNA 4KUZH 1M3JA 4L3CB 4N3TA 2EC9T 3ZMNA 3D25B 4L4JA 4NQEB 5AOKA 1Z9LA 4I8DA 1S5HA 4P46C 1T5XB 4PB9H 1L7TL 2I07B 4FL4B 3DUUA 4NNXA 1T4KB 2QPEB 4GT0A 3KBFA 1ZIAA 3D7PA 1S9WA 3T3PB 3NFNA 1X5JA 3I02B 4D7BA 3QFJA 1KSRA 5I15H 3H42L 5JQIB 1A3RL 2AK4A 5ABDE 5JW4N 5TE6L 5MEND 4IDJL 2PWDA 4JFUA 4R2GC 2BRRH 3X3GH 3QG7L 4TL5A 2A6DB 3KPQA 3BIKB 4H0HB 3AFLA 4WNQA 2L3BA 1FL6B 3BRDA 3OKDA 1HHGB 5FYJE 4MMXB 2WLZA 3L3OC 4YHPB 4O58H 3V4PA 1R3IH 4PBXA 1BQLL 1MPAL 4QIRA 1CN4A 4PJHA 4AMWA 3GSXA 3S5LG 2R27A 4JVPA 1UOLA 4PBDA 3LSOB 3MBEC 5DK2B 3T9WA 5I1DB 5AUMA 1JYVA 1P9MA 1CD1B 4XO4A 1HOCA 2VXQA 4BDVA 3T0EE 2F7IA 4QKTA 4QOKE 1KTDB 4ONFH 2FX8L 3GIVB 5IB4A 4ZS6D 2WBXA 4GXFA 1AGDA 4W4OA 1ET8A 4UM8B 3QFJB 1FJ1B 2VDNH 2E27H 1XB3A 1CF1A 3MBWA 3WAKA 3MU3A 4Z5RB 1OAUH 4FULA 3BUBA 3EBGA 4R0LC 3RGVC 3KVPA 2B14A 4F8LA 3EOTH 2GI7A 2O5XL 3BJ91 1OB1B 5GS1C 1XIWB 3GPEA 2AJUH 5IJVA 4H44C 1TVBA 3DJRA 4YC2B 1I7TB 2ZX9A 2WYHA 1WBZB 2IGFH 1XVSA 4FP8H 1QOKA 5DEZA 2EUWA 1SEQL 3HRPA 3IDXH 1XR9B 1DE4A 3Q44A 5SX4I 1QPKA 2Z92B 4V2BA 4YPGA 2ZF8A 2WXJA 5DJCA 5IBUG 2Z8WC 3WN5B 3ZUNC 3VW3H 3CBKB 4LDOB 3UTSD 5I1LA 5HYSA 1BD2A 4OJFH 1NKOA 3PAVA 2RFXA 4FMFA 3ARGB 3FCGA 3SE9H 5GGVL 5HYJD 3T6ZA 3WIIH 4NQXA 3PP3H 35C8H 1W0WA 2ED9A 3WTYA 3T0EA 1FYTA 4ELME 5HBBA 3DV6A 3JV5A 5DLML 2ZQKA 4PJIB 1CLYL 4DO5A 5E6ID 5KYXA 2F54B 1LE9A 5SX4H 3VFUB 4NZUH 3BEVB 3TA3D 3IETA 4XN1A 3SDCA 4ONHB 3EBIA 5AWNL 3UG4A 4DF9A 4OUUB 2IFFH 3FUNA 4LQ1A 4MNQD 1I1FB 2NSXA 1KGWA 3HE6C 3UZQA 2X9XA 2WTRA 5E94B 4G5ZH 3LNGA 4F8QA 4OFYD 5F44A 3VFOA 4GXUN 1RUQL 2AABH 3K3QA 3KPNA 5CWSA 3MREA 2LU7A 5DMYA 5CIPH 1CICA 3AC0A 4RA0C 2UY6A 3C6EA 1U8PA 2FSDA 5D7LB 3MTRA 5D7JA 3MRNB 5GZOA 3ZTJG 2CJUL 3BXNB 4D0BA 2IQAA 3OGCA 5FUOL 1KMGA 3CAFA 5HHQA 5FGBC 3CFEA 2DIJA 5TDPA 5IB5A 5BZWB 1ASPA 2W07A 3CVHL 3CQPA 4P2YA 5AALA 4G8IA 5E4AA 5DI8B 3T77B 3LKNA 2X12A 2H8PB 4TOYL 4AE1A 3MV8D 2NSMA 3AQXA 3LS5H 4U6TA 1VFBB 1W0VA 5AVRB 1N0XH 1FNLA 2JCCF 2PYFA 1XD0A 3MCKA 1X5GA 3MRRA 4MVBC 5FX3A 2Z1KA 4LVHC 3GMMB 1SJMA 4WI6A 3FQTA 2BJML 2QSCL 2MJWA 5H94A 2PWHA 5G4OA 5F0PB 3DV4B 2FX9L 1U58B 1MJUL 1CGSL 1TNMA 2NY6B 2FL5B 3MOBH 4LHUB 1N5AB 2Q5BA 2CGRH 3TASA 1KDJA 3HAEH 5ERWB 1BMZA 4WHYH 1PG7W 3PRZA 3NCEB 3VRJA 