1S7QB

Crystal structures of the murine class i major histocompatibility complex h-2kb in complex with lcmv-derived gp33 index peptide and three of its escape variants
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of structural principles underlying three different modes of lymphocytic choriomeningitis virus escape from CTL recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
total genus 12
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s7qB00
4MAUH 2P47B 1T03L 2DQEH 2O61A 1V7NL 1XZ0B 1UXWA 3FCTA 3HTLX 1G9MC 4BKLA 4K9EC 3GSUA 3VFPB 1WVZA 3BPNB 4IRJD 1U8JA 1JHTA 5GGUA 4FXKB 5IBUB 2XXCB 5FGCE 3ZKXB 4TOYL 5JHLH 4PLOB 2F19H 5HI3D 3D39E 1AGBA 1PG7L 3MYJA 1KB5B 3W9DB 2MQCA 2PUQT 2HT2C 5F1NA 5JOFA 5C0CB 5B4MD 1U8IA 2Y72A 5EG6C 2QL1A 4G8FB 5T1LA 3GMPB 5JA8B 4XBGA 1B0GA 1YPZB 3HI6L 2ZUSA 2R2HB 5FCUL 4S10A 5E7BA 4MA7H 2BSRA 2YBRB 4HIXH 3AFLA 2NY4D 2IQAA 5DJXB 4YXLL 1X5LA 3MZTA 4CNIB 1SVCP 4MNQB 4HW6A 1DBKL 2QQNL 5BZWA 3S97C 5E1HB 1A47A 3OR7B 5E8PB 3TO4D 3GHBH 1RIHL 3FO9A 2VZ3A 2R2EA 5ISZE 4TRPL 5EBMB 4NO3A 3BP7A 3RIAK 3S4SB 4U1SA 4QRRE 1RHHB 3WEXA 3OJDA 1R3IL 5FO7A 4U1NA 2OP4H 3B6SA 1GZQB 5IGXL 3CFDB 1K8IB 1IQWL 1NMCB 2ADJB 3P4OA 4MJ6B 4XAKE 4Z5RA 1QBLH 3HE6D 1X7QA 4JN1L 4FQ1L 1OAKH 2HKHL 4JO3H 4AH2B 2AQ2A 1QR1B 5DRZB 2CUIA 2FNBA 4PJ5B 5EBWA 5EU5B 3L95B 1P7QB 1CDHA 5DMGC 3UO1H 1CFTB 4C83B 1NMCC 1CLZL 4HZLA 4I0PD 3DVGA 5DK0B 3I9GL 2BXYA 2XZCH 1ZANH 3MUY1 5DC9B 3T4YB 4TSAL 4IOFD 3MRFA 4FFVD 3JTSA 3LKOA 2AV1B 4HFUH 1MCIA 4RA0C 2EKSA 3CK0L 4MAYC 1V5JA 2A38A 3BT2L 3FFDB 4HUXA 2EDLA 1EFXA 1E28B 2X9YA 3QZWB 4YGVA 4X4YB 4LSUH 43C9A 1EFXD 4LVNC 5CCKH 4OZIA 5C6WH 3KYOA 5FYLE 1OT1A 1DR9A 2OZ4A 4QGYA 1PZ5A 4GRMA 2P8MA 4HKXB 2J8OA 5C9JA 5T1DH 3SDDA 3BD4A 1GOGA 2QEJA 4M48H 1TQCB 4X5WB 4HEPG 4OCYL 3GI9L 3C5ZB 3U9UB 5IR1A 4LEOA 3OXRA 2JF1A 4XC3L 3OBAA 2JCCF 5JDJA 3LKQA 4WW2A 3VWJD 3FHAA 1FO0A 2CKNA 3LKNB 1JPTH 4U1LB 3QUML 4BH7A 1S5IH 5J57B 4JZJA 3RRQA 1L7IL 3ULVL 1VPOL 5GJSL 3C08L 2VLJD 3EFFB 5ALCL 3VH8A 2QSCH 3NVQA 2IH3A 4H88H 4U1IA 4DVRH 2QADC 3UPRA 3QNYB 3HC3L 4KKCD 4XCFL 1C12A 1JGUH 5DGRA 4K94L 1NLDL 1ZWIB 3DHMA 5FKAB 5DJZA 2ADFH 3LAFA 4QTHA 4PRHB 2VL5A 3REVB 2DI8A 3MJ6A 3LRGA 3U4EB 1BECA 3G6AB 4RISH 3SDAA 4F57H 5IMLA 2OBGA 2IAMB 3A6CH 3RY6A 4Z7NF 4ODVH 3GIZL 1K5NB 1FH5H 2W60A 4XBGB 5GQBA 4IIQC 4WWID 1MCNA 3DUSB 4P46D 2BNRA 3DROB 2P4AB 3MLXL 3MV7B 2ZKHH 1LEGA 1S5IL 5CP7A 4A6YA 5M94B 4LVHC 1H3PL 4EBQH 3EHBC 1W2KT 2Y36H 2ZUXA 4FZEH 3TV3H 1MCOH 3QHFH 2AABH 5FUCC 3ULSB 4C4KO 5DMKB 2OZ4H 2EDKA 3ISWA 1MRDH 4NC1E 1P4BL 4D9RE 2BFVL 4OGXL 4XHQA 1DVFA 5T1LD 5D7LE 2GTZA 4XH2B 5HGBB 1VENA 1NGZA 2X7LB 3MFFA 4LLWA 1HDMB 4BK4A 2ZG3A 4LVHB 4Y2DD 2W65A 1E0OB 5CEXB 5CZXD 5EWIH 4LLAA 4NQUA 4IDJL 3IXAB 2A73B 5EO0B 1L0YA 1J10A 1FN4A 1KCLA 3NFSH 4JRXE 2WP3O 2AS5M 1PG7W 4WFEE 1JZ5A 4XWOC 3V8CA 4J3XA 1GXEA 2FHFA 2DMBA 1FZJB 3RHWK 3WHXA 3DETC 3PJSA 4P59H 4PRNB 1OTUD 4GSDL 4G8EB 3I9GH 3BSZH 3O6ML 4UIMA 4R6UA 4N0CD 2MSPA 3CSYA 3LZFL 3L5XH 1NJ9B 5F9DC 1CE6B 3UO1L 2I24N 2XWBA 2ZOKA 4HK0B 5HI4C 1FFPA 4QF1A 43CAB 3RU8H 3ARXA 2MQ0A 1W8OA 1INDH 4ERSL 3P9LA 3DVGB 5DK0A 4S2SB 1FRGL 3H9ZA 3BQUB 3QSKB 3DIFA 4JDTL 4PJCB 1JP5A 4QHUA 3RI5F 5GS2D 4E42A 3WFCL 4Y16B 2NX5A 1CQKA 3KDMA 1KCSL 5HHPB 1JZ2A 5IF0A 1N0LA 3MLYL 4U6HB 4KC3B 4QXUH 3G04B 2DI9A 4P2OC 3MYZA 4KVNH 4NM4L 3LD8C 2J8UF 4ODHH 2VKWA 3FRPA 1JK8B 3MV7D 4POUB 1NMAH 2B1AH 2AQ3A 1NDMA 1S7VB 1CT8B 3HNTH 5T3XE 5JHDD 3RNQB 5CJQL 2L4OA 3FZUD 3P40A 4XP4L 3HC0A 1RZKH 4UT9H 1KJMA 1AGDB 1JCKA 2X89A 1FLRL 3SGJA 1Q94A 3AY4A 4OCMC 2QQKH 3FN3A 1OGTB 2VLRA 5KS9B 2F74A 3RJDA 3FB6A 3R8QA 5CWSB 3S7GA 3MXVL 4KK9D 3ZE2E 1WTLA 4Q7DA 1PEZA 2ARJQ 5E9DA 4HZLB 3MRRA 3NTCL 2VIRB 3WXWH 1NSNL 1TMCB 2P8MB 1C5BL 1RZGA 4HKXA 1JZ3A 4EUPB 1GAFL 2F58H 1MJ8L 4ODWA 4NN5C 4G6MH 3MGAA 3STLB 3RIFK 4OJFL 2A74A 1JPGA 1XF5B 3MA7A 3PHSA 1UEMA 2R0KH 4JHWL 4QRRD 5IW1B 1FZMA 1PKQA 3RUGA 5D5MA 1OL0A 1M7DB 2RR3A 3IVKA 3NAAH 5LAXB 1SY6A 4FQJH 3L5HA 5C6TL 4XWGL 2XTJC 1B3JA 2GY7B 4KTEH 4RAUB 4U1KB 5SWSD 5E56A 3EHBD 4HIXL 4FXKA 3WNPA 4WIQA 3F7VB 3TIDA 1UG9A 5FYJH 1ACZA 5GRVL 1IFHH 1NEZB 5C07A 1UB6A 3GSNH 5C0AB 3LVEA 3BOVA 1A3LH 3VRJA 1HKLL 1T4KB 3CU1A 1WEJL 2QSCL 5DMKA 3ULSA 3FOMB 3WNMA 3SCMA 4JO4H 1JNHA 3D3VB 3B9KC 5DVNA 5B39A 1KNOB 1ZA6A 4UT6L 4UOJA 3MV9D 1LE5A 4TOYH 2AV7A 4M4PA 5DHYB 4QXUL 5E6IC 4GRLD 3MFFB 3EYUH 5DI8A 2W65B 2X4RA 4UAOB 2HT4C 4R96A 3G6DH 1A9EB 3HAEH 3P0GB 4GRLA 4QOKE 3QEQB 4YFLF 2APFA 1IC7H 2VL5B 3MBED 4WFGD 4HGKC 3CMOH 2F8OA 3ZTNL 1V3JA 1FNFA 5E2UL 4KZDH 3WIFA 3ARFB 3BP7B 3D85B 2XOTA 1I3RB 2YSSB 5AUMA 2FEDC 3L95A 3DVFA 1OP3H 5EO1A 3UC0H 3TESA 5CAYB 2CUHA 1ZKAA 2AJVL 2VRAA 5D1ZC 5ID0B 1OTTD 4ZUSA 3CGTA 3CVHH 2V9QA 4J4PC 5IWLA 2BCKA 2E7HA 3ULUD 5DEFB 1IBGH 2NTFB 3U6RB 4HJ0C 4LK4A 1OLZA 1WZLA 3O8XA 2V2WB 2DD8L 5M7QA 5E99L 4G9FB 4E5XB 1SM3H 3TO4B 3BAEH 4PJXA 3NIGF 1Y18B 2AXGB 3T2QA 5TFSH 2ICES 3CCHA 5L2KB 4XPAL 4X4YA 3C60D 5IVXB 4ZPTA 4RMTA 1TTFA 3Q1SH 4LCYA 4UQ2B 4XMLL 5CHNB 2E6PA 2EDXA 3ZE0F 2NCMA 4RQQA 5IB3B 1BM3L 1G7MB 1P53A 3LN4A 