1S7QB

Crystal structures of the murine class i major histocompatibility complex h-2kb in complex with lcmv-derived gp33 index peptide and three of its escape variants
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of structural principles underlying three different modes of lymphocytic choriomeningitis virus escape from CTL recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
total genus 12
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s7qB00
3M8OH 5M94B 1YEKL 4NQEB 1XZ0B 5CINL 3QEQD 3S5LG 3ZHKA 5K9OA 3QI9D 1RZ7H 3IF1A 2V7HA 3D0LA 5M7QA 2YPVH 5F7YC 4YHYC 5E6IB 4PJ5A 5D7IE 3TESA 4Y4HB 3K81A 3BX7C 5LAXB 4B0MM 5KSVB 4D9QD 4XRCA 1IGIH 5DVLA 1ZS8B 4H8WH 3FO2B 4KMQA 2D0FA 3HE6D 4KAQH 4PRHE 2DQTH 3GRWL 2G2RA 1WF5A 2BXZA 2D31A 1S7SB 4QCIA 5FXCH 3WMSA 2HLFD 1GVIA 4ZPVA 1S9YB 4HWEL 4MJ5A 2F9BT 4QXGL 1OGAE 4ZTOL 4Z18A 3UPRB 1YMHA 1MHHA 4WWID 1MVUB 3L9RB 5LVEA 5HGAB 3IDNB 1RFDL 3SE3C 3BAEL 1KB9K 1TENA 1KLGB 5DHYA 3BD4A 5F89B 3V4PL 4YDLC 1DSFH 4LCCC 5FK9B 4ZUSA 5H35A 5FUCE 2HKFL 4OGYH 2W38A 4HZLA 3FFDB 1KXQE 3ZKND 1RZIA 4HS6B 1BFSA 1QLFB 1A9BA 2QQQA 1FP5A 1KLGA 5DHYB 3ECBA 2NY4C 5IFJA 3QI9B 4KI5D 1RUKL 2FL5B 1UEMA 2H2PD 4Y4HC 2X89A 4M48H 1MIEL 4W70A 3NFNB 2ZG1A 1ZT1B 2HJLA 1U8JA 2DQCH 5DHVA 3VCLB 1EZVX 1T7YA 1MCSA 3MGAA 1FZOB 4OT1L 2Z92A 2C7UB 4UTBH 3MLZH 4RA0C 4TVPE 5CGYD 4YHNB 4HCRA 2FX8H 1L6ZA 3H9SE 4MX7B 2VXSL 3OKMA 2X10A 4JKPL 2EIDA 4Y1AE 4OLWL 2DKMA 4L3CB 4QXUL 4LP4A 1YNLH 1IEAA 2K1MA 1MI5E 1MJ7L 1K8DA 4TVPH 3VGHA 1IFHH 1EO7A 3SKJH 1PGRB 5DI8B 1LO4L 1GHFH 1QFPA 2XTJC 1NEZB 3JXAA 1IM3B 1T0PB 2VLLA 4YO0B 2FJGA 5HYSG 1HQ4A 4B7LA 3GKZA 3NFPB 1CL7L 3QIUB 4HWBH 1EHLL 4M7LT 4JRXE 3MYJB 3C60A 3WUWA 1QBBA 1VSCA 1NCAH 1JV5B 5ANMA 5ETUA 3ET9F 3ORJA 6FABL 4X8XA 1KIRA 2F53A 1KB5H 5AD0B 5D6CA 5JPMA 1IM9A 4UBDC 1SVCP 1HIMH 5GRJH 4DGIL 1QR4A 1RZFL 4N8VG 1KGCD 1C16A 2C3HA 5FO8A 3H42L 2R0WH 4KRPC 1NC2B 4MJ4A 5E24E 3SEPA 2M1KA 3QUYA 4NZJA 4JM4H 2W0PA 2AEPH 1HKFA 4UNUA 3O11A 1J0ZA 4DKEL 3S4SG 3DGGB 5MENA 1DQQA 3EJYC 2FLRT 1DN0B 4L8BB 3BZFB 4DKEH 2NX5A 1REIA 1U8KB 5EA0L 4HKJA 4K9EC 4KC3B 3WS6A 5EZLA 4OFIA 5B38B 4OLYH 1LD9B 4HKXB 4OFDA 5DFVC 3LN4A 5HD8C 1GPOL 1XR8B 3LD8B 3BZFA 3ME0A 5JW3L 3ULUL 3GNML 1A6UH 4PJ7B 1M6OA 3I2CH 3BI9X 1MQ8A 4NBXB 5C08B 1C1EL 2WP3T 4LKCA 5GGTH 1DUYB 1QFWM 3TH2T 3VGBA 1ACYL 1SBSH 1UQSB 4FQCL 3AS0A 3FHAA 3CX5K 5D2NB 3OAUH 5CIPB 1E6JL 4AEIH 5GJTH 4X6CF 3UTTE 5LWYH 3S96B 5H37H 3ROOA 1HHIA 3SKOA 3V4UH 3IDGB 4WU5A 4Q97A 5JA9A 1UQSA 4WEBH 1AGCA 1KCSH 3SKMA 1EFXB 2RGSA 1RJLA 1XGPA 4IDJH 2NY0D 4LSRH 3WBDA 2FWOA 3O2DH 4YX2H 12E8H 4X7SH 1FVCA 4XNQB 4E5XA 2GFBA 5IVXE 4EQ2A 5JLZB 3QUYD 3EDDA 4YBLC 2AKRA 3NBNA 5T1KB 3VXRE 2OMNA 5DC4B 1KLUB 1C12B 1RHHA 4OIAA 3WKMH 4OD2B 4AM0B 1QSFE 3MX0A 3WNKA 4MQSB 3IJYB 2EDNA 2W65A 4XVTH 1AGDB 2DMBA 2X4TA 4I0KA 5FYJU 4WWKD 4XI5D 5DD1L 5DK3A 1YYLL 4IOIB 3TYGH 5T3ZE 3OR7B 1RZIB 3LKNA 5T3ZD 2IPKA 3OG6B 4NN6B 1TZHA 1MIEH 4Q6YA 5DQ9A 4LCIH 5DI8A 1CICD 5AYQA 3QUML 4FQ1H 3S5LA 3WNNA 4KKLD 1HQRB 3C60D 3UX9B 2P49B 3C8HA 5DVKA 4JFXB 1FLRL 2XN9D 2UWEE 3WFDL 4PJAF 4GAJL 1MJJB 1I9RL 1MUJB 4CMHC 3KPRD 3PGCB 4S1RH 4FQQA 1FN4A 3ES6A 4YGAB 3C08H 5D1QB 1B4RA 4Z7OF 3G5ZA 5T1MA 4ELKB 1H3XA 5D7IF 1XGUB 3LQAL 5E99L 3VD4A 1CFSB 5GJSL 3SY0B 5FO8B 3BISA 4JFYB 4KHXH 4OGAD 4QXTB 2BRRH 1BJ1J 1TPXB 4QY8A 5DRNA 4R7DA 4Z77A 3GMOA 5F1NA 1RUPH 1DQQB 3IFLH 1ZVYA 2OYPA 4M4RA 1MFEH 4K3GA 4OAWB 4P59L 2E5EA 3RKDC 5D8JL 2CR6A 3MLTB 5D5ME 3U0WL 4JHBA 2MWCA 1JRHI 4O9HL 1H8OA 1MIMH 1KF9B 5F70A 1FNSH 5ACLA 4ZD3L 2APFA 1G7MB 3DHMA 1T5WA 1UM5L 5E6IA 1A1MA 4ACPA 3DECA 5L9DH 4JY6A 4EQ3A 3TCLB 5DMKB 3HFML 2YPVL 4BSWB 4N0FA 4HX1A 1DQDH 4QOKD 2MOVA 3H9SA 3D1MC 4GRMA 5FAAA 4ZNEA 4PB0L 3KYKL 1B0GA 5GRYA 4CVZA 3SE9H 3S3JA 1S78C 3RAJH 5C09A 3RGHA 3EO9L 3QPQD 5IJKC 1DBJL 1YEIL 2NZIA 2V5MA 2X4PB 3BQUA 3CAFA 3OL2A 4G8GD 5SWQB 1I8IB 3IU3B 1PDKA 4EIZC 4G9DB 2A83B 3WXWH 3TV3L 5BZWA 2VH5H 4KVNL 3MROB 4PLJD 2FRGP 4MHHI 3V5DA 4LPUA 2AJSL 4F7EA 2BX5A 2DKUA 4WENB 4NRYB 5EU3B 1QBLL 1AQDA 2B1AL 3L5WA 3FN3A 1I1CA 2ZCHL 3UXFA 1DR9A 1V3JA 4UQ3A 4EI6B 1RK0A 2XWJA 4OCXL 2Y72A 3R06A 5DJXA 4PGBB 5HHOD 1ES0B 3BYYA 3QJFB 1MFBL 1T1XA 3TNNA 4DK3A 4H0GA 4CU8A 4FS0A 5C8JB 4LVNB 1TZGL 3BEVB 3TO2B 4FFYH 1F00I 3VFRB 1OGAA 2GJ6A 4F33B 3ZKNC 3OPZL 3S37H 2Q86B 3S96A 4U05A 5HGHB 4PLOB 5D7IB 3TWCL 5C8JA 4MXVE 2ZSWA 5JDSB 2IMMA 2J8UA 2OSLA 3KDMB 9CGTA 4GW1B 3FOLB 4I3RL 5L88H 4QRRD 1ZT7B 2X7LA 1NDGA 5HSFA 2X4OA 1EBAA 4MDIB 3U4EB 1FFRA 4QRPE 2B1AH 2BNQA 2OK0L 4YJZL 1GGCH 1B0RA 4PJXE 4WFFD 2EDQA 3JSSA 3KPOA 4OD3H 5GGSB 3RTQB 4KVNH 1B90A 3K0WA 4Q6IA 1F90L 4M9OA 4RFEA 1JGVH 4F58L 2EIBA 1QSEE 1OPGL 2P24B 1JPGA 3LQMA 4F15C 1K6QH 2I9LA 1B0RB 1IVLA 5HGBA 4HK3J 3EJJX 5HYEA 5GQBA 1U95A 1F6AB 3BXNA 3PHSA 1IAMA 2YOCA 3MGOB 4K3HA 1XGYH 4AH2B 2VSDA 1Z9OA 3OV6A 3LKRB 1J05A 3QIBA 2R2EA 2P5WD 1QLEH 1RJYB 2X6MA 3OKEB 1MJJA 1L9NA 4F7CB 2WLYA 4ZFFB 3AGVA 2EEAA 2XWTB 1ZT4B 1OAKL 4FNLH 2DS4A 1HDMB 1UXWB 3QDME 1Q0XL 1N5AB 1J05B 4M48L 2DTSA 5BO1H 4ZD3H 4HQQL 5HHQB 4X6CA 1AR2A 2XA8L 1FO0A 