1S7QB

Crystal structures of the murine class i major histocompatibility complex h-2kb in complex with lcmv-derived gp33 index peptide and three of its escape variants
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Determination of structural principles underlying three different modes of lymphocytic choriomeningitis virus escape from CTL recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 12
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s7qB00
1AGEB 1FNLA 2B1AH 1H3PL 3W81A 3QIWD 3RY6C 4OZHF 2WM0A 3P0VH 4Z18A 1ZT1B 3SE4A 3GGWB 1EDQA 1I4FA 1U58A 2NX5D 4BSVA 3W82A 1TVHA 1YY8A 5EO9A 1HWGB 4PJIE 4D8PA 4YEFA 3QWRD 1HHJA 3NIFF 5D6DA 4BZ1L 3SDYL 2JIXD 3WFZA 1HQRB 5E56A 3UTOA 1HINL 4C83B 5BVJB 4XP6L 4P5TD 4DN4H 1NMBH 3QIBC 2J88H 5I16B 1I1FB 1SEQL 4O4YH 3S5LB 2DM4A 3NABH 1MEXH 4ZDHA 4BZ2L 2HN7B 4ZAKB 1DQDH 2A6IA 4YUEL 2BNRE 4PGCA 5T1LB 4ZS6C 3HA0A 2VWEE 1RJLB 4KVNL 4RRPA 5GSRB 5MEOA 1ETZA 4NQED 4OZIE 3SKMA 2ED9A 2J4WH 3MLZH 4J4PC 2NX5A 4N0YL 1GGTA 5LXGL 2YOCA 5EC2A 1GRWA 5JUEH 1DR9A 5IBTL 4YC2B 1IC1A 5I1KH 4HUWA 3K0WA 3QWRA 4WHDA 1JI1A 2QR0A 4GXVH 1JWUB 3OPZH 2JIXA 3FKUS 3NFNA 2DLTA 1PJ9A 3NAAH 4AEIL 1NBVL 1UB5A 1UYWL 2BC4A 3LS5H 2ESVD 1U3JA 4P5TA 4M43L 3S96B 4DVRH 2YSSA 2GJJA 5EPMA 4ZFZB 1R3LB 3WO4C 2VDOH 2CK0H 3QA3B 5JPMB 4IMKC 4HWBL 4H8WC 3T0AA 1B9ZA 2VLRD 1M7DB 5CINH 2NXZC 3H9YA 1YC7A 1DBKH 2FJFA 2G2RB 2CUIA 2PTVA 1E27B 2FX8L 3ZKND 3OHXA 4NQEA 5L8JB 4OQTA 3ULSB 1ZHLB 5F6IB 4CVUA 3SE3A 3RNQB 4OCLC 4IDLA 1CD9B 5DMKB 3SDXF 4AG4H 1A64A 4LASH 3RIAF 5KZCD 2HFGH 2NR6C 2JTDA 2V5RA 3MBEC 1NKRA 4PLKC 3L5HA 5CD5D 1OP9A 2ESVA 1WT5A 5DD0H 3QQ3B 2RQ8A 1T20B 4FN0A 4LARL 1IEBB 1BBJB 5GQBA 3D85D 4ALAL 3MA7B 1DTUA 1OAXH 5KN5A 1NCWH 3S37X 5DWUH 1KPVB 3U7YL 5F88A 2VLRA 3VG9B 1FLTX 3RWJB 5CS7A 1IL1A 1OM3H 5ELIA 5C07B 4M5ZH 4LRIC 5IJVA 4JCMA 1S9VA 5TDOB 3V5HA 2R0ZH 4XNYL 3IKKA 4WV1B 1ZA3A 1KLGB 1A6UH 1Q0YL 3SKJL 3WIHA 1HHGA 2WQ8A 1GC1C 3QIWC 5B21A 3U7AA 2APFA 3C9NB 1FAIL 1KTDA 1ZLUH 1VGKB 12E8L 1G6VK 5GS0C 3S37L 2D0FA 3QYCA 1MCWM 5L2JA 1YC8A 3KYMB 3MV8B 1A4KA 4RISH 1MCEA 2HWZH 2C4FT 2ITDB 2VZ3A 3BKYH 4U1JA 3D85A 4ONHB 4JFEA 4XB7A 4KRNA 4ONFL 3O45B 4XGZB 1L0YA 2P48B 4JHAL 3RU8L 3VXMB 1L7TH 2X1QA 5J06A 4R97B 2DL2A 5FGBC 2GT9A 3PWPD 2Y1VA 3B4NA 3TJHC 3ZYIA 4R2GB 1IT9L 3P4OA 1DDHB 4EXKA 4M9OA 2D9QB 5ESVB 3KXFE 5C0EA 3HPJA 3IFOA 3MLWL 1VFBA 4MMXC 3FOLB 4S2SB 2CR6A 4S10A 3IU4H 4X7DC 5IFAH 1RUQL 1GGUA 2BVPA 3O3AB 1OY3B 3F12A 5EU7E 4F80A 2V2WA 4KDTA 5IEKB 2YR3A 3P11L 1DFBH 1X7QB 3MX0A 3BP7A 4G80A 4MJID 5F7WC 1MHPH 3GI8H 5IESH 3TNNB 2J6EA 5FGSA 4HV8A 2H3NB 4U1NB 1BFOA 3MLRL 1T2JA 4F37K 5IJKA 3CDFA 4I77H 3MJ8B 1UC6A 2Q76A 3SKNB 1HSAA 4EN3C 1E6OL 1Q9OB 1GH7A 5DVKA 5TFSL 3PWPA 1QSFD 2VC2L 4JFPB 2IBGA 5DHYB 3MRIB 2IPTL 2OQJA 4Z95L 3SO3C 4OLZL 3U0PA 1TTUA 3V0AC 3UPRB 7FABH 3CFIC 5TE7L 4OCMC 3V0VA 5T5FL 2APWA 4NQCA 3FMGL 5E00B 1MJJB 3IJYA 1KJMA 1I7RB 1BEYH 1AKJB 4P4KB 3MFGB 3MGOB 4MJIA 4NBYB 5J9PB 4MLSA 2JCCA 2VQ1B 4ZUVA 1QBBA 3HRZB 4NQUA 2R23A 4FQHB 3CGTA 4F3FB 3VI3F 5CBEA 4FA8A 4CN4A 4ZG1A 3LKPA 4LMQI 4X6DB 4YBQD 2BRRH 4Y5VC 1QSFA 4R26L 1N6QH 1U8QA 1RIUH 2F19L 4M1DH 1BVLA 2O93L 4FG6C 3O3EA 3IDNB 1AO7E 3CFBA 4O00A 2XIDA 5KSBA 5IB1A 3RL2A 5B38B 3NZ8A 3I6LE 4O02L 3T3MF 1N64H 3ZKMD 4N0UE 1T22A 1CGVA 1FV1A 3BN3B 3MV7A 5E2WL 1F58L 3O3UN 4JHWL 1C1EH 3PGFL 4OFYD 5JHDD 3I6KB 3EKCA 5L9DH 2ICWJ 4KROD 2DQCL 4M48L 4JPKL 3DX7B 5I1DB 2AGJL 4IIQA 3QDGD 2YPLB 1UCTA 2ADFH 4NNYA 4PBWD 1IEAA 4P5KB 5JW5B 3PP4H 4KI1A 4P2QD 4R7NA 1HWHB 4IRJD 1NAKL 3UBXB 1TDQA 5C70A 1JN6A 2AK1H 1Z6JT 1VFAA 2ZG1A 3QJFA 1I8KA 5DRZA 3ROOA 5ADPL 3F7VA 3KWWB 3VFOA 1WFTA 4JKPL 3QQ4B 1K8IB 3GNML 3RL1B 5C0CE 3GSOA 3UAJC 2YZ8A 3RX5A 4ZUSA 4FMFA 4OFYA 5ISZB 5JHDA 1X5JA 1YUHB 2EE9A 3LKRA 2F53D 5CJOH 5IB3A 1UWGH 5FYJU 4G5ZH 3RDTB 3K46A 3WIFB 3FO9B 1OQXA 1MF2L 3ZHDA 2D7TH 3PQYD 3UO1L 3QDGA 1XF1A 2P43B 1EPFA 1EGJH 4HJJH 4JFYA 4M4PA 5C0BB 2QQNL 1IM3A 4JO2L 1RJZA 4GS7B 2EEBA 2JB6B 4P2QA 2OJEA 4IRJA 4JM2C 3PL6D 1WQVT 4MDJB 1JUFA 4KWUA 4U6XB 1KN4L 1TENA 1JE6A 4K55A 5CIPB 4WW2C 3BH8A 4FABH 1NFDB 1FGVL 3ARFD 1FC1A 2HLAA 4U3CA 3QFJE 5LVEA 4X6DF 1V3MA 4DTGH 4KK6D 2F53A 4Q6IA 1LWRA 1IGYA 1E6JH 3VXRD 1N8ZA 5DJZA 1Q9WA 1YMMA 3MO1A 3O6KL 3T8XA 5JOFB 3PQYA 2D0HA 1FH5L 1G7PB 1T7XA 2X7LA 3C2AL 3Q1SH 1NGYA 4JQIH 2ORBH 3G6JF 3HE7C 4ODXA 4L8SC 3BH9A 1NGWB 1KTKE 1NUGA 4MSWB 5FYJE 4Y5YB 5C6WH 2D0GA 4LOUD 2JE8A 3PL6A 8FABB 3N1PC 3QUYB 2FNBA 1DLHB 4XC3H 5FGRA 4ZXBB 1DL7L 5HI4D 5EZIL 2IG2L 1RZ7L 3O2VH 1A9EB 3STLB 4WI5A 5GS2H 3ARFA 4G7VH 5INDB 2A9NL 5ERWA 5BZWA 2ICWB 4S1QH 2CMRL 3LQAH 3QFDB 4RCAA 4BELD 3U46B 2FX7L 3FHAA 3QUMB 4GRLD 3TPUB 1WAAE 5D71H 4I9WE 3A67H 3A6BL 3CU7A 2E8ZA 3KJ6L 4AMKL 4JG1H 4PRBA 2W38A 5IVXF 3C60D 4MXWL 4WI4A 2EDXA 4OAWB 2BFVH 2XQBL 3UJTH 3G6DH 5J1SC 1TJGL 1MLCA 1XGUA 1FL3B 4G6JL 3HUJA 2AJUH 3Q6GH 4Z7VA 4K2UH 3KLHC 4HC1H 1JNJA 2L7JA 1CWVA 2EYSB 4MDIB 1RZIA 5FM5M 3ZKSD 4M9PA 1MCFA 3FQWB 4PJ5B 1ACYH 2FJHB 5IT2H 2YN3A 1JF1A 1K5NB 3IETA 4RZCB 3B2VL 4FQ2L 5IB5A 1YEJL 2FD6H 4X4XB 5DZOA 2Z91B 4HZLB 