1OSPH 2FJGA 4R7DB 4PVNA 1DBML 5HY9B 3JVFC 3ZE2B 4H8VA 5IVXE 4TQEH 1DTUA 1IGIH 2Y36H 3T2NH 3BLPX 3FTWA 4ODUA 5E24E 2YARA 3FRUB 5B1JA 3P3YA 3MRPA 3P4LA 2AMGA 2FO4B 1CJYA 3Q3GB 5E5LA 1WBYB 3TBSB 1BCIA 2IOOA 3PCYA 3QUXC 5HI5D 1NMBH 1KXHA 1ZK9A 3L8QA 5E56A 1Q0EA 1VKXB 3P1VA 2TSAA 1LWRA 3MI6A 2JQMA 5KW9L 3P9LB 4UT6H 2Y69B 3N42F 3T0DA 4AW7A 1E4HA 3KGRA 2KUTA 3BIBX 4AIZB 2HG5B 5I19H 1ZLWK 3AZUA 4IOFC 4KC3B 4Z7WF 4FFTA 2FWOB 5DGRA 3EJRA 4KK9D 4JGNA 1YNTB 3N1GC 3PGFH 3EDFA 3NSJA 5EMYA 2IH3B 3VE0B 5I2IA 2D73A 4XE5B 4TRPH 4BV1A 3GWJA 1QVOA 1LL1A 1TEYA 3ETBJ 4XP5H 2KLTA 5F71A 4FKHA 2G5BA 2JKSA 4LPTA 4JPWL 3ECBB 5B7FA 3MGAA 2D3LA 5L8JB 2UY7A 4ZUWB 1I3GH 3PJSA 2OZ4H 1CU4H 3GTVA 2JI1A 3G6DL 3RAJL 5CJXA 3HMXH 5B39G 2DQHL 2NDGA 3KPRE 3QJSB 2RBLA 4V1DD 2Y22A 5FO9B 3L3HA 2VQ1B 1Z9OA 4M5TA 3MLPA 4U1HA 1HNGA 5HJBA 4A55A 2ZWYA 2WVTA 3TN0A 2PW2B 3NIFE 5BVJA 2A83A 1DLFL 5KTEL 1XF5B 1H6TA 4LSPL 5CJOH 1G1OA 5FECA 5J6HB 3DOSB 3VD1A 4GSXA 4RIRB 2I9LB 3KYMB 4QTIL 3VGEA 2COQA 2H6PA 2FYYA 3VD2A 1ECYA 4PYGA 5L2KD 3II1A 3K0WA 3QUZB 5EWIH 4FF9A 3ZE1B 3VI4F 4C54A 1HINL 4I1PA 1DVFD 1UXLA 1XTMA 3D69A 1LNUB 2WN2A 2QEJA 5IJKC 1UADC 2CLZB 2WLJA 1MLBA 3HFFA 5D72L 5LNGA 1JYNA 1EERB 3NZ8B 4OF7A 1HCVA 5EBWB 1BFTA 2WZPD 2NDFA 4UTCA 1TZHA 2NXYD 3D85D 5DMKA 4RA3A 3FHEA 1OP3K 1EUTA 3RIKA 3TFBA 1JGUH 1PFOA 1UQSB 3S8WA 2X70A 1X5YA 2XFGB 4LCWA 3VMPA 4ZS7L 1N5AA 1O5DT 3KJ6H 1J48A 4QRUB 2Z6FA 5DHEA 3TIEB 4DWHA 4AJWA 4E5XB 5KUMA 7PAZA 2C7FA 5I0YA 4J4PA 4PJ7A 1UACL 3EBHA 2VTFA 1YNLL 4EI5B 2G30A 2AVFA 3CMOL 1GGBH 4JZOB 3U2SA 1NKGA 2NT0A 1RD6A 1A65A 5C2UB 2VITB 3R7QA 5SWZD 3OLEA 1D5XB 1OAYL 2CU9A 1J1XH 5JOPE 3B5HA 4J6IA 2WWNA 4GKSB 4WUUA 3AGWA 1U93A 1E4KC 4RGMC 1F4WL 3KVQA 2O5ZL 3H3KA 1WTLA 1YJDH 2VH5H 5DRNB 4XT1C 2C3HA 2YD1A 4LVOC 4A7UA 3ULVF 2G75A 1HI6B 1N19A 4PJBA 1NWOA 4XB8A 5E0FA 3BXNA 5E5MB 1X44A 1OD9A 2MKWA 1A14L 2IOIA 1U3HB 4GFXA 4JG1H 2FR4B 4DGUA 2I7SA 4L5FH 2EDRA 5D6DC 5L4IA 5IFHL 5IESL 1E5YA 1I1AA 3KPLA 3TJPA 4I89A 4E41E 2BVOB 5AD0B 1HDMB 5KYUA 1QFPA 1MNUL 2MTAA 3LXAA 4PJBF 1J8RA 2CO4A 1OANA 4Q6IC 4XH2A 5A2CA 1W8OA 2WTRB 4R83A 3UZQB 4BELD 5L0QC 3FO0L 3MMEB 5I1GH 2CLVB 4R5XA 4XBEL 5GRJL 3HCVB 2VDLL 1OM3L 1MVFA 2H6UA 4JHZA 5KJRH 2C5DC 