5BS0B 2NX5B 4ERSL 3MRLA 3QPXH 4YFLF 2DL9A 4ZPTA 1S7VB 2MFNA 5DFTA 1YPZB 43C9B 4RQQA 5E1AA 1M7DA 3ARGD 3O3DA 3MROA 5KSBF 2IANA 3WFBH 3NCYP 5DJYA 1ADQA 3ULSA 5MEOA 2A6DB 4R8WH 1OAQL 3A6BH 3QCTL 3QFJB 4M7KH 1CGUA 4OIIL 1BWWA 4P59H 3UPRA 5I17A 2R4RL 3RY6A 1F4XH 2NR6D 4PGEB 4C59B 2R23B 2OR9L 1CCZA 4CKVX 3DSNA 2KDGA 4FXKB 4OI9A 5IK3B 3S37X 4H1LB 4MYWB 3ZKMD 3ULUF 2DI9A 3Q1SH 4PTUB 4NO5B 3EFDL 1F6LL 4PTTB 4LDEB 1YNTB 4M7LH 5IKCA 1C7TA 1SEBA 4NQCE 4JG1L 4P0DA 4Z76B 5FOJA 4Z7QE 1JNNL 4BFEA 4M6NL 3TT1H 3DX8A 4S0SD 4U1HB 4HUXA 2EE2A 3TNMA 3QH3B 3WLWC 5I1JH 5CJOH 3LKQA 5CP7B 1CT8A 4XC1L 3VFMA 3ARVA 1VA9A 1ZTXH 4DOHE 3OB0H 3QWRA 2UZIL 5C08D 5I18L 4I77H 4AIZA 5LCVH 1TMCB 3LKPB 4P4KA 3D69B 2WW8A 2BVEA 2VTFA 3CH1A 4YHKH 1F6FB 4LLUA 5EO1A 2WWMC 2DTMH 35C8L 4U6YA 4RGMC 4LSUH 4UV4L 1WWWX 4TOYL 3SJVE 2XTLA 1W8NA 4HMDA 5EU7C 2N1KA 4POUB 2ICWJ 3U0PA 1DVFD 1R5WB 5LBSL 1KJMB 1U92A 2Z93A 4NKIL 2CLZB 1LP9E 4ORGB 4JAMB 4BSVB 3WO4B 3EUUA 5JNYA 4JFQB 5I1AB 1A3LH 1AP2B 1RUQL 4U1KB 3RWGB 1ACYH 1CLYH 4IRZH 5DJAB 1WISA 2B2XH 2A6IA 3OBAA 4OZFA 5T1KD 4NHUA 5FB8B 3WIHH 5D7LE 1QFUH 1WAAE 2XXCB 1FL5B 5E0QA 1DEEA 3T08A 1J9CT 1TJGL 1I7ZA 3MYJA 3P73A 4LU5L 3WUWB 5FHBH 3C60C 3FO2A 5GZOD 1D6EB 1PQZA 2ZG3A 4F15B 3OTTA 2JIXD 3ZDYE 4PJHB 1MHPL 2XIDA 4Z77B 4NSKA 4NHCL 3RY4A 3I6KA 5AUMA 4JFDB 2HMID 4EKXA 4Q9QL 4RGNB 4GT7A 3D9AL 2HKHL 2X9WA 1N6VA 4X5XA 5I1GL 1IC4L 4I18A 5IG7B 5HGDA 5IM7A 2D7NA 2HJFB 3QIWC 4N1HB 1RSFA 2CRIA 4PJHA 2V2XB 4K7PY 4MA7H 1YQ2A 1Q9KA 3ARXA 4RA3A 3HC4L 3KPRB 1WFUA 1I3GL 4N8CH 1D9KD 3HZYA 1CGWA 3GMRA 1U8KA 1I3GH 3G5YA 3QDJB 1ZLVH 1Z2KA 4JZJB 3BP4A 4LLWB 2EYRB 1QFUL 4CBPA 2YN3A 2R1XA 2Y23A 4X9HA 2BCKA 2NY5L 4H8WC 3HA0A 3RL2A 2Q6WB 3ZSSA 2ZCLL 3D85A 1OB1A 3Q0HA 3T77A 1Q0YH 3KYOB 1JZ2A 3FQNA 4NHCH 2ESVA 5HJ3A 1DBML 5ACZA 5ESVB 4IMLA 4HLJA 2EDOA 5GGQH 2PW1B 3HB3D 3SGJA 3OF6D 1CL7H 1ZHLB 4EDXB 3HI1A 4GS7C 4KRLB 4NQVB 4MVBD 5EB9A 2VN7A 4U1NB 3KR3H 1GOGA 1ONQA 4QXUH 2F8OA 43CAA 2LU4A 4P2QA 4JHWH 1LILA 4TOYH 5IW6B 5CS7A 3RZCC 1VFMA 4P2QE 3WLWD 4ZFOA 5LBSH 4QWWC 4NQVA 1TQCB 3F62A 1MWAH 4GKNB 3RZWA 1D9KB 3CVHB 5I1JL 5F3BA 3QDGA 4PJXF 2EDDA 4ELMF 3GJEB 1OTUD 3RWHB 4NO3A 4S2SA 5EZOH 4L4TB 4P5TB 3DLQR 2IG2H 2XWBA 2VLMD 1UC6A 1F45A 2E9BA 4JVWA 4JCMA 2ICCA 4F7MB 2ZP0T 1MCPL 3BP6B 2XV6B 1UH2A 4IBLT 4O5LL 1A0QL 1T66D 4JG0H 3HMXA 1OF2A 1DVFC 4I5BA 4W68A 4P23D 2FGWL 1RFDH 4M61A 5HBBA 3Q2CA 1WBZB 4S1QH 3K8KA 1I7RB 5L2KB 4GRLC 1DQJB 1OSZA 4LEXH 3SO3C 1YDPB 1KNOA 4JQIH 3M1BA 4D9RD 3MV9D 3WN5C 4LLQA 4MXQC 1D5IL 3R0MA 4EEEA 5FA4B 1QQDA 3GIZL 4Y1AB 1KG0B 1SJVA 2XRAL 3J8F7 5IVZA 3IF1B 1CF8H 4YGVA 1BZ9A 2P8LA 3TA3D 4JR9H 2ZCKL 3MODH 3RBGA 4TSAL 4PRID 4PJEF 4G43B 1KUMA 5EUKB 4C56D 4XRCB 1S7QB 1ZK9A 3QHFH 1CS6A 1T89A 1TTGA 4CN6A 2WIIA 5DC0A 1XIWA 3NA4A 2A9NH 2APBA 3B9DA 3P9LA 4C57C 2YD3A 3BUYB 4YHLH 5DD3L 2YZ8A 1LVEA 2QSTA 2J1KA 2VE6A 3FCTB 4E42A 5L6YH 3V6FA 4P9ML 1UZ6E 1A1NA 2WLZA 1G7JA 5IR1B 3D5OF 4ISVB 1VEOA 3IJSA 5J6HB 1YMMA 5KZCD 3SDAA 3LN5B 1KACB 4AT6B 4OF5A 3WJLA 4ZFGL 1Q72H 1OCWL 1J10A 5SWSB 3OKDB 1AXSA 3KPNB 3QEHA 5IWLC 1N59A 3HR6A 3U0TB 2QBWA 5EIIB 5B38A 4OD2A 1F8TH 1H3TA 1WIPA 4AM0A 3DETC 2X44D 1JFQL 3P0YL 5HYIA 4FZ8L 1VGKB 1CLZH 4X99B 5DD6B 1XGTA 3HZYB 5I19H 4HKBB 4M8VA 1JGVL 4Y8AA 1YY8A 2XKNA 5A16B 5E9DD 2QHRH 1NCCL 3L9RA 4Y2OA 4NQED 4KVCH 4KY1L 4WCYL 1INDL 5DJXB 3LY6A 1TVHB 4U1HA 4U2ZA 3U36B 5KVMC 4OBRA 1T03L 3TVMA 1IC7L 5F7EH 3LQAC 3FB6A 1NAML 2PO6C 4B53A 1G6VK 5MI0B 4XCEB 3DUSA 3UTSD 5ALCH 5FGBC 1LEKB 1T83C 5DJ0B 1FFNB 2AV7A 2QQNL 2HLFC 3I6GA 1Y6MR 5KAQG 2PW1A 5FYLL 2NY2D 1T4KB 3KPSA 3CFBA 1MPAH 25C8H 4OJFL 3CFJA 3SDAD 5EOQL 2IPTH 1MFBH 1U3HB 4R0LC 2QKIB 3FOLA 5CP3A 2CR3A 3IS1X 4OCYL 1IC4H 1O7VA 3QUKA 2JJTA 2AJSH 3G6DL 1I1AA 2V5SA 1P7QD 2MSPA 4AL8H 1BJ8A 2CLZA 1NUNB 3VXMA 2EECA 2W07A 3WL9B 5HYJD 1TZHB 4I9WD 1MY7A 4LPTA 5C0DB 2NCMA 3FT4A 1A2YA 1EO5A 1RIHL 3WXWL 1T20B 3LDBB 2B8OT 2F53B 4S2SB 5GS2H 1K8DB 4YR6B 3RNKB 4G6JL 3QUXC 5FKAA 1ZSDB 3N1QC 2V17H 2R69H 4ONHB 1K5NB 1I8MB 5FECB 3L3GB 4PR5B 5C0EB 2HTLC 1ZLWK 1JYWA 2M8XA 3MACL 4FQXB 1JNHB 3ARBD 1UM5H 3I6KB 4UIMA 5AUMB 1X5KA 4FQLL 4XBEH 2CDGA 4QHLB 4E0RB 2JB5L 4WY7L 5DJDB 5DVOA 2DTML 35C8H 4HFWA 1S78D 3DXAB 1DQDL 3TZVD 4R7DB 2CLRB 5IQ9B 4PJBF 2XTJD 2EIEA 3WN5A 1P4BH 5GRWA 2GYSA 1IARB 2Q3ZA 4QHLA 3FZUC 4O00A 5EPMA 3QEHB 5F9DC 5E2WL 5ADOL 5FOBA 4JZOA 2AK1H 1DDHA 1HZHH 3LHPH 3U0WH 1K4CB 4Q9RL 4IEFB 5DD6A 2A6DA 4GKSA 3WO4C 4NJAL 4JDVB 4HWNA 4Y19E 4PJIB 2Z91A 3CDGB 4PRAB 4GW4A 2F53D 5J11C 3JTTA 4S1SL 3TVMD 1NC4A 3BZDA 3B9KD 3MUY1 2WV3A 3P9LB 5IK3A 1QRNB 3H2WA 4K8RC 1G7IA 5FA3A 3NMEA 4BQBA 2XFXB 2FL5A 3O41B 1N6QL 4RMRA 2FZ3A 2Z8SA 2ZSVB 3BH8B 3FB5A 5I16B 5IB3A 3QNYB 4HV8B 2AK1L 1J0KA 3C6LC 3VXUB 1F4XL 1YYLH 3QQ4B 4FQ2L 4B50A 5IESL 5CUSL 1JGLL 2VO5A 3IJYA 2GKIA 1JWSB 1YEHH 4RGOH 4JN2B 1E4WH 1S7XB 2AJ3B 4TUKL 5EBLB 4OUOA 4JANB 5TDPB 4OM0H 1C5DB 1TJHL 3CFJB 4ODBD 1SYSB 4MNHB 2FR4A 1E27A 1HYRC 4GAGL 4HKZA 1A14H 5F1IA 5BW7C 4BQ9A 3G04B 3ULUD 4NNYB 5IB1A 3N85L 4PGDA 1EGJL 4BZ1H 2YA0A 4XC3H 4AQOA 5CJ8A 5GGUB 1TNMA 4JM2D 