3S36H 3JTSB 1ZTXH 3HFML 4JFFE 3ZKXC 3JWDC 5CBAB 4E41E 2JIXD 1ZVSA 3VXMB 2Y4SA 4HWBA 4RGMC 5TE4H 5C86A 2ADIA 2ZCKH 4QF1B 1MHPL 1ONQB 1QLFB 2I25N 5HYFA 2ED9A 5L8KB 3RWJB 3MRGA 1RK1B 4XVUC 1A6ZA 3MLZH 4Q6IB 4U4BA 5DVKA 4CDHA 1FO0B 4N5EC 5F96H 1QFOA 1RSFA 4AG4H 3BP6B 5MEPB 1LO3L 2IADA 1UVQB 5DJ2B 5JORA 1VFAB 1FNSH 5ELIA 5DMYA 4XNQA 2QR0A 1NSNH 3HAEA 1F4HA 3EOBB 4FS0A 4X99B 4DW2L 5LGHL 4HUUB 4QEGA 2EIZB 4AJ0A 1TZHB 5JUEL 3FO1A 4LEXH 1MFDH 1LO0H 5DFWH 1JGLL 3BPLC 3X12B 3U9PL 1CBVH 3DMMD 4DCQA 1J1PL 4GW5A 4PY8I 3ZHLA 1BLNB 4CDGC 3B3IB 1GGBL 3V6OA 1S9VB 5C07E 2K7QA 3I85A 2NR6C 2HKFL 2IANE 1T04B 3T0ED 5IW1A 5ESAA 4WDIB 2XZQH 4U7MA 4HBCH 2NX5D 5BCAA 4IMLB 2W1NA 5F71A 3WJLC 4Z7VB 4L3EA 5KSBB 1UB5B 4X80H 3V4PL 3N0PB 4JPWH 4U1KA 3U0PB 5F70A 1YN7A 2IFFH 3HG1E 2A83A 4QO1A 4KK8C 1LEGB 2Z92B 2WBKA 2XN9A 3O3DA 4WGVB 3H0TA 3EYSH 3T2PA 3ARWA 1Q9KA 5MEOB 1EBPA 2FJGB 3AS0A 3IETA 4PRPE 1H15A 5FYLD 5I75B 1A6PA 1YNLH 4FQLH 2NY1C 2KBGA 2D7TL 3ARPA 3VXTB 5I8KL 1A2YB 3E2HC 5DQDL 5C0BA 5EA0L 5HHMB 3SCMB 1H3VA 1S7UB 3RGVC 4NZRH 5HHNA 5HGAA 1Z3GH 4JKWA 2YC1B 1MEXH 2L7JA 1JYNA 3EYUL 1GGIL 5CJXA 2DQCL 3RVTC 4WTXA 1P7KB 1U3HB 5IJKA 1WITA 1BF8A 4HH8A 4PP1C 4NO2A 4WW1B 3NCJL 4NNPH 2LAAA 1XH3B 5D96C 1U8NB 4MA3A 4LVOC 3WS3B 1IEHA 2ZUYA 2B1HL 1KTLA 1OT2A 1WZ1L 1ZHBA 3GNML 4HV8A 3RVWC 5GIRB 4HPYH 3V0AC 4S1SL 4LQ1A 3AREB 2OSLB 1LEKA 4CW1B 3G5XA 4M5ZH 3VFWB 3B5HA 4ODXA 1FAIH 3ARGC 3MOBL 4Y19B 3RL2A 1J9CT 4PJFF 3QXUA 5DVOA 3C5JB 4C58B 5LKNA 1VEOA 1IM9A 3QCUH 1N5YL 5DSCB 4NC1C 1KSRA 3C6LD 2AJZA 5GXBB 4P2QB 3SQOL 1XAUA 3VXOA 2AJYL 3LQMA 2BZDA 5F9AC 2ADGA 3QCVL 1X5ZA 1AGBB 1M7XA 1WF5A 2NY1B 3QDAA 5DHVH 1YNTA 4EVNB 3BYYA 2JTDA 3HC4L 1XGTB 3ME0A 5CEYA 1CDJA 3RY4A 3EYVB 5FXCH 2UY7A 1HOCB 1G7HB 5I1HL 1QUNA 1T2QL 4Y8AA 1K3IA 2H32B 3GIZH 1Y6NR 1F4YL 5INCA 1CS6A 3CFJA 4HDIA 3MJ7B 2AK4A 3CVIH 3PXHA 1AQDA 4PGDB 2FX8H 1NDMB 4AZ8A 2R0LH 3CNKA 3RWFA 4CNIA 1MCKA 2V2TB 1EDQA 4QHLB 4G8GB 4JRXA 8FABB 4GKNB 1BGXH 3CXDH 4K3EL 4M9OA 5DD0H 2VJXA 2XWTA 4TYUA 2DLGA 2WIIB 4JY6B 4JGUA 3SE4A 3J8F7 4OD2A 3KWWA 4LHUG 1UWXH 1ZLWH 1OQXA 1F45A 1K4DB 1AFVH 3ARGA 4OLXL 3T0AA 3QR2A 1F02I 5HHME 3TT1L 1TJGH 2VLJE 3MCKA 3B9DA 4LCUA 4P9HC 1JF1B 2HN7A 3BGMA 1TETH 3NPZB 1UM4L 4JQXC 3K1KC 5I8OH 4CVZB 2KUTA 4FXLA 3T08A 3FB6B 4OAWB 3N85L 5CSGA 1NGYB 4EDXB 3OSKA 3RUGB 3RDTA 2P8PB 2WWMD 2R4SH 4UQ2A 3VDAA 3TZVB 4I3RH 3K2UL 2LU3A 4PGZA 4KK8D 1H3UA 2DYPD 3DUHA 4D9LH 2UZXB 2WUCL 3QXAA 3C9NA 4GKZA 5JXAH 3IFOB 5KZCD 3FMGL 2QHRH 2BDNH 4D0DB 1EXUA 4G42A 4JRYD 1TTUA 1KBGL 1KEMH 1JMXA 1S7QB 5CLTA 5I1GL 3GJFK 2DWEA 2NY4B 1RK0B 4M6NH 5IHZB 4OGYL 1JNLL 4D0BA 4M8QB 5DJ8B 3VXSB 2R1XB 2BVQB 2GJZB 5D7KD 3P9MA 4PG2A 2XKSA 5JW4N 3MLRH 2W0PA 5SWZD 3MLYH 4O2CB 4DTGH 3TEUA 5GRXG 3EO1A 1W8NA 4H8WC 5C2BH 1QFHA 1YEKL 3MJ9A 4DKDC 4YHNB 4DAGH 3ZTNH 3UTQB 4YHZH 5D7IE 4LRIC 1QLEH 3IT8D 4MB4A 3RGHA 4KRPC 3FO2B 4OTXL 1RUQL 1IGCH 5HY9A 5FO9B 1KN2H 1OTUC 4G3YL 1S5HB 1P2CB 3L5XL 4L4VD 4NQCD 5DHYA 2BSSB 2XIDA 4N9GA 3QFJD 4YFEA 3ARTA 3IDNA 1OVZA 2FDBP 3QIUA 3ARDC 1TJIL 3VFRB 1VB9A 4OT1L 1RV6X 4IRJC 3VH8B 2XWJA 1H8OA 4OZIE 3QA3B 3QNZB 4P2OD 4AQ1B 1G9NH 1YN6A 3IDYB 1SY6L 2AJUL 1H3TA 3JSSA 4ELME 1C12B 1Q9LB 4H25B 1AIFB 5DD5L 1WWCA 1R3HB 3A6CL 4MQSB 3ZHDA 3SBWA 1DN2A 5J3HC 3BX7C 4NBZB 3MREA 2YPKA 1JWUB 5E8PA 1HQ4A 4FFZL 5TE7H 3T4AB 4HWUA 3HA0A 2AXGA 2VXSH 3Q5OA 2WW8A 3U9PH 1CBVL 1I3UA 2EE6A 3LDBC 3MV9B 4MXWL 5AAMA 1YNTB 3U4EA 5HGAB 5HHNB 4JB9L 3ARQA 3BKJL 3MLWH 1HHJB 2OCFD 1FFNA 1ZE3C 1LDPL 5MI0C 3OJDB 4JO2L 3QDGA 4X7FC 2ID5A 1MCOL 3WIIH 1BFVH 2HWZL 2DF3A 1P7QD 3CX5J 4NO2B 3D85D 4FMKA 1U3HD 4JRYA 4CUCA 1SEBB 3BKCH 4Y4HA 4WWKA 1L0XA 3MNZA 1DZBA 3R06A 4PJGE 5GISL 4UQ3B 3ZYJA 4ZMAT 1X5GA 1YDPB 1B0WA 3IFNL 4GJTB 2FWOA 2PO6C 3QUXA 4K3DL 3N9GL 3H8NA 2OJEA 5T3XD 3BZ4B 3SQOH 5CJXC 4N8VB 5DQ9B 3S35L 5C0NC 3CSPA 4ZFFA 1QRNA 3BKYH 2XKNA 4L4TB 2EXWD 3UDWA 3WJJC 4QRRA 2VNCA 4KJWD 5FUZL 4KFZC 1DQLL 2QKIB 5IJVA 1CU4L 1N5YH 5ISZA 3WLBA 1JUFB 1ZHKB 2R0WL 4JKLA 1FDLL 4E0RA 3GB7A 4GAFB 4KI5C 3T0DA 5T1DL 5EU6E 1FORH 1JGVH 5T3XH 5KAQG 4XX1E 4ZDHA 1YEKH 3U79A 4NSKA 4IOIB 1RURH 3TH2T 2AV1A 3BDXA 1TIUA 1CF8H 2CDFA 2YZ1A 4L8SC 3THMH 3OAZH 4OF7A 1RHFA 4JRWA 4YZFF 2VO5A 3BGMB 4YDIL 2GYSA 1WICA 4LCWB 3CX5K 3LV3B 3OJVC 1NPUA 3PWJB 4QXGL 4U33A 1N3NA 1NAMH 3O6MH 4Z6AT 2V2TA 4NZUL 4OFKA 4JANB 3ESUF 5DUPH 1GRWA 1MCLA 3C08H 5C1MB 4YDVA 1HXMB 4XC1H 1IL1B 5DD3L 5MEQA 3LEVL 5HGDA 2WIIA 2Z31C 3SDDC 5EOTA 3VRIA 1TJIH 5LGJB 5TH2A 2ESVE 1FNHA 5K59E 4QRTB 4YXHH 3WJLA 3IDUA 1FO0H 4E41B 2QADB 2IFGA 3QWRA 5ANMA 4ZOBA 5F72S 5D9SA 4PTUB 1MUJB 5BRZA 3B9KA 2R1YB 3DXAE 2X1WL 4PJ9B 4MHHI 4AEEA 2A9MH 3NZHL 1DQLH 5DJYB 5C0CE 5JR1L 3U0TB 4C56A 1WJ3A 3BW9B 3DV6B 1KLUA 5L8JB 4L9LA 2DJ4A 3LS5H 3OG6B 1A7QH 2VC2H 1GIGH 1GZPB 3EAKA 2DLFL 2YZ8A 3MCG1 1FZOB 5HYSA 2BNQE 2FGWL 4L5FH 4U6TA 5CIPH 4R0LB 1E4XH 1F90H 3MODH 1NGXA 4XVJL 5DUBB 1IGMH 2NXZB 3JV6A 5DUPL 4FTVA 3Q6GL 3VI3E 4E9LA 1HKLH 1E6OH 1PD6A 5IVXF 1U8KA 3GSVA 3UTSE 1N5AB 3DUUB 3FONB 25C8H 4DK3A 2X9WA 4EDWH 3MSPA 2V2XA 5J12C 3HE7D 1BGXL 2GJZA 3KS0H 