1ZGLA 1MFCH 4GRLA 1WZ1H 5IMKB 3DMMB 5IM7A 1UB6B 1RZJH 3JV0A 2YRZA 4LP5A 1Y6MR 3C60A 5C0GA 4YE4L 5T3XL 1Z9LA 3N85L 3UJIH 4R96B 3T09A 3LVEA 5K9JH 4HXAH 1SVCP 3DOSA 5J1AB 3JTTA 3GSQB 5D5ME 2NLJA 2AJXL 4P2OA 5TDPB 2DJUA 4FQ1H 4QRTA 2GTWA 4LSVH 1S7VA 1MCNA 4M1GL 1K3IA 4EQ3A 4EI5B 3OJVC 4N0FB 4LSDA 4XVUD 3VXSE 3RNKB 4RFNC 4JQXA 2H6PA 2ATKB 4LVEA 1EHLH 1Q9LB 3HS0A 2DLHA 2D2OA 4GAJL 4PJ8B 4YHPA 3TF7C 4ENED 2GY7B 4K94L 5F7EH 3C6LC 1MAMH 3PGCB 5DJ0A 1U3HC 3FT4A 1FFRA 4M1CC 2BNQD 4W6YB 3TCXA 1UEYA 4KRMB 5ESAA 2WUBL 5J6GA 5I1LB 2O5XH 2HFFA 4GKZA 4BQBA 4LOUC 4MD0A 4F33A 1I8IA 4HIXH 3FONA 1M71A 3EJZD 3CVHB 3PWUB 5HGBA 5F89A 5LQBH 5GZOD 1S7WB 1JGUH 4OKVB 2GTZB 3O4LB 5IQ7H 3KGRA 5CKGA 5EUOF 3AAZA 1NL0L 2GITB 3QUXB 4H88L 5IHZB 3H42L 3G6AA 4YDLB 5CEZD 4IS6A 4Q2ZB 5FYKU 4HH9B 4DKFH 1R3KA 5FO8A 4TRPL 4NYLA 3GSNB 4WI8A 1JZ5A 4Z7QE 2BNQA 1A7PH 3DX9A 4FQCH 3RGHA 3BD4A 4MNQD 1R3JB 4F7EA 1PSKH 2B4CL 1BD2B 5IGXH 4DAGL 1N5AB 4V1DD 5DEZA 4UIMA 4NO5B 3VFNA 3GMLB 1NQBA 4OD1H 3QNZB 4L8BB 1ORQB 1UACH 2J2ZA 1INEH 2NY2C 4PJFE 3T2NL 4LSUL 4JZJA 1NMCC 4K23L 3NCJL 3TWCL 3U0WH 5GGVY 2XWBB 4Z7UB 2DBLH 3NOIA 5BO1H 5B4MD 1QFWH 4MA7H 3THMH 3VFGH 1JV5B 2ZUUA 1GIGH 3WE6B 1DANU 3BO8B 4XNQB 3RWFB 1X5XA 4N90D 1FG2A 1HHIB 4FMKA 5E8NA 4JANA 4MNQA 4U1IA 5FYKE 3H3BC 3CVIH 4RFOL 4XH2B 5HGDA 3HB3D 2J8UF 3U2SA 1VFOA 4U1GC 5MEPA 1KENH 5ALBH 5DVOA 3TN0B 1LK2B 2IALB 4ZPVA 2NY5L 4V1DA 4PJDB 4OLYH 4XT1C 1Q94A 3GJFK 1EXUB 3NGBB 3HZKB 1MFAH 1MCOH 1U8IB 1DBAL 1FVEA 1CDYA 4RSVA 2BDNL 5I1EH 2ERJC 1JGVL 4P48A 4GKNA 2N4IA 1Z9MA 4HF5H 1P53A 5I17A 3RWGB 1TVBA 4N9GA 1G7QB 3NIDE 1ZANH 5C09E 4PBXA 2PXYD 3RVUD 2W1NA 4M6OL 4JN2B 4HUXA 2KBGA 4DUVA 2EKSB 3LV3B 1I3RA 1RPQA 4LAQH 5EFIA 3RVTC 4JR9L 3O2WH 2XTJC 2AABL 2QADC 1WBXB 1Q72H 3L6FA 5AZEL 5KSUA 2D7NA 2FBJH 4MAUH 4PJ7B 4X6CF 5E6IB 5F7UA 3QNYB 5DJCA 2Y5EA 2OZ4A 3H9SB 3R0NA 4UZGA 4MNHA 2H8PA 5GS1B 3AXLB 4P2RB 5BOZG 1TZGL 4MGXA 3GMOB 4UIKH 2X2YA 4M8QA 4KKCD 5CP3H 5T3XD 5JOPE 3GBLA 1N6VA 1U8MA 3KPSB 1F4XH 1Z2KA 4OCSH 2X40A 3O6ML 5I1GH 2PXYA 3H3KA 2C3HA 1JJUA 2H2SC 4YHIA 1J5OL 4U3HA 4ZODA 1N3NB 1A2YB 2OL3A 1A7QL 2A9ML 4PUBL 4S11A 5L0QB 1FGNL 1CFTB 3GMQA 1OPGL 3SOBL 1WWCA 4LGRB 3UROR 1AC0A 4PGEA 1T2QL 1IGCL 1KIRA 2NY6B 3O4OB 2DLFL 5EBWA 5KSAC 2DIAA 2EXYC 5CHNB 3IDGB 1EK3A 5JXAL 3P30H 4GG6A 1OAQH 1T89A 4LCCC 4Z7UF 5FYLE 3T0EC 2PYFB 3G5YB 3QHFH 1NUFA 1EMTL 4RFEB 4CDHA 3HNVH 5EN2A 4UU9A 3QT2A 3UTZB 3NIGE 4RMWA 1SEBB 3BMVA 3V7AE 3QG7L 3RX7A 1IZKA 3ZSSA 5JDJA 4DKAA 2NTFA 4HFUH 4TPRH 5DRWA 5EOQL 2BY2A 1CTOA 2EDKA 4KK8C 2DDQH 3I6GA 1B4RA 2X42A 1CXIA 1RFDH 5D7SL 2KQNA 1DE4A 3VCLB 2Y06L 1KJ3L 4P3DB 2CGRH 1BQHG 1U93B 3MRGB 4LF3A 3M1BB 3CCHB 4FP8H 2FHFA 4ODTL 1D6EB 3MLVL 1IFHH 3MA9H 4LNRA 4I5BA 4K8RL 5FCUH 3ZL4L 1F3JA 1T1WB 4OGAC 5TDNA 2H32B 2F74A 1HE7A 4D3CL 5T3ZE 2EDOA 3TYGH 1PZ5A 2JELL 3ORJA 4L9LB 1B6DA 1HXMB 2QTEA 4PJ7F 3NBNA 3EDEA 3OKLA 1GZQB 4PJ9C 2FIKA 4XP4H 2EDYA 4S1SH 2CH8A 2QJDA 3CPLA 3UXFA 2F9BT 3M17B 4HIEA 2ADJB 3MRFB 1NC2B 2R4RH 4QT5B 2WWKO 2ZCHL 1OD7A 3VXPB 4LEXL 2IBZY 3SHSA 5IW6A 1YNTA 3WS6A 4PJEE 1ZT4B 1YPZF 2NY4D 5CZXC 2IJ0C 1MFDL 2PTTB 4K3EL 1NC4B 3MNZB 5FYJL 4M7JL 3T1FA 4XBEH 5GIRA 2HFEB 2VLJE 4LCUA 5DK2A 3VWKD 3MLTB 3CK0H 2CLRB 4XPGH 3D3VE 4Y89A 2E6QA 4CKVX 1I9IL 4JO3H 2ZUQB 5HHQA 4JY6A 2AEPH 2KZ1B 4NZDA 4I3SH 4R4NC 3RTQC 4UTAH 3S8WA 1G7JB 4ZFOB 1KLUB 4H1LB 1CDIA 3RZCB 5CIPH 3VXUA 4X7CC 1U6AH 4CADA 5EU3A 3SGEI 3CFEB 1B90A 3OG4B 4O58L 3RVWC 3WUWA 1CGYA 2RFXB 1JZ4A 3FT3B 3DARA 4KMTH 4KRLB 4PRIB 5D7JB 3BEWA 1YJDC 3R06A 1HXYA 2RGSA 1J10A 9CGTA 1Z3GH 3D39D 1REIA 4M61A 1MUJB 5HD8C 1O7SA 4HKZB 3VWKA 3DRTA 1NCBH 5D7LB 1URLA 4WFHD 4LAJH 1JTTA 5A16B 5J89A 5E2JA 2BNUB 4K94C 5DF0A 4MLIA 1WSST 2A2QT 2SEBA 2ADIB 4RA0C 1CFVL 2IBBA 2X89D 4UILH 4JKKA 3ZKQD 4I3RH 2HH0L 5DT1L 1K8DB 3HR5B 1S7XB 5KS9B 1UJ3C 1SMAA 4A6YB 4R0LB 2IQ9L 2VXSL 3QUMH 1YN6A 5IFJA 4NPYA 3BXNA 1PVHA 1DBJL 2V5MA 4TUJA 3TBVA 2R56L 4LVOC 3QEGH 3D39A 3ZKXB 5IP4A 4OFDA 1ED3B 4NO0D 1NAML 4FQJH 3N9GH 3MRMA 4ACPA 4CMHC 1X4XA 1IBGH 4GAGH 5GGTH 5C9JA 1CK0L 2C4FU 2JJSA 4YBHA 5EZOH 4KV5E 4G8GB 4RAHA 1L9MA 1BAFH 1MPAH 4MXQC 5AAMA 1DLFH 1QVOB 2F58H 1CFSA 5K59E 3V79C 2B8OT 2GIYA 4U31A 4J1UB 5FO7A 3MREB 3QIUD 2NXYD 4NDMA 1GGIL 4LLMA 4U1SA 2X89A 3ARWA 4H26B 1KJ2H 1KPRA 2J5LC 3KNBA 1S7QB 2B4CC 1P4LA 2WINA 4HGKC 1CF8L 3LKQB 5AAWA 2UZIH 3W0WD 3CXHK 1SJVA 1H8SA 4BKLB 2XFXA 2EH7H 4C59B 2A0LC 4I48A 4NO0A 1KCUL 4OZHE 1WBYB 1RZGB 1EERB 2MFNA 4XVSL 1G9ML 2GJZB 5C0ND 1JNLH 3CMOH 2M2DA 2XWTA 3NIFE 2ZSWA 3V4UL 1OGAB 4J3SA 2R9HC 5GGSA 3UX9B 4OJFH 3SDDD 4U49A 1FO0B 5I1AB 3JVGC 1DBML 3IFNL 3QIUA 5EU7C 3W9DA 4PJHB 3UZEA 1MAJA 1QG3A 1T80A 3ARBB 4D0BA 3G04B 1LNUA 2Z8WC 4DW2L 4LCWD 5KVFH 3GHEL 3VXTB 3SDAB 3BKML 3LPWA 4QRUB 3W0WA 2NY5C 1ES0B 1QSED 4PB0H 2E27L 3MRRB 2VXQL 4OCXL 4UDUB 5JZ7C 4MAYD 4K7PX 4XVJL 4R6UA 1I7UB 4QRRB 3MLYH 3BE1L 4GW4B 2BVQB 2AXJA 2R39A 3EZ8A 4FXGA 4NRYB 4E5XB 5SWSE 5DGRA 3O6FD 4X9BA 1MIMH 2CIKB 3F8UB 1Y18A 3SJVD 5E94A 4X7TB 4POYA 3BIKA 3SDDA 1F45A 2E9IA 3QEQB 3VMNA 4DVBA 4ZUTB 4YQXL 1FLRH 4ELKA 