3WY3A 5C0CA 3P30L 3F6IA 2QTVA 3OKLA 4YDVA 5EOQH 2I27N 3AY4A 1KXTA 4A68A 1R3HB 1CXLA 3Q6GL 1SGKA 5AW4B 1GYAA 1Z9PA 1OSZA 2IC2A 5CEYB 1JTOA 2B7DT 2V5TA 3C8KB 3R4RA 3GI8H 1CYGA 2VSMB 1H8OA 4FX5A 3LTVA 1N9PA 3DOSA 3DX3A 5FECB 5J6HA 2B3IA 5LGHL 1SY6A 5I1KL 2ZP8A 4P05A 1QAWA 3ELQA 3VX0A 1K5NB 3LKRB 3IU4H 2BOCA 1HYSC 1WDAA 2XFXA 4W4NA 3PAUA 3BFQG 4QRSB 4OZGE 1XH3A 3MCYA 1H0DB 2YD0A 3BN3B 4XP1H 1MEXL 1GCYA 2PO6B 1ZLEA 3F58H 4JFFA 2V9RA 3V7AE 3D2UD 2DV6A 3G08B 5FGCB 4YGVA 3TBYB 3UCRA 1IAIM 5LQBL 1ZVHA 4PMFA 2OL3L 4TVPL 1YY9D 4XCEB 1TJHH 2NZIA 3P73A 1BVNT 3QFDA 2E9WA 4GIPD 4O2EA 4QRTA 5I8CB 2A4EA 4KROB 1D5RA 1A7BA 1DANT 3HS9A 3NABL 3TNMB 2NR6C 4U6HB 1QLEH 1KTRL 3U7WL 3WLWD 2LLNA 5ID1A 3FAXA 5EO0B 4KDVA 1H5BA 4NI3A 1DR9A 2R69L 4HEMA 2CSPA 3VXQA 2AQ2A 1ZSDA 1MSPA 1PS3A 1XDTT 2QPUA 3O6FA 5GJTH 4JJ5A 1GW0A 5D71H 3S48A 3DROB 3QDGE 3GGWA 4I4WA 3PQYD 1TLMA 3E1F1 1VKXA 5K93A 5HDQL 4XO5A 1AI1H 1CVSC 2X40A 3UO1H 3PWJA 5L88L 3C08L 3SE6A 3WJMA 2PNDA 4M6ML 3AT0A 3FONA 4MJIA 4PV8B 4HJ1A 4JL2A 3I9GH 5LCVH 1MN4A 3GRWA 4G6ML 3GUTA 4IBLT 4P5TB 4TULH 3VXRB 5C08A 4Z78B 4H8UA 2DLEA 1Y6MR 4JFQB 3EFFA 2XN9E 1DDTA 5AQ0A 2X6MA 1IGML 5C9JA 3U4EA 3US0A 5HYIA 3WIAA 4K9EH 1WFMA 4BFBD 2CBPA 1FLTX 3KYKH 3L16A 4AM0B 2LU4A 2N01B 3NH7L 5AOJA 5T1MA 2NRDA 3I02A 3S5LA 2PUQT 4X7CC 4W9LC 4ODWB 1P4UA 1TQSA 4XBMA 3WBDA 1FGVL 3RA7H 4KRMB 5D2LB 4YMPA 1I8MB 1ZT1B 1CXEA 1ZCRA 1BQUA 3K8KA 4S0HA 1D5BB 1YMMD 4NQQA 4XNZB 3HE7B 3WHXB 3Q2CA 3VFSA 1Q0XH 5C0CD 3EFDH 2CMRL 5DFVD 2X42A 4Q8BA 4ZNEE 3D06A 2GBVA 1JXFA 1HKLL 1IBGL 3T6XA 3LQAL 4PJ7B 4NRXB 4ZNCD 2C1PA 1OAQH 4M03A 5A3IC 3M6DA 3FS9A 3KCPB 1JWMB 3S37L 1UYWL 2XV2A 4NKDA 3QUKA 1TYRA 4DAGH 4Q9QH 1MCWM 5SX5H 4OUUA 5L0QB 5T3XE 2LABA 4YSAA 4PLKD 4LLQB 1PY0A 3E3QC 1WE5A 3NACH 1TPXC 4N2EA 4NEHB 3MRGB 4NRZA 1BVKB 2W0LA 3A22A 5DTFA 2IDFA 1M71B 1MFEH 2HXAA 1S7WA 5CU9A 4MJ2A 2OS7A 4LHUG 2O5YL 5E99L 3HA0A 4YVUA 2GJRA 2JNZA 1H3PL 3QFJD 5E1GA 1TPXB 2NY5C 4NAJA 1BVZA 2AAVA 5AZ2H 4YNYA 5FYLL 1RSFA 3UJJL 4DZ8A 5JMRA 4OLWH 3HJ0A 1VADB 1DJSA 1YDPA 2GBUA 3TO4B 5ANMB 5FFGA 5D1ZB 4KV5E 4KZDH 3QEQD 3PPSA 4OF3A 4PAZA 5DJCB 1FVCA 3WNKA 5FB8A 2APFA 1PEWA 5F9WB 1DQQB 5B7EA 2WAHA 4MSWB 5F1OB 2AV7A 3X1NA 3FT3B 1S7TA 4PP2B 