1N59A 1IAKA 2BRQA 1ND0A 1T20A 3WL9A 2IH3B 4PJIA 1SYSB 5JUEH 3EGSA 5AEAA 4X6EB 1M71B 1NGWA 3ULUF 1U8PA 3H9HA 5HYJD 4JHBA 4YLQT 5D8JH 4TPRH 1MCQA 1XR8B 2YRZA 2IEPA 4LSTH 4M61B 1JGDA 2IPKA 3ZHKA 4F2MB 3AROA 4W68A 4O9HH 3FFCB 5I8CB 2GSIA 4WUKL 5D2NB 3ILQD 4I3SL 5AZEH 4R2GC 4P3DA 3SGJC 1DE4A 5DK2A 4TUOB 2PCPA 4ZUVA 2IAMA 3G5VA 3W2DL 1MCPH 5D1ZA 3RKPA 5FKPA 5E5UB 3VGBA 2HMID 1CLYL 4OLEA 4XP9H 3ZDZF 2RGSA 2YD8A 4XVSH 2VL4A 5TPWH 3E6HA 4KDTA 1T03H 4FG6C 4OTXH 5GSVA 3HNSH 5HHOE 2P7TA 4DN4L 4XHJD 2EH7L 2Y9RT 4Z7QF 1T3FB 4P2OA 5HYJB 4G8GD 3MGOB 5C07B 1TQBC 1I85A 2PYEE 3WS6C 5CJBA 1P2CA 1KGCD 4OZHA 5EFIB 4JQIL 1F3JA 3KAAA 5CGMA 4N0UA 1JGUL 2OXGA 3DSFL 1IEBA 4Z7VF 1DLFL 4MAYB 2X40A 3FRUB 3QI9B 5KSBF 2Y5EA 2Q7YA 4DTGL 4NQCA 3F7YB 2XWJB 1JFQH 2KH2B 1LE5B 4NP4H 3CDGA 1YQ2A 5KN5A 1VESA 2FL5A 2EYTA 1QACA 4UILH 3FQTA 1D5ZA 2I26N 1KIQB 2Q7NA 3TA3B 3KR3H 1MCHA 3RVVC 5BW7A 4JDZB 1JMZA 4NKDA 2XNAA 1A7RH 4FFYL 2BVEA 5E2UH 2NY4C 4UNTA 4J2XA 4XCYA 3QDJD 3KYOB 1R24A 3T0XA 5D96B 1S7XA 2PYFB 3BJLA 2CSPA 5CBEB 2DKSA 3QPXL 3TA3C 3BZ4A 3HLAB 3IJYA 4P46B 2DLTA 3SDCA 3H42L 4KROC 4YC2C 4GG8A 1B6DA 3B2VH 1IAIH 3H7BA 5INDA 3UDWC 5F9WB 1JUFA 1ZHKA 2YD7A 3QFJE 3GMLB 1CG9B 3GMNB 2DTML 1WZMA 5HDBF 3IFNH 4JFXA 4M7LH 1E4XI 3PJSB 1A6UH 1HI6B 3GKWL 4NQEE 4PRNA 3VXSD 5EZIL 2E27H 2VZVA 4NZTH 4Y4HC 4OF6A 1PSKL 4EJ1C 1S8DA 5DWUL 4UTAL 4LRNH 1NL0H 4N0YH 4PJEF 1PZUB 4PRPD 3DYMA 3NH7L 4PJFB 1A5FL 1IL1A 3BKJH 2F54E 3I6LE 5D7LD 4N68A 1SJEA 5CMAA 3S5LG 4UU9A 4ZTPL 5EPMB 1CFBA 3TN0A 4G7VL 2B2XH 5KANG 4YK4B 4HUVA 3MLSH 1EJOL 5F7KC 3EYSL 1QYGL 1HWGB 2Z0BA 3SPVB 3CZJA 3O3AB 5BV7L 4KKAD 4RFOH 3C2AL 3GBNH 2R4RL 3MV8E 5FFLA 1G9NL 1I3VA 3FT4B 2Q8AH 3O4LD 3U1SH 5GISH 3TF7C 1QSFE 4XPTL 5J6GB 3MRFB 2BY0A 3U36A 1EK3A 1KENL 3OTTA 5TDNA 4QHMA 3ZTJG 3QA3A 1QFWL 2B4CC 3TIEA 4JHZA 1UM6L 4GBXC 1DP0A 2C1PB 2ATKB 4IDLA 3MRIA 2PW2B 1GGBH 3OR6A 1A9BA 3U46B 1ZEAH 1KULA 3BPOB 3VXUE 2YUVA 2GFBA 1T4KA 4M93B 1JWUA 1ZSDA 4B5EA 3S96B 1DJSA 1QQDA 4PJDE 3QUYA 5I30L 4ELMB 1R5VA 4YIQA 1A5FH 2DKUA 4WDIA 4Z7WE 1X5IA 3K4AA 3OKNB 3KYMA 4KVCL 4UV7H 5IFJA 1TZGH 3DGGA 2HTLC 1WZ1H 2UVEA 5HPMA 4GT7A 3GRWH 2R23A 2ZG2A 2VAAB 2Z91B 4M7KL 4TQEH 2VDML 5F96L 1L0QA 5I1DA 4PLKD 1E4JA 3L3OB 4EI5B 3RUGF 4K3JL 1RIUL 1S7RB 1FV1A 2GAZB 3HMXA 3QCVH 2ZOLB 3WIHL 3GMQB 5IBLD 3DX9A 4HKBA 1YYLL 1A6TA 1QG3A 3E1F1 5FB8A 3HE7A 1A3QA 4PJBE 4MD0B 4XCCL 4AT6B 4B7LA 1NFKA 3SKMA 4U6YB 5FA3A 4K23H 2CLRB 4NRZA 2W91A 3BDYH 1Z0NA 1AGCB 4YDLB 4ACPA 1KCVH 2FBJL 4MDIA 5DDHA 4KUCF 4BQBA 1BFOA 4HC1H 4PJHA 5L0QC 5GZOC 1A7RL 1BZQK 4UTBL 3ZKNC 2NY0B 5TF1L 5C0CD 4AEHH 4JLRA 5LG1A 5C0FA 4QNPF 1LO5A 2E7MA 3T0VA 3E8UL 3L3JA 4ODTL 4S0SD 1JWSA 5T1MA 4WW1A 1DE4B 5DK2B 4X7CC 1T7XA 5AZ2L 4HMDA 1F2XK 5DD3H 4ZSOA 2C3HA 2BNQD 1QP1A 5IVXA 4IOFC 5EU3A 4YZFE 5E1AA 4HWBH 3CH1A 5DFVC 2PYFA 2C5DC 4JPKL 3MZGB 5JXED 3BP5B 2EEAA 1EIBA 4NZRL 2XZAH 1NC4D 2X70B 2VITB 4LCIH 1CTOA 5HYEA 1J1PH 3ARRA 4IMKA 4XP6H 1LK2A 1CG9A 3ULVD 5T3XL 1EAPA 4H26A 1I8LA 1GGYA 4YR6B 1JI2A 4I8DA 3WDIA 1OAKL 3QFJA 4NO0D 5DJ6A 2GITB 2JK5B 5HYQA 4KJPC 3PWPD 2H1PL 4LPXA 4K23L 2XTJE 1M1SA 4XGZB 3BH8A 4RCAA 1YNKH 3WFHA 3RKDD 4XVUD 3ULUH 3HN3A 2DWDA 4O4YL 1YA5A 3O6FB 4OZGF 3SE8L 3ALWA 1G7PB 4F7EB 4OF0A 3I75B 5GGSA 3BGFB 1L6ZA 4W4OC 1JPSL 2D03H 3CSGA 3TYFA 2F53D 1BD2B 5K9QI 2VLKE 2X4QA 1U95B 3HZVB 2R4RH 3LRSA 5GRUL 3WO3B 1A3LL 3QDHA 3NCYP 3PDOB 5HVGB 3TCLB 4FTVB 3U0TA 4C56B 3EW3B 4YHYC 4JZOA 1F4AA 4I5BB 1P9MA 4HUMB 4TULL 5LAXA 1MQKL 4LIQH 2ZCHL 4DUXA 2FH6A 1YJDL 1C1EL 4IEFB 1WQVT 4LSPL 5CILL 1FAIL 1I1FA 3RPIB 3L5IA 2QR0B 4KU1A 1NLDH 1ADQH 3H9SA 4K07A 5D6DA 5F44A 5B3JF 3MQIA 4Q9RL 2OL3A 3CLEL 5EIIA 4MMXC 4X8XA 2FCBA 5FOJA 3BE1L 3MRCA 1N6QH 3B8YA 1E4WH 3QG6B 1E4XL 3H7LA 1IJ9A 1OW0A 1Y0LB 3VDBA 3QZWA 4J7RA 4YGVB 3RA7L 4GFTB 2CMRH 2X44D 1S9YB 3UC0L 3PP3H 4IMLA 2ZUQB 1BD2E 4HZAA 3VMPA 3FT4A 2FHCA 1AP2A 1T1XA 1SJEB 1IGCL 1MRCH 2R0ZL 3FHQA 1MCCA 2QHLA 4PPTA 3RNQA 2D7PA 1EHNA 1UQSB 1H3WM 4QXTA 1SJVA 3NCYS 5DGQA 1YEFL 2W07A 2D7TH 1INDL 3PHQA 4H20H 5F21B 1JPFA 4PJAE 2ZJSL 4X83A 1DSFH 5GGRB 1XF3A 4BELD 4NN6C 5BJTA 1NDGA 4N0UB 1T6WA 3L3GA 1YEJL 4MQ7A 5EBLB 2Z31D 2NY5L 2D0FA 3GEWB 4NQSA 2VZ1A 4OFPA 3CFIC 5T3ZE 5KSVA 1BX2B 3TBSA 2MQ3A 4OF5A 3UTSA 1KV3A 4XP5L 2ZSVA 3S4SG 1TZGL 4F37F 1NBYA 1RAMA 1MCEA 3LB6D 4PJHB 2N7BA 3O2WL 1Z5LB 3VXTA 5E94B 1R3JB 4KK6C 1RZ7H 1FRGH 1DQDH 2CR3A 5J13B 1ADQA 5IB2A 2J2ZA 5FO9A 3LEXA 3OGCB 3V0VA 2NY7H 4YX2H 3I02A 4RSVA 4X4XA 2OL3H 4C56E 1N0XL 4DKAA 1F3DJ 5C07D 3G5XB 1S7SA 3IU3B 1AC0A 1VGKA 1EFQA 3Q5YA 4K3DH 5D1QC 4GLRH 4Y5XA 4MA1B 5BRZE 4OJFH 2BK8A 3JVGC 3VRJB 4R4ND 3VWKA 5ANME 1TJHH 3GI8L 3RWCB 4XMKL 1CIUA 1KPRA 1DEEA 4XBPB 3WKML 1BVZA 1J8KA 5ALBH 2ERJC 2YD1A 3T8XA 4O9HL 4AENB 2ESVA 4HBCL 2IPTL 3NFSL 3RAJH 2E3VA 4JFOA 5I1EH 5ID1A 3RZCA 4C54A 1A6VL 4M1DH 3E0GA 5CEYB 3IFPA 3AU1A 4IM8A 4WENB 5D72H 5A2KH 3F7RA 4CL7A 4RGNC 1NAMB 2NZIA 3D39B 4HUUA 2GIYA 5DUMH 4YWGL 4NJAH 5I1IL 1GOFA 4GRLB 2AKRA 2C3VB 1W0YT 1FLRH 2ARWA 2R15A 4PGEB 5D71L 4HMCA 3WHE0 3JWOL 2IG2H 5SWQA 1SEBA 4UNVA 2QBWA 1K85A 1IKNC 