4HMEA 4JPVH 2E9WA 1X5KA 1HK6A 4LCWA 4K7PL 3P0VL 1LP9B 4JLRA 2HT4D 4JZOA 4QTIH 4CVZB 1DQQA 5IIEB 1QSEA 2VZTA 3TBSB 2DQJL 3DHMA 3SKOB 4RDQG 1JZ7A 5CD3A 4MAYA 3U83A 5DJYA 3EZJB 5IG7B 3LKNA 3MR9B 3D25B 1WEJL 2B2XH 4E0RB 4DN4L 3F7RA 2J88L 1NBYA 4O4YL 1MEXL 2IH3B 3L5JA 4BFEA 2P24A 1QKZH 5I66B 3K8LA 1FORL 2V2XB 3S3SA 1DQDL 5GGSY 4GUPA 3SJVA 3ARGB 1XF2A 4NHCL 2VRAA 1XF3A 2R2HB 1QA9B 3U1SH 2VZOA 4LRNH 1VSCA 4LVNC 4GW1A 1BOGB 5KAQG 1HQ4B 3MRPA 2GJ6E 4PP1D 4YIQA 1X5LA 2J4WL 1JP5A 3LEYL 3KDMA 5SX5K 3AREB 4Z0XB 3TESA 4GQ9H 1YECH 4GXVL 4X5XA 1JF5A 1TQCC 1ZS8B 2HKFH 4WHYG 5L8KB 3NAAL 3MRQB 1DVFD 1BX2B 3LS5L 5JR1L 5IW1B 2XZQH 5HHNA 5JQHC 3M45A 2BOCA 2WIMA 4POZD 5C08E 5EU6D 1Q8MA 1TCRB 1YY8B 5EO9B 4AIZA 1JFQL 3IDYC 2CXKA 5D6CA 4D8PB 5FK9A 1HHJB 4WI2A 3SDCC 3EO9H 3EJJX 2E7LA 2QSVA 4QHLB 4NHUA 1YEKL 4LL9A 5C6PB 5HDQH 5DURD 5ILTL 2ZCKH 1CS6A 3VFSB 3VRJA 5DDHA 1A1NA 1D9KC 2A6IB 2D7OA 2GW5A 4PGCB 3U7WL 1IGIL 4LPTA 2HFGL 2Q7NA 3EYVA 3GM8A 4UV4H 4WWKC 4EUPG 1G7IB 4PLJD 4P4RA 1DVFA 2A6JA 2XWJA 1OGTA 2CD0A 4CU8A 5DD0L 1ETZB 3IU3A 4K8RC 4WW1A 5EU6A 3AB0C 4JAMB 2HT2C 3DVNA 5EC2B 5C0DB 1OAXL 1NCWL 4Q58C 4HUWB 4YHLH 5C71A 4HHAA 4KJYB 1E4XL 3AY4C 2VDPH 3D1MC 4IOFC 2JIXB 3T1WA 4WDIA 1FIGL 1CYGA 4UT9L 3MCLH 4NRZA 4N0CD 2YSSB 5EPMB 5FYLL 3SCMD 2XG4A 1T21B 2R0ZL 5DJ2A 3DX6A 3DYPA 1EUTA 3PP3H 2VKXA 1W72A 3VDBA 3UYRL 5SWZD 4PJAF 2MSPA 1CXKA 3QULA 1HNGA 4NNXA 5J6HA 1GGCL 2BSED 4TULL 2FJFB 2F8VA 2R8SH 1FN4A 3CFKA 2EZ0D 4NQEB 1J8HD 1SY6A 5IBLD 4NCDA 2HWZL 4W68A 2QKIA 2IFGA 4LLDA 4FFYH 4OFIA 1TETL 1J0HA 2P46B 3PHSA 4NJAL 4Y2DD 3C5ZD 5ACZA 5FCSH 4S1DD 3V5DA 3QI9B 2UWEB 1GCFA 2XZCH 3VU2A 4L5FL 3GSXA 1BJ1J 2ESVB 1OB1A 1Q1JH 4KMQA 3SCMA 4IDJH 1PEZA 5F9WC 3BQUB 1RHFA 4XCYA 5KN5B 5SWZA 3VI3E 3HCVA 3UTQA 4ZFGL 5F88B 2ARJQ 5HVWA 1IL1B 2AQ3A 1RJYB 2VAAB 4KQ3L 5IFAL 5IJVB 2AP2A 1XGRB 3K2MC 1J8HA 3OB0H 3QXUA 2KH2B 4M93B 3V5HB 1G0XA 4X99A 4JFZH 2NY0C 4OCRL 3MXWL 1MHPL 2GY5A 3GI8L 3T3ME 4Y2DA 3C5ZA 1KPUA 5FUZH 1J8KA 1Z0NA 2PKDA 1ZHBA 4X4ME 3H3PH 3RHWF 3O9WD 4PJBA 4NM4H 1H5BA 3GMPB 4WI7A 3EYSH 4PG2C 5CSZA 1T0PB 4KAQH 3RWCB 4U1JB 4RAUA 1YY9D 4JFEB 3L3HB 2BVOA 5D7IA 1J05A 2VDKH 4TUOB 1ADQA 4EZMA 3TIDA 1MRDH 3KR3L 7FABL 2VDLH 2Q8AH 3ZE0F 1H0DA 2XG5A 4MXVF 1MFBH 5DJ6A 4P46C 1IILE 4Z76B 1KUMA 5IVNA 3EJYD 3MXVL 3O41A 3ILQD 2AK4E 1T6VN 5EBLA 3HPJB 2WIIA 1R3IH 2Q1EA 5E6YA 5CCKH 2DTMH 5I8CA 3O9WA 1IGFH 4YXKL 2R0LH 2BRRL 4PB9L 5CUSL 2XN9B 5JORA 3IFLL 1QLEL 1RIUL 2BY1A 3BP7B 3TP4A 5DQ9A 4UAOC 2E8YA 4HV8B 1QOKA 1ZHNA 5ADOL 1YMHA 2V7NA 2VLLA 1N64L 3JV4B 5EBMA 1B4JH 3ARDC 3B5TA 3LIZL 4LFHD 4XMKH 3GB7A 3WEXA 1GOFA 4QOKD 2VTFA 4M7LT 5HVHC 3BZEA 4CBPA 4H1LH 1G9MC 3GZKA 5L9DL 5EIIA 2ZPKH 1OP3H 2BY3A 1B0WA 4Y16C 3V0VB 5D96C 1RZKC 4NQCB 5EG6C 4ISVA 3HI6L 1OTSC 5E9DB 4ZTPL 1RIHL 2ADGB 3IJYB 2ADFL 2PCPA 3AROA 3OXSA 1VADB 2EYTB 4I2XE 4MJIB 1DBBH 2JCCB 5B8CA 1WGOA 1M7IA 1B0GA 2Z93B 2R23B 2VDNH 3FZUC 2AK1L 5CBEB 3DUUA 2I27N 4ZPTB 2O61A 1QRND 3V6ZA 2DB8A 2JKXA 3G6JE 1EHNA 3WNNA 1U8QB 4QOKA 3ZTJH 4KTDL 2DKSA 5HHVL 4F7MB 2CDFA 4CW1A 4G5ZL 1BM3H 1FNSH 1LE9B 5KSBB 4MQTB 5IB1B 1CCZA 3NZ8B 4LLYA 3QJHB 1ZGLP 1JRHI 4GLRI 5F97E 4A6YH 4X6FA 3MV7B 4Q9RH 1EGJL 1FPTL 4HDIA 5ACLA 4YK4B 3GSWA 3K4ZA 2NY1B 1M4KA 1QR1A 4EJ1C 5HYSG 1KOAA 5K93A 2MNUA 2CO7B 2AJYH 1MWAB 1VHPA 3S3JA 3DXAB 5IVXE 5D1XB 1QRNA 1CGSH 3F7YA 1T1YA 2IANB 1IEAB 3VD9A 3P4NB 3BWUC 1JN6B 4LLAA 3QJFB 5DRZB 3L7EB 1N0LA 3F7VB 2ITCA 5DYOA 5ICXB 3WN5C 5MI0C 3VFOB 2ORBL 4ZUSB 1MSPA 3MV9D 2EIBA 2X4RB 2NMSA 3S36X 1K4CB 1SYSA 3LKRB 5IB3B 3LZFH 5JO5B 4KROB 4FQXC 4JY5L 4RGND 2ZSVA 3ARTA 3N0PB 1J18A 1FVDA 4DOHB 2HVJB 1UM5H 3QDGB 5JXED 4X9IA 1GHFH 1MRFH 4XXDA 5I1CH 4OV5B 2P5EE 4JFYB 4QXTA 1FO0H 1RJZB 5FV2A 3TBYB 2AAVA 4P2QB 2OJEB 4M6ML 4IRJB 3S36L 1YDPA 3U4BL 5D71L 3A67L 5BRZB 4URTB 1JUFB 4XP5L 1S78D 2JCCF 2IEPA 2VXVH 3WLWD 2VH5H 3BH8B 1YA5A 1FYTD 1S9WA 3WFEL 1WLHA 3MV9A 4G9FB 1JZ2A 5D2NE 4LMQE 2F53B 4Q6IB 2IH1A 1IGYB 2W9LA 1AXTH 4TUKL 5L2KB 4KKBD 5DJZB 1Q9WB 3ZDZF 3QG6A 1UQSA 4JDVA 3O3BA 1YMMB 4WW2F 3T8XB 1IGTA 5IT2L 2Z8SA 5JXEA 2IPUK 4CMMA 1NGYB 1KT2A 4YR6A 2FD6L 4ODXB 1T83A 4XMPL 4ZYKA 1MFCL 1JPST 4JO1H 4RWHA 4MD5B 1HH6A 1WZ1L 4YFDB 2WP3T 4QTHB 3CDGB 3OR6A 2APTA 4XWOD 1G9NL 4OI9A 4OM0H 4JEGB 4OSUH 3ARFB 3W9EA 1FYTA 2O5YL 5C0AE 3UJIL 4LSPH 5K9KA 5ERWB 5BZWB 3WFBL 3H0TB 4HXAL 5EUOE 5B3NA 1RUKH 1F4YH 4UNUA 1P4BL 2C7UA 2XZAH 3QO1A 4UT7L 4JFDD 4XVTH 1LK3H 1AGCA 1F4HA 1TJIL 4V2BA 4FQ1L 5MHSD 1XCQA 3D9AL 1ZLWK 3IAPA 1CGTA 2WUCL 2Y36H 4NCC2 5F9JB 3LB6D 3MLXH 4JVWA 4MQSB 4PJ5E 4XNXH 2V2TA 1XGUB 1J0KA 5FM5O 3HUJB 2VAJA 4JN1H 4K71B 4Z7VB 4ZQKB 4J3UA 5JQ6H 3MRNB 3RBGA 2YMXL 1RZIB 1F3RB 4Y1AD 3TJEL 2ZOKA 2KUTA 3EGSA 3LEVH 1CGXA 1YEHH 1A9BA 1UH2A 4KHTL 5CKAA 1JF1B 5H37G 3QWOA 1CXEA 1DN0A 2FIRT 3AM8C 4NKDB 1BQUA 4R4BB 5IB5B 1LO4H 2MKWA 4Y19D 2PUQT 4N0RA 4M02A 1CFNB 5GSVA 1ZGLB 1JZ8A 3DVGA 5E24E 5F7HA 4U1KA 1MCPL 4ODHH 5AWNH 1KCLA 5CZKA 1AR1C 4JFDA 5CILH 3B83A 3TT3H 3QXAA 4HXBL 3D2UD 1S7TA 1QFHA 4ELMA 2FWOA 2DMKA 3KPOB 5IQ7L 4P23B 3G5ZB 3JTTB 4OF8A 2NLJB 4P2OB 1ZTXL 2J8UE 