4Z0XA 1IGCL 2X6BA 4MA7H 1BBDL 3OHMB 4PG9B 4U1MB 1D9KA 5DMJB 5DZAA 3WELA 2HYMA 1U2HA 4P8QA 4Y4KA 2PF6A 1TJXA 1E9OB 4PMEA 5I73B 4DNLA 5KAQF 4HIHA 3DVFA 5LGJA 3WJJA 5CUSH 3NJKA 4X50A 2C1OA 4S1RL 2MPVA 4QHLA 1TVDA 4J3WA 5LWYL 2MEJB 4MYWB 5HHMD 1E5AA 2MNWA 3GZPA 4RMTA 5GHWH 4JRYD 4DKEL 4ZFOB 3JV6B 2XQ0A 4XVUD 2YGPA 2WBJC 4JHAL 1IEBB 4XCFL 5IB4B 1KELH 4TQ8A 3IDIA 1J8HB 3AAZA 3BPLB 4ELMA 4EXKA 4JNXA 3Q5TA 3UYRH 2FUQA 3FU3A 3LJ3A 4FQCL 3DUSA 3DVNB 4FZ8H 3TO2A 3P9LA 4HD9A 5MHSE 5DMIH 5KJ7E 2CBOA 5HPMB 4W9ZA 4E41A 4KTDL 3LPPA 1WBYA 4U6YA 2XV3A 1WEJL 1SYVB 1KIQB 4KU1A 4W9JC 5DO8A 2OSWA 3WEBA 1FL5A 2H2PD 1RY7B 4H8WL 5B4MC 4M5ZH 4FGMA 4CBZA 3ABMB 4GRLB 1C12B 3KPOB 4NKIL 1PZBA 3SCMA 3JT0A 4B6ZA 1KYOJ 4MAYD 4YHIA 1VCAA 5CS7A 1CLOL 5EV7A 1A2YA 3J8F7 4NAQA 3N1FC 3PV6B 3QZLA 2YZ8A 3KLHD 1KNOB 4DOHB 1PAMA 1HX0A 3QDJE 1P2CA 4NWUL 1G9EA 3N50A 4POYA 5GGRY 4V1DB 3EGDA 5CLWA 1JGEA 3SOBH 4PJ7E 3BSZA 2CHXA 3NP4A 5HTSA 4KROC 2A6JA 3ZKXB 5IBTL 4YFLI 1PJ9A 1R3LB 1PL3A 4P57A 3X13B 3RY6A 4PS4H 1ONQA 5KS9E 3BCDA 2BSTB 2VLLA 2JKNA 4HSQA 1A7RL 4IU2A 4LCYB 4Z7UB 3C6LD 5E6UB 4P5RA 5DVOA 4FQJH 3UZEA 3GMQB 2F15A 4FA7B 5E0QA 1JK8B 4EXPX 4ZMXA 1MQKH 1KXVA 4G6KL 1I3RB 2TSBA 4UOW1 1VCBC 3QARA 4B9YA 1EJ6A 4JB9L 3VRIA 5DUMH 5CCHE 4P48A 5CINL 2Q3XA 3SKJH 5CD3B 1GZPB 5DD1L 1M6OA 3SYPA 3O0RL 5CKAA 5ILTH 1B4TA 4UQIM 3U4AA 2XKSA 1N68A 4CW1A 1CDIA 2VDKB 3UAJA 1LMIA 2UXVA 3JWNE 1NDTA 4P2RA 4W81A 4QYAA 3RQ3A 3L1OL 4KO6A 5HHXH 1HILA 2WLHA 3GBNL 3L3JB 1SY6H 1REIA 5EC2B 4OH2A 5EEZA 3QDGD 2BSRB 2IWGA 2J12B 4U1KB 4NN7B 3AW5A 3KGTA 5E5UB 5ABZA 3EBAA 2D0FA 2H0JA 4NCC2 4KK6C 2LR4A 1W6WA 1YAIA 3BT2H 3BLBA 3MRDB 3QIUC 4XMKH 1JNNH 1JDCA 5AVQB 5LBSL 1R6VA 5CP3A 4W6XB 2Q86B 3MLYH 3ZDWA 3WS3A 4GYBA 4U49A 1R3LA 4P57B 4DN3L 2X89D 3G04A 4L2YA 4YDKH 4WU5B 5HDBE 1VESA 2WOYA 4PRPE 4N0YH 4LCUB 2ZUTA 4PJ9A 3ZZLA 2VL5A 3BZEB 3MOAL 4B0MB 2NLJA 2BCKA 3KYKL 4KK5C 3RWFB 1C1EL 3NCYS 4P4KA 3MKKA 1J5IA 2Z93B 3KPSB 4QYOB 4TQIA 1FCCA 2VLRD 4G1EA 1EZVY 4NNXB 4YHOL 2CUMA 3SO3B 5J5EA 2EEBA 1IQWH 5IFJB 3B2UC 3FOMA 1NIDA 3NJJA 4FABH 5ENWA 3VXTA 4H2AA 4UILH 1QASA 1YEGL 3A67L 5HGGS 5GSRB 1BVNP 4OZHE 1HKFA 3FL7A 2HH0H 1Q9LB 2GSGA 2WC7A 3QZOA 4DEPC 4N2FA 2A0LD 4UOZA 3D0LB 4HU8A 