5D2NE 1KCUL 4PRPB 4DEPC 1D9KD 3C60B 3X14A 2P8PA 5KSAC 3HR6A 4PJAA 5K9KA 5IMOB 2V7HA 3BP4B 1T21A 4HLJA 5BQ7B 3SGDH 4GRMB 1UB5A 2BCKB 3QQNA 3QWRD 4POYA 1P1ZA 1LO2H 5BOPA 1VCAA 4HWEH 1Z6JT 4PJGA 2I9TA 1BD2A 3X11A 4LKCA 4YBHA 4OSUL 3QFJB 2EKSB 2AW2A 3TBTB 5L2KA 4YHZL 1HNFA 4BFIB 4Z78A 1NLBL 2HJKB 4X0KB 1W72B 2Q20A 4X4MA 4M62L 1LEIA 4OD3L 3QH3B 2DQUL 1BVLB 3DX8B 4H88L 1IRAY 3B2UD 4NO0A 1KPVB 3C2SA 3OKYA 4V2BA 1RIUH 5F1IB 4LPWA 2HN7B 2COQA 4Y4FD 4JFQB 2VXTH 2XFXA 2LU4A 3VXSE 3O41B 3P4MB 2JJSC 4MSWA 3UZQA 1ZXQA 4AIXA 3AC0A 3CXHJ 2W0FA 1XF4B 3IJSA 5I1DB 3HC0B 1CK0H 5I17A 4ELMA 4FZ8H 4M6MH 1J1XH 3HB3C 4AEIH 5KVGH 1KJ2L 2I60H 3IJHB 1ULVA 3K1DA 1T2XA 5HHOD 3NZHH 1VA9A 3QUXD 2APVA 4I0PB 4GKZB 3ILPB 2VLKA 3QDME 3BKML 4P9MH 5I16A 2ZUWA 2JIXA 1ZGLB 1AHWA 2OL3B 4X4ZA 3ARDA 4ZQKB 4LMQE 3RL2B 3QNZA 2ATPA 4APQA 3K8MA 3VFTA 1EGJH 1FFRA 1RK0A 5J1AA 3S36X 4KK6D 5EN2A 1R3LA 4BZYA 4J1UA 1KTDB 5E7FA 3HRZB 3SKOA 3V5HB 1L4IA 4LRIA 1FZMB 1PKQB 3MRQB 5HHMD 5IM7B 1YEEH 3CXHK 4IMKC 1I3GH 3MOAH 3BKCL 3UXFA 4PJEB 3VXQB 3HI5L 1KFAL 1OAZH 1JV5B 3LEXB 1HDMA 1BBJB 5FO8B 1A22B 1C16A 3GKZA 4TPRL 1EUTA 2H32A 1J5OH 3NIFF 2BNUB 4JFYB 4NC2B 1WBZA 3SJVE 5GS0C 1FGNH 1CL7L 4JO3L 1NGWB 5A2FA 1MFCL 1FGNL 4UOW0 2O5YL 1DUYA 3CFBA 5EOQH 4FXGA 3QQ9C 4ZSOE 1ZLSH 1L6XA 3MGTB 4FQJL 2V7NA 1UGNA 4O51B 1UYWH 1ZA3A 4L3ED 4Z0BL 1KLFA 4TUJB 3M17B 2NLJA 3MRNB 3QQ4A 2W38A 1N8ZA 3PP3K 1FE8H 1QRNB 1INEH 4HEME 2M1KA 2WLZA 1HEZA 2ZKHL 4WEBL 4OKVB 5IR1B 3I75A 5GGSB 3VMOA 3HUJB 2DI7A 5D7SH 3EYOB 1FFNB 3W0WA 1XR9A 4PTTB 1RJZB 2NXZD 3MLZL 4R90H 5F7EL 2AQ1A 3OV6A 1I1AC 5F97E 2X1XR 3UTSD 4F7MB 1IE5A 3KJ6H 2NW2B 2NY1D 2VLJA 2X1PA 5GHWH 4ELMF 3V6FB 3SGEH 2A6IB 2R56H 1BWWA 4G80B 4HFWA 3T1FA 1MPAH 3UROR 4FFZH 3VWJA 3LOWA 4IHOA 3T65A 4I4WB 2X6MA 1NCUA 5JNYA 1FVCA 3BQUD 4DGVL 1YEDA 5BS0B 3QRGL 3O2DL 4TSBH 43CAA 4NHCH 3MROB 3MV8D 4KK5D 3UCRA 2FLRT 4QHKJ 3MRMA 2B1HH 3KLSA 4Y5VC 3R1GH 4UQ3A 1JHLL 3R4DA 3VXOB 3P30H 4KTDL 5SX5K 4Z7WA 3RWIA 3ULVH 2EXYC 4XC1L 3ZYOA 1EEYA 5IROA 3HZYA 5T3ZD 4TSAH 5B38B 4RDQF 1RUPH 1G7QA 5SWQB 3PWVB 2EC9U 1QA9A 2H32H 2JE8A 1NGZB 3E8UH 4ODTH 4WUUA 3VXUA 3WV0A 1I4FA 4DGYL 5DC4B 4P5KA 4HIHB 3RWDA 5FECA 5C3LD 3EJZD 4MWFB 3PL6B 1RMFL 4JHAL 3WNLA 1IC4H 2FBOJ 4OIIH 3RZCD 2NY3D 1ZT1B 1J87A 4WUUD 3L1OH 5EA0H 2AEIT 5AYQA 3J7HA 1EX0A 2H45A 3OF6A 1A7BA 1HINH 4WCYH 4L4JA 3ALXA 4KJYB 5FF6B 5T1KD 4PG9B 3ARFD 3KLHD 3D18A 3P4MA 3OXSB 2XQYG 5C2UB 1X3DA 1A7OH 2GEEA 3MV8A 4Y5YA 1F00I 4Y4FC 1CDUA 5IBLC 1PG7X 2JJSA 2G60L 1INQA 4OD1L 1OGAD 1NDGB 3OKKA 4LSSL 1CCZA 4I3SH 1C08B 3VXPA 4P4KC 5HDQL 4WI3A 4M03A 3QEHA 4I77H 3DX8A 1NAML 3VGAC 4GLRI 3DLQR 4MQXC 3EYFA 4KVCH 4X7EC 4GAYA 1HH9A 3TBTA 1V05A 4JFQA 4MCZB 2NX5B 1I8MB 1D7FA 4RA3A 1LGVA 4U1GB 1GGUA 1IZKA 2YMXH 1UACL 1R3JA 2V9RA 4MQ7B 3EDDA 1I9RL 5HVFB 3V5HA 2ZCHH 4HMEA 3HNSL 1KXTB 3W11D 4OZGB 5KW9H 3MV9A 5K9JH 3QAZC 4NQEA 3IJHA 2N7AA 2NY3C 3OAZK 4Q0XH 1B2WH 3EIFA 1M6OB 5JDSB 4WRLA 5IGXH 5GS0D 1FL6B 5C0BE 2VXQL 4JHWH 3O11B 3LKQB 1FJ1A 4WHYH 1MFAH 1CZ8L 3KPRA 3QIWC 1NC4A 3WUZA 3P0YH 1KIUA 5DMJB 2EO9A 1TJGL 4D0CA 2DWEB 3QNXB 5I1KL 2P7TB 4HT1L 3H0TB 3VWKB 2F15A 1LK3L 2DBLH 4WO4C 4ZNEE 4M61A 1A9BB 5JW5A 4O4YH 1NUNB 4G3YH 3D3VE 3HRZA 3QRFM 1U8LB 3WNKA 2DM2A 1VKXB 3FRUA 3K46A 3QI9A 3QUKB 3NN8A 1EEZA 4TUOA 1RUML 1UEYA 1F4WL 4FQHB 1UM5H 3QQ4B 5AG8A 1ZWIA 2YA1A 3L1OL 2Q86B 3S3SA 3HR5A 2IANA 2JJWA 3PL6D 3ZDXE 3T3ME 1WFUA 5DYOB 4XAWL 2AEPH 5DRXA 2IBGA 4J1UB 4PV9A 4NQCE 4DZ8A 4PLJD 2RJMA 4JPKH 2V5YA 2EYRA 4MB5A 4LSVH 4RNRA 1U8NA 3QXVA 4MA3B 4JDZA 4NKDB 4RBPK 1KYOK 5D70L 4OZHE 1UJTA 4XPHL 4LSSH 2PYEA 3FTGB 4PREA 5C71A 1A6UL 2EZ0D 1WFTA 5CINH 4F33B 2B7DT 5KTEL 5FGBC 1J11A 5MENA 5HHOA 1AXTL 5EOTB 5C0AE 3SDCB 2YN3A 1U58B 3VFWA 3KG5A 4PGEA 5TF1H 1RUQH 3KPRD 4JFHD 3PWNB 4U6VH 5AD0B 3FOLA 3ZDZE 3QUZA 4PTTA 3CC5B 1RZFH 4WO4D 4DAGL 4Q6IA 3MBEC 2VDPH 2CUMA 2VMFA 4GW4B 4XCNB 1T80A 3O9WC 4Z77B 3KPTA 3EJZC 4RMVA 1I1YA 3NZ8B 2WNGA 1RPQA 3BP6A 4PRAB 4C56D 3C87A 5DJYA 1F58L 1IAMA 1XF2B 3U4AA 1FC2D 1RZ8B 3TZVD 3VXRA 4HFWB 3T1FB 4NKIH 3STZB 4PB9L 3ZDXF 3BT2H 4TVPL 1H3GA 3L7EA 4NT6B 3IDIA 4UT6H 5BRZD 4AL8L 2QV2A 3VW3H 2D2OA 3MUJA 3O3BA 4ZAKC 4PJHF 4F8QA 4PYGA 4JO1L 7FABH 3EO9H 1YDPA 5F7FA 2BOCA 2ZSWA 4IDJH 2LTQC 5E8EB 5H2BA 5IFHL 1CFSB 2P5ED 1OY3B 1TCRB 5IHUL 2YRPA 3FFCE 4DZBA 1WLHA 5IMKB 5MEPA 3HLAA 4XZUB 2VABA 1MFCH 3Q48A 1KELH 3QUZC 2AXFB 3ZZ1A 2WBJD 3QO1A 2BY1A 3P73B 1VGEL 2A6JA 4G5ZH 1WBYB 3HZMB 1C08A 1MRCL 1NAKH 2R0ZH 3T3PE 5DXWA 1KIRA 4L8BB 5FGBA 4JFZL 2VUOA 3AM8A 3QHFL 2Y07H 3VFTB 3LS4L 3IDXH 4WI4A 5B8CC 5F7EH 2G2RB 3T0EC 3MLVH 5MEOA 4MJ5A 3QXDA 2YK1H 1VADA 4QOKA 1YEEL 1LNUA 5D5MF 5C0CA 2F19L 1A4KA 4OZFH 2PW1B 4H8WH 3V6ZB 2M8XA 3HPJA 1AFVL 1U8QB 1K8DB 4CADB 3CFKB 1NCCL 2AJYH 2UYLB 2GCYA 5GZOD 4DFHA 4FQCH 1IAIM 3BRGC 1CXIA 2UVFA 1DVFD 4TNVK 2BSRB 1MLBA 4NHUB 3S36L 4RFNC 5EOCH 3NFPB 5AYUL 1R3LB 1JVKA 4OQTL 3G6JE 4MA7L 3SHSA 3D69B 4QRUB 5HJ3B 2DKMA 3EYFB 5J1SC 1P84J 2F74B 3VFNA 3OKOB 4PY7A 4WFFD 3DRTA 3FQXA 5F1NB 5JOFB 1R5IA 2Q87A 2WMPA 2I5YH 3AS2A 4NWUL 3TVMB 4FA8A 4K8RD 