3NA4A 4Y1AA 1BLNA 1XIWD 5E8EA 2GTWB 1AJ7L 2UV3A 2ZKHL 5FKAA 1S7VB 2W92A 3RIFK 4NKIL 2VISA 2YA0A 1AD0A 3VH8G 4FTVB 4Y19A 3QQ9C 3CH8A 1F6LL 4X6BA 3TFKC 3X3FL 3RWEA 1RURH 3NH7H 5DZLA 1PSKL 4UT6H 5B3JE 4P57B 4M03A 2Q20A 3DETD 2QBWA 3O0RH 4NIKB 3D2UA 3R1GL 5E70A 2P8MB 3HMWH 4OD1L 5DFWH 1KCVL 1X3DA 1UACL 5DI8A 3BIBX 5ABDE 4X5LA 1YYML 1INEL 1AHWC 3JWNC 4FHBD 3JTSB 5ESAB 2Q3AA 2K9UA 2R29H 5J6GB 4U6VL 3NZHL 4JDTH 4X6CE 2HFFB 1XIWA 4GKZB 2EIDA 2IAMC 4MD0B 3M8OL 4F33B 4TOYH 4G6KL 4RWYL 3FONB 1UZ6F 4HX1A 5HGBB 4MA7L 5F89B 3SE9H 2CSPA 3THML 3WFDH 5I30H 3VD4A 1JPFA 3R0MA 3S9DB 3AAZB 3RVXD 5IMMA 1VGEH 1VFUA 5GS2D 1KC5L 4IS6B 1LMKA 4ETQB 4HUUB 3HUJF 4MJ5A 4MNGE 3FO2B 5B39A 1R3KB 1I9RH 1OCWH 2BVEA 5I75C 5KVGH 3BGFB 4J2XA 1MFAL 4WEBL 3QDJE 2BNQB 2VDQH 3QPXH 3DX9B 3FAWA 2EO9A 4K3HA 5MEND 5KOMC 5EDXA 3WFHB 3GMRB 4HF5L 3RPIA 2LU7A 5F1IA 1ZANL 5IMLB 4G7YL 4J3VA 4UIMB 1LVEA 1OTUC 5TQ0H 3OKKB 3O2WL 1N6UA 3MRJA 2LQRA 1FZKA 1HKFA 4JZJB 1Z9SA 4MAUL 1XGQB 4YBLB 1BZ7A 1BQHB 4ZOEA 3ZE2F 1N4XL 1BF8A 4DCQA 1VACA 5E8NB 5MENA 4FZEH 3KPRE 3OAYK 4M5YH 1HSBA 5HHPB 2YXFA 3U2SB 5I73B 5MEPB 1F4XL 1P4IL 2NW2A 1RUPH 2I5YH 3AS3A 4ZPVB 4V1DB 3SPVB 4QLRA 2OTUB 4HC1A 2APVA 3BP5A 1I1YB 2PO6D 4KY1L 5HHMB 2E7CA 2XKSA 1K2DB 2VJXA 4ZAKD 4JFHD 2ZCLH 3TA3C 3V8CA 1A7OL 2P5WD 4NN5B 5I17B 1TVBB 4N9GB 4AEEA 2R4SH 3T4AB 3WXVL 3STZA 1RHHB 2WAHA 3HZYB 4XCCL 4HIJB 5KG9A 1CIUA 4HUXB 4PJ7E 3HHRB 3P30L 4XPAH 2Z31B 2XA3A 4PY8J 4ODSH 4I0PC 3H9SE 2F54D 3KPLA 5F21B 3E6HB 3L6FB 4OCYL 3VG0H 1P1ZB 2Z4QA 1W8NA 1MAKA 4UOW0 2R2EA 2D4FA 1CXHA 3I9GH 5BVJA 3KPSE 1U0QA 3MMEA 2PO6A 1I8LA 2XTLA 1YPZE 1BIHA 4QHUB 1A6VH 1NDGB 5I0ZA 4LBEB 4RGMB 4M8QB 4MWFA 4ZAKA 2EXWD 4L4VE 2P5WA 3DV6A 3PJSB 4NNPH 3O8XB 2X1WL 2F5AL 2PXYB 1NCCH 5GSRA 4FP8L 1IKNC 1BJ1H 4EIGB 3CFCH 2OL3B 4JRYE 1I3GH 2DM7A 5IWLA 2F54A 3ZHLA 3INUL 1KIRB 3DPBA 4W6WB 5EBWB 4BUGA 5E2TL 1JWUA 1SMOA 4YHML 4M00A 2B20A 3HZVB 3BHBB 4BSWA 1R3LA 2V17L 5J0BA 2YUXA 1CICC 3QA3A 5JPMA 4S1SL 5FDWB 1T0MA 1EO5A 5EN2B 2R4RL 4UU9B 4D9RD 4X98B 3ULUH 5E08L 3ALXA 2G2RA 4DFHA 1E27A 5C07D 1DSFL 1F97A 3MOAH 5IB4B 3CLEH 2O5ZH 5ALCH 4KZEL 5TF1L 1ZHLA 2NTFB 1S9KC 2FH8A 1A1MA 3RNQA 4PGJA 4KMLB 5DRWB 1IGMH 1MCWW 5DMKA 1NSNH 1GPOH 3I6GB 4LQFH 1AE6H 1BQLL 1OD9A 1CD8A 3SGDH 1DQTA 1G9NC 4F15B 4PJXA 5MEQA 3F5WA 2NCMA 2AEPL 3MV8D 2G60H 5A3IC 4JG0H 3QQ3A 1MWAH 1T20A 4JRWA 1IEBA 1BBJA 2E5EA 2YD1A 1S3KL 2HLFD 1CQYA 4P2CG 3D87B 5JLZB 4YXLL 1FBIH 2F74B 5JW3L 2UZYB 1GSMA 1B88A 3RWJA 3VXMD 1MJUL 4WNQA 4Z0BL 4APQB 5BS0B 3CFJA 4HT1L 1F6FB 3OKLB 5TDOA 1Z3GL 4R2GD 5KTEL 3LHPH 1KLGA 2VQUA 3CPLB 1U8KB 4HIEB 3C6SB 4XAWL 3V6FA 3C9NA 1VGKA 1IKFL 1HYRC 3MUJA 4OFVA 3WNLA 3DUSB 3G5XB 3JV6B 3V52L 4WUUE 5HYEA 3KYMA 3MV8A 1YNTB 4XNMB 3GSVA 3IFPB 4O2FB 2ITDA 1RY7B 4ONHA 1QACA 4QGTA 1BPVA 4WVRA 2A6KB 4S1RH 3WJJC 43C9B 1QBLL 3VXMA 3U9UB 1JWMA 4LDOB 3EOYG 4JY6B 2JLLA 2HTLC 5BV7B 5GJSH 4YHOL 4PRIE 4AENA 1WWWX 2Y6SC 3VXUB 1DDHA 2IPUG 3VI4E 4CADB 1QBML 2FB4H 3H9HB 1LO3L 4GAGL 4LVHB 1U91B 4TNWK 5GGTL 5ESVA 5HGHB 4LGSB 4GG6F 2VR9A 4CN1A 2AI0H 2LU4A 3WUWB 1KELL 1CXLA 1DLFL 5CWSB 3ROLB 3O3AA 3OB8A 2YD6A 3I75B 2AXGB 2W0FB 5IEKA 3AFLA 1JPGA 4P4KD 5D4QA 4L8DB 5HHXL 3RJDA 5JIKA 1PQZB 1TTGA 2KPNA 4AY0A 3GUTB 3U30B 3TNNA 1JPTL 2H3NA 4U1NA 3QXVA 3TVMC 3W11D 2UZIL 4P59H 4PTUB 3MJ8A 3SKNA 3NFSH 3MRHB 2CR3A 1SBBA 5KVEH 4QRPB 2EH7L 4U0QB 5CP3A 3VG9C 3HE6C 3MCG1 4JFPA 4D0DB 5JDSB 3MRIA 1ZGLM 4XNUH 3KXFA 1FZJA 4WO4C 1NGPH 3UPRA 1CE1L 3MGTA 5HYJB 3MRBA 4WV1C 2DQHH 3CMOL 3BISA 1YN6B 1MCHA 2ZG3A 4BJLA 1MJJA 5C1MB 4KGJA 4TVPL 3S6CA 3TBVB 3B5HA 4XCEB 3LN9A 5HYQA 1TJHH 4P4KA 3MGOA 2FGZA 4JRXB 1R3HA 5J9PA 1JYNA 2VQ1A 3MRMB 4IRZL 3DECA 4FQHA 4F3FA 3WL9B 1CFSB 3ULVH 3UTSE 4PB0L 1CLCA 5FO7B 1FFPB 3VWJB 4NDMB 3IDNA 3GJFB 5DMGD 1U42A 3KNBB 5J1TC 5CMAA 1P4LB 3I6LD 4WGWB 2P45B 3WS3B 3JWOL 3S97C 2OR7A 3DTXB 2B1HL 4JO4H 4OT1H 2AJSH 5T33H 3WIIL 4G9DA 5ISZD 3I6KA 1KACB 1FLRL 4NO0B 3NACL 5HI3D 3CVHL 5TQ2H 3RDTD 1KEGL 4MJ2A 3SGKA 1QYGH 2DD8L 3DX7A 5I1DA 3GFUA 1YEEL 2PETA 1FNGA 2XWTB 4EOWH 5GGSB 1HYSD 4DQOL 2H41A 4EUPB 2OMBA 2X4QA 5E03A 1QBAA 2W9DH 3W9DB 1AGDB 3ZDXF 2NXYB 2B2XL 3EO1B 4GMSH 3BN9C 3RA7H 1FSKB 3FRPG 2DQUH 3SQOL 3GSNL 5KW9L 3I3EA 5C6TH 1KIUA 5T1DH 1OAYL 5I1JH 1I1AB 4N0UA 4NWUH 2RAMA 4WFED 1XMWA 3QQ4A 3RL1A 3HAEG 5C0CD 1WV7T 5D8JL 4FFVD 5F9OH 5ISZA 1YUHA 4LRNL 3WFCH 4LLUB 3NCMA 3RDTA 1FJ1A 5BW7A 5EO0B 3WIFA 5FIEA 4KI5D 2XPGA 2VE6B 4KKLC 3QXTA 5I6XB 4NZJA 5E94B 4R3SB 1PG7X 3SDDB 1Q0XH 2HRPH 3L95A 4DVBB 3W11C 5IF0B 2JB6A 2FCBA 4LCWB 2XRAL 5LGHL 3EYOA 4JLRB 4PRPE 3QUYD 4MDJA 4U6XA 3LKSB 4XPHL 4ZXBD 3SBWA 1WIPA 2PW1B 4PJAE 1D3CA 5CIPA 4O51A 1BBDL 5C0CA 5CD3B 5IFHH 5DJYB 5TE4H 4RA3A 3LKNB 5J11C 1PG7L 2A83A 1QQDA 3FHQA 1VB9A 1A6AA 2M1KA 2HJLB 4K9EH 5HDQL 4Y4KD 1A3RL 1L7IH 2RR3A 3KHOA 3BYYA 5JOFA 5IHUH 4E9LA 1NANI 4GUPB 2PYEE 1PLGL 3QDME 4UV4L 4Q9CA 2LAGB 1GZPB 5KANI 4KPHL 8FABA 2CUMA 3NVQA 3VRIA 3CUPA 1MY7A 5A2IH 3CDYA 5C0FB 3L3JB 2X41A 5SX4H 3U9PL 4NZUL 2WANA 5INDA 2ICWA 2BJMH 5SV3A 3SE8H 2OCFD 2VZ1A 4LNVA 2I25N 3WO4B 1A6TA 