3ENEA 3MAWA 4G3YL 4KAQL 4Y4HC 2OR8A 4YHPA 4FQIH 3TV3H 3FSOA 4Y7MA 1JZDC 3QUZC 1P7KA 1XR8B 2Y7LA 1R24B 3SBPA 2Q0ZX 5KS9A 5EU7C 1VLXA 3I75A 4FEIA 1QPXA 3ILPA 1HWHB 4HKJA 3UAJD 1NBQA 3FUHA 4HPOL 3QO0B 1WA0X 2B5IB 5D7KD 2G0KA 3FK3A 4DQOH 1RZKC 3WSQL 3UGXA 2XWEA 4AQZA 4PJ5B 5KBMA 1R9FA 1ZY9A 3H54A 12E8H 4NZTL 3SE8H 3V2AR 4X0KA 1IAMA 4YFLF 3WNPA 3S3PA 4AKOA 1XIWD 4WEBH 4QHKJ 4EVNA 1KIUA 1ES0B 2OMTA 1DSWA 5BS0D 5ICYB 3IJ7A 4UWQB 4LSRH 1IC4L 3BI9X 4YSEA 1NPJA 2AMUA 2OMXB 3ASNB 3VGAC 1N7ML 2L7UA 3MRHB 5T1KA 1F11A 4Z0XB 3QQ3A 3W38A 4GXVH 3IJSB 5L9DH 1BXUA 4N8CH 3ZKXC 2MTPA 1OOWA 3IDMA 4HC1A 3MODL 3QHZL 1T83C 2DQEH 5TE7H 4K7FA 2I5YL 4NN5B 2APWA 4D9RE 1QEWB 1E6OL 4EOWL 4FG4A 1KBKA 3WN6A 4O51B 4NBXB 2CR3A 4C4KT 3OMAB 4GBXD 1XGYL 4WFGE 1RJYB 1F6AA 2YEZA 1BG1A 2EE0A 1SMOA 5EU3B 2IQ9H 3FFCD 4HXAL 1JZ2A 4JFEB 2C4FT 3RGBA 3MRGA 5FUZH 1PMYA 4LLWA 5F3FA 4R6UA 3WI9A 4ONGH 4AEEA 1YQVL 2Y2YA 3A6OA 4E9QA 4FXGB 5MENB 3NEOA 5DZOA 4APQC 1QLRA 1Z5YD 3LRSB 1MCKA 4M7JH 5BZDB 5TQ0H 1COBA 2Z31A 1NPUA 2NW2B 4OVUA 1OAKL 1CI5A 1ETJA 1A1NA 3E9TA 2V5MA 3QAZB 2FWLB 3MUUA 2NUPA 4I77L 2OX5B 4GMTH 2ZUSA 3CXHK 4IW4C 4JFSA 4MJ6A 4ZUSB 4LK4A 2VXQL 4FG2A 1HNFA 2EP6A 1NFDF 2E47A 1PZSA 3KWUA 1MH5B 5EA0L 5EZOL 4NCC1 5FCUL 3GMRB 4PCTA 2FX8H 3BSGA 3DRQA 1HSAB 1Y0LB 3PXHA 2A6IA 2WNXA 1C7TA 2W0PA 4OZFG 1AY1L 2AXHA 1T22A 5INCA 1Z9SB 4AQOA 2HX9A 2ZG1A 4WU7B 3SE3C 4CUCA 5ITBL 1CFQB 3HN3A 5HVWA 3F12A 4HT1L 2Y7SA 2AKRA 4PBVC 4HQQL 3S35H 3PFQA 3SDAD 5DS2A 1BOYA 4PJ5A 4KZ0A 3P02A 4I3SH 3U4EB 2XWXA 4JJHA 2IGFL 4HHAA 3L45A 3UTQB 4JQVA 2JJSA 3N0PB 2P26A 4JKPL 3DX7B 4JHUA 5INDB 3ZDZF 2DMBA 4FTVD 5E1HB 5TGBB 3TBTA 3ZL4H 4BYHA 2VXTL 3QORA 3OZKA 2QVMA 2JLPA 3FOLB 5GRVL 4X8GA 2P46B 4Z7OE 3U36B 4Y4HD 5FYKH 2AJXL 4GW1B 3BJLA 5I74B 3CVBA 2BVEA 1CWVA 5B7MA 2Q7YA 4RVBA 4MQSB 3SBRA 3MRKA 3LZFL 4KX7A 4G5AA 3QI9D 4GLRH 2FO4A 4JE0A 4FADA 5JPNC 3ARGC 3QP3A 3T4AA 3O6FB 2ZTBA 1ZSDB 4OFYA 4CVUA 4P5MB 4DP1X 3TS8A 2NY0B 2VC2B 3FB8A 2Y1YA 3OF6D 3P9WB 5JOPD 2GTWB 4Z18A 3NZUA 4J1UB 4H88L 2XWTA 4LLVA 1GGCL 4LHUA 4QF1B 3C8HA 1OTTD 2IFFL 4IS6B 1GS7A 2IADB 4QYOA 3KPSA 4LSTL 3TFKC 3G7TA 3LQAC 1JNHA 1WH0A 3FQTB 5KSAD 4PY8J 4MJ5A 1FZOA 2D31B 2F7QA 2QSQA 1VFOA 4WI0A 2ED7A 2EIBA 