1S7QB

Crystal structures of the murine class i major histocompatibility complex h-2kb in complex with lcmv-derived gp33 index peptide and three of its escape variants
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
99
structure length
99
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Determination of structural principles underlying three different modes of lymphocytic choriomeningitis virus escape from CTL recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 12
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s7qB00
2UWEE 5L6YL 3FO2A 2EDLA 1DR9A 1D5MA 1W8NA 3B8SA 4Y5XA 2P5WB 5EFIA 3FQTB 5DD6B 1EEZB 3RUGE 1A6ZA 5T3XH 43CAA 2NY0C 3BH9B 2F19L 4PREA 1T4KA 5JLZB 3UJIH 4IOSD 5EOQL 3SO5A 1YY8B 3OQ3B 5T33H 4WFFE 3KLSA 3MFGB 4GKZB 3I75A 4EDWL 5E0QA 2