1OW0A 5J7CC 2VLME 1CGWA 3QUMA 5DS8B 3TPUA 4GOSA 4Y4KA 4CGTA 3MRDB 4AIZB 1HZHH 3ZYZA 4HS8H 1XGYH 2NXZB 4OAWA 1XGPA 1PDKA 3MLPA 5K9QI 1DQMH 2ENSA 4NHUB 2YC1B 2P49B 1HYSC 3CXHJ 1UM6H 4MDIA 3MYZA 1PKOA 2Z92B 5DDHB 4GS7C 5D72H 1A1NB 3FQWA 3SO5A 1LDPH 3MBEB 2NX5E 1E4KA 4RZCA 4ZUWB 3GKZA 4XP1H 4GRWB 2ZG2A 4EI5D 1SM3H 1KJ2A 3EYVB 1BOYA 2QQKL 3ZE0E 4P4RB 4MXVE 1CFBA 2A6JB 2XWJB 4HZLA 3FQNB 4PLNC 2V6HA 4WW1B 1WAAA 1CU4H 3GRWH 3L5WB 3FN0L 3QAZB 5DD3H 4ZSOE 4PJ8D 5GS3A 4HUNB 4YDIH 2WK2A 4G42B 4MB5A 4HW6A 3ILPA 2GK2A 4HHAB 2VN4A 3OX8B 4HGWB 1S7SB 4MQXC 4GKOA 2OP4H 4NRZB 5D2NC 5J1AA 1D7FA 1XCTB 3GSQA 3REVB 3IYLW 4JFZL 3LMJL 3DROB 3VGFA 1W72B 4Y5YC 1RZ8A 2IWGA 1BVKB 3QULB 4NNXB 3GI9L 5J6HB 4EI5A 4R4FH 2PR4H 3FT2A 4KJQD 3O4LD 2C3VB 1NGXB 4ZXBC 3RNKA 3X11A 1YQVL 4F57H 3QUXD 4ONOA 2FSEB 2ATKA 1YNKL 3EYSL 1Q9LA 1AY1L 4QWWD 2OL3H 2VSCA 4PJ8A 5FM8A 5EULV 2BSRB 3DHJA 3D0VA 2VDKL 1MIEH 4F9PC 1MRDL 2NY7L 1DP0A 4U2YA 1RVFL 4FFWC 2VDLL 5F7FA 2Q8AL 1CFQA 3UC0H 1UJTA 2VLRE 2QSTA 3I85A 5D5MA 3HG1B 4N5UA 4NO3A 1FL5A 4F2MB 3QO0B 1QFUH 4TSCH 5I1LA 3T4YB 4LDLB 2WW8A 1F11B 4LLQB 3V6OA 3UTQB 3SY0B 3ETBF 1R3IL 5CCKL 1S7WA 4B0MM 1FG9C 2GTZA 3O4LA 1QP1A 3DO7B 2BX5A 2WWMD 2GITA 3QUXA 1XF5A 5IHZA 4GH7B 1U8OA 2C5DC 2L0DA 1TNNA 2VXUH 1OLZA 1JHLL 3L1OL 1P5VA 2I07B 3OGOE 5HYSB 2DQTL 4FFZL 1UCBH 3C5ZB 1KPUB 3DMMC 4EN3B 5J13C 2P8LA 5L88H 4AEHH 5CJXC 5DEFB 1MFEH 1C8PA 1ZHBB 3C8KA 1AIFB 3KLSA 3B6SB 3SO3B 4V2CB 4NFBA 1X5HA 4IRSD 2HG5B 1KSRA 4QO1A 2ZPKL 4Y4FC 4M7KH 4NO5A 3Q6FA 2NTSP 3QNZA 4W4OC 3RKDC 1ORQA 1H0DB 1BZQK 1MFNA 5DJ6B 3V5KA 3DIFA 5HDBF 1A47A 4RMUA 2DKUA 2FLBT 3QHZH 4U1HA 4XPFL 1NCDH 2VLKD 1EFXD 1WIOA 4CJ1A 3LAFA 2XACC 3RKPA 4HKBB 2D9CA 1JV5A 1ITCA 3HC4L 3WE6A 2HA1A 4XNQA 3RWFA 2LE9A 4OZ4B 3O9WB 1HHIA 2WBJA 5E2VH 3FOMA 15C8H 5JORB 1J1XL 4PPTA 1B0RA 3MRCB 2YA2A 5E6ID 4BK4A 1NCAH 3PWPE 3QZWA 4IRSA 5DQ9B 5F72S 1FNSL 2IALA 4PJDA 3JWOC 3E8UH 3CMGA 5DUPL 1RAMA 1C5CH 3T3PF 4HUVB 1JZ3A 1YMHB 2V7NB 1QSZA 2VLLB 4YO0B 5TE6L 3HZKA 3OKOB 1MHCA 3BP6A 3FJTA 3GK8H 1JGEB 4P2RD 2EDRA 1OHQA 3HI5H 4PJFA 1MREL 3GB7B 2YKLH 5BV7H 1UA6H 4N8VG 5F7DB 2VLKA 1EFXA 3BZEB 2VUYA 1O7VA 32C2B 3RWGA 4XCFL 1CLOL 1G7QA 1D5BA 3S4SA 2MPAH 4MJIE 3OR7B 4UBDC 2EKSA 3LV3A 4PJGB 5F3BA 4GAYA 4NC2B 3HC0A 2PCPB 3OXSB 3L9RB 3QUZC 3WKNA 1F3DJ 3TIEA 2ZUVA 2NY6D 3BDBA 3BDYL 5GISL 5B8CB 2W60A 3TCLB 5DJ8A 4FZ8L 3BPOC 1FNEA 5E6IA 4ERSH 1M7IB 1QSFE 1LGVA 3QNYA 4Q9QL 4U0RC 3ZDZE 1N7MH 3AMLA 3LRSA 1K6QL 3DUUB 3IDXL 4LSTH 2BVUA 4PY7A 5E2UL 2O61B 5E99L 3AXLA 4P2RA 4GMTH 3BGMB 4L1DA 4M6NH 4O5LL 3GMOA 4E41B 4QOKB 5HBBA 5C2BL 1OSPL 2P8PB 1JTOA 1MQ8A 4PJBF 1KXQE 5C09A 4TSAH 4UQ3A 5D7IF 1A2YA 4X6FB 1NLBH 5LCVH 1MRFL 4OF6A 5I1CL 3MRLA 5GGRA 1CFTA 5FDYA 3OKDA 2YPVL 3GSWB 1AD9B 1FO0L 5GRZA 4JM2B 1PZUB 4YDKH 1QR1B 1QPPA 2YRPA 4YXHH 5FEBA 1EVUA 5ITBL 3ZTNH 2VXVL 3CXDL 2VH5L 2YUVA 4K7PY 1BFVL 3TN0C 1I3VA 4WHYH 3WXWH 3G5YA 3EYUL 4ONGL 4RFEA 3HZMB 3ARZA 5DQDL 4ZD3H 1HKLL 5I8OH 1H3TA 3GJFH 2AVGA 5JHDE 1SEBA 5DD1L 3O2DH 4HCRH 4ZOCA 1QO3B 4JFXB 2ITCB 5DYOB 1YEGL 4U1LA 3HE7B 3PWVA 2IFFH 4L8SB 3IXAA 3QBTB 3EHBC 5EC1B 1CVSC 2W65B 4NQTA 4JO1L 2J12B 4OLWH 3T0BA 5CZVL 1KCSL 3ZZ1A 3OKNA 2ZSVB 1U93A 3MRGA 3CCHA 4PRNB 1D6EA 4WTZA 2CLZB 1MQKL 4IEFB 3RUGF 1I85A 4KHXH 2H2PD 4KTEL 4XXDB 4OGXH 5HVGB 1V7ML 3QRGH 4OV6F 3WD5H 4EUPH 1T1WA 1FNFA 4WCYH 3MOBH 2XZAL 2VL5B 5LKNA 1ZT7A 3WJLA 1YDPB 3QZWG 4XVTL 1LK3L 4OTXH 4L9LA 4EQ2A 1HXMA 1WWBX 1NLDH 3EDKA 4Q6YA 2EDEA 1GZQA 3PXJA 5GGRY 3RZCD 1FFQA 5IW3A 3MLXL 5DR5H 1IAKB 4M7LL 1WZKA 4XNXL 3M17A 3OJDB 3PQYE 1DEEA 3RIAK 1G6RH 3MRFA 4QT5A 1MJ8H 4OZGB 3IDJA 4QNPF 3VXPA 3GMMA 1JNNH 5CJQH 5D7JD 3S4SG 3QG6B 1BREA 1UQSB 3HMXL 4MA8L 3LEVL 3O3BB 3B9DA 1ZT4A 2M8XA 4CMMB 1KT2B 2DQGH 2PTTA 5J3HD 4MHHG 4YHKL 1UT9A 2HFEA 3MLTA 5D7LD 2CLRA 1HH6B 4ODVH 4XTRC 4XMLL 4ODHL 3RJQB 3OR6B 4K07A 3MLSH 5CILL 3VFWB 3VXRE 2VSDA 1G7JA 4ZFOA 1UZ6E 4H1LA 3RZCA 1FYTB 3QDAA 3SGJC 5ANMB 4WY7H 3CFEA 3FB8A 1S9YB 4MYWB 2C7UB 4JCLA 5TPWH 3FB6A 5JIPA 1KXVC 2RFXA 4UUJA 3FT3A 1VDGA 1KF9B 5D7JA 1TFHA 3LN4B 4I3GA 2FEDC 3HUJE 5LWYL 1XCQB 2VDML 3LEXB 5ICYA 1DZBA 1LD9A 4LLWA 4RFNB 2JJTC 2XQYK 3IT8D 5D7LA 1N26A 1YYLH 5IROA 4G8GD 4YZFF 4IOSD 5DFVC 4JQVA 5A16A 2BNUA 2ZOKB 2MJWA 3UTTB 3EGSB 3IDMB 3EYQC 3O0RL 3RRQA 2ADIA 2R0KL 5GZND 4KZDL 4XHJD 1U3HB 2VZSA 1LO0H 4HAFA 1K8DA 3HR5A 3FL7A 3DVGB 3OSKA 4A6YA 3OZ9H 3W2DH 4Z7WB 4JFDB 1AQKL 4J3OC 4JDTL 2IAMA 4UTBL 1WJ3A 4H8WH 3EDJA 4TOYL 5KVDH 5GGQH 3ZE2E 3NTCH 5I71C 1S7TB 1ED3A 5LGKA 1DQLL 1LEGB 2OMNA 3WFDL 5DRXB 2FWOB 1IAIM 3ZT5A 1TIUA 5F3HA 1AGBB 4G8GA 1VGEL 4HWEH 1QVOA 35C8L 5HGAA 3AU1A 1F5WA 3GSRA 4LP4A 1U3YA 3WKMH 1BLNB 4J1UA 2XOTA 5E8EB 3MREA 3RY5A 4NKOA 3ARUA 4NZTL 4C56B 3ARBD 2VISB 3D18A 2ZJSL 4NUGL 3A6CH 3EUUA 4H26A 4KU1A 2VDQL 5DC4B 1AGFB 1S7QA 3PNWA 1S5IH 3GIZH 2D03L 1XH3B 3KYNA 1CLYH 4BKLA 4XXCA 1Q38A 1YEIL 3V7AG 4O9HH 3MZGB 3HC3L 2P42B 4XPTH 4JB9L 3MNVB 4L4TD 4QRRD 4DKEL 1MCIA 1UXSA 4NGHL 1ZHKA 5DI8B 2NY2B 5BXFB 5I15L 2GJZA 4KJPC 2HT3D 1IAIH 4CNIB 3V2AR 4WUKL 1XIWB 1S8DB 1GC1H 5I1AA 1FO0A 1ZLSH 