5K9KB 2CGRL 2V2WA 3BD3A 3I3DA 4IRSD 1SYSA 5D7LA 1KCVL 5C07E 5CP3H 3Q3GA 5JORA 5E56A 4NP4L 1A47A 3C5ZC 2FX7H 1CTNA 5JOFB 4UB0L 5F88A 1RMFL 1S9VB 3L6FB 2EEBA 1NKRA 1EVTC 1Z9SA 2X4QB 5JO5A 1VGEH 2ADFH 1PSKH 1FQ9C 3HHRB 2K7QA 4LCCB 3HPJA 1MQKH 4IOIA 3P0VH 1AE6H 4WEBL 1IAKB 4L9DA 4X6FB 4GMTH 4D8PB 1MCJA 1QP1A 2AK4B 5DD0L 2IBZX 4ONHA 3ROLA 5CLWA 1Y0LA 4X7SL 5EO9A 3VFGH 4JLRB 4N0UE 4OZ4B 3KDMA 4PJCB 4CAGA 2P48B 2PW2B 4NHUB 3HCVA 2VLJE 1UFUA 4CN4A 1N5AA 4WI6A 2X40A 5JPMB 5EU6D 1KJ3L 3I02A 3UMTA 1PYWB 4WNQB 2FDBP 2FD6H 4MDIA 4KK9C 3P4MA 4RFNC 4PRDB 2A2QT 1UJ3C 3FAWA 4N8VA 5K33A 1X5IA 4K07A 5DRXA 1AIFB 1GZPA 1SJXA 5C0BA 2EKSA 3HCVB 4X6BA 3HI6H 5IHUH 2YPLA 4HPYL 1MH5A 4PJAB 2W0KA 3UYRL 4Q6IB 4JPIA 2VDKH 2JJVA 1NANI 4U1LB 4WFGD 5AZEL 3RPIB 3KPPA 4K71B 2AEWA 5C07D 4BH8A 3VXSE 3A0OA 3VE0B 1KPVB 1JPGB 4Z0BH 2BC4B 4MNQA 5I1KL 1B4JH 4NGHH 4X5LA 4H26A 4MA7L 3EDKA 4J3TA 3VWJB 3ZYOA 1XIWB 1HIML 4PY7A 4Q2ZA 5GRJL 4DGIH 3FO1A 1IM3A 2VDLH 3HS0B 1KIPB 4R97B 4HC1A 2EE3A 3MJ7A 4X6DB 5T3ZH 1YY9C 4IIQB 4EBQL 1M05B 3D9AH 1R5IA 1WZLA 1MNUH 2V9RA 2LU7A 5I1HL 3FB7A 3VWJA 2Q8BL 4D0CA 5FGSA 4F7PB 2ED8A 2UWEA 1I8KB 5JXAH 3JWOL 1IM9B 5C71A 2JJSA 3V7MA 3SKJL 5ALBL 2BNUA 3GM8A 3KPRE 1XCTA 1D5MA 4QTIL 3FOMB 1N8ZB 3B43A 1DLFH 5ID0A 4JFEA 3O11B 4GXVH 3TIDB 1INDH 1T2XA 4HIHB 2MHAA 5DJYB 4LAQH 2VABB 5MHSE 3CXHK 4Q74A 4S1DD 4OV5A 1QO3B 3RKDD 1KCUL 5CD3B 4WU7B 2X4NA 1AKJB 3HUJE 1RHHB 1W0YT 5I19L 2R0KL 1YNKH 3VRLE 2EXWD 2IFFL 2A77H 4HIHA 4ZMAT 4ONOA 3O6MH 5MEQB 3P0YH 3KHQA 1YECH 1QNZL 1G9NH 1RK1B 2H1PL 3EFFB 4GSDL 5F7KC 1U8QB 4Y4KD 3MRJA 3BD5A 5HDQL 2AGJH 3ELAT 2ZUTA 4M4PA 5F88B 4XZUA 1EO8H 2Q7YA 3L5XL 1R6VA 2R1YB 5C0CE 4FN0A 5EOCJ 3EYFA 5JO5B 1SM3H 4L4VA 1QSEA 1YMMD 2VOTA 3BPNC 2KZWA 2VDNH 3W9EA 3D2UB 1A4KB 4JKKA 1AQKH 4HULB 5GSRB 5DSCB 1P7KB 4TQEL 3IXAB 3HR5B 4X4XA 1NMBH 2W92A 1P53A 1GGIL 4Y5XB 3QHFL 5TJWK 1S7TB 5F9JA 3WFCH 2CKBL 1Y6NR 3DBXB 3JUZA 4LLUB 1HWHB 2YK1H 1U91A 3TJEL 3UPCA 4L8CA 3GSQB 4ZO7A 1LE9A 4JJ5A 1N64H 3MOQA 1CD8A 1YDPA 1NDGB 2DMCA 3VMOA 5A2KH 2ORBL 3BKCL 5CSBA 1ZSDA 1HN1A 2P43B 1EEYA 4CJ0A 3HLAA 4YDKH 5DFVD 4RFNB 1FNEA 4WUKH 2EYRA 3OJMB 3S5LB 3G5VB 4GG8A 2CD0A 4Q58C 3ZHDA 1SMAA 5CEZL 4NOBA 4XXDB 4ZS6D 3T0EC 3OJVC 5D70L 1RU9H 2LQRA 1XZ0A 4GG6E 1G7LA 1R5IB 2XYCA 1VKXB 3O2WH 2VDOH 1QA9A 3DRQB 43C9A 1A0QH 3K8LA 4GLRH 4MLIA 1NSNH 5GIRA 4N5EC 4WO4A 5F72S 4KK6D 3SDDB 2E9JA 4H8WL 4TNVF 4MQTB 5AWNL 5B21A 4E42B 5C0AA 1U8MB 3W5MA 3P30L 3AS3A 3I50L 3IT8D 4F9PA 5A2IH 1XGYL 1IGJA 2ATPB 4PYGA 3B2UC 1IC1A 3HNTH 3ARQA 4OTXH 5I2IB 4RRPG 3CUPB 1OPGH 3TO4A 5H37G 1OTUC 3VXQB 1ERNA 1I3RB 2DQIL 1EXUA 1HXYA 1AJ7L 3CVHL 3CVHA 5D2LA 5ICXB 1NC2D 1P6FA 4JFPA 4M6ML 2AV1B 3P4NB 5L2JA 5GJTL 3DXAD 4MDJB 3RWCB 1LO2H 4LFHD 5T3XE 3IXTA 3IAGC 3KLSA 5E5UB 2QL1A 3O4OB 1X6LA 3GHEL 1N5YH 5E8DL 3PDOA 1AGCB 3OGCA 2P5WB 4HWUA 5L88L 2IAMC 2P46B 2F15A 3AREB 4CVZB 4IOFD 4KKBD 3LEYH 2VLKB 4PJ8A 5IMLB 3IU4H 4OF6A 4QYOA 3HG1B 1ZWIA 2AERT 1RIUL 3S35L 5HPMA 3VFOB 4ZXBA 4YHIB 3UTOA 4PRBB 4TRPH 5DHXB 4J2XA 3RIFF 1FYTA 3MC0A 3SCMA 3PGDA 3MNVA 3LOWA 1RIVH 4O2CB 1U3HC 1JZ3A 2BSTB 3ZDXE 2VKXA 3LKQB 5ITBL 5IT2H 1AXTH 1QPPA 5FGBA 3CMOH 1FH5L 2DKSA 5DJAA 5LJYH 1DQLH 3LKPA 3MLWH 1CFNA 4JQXC 4C56A 3CZJA 3QAZC 1R3JA 4F9LC 4LQFH 1NAKH 3KGRA 3ZYJA 5ISZA 5EUKA 1EHNA 3GKWL 4HS8H 2PCPB 4Z7UA 4DCQA 1FSKB 5TGBA 2C4XA 3VWKA 4F33A 1ND0A 4OB5L 3F12B 3MLXL 5FYKH 4PP1D 4KWUA 3EYFB 2ZUVA 2IADB 4N0CD 4QNPF 4M5YH 4I5BB 3VFGL 5FYKU 5C0FA 2Y5TB 4PJ5E 3GBNL 2P4AB 5IWLA 3T09A 4G6KL 4WV1A 2H2PC 4JM2B 2J8UB 2OSLB 1BMGA 5ANMB 4X5WB 2V2TB 5J13B 3KPSD 4BJLA 5D72L 1MHCB 3GM0A 1MCIA 4WHTB 4YC2B 3MV8B 3N1PC 4DUXA 1XGRA 3MCLH 4X6CB 2JELH 1FO0B 2V7NB 3PV6A 5EUOF 5BS0A 4L8CB 4BUGA 3OXRA 3MJ8B 4KKBC 3SDCB 3I85A 1Y6KR 4PLJC 2YD1A 4JJ5B 1NGPH 5CKGA 3MO1B 4XTRC 3MXWH 3JBG7 4K9EL 4UV4H 3FAXA 3RGVB 1TXKA 5H94A 5CSZB 4JY6B 1KLFA 4LQ1A 5D4QA 3BPOB 4JG1H 4XCFH 4JZOB 5TH2A 5B8CA 4TSCL 4M7JL 1YMME 4CJ1A 3DVGA 2A1WL 2UZIH 4XPAL 3VFVB 1NGQH 2A0LC 5A3IC 3T2PA 5F7NC 1HSAB 4J3XA 4OI8A 3PL6C 2AABH 3SPVA 3O3UN 3U83A 3UC0L 5KSAC 2E6QA 1FORH 4KQ4L 4Q9CA 4PTTA 3VGAC 3ZZ1A 2APTA 3VFUA 5SWQA 2HJLB 4XBGB 3UCRA 4MA1B 3PJSA 1A6WL 1DEDA 2VLKA 1MWAA 2EDFA 3KPSB 4NRZA 5JQHC 4OV6F 3MRFB 4OF8A 4YPGB 2VWEE 5EU3A 1MJ8H 4YHNA 1QSFD 2AQ3A 3F7QA 3S97C 3WS3B 4GAFB 3KXFA 2VDRL 4M3KB 3QNZA 2G75B 2F58H 4KPHH 4KH2A 3K2UL 2Z31D 4O2EA 5TF1L 4HFUH 2IH1A 4N1CA 4NQCD 4PGBA 4ZUSB 5FK9A 5H35B 3GSVA 4K71C 3OB8A 1S9WA 3MLVL 2VR9A 5EULV 1OAQH 3IDYC 1I3RA 3SDAC 1UJTA 3VRJB 4QHKI 2Y6SD 4M3JA 5FUOH 4LNRB 1S3KH 3MNWB 4G8FB 1E28A 3EJZD 3FT3B 3B83A 3UJIH 1U8IA 4LF3B 2EDRA 4V2BA 3VXPB 3L3DB 1FNLA 5GRUH 4G3YL 5CINH 1AGBB 4X98B 1FGNH 3RWHA 3SOBH 1A7NL 4BFGA 3RNQB 1PJ9A 4ZXBC 4KGLA 1C08A 3GMMA 4G6JH 1ZV5A 5IROA 1BLNA 4YXHL 1J8HE 4KKNA 3T1FB 1IAOB 5DUML 2DL2A 3ULVH 1QSFB 1IGML 2NY3D 3L3HA 2DJUA 3RTQA 3QCUH 4G9FB 2Q87A 5K9JL 2MPAH 2AQ2A 5JW3H 1F3JA 2YK1L 4KV5E 3HLAB 1CIUA 1PEZA 4M1GH 3QUYC 3W0WB 1GPOH 4I0CC 2BOCB 4OD3L 2J5LB 5DTFB 4TN9A 4HKXA 1LD9A 4M8QB 4UQ2A 1WQVT 1YYMH 3VD7A 5CSZA 1PG7L 3CFIC 