4N1HB 3S96A 1Q0XH 2R29H 3QBTB 2CJUH 4KHTL 4TSCH 2Z93B 1IBGL 4NZDA 2FSEB 1L7IH 2HJFA 3KYNB 5ACMA 4OT1H 4O2CA 2PN5A 5JW3L 1D9KC 4LCCC 2AAVA 1EEQA 2GSGB 5CSBA 5EU6A 4QRSB 2Z35A 4NBYB 4M7JH 2NY2D 2R39A 3I2CH 1T1XB 2Q86A 3O45A 1F58H 1U2HA 1YMHB 5D5ME 1JPGB 1XF5A 3MA7B 4YQXH 2GHWB 3A67L 4PGJA 4PJ8A 3DTXB 1DSFL 1QRNE 2PO6A 3QUXC 1S9XA 4LU5H 3IXTB 5IEKB 3MRDA 1QQDB 5TE6H 3I6LD 3LHPH 4UUJA 2XACC 1I8LC 1EERB 5GRZA 4ZTOL 1QO3A 4WWKC 4LVNB 5GGRA 1DLHA 3G6AA 3P77A 4MD5A 1I9IH 3BVNA 3QDMD 4XPAH 2I60L 3I3DA 4L4VA 4MJIA 2NNAA 4JRYE 3KPPA 4LL9A 3HMXH 5EBLA 3MRKA 3NOIA 4IHOB 4EQ2A 1N4XH 4X6BB 3PIQA 5INCB 3BI9X 3DWTA 2RFXB 2VLRE 4JM2D 4B50A 2Q1EA 4F2MA 2RAMA 1F6AB 3NCJH 4JPWL 4F7PB 3MJGX 1MJUL 1FV1B 3KPLB 4ZS7L 4NQXA 3O9WD 4X6DF 4KHTH 5FOBB 4KH2A 1IM3A 4DFIA 4MZ2A 4Y5YC 5HGGS 3X13B 4OZFG 3RZWA 1KCUH 2DYPB 3TBYB 3U30B 4MGXA 2DQTH 1KBGH 4EN3C 1AQKH 4I18A 2MTPA 3T4AA 3QJHA 5SWZA 3WKNA 1MRFH 3FN0L 3RWDB 2BJMH 1CDCA 2X4RB 3A6BH 4MWFA 5IT2H 1XF2A 1IILE 3V5DA 2XRAH 1J0HA 1FVEA 4IRJA 4LSPH 5CILH 3NGBB 4B41A 3MR9A 3LHPL 3GUTA 1T1YA 2VISB 4GRWB 4UIKL 3RWIB 2J8UE 2DTSA 3WHE1 3WD5H 4JY4B 3HCVB 4R97C 5DEGB 5I1EL 1UM6H 5FYKH 4NOBA 1G6RH 4OCRL 4NUGH 5GIRA 4KQ4L 5EU3B 3WKMH 5CZVL 1D5IL 3PE9A 3NIDE 4IRSB 4P3CL 1MVUA 4P5TB 3IDJA 1IEAA 4QNPE 4OCXH 4P3CH 5MENB 2CJUL 4JFOB 5D7IA 2VXUL 4OD2B 2X89D 4EN3B 4MXQD 1A1OA 4HLZH 4HXAH 4ZFZA 5LBSL 1X6LA 4P2RA 1G9MH 2EC8A 1P7HL 2DMKA 4PG2C 3H3PH 2BRRL 4L8CB 5E2WH 1NGPH 1MQKH 4LIQL 1T5WB 3JV0A 5GGRY 4LCYB 2YKLH 2NPLX 4GBXA 1PAMA 3LQAH 3HRPA 1RI8A 3TZVA 3D5OF 1I1AA 4O2EB 3SGDI 4DUWA 3HUJF 3BIKB 1CLCA 4HG4K 2XTJB 3IGAA 2ZUTA 3LKRB 4XNUH 3MRBB 3K74B 5F1SA 5K33A 4IBLT 3KNBB 2FGWH 2J12B 2VAAA 3WUWA 3QO0A 2OTUB 5FKAA 1JJUA 4QTHB 4D0CB 1L7TH 5CP3H 1QKZH 3QEGL 4POZD 4D8PA 1AR1C 1EGJL 2NZ9C 2H9GB 1CGXA 2ZOLA 2GI7A 4M8QA 2DQEL 1M6OA 5C09B 3N1FC 5F3HA 4PR5B 1SQ2N 1MI5B 1MWAH 1ZS8A 5E9DB 1KC5H 3BPCA 3EO1B 5J11B 2HFEB 3EZJB 1PQZA 1YEIL 1BFOB 5IKCB 3SE4C 3V4UH 4WU7A 4DKEL 4HG4J 4I9WE 3UYOD 1AIFA 1ES0B 1WIPA 2CK2A 4J4PD 4JO1H 4M6AA 4QRUA 2X4TB 3V6ZA 3O4LE 4P9HL 3TGXA 4OZ4A 3SO3C 3VFSB 3PWLB 4NM4H 1AXIB 1C5CH 2VLMD 4PJ8C 2H6PB 2DL2A 1QO3B 5J7CC 3QI9D 3PDGA 4QXGH 2D7NA 4HK0A 4AEHL 4P2RE 4YDIH 3V4VL 3V6BR 4DQOH 2AK4E 4UTBH 3GHEL 5JQ6L 2WUCH 4YBLC 5I30H 3GMMB 2OMNA 4P57A 5TDOA 1UM5L 4OLZL 2RFXA 2VKXA 5F89B 1P6FA 2VR9A 1T66D 3DRTB 3FQXB 5LJYH 4YDJA 2NYYD 2VDKL 4HJJH 4Y5VA 4OV5B 4KJWC 2DMCA 2H3NB 3KPMB 1S7UA 3ZDYF 5KVEL 3S5LB 4J3SA 5JPNB 2YPLB 5B39B 1AJ7H 4ZO9A 1NMBL 5KSUA 5F6IC 5TJWK 2J8UA 4PRDB 3UEZA 5E2VL 3VI3F 3F5WB 4KKLD 4QWWD 2EDYA 5DJZB 1H0DA 3DTXA 1XH3A 5FYKL 1XIWC 4JE4B 5HD8D 4PRAA 5FV2A 2E5EA 3CH8A 3MLWL 1R0AH 1NKOA 1R0AL 1S7TB 3L7EB 5F7DA 2DQHL 4KZEL 3D9AL 1BMGA 5JLZB 2HTLD 3T2OA 5IB4A 1P4BH 1SVZA 3P73A 3VCLA 5L88L 1QHPA 3C5JA 3CVIL 4HS6B 4K3GA 4R3SB 5TH2B 1AR1D 2D7OA 3HI5H 4LOUD 3TV3L 1KIRB 3AB0B 4K3HA 4L8BA 4MJIE 2MMXA 2WWKO 5T1KA 4P0DA 4WO4B 4ZUTA 4NKOB 5FA4A 1Z9MA 4BJLA 1MJ8H 2D7QA 2DDQL 4LCWA 5JOPE 5GS2H 4HUNB 1XIWB 3BN3B 4J3WA 1BWMA 5CP3A 4FN0A 3WEXB 4PRPA 4S1QH 1U8QA 3JV5A 3ULUL 2H26B 3BW9A 3BWUC 5CUSL 2Z9TA 2C3XA 4YHIA 4RQQB 3PHOB 1VDGA 1M05A 2XV6B 4HLZG 4R8WL 4CN4A 3TFKD 2FRGP 3EDKA 3QXDB 4RDQG 3HKFA 5JPMA 1MAML 2ENSA 3VFVB 4LIQE 4FFWC 5IIEB 1R3KB 3RWJA 2XTJD 4P2RB 4L3EE 3PV7A 1P7QA 2VZUA 1JNHB 35C8H 5IUSA 3OKOA 4CVXA 2ED7A 2WV3A 4HD9A 3DUUA 3UTOA 3KWWB 5J3HD 5DEZA 2HH0H 1A64A 4IJ3C 4S11A 1QA9B 4HFUL 4HK3J 2HH0L 1I9JL 1MHEB 4OGYH 3OHXA 2FSEA 1M7IB 1HHGB 1REIA 3EOTL 1RJCA 3DX7B 1BQLL 2BXZA 1U8PB 1TVBB 3T0EB 1GPOH 3U7YL 5JQHC 2ARJA 1MVFA 3WSQL 4F8TA 1J12A 5EZJA 2CXKA 2K3TA 1FDLH 1NFIA 3DVIA 3OXSA 1XGQB 5IHBA 4JN1H 4Y2DB 3RJQB 3DO7A 3FONA 1F2QA 4J3VA 3HI1A 2X4NB 1TVHA 1FIGL 2EEBA 4Z0XB 1CLYH 5F88B 1HILA 4JR9L 3U48A 3BSZL 1DDHA 4JZNB 4KUZH 32C2B 3RNKA 4Q9CA 4JM2B 4JG1L 1A6AA 4E41A 1SYSA 4EBQL 4ALAH 3QT2A 1CR9L 4JFFA 1EZVY 2V2WA 3INUL 4PB0L 2W9DL 2VDMH 1Q0XL 4HUWB 4JJ5B 2PKDA 3UYPA 4CMMB 1T3FA 5J9PB 4PBVC 1DEEB 2PTUA 4XBPA 1KJ3L 3FFCA 1U91A 2IG2L 3NPSB 2X4TA 4Y5VB 4HUKB 5IB1A 4OV5A 5K9JL 3DV6A 1DQQA 4PJXE 2E9JA 2EE2A 4P23C 1CD9B 5DK3A 1FORL 3WE6B 3BRDA 2X10A 2XA3A 5AYUH 5DC0A 2OYPA 2AGJH 3NA4A 2ADIB 5IFHH 3RVVD 5DJDA 3WJJA 1FNEB 5C6TH 1ITCA 4WTZG 4D9QD 5GRJL 3VXRE 4LRNL 4YK4C 5D5MB 2PXYA 2VYRE 2YS4A 3KPRB 4M7LT 4OUUB 5DA0B 5TDOB 3T77B 1F8TL 1S5HA 4P2OB 3W2DH 1IGML 4HT1H 2BOBA 4R7DB 4BH8A 2GT9B 1NC2A 5BVPH 1F97A 4DGIL 3VXQA 2WWKT 5D1QB 4U7SA 1NCAH 2EDEA 2VLKD 1KJ2B 4M9PA 5KSBE 2HRLA 1FE8L 5E4EC 1G7JB 1T20B 3KLDA 4PJ7F 1JL8A 3G5ZB 4PRHD 3BEWB 4XBEL 4K71C 4I2XA 1N0XH 3WO4C 1FZOA 4OKVA 2OL3L 3L3HB 5DT1L 3TP4A 5C0AA 2IBBA 3OB8A 5MENE 4QOKD 3BMVA 3FQTB 5D93C 2A0LD 4LHUA 5BXFA 1HZHH 4YDJB 2G5RA 5I8CA 4MS8C 4BK5A 5MHSE 5TDPB 4O51A 3CZFB 4M00A 4Y4FA 5C0FB 5ICYA 1PVHA 5TQ2L 4DWHA 4LDEB 4ZUTB 2VLJB 4OI9A 4YDLC 3GBLA 3BAEL 4FG6D 1AD9B 1J1XL 3RVXC 3MACL 4Y8DC 5DD5H 5DFVD 3WO4B 2YRLA 2PTTA 3V79C 5EUOE 3WL9B 2VQ1A 3FJTA 2EH8L 4UDTA 4M6OL 5ADOH 3VWJB 4F33A 3ELAT 5ADOL 1JN6B 1HH6A 5FYKU 3R1GL 4KUZL 1AQDB 1BEYL 2LVEA 1FIGH 4UB0L 2YD4A 1DEDA 