3EOBA 3VGBA 3NCJL 4IBYA 5A7EA 1I7RA 4NN6B 4Y2NA 1T21B 3N85H 4RMBA 1KXQE 3OV6A 3CFKB 4M56A 5JORB 3RDTC 1W16A 1NBYA 4UZSA 1LP9A 2W07B 5BZWA 2I60L 1PGRB 3I3EA 5DQJB 3MV9E 2HJKA 2XWJA 4KMTL 4Z77A 3GDBA 1KACB 1EHLL 1M7XA 1YECH 2ZE0A 3LS5L 3VFTA 3HI6L 1VGKA 3L1GA 4LSSL 1W72B 2YXWA 1VIWA 3TT3L 5I8OL 2W9EH 4U1GB 4Y16B 3QIBC 2R0LH 1FFRA 4Z95H 4JRYA 2HTLC 5CWSB 3CSGA 4XPFH 3WL9A 4S1SH 3T4YB 2N4IA 3AXLB 1IAKB 2RQ8A 2K0RA 4NQCB 3FTXA 3C9NA 3ZDXF 3VH8B 3X14B 1EO8H 4M1DL 2CGRL 1A1MB 1TIUA 5IEKA 4X4XB 3KM2A 3T71A 1UM4L 5JPMA 2GTZB 5CEZL 1ZT7B 3WV0A 3VXNA 5JO5A 3IE4A 4GP4B 1F6AB 2B1OA 1RPKA 3LX9A 2P49B 3HLAB 1A6TB 2HJKB 3Q48A 2C3VA 5CZVL 3RWGA 4N2BA 2XWCA 2JKLA 3ZDXE 5LAPA 1JK8A 4X9FA 5M95B 1U93B 1KCUH 4PJXB 1WAPA 3CHRA 2AJVL 4NZ8A 3HNSH 3O6MH 4G8GB 3E7JA 4JDVA 3OJDA 5AW0B 3TIDA 1X4XA 3NIGE 1AR1D 1OGTB 1QFWI 1YCSA 3KM1A 3VI3A 3BH8B 5FHBH 4R5TA 3WSQH 2XXFA 2BZCA 1IC1A 3MVSA 1QRND 1U95B 4TXVB 1UM5L 1AZNA 2E76C 1ES0A 2OMTB 4QKXB 2PO6C 1I9IH 4I9WE 1U3HD 1BDYA 1UATA 2QR0A 4JX0A 2DI9A 2PTUA 2E5EA 3VFMB 3HPJB 3EYSH 3PGDA 4XOCA 1YMHB 4MAYC 4RWHA 2JLLA 5I73C 1ZEAL 1AGDB 1Z1WA 5K9JL 1RZJH 2YD4A 4NPYA 3GSQA 3FH8A 4LARH 4PUBH 2NY2C 4DW2L 1ADQH 5K9OB 2WQWA 3QEHB 2HG0A 4ESKA 3MLRH 5KS9B 2VDRL 1DQLH 1F18A 2VW6A 5GGSY 1CD1A 5SWZB 3UTTD 1NCBL 1BJ1J 2XA8H 5FM4A 1YPZB 2VABB 4E0RB 5F9WC 1QUNB 4YE0A 1E4WL 5KVMC 3P11L 3QJHB 4OJFL 1GSMA 4ZOCA 5EB9A 3A5VA 5C0IB 1XF1A 1FSKC 3K4AA 1BEYH 4PFEA 3MRMA 3B3IB 1XL6A 2F8OA 1HHGA 2LOEA 1QLFA 5DXWA 5C1MB 2DYRB 2MSPA 1KGIA 3FUEA 2HJLB 1XB6A 3UYOD 3VXTB 2CDFB 5LG1A 4X4ZA 2UYLB 2A74B 1SN0A 4AMKH 3CIQA 5F72S 1WC7B 4X8XA 3BKCL 1R3KB 3KPMB 2G2RA 4HYTB 3UG5A 4LVOB 1H9VA 2HP4A 4OCNC 4S0TD 1MZYA 3J07A 1PLCA 4OGZA 5I0XA 3KPSD 1QA9B 3V6FB 5BCAA 2AABL 4FFYA 4JBSA 3HC4H 3Q2VA 5BRZA 1XCXA 2W91A 2HX8A 3D12B 1JGDA 4PQXA 2DWDA 4P2CG 2LAAA 1S7SA 2VXSH 3L9RA 3GMNA 1XSJA 3SGEI 5B1KA 2AV7B 4IRSC 5DVLA 1MW1A 2G9HA 3I2CL 3RL1A 1PZAA 2Q8AH 4F7MB 4UAOB 1JWSA 4YWGL 3KPPA 4U1KA 1K5WA 2G3MA 2MQ3A 4OD3H 1NC4A 4L8DB 4IRJB 1J0ZA 3H55A 1IBBA 1HHIA 4FXGA 5MENA 3DVIA 3EJSA 3I50H 4J6RL 4WY7H 5E00B 3FO2B 1HIML 4HGMA 2H26B 3FRUA 2WLMA 3HVDA 4K71C 4Y9FA 3EO0B 3VWKC 5FLUA 3GXTA 4ZFGL 3QORD 4G1MB 1ZA6A 4OY9A 2YJQA 4AEHH 5KN5A 