2FNBA 5ADPH 3VW3L 4QRRB 5HYJE 4HWZB 3ZKXB 3MJ9A 1NFDF 2IJ0C 4ZS6C 4LASH 4MNQB 5C0JB 1TJIL 2PO6B 5IJVA 4KRPB 3KPMA 1CU4H 1JUFA 4I3RH 1QSZA 4HIEB 1GIGL 3NTCH 3RUGE 3SDDA 4FQXA 3RL2B 2J5LC 4DFIA 2AAVA 4EOWH 3OXSB 4S11A 1TETL 3KNBA 3VH8A 4XI5C 1H0DA 4N9OB 4R9HA 4RGMB 1T2QH 5I16A 3FQNB 3PIQB 2P8PA 5D6DA 4ONGH 5KTEL 5MHSD 3MV9A 2XI9A 4L5FH 3T0ED 1TTUA 5EOCH 1KN2L 1UM6H 2C9AA 3QJHA 4P2OC 1YC8A 4NZUL 2VE6B 3FCTA 3RVTC 2OR7A 5F89A 5D7JB 1INEH 2GY5A 1JE6A 2VH5L 5IUSA 1A1OA 1MLCB 4MNHA 1TQBC 1L4IA 3MV9B 2LAGB 3LD8C 3BW9A 1CLZL 2I25N 1JNJA 3Q5YA 1KT2A 1DFBH 4LRNH 2ZCHH 3FONB 5TFSH 4KK6C 1DLFL 4E41E 1A1OB 4XAWH 3UJJL 2BY3A 1KSRA 4PY8J 3TJHD 1DFBL 5I1DB 2R29H 3B8SA 3AU1B 1MCLA 3W39B 1D9KA 4RZCB 3BN9C 5DQ9B 1U8LB 1JHKL 1FFPB 1J12A 4MNQD 3I6GB 1UCBL 3O9WA 3R4DA 1CU4L 5F7LB 5BRZA 4JY4A 1ZWIB 2ZUWA 4D8PA 4F37K 3WFEL 5I71C 3QFDA 1L7TL 5JIIA 3ARTA 5MEPB 4JFFE 3QQ4A 4PB0H 5KTEH 5D8JH 1BZQK 2GK0A 2Z4QA 2D3VA 4LGPB 2YXFA 4IMKC 1LEIB 3K1DA 5KANG 4TYUA 1IE5A 2GSIA 3ZTNH 1W0VB 3UP1A 2YXMA 3NACL 2GIYA 5DYOA 3IXAA 2YD2A 4JFOA 4WTZG 4JR9L 4NC2B 4O4YH 1YEGH 2VLJD 3RWDA 4LBEA 3VFNA 5F9OL 4P99A 1TZIA 3FRPA 4GH7B 1WSST 2OTPA 1VERA 1ZHNB 1A8JH 1OAUH 3C08L 1YYML 1U91B 4A6YA 2HFFB 2XXMB 2FD6L 3HG1D 1RUAH 1VADA 2IQAA 4MA8H 3GBML 3WFDH 1I1AB 5JIKA 2VAAA 5I9QB 4L3CA 1DBKL 3Q48A 5KANI 2BRRL 2ESVD 4D9LH 1QUNA 2WQ8A 4O51B 4XVSH 3T0XA 1IAKA 4YZFE 2WM0A 3QUZB 3V6ZA 4MAYB 2PKDA 3IKKA 3B9VA 4PJCF 5E99H 4CNIB 5BVJB 3VFWB 5E08H 1ZVHA 1AE6L 3P0VL 4OF3A 1G7QA 4HSQA 4GG8B 4GG6A 4L3EB 4LSQL 5HHNA 4S1RL 2EDEA 5HHME 1NUFA 3MA9H 3TCXA 3QIWD 3MUHL 4AY0A 2XKSA 4MXVF 5BVJA 1U6AL 4L1HA 3L3KA 2P8PB 1FGNL 3HUJF 4UT6H 3RHWK 3TO4D 5ID0B 1CFVH 3IDYB 3SDAB 1OSZB 2CGRH 1I7TB 4LCIL 2J6EA 2F74B 4GKOA 3IB4A 2AXGA 1CFQA 4DZBB 1P1ZA 5EN2B 1IGCL 4AYFA 1KJVB 5HHXH 4KZEH 3FO9B 5GGRB 5HHQA 4HUWB 4PBXA 1AD0B 3QG7H 3VE0A 5JA8B 2X4NB 3U0TA 2C4FU 4PRPA 4XNZC 4P2RA 5IQ9A 1QFHA 3V6OA 1U3ZA 3BQUD 3L7EB 2F54D 1W8OA 2RHEA 2DD8H 3C09B 2E8YA 2O26U 4UAOC 5LQBL 5KSBA 4U31A 1S7RA 5FOBB 2EH7L 1BREA 3VD3A 2Q3AA 4DEPC 3BDBA 5GGTL 3DURB 5E8NA 3EGSA 3RWJA 3VFRA 1CWVA 2HTKD 4H20H 4KU1A 1JN6A 1IT9H 3AXLB 4BZ2L 2WP3O 2CKBB 4R4FH 4NQEE 4RAVA 3QRGH 4PJIA 3V95A 2VQTA 5C0CA 5JLZA 1S7RB 2YSSB 5EFIA 3HRPA 1RUAL 2DQJH 1KPRA 4LCYB 3U4BH 3O6FA 2ZUYA 5DSCA 4NWTL 4ODSH 4S1DC 5C9KA 1L7IL 4HIXL 5CEXA 2BY2A 3O0RH 43CAB 3B9AA 1JPSL 4RAVB 2DQDL 2J12B 5HYQA 2X4OB 2W0FB 4P48A 1OGAD 4OKDA 2BVUA 1AO7A 3S88L 3AREC 3WD5L 5DYOB 3NACH 2FO4B 3V0WL 1UYWH 1LO3L 3QUKB 2CDEA 3ZE0F 1NBZB 2VL4A 4BKLA 2LTQC 1HHKA 4OCSL 4Z7OE 4G8FA 3TFKD 1ZEAH 2EYSA 4AMKL 3P4OB 4LCCA 1I4FB 1UB5A 3PWPA 4G6AD 4HH9B 1SBBA 1MCQA 3DYOA 4IHOB 4KUZH 4GG6F 5D9SA 5GRVL 3GBNH 2HRLA 1FO0H 3ECBB 3DSFH 3V52L 1QYGH 3MR9A 2O5XH 1A2YB 3E2HB 3H0TB 3IDMB 3O9WB 3QCVL 4OLZH 2C3VB 1XGUA 2EXYC 5CJXC 4NJ9H 3IDUA 1KN4L 2R0WL 1GHFL 3CZFA 3V6ZB 1ZGLM 4G7VH 1ZT1A 3WHE0 2E6PA 2YMXH 4U33A 3OJ2C 5E8EB 4P2OB 4NM8H 4N8VB 3RU8H 5A40E 5A2FA 5C0CD 2OTWB 3PHOB 3FB8B 4LNVA 4R2GB 2DBLL 4OFYD 5M95B 3F7YA 1RQ5A 1Q9LB 5CD5C 1KN4H 3NH7L 2APVA 4JO1H 1LQSR 2RCSH 3P73B 4DN3H 3BESR 2P42B 5DMYA 4YK4B 4OLEA 4MNQE 4EUPB 1QYGL 3DX6A 2YRPA 5IVZB 1EVUA 3DGGA 1ETZA 3G6DH 3WNMA 3C5ZD 4UQ2B 5J3HC 1Q38A 2VXVH 1JWUA 1G1CA 1NC4D 1T3FA 1TVDA 4LQFL 1AD9B 1ZHNA 3LAFA 1RZJC 1ODAA 3DV6B 3P4MB 4JPVH 2BDNL 1R3HA 1YEDB 4OZIF 2IPTL 5BV7H 3S35H 4KI5C 2RQ8A 4X0KA 4X6BB 4XWOC 4NQSA 2Q8AH 1LNUA 3V0WH 1ETZB 5DMGD 5DZNA 3MXVL 4GS7B 5IMOA 3L7EA 3O8XD 3DPBA 2GITB 2YPKA 3L3IA 1V5JA 5GHWH 1KEML 2O93L 1JMXA 3ZL4H 2FX8L 1HYSD 2OJEB 5EU5A 4PTUA 2WMPA 5GGSY 5CJOL 2WBJA 1ZS8A 1Y18B 5IVOA 4DTGH 4OSUH 1OP3H 5I1LA 3RIFK 1J8KA 7FABL 2J7LA 3T0EE 5L8JB 4JRYD 3W0WD 3DMMA 2NLJA 4ODUA 4P4RA 3KJ6H 1KBGL 1S9YA 3RDTA 3KYOA 3NCJH 3FB7B 3OZ9L 2ICWA 3LB6C 3VXTA 4H20L 1L0YA 2IF7A 4UZGA 4UI2A 2YRZA 3V0AC 3MRDA 4ZFZA 4OBSA 1IKFL 4TULL 1WBXB 2DQUH 2NLJB 4ODUB 4P4RB 2Y25A 5FHAL 4NQDE 4IOFC 3QCUL 4WTZA 3NIDF 3SDXE 2W60B 1OARL 4KJQC 4OZFH 1RI8A 4UTAH 3EOTH 5A43C 4QXWA 4RSVA 1H3GA 5HDLA 2DD8L 1VEMA 3C5ZB 3ULVD 1NDMA 1FG2B 1YY9D 3JWNC 1CLCA 5F6IC 1BJ1H 2ERJB 5ECJE 3SKNB 1MCBA 3MGTB 1LO5B 4QRQB 5DJ6B 2LU3A 3EBAA 3RY5A 3KS0J 4ELME 3GMLB 3B5TA 3BN3B 4JAMA 1OT2A 3RL1A 4NOFA 3CU1A 3MUJA 1Z0NA 4OCRL 1NGXB 3LH2L 1A4KA 2DIAA 4W6WB 3DX9B 5SWSD 4NN5C 5D2NA 3RJDA 3EYOB 4PY8I 5FCUL 1Q0XH 3MLRL 2R8SH 1WT5C 4X4XB 4HUXB 3N06B 5T33L 4ODVH 4HG4J 4X6EB 4NO0A 5BW7A 2GW5A 2CK0H 3DUHA 1WZ1H 3VJ6A 3KJ4B 5EFIB 5EU6E 3CZFB 5EU4B 1RY7B 2CK0L 3RKPA 1EZVY 4NFDA 3VXUA 3N1FC 4LSTH 2DJSA 4POYA 3THMH 4R26L 2R1YA 1A21A 1WIOA 3MLRH 1IJ9A 2DAVA 1F4HA 3QEQB 1SY6A 3GMPA 3D69A 4JRXD 5TF1H 2AKRB 5FIEA 3P0GB 4TULH 4FQJL 3CGTA 3BP5A 1EMTL 4LLYB 4PYHA 3VXMB 2ATKB 2VL5B 4OGZA 4AG4L 1A9EA 2EC8A 5I8OH 2P24A 1GYAA 4CVXA 4M7ZC 1NBZA 1DE4A 1QSFA 1KGCE 3U9PL 4S10A 5K9KA 1T22A 4XXDA 1UXSB 5D71L 1MY5A 1JWMA 3PWNA 4JHZA 2R2EB 3QIUA 2PXYC 2BNQB 1K8IA 2W59A 2Y06L 1UA6L 2BFVH 1BGXL 3VI3E 4L4VD 5B8CB 2DQUL 5D7LD 3VRLF 2J88L 3UC0H 2H41A 5E4EC 3HRZB 2UVFA 5B4MD 5L8LB 1OTTD 1IEBB 1U8OB 4DN4L 4TSBH 4YNYB 4YDIL 4Z8FH 4MNGB 