3MV11 3D3VA 4MJ4A 3ZE1F 2DQUH 2OJZL 2AK1H 1EV2E 4LSQL 3JBG7 2D0GA 4ONFL 1KNOA 1ZA6B 4UBDD 4GXUN 4NKOA 3E6FB 3U83A 3QPQC 4ZNEA 1U8OA 3O4OC 5EU5A 1PKQE 4ERSH 1XZ0A 4WU5A 1FFPB 4MNGA 1EEUA 1FVCB 4Y4KD 3GB7B 1U92B 3DURA 4XRCB 3IKCA 3S35H 1X5HA 4X6DB 4KAQL 4MNHB 4PUBH 1R3IH 2B4CH 5GGQH 1A14H 5CD5D 3G9VA 3LV3A 3FL7A 5E9DE 2J6EH 5D1XA 5I76B 3C6LA 4QY8B 2BVPB 3MV9E 3AY4C 1IM9D 4XNUL 4HJGB 2WIMA 1T21B 2I27N 1F5WA 4NYLA 3OKLA 4PV8B 1E6JH 4PRIA 4X9IA 3B9VA 1NBQA 3GK8H 2VABB 1CT8A 1XGUA 1AD0B 1UCBL 2IBZY 2VDOH 4KZEH 4GRWF 5J89A 4G6AD 4LPTA 2BVOA 5I9QC 4PJGB 2Z4QB 4YNYA 4JPIA 1U3HA 4F15B 2LAGB 2KZ1B 1GVIA 1URLA 3RDTC 1MRDL 3Q5TA 1LEIB 2HVJB 4XCEA 4OM0L 4ZD3H 3FB8B 3N9GH 3GMQA 4JZJB 1FNSL 1A0QH 3RVUD 1KLUB 4JQXA 5SX4I 2V6HA 4H8WL 4JVPA 5F9JB 1MHCA 4JKKA 3TCXA 4JFDB 3U2SA 4BM7A 2EZ0C 1HE7A 4EUPA 3DYOA 3MNWA 3BGFC 1MOEA 3TBVB 3H7BB 3M45A 4OLXH 5INDB 2B39A 4U1IB 2AJ3B 4ODXB 3LKSB 5GGQL 1F8TH 3HG1D 1A7QL 2VC2L 1CXEA 2DQIH 2OR9L 1NEUA 5AAWA 4G9FD 5LVEA 2R23B 2R2BB 4F57L 2EDFA 4UT7L 1UA6L 1N2RA 4Y16D 4FRWA 5CKGA 4G7VH 2DQHH 3VG9B 2OXHA 4WUUE 3QQ3B 1QSFB 4MD4B 4Z7VA 2A6IA 1EHXA 4BH8B 5C0IB 1A6TB 1U91B 1FL3B 4J23A 4KI1A 2X4PB 3FN0H 1CFNB 1V3LA 2D31B 3HC3H 3OJMB 3L7FA 3EDFA 2A83B 3DV4A 1AHWC 4OM1L 4YXKL 3BH9B 5CIPA 2HJFB 2X4UA 3KYNA 5FGCB 3LB6C 3WFDL 4W6XB 1OGAE 2ZZUT 2PO6D 3LH2L 1T7YA 4PJ8D 3L3KA 5TF0A 4LGSB 4N90D 2LV4A 5CFHA 1NMBH 43C9B 1LO4L 1T04A 1YEJH 2B4CL 2BY2A 1U3ZA 1G7IA 2YR3A 2XI9A 1S9KC 2IF7A 3L5WA 3HPLA 5D7LA 2AEQL 1K6QL 4QTIH 3MBXL 4MA1C 4Q74A 1NCNA 1FZKA 3K3QA 1I9IL 5EUKB 4CMHC 3BVNB 4RAVB 1FVDA 1RZFL 4QRPD 2Q6WB 3BZEA 3BEWA 1ZV5A 2IQ9H 3FT2A 1PX3A 1FNAA 2OJZH 3ESVF 4LSQH 1ZK9A 1F3DH 2P49B 3LRSB 3F12A 3CAFA 3KPSD 1FZJA 2R9HC 1HYSD 4KGJA 4NPYA 2NXYD 4W81A 5FUOL 2DYPA 4H0HB 3QEQD 4TQEL 3LMJH 3QG7H 4EI6B 4LSVL 1T1WA 2HFFA 4OZGE 3OX8A 4OZIF 2F53B 5ETUB 2H41A 4LLYA 3RX5A 1QHOA 5DJXA 2ZOKB 3G9AB 4YHMH 2IGFL 3HE7C 5CD5C 3SJVA 4RFEB 2VDNL 1VSCA 4HKZA 3S34H 2GJJA 5BXFB 3TA3A 2AGJL 5HVWA 3FZUC 3P4NA 5I73C 1AXSA 4S0TD 5ILTH 4FQ1H 3GO1H 4G8FA 3RX7A 5EOCL 1G7LB 4UINH 5JXEC 1AD9A 1R24B 3HI6H 1KACB 4K9EH 3LKPA 3C6SB 1BVKB 3WIHA 5KVFL 2HMIC 2NY2B 5DR5L 3DROA 1MREH 3VXMA 3REWB 3VGFA 1NCAL 3KXFD 4ZNCD 4Z76A 1X7QB 1FBIL 3H2WA 5I71C 1I8IA 4BFEA 3QDMA 2J5LC 4JFFB 4QHLA 5E70A 4OM0H 4PTUA 2G9HA 5DQJB 5D1XB 3WD5L 1ZAGA 3HI1B 4NO3B 1A8JH 4NWTH 1FSKC 4L4TE 4Z0XA 2D4DA 3QIWB 1SMAA 3HZMA 5HI5D 4ZOEA 3WFBL 1JGLH 3RWGB 3PGDB 4CGTA 1K3ZA 4PGCB 1V8HA 3IDMA 2HG5B 2VN4A 4G9DB 4JY5H 5J06A 4YFLI 5I2IA 1EBAA 1JNJA 4DQOL 2WUBL 4XMPL 3NCCB 4HUWA 4JJ5A 1FGVH 2PTVA 4LEOB 4ODWB 5F1IA 4NZJA 4QT5B 4KRPB 4XVTH 1FCCA 1RD6A 1BOGB 2Y5TB 4H1LA 4PD4K 5HDQH 2CQVA 2ZPKH 4IS6B 5E03A 3S88H 3TN0C 3L5JA 2X2YA 2UZYB 1Q72H 4X4ME 2OJEB 1DQML 1YMMA 2A6KA 2GT9A 4JGJA 2UYLA 5L2KE 1WCQA 1FL5A 5E8NA 3TBWA 4WFHD 1OTSD 3RHWF 2V2XB 4M3KB 3VGAB 3IF1A 3C5ZA 3U9UA 1DANT 4XAKD 3U4BH 2NXYB 5EU4B 3WFCH 2Z92A 4E0RB 5HTSA 2FATH 5B38G 1NKRA 1K2DA 1AGFA 1X5XA 3K0WA 3V0WH 3D25B 3EGSB 3OKMB 5DURB 3VJ6B 1S7QA 1LP9E 1CGUA 4Y5XB 4EOWH 4PLNC 4LVOB 3A6BL 5IT2L 4O02H 4OLUH 3QG6A 4B0MM 4Z7UE 1JZ6A 4ZS6D 1EH9A 3LSOA 4I5BA 1K6QH 4JM2C 1AC6A 4ZPVA 1AE6L 1OTTC 5K93A 5D2NA 5I15L 3EZ8A 2CXGA 4L29A 5KTEH 1Q1JL 3CDYA 4OZ4B 4MD4A 5C0BD 4HIJA 1C5CL 5HGDB 3TBVA 3OGCA 2NMSA 1UCTA 3SDCC 3BXNB 5F8QC 1G84A 1DBJH 1AH1A 4ZOAA 1XCQB 5FAAA 2AJVH 1CGWA 2R2BA 1IKFL 1KJVB 1U36A 2C3GA 4JDVB 1KB5A 4L9LC 3PHQB 4UV7L 1G6RA 5IEKA 2BDNL 1MUJA 2AEPL 2CDFB 4K55A 2R8SH 2O5XL 3LQAC 4WI2A 5FK9A 5DD0L 5T1LB 5JXAL 5KS9A 1KTRL 5MP6L 1A7NL 2OI9C 3L6FB 2ZUVA 2BRRH 4A6YH 1YY8B 5HDBE 4GRLC 3FKUS 3EFDL 3KJ6L 5F7MC 4JM2F 5CIPB 1MNUH 3AU1B 4DKFL 4WFFE 4I18C 3WIHH 4RAVA 3GSXA 2EDHA 2WSKA 5ALBL 2Q6WA 3X3FH 4HGWB 4U3XA 1TETL 1EZVX 5I1HH 4ESKA 4Y2DC 3O8XB 4J12A 1D5XA 3VFUA 3G6JB 1XCTA 1H0DB 4EQ3A 3SGKA 1WAAF 1U8KB 3GSVB 3MRLA 1P5VA 1FH5L 2FEDD 1Q9OB 4NWUH 3B2UC 5KVFH 1RJYA 2FLBT 1FAKT 2P5WA 4Y1AD 3UJIH 5TGBA 1HHJA 3DURB 4NGHL 2VDKH 3CLFL 4ISVA 1FVDB 2XQYK 3WN5A 2CIIB 2LVCA 1I9RH 2IAMC 4YHLL 2V5MA 4W4OA 1D6VH 1HSBB 4PP2B 2OR8A 2BJML 4PJCE 4M5ZL 2XZAL 4EDWL 3MXWL 3F12B 3GSRB 4XP1L 4YHML 1T22A 1BP3B 1FFOA 3EO9L 2Y7QA 1CIDA 1SJHA 1H9VA 4NN7C 3DECA 4AIOA 4D8PB 4OB5H 1TVDA 3ECBA 1NEZG 4JFPA 2C4XA 2AV7B 1CICB 4PLJC 4JFDD 4PJ7B 4XWOD 4G6ML 1CFQA 2V9TA 3LKPB 5EO0A 3P9LB 1AO7E 3HAEB 2E7BA 4JPIB 1JF1A 1MHPH 4Z7NE 2D7MA 4D9RD 4YHPB 5D6CB 1YNKL 1IC5L 2YUXA 4K8RL 2F54B 1ZTXL 3HFMH 4N8CL 3O9WA 3AS1A 2IQ9L 2VSDA 3ARGD 3FFCD 1VGEH 2VDPL 3SGKC 4G8EA 3GGWB 4X5LA 4OLZH 2DN7A 5MP6H 1D5BB 5C0DB 4K7PH 4X6FB 4KMTH 4HX1B 2F5AH 2ITDA 2G9HB 5DQJA 3BD5A 5E8OB 5CCKL 1RVFH 5J56B 1KB9K 3C9NB 5FKPB 3MRBA 4QRTA 4F7CB 3EDJA 3IF1B 5I1CH 4K3JH 4WW2B 2HLFC 4ONGL 1AR2A 1WBZB 3H9SE 1IAII 5MERA 2ICWJ 3O2VL 5EZIH 4P9HH 1OAQL 2L7UA 4ZQKA 1IGYA 3NCFB 1CVSC 1TITA 2NY5H 5ICXB 3GKWH 4S1DC 5EOCJ 5CGYD 4HCRL 4WU7B 2DQCH 3MNVA 1JRHH 4PRHE 1DN0A 2XZQL 3RIAF 2SEBB 3AB0C 5DD6A 2GCYB 2AJXL 4PJEE 1RURL 5KBNC 1GHFH 2V5RA 2NYYC 3L3DA 1N8ZB 2NY6B 1OD7A 4G8IA 1BJ1H 1P6AB 3JWNC 3O4OB 4R2GB 3TIDB 5HYIA 3U30C 1RK1A 