4NX0A 2Y7MA 2BSSB 2VISA 5C7XH 1SDDB 3U0WL 1TZ8A 3CGTA 4JFZL 5FW6A 3U0TB 1B2YA 2FEDC 2D0HA 1FH5H 3L2MA 5JOFB 3NJHA 4F3FB 5EO9A 3QRFM 5LAXA 1OP5H 5HDOA 3IBOA 4HZAA 5J9PB 4MD0B 1S7QB 5DHDA 2J8UA 2CR0A 4Z7OB 1NGYA 1M9SA 3IDMB 2XBTA 3N41B 4LPUA 5T1LD 1LDPL 1YY8A 2ZIDA 1NCCL 3IDJB 3LZFH 3L5WA 1AHWA 3MRJB 3BX7C 1QSFD 1UH3A 5I1KH 1XCQB 3FFOA 4QCIA 1NPNA 4PRAA 4JQIL 2WWMD 3CZNA 1MWAH 5GRXG 1SFHA 3LIZA 4HUCA 4YBHA 4ZTOL 2XCMC 3HBGA 1WFOA 3V4VB 2O93L 3H4HA 4YS4A 4KZEH 5ETUB 3ZKMC 1U8PB 2UY6B 3VXOB 3MJ7A 4JN2B 3GHBH 1MCCA 2AQPA 3E0GA 2KLSA 2OKMA 1NGYB 4WGVB 3THMH 2NYZA 1JGEB 4JPWH 5B39A 3EGDB 5JHDD 1F13A 1K72A 2X53A 4F9PC 3QO1B 2PXYA 4JR9L 3WUWA 3WEOA 1EJOL 1Q8MA 2NY1D 4MASA 5D2LE 3EADA 4FLRA 4G71B 5LBVA 1XEDA 4HJSA 3WDIA 1FGNH 4G8EA 3VB8A 1H3WM 5DRZA 3V95A 2HRLA 2J57A 3BWZA 3JTTB 5BOPA 4TKWA 1YPZE 5LGYA 4U7MA 1R34A 3GLZA 3RKDC 1BQHA 2B20A 5JW5A 1U8CA 2C4FU 1HJBC 2EXTA 1WICA 1OGAD 5J12C 2J8UE 1DJHA 2WBKA 4P3CL 4QRRA 4Q9RH 2ATPB 3ME0A 1KGJA 1PD0A 1OAJA 2C3XA 3BVTA 3QJVB 1HHIB 4NLAA 4BFJA 3WJMB 1SMDA 4OCYH 1NAMA 1SUHA 1I8KB 1LWJA 3QXAA 5DU7A 1BZ7B 1AQHA 4AL8L 2DQJL 2CDEB 3VSQA 2G9HB 2W94A 3FOMB 3MYZA 5IFJA 2IGLA 3K2UH 1A9VA 4G43A 1A1OB 1RL1A 4MCYB 4ICWA 4BZYA 2V2WB 3H7BA 5EPMA 3W9EB 4BSVA 5T1KD 5ADPL 1VEMA 3BHBA 4HBCH 4GAGL 1J8HA 1R75A 5FKPA 2ADFL 3UYPA 3I9IA 1GHFL 3DGGA 3QI9B 4U1SB 2IAMC 3MBED 4CAGA 2L8AA 2NR6D 4F7TA 5L7XH 4MNHB 3C60C 3EFOB 3S35X 4H8WC 2JJWA 1GGYA 3ZYOA 5IMMA 3V5KA 1FFQA 3O11A 4ZOEA 2VZUA 3WGUB 4AK1A 4CILA 3F83A 5EC1A 3RA7L 1UACH 2A74A 3N9GH 2JKJA 2UYLA 3WAJA 3PIQB 1ZS2A 1QR4A 1S6NA 3D3VA 3KWWA 5J11C 2EVGA 1I8KA 1D9KB 1JD9A 2FH8A 2JSFA 4M93B 4U1MA 5KSAB 4J27A 4N2KA 2VW4A 3LKRA 4RGMB 2WVSA 3F04A 1A7PH 1EBAA 5JXED 3BE1L 3FN9A 3GXFA 2IWEA 5FYKE 3O41B 5KZCB 1FVDA 2XT1B 3CBRA 5DWUH 2WWOA 1Z3RA 2DQIH 2BWIA 1LQBC 1BM3L 3SDYH 2VDPB 4WFGD 1YDPB 3TO4A 4HEME 5DJAA 3T1FA 5IR1A 1RZ8A 3S34L 1CI3M 2K6ZA 3FF8A 1OAZH 2R2BA 4Y19D 4XX5A 2AK1L 2KPWA 4WNQB 4J7RA 3LVEA 1AG6A 2WV3A 2OMUA 3BWAA 5FGCE 3HG4A 1IGFH 3CSFA 1QSZA 3VRLF 3ZU8A 4WVRA 3TWCH 1N4XL 1FZMB 3GHEH 5ITFB 1M71A 2R56H 3QJZA 5B39B 3GSUB 3B9KC 1TJMA 4FLSA 4G42A 5I30H 4LARL 4DW2H 3JUZA 3X2QB 2XY2A 1A3ZA 4PLOB 2YD7A 2QVTA 4BGDA 1X5ZA 5FUCC 1QD0A 