1RUMH 3D85B 3ARDD 4GBXC 2EO9A 3ALWA 3LVEA 4XMKH 5D93C 4Q9BA 5DO2D 4RFOL 3G5VA 4OLUH 3NZ8A 1J88A 5FV2A 3BUYA 1AQKL 4AH2A 4OFPA 5CMAA 3HE7A 4WUUD 1OLZA 4PG2A 2QSCH 4M62L 5C9JA 4G8EA 4M1DH 3BGMA 2GUOB 1NGPL 1SM3L 3IFPA 3AMLA 3JZ7A 3PIQA 1QA9B 1CICA 3DRQA 2ZKHL 1QHPA 3SBWC 4JPVL 1AIFA 4ZAKB 1KCUH 2AXHA 2EYTB 2PTVA 3DX6B 1LEGA 3OQ3B 2V2XA 5F1NB 3FFCE 2G5RA 4JO1L 2WAHA 1SEQL 1FV1A 4DW2H 4K8RD 4FRWA 4U49A 3P9MA 4V1DE 1X44A 4Z78B 3NIGE 3EJZC 4IS6A 4DAGH 1QNZH 3EYQD 3UO1H 1MVUA 4LEOA 4MXQD 3VRJA 1BIHA 5B3JF 3OGCB 3MLSL 1KT2B 1KTKE 4DVRL 2DQEH 5DLML 1RK1A 1RPQA 2HVJB 3EFFA 1U41A 3NIGF 4KJPD 3PGFL 4PB9H 3G5XB 4MAYC 3B2VH 1T04B 2GSGA 3E6HA 5CILH 5HPMB 2ZOLA 1G9NC 5I0ZA 5EOCL 5I66B 2PETA 4KI5E 3RRQA 1FJ1B 3SE4A 5TQ2H 1KTDA 5C09B 1ZEAL 1ADQL 3WIFA 2GFBB 2HA1A 3DETD 1NQBA 5IQ7H 5J0BA 3SDDD 4HXAL 2BY0A 4JGMA 1I85C 3T04D 3T2NL 1FRGH 5F1IB 2XG4A 4EI5B 1V3MA 4KI5F 5GSVA 2O5XL 1IAOA 4PRIA 3MRPB 1FHGA 3FQTA 5C3LD 1S8DA 5IF0A 4GO6B 1U8PA 3SQOL 5KVGH 3UZVB 1NAMB 1LEIA 1LO3H 4BFIB 4TVSa 5CD3A 2PYFB 5ADPL 3VW3H 4EVNB 1NANH 4DJMA 1MFEL 4U2YA 4M93B 5L0QC 1R3KA 2OR8A 2ZOKA 2R2HB 2FB4L 3K4ZA 4LBEB 4M03A 3V7AE 3MNVB 2G60L 4P23A 3MBXH 3LS5H 3VI4E 1CK0L 2MMXA 2APWA 2C5DC 3CPLA 4FFVC 1HXMB 5AZ2L 3OKOA 5FHBL 3K46A 5DK0B 5JQ6H 3AAZA 4D9QE 1K8IB 4HPYH 2EIZA 3ILQD 4LSDA 4YBQD 3BEVA 3TO2A 2E7LA 2AJXL 1F3RB 2AEIT 2YC1A 3ABZA 1GCFA 3D0LB 4B7IA 2X42A 4HHAB 1PSKL 2PYEE 4NSKB 3CPLB 2YD8A 3MV8A 4QRSA 3VJ6B 2Y4SA 3O6FC 3V6FB 3RVTD 4ZTPH 1C08B 1EJOH 1CE1L 1MFAH 4WI3A 5EORH 1ZT4A 3VWKB 3UPAA 3CC5B 2EDWA 3QUZC 2E9IA 2OLDA 1HH9B 3QUMH 4JE4B 4KJWD 4DKAA 1CXFA 5T5FL 4OF0A 3U6RB 5FUCC 3UTSE 4K2UL 5KS9B 3MUZ1 3PXJA 1OQOA 2X5PA 3GI9H 5C0AB 5IBLC 2YUWA 4XPBL 1FZJA 3WLBA 1YEDA 5DD1H 4DGVL 2NXYC 3H7BB 3EYQC 1ZANL 1XF2B 3MBEC 1QFOA 4M8QA 2QTEA 4RMQA 4UDTB 5JXEC 4XNZB 2HLAA 2R23A 4LOUC 4XP1L 3K8MA 4NKOA 2V7HB 4K2UH 2DICA 4D0CB 4LHQB 4PPTA 4MVBC 4YX2L 3X13B 4Y7MA 3LRSA 4GKSB 4Y4KC 4AK1A 4Y19A 3U30C 1RJYA 1H0DB 4PJGE 4JY4B 3RUGA 2CSPA 3VGEA 2HT2C 1D5MB 4JFFB 3TBSB 3VXTB 3EOYG 1P7QA 4GRLB 4XVSL 5EORL 1QRNA 3G6JB 2VXQH 5IGXL 5TE4L 4YEEA 4XWOD 2KBGA 5D6DC 1PZ5A 2AXFB 3NPZB 3S6CA 5IP4A 5FO7A 4O4YL 3O4LE 3MCG1 2A6JA 4AENA 4EIGB 1OM3L 5C0AD 2CJUH 2VERN 3TJEH 5FEBA 4XNMA 1OOAA 5I30L 4F8TA 1FZKB 5KBNC 1G7PA 3GK8H 3FQWB 3QB7C 4MD4A 1NFDB 2DN7A 3QBTB 2X05A 1KOAA 4JKLA 5LGKA 3C5JB 2CKNA 4UDUB 4WI7A 2FJFB 4P2RD 2VDQL 3T2NH 3LPFA 4U6YB 5AAMA 1DUZA 2J8HA 3AU1A 5ICYB 3VDAA 1A9BB 1FNHA 4KMLB 2EDXA 4YHZH 3HN3A 4FXGB 3QA3A 1YEGL 2JCCB 3MACH 1FPTH 2WBJD 5TDNB 1MRDH 1OAKH 1EEZA 4NO0B 3MCLL 1BAFH 4OFYA 1WC7B 1J1PL 1LO0H 5F93C 1HHJB 2PXYB 1Z9LA 1P4LB 5D72H 1S9VA 4IIQC 1HOCB 3VGDA 1A3QA 3F58H 1WTGT 2AJYH 1HQRA 2LE9A 1IAIL 4G6KH 3RDTC 2X7LB 3SE4C 1EEZB 3V2AR 4ENEC 1JHTA 5F7HA 4LLDB 5I76B 2DYPB 2E7CA 1K6QL 5KSAA 5E8PA 4LLQB 4M5YL 2RJMA 2ZPKL 1A7RH 1Y0LB 4X8JB 3HNSH 3R8QA 2X09A 2R0KH 4F58H 1I9JL 2CLVB 3BO8A 3WXVH 5IEKA 3KLHD 3WIIL 1D6VL 3MTRA 4OCYH 3O4OC 2UYLA 1HWGB 1QTYT 3DRTA 3QUMA 3L1OL 3PWUA 4LKXB 1XGQB 1N3NB 1YN7B 2FIKB 4KTEL 3TP4A 5GS0D 2F54E 4UU9B 3MV7E 4O51A 1X7QB 5ITBH 3GBLA 3UTSA 3FMGL 4ZQKB 3TZVA 2L7UA 3PHQB 3BZ4B 1ORSA 3W0WA 2P7TA 3L95B 2XN9E 3PV7A 5F3HA 3LSOA 4XP4H 1WT5A 1J1PH 3G6AA 2VR5A 4XP6L 4JB9L 1IC7H 4RAHA 1UM6L 4ODWB 1JI2A 5MERB 5JHDB 3VXNA 5AD0A 2R39A 3IVKB 1FPTL 3U9UB 5HYFA 3UTZA 3ZE1F 4LIQL 1GGTA 1RUML 1S7QA 2Y06H 4I18C 5T1LD 4YHZL 2V9QA 4N0RA 3LZFL 4ZSOE 2C26A 3O6FB 2DDQH 5E1AB 1JK8B 2P5EE 2DYPD 1KULA 3S34H 3IDNA 2BNQD 3ZE0E 4I2XB 4L4VE 1P7HL 4FQHB 3VA6A 5TDPA 3ULVL 1UWGH 4NKMB 1BJMA 4UINL 4NO2B 1HI6A 2A6JB 4AENB 2QV2A 5J13C 2G75A 1AJ7H 3QNZB 3U9PH 1RULL 2I9TB 4LDLB 4Y5YB 1TVHA 2LVCA 1DQMH 4D3CL 4AG4H 4KKAD 2VXQL 3C5ZA 3KWWB 1MCKA 3KPLB 4HJ0D 2VLRB 3GGWA 4WUUB 4OLVH 2GK2A 4QF1B 1VENA 3PP3H 4JFHE 4UMGA 1GC1L 4ENED 2PR4L 5ERWB 5L6YL 2UUDH 4Y5YA 3PG2A 1MQKL 4QHKJ 2ADIA 4JN1H 2ADFL 3GMLA 5GRUL 4OZFG 3OR6A 3MV7A 4H25A 2GSIB 3GDBA 3GSUA 4P3CL 1SY6H 4JFHD 4LMQI 4ETYA 4D0BA 3DTXB 4LARH 4PP2A 5HVHB 3H3PL 5SWZB 5T33H 5J89A 1M4KA 4O02L 4R96A 3G9AB 3H3PH 3MRPA 4YH6A 4APQB 4ODXB 5T1MB 1NFIB 1WZ1L 1YJDH 5D7KD 4JANA 5EZIH 2JF1A 2VSCA 5EZJB 4D0BB 3GO1L 4GXUN 4HKZB 1ONQB 3D48R 2Z92B 3EYSL 2XNAA 5CJ5A 2WUBH 4OM0L 2X9YA 3AFLA 4L8DA 1UWEL 2F58L 3AY4C 2ZZUT 1BVLB 4DKFH 1DZBA 1T0MB 1GGUA 2YUXA 5F8RC 3MCKB 1JMZA 3MLVH 1IBGH 4JFQA 4LSSL 4U1GC 2IPKB 5I1AA 4Y5VB 1AY1L 2BC4A 3MUGA 4HPOH 1CFTB 2FATH 2FHBA 3H9HA 4KPHL 3VMNA 2A6IB 1FORL 1W72A 4OZFB 3CSYA 1HILA 5TDNA 5T3XL 5B39G 1X5XA 4GAYA 4XCCL 2VR4A 3GHBL 4YAQA 2IQ9L 1EGJA 5EBMA 3MUGB 4HJGA 3MRQB 4HDIB 3GMQB 4MB4A 1HOCA 1YQVH 4R90H 3HMWH 3HC3L 3NCJL 3LS5L 4XHQA 1JZ6A 1JYNA 1IAIM 3GSOA 1C5CH 4LIQH 4ALAH 1K5NA 1MWAL 2BNRE 5TPWH 4P46C 4JGUA 3BP7A 5L2KA 3OSKA 5JUEL 4EUPA 2NXZC 5TQ0L 4KTDL 4J1UB 3MRKA 4YBQC 4MCZA 2UY7A 4NKDB 4NN6C 5EZOL 2D9QB 5EU7E 4OV5B 5C6TH 4FFVD 4J7RA 5GS0H 1Z6JT 1AGEB 1G9NL 2H1PH 2YPLD 3J7HA 4UILH 4U3CA 4LPWA 4NM4L 5GS2D 2JB5H 2EYTA 3HZKB 4QRTA 3PWJA 4PIRF 4WWKB 2IFFH 5C07A 3X3FL 4AEHL 4XPTH 4ZUVA 3WE6B 5IQ7L 1JGUL 5FGCB 1OTSC 1EHXA 5GGQL 