3WIHL 4PJHA 5GS0H 5K9OA 1XZ0B 4PYHA 1WTLA 1X6LA 3BT2H 4JPWL 1JPFB 2LTQB 2XTJE 5IMMB 1CDBA 4FZEL 4GBXC 2N7AA 4HIHB 5DHXB 3PXHA 4U1GB 1SY6H 1INDH 2BNQE 1ES0A 2YD3A 2WP3O 1ZAGA 2W0LA 4MJ5B 4UDUA 2C26A 2I5YL 2X1PA 3LN5A 4RAVB 1WICA 4L4TA 4QRRA 4G8EB 4R0LC 5BMFH 4NRYA 1KEMH 2FRGP 5DLML 3N1QC 5HXMA 1TVDA 1E4WH 4NQVA 1N0XH 2HKHL 4OLUH 2CIKA 4LPWA 3RPIB 3ARGD 1EO8L 2VUOA 4X7TA 2R4SL 2WV3A 2DLGA 2A73B 4KUZH 5CEZE 2K3TA 4ZUTA 1U8LA 4PR5A 1CR9L 5C7XL 1ZK9A 4XHQA 4OD3L 1LP9A 2NW3A 1CDUA 4CVZA 3ARED 4ELMF 3ZMRA 3MRJB 5TF0A 4NQDB 4HQQL 5DGQA 3HLAA 4MNQE 1RJCA 1RV6X 4I18C 4WFFD 3UJJL 4FQLL 4WGVB 5IG7A 4OD2A 3I9GL 3MR9A 3GDBA 1IAMA 1IC7L 2J6EL 4M3KB 4E0RA 1UM4L 2VR5A 4Y2OA 1BQSA 5EA0H 2UY7A 4M4RA 4V1DE 3T0EE 5MENB 4JFOB 1H3WM 5I66A 2UUDK 4W81A 2V2XA 1S7UA 2FR4A 1OP5K 3WO3B 4NNPL 1QA9A 2NW2B 3RX8A 5CJ5A 3RAJH 1UWEL 3BP5B 3L3GB 3FN3A 3U0TA 4KK5D 4N9OB 1F4WH 1M6OB 5E8PB 5KSAB 3AREA 3ARBC 4Z0XA 3X3GH 4DGIH 5I18L 4N90E 3SDAC 4NJ9H 3STZB 1MCDA 3MRQA 1BX2A 3QB7C 5KG9B 4DK3A 5IW1A 3QCVH 4LCCB 4WFGE 2RIKA 4YGVA 1G0DA 5C08D 1TCRA 1QFWI 1OAZL 3KPLB 3NCBB 3BAEL 1I7ZB 5SWQB 3QCUH 2Z4QB 3VXOA 4OGZA 2DQEL 4RQQB 1YEDB 2R2EB 4P9ML 4QHLA 2QQLL 3MOAL 3MMEB 2PO6B 3OAUL 4HBCH 4TQEH 4X7SH 3PHOB 4RIRB 3FFCE 3VFSA 4QHKJ 1JBJA 1IGML 4MWFB 4GSDH 3B3IB 1C5BH 1K4DA 2I60H 5I74B 1GPOL 3GKWH 4ESKA 1KCKA 2P5WB 1AE6L 3DV6B 5AEAA 3TZVD 3VD3A 1U8PA 5TGBA 1G7IA 1PX3A 3L5IA 3S88L 4JG0L 6FABL 2EH8H 4Y5XC 1WC7B 1ZXQA 3OQ3B 4TTDC 5C08A 2OR8A 5CEYA 3RP1A 3CU1A 4JAMA 4PJIB 4RGOH 3VMPA 2F54B 5DO2D 5C0DA 4WTWA 4XPBL 4GG6E 4YPJA 1FBIL 4S0SD 1BWWA 5E6ZA 4KJYA 4GT7A 1OAUH 3D48R 1FRGL 3QI9D 4MS8C 5IKCB 5L6YL 5T3XE 4BSWB 4PJ9B 1T21A 3BQUD 1T0MB 4GO6B 2BNRB 2FH6A 3MUHL 3TZVA 4RMRA 1A0QL 2GI7A 5H94B 4ZNEE 3BKCL 5D9SA 4F9LC 2H45A 5SX5H 1A1MB 5LG1A 1CQKA 2BHZA 2D4DA 1OTTD 2JJWA 4J3TA 1YEFL 2XKNA 3SE4C 5GXBB 4HWUA 2HTKC 3QI9A 2UWEA 4NZRL 5MEQB 4PJXB 3F5WB 4PRDB 4BZ1H 2A77H 3SDYH 5HY9A 5D6DC 4JREC 4XP6H 3BQUA 4JFED 4U6YB 5H37H 4JE4B 1IZJA 2G75B 3HFMH 1SEQH 4D0CB 1HOCA 4MVBC 4BZ2H 4WNQB 1RJYA 2VAAA 3CFJB 4LSSL 1HEZB 1XGRA 2J8OA 4HS6A 5HHOE 4YDJB 1A6PA 4KVNH 4X80L 1SBSL 1ZLVK 2Y72A 4KKAD 4Z7NE 3V6FB 3MLUL 1QSVA 5LXGH 5I19H 4P59L 1DN2A 2JB5L 2B0SL 5HJ3A 3HE6A 5D1ZA 3GMPA 3GSVB 1BFSA 3NPSB 4AEIH 1NBVH 2XN9D 3PGDA 3RWCA 1F6AB 3OF6D 1UYWH 1SYVA 1JRHL 3L3HA 4M43H 4XNUL 4NQXB 4P5TC 2IF7A 1UJ3B 4TUOA 2O26U 1J12A 4XI5D 4HWBH 1PEWA 1JWMB 4OFPA 3HAEB 1F8TH 4LVOB 1ZE3C 5HPOA 3ZDXE 3FO0L 4FNLL 4AENB 4CMHB 4Z76A 1IAOB 2FX8H 1T66D 3UBXI 3C09C 3T0DA 1KTLB 3PV7A 5DTFA 5E8DL 5IV2A 1T7ZA 1E28B 3SE3C 4OZFG 4NQCD 1N5YL 3P2TA 2AQ2A 2H26B 5DMJB 5E9DD 4N1EA 5EWIL 3M07A 5IR1A 1JPGB 2XN9A 1SJEB 3OF6A 1S5HB 3WNKA 2J5LB 4X4YA 1WZLA 4K3GA 4LARH 1WT5C 3LSOB 5IB2A 3QXWA 1YNLL 4OLEA 1G1YA 2X9XA 1T04A 2WMPA 5IQ9A 8CGTA 2ED8A 3BKJL 3JV4A 3HR6A 3U7YH 4JO4L 2BOBB 4OT1L 5H35B 4XRCB 4QHNB 5GRVL 1V3KA 4JJ5A 1FZMA 4PJXF 3ULUD 2BSSA 3IS0X 1H3XA 2FL5B 3ZKNC 4XNYH 3D39E 1FZJB 3KXFB 3TBTB 5A1AA 4YHZL 1Q0YH 3MV11 3MGTB 1OL0A 4M93C 1KB5A 3SKJH 5CBAA 3MRBB 1RI8A 2X4SA 2NY3D 1FAIH 3Q5YA 3MV7D 2EKJA 12E8H 5E9DA 4EOWL 3MJGX 2ADGA 4NM8L 4WFHE 1T1ZB 1VADA 1INQB 5HYQB 2EYTA 2NY1D 4GMSL 4HEME 2KZWA 1R3HB 1ZOXA 3RA7L 1T4KA 3CSYA 5E5UB 2DQUL 5CD5C 2Z93A 5T1DL 3DXAD 4ONFH 5D1XD 1NEUA 2D3VA 4NWUL 4ZPTA 2X5PA 4JHAH 1NJ9A 4YFEA 2IAND 5IBUG 2DTSA 1IC5L 5GGVL 4F7MA 1P7QB 2IGFL 2GK0B 5F8RC 1LE9A 5CMAB 2COQA 3QJHA 2AJ3A 2ATPB 4G6FB 1LO2L 2ICWI 4G9DB 1RUQH 2CKNA 2DLIA 2PF6A 2MKLC 2MQ0A 4S0TD 4JZNB 2L4OA 2R0WL 4KDTC 1MWAA 4O2CA 3DXAA 1FNGB 5D1XA 4UB0L 2W0PA 2QEJA 2FHCA 3MLRH 4MB4A 2X4QB 2IANA 4OCWL 3W0WE 5IFHL 3EIFA 5IJKC 2FGWH 3K2UH 5TFSH 1AO7B 3P4NA 4K9EL 3B9VA 3E0GA 2A74A 3CIQA 3QUKA 5BRZD 2VC2H 5KJRL 2X6MA 3L7EA 3BPLC 4Z95H 1UFUA 4N0UB 3BMWA 3CC5A 1T66C 4OLZH 5ICXA 2HYMA 5IHUL 3LKOB 3NN8B 5E95B 4Y8DC 4CVXB 4LVNB 4F7TA 3FN9A 5BZDA 3CZFA 2X4RA 5T5FH 4G9FD 1M05B 3FMGH 1K4CA 1ROWA 5JO5A 1HIML 1UXWB 1FE8L 4L1HA 1FJ1B 5L2KD 1VPOH 3C8HA 5C9KA 1CL7I 2E7MA 2XPGB 1JK8B 4LCIH 1YMMD 1TQCB 2HVJA 5CEZL 4AJ0A 4OV5A 4X5WB 3EYFB 4L3AA 2DQIL 3VDCA 4BQ6A 3L95B 3SE8L 2GSGB 3K7UA 3TBYA 1QSEE 4J8RB 4JFFE 1GGBL 4R26H 1FCCA 3EYOB 4WIQA 2F19H 5FGCB 5BRZA 5HGGS 1WTGT 1D5IL 4QXUH 3SDCB 4LIQH 4O51B 2XZZA 4C4KT 1XGYL 3IDUA 4PYGA 5FM4A 5C0CB 1VESA 4O02H 1KLFA 4G9FA 3SJVE 5E2WH 1F58H 4JHWH 2A83B 1QQDB 2OR9H 5IK3B 1A6AB 5L2KA 2MWCA 4L4JA 4Q7DA 2FZ3A 1A4JB 1D9KB 2V9TA 5EU5A 2DQCH 1LDPL 4M48H 4WWKB 4JPKH 2P5EA 4RMVA 2AGJH 3VJ6B 4B7IA 5DMIH 4YBQC 3T0XA 3ULVD 4IIQC 4MD5A 5F1OB 1UGNA 1F00I 1U2HA 4HPYL 4QTHA 1DQJB 3CDGA 3GRWL 3O6LL 2CDGB 2OTPA 3CUPB 5DD3L 2Q7YB 3VRIB 3SKUD 4XZUB 1F2XK 4GW5B 4L9DA 1NAKH 3GMNB 3BDXA 2B39A 3GIVA 5ADPH 5A2JH 2DI9A 3H0TA 1IC4L 3B2UD 4JKPH 1DJSA 3GNMH 3ZKMC 3BUYA 1A6TB 2OZ4L 4DK6A 2M26A 4Y4KB 1GAFL 3RPKA 4G8IB 3Q2CA 1U92A 4WJ5B 3IJHB 5F9JA 4KROC 1XGPB 1NMAL 5T1MB 1MF2H 2HJFB 2Y5TA 2AJVL 3N1GC 2IBZX 4P23D 1JNHB 3PDOA 4ZQKA 3MRNA 5DJDB 4JO2H 5ECJE 4XB8A 4P2OD 2DQDH 2QSCH 2OL3L 5I8EA 1KGCD 1RUML 3CX5K 4FQIL 5FECA 3L5XL 4IRJC 5EU6E 1KN4H 4KK9D 4NKDA 4R4BA 1KJ2B 