3P69A 3V0GA 4UQ2B 4QDGA 4NOBA 4X8JA 4OVVA 4GAJH 4CSPA 2P5EA 4JPKH 4NJAL 1OAXH 1JPFA 4XPAH 4LCYA 5J89A 2A4CA 4LPVA 5FOJA 2B08A 1BEYL 1NGZB 2YAEA 3U4BL 3QJFB 4JDEB 4XAWH 3LQZA 1T7YA 3OJDB 1RPUA 2UZPA 4YC2C 3MV7A 5BNXD 2F58H 1IZKA 4K8RH 1L9SA 1IL1B 4GBXB 1HE7A 3D0VA 4JZOA 3U2SB 1KLGA 2SEBB 25C8L 2KQNA 3L2NA 3LAFA 4YQXH 5FK9B 4B53A 5D2NB 3QZPA 4G42B 2Y24A 1RIHL 2VLKB 1CF8L 1JTPA 1CBVH 5T1MB 2DDQL 3V5HB 4LLMA 2X09A 3MJ8B 1HHKA 2YMTA 4ZFFA 4GRLA 1IC0A 3MLSL 1FL3B 5A2BA 3HC0A 3PL6B 4X9IA 1CFSA 3OG4B 4ZFZA 1B9ZA 4XCFH 3VB9A 5JQ6H 1WZAA 2X38A 4FOMA 2O6EA 3BWUC 5D1QD 5FYJH 1Q1JL 1DZ0A 2QJDA 1YN7A 2QQQA 3AREA 3OB8A 4LSVH 2FHFA 2MOVA 3KPPB 4ZMQA 1JWSB 3U7YH 1JK9B 4MKTA 1NUNB 2B9BA 3S97C 1SXBA 1BFVH 1XX9C 3BUPA 5I1CL 5A6LA 1CG9B 5DVMA 3QPQC 4U3CA 43C9B 5HI4D 4QRPB 3BN9C 4RGOL 2FB4L 5EUKB 2P3YA 2DQUL 1CL7L 1W72A 3F8UB 3C08H 3EXLA 5F7YC 4OFKA 2W92A 4XNYL 3ARDC 3BUYB 5ADOL 1HHJB 2WINB 4HV8B 1JWUB 4OM1L 2XWJB 4MZ3A 5ANHA 4ELDA 1S46A 3KGUA 4JJ5B 4W9FC 2QHRH 2XY1A 2ZX6A 1NLDH 1E90A 3IRZA 4N26A 2AJ3A 4P46B 4X6BA 1UA6L 4RMUA 2F18A 1KLUA 3FN0H 5E23A 3ZE1F 5ID1B 4R4FL 3COOA 4XX1E 1RZIA 5D55A 4D0DB 3MOQA 3VFGL 2WQVA 1M56B 1N26A 1CZ8H 2ARWA 4H13C 2FBRA 3OAUL 5E8DL 5GRWA 4YFEA 3CDCA 3RVVD 2CGYA 3DX8B 4JZJA 4WW2A 1LD9A 1UVQA 4D7PA 5CR1A 2W9DH 1RZQA 2GTWA 4XWGL 1SUJA 3EUDA 2ERJB 1Q1PA 4CC4C 5C07A 2XFXB 2Z3FA 3VD0A 3NSCA 4OGXH 2FUTA 2ZJSH 4LSUH 4FQJL 1F1DA 5L2JA 5DR5H 5EF2A 1S5IH 3NK3A 4KKPA 1W8EA 1WWCA 3DX1A 3MV11 5FFOA 3AS3A 2JH2A 4OCSL 2OMNA 4HS3A 2BY2A 3IAGC 2JWYA 3OQRA 2BK8A 2JK5A 1E9QB 2JB5H 3KDMA 4PD4J 2JCCA 1MCRA 3H9SA 2MQ0A 3JSSA 4J28A 4PJ8C 4ODUB 4G8EB 3GHPA 4CU6A 3DO4A 1LO5A 1DDHA 2X7LA 4A67A 1VPOH 4OF6A 3MRLB 4LCWD 1GTFA 2NY2D 2H4EA 4HIIB 2K3TA 4Z7QF 5INDA 4Z7NB 3DX7A 5IV2B 2IAMA 2FATH 5DZ9A 2XPZA 3DXAD 2VR5A 4XH2B 1ZT4A 4AGMA 1E6JL 3FB5B 4Z0BH 3M1BB 4XCNA 1TYEB 5DVPA 1EMTH 2NW3A 1EX0A 2CPCA 3QDMA 4U3XA 4DKFH 4OI8A 2M26A 3HJEA 3AXHA 5IUCA 4CVZB 5KG9A 2WXRA 4WU7A 5KVFL 2O61B 2CPUA 4N2LA 4J3OF 4AY0A 4Y1TA 4KKNA 1ZS8A 1U41A 1NFDA 1QW9A 1U6AH 2G5RA 3PWNB 4L8SB 4BK5A 3RHWF 3SKOB 5CN1A 4AL8H 2NX5A 5EDXA 5E2JA 4P9ML 1KDIA 1DYZA 4L5FE 3QVAA 3QPKA 1T0OA 1GCFA 3GI9H 1J05B 2HB0A 1RUAH 2MHAA 2XRAH 3NJXA 4ODWA 3WN5C </