1DJSA 3ULSB 12E8L 2QEJA 1X9QA 5INCB 3HPLA 5CJXA 1I3UA 4WVRA 4U4BA 2R56H 1SJHB 2I5YL 1M05A 3V0VA 4M6OH 3ZO0A 4PGEA 1Q0YL 5E94B 3I6LE 4M5ZH 4PJBE 3EDEA 3TN0C 1ORQB 4BM7A 5EU6A 1WCBB 3PGFH 5CEXB 2ADIB 2NY5H 3U7YH 5A2LH 3O45A 4H25B 2GSGB 4XVJH 2FH6A 4WI5A 3K4DA 3JWOH 4OLXH 5FO7B 4X7TB 1E27B 4F7TB 3HI1B 2RAMA 3L5IA 3QIWB 3KXFB 3ULUH 5FO9B 5GS0L 1WBXA 5C6TL 4WW1B 2ZSVA 3VFSA 2IH1B 3QUXA 4Y5XA 2ZCLH 2H6PA 3OKDA 4RGNC 1CDIA 1QEWB 5T3ZL 3F8UB 1YMHB 4PJBA 3V5KA 3G9VA 4BQ6A 4YHMH 1AXTL 3KLAA 1VFBA 4L3AA 2ZG2A 1RK0B 2KH2B 2ICES 2NY3C 4MJ6B 5C3TA 2DIJA 1WFTA 4I9WE 4JFFD 5C0RL 2L7JA 3SDXA 3VA2C 1MHEB 1WEJH 5DJZB 1WZMA 2ZWLT 3O6KL 5KS9E 4KK5D 2XQYG 4HK3N 1PFCA 4RBPK 1DBBL 3AC0A 1MAML 1RZ8A 1TJGH 4OCMC 4L9LC 1RD6A 1U95B 3DARA 2YD6A 4G7YH 1HILB 1OQXA 1Q9OA 4XPHL 1U8OA 1MAKA 2DQJL 2HJKB 3LKRA 4IRZL 3T0EA 1OT1A 3X14B 3UDWA 4HPOL 3TA3C 3ZMRA 2ZSWB 1LWRA 3UDWC 2IPUK 5EC1A 5DFWH 5C0ND 3C8KA 3T4AA 3NZ8B 5I8CA 4GG6B 5H8DA 5F7DB 3UBXG 1N0XH 1HH6B 4CDHA 3BWAB 3QEGL 3RVUC 5IBTH 3DVNA 4GQPH 4POZC 5LQBH 3ROLB 3D18B 5DWUH 3X3GL 1K3ZA 4JFOB 3BIBX 4LSPH 2HRPH 3T1WA 2BOCA 1KB5A 1LE9B 1G9EA 3ZYIA 2DLTA 4Q2ZB 2OQJB 2AXGB 2IANB 2VZ3A 5IMOB 1OCWH 3MLPA 1T0MA 2W9EL 1JHLH 4X5XB 1MOEA 4KMTH 1IILE 1NSNL 2A73B 3CDFA 5EU5B 3V4VL 3MRNA 4Z7WB 2R1WB 1UB6A 1FNGB 4Y19D 2BMKA 1UWEH 2B4CH 3O2WL 1MH5B 4PJAA 4F37F 1IQDA 4U1GB 1KYOK 4NZRL 5I8EB 3NZHL 3KPRA 4Y5XC 1CR9L 1HEZA 4K23L 5JW4Q 5DD3H 4YHLL 5JXEA 3FO0H 4JO2L 3TN0D 3I9GH 3QG6B 4WUKL 1G7JB 3OAYK 3O9WD 5IR1A 3TBWB 4G9FD 4QHMB 3U2SB 2R1XB 5K59F 3VFTA 2OS7A 3MZGB 1DBKH 2ZJSH 1OP9A 1EJOL 1NGZA 4JCLA 4Z0XA 2MHAB 2ADJB 5CZXC 4W6YB 1H8NA 2OJZL 4MA8L 1EK3A 2X4SA 4JPKH 1OGTA 3ZKQD 5IHLB 4E0RA 4WIQA 5FGCE 5CWSA 1T0NB 3FFCA 1GGBH 1R0AL 1CBVL 2F19L 4R8WL 2CLRA 1LHZA 1Z5LA 4L4TD 1FFOB 4H5SA 1NGZB 4KJYA 4X83A 2FBJL 1PZ5B 2NY0C 3OJDA 5EBLA 5EUOE 2C3XA 1PG7W 5IB4B 4OUUB 2EE6A 3TA3A 4UT9H 3CSPA 4PGJA 3LB6D 1A6AB 3QDMA 2A83A 5C0BE 5HI5D 1S7UA 1HK6A 4P2QB 2VDNL 2Z0BA 5ADOH 4P23B 1YN6A 2EEDA 1HHKB 2VZUA 4KK5C 3U0PB 2NY6B 1NCDH 5C2BL 1X5FA 4O5LH 4ZUWB 1JZ7A 3MREB 1HXMA 1UJ3A 4HH9A 2C1OA 4PGCA 3WFEH 4KHTH 4NCC2 4PP2B 4KZDH 2AGJL 2JB6A 5FM4A 4GBXB 2GK0B 5F1OB 3TN0A 5I74C 4N5UA 5IVXB 2DDQL 4PJFF 4PJEA 1TVBB 4JZNB 1U8IB 3MLYH 1U8QA 1HHIB 2HJKA 1PKQB 3MXVH 4I0PD 3QNYA 4HV8A 4WI9A 4NCDA 4Y2DD 5HYSB 1KPRB 4LCYA 2VYRE 5J1AA 1MUJA 4LLYA 1EFXA 1UCBH 3GI8L 4YDLB 2NTFA 1UENA 5GS1A 3RVUD 4PRIB 2BNQE 5D96C 3RFZC 4F3FB 4WW1A 5I0DA 1FVDA 1OP3K 4EUPG 3ARFD 4U3XA 4OM1H 2P44B 1TDQA 4GQ9L 5E6ID 1A6TA 1I9JH 5FUZH 4GSDH 3I3EA 3B5HA 3B9KC 3T1FA 2IAMB 3HR5A 4RAUA 3W0WE 4ODHL 3VG0L 1T21B 4JO3L 1D5XB 2A77L 1FNFA 5DURB 2P47B 1FCCA 4ODHH 3VG0H 4QT5B 4JDTL 3E3QC 2FJGB 1E6OL 1IAIH 2L4OA 5DQDL 1G6RB 4L8SC 5DXWA 1P2CA 2EICA 2D03L 4NNPL 1X3DA 5F7UA 4NM8L 2NY5C 3T65A 2Y07L 5EBMB 2FECI 1J8HB 2ITCA 5E1HB 1X4ZA 4RMSA 3X11A 5ID1A 4RGNE 1UACH 3QCVH 3DI3B 4XHJC 4JFXA 4HEME 4ZQKA 3EYUL 2VJXA 4XCNA 1I7ZB 4OZHE 4CADB 1TETH 3L3KB 4ETQB 4ZPTB 4W81A 4JRXA 5I1LB 3FB8A 4HIEA 1Q1JL 2WQRA 3FT2B 5GRZA 4AMKH 2YEZB 5E9DB 2VDKL 4MCZB 4WW2F 1D3CA 2K3TA 4LVOC 2EE9A 1WK0A 2OI9C 3DIFA 4TSBL 1NCNA 1FLTX 4X4YA 1HCFX 1WVZA 5CGYC 1NCWH 4HIIA 1QBLH 2D7TL 3LKOA 2XZCL 2YEZA 5E9DA 3VXMD 1CIDA 8CGTA 1MI5A 4KKCD 5DZLA 4YWGL 1NGYA 1QKZH 3IS0X 3S4SA 3VU2A 5SWSA 5INCA 4Q0XH 2DF3A 2MQ0A 3MLTA 2VIRA 5F96L 3ARFA 5C08A 1H3PL 1RZKL 1U42A 2E7BA 2XZZA 3KYMB 1S7UB 5E95B 4G80B 1VGKA 5T1DL 5JMOC 2R0ZH 5H2BB 3WIHL 3GJEA 3TO4B 3AXLA 2BHYA 3SGEH 4FTVD 3D39D 1QR1B 4QHMA 1CLYL 2C1OB 2OJZH 1NLDL 4PGCB 2O61A 3PABA 2FX7L 1P7QB 4GRLA 3THML 1W0WA 2IGFL 5IFJB 2DM7A 4YXHH 1AGBA 5E5RB 2HVJA 3PQYA 4M00A 4J4PA 4PG9A 4LSVH 4LVHC 3W9EB 5KSAB 2JLLA 5I71B 2MCPL 1I8IA 1UH3A 5JZ7C 1F4YH 1I1YB 3RDTD 4L29B 4JHAL 5FYJH 5HXMA 4QRUA 3QIUD 3E6FB 4HFUL 3NCCB 4F3FA 1A6VL 4ODXA 4BZ1L 2RR3A 1QSVA 3UJIL 4Z7NF 4N8PA 4HUUA 4HUVB 4X80L 4K7FB 1CGTA 4Z7VE 5F6HI 3CK0H 5AYUL 1I1YA 5GRXG 4FQXD 2W9EH 4MJIA 3ARBB 2XY1A 2GHWB 3WNLA 4JFZH 4ZTPL 1FAKT 2FIKA 2P8LB 1I1AC 1ES0A 4LPYA 2VDRH 1Z0MA 3VD5A 1BVLA 4W6XB 1N6QH 2IC2A 2VQUA 4UTAL 4HUUB 1JNNH 1MJ8L 1KYOJ 5CD5D 3OX8A 1CXIA 3GI9L 1A4JA 2Q1EA 3LN9A 1CG9A 1OGAB 3SGKA 1A6WH 4JM2F 3D39B 3C8KB 2WINA 3WSQL 4FTVA 3MV7D 4NQUA 5DT1L 5KJRH 1CD9B 2ITDA 3P11L 3NFPA 4JFDA 2D7MA 5LAXA 2DYPA 1A7BA 2P5EB 3LHPL 3OX8B 5LGJA 1A1NB 4P4KD 4ZSOB 4RIRB 4Y16A 4ZYKA 5IG7A 3BGAA 3B8YA 4NZTL 4OZHB 4YHOH 5DRXB 1OAUL 3VI3F 1N26A 1KIQB 3MNZA 3A6BL 3QCTH 4M9PA 3TT3L 5JHDE 1JTOA 5DZOA 1EAJA 1CZ8L 1WLHA 4LK4A 5E5MB 4OAWA 5JW5A 3VG9B 5E2WH 4J4PD 1INQA 5KG9B 4NJAH 4EJ1C 1W2KT 2IAMA 4RAUB 4HIIB 3A6CH 5EBWA 1P9MC 2C3GA 2HWZH 5CJQL 3O3DB 2N7BA 1FZMB 1LP9A 4YE4L 3BJLA 5FYLE 1HSAA 3HE6A 4U6XA 1AD0A 4IDJL 2X4UA 2YUZA 3OXRB 1XF3A 3WDIA 2OJEA 4FNLL 1HE7A 1AR1D 3GGWB 1T6WA 3KPMB 4M02A 4QOKE 4OGXH 3B2VL 4NYLA 4EN3D 3MLXH 1M6OB 5L2JB 5DLMH 2ADJA 2VAJA 1WGOA 4P5KB 2DMKA 4LCUB 4MD0B 2H9GA 1QR1A 1C1EH 1PW3A 2KPNA 2CMRH 1PX4A 1YPZF 3EGSB 3RWJB 2ICEB 4Z76A 1WCBA 4XAWL 3UJJH 3FQRA 4PRPE 1BD2A 4XGZB 4UOW1 1BVKA 1FFOA 4H5SB 2Z9TA 1T4KA 4G42B 4LRNL 1JF1A 2H45A 