4ZXBB 2WQRA 3ROOA 4JM4L 5GRUH 4Y0GA 5IMLB 3X3GL 1GGCH 4TN9A 4LHJB 3JZ7A 4A2MA 1ODAA 4NPYB 5B3NA 1QSFD 1J8HE 1B0RA 2YXMA 1OF2A 4TUKH 4Z7OF 4AT6A 2NLJB 4GQ9H 4BZ1L 3OZ9H 4HQQL 4PJFA 4QWWC 1H3XA 1V7MH 3ULVF 2UWEA 2WUBH 3QDJB 4PJGF 5IEHA 5IOPA 1ZHLA 1EHLH 4JB9H 3C8DA 3AS3A 4IRSC 3GSXB 4UBDC 3S98A 3O81A 3RKDC 4U1HA 5E00B 1NGQH 5CSZB 5EC1A 4PV9B 4XVSL 3G5YB 2H2PD 3VA2C 2BOBB 4R7DA 2XQBH 3L9RA 4ODSH 4I0PA 3L6FA 2VXUH 3Q6GH 2FIKA 1LQSR 3IU4L 3MODL 2FD6H 4XVJH 3W39B 2H26A 2VLRD 4AG4L 4Y4KA 3INUH 1IGJA 2G75B 1N6VA 3H6JA 3WN5B 3M1BA 4XNZB 4DUVA 3UTPD 1AKJA 1RJLB 4WGWB 3X3GH 3B9KD 1GAFH 4UU9B 1A0QL 4RFOL 2VR4A 2PW2A 1AGEB 1ED3B 3CJJA 1QRKA 1WFNA 3SQBA 5DF0A 2A6DB 5D8JL 1H15B 3SBWC 4UIMB 5JIHA 3C8KA 4Z7OE 4P3DB 4OCYH 1YY8A 2AVGA 8FABA 3EO0B 4LLMA 4QHNA 4V1DD 3HUJE 5EC2B 4XXDA 3WLBB 1F4XL 5ISZB 1FLTX 4XNYH 5IHUH 1DBBL 1IVLA 3EYOA 4MLSA 5HPMB 3GK8L 4JN2A 2Z91A 4R4FL 3IDIB 1K9TA 1MIEL 3DX7A 1FP5A 2YEZB 1UH2A 4WO4A 5JW3H 2KKQA 4HHAA 1J7VR 2IMNA 5E6YA 5BV7B 5BW7C 2GFBB 2DS4A 3IDJB 1ZSDB 4WV1C 4WW2C 4LLQB 2HG5A 4G9DA 4HX1A 4IRZH 3V4UL 5ITFB 2FX7H 3QQ9D 4XAWH 1I8KB 3QIBD 1PY9A 4O02L 3VD5A 1FNGA 5IG7B 5T3ZH 4EOWL 1HZHL 5E8DH 3RNKB 5FHBL 1OTSC 4NWTL 5I1AB 3BDYL 5ACLA 2VQUA 5EZLA 3D1MC 1H5BA 5CGTA 5IV2A 4CVXB 4ORGB 4FHBD 3KR3L 1X4XA 1RUAL 1AXTH 2EIBA 1XGTA 4K7FA 5JZ7D 1VADB 4QOKB 4UV4L 4PJ7A 3VMNA 3Q3GB 5F6HJ 3F65A 1QSEA 3ULUE 4OZIB 1U8LA 3T65B 1AGFB 4TVPE 4TSCL 4X80L 2F53E 3D25A 4PJIF 3O6FC 2R69H 2ESVD 5BO1H 4OM1H 3O41A 4YXKH 1K4CA 2F54A 4F3FA 1BLNA 1FYTD 1QVOA 1CFVL 2B20A 3BFOA 3B3IA 3LKOB 1YMMD 3BN9C 5ECJE 1EEYB 1WIOA 1YPZE 3PUCA 4X6FA 1UT9A 5E2WL 4RGMB 2EDDA 4ZFOA 2ADFL 3ARBD 1L9NA 2CR6A 3U0WH 1MFDL 2BNQB 4U1LA 4CJ1A 3JV4B 1CU4H 4WVRA 1JTPA 2XZZA 4K94H 4MNQE 2BY3A 1HILB 1DANU 3SDAD 3NAAL 1C8PA 4GQ9L 5D2LA 2R1WA 4BZ1H 2DQIL 3SDXA 4L3CB 1BQHB 4I77L 1FSKB 3IS1X 2N1KA 4QGTA 3K81A 4ZG1A 4WHTB 4RRPA 5GS0L 3MLXH 3VFOB 4L5FL 5IROC 2D9QB 1INEL 4HXBH 1D6EA 1FQ9C 4Q97A 2ERJB 1WTGT 5E5MA 3VD4A 4JR9H 2EYRB 2ZCKL 4M1GH 5CKAA 2OQJB 5KOVC 5ICYB 3BH8B 3OPZL 5AWNH 1UXWB 4H1LG 3H42H 1RJYB 3UJTH 4NFBA 4JDTH 4J3TA 1MJJB 3I02B 3C09C 4YBLB 3VWJC 2OM5A 1WAAE 4NCC1 2XN9B 3O3DB 1YC7A 2NNAB 3P9WB 2ICEB 3W5NA 1GC1L 1TNNA 4U2ZA 3S34L 2WBJB 3OR6B 3CU7A 3MCLL 3T0EE 3W9EA 4EI5A 2Z8SA 1AKJB 1B6UA 3ARFA 4HV8B 4X98A 1AI1L 2H3NA 3KPMA 5IBTL 4HCRH 1II4E 3DPBA 5SWSA 1ZVHA 1NCWL 3S3PA 1O5DT 2FZ3B 3B5GA 4N0UE 5GS1B 1U3HC 3P30L 2PNDA 3ULVC 2XICA 2EIEA 2D9CA 2DL9A 2DLFH 3GSUB 5KN5B 2W0KA 1HOCA 2Z8WC 4R4BB 3E3QE 5L2JA 5BZWB 3QPQD 1GZQA 3QHTC 4M62H 3BZEB 3O6LL 1CE1H 4DZ8B 4NCDA 1RJLA 4G8GE 4DN4H 4Z7UF 5D1XC 1GGTA 5F7UA 3VE0B 1HHHB 2WBJC 3PWPE 2BFVH 4OGXH 5E4IA 3RTQB 4AH2A 3BKYL 4LSDA 5EIVA 4YQXL 2ZG1A 2FIKB 4UI2A 5AG9A 2C1OB 1EEZB 3SOBH 4XH2A 3HZKB 4QRPA 5CINL 3UTZA 5ITFA 4MJ6A 4Z5RB 4MDJA 2VB5A 2P8LB 3HE6A 1R6VA 1J8HD 4JN2B 2DLHA 3GSQA 4ODVL 2ADGB 2E7LC 1IKNA 4MNHA 1AY1L 1FGVL 5JIKA 2ORBH 1BJ8A 2YEZA 5CZXC 3WNOA 1I4FB 2LE9A 4M02A 5FGSA 5ESQB 4XHJC 3B8SA 1O0VA 15C8L 4LARL 1G7PA 3FQRB 5DD6B 1BQUA 4YWGH 4U1NB 1SYVB 4MA8H 4WEUD 4LARH 5C0JA 1NFDA 3UJTL 2HAZA 4MXVE 3CLFH 1VGKB 2JB5L 3TBSB 2YPVH 3SCMD 4DVRL 4JRYB 2FO4A 3V9FA 5C08E 3G6JF 3PDOA 1ORSA 3TCLA 2BVOB 4Z76B 1SBSL 3QUZD 5IMMB 3SE3A 3VG9C 3RPKA 4YHKH 2HFTA 3ARBA 3DYPA 3B9AA 4X6CE 4M93C 4XCNA 5E8EA 4CAGA 1HQRA 4PGBB 3PQYE 3KLHC 1TJHL 4JFDE 3D2UB 3SE3C 4Y16A 3I6KB 2FEEI 1CQYA 1KYOJ 4D0BB 3DXAA 1AO7D 4G7YH 3U0PA 3VXPB 3KPSB 4DKFH 3JTTA 1XGYH 4GG6E 5C09A 3EDEA 5EUOB 3MNWB 2YWZA 3MCKB 4LCUB 2ATKA 5IEHB 5K9QG 3FFDA 4MCZA 3PP4H 1BQHA 1ERNA 5D7JD 1U0QA 5HDOA 15C8H 5IHZA 2F8XC 2VDOL 2YD3A 2K1MA 4GRWE 4KKCC 3TO4C 1ACYH 4NQVA 1RZKL 4UT9L 2O5XH 3FB8A 1Y0LA 3V4VH 2Y6SC 1CFVH 4U1HB 3CUPB 3ZYZA 2E7LA 3LN5A 3BPNC 4O58H 4HH9B 5C9JB 5BZDB 4UDUB 3PDDA 3AGVA 3IVKB 4BYHA 2BSSA 3HS0B 4HCRA 1I9JH 2PCPB 3LEVH 3IDNB 3QXAB 1TTGA 4LMQI 5E95B 2MJWA 2J4WH 1OSZA 4ONGH 2ILLA 4IOSD 5JOPD 3QIBA 3Q6FA 4NKIL 1JN6A 4LP5A 5IVZB 3FT2B 5JTWA 3UBXI 3EBAA 3VFNB 1IT9H 1Q9LA 4GMTL 4H25A 2ZJSH 1LD9A 2R1XA 1KXVC 2XN9D 4NKMA 4XNYL 3OAUH 3UYRL 3EJJX 1LEKB 4CW1A 1KCVL 2FBJH 1LWRA 5KOMC 4P48A 2N4IA 3L7FB 1AGCA 5D7LB 5IMOA 5KSVB 4HS3B 3MV7A 4K8RH 1GYAA 3KPQB 1KF9B 4XXDB 1MCWM 4WW2F 2HLAB 1CD1B 2IPUK 3QDGE 3EUUA 4DGYH 4XP5H 2MCPH 3MR9B 1FNLA 4ZYKB 2A9NL 1NGXB 2EICA 1UWXK 1ZLWK 2VXTL 5DRWA 5LWYL 5DEGA 3JVGA 3VWKC 2BVPA 5EC2A 1KJ2A 4X0KA 4KRLB 5CGYC 3QH3A 1RU9L 2HRPH 3UBXA 3PV6B 5HYSG 2NY0D 3MXWH 1XEDA 4MB3A 4JQIH 2X05A 2VLKB 4ONOA 5EU6B 1OB1B 1KIPA 4XI5D 4GG8B 4LLYB 4LEXL 3EOAA 4QKXB 1EHLL 4OSUH 5ABDE 5C0ND 3GSOA 3IS0X 3WHXB 1IC5H 1QBLL 4UT7H 1OSPL 5HHVH 1P84K 1LO2L 4Y4FB 1KTDA 5IV2B 2NW3B 3ZT5A 5L7XH 1J8HB 3FO0H 5IF0B 4D94A 5F7WC 2LU7A 4FQ2H 5BVPL 1JV5A 2FD6L 4YDVB 1FNGB 5IG7A 2V5SA 3PGDA 5EO1B 3RIFF 4JFZH 5IB5B 2FH8A 1Q38A 1UJ3B 4LKXA 5D71H 1T5XB 5C0EA 5M95B 4JFEB 3C5ZD 5FOBA 5J1AB 3TN0B 4O2FB 3U0WL 5E8DL 2VZTA 4L1HA 2CDEA 1CGYA 4KKBD 4G6JL 1OGTA 4PBXA 1C5DB 4LCIL 3ZO0A 3WSQH 1A1MB 4LLUB 4YBQC 2ORBL 3ZSTA 3VXNA 1S7VA 4MJID 4ENEC 2YPLE 4YAQA 3WDJA 2EEDA 1XR9B 1W72H 1F90L 4ZS7H 3ARSA 4QHMB 4ALAL 3NIGE 4ZFGL 2OI9B 1RULL 2A2QT 3QUYD 4X9HA 1LE9B 4X9GA 4Q6YA 3FQNB 5DO2C 4BFIA 4Z78B 2JJVA 4K2UL 4JM4H 5IMMA 3W0WD 1B4JL 1OARL 3B2VL 1KN2L 1H5BC 5JOEA 3OKLB 3NGBC 4PV8A 1ZA3B 1YUHB 1RUKH 2OQJA 2VTFA 4XPGL 4RGNB 4LSRH 2J6EA 2A77H 2OTWA 3GJEB 4H1LH 1MLBB 3NFNA 1MFEH 4KROB 2ZUUA 3MJ9L 3SKJL 1HEZB 4JFEE 2GJ6B 3VFOA 1XCQA 1D6EB 1P9MC 2I07A 3TZVC 2I9TB 4LSUL 4PRBA 1FC1A 2P1YA 1QFUL 3SKNA 1A1NA 5ESVB 1BZ7B 4GRWH 3MLRL 7CGTA 1UVQA 5DJ2A 3O3EB 3O6FD 4M8VA 3DOSA 5SWSB 4MYWB 1JHLH 2VLLA 1UC6A 3C5SB 3W81A 5DD1H 4J8RB 4ODSL 4MVBC 4KK5C 3ZT7A 5JPNA 2VZOA 3D48R 5HI4D 2HFEA 4NRZB 4G9FE 4XX1G 5D1ZB 5L88H 2MPAH 2M26A 2ZSVB 3BXNA 2K7PA 2Y6SD 3SJVD 4LNVA 3MTRA 4XI5C 4CU8A 3FRPG 4PJ8B 1B88A 1ETZB 4OCNC 3VXUD 2IANB 1A9EA 5IK3B 1YEFH 1S9VA 2N56A 3SO3B 3KHQA 5GGVL 5GS1A 5K9OA 5DT1H 1X5AA 5HYJA 4QYOA 5LGHH 3TH3T 5FK9B 4L3EB 2AEWA 2PR4L 4BH7B 4R4BA 4MAYA 3F6LA 1A2YA 3B43A 4PJIB 1UM4H 4NM8H 3QCTH 4OKDA 5I16B 1HYRC 4CMHB 2CIKB 4N90E 2FJGA 3CLEH 3SE8H 3RWHA 5HBBA 2XYCA 2O93L 5TE4L 2GSIB 3I84A 1CDGA 1OSPH 3FOLB 1WV7T 1NAKL 4KTYA 4LFHG 2VH5H 3AXLA 2V17H 3D9AH 4ZFFB 5FYJL 5FA4B 4RWYH 5TDPA 5HD8C 4ZTPH 3G5VB 2YPLA 1FZKB 1UACH 1DQDL 4G6AC 5EUKA 9CGTA 3MMEA 1UJ3C 1LMKA 1B0GB 3DGGB 1RZ8A 5IB3A 3MPCA 2DM4A 4ZDHB 4OCWL 4R96B 5DTFB 4HXAL 1RU9H 2HRPL 3LN4B 1PLGL 2NY2C 1UZ8B 4HKJA 1IAOB 4GAYB 2WWMC 3GZKA 2P5EB 1I3GL 3MOAL 4KKBC 2UUDK 3BUYA 3LMJL 4GAGL 1T5XA 5C0EB 3CCHB 5F6HI 3O2VH 5IIEA 3U1SL 4H1LB 3QCTL 4HAGA 1F6FB 4HGMA 1UWGH 1A14L 3BP4A 4GO6B 2EE9A 1G6RL 4OCRH 1GGIH 4GXUM 3D2UA 3ZL4H 1G7MA 2WBWB 1A7OL 4PJ5A 1QLRA 4DZBB 1VFAA 1HSAB 1GCFA 2FECI 4XZUA 4XNQB 5ERWB 2FB4L 4RFNB 1T89A 1QLEL 2YN5A 1D9KA 2X7LA 4JKPL 2XN9E 4LLWB 3F5WA 5IWLC 5E2TL 5CJOL 1FL6A 4F7CA 2PYED 3HG1A 1U8MA 2VOTA 5CJOH 3WN5C 2IAMD 2FHBA 1DBML 4JZJC 4MNQD 5T1KB 5IVNA 4FFYH 1CXLA 1W0WB 4U1GC 2NW2A 3DRQB 1Z9LA 1AQKL 5DRNA 3LZFH 5DJAB 2EC9T 3QJFA 4K2UH 4XXCA 2EDWA 1DQJA 3ZSSA 5FECB 3DMMB 4MCYB 3V6OE 4Y2DA 4AL8H 2Q76B 3D0LB 1YJDC 1PBYA 1UWEH 5C0RL 4JY6A 4M6NL 4TVPH 2VDRL 2BMKB 4P2CG 3NFNB 5J13C 1DBAH 4OCSL 5E6ZA 3QFDA 3ZE1E 5C09D 2LQRA 3MO1A 5JHDE 3QUZB 5DMGD 4Z7UB 2AJSL 1FG2B 5ICXA 5I1AA 5DRZA 3SN6N 2JK5A 5HYQB 1G7QB 1JGVL 4Y19E 2CRYA 5KG9B 3FQNA 4FQXD 2KQMA 1I1YB 3NZ8A 2CO6B 4OGAC 3CIQA 1MQ8A 4RWYL 1I7UA 4U6VL 4HBQA 2V17L 1EJ6A 3UX9B 5AWNL 5D1XD 1U42A 3Q6FB 1PZ5B 3JWOC 3KPSE 4F15C 3H9HB 1A7PL 4BQ9A 2IFFL 3S37X 1G0YR 3VFVA 1LD9B 3PNWA 5I6XB 3IFOA 4HS8H 1DN0B 3MLVL 2C4FT 4Q2ZB 1TLKA 4PRBB 5IK3A 4PS4H 4V1DA 1NFIB 4ZD3L 1AGDA 3MRLB 3FQWB 5CSZA 3FO2A 1MNUL 4AM0B 3DSFH 1MCBA 3QQ3A 4KUCD 1UKTA 2H1PH 4Q9QH 1V3KA 4ZAKA 4X5WA 1BM3H 5ILTL 4I0KA 4BFBD 2XA8H 4AEFA 4G43A 3V7MA 1MCDA 3KVQA 1CL7H 4J8RA 1DUZB 3RVWD 3TIEB 4OFIA 4PBWD 4JQVA 5D72L 3VU2A 2VH5L 2NQCA 2WINA 2VERN 1A1NB 2RHEA 4N0YL 5ESVA 4Z7WF 2XT1B 5GZND 4X6CB 4RMUA 2EKJA 2DQDL 2XG4A 5A16B 3OJ2C 2NZ9D 2Y36L 1R3HA 2X9XA 4Z9KB 3RQ3A 4R4NC 5CEZD 1RFDH 3GFUA 4ZSOB 4GG6F 4P4KD 5EUOF 1CFQB 1C5BH 3EOAB 4JREB 3V5KB 1WBYA 3UTTD 4Q0XL 1J1OH 1FJ1B 1YECL 4XRCA 3BGAA 4KHXH 3PG2A 3GMOA 4YHPA 1LO5B 5DURD 2NW3A 2GAZA 3ULVE 4ZO6A 1AGEA 1ED3A 4KXZH 1XF3B 4Z95L 2D4FA 2AJSH 3QUMB 2APXA 5ENWB 3LPFA 2VDNH 3MBXH 2LFGA 2CLRA 2B5IC 1BHGA 2ITDB 3HNTL 3VI4F 4CVWA 1NFDE 5DWUH 2Z93A 4LLQA 1WWBX 1IGJB 5JNYB 4Z8FL 4J3UA 2ICWI 3SE9L 5EU7C 2CIKA 1G1CA 4P59L 1VPOH 1G1YA 1K4DA 1MJUH 4PD4J 5FV1L 3H9YA 5E08H 5GGTA 4P46C 3IKCB 2A9NH 5DTFA 5J4MA 3QAZB 4YUEL 3QHZL 3TYFB 3GRWL 3MRHA 4NZUH 5D2NC 2PXYB 4OUUA 3DETD 3DMMC 5BS0E 4Z77A 3GSNL 1W0WA 1OPGH 2XWTB 3O8XD 3WFHB 2Z8VC 5I76A 3A0OA 1DLHB 2FO1A 2IH1A 1CD8A 2GTWA 1MFEL 3RUGE 2O5ZL 3OMZA 3CFJB 3MRKB 3TVMD 4BZ2H 3QDGB 4X6BA 1WWAX 1HH6B 4S1QL 1EO5A 3OXRB 4O5LL 2OR9H 3QIUD 4GAJL 1CGSH 4X7DC 5HI3C 1UWGL 4G8GA 1DFBH 3OL2A 1CI5A 4HXBL 1H8SA 3MO1B 4L8DA 2X4SB 4Q6IC 4FFWD 1F11B 5GS0H 4NJ9L 2ZPKL 3ECBB 1S9WB 3FO0L 3MRJB 3F58L 1NJ9A 2XZCL 4B53A 1OCWL 5HHPA 3I50H 4FP8H 3WIIL 2GJ6D 5T33L 1QYGH 3T09A 3PF2A 2YPVL 1G0DA 4C4KT 3LD8B 1D9KB 1HHGA 5D1ZD 4XTRD 5SV3A 2B2XL 3IRZA 2E8YA 1UZ6E 4R9HA 4TNVF 5F1KC 1P4LB 5SWSE 1MI5E 2X1OA 3STBA 1UKQA 4Y16C 5DFTA 2YMXL 4YHLH 4IIQA 5EZJB 5DLMH 4W6WB 4F9LC 4NQXB 1DL7L 2XY1A 4XCFH 4U6HA 3UMTA 3NCMA 5E5MB 4HQQH 5FM5M 1PY4A 1QFWH 4OV6F 1EPFA 5GS1C 4G7YL 1NCCH 2AXFA 2NX5E 1OAUH 2BC4A 3KXFE 4OLVL 3G08B 2E27L 4KROD 3BO8B 4NHUA 1S3KH 1OP3K 3ET9F 1HNGA 5KVDH 2GUOB 1T83C 5CZVH 4JVWA 3TNMB 3EJYC 2IMMA 2VIRA 1UFUA 1EO8L 4P5TC 4YJZL 4PRID 3PABB 3PWUA 5HGHA 4NQDA 2WAHA 2VR5A 1BJ1J 3AMKA 3MUZ1 1LDPH 5L8LB 1M71A 4FTVD 4XNXH 1EJOH 2BVYA 3W9EB 1NCBH 1A4KB 1P4IL 3HE6C 5DMIL 3MGTA 1WK0A 1WUNT 3O6LH 1CTNA 1HN1A 4W4NA 4L9LB 1N5AA 2AK1L 5IB2B 5HPOA 4LFHD 2HT3C 2VWEE 2R8SL 4HH9A 4NO0B 1ZLVH 4X7TB 1I7ZA 3V2AR 3UJJL 4KJQD 4PJAF 5CS7A 4OCSH 1ROWA 4R0LA 2Z4QA 1LO4H 1OP9A 1FN4B 4NZTL 1YN7B 3ZT6A 4P5MA 3PQYD 3U7WH 1TENA 4JG0H 3TWCH 4NDMB 2R9HD 3IXTA 1HQ4B 4BQCA 2EDTA 2P5EA 3R0MA 2EH8H 1UB6B 2G60H 4OD1H 1JGEB 3MA9L 3OAYK 4NHCL 1AE6H 4O5LH 3I3BA 3VGHA 1KG0A 1MAJA 5J8OA 4OD3H 4P3WA 5FDWB 1QNZH 1VFBA 2G5BA 3N1GC 3EJYD 1QSEE 1NLBH 2AJ3A