4FTVD 4Y88A 2X10A 1FGVH 1RUAH 1CFNA 4WHTB 1PGRB 5FF6B 5F9WB 5IVZB 3UDWA 1QFUL 4TSCL 5INCA 2N56A 1CI5A 2NZ9D 1F2QA 1Q9KB 1JVKA 5FHAH 4LU5H 1BIIA 3ILPB 3BJLA 5D70L 1FNAA 3O11B 3KPOA 4AEFA 1FH5H 4P23A 1NFDF 1QNZH 3ARXA 3G5ZA 1PX4A 3FO1A 3V6BR 2NY0B 4G6MH 4N8VB 1I8MB 3BVNB 3T2QA 1RZ8B 3T3PE 4L3CA 3PL6C 4J3WA 1J0JA 4KI5F 4FTVA 2AXFB 1C5DA 1RZ7H 3FT2B 4AEHL 3X11B 5I1IH 1WITA 4NC0B 2A9NH 3ARFC 2CMRH 5F93C 4Q74A 2EE2A 1JYVA 2FX7H 4P57A 4KK6C 2X4TB 4NKMB 3D0VB 4H5SA 1JHKL 2PN5A 3LH2H 3A6BH 3KJ6H 2P8MA 5C3LD 4AMKH 5SWZE 4MHHI 4MXWH 1NAMB 1CFQB 5EORL 2XQBH 4JPIB 2YEZA 2YD7A 1MJ7L 3JXAA 1QR4A 2ENYA 3JTSA 4R7DB 1TJGH 5D5MB 4NO3B 3C08H 5D2LE 2EC9T 1FL5B 3PHQA 3NCFB 1ZLWH 1ERNA 2X09A 1J8HE 5KOVC 5GJTH 3KPQB 2OJZL 3K4AA 3RWDA 3H7BB 2DF3A 3ELAT 3VXSB 4DGVH 2AKRA 3IRPX 5HI4C 2YBRB 3ZT7A 1D5XB 1PFCA 3B2VH 4QRSA 4FQ2H 1XF5B 1YEJH 1OSZA 1U8OB 4Z5RB 2V5SA 4ETQA 1QFWM 4UAOB 1QEWB 4HUUA 2H1PH 3ARPA 4PJBE 3LCYA 1RULH 3FO2A 3LRGA 3MACH 4NC1C 1J88A 4LDEB 1DUZB 4GRLC 1C5CL 3X14A 1PYWA 2P8LB 5D7IE 3ARDB 2X70B 4P9HL 1EZVX 4CDGC 1S9XB 3C8KB 3FB7A 3DSNA 3C60C 2UY6A 3N85H 3OV6A 3HI5L 5HDOA 4OUUB 5HVHB 4LSQL 4Z8FH 5C3TA 4B5EA 3WFHA 2YKLL 3GMRA 3QEUB 5GRJH 1UA6L 4X6CA 3JWDL 2OXHA 2FO4B 5IMLA 1AR2A 2WZPD 5D96B 1VKXB 3NFPB 3Q6FB 4P2OC 2YN5A 43CAA 3BX7C 2DJSA 5HHMD 1YJDH 4H20H 3NA9L 4M1GH 5A2FA 3V5KB 3VFVA 3DIFB 3OKKA 4AIXA 4U1HB 4DKDC 1XGQA 3KYKL 5MERA 1BQHA 2VIRA 4JQXC 1C16B 1N7ML 3V7MA 4K94H 3QDJA 4LSTL 2Z31D 2WBJB 3KPRD 4KC3B 3ESVF 3FOMB 1PY9A 1B0RB 1MVUA 3B9KD 3RZWA 5HHPA 2K1MA 3ISWA 3SEPA 4IRSB 5C92A 3QZWB 1ZV5A 1MHEB 2WUBH 3SPVA 2EDHA 2OTUA 1T5WB 5GRUL 3T04D 1TMCB 1I1YA 5FHBL 3RUGE 3QCTH 5BQ7B 1CG9B 3BZ4A 1MRCL 5GHWL 1NLBL 1MHCB 3BP6B 4Y4HD 3HAEH 2KQMA 4PJFB 1K2DA 2APBA 5C0IB 1NL0H 4JKMA 2VLKB 1EFXB 4XVUC 4H88H 4YDKL 5DXWA 3O8XD 3T4AA 1D5BB 1U36A 1RHHA 1X5ZA 1WZMA 3H42H 5D5MF 3HZYA 3S4SB 4HIJA 2HMID 3GRWA 5EOTA 5IUSA 4ENEC 2Z31A 5F3BB 4GAYB 4YWGL 3HC0B 3KPRA 2XXCB 3TIEB 3E6HA 3P9LA 3B9KA 1P1ZA 1OARL 2W60B 5DJ8B 3RGVD 2N7BA 1FNEB 2NQCA 2GSIB 2R15A 2B4CH 4QOKE 4TSBL 2DLEA 3LRSB 1BGXH 3WN5B 5MI0B 3H9ZA 4DAGH 3X13A 4PY7B 4QHUA 4XP9L 1NDGA 5F96L 4LBEA 2IFFL 1V7NL 4Y4HA 5EO1B 1A6ZB 4HJGA 3EJZC 5GRXG 2X9WA 5GZOC 3HN3A 4DJMA 2OK0L 4PGDB 4FQXB 3PJSA 4G43B 3WSQL 3HNSH 1U8NB 3O8XA 3T2NH 5JOEA 5C09B 2VN7A 4K23H 3NCJH 1R0AL 3TWCH 3TNMA 3P0YH 4JZJC 1EEUA 4UQ3B 4W70A 2HVKA 4OGXL 3MRLB 5GGRB 3QRGL 3OKDB 3OGCB 1NEZG 1QRNE 3RGVA 5L8LB 3T65B 3HZVA 4RFOH 2XA8H 3V0WL 3BHBA 2N1KA 2YHGA 3DYOA 4BA8A 2NY5H 4J6RL 1WIUA 2DMCA 3OAYH 4PS4L 2YS4A 4UINL 1J0ZA 2UZXB 5FDWA 3ARRA 3KPNB 4F58L 1DBAH 4H0IA 2BDNH 4X98A 1JGVH 1J1OH 4APQD 5BS0D 1JNNL 3MBXH 3VFMB 3ARSA 3PIQA 4KJWD 1P9MA 5IB4A 2MCG1 4JRYA 4Q9BA 3PWLA 4U1LB 3PWVB 4M6OH 4PJDF 3K8MA 3IXAB 5B4MC 3V4VL 3TT1L 2Y7QB 4ZTOL 4OIIH 2F5BL 5AZEH 3OKNB 2QLVB 4WEMB 2A1WL 4NN7C 2CJUL 3W39B 3HB3C 3L3DB 4PRHD 4L3EE 1T7YA 1KIPA 5JLZA 4N5ED 1P6AB 4PLOB 1UVQB 2ZUSA 4OBRA 1ZT7B 1U8HB 3MV9E 4NWTL 3TGXA 4APQA 5BS0A 4RGMC 5BVPL 5I9QC 2FBOJ 5EOCJ 3NPZB 1RMFH 2OM5A 1U3ZA 3AS0A 3FQUA 1G7LA 4M62H 1ACZA 2XV6B 3O6MH 4Y7MA 4RGNE 5DHVB 3VXUD 4OLVH 3TO4D 2PXYC 3RVUC 1FHGA 1U8KA 3U79A 1J5OH 3C6SA 1DEEB 4LKXA 2A9MH 4PUBH 4U1MA 4UDTB 1FGNH 3IDJB 4WEUD 2CDEA 5ESQB 3SOBH 3DUSA 3G5XA 3GMMB 4G6AD 4B50A 3FQXB 3JV6A 1T2QH 2DLFH 4OB5L 1YN7A 2AEQL 4XNMA 5AD0B 3NMEA 2ZZUT 3K3QA 3IFPA 4LKCA 4O2FA 4PRHA 3PWJA 3I84A 1D6VH 2E9JA 5JXAH 2A6KA 2IQAA 5EB9A 2B5IC 43C9A 1IARB 1KBGH 1T89C 2JK5A 3W2DL 3U9UA 5GGUB 1A5FL 5E5MB 4KKCC 1T7VA 4BFBD 1S7RA 4YX2H 4QRPD 5J8OA 4NBZB 4ODUA 4GG8B 3NTCL 3K81A 3TO4A 1HN1A 3H9HA 1J1PL 1U91A 5F1KC 5HGHA 3FB8B 3MROB 1QLRB 3QP3A 3FB6B 3NCYS 1RIVL 4R8WL 5EOQH 5HYJD 5CWSA 1DCLA 2G9HB 3ROLA 1CZ8L 4UUJB 3TV3H 5C0RL 2EDNA 3RHWK 4ZS7L 5D7SH 4PJEB 1A7BA 2Y06H 1KJ3H 2AXGA 2W0FA 3I75A 4MA3A 4OF3A 5ICYB 1EAPA 4JRXD 4L8DA 4F15C 1LD9B 4ODTH 1PQZA 3A6CL 3MLVH 4LLWB 1WBZB 2VLJB 3GUTA 2JJUA 3EO0B 4YJZL 3VXQA 3AMKA 3D3VB 4K8RH 2ZNXA 3ZL4H 4RBPK 4PTUA 5JIIA 2YD9A 1B3JA 2DRUA 3MRHA 4QHMB 4QRPA 3AGVA 4UOJA 2GAZB 2X4PB 4XPTL 3VWJD 1UKSA 5JDSA 4C54A 4D0DA 5MHSE 3V9FA 4HJ0D 3T0WA 1NUNB 4HFWB 5HYJA 4G3YL 5E4IA 4ELME 2P7TB 5FO9B 2WNGA 5DRNB 1BWMA 1IAIL 1C08B 2IAMB 3MODL 3D69B 4HKXB 2ZCHH 4MA1C 4KUCD 3NIGF 4XCEA 1W72L 5ICZA 1H3GA 4LEXH 1LQSR 4JRXA 5GS0L 4Y1AE 1SJXA 3KLDA 1JMXA 2DWEA 5LBSL 4GBXA 5CGYD 1MFDH 5F3HB 4K3EH 5FYJH 4M7JH 3WL9A 5HGAB 4Y19E 3AU1B 2VXTL 1SY6L 3GSRB 1AFVL 3T0VA 6CGTA 5CP7B 2YD8A 2GQHA 5D1QD 5I75B 4NKOB 3GO1L 1FFPA 4P9HC 5FUOH 3VWJA 1ZSDA 2AEWA 3D18B 3GJFA 3O2DA 4HCRA 2Q8BH 3PNWB 1RZFL 1OT2A 4WI3A 3WS3A 3JWDC 1LDSA 4RX4D 1LEKA 3KYNB 1I1AD 3I2CL 4WU7B 3DTXA 4O58H 3GHBH 2YWZA 1G7HA 2W9EL 1X6NA 3ET9F 4O2EA 4YDVA 4I4WA 4U6HA 3CLFH 1CL7H 1RK1B 5ETUB 3FFDA 1UXSB 1ZHKB 2FATL 2NY4C 2CIIB 4UMGA 3VWKC 2R69H 3ES6B 4EUPA 4HK3J 1KFAH 5D1QA 5J12C 1A3QA 5DMYA 1AGDA 4BFIB 4OLXL 3EO1A 4AH2A 5K9OB 3C5JB 1AI1L 1NBQA 2RBLA 1FL6A 5EA0L 4DN3L 3A6OA 1P84K 5HPMA 2BMKA 4YGAB 1CFVH 1U9KA 3I50H 4RX4A 1I1AA 5A2LH 1P2CB 3MCKB 4MCYB 1TZIB 2HH0H 3OWEA 5DT1H 3VGAB 4XWGL 2VITA 3TH2T 4JY4B 1W2KT 1G6RA 3LN5B 1TPXB 5BJTB 4L4TB 4LLUA 1ADQL 1UH3A 3QIBD 1HH9B 1EO7A 1DBJH 2R56H 3T77B 5EO0A 1F4WL 3C8DA 1NAMH 5EZLB 3TA3B 2VE6A 1FP5A 5JMRA 5DVLA 3AC0A 4NQVB 4ZS6D 4R3SA 5KS9F 1L6ZA 2JJSC 3UZQA 5AYUL 4A2MA 1OWWA 2B1AL 4KQ4H 3RY6A 3UTPD 1ZWIB 5IF0A 1U8LB 4PR5B 4IHOA 4J4PD 5T5NF 4NOFA 4BH8A 4RMQA 4ORGB 3QXDB 2NW3B 5LJYH 4KGLA 3LKSA 2EEAA 5F6HJ 2PW1A 3HLAB 3QDHA 1CF8H 4NUJA 3HI1A 3BFOA 5FFLA 5F8QC 3FAXA 5DD5H 4OD2B 3QIBA 3CSPA 2OXGA 1NMBL 2HJLA 3CH1B 4BSJA 3IAGC 4TQEL 1KCUH 3NABL 5SWSB 1IM9B 1TXKA 1NBZA 4GSDL 3SDXE 1CDHA 2E7HA 1V5JA 4XVSH 2NXZD 1S7UB 1G9MH 3QDMD 2FR4B 2AEIT 2Y25A 3MNWB 4NCC1 3V4UH 3F6IA 1GZPA 4J4PA 3U0TB 1RZKH 3IFNH 1IQDA 4R90H 1JMZA 3MLZL 4PRPA 3QIUC 5F1NA 2FDBP 4DW2H 2OS7A 3MGAA 3DRQA 5JUEL 2NXYC 4PJAA 5C0FA 3L3JA 5I1KL 1FSKC 2NR6D 1Z5LA 2IC2A 3MBED 4OQ1A 3OPZL 3Q5OA 1CGUA 3BKMH 4PLKD 4HH8A 2CXGA 2Z8RA 1J9CT 2DYPB 4DVRL 4P99A 2VLMD 1BJ8A 2BHUA 1T5XB 5DS8A 4XVJH 1CICB 4YGVB 4IMKA 3MRDA 4PJHF 2VDOL 2CK0L 2Z35B 1PD6A 2DN7A 3DX8B 3KJ4B 2W07A 2FO1A 1A3LH 3DI3B 3QDMA 3VXOB 5CINL 1DBKL 5DD6B 5C0NC 2XXMB 3B9EA 4JFHE 5IMOB 1P7KA 1MVFA 2P5WE 5I6XC 4PTTB 2GJ6B 2YC1A 3SDDC 4YQXH 2Z92A 1RU9H 4K7PH 1K4DB 1XR8A 5GS0D 4AG4L 3MBEA 4ZUWA 2RCSH 3CD4A 4LASL 4OZFB 2F54E 1U8PB 5TGBB 1PBYA 4EBQH 2YWYA 4PV8B 2DQJH 3IGAB 1A7RH 3FQNA 2A77L 2MHAB 1LO5B 5C08B 5CEYB 1WEJH 4MAYC 3L5WA 1R24A 2YD4A 5IEHB 3DURA 3OXRB 3HFML 5DWUL 5FYKH 1G0YR 4G42A 1LP9F 1HHHA 3JZ7A 3OX8A 1EJOH 4HGWA 1S7SA 4LRIA 1FORH 4HUMB 1OM3L 4TTGA 3O6FC 4AT6B 4M5ZL 3VFRA 3TJHD 4NHCH 3BRGC 3N1MC 4UI2A 1XCTA 2XKUA 3HG1D 3REVA 1KNOA 3QIWA 3DROA 1A6UL 4N8CH 2E3VA 1CTNA 1BVKA 2CO6B 4M7ZC 3LEYH 5SV4A 3TZVB 3EBAA 5I19L 2HT4C 1X5IA 5F7NC 2GYSA 2C3VA 3DV4B 1NGXA 3E2HC 5D9SB 1X4ZA 4NP4H 4NO2B 1ODAA 4RISL 2FSEA 4J7RA 4OF0A 1X9QA 4PJXE 1R5WA 3BKYL 1WK0A 2AV7A 2CRZA 4ZSOA 5JR1H 2BSRA 4CVWA 3BI9X 3R8QA 2EIZB 1FNHA 1RD6A 1JFQH 4AQOA 4LQ1A 1ZA6A 2ICEA 2XKNB 4QF1B 1L7TL 5FGBA 4EN3D 1MHHB 4DEPC 1Z9OA 1B2WH 1CD1A 1F8TL 3G9VA 2OSLB 5HY9B 4XBGB 4D9RE 5IBUB 4EI6A 3HG1A 2E7LC 4F2MA 3QO0A 5C07E 3T4YA 2VQTA 1YEKH 1R5IA 1F11A 4YHNB 4LLQA 3GJEA 5ILTH 4PP1C 1HOCB 3SY0A 5D93C 4NN6C 3IU4L 1A6WH 3DO7A 3MYJA 4NSKB 3U7WH 1IGIH 2C1PA 3RWIB 3EOTH 4HS6B 1DFBL 3REWA 3MV8E 4HG4K 5HYSA 2I07A 1DVFC 1QRKA 5IESL 3TVMB 1C12B 4CU6A 1C7SA 4POZC 1GYAA 4EN3A 3QAZC 4I77L 5DEFA 5F7YC 5IHLB 1AIFA 5HJ3B 1E4XH 4KRPB 3VXME 3ESUF 3HE6B 5D1ZB 3SGDI 4FG6D 1FIGH 3B6SA 4AK1A 3PGDB 2EDWA 4UT9H 3U6RA 1SYVB 2F8XC 4WO4B 5FYLH 1KJVB 2HG5A 2NYYD 3P9MB 5JW4M 3AUVA 3UYRH 1L9NA 1EHXA 3L7FB 3MJ9A 1GGCH 1XT5A 5AG8A 4TULH 1BEYL 5D7KD 1K9TA 1EIBA 2OTWA 4PLJC 5DHVH 2NNAA 2WQRA 4PREB 5IV2B 5DTFB 3RI5F 1IGJB 4DWHA 3L3OB 4HKBA 1TETH 3VGHA 5I76B 4HK3N 2WSKA 2DI8A 4OZ4A 4NJAH 4Y5VA 1TCMA 1H3UA 5IR1B 1N6QL 4L5FH 4M1DL 1HHKA 2EDFA 3MRCA 2FECI 1MCRA 4X4YB 4N0CC 5IB2B 2EC9U 5C2UB 4C55A 1T04B 3SCMC 4HUVA 5IQ9B 2EEDA 4YO0A 5GRVK 5T3ZH 3OKOA 2DAVA 4MX7A 3UAJD 4ZFGH 1JGEA 1W0YT 1C1EL 4OGYH 3I02B 4E41D 3B8YA 2UWEF 4JJ5B 1FZMB 4KQ3H 2FLRT 4RRPG 2BSSB 5F7DA 32C2A 4GAFB 3WNPA 2AK4B 1W0WA 2EZ0C 5IBLC 5CBAB 3OR7A 3FCTA 4OCRH 1KB5B 3MXWH 3FQRA 2X4SB 1BP3B 3ARVA 4D9QD 4PJGA 3L9RA 4X6DE 3K74B 4Y2DC 4ZNCD 3C5ZC 4S1DC 1EBPA 4JM2D 2FGWL 4H25A 3K2UL 3PP4L 1T4KB 3CSYB 3TCLA 3CFDB 2W91A 1H5BC 2R2BA 2HJKB 2G5BB 4ZOBA 5EUKA 3VE0A 3KR3H 4XC1H 3BGMA 3ZDYF 1NJ9B 2FJGA 4E41A 4DUWA 3P77A 4QRQB 4U6TA 5CJOL 1UWGL 1F4AA 2P8PA 4QXGH 4DZ8B 1VPOL 3KHQA 3MXVH 2AJ3B 2AS5M 4LCIL 2X4NB 2D7TL 3RVVD 2NY3B 2BK8A 5E7FA 2QQQA 3HE7D 5T1KB 4HJJL 2Q86A 1A14H 4I2XB 2UYLA 1AD9A 4JM2A 2YPLE 4YXKH 4PB9H 5CUSH 4X7EC 3O9WC 3IFLH 1QLEH 3TC9A 4O2CB 4WW2A 1OOAA 4QXUL 1YY9C 4LIQL 5EOCH 4BQ8A 2G5RA 1QZ1A 4FABL 3LOWA 3VD5A 5ADOH 2NYYC 3G6JB 5J11B 1AXSA 4XX1E 4DTGL 4TNVF 2R2CA 2FYYB 3D6GA 3HZMA 2OR9L 4M6AA 3RY4A 1E6JL 3LIZH 5ISZE 2A74B 3QUKB 5DUMH 4GXUM 3F6LA 1QO3A 2A6DA 3EJYC 4JFXA 4KXZH 3CC5B 3WHXB 2WLZA 3ILQC 1XGTB 3HE7A 3Q1SL 4JQIL 4L8SA 5AZ2H 4F7TB 3PV6A 5BZDB 3CZFB 5ITFB 3BW9B 3MUY1 5EC1A 2VZVA 3HI6H 3KLHD 2W65A 5DMIL 1RIHH 4ZTPH 3ZO0A 3MZTA 5C0BE 3WCYA 4TVSa 2BP3A 4XC3L 2XY2A 4PRNA 4K3JH 2C4XA 5IVXB 5JW4R 2CLZA 3O2VL 5B8CC 1NUDA 5FGCE 3OG6B 4G7VL 3VH8A 3VGEA 3OKMB 2IPKB 4RNRB 4S1QL 5DA0B 1LE5A 1UWXK 3LQAL 4WFEE 1NFDE 4HWBA 1L6XA 3NCCB 2GUOA 2VL5A 3X17A 2AJZB 3DBXB 4KTDH 5HHVH 3CX2A 1W8OA 4W4NA 4JG1L 1TNMA 1VERA 1CIDA 3CZJA 4KI5E 2BFVL 4TYUA 4DZBA 3UJTL 3G6DL 2GCYA 1IAKA 2P1YA 5DJAB 1MI5D 3OJDA 2Q87A 2AJUL 3Q6GL 1FPTH 4K2UL 4OZGA 4HC1L 4IJ3C 2FZ3B 3BPNC 2DQDL 2QSCL 4QCIA 2X1XR 3ULUF 3ZYOA 1ACYL 5EU5B 3BD5A 4LK4A 3EFFA 5KSBF 2P5EB 3DO3A 1BFTA 2V7HB 2E7BA 1I1RA 1EBAA 4PRAB 1RUAL 3U36B 4LCYB 2ZP0T 2E6JA 3BPCB 5FOJA 1A7NH 3VFWA 1RZJL 2EDTA 3UTTD 1OAKH 2QHRH 3C6LD 2QSQA 5FHAL 3UZVB 4LU5L 3GIVB 1GOGA 1U3HD 4M1CD 5K9JL 1MI5A 5ANMA 5D2NB 3Q5TA 1S9YA 3HKFA 3BUYB 4MJ6B 4L8CB 1KULA 1QNZL 3RVVC 4AZ8A 4G6ML 3EDFA 3LN4A 5H2BB 4OKDA 1U92B 3VGBA 4LSVL 2WBWB 3LEXA 4JY5H 4JDZB 1GJIA 4PJCA 4ETYA 3BZDA 2Y5TB 3H2WA 5I1IL 3PDOB 2Y9RT 1EHLL 4YPGB 3JBG7 3L3KA 1A1OA 5I8EB 1XFPA 3UTTA 1D5ZA 3KYOB 4M6MH 4U05A