5ICZA 1IL1A 2OZ4A 2ARJQ 3G08B 2R2BA 1AHWB 4MXWL 1FAIL 1CICB 1BQSA 2H3NB 4NDMB 4AEIL 1LK3H 5MENE 3SN6N 2A0LD 1GAFL 4NC0B 5A3ID 5IW1A 5FCSH 3B9EA 1BVZA 1U93A 2AEQH 4AL8L 4AIOA 3FQRB 3T0AA 3GZKA 2Z35A 2FX9H 1MWAB 1XF4B 4ZOAA 5C92A 2VXTH 3R06B 3D0VB 5CEZD 4BELD 4TNWK 2AJ3A 5TE7L 3MNWA 2QSCL 3LQZA 4FZEH 2LTQB 5ICZB 3P9MB 5HYQB 1NAKL 3FQUA 4BQ8A 5T1KA 1A6UL 4UILL 3TBVA 4QRPD 2ARJA 1KIUA 3ZKXC 2VLRA 3HC4H 4OCSH 1L0XA 4LVEA 2RFXB 2HAZA 3TH4T 4JO4L 1MPAL 25C8L 1G7PB 2EDTA 2ZNWA 5D1ZC 5FYLD 4G5ZL 4J6RL 4B41A 4LAJH 4W4NA 3FT4B 4R0LA 5EA0H 1F02I 2UZYB 1ZLSL 1AFVL 1EFQA 4C56B 2ZKHH 4MS8C 3G5XA 5BCAA 2ARJB 5HHMB 3PWPB 5E00B 1IGTA 3PF2A 4ALAL 4ODTH 5ICYA 4XBPB 2E8ZA 4PBWD 5J8OA 2A9ML 3QXUA 4LNRA 1S9KC 2AEPL 3IDJB 2C1PB 4R4NC 1G7QB 1DBAL 3AREA 5DA4A 3QULB 4OLUL 4XMPL 2RBLA 2XACC 4JRYE 4NPYA 4CN1A 4G6MH 5C0FB 3OGOE 4LHUB 3VI4F 2FYYA 4XMLH 1XIWD 4QOKA 3MFFB 4PRBA 1P4LA 1QOKA 4P9HH 3LIZH 4IJ3B 5DVNA 4MCYB 5GZOC 1BGXH 4BFIA 1Q9LA 4JEGB 3MMEB 3LPWA 3SY0A 4XNXH 4OZGA 4LHUG 5IB5B 4HUMB 1LO4H 1T5XA 1MCNA 1WWBX 2J8UF 2EKSB 2KQMA 1CFTA 4FZ8H 4KXZI 5CEZE 3L3HB 5DO2C 1DANU 4YXKL 1ZKAA 4GJTB 1F8TL 1N4XL 2PF6A 4ODVL 3KYKH 3DV6A 1YNLL 4WW2C 2X2YA 3DRTB 3QUMB 5C6PB 2PCPA 3RVWC 4I77L 1OVZA 3VG9C 4WFEE 2BVTA 1FGVL 3HAEB 5HHMD 4OTXL 4ZFGH 4R26H 5KN5B 2ESVE 15C8H 5CEZH 3UTSB 2QJDA 2VZSA 1FBIH 2HFGL 1LDSA 1SY6L 4KHTL 2HMIC 4XP9L 3KPNA 3G6AB 3IDGA 4WU5B 3K80A 2W9DL 1MHHB 3BFOA 3BKCH 2ICEA 3OAZH 1JTPA 2ZCKH 1PX3A 3E0GA 3DMMB 2PYEB 2PR4H 3ALXA 3NPSC 1WAAF 4C56E 3UBXB 3WNOA 5DUBB 4FP8L 2DBJA 3VRIB 3RQ3A 4X9IA 1A3RH 1IKNC 4Z5RA 1T0NA 3FFCB 4GUPA 3WS3A 3MODL 4PRHA 3KLAB 4NNYA 3MV9E 5HVGB 3QO0A 1NMAL 5IFAL 1X6NA 1I7UB 1QLRB 4JFPB 1ITCA 4GRWB 2ORBH 1R0AH 1CBVH 5KOVC 1CDYA 5E4EB 3BT2L 1U3JA 3Q3GB 1OAYH 3BP4B 4GKNA 2E9WA 1I9RH 1M7IB 3BYTA 3WFCL 4DK6A 2FJHA 1G84A 3ARBC 1U3YA 4QRQA 1NMBL 2ZJSL 1K4DA 1IQWL 4BZYA 3FT3A 4ZAKD 5IVNA 3ZT7A 2E6JA 2BVOB 4FP8H 4HF5H 1EO8L 5HYJA 5IEHB 2EDBA 3L7FB 3LV3B 1A6ZA 1G9MC 4XB8A 3VFOA 3B5GA 3OKMB 2HFEA 5E2UL 4GBXA 3ZDZF 3TYGL 1X5GA 1SHMA 1BEYH 4L29A 1MCPH 5F7FA 2PW2A 2WWKT 1YECL 4XP6H 3IDXH 2P8MB 2JKXA 2VXVL 3L5JA 8FABA 1SYVB 3DX7A 5J4MA 1IEAB 4IMKA 4OCLC 5EU4A 3QFDB 2H3NA 4RWYH 3EKCA 1V3LA 4WI8A 3Q6FA 3HZVA 3QDJE 4Y5VA 1G9ML 1ZT7A 1NEZG 4LLMB 4KTEH 1MCFA 4HJ0C 1A7OL 3VXSB 5C0GB 3FFCD 3NH7H 2P8MA 3QYCA 2A74B 1F5WA 1TNNA 2IBBA 2FSEB 1WCQA 2DBLH 1G1YA 3C9NB 4PREB 5C09D 1MCEA 3AAZB 1F2QA 2YMXL 4JHWL 4DWHA 1JV5A 3RWFA 2OP4H 1BQLL 4R0LB 1KELH 1YEFL 2DIBA 4X6DA 4BQCA 3HPJB 1GH7A 4QHUB 5FYKL 2ZPKH 4RNRB 4UOJA 1CXLA 32C2B 2P7TB 3L95A 1MCWM 1VADB 4R2GC 3INUH 4K3DH 4HMEA 4X7FC 1AGFA 2ITCB 4UIKL 1Y18A 2BNRB 5D1XB 4KUZL 5FDWB 3MOBL 4OZHA 4YK4C 7CGTA 5IB2A 2DJ4A 2O5YL 3BHBA 4M43L 2VLRE 2HYMA 1TCMA 5SWZD 3T2OA 4Z0XB 5I1CL 1DN0A 1JGDB 3CXDL 4FABL 1L9MA 4BUHA 5JHLL 3WV0A 3ARGC 4RX4D 1BLNB 5EWIL 3UTTD 3FOMA 3QXAB 1F42A 1JNLL 4F2MB 3I3BA 3GSWA 2EDYA 2NW2B 1TZGH 5I1GH 1BFVH 3H9YA 5KAQF 4FFZH 5I1KH 1KFAL 3GB7A 4EZMA 3O3EB 3QISA 4P4KC 3SJVB 2Z91B 2GQHA 2VLKD 4TUOA 3VDCA 3DXAA 4OCXH 5EWIH 5BJTA 1IZJA 3U4BL 2EH8L 5D7KE 3GK8L 5J12C 5ESQA 3KYNB 1F4WL 3SKNA 4UT7L 2Y5EA 1JPFA 4G8GA 1L6XA 2YA1A 4YIQB 4GRWF 5FM5M 2FZ3B 3ZKSD 4HWZA 3KWWA 1ORSB 4Y4FC 4DOHB 4QTHA 3HI5H 4V2CB 5FDYA 1NGXA 3KLDA 4PV8B 3QQNA 3H9SB 1D7FA 1ZA6A 4XP5H 2C4FT 5CZKA 1A64A 5IGXH 5E03A 2XN9B 3HPLB 4NWUL 2AV1A 3P4NA 4FOMA 4JDVA 3QQ3A 5CBAB 3RBSA 3EO0B 3RVVC 4JDZA 2ZUSA 4E5XB 2WK2A 3FB6B 3F5WB 3MLUH 3LPGA 1BFTA 5IMMA 3JWDC 2X1PA 5D1QD 2R2BB 4PV8A 2AJVL 3ARPA 4XH2B 1C12A 2DQIH 5J6HA 2R56L 5E8NB 2HFEB 4ZDHA 5EU6B 5CEYA 1T1WA 1Z5LB 5GS1B 1MFCL 3QG7L 1YC7A 1A7QH 3M45A 5DD0H 4PJIE 3U46A 4XC3L 4BA8A 2Y36L 3UTTA 5IW6A 5CJQH 4MJ5B 3GSVB 3VH8G 3BVNA 1HHHB 1KCVH 3CFCL 4P46A 4JKMA 5IOPB 1JYXA 5ESAA 4KV5F 3N50A 4UB0H 3HUJA 1KJ2H 3KLHC 3TT3H 3SCMC 5I18H 2HG5A 1F58L 1YEHL 4PS4H 4RGOL 4KTDH 2A74A 2X4QA 3WFHB 1BF2A 1MRFH 1V7MH 4NZTH 1TCRA 1BEYL 5CGTA 1IAII 3KPLA 1MI5D 5DVMA 4GLRI 1OTSD 1WC7A 3I75A 2UWEF 1JZ8A 3DXAE 4JFEE 1TLKA 3ARBA 3FL7A 4JFDD 5TF0A 3VXPA 1E4WL 3D25A 2J8UE 4BKLB 2BSED 3RWFB 2EZ0C 2NX5E 3DI2B 4PJCA 3HC3H 4WTWA 3SDXB 4Z7UE 3EYVB 4PJEB 2I24N 4UUJB 1TJHH 1RJZA 2NY2C 1CQKA 5B39A 2EIZB 2VISA 3GHBH 3HAEH 4OZIE 1CG9B 2ERJC 1XFPA 2OR9H 1A5FL 3QUXD 4F80A 4M6NH 2K9UA 3VWKC 1B2WH 4CW1A 4Z7VA 4KQ4H 4U1SA 5EIQA 4X6FA 3KXFD 2F53E 4WHDA 2BY1A 1BBJA 3S8WA 1GZQB 4NT6B 4JM2A 2R4RH 3DIFB 4JLRA 5AYUH 3WSQH 3GSNA 1XCQB 5DJDA 2R1WA 2QKIA 3HKFA 1WITA 4M7JH 5C0NC 1E4XI 1G7MA 3F7PC 3WN5B 5BVPH 3DVNB 3QZWA 3NA9H 1V7ML 4IDLA 5CBEB 4PJXB 1F58H 4KAQL 1NPUA 4ERSH 2I9LB 4BSWA 3QO1A 1YJDL 4XHJD 4J3WA 1Q9KB 2JJTC 4YFDB 2R0LH 3VGGA 2QQLL 4WDIA 4FXKA 5ID1B 3T3PF 2XOTA 2X4RA 3D3VB 3DYPA 1EERB 1FRGL 4KKCC 4YNYA 1NKOA 2JJUA 4HLZH 2A73A 2JIXA 3M17A 4LRIA 4K7PH 2R69L 4QTHB 3V6BR 4K3EH 3E6HB 3T3ME 4PY7B 1F4YL 4WDIB 1YEKH 5CCKL 1N4XH 5T1DH 1KC5H 3CCHB 2BK8A 1K3IA 3U30B 3O6ML 1VESA 2WIMA 1P4IL 3VRIA 4K8RH 3MRLB 4QEGA 5JW4M 5ITFA 3BP7B 5IHZA 1MLCA 4XNYH 3T3MF 5LKNA 4NO2A 2GT9A 3GMNB 1BPVA 3O8XC 2W9LA 1XF5B 2BHUA 3RVWD 4EI6A 3HI5L 2X1QA 5MEQA 2V17L 3RIAK 3N9GH 5HY9A 3FO9A 5GGRA 1I7UA 4KTYA 2DQHH 4HT1L 5C1MB 3I2CL 2H6PB 5EPMB 3E8UH 5C0AE 1UZ8A 5IHBA 1WUNT 2UVEA 2XKNB 5CWSB 2NY4B 5EO1B 5D1QC 1RURL 4P9HL 3FRPG 4L9LB 4QTIH 3BE1L 1KENL 3R0NA 1FFPA 4KJWC 5FYLH 3JTSA 5FF6A 1T1ZA 5IMKA 3FQUB 2YR3A 4YFEA 4OUUA 4I4WB 3QWRD 5HGHA 1E4XL 1T80A 4GW4B 3WJJA 4RDQG 3N1GC 4M1DL 3PABB 5MEPA 4M6AA 3QQ9D 5F7EL 1LO5A 2FEEL 4WO4C 5D7SL 2H26B 3LS4L 1KN2H 4P23C 1FFNA 4L5FL 1P6AB 2WINB 1TFHA 5D7SH 2CXKA 2OXGA 1N7ML 4XCYA 5ALCL 4BFBD 1NFIA 3V6OC 4XWGH 1VFAA 3QDHA 2B0SH 1E4XH 3BE1H 5CIPH 3JUYA 4YHPB 2JB6B 4P2OA 4HAFA 5DQDH 5FO9A 3OAYH 3SCMB 5K59E 5AZEH 5IF0B 3U7WL 1J5OH 5J6GA 3N9GL 1C5DA 5LXGL 1HHHA 3C9NA 5GSRA 3ARGB 1J0IA 2Y9RT 2CIIB 3MRBB 4Y4KA 5E8OB 3T0BA 3PXHA 2NY4D 3MO1A 4LLAA 3X11B 3NAAH 4DUWA 2EYSB 4H0IA 1ZLVK 3E8UL 4APQD 5DK0A 4KDTA 2CMRL 4MB5A 4F7CA 5L2KE 1DE4B 3D25B 3IDIB 1RZGB 3HNTL 2VZVA 3UTPD 5FUZL 3SE9L 4PJ8C 1Q9OB 4R6UA 1P5VA 1S7WA 3IFOA 3F58L 3GSRA 3VWJC 1VGEL 1G6RA 1FL5A 1DBJH 1YEIH 1LO0L 2AK4A 1Q72L 3ARED 4P9MH 5HGBB 5J56B 1J8HA 3LCYA 1TQCC 1FNEB 1J11A 3CFEB 5EC1B 3CJJA 1N0LA 4YDVB 3U6RA 2VDOL 1Q9WA 3EO1A 4W4OC 5KSBE 3ZDXF 3BH9B 4L3EE 2XRAH 3OHXB 1OW0C 4V1DB 3B3IB 1MIML 3WJJC 4PJFA 2HWZL 2NYYD 5D70H 1IL1B 1HKLL 3NGBC 3NA9L 2H8PA 4KHXL 4U1NA 5DRNB 4G9DA 4LEOB 5E4IA 4NUGH 5D1ZA 1MCOL 3LN4B 3HE7B 4JQIL 1H8SA 1WICA 5E6IC 1OAYL 5I6XC 3OJDB 3NIFE 2J4WL 5DURD 3V5HA 4MWFB 1CF8L 4RMVA 2I60H 1ED3B 3LQAH 4ZUTA 2JJSC 1ZA6B 3NGBB 1AO7D 1IMHC 4PJ7F 2XFXA 3O41A 1BBDH 3HC0A 3QH3A 3DJ9A 3RUGB 2AW2A 4MA3A 4X7EC 4F7PA 4JG0L 3QIWA 4XX1E 3GSNL 4D0DB 4E41D 4K23H 1CR9H 4FQ1L 2FGWH 3ULUE 4XCYB 4XP9H 4QRRE 5HYJB 4U6VH 4N0CC 5I1EH 4X6DE 3G08A 4BH7B 5EOTB 4PJBB 5B3JE 5HHPA 2YPLE 4H88L 4Y88A 5MP6L 3L5XH 1XF1A 5GPRA 4KKAC 1KTDB 3EOAA 3TNMB 1QBMH 4RISH 5IEKB 2XKUA 1FVDB 3H9SD 4ZUUA 2F5BH 1MHEA 4AJ0A 4CMMA 5DJCA 1TCRB 2AJUH 3L5WB 1A6TB 3KHOA 1MRFL 3VXRD 3LKNB 4WY7H 4YXKH 4PS4L 5I8KH 4Y1AA 3MXWL 3QEGH 4PBVC 4N0UA 2OL3B 2JCCA 5T5FH 3SDDC 1HCVA 4LSRL 4JRWA 3UTQB 3WUWG 3TZVB 2QHLA 4NNXA 3JV4A 3WYRA 4PJ8D 3MLUL 3OKYA 4XZUB 4ZSOA 1FL6A 2WUCL 4BSJA 3X3GH 2XPGB 2F5AH 1KCRH 4EDWH 4U1SB 5E70A 5BRZE 1SBSL 4FQCH 1OLLA 3KNBB 4PV9A 1G7LB 4C58B 1XH3B 5B38G 4PRDA 1T7XA 2V6HA 1OSPH 5IM7B 1CK0H 3MJ8A 3SDCA 4I48A 1G6RH 4MNGE 1DN2A 4AT6A 3DYMA 1RZJL 1QKZL 2X1XR 1KFAH 4RCAA 1FZMA 1LP9B 5D2NC 3RGVA 1BFVL 4N68A 5LGJB 1B6DA 3Q5OA 3B9KB 1QACA 4FQXC 2GTZA 2Z31B 1JNLH 4I2XE 4WFGE 5SX4I 5BV7B 4X0KB 4FFZL 3BW9B 3CFDA 4MJ2A 3DGCR 3LEVL 4KUCD 1SMOA 3PP4L 3DVGB 4Q6IC 3QEUB 1KJVA 2L0DA 4RDQF 4M43H 3VXUD 3GUTA 4DVBB 3AB0C 1HSBB 1II4E 4J4PC 3T65B 1ZA3B 2H9GB 3TBWA 4HS6A 4NQDD 1RZJH 5F7MC 3ZDZE 1KCRL 4LCWE 1NAMH 5ESVA 3WEXB 2X41A 1S5HB 1UACL 4M6MH 4LVHB 3GUTB 2MTPA 4NC1C 3VH8B 3ULUC 1MJUH 2BP3A 4FMKA 3MRGA 1MCCA 5C7XH 2JTDA 2Y07H 5D2LF 4EDWL 4R4FL 4X7CC 5SWZA 3JVGC 1S5HA 4OLXL 4HUKB 5I6XB 2OP4L 3F65A 2CIKB 4JDZB 4AEHH 2OX5A 4GMTL 4L8SB 1SYVA 2FHFA 1UG9A 3D3VD 3RY6C 2FEEI 1QG3A 1U3HA 3PP3K 1AXIB 4UQ3B 4L4JA 3EOAB 3P30H 2M2DA 3VFPB 1AR1C 4NP4H 4AIZB 1CFBA 1NGYB 4OFVA 5CJBA 3S4SB 3DOSA 4O2CA 4LSUL 4OD1H 1MJ7H 1JCKA 4MD5B 4P5TA 1V7NL 2V5TA 1R3KB 3X3FH 1C5CL 5I1EL 5I8KL 4Y4FA 2C1PA 1G9MH 4C4KT 4A2MA 5DJ8A 3HMWL 1KJMA 1U92B 2Z93B 4NQDB 3FTGB 4OT1H 5MP6H 4EUPH 2EO1A 5E2UH 2WBJC 3UTQA 5E9DE 2Z8VC 4XC1H 5CLTA 5GXBB 4P3DB 4KZDL 2IQ9H 1YNTA 3MA9L 4CNIA 1JF6A 4U6HA 4Z8FL 3MRQA 4HDIA 2DQGH 1JGLH 5C0EA 3BO8B 4H88H 3GSNH 3D39A 4WV1C 3SO3B 4U0RB 1BQHB 5J6GB 3V4PH 3CVIL 2GEEA 3T0EB 1NL0L 2Y5TA 4LCWA 1GGYA 5F9WB 3U82B 1KTLB 2APXA 2X70A 3O8XB 4FQQB 5FA4A 4YEFA 5AG8A 3FQTB 4S1SH 2EXYD 5C0GA 3EFDH 4NUGL 2FYYB 5IV2B 3GRWH 3MRRA 1R3LA 2GTZB 3W2DH 4M7KL 3QR2A 3HAEG 4HWBA 3V9FA 1DSFL 1Q94B 2FATL 1MRCH 5IFAH 4HQQH 4QRPB 4ONFL 3CSYB 4MA1C 4LSSH 1T20A 1IBGL 5IV2A 3QHZL 5KVEL 4OIBA 5KS9F 3CLEL 1KPUA 4U3HA 4X9FA 5GISL 4BH8B 1OWRM 3HG1E 4GAYB 3OKOB 3SO5A 1AP2A 2HT3D 2DQGL 2LABA 2VLKE 3ZTNL 5ILTL 5BO1L 3PQYD 1U2CA 2XPGA 2R4SL 4C83A 4TQEH 1PKQE 3MV8E 2Y1VA 1U8NA 1UWXK 5C0JA 5ELIA 4U1JB 1YPZA 3BDYL 1DQML 3K2MC 4LARL 1AC6A 5JW4R 4P2YA 4EXPX 4XNXL 1FGVH 5L2KD 3MRCB 4HLZG 2JCCE 1LK2A 5JW5B 4HKBA 1OAZL 5ENWB 1ZAGA 5T5NF 4P46B 3QI9C 1FG9C 1OARH 5GGTA 4OQ1A 4H0HB 2V5RA 5F7WC 2KZ1B 4WFFE 3DMMC 1JPTL 3ZE1E 4Y8DC 4H1LA 4HIJB 5EUOB 1AXSB 3SDYH 3TH3T 5JXAL 2V2WB 4ZFOB 5DRWB 5KSBB 4TNVK 5INDB 1UH4A 4L9LA 4LGRB 4N9GA 1MCWW 2EC9U 1JYVA 4R7NA 3DTXA 4V1DD 3V8CA 4NZUH 2NX5D 1ZGLA 1CGVA 3ARDA 3C5SB 2C7UA 2Q7NA 4EBQH 4XPHH 3LS4H 3QJFA 2D0GA 3QAZB 1JTTA 3HE7D 3U7WH 5IB3B 1J5OL 1S5IH 4XBPA 4XWGL 4MZ2A 4ODTL 3V8OA 4I13B 3KAAA 4OZ4A 2CO7B 2H32H 4FQPA 4CU7A 3C5SA 5ACMA 5GSVB 1DBAH 4PJGB 4N8CL 4WRLA 4DZ8A 4IM8A 2GCYA 5I1HH 4L8DB 3NN8B 1YEEL 3UYRH 2NY1C 4NBYB 2VXTL 2WBWB 4MMZC 1ACZA 3L1OH 1T89C 3A67L 2XTJB 4G8IA 4YLQT 1GAFH 1ZLSH 4Z7WE 3C2SA 3D0VA 3ZDYF 2HKHH 2FX9L 3R1GL 1H15A 4Q9QH 4Z0BL 2VLLB 4YO0A 2IANE 1UB5B 4JPWH 5DA0B 4HC1L 5K9JH 3QUZA 4JDTH 2R15A 3Q6FB 1GC1C 4K8RL 1KENH 1FYTE 2YKLL 3EO9H 2HN7B 4DQOL 1AGFB 4Y4FB 5FM8A 3T4YA 1BQUA 3S35X 3U7YL 1B6UA 5BZDA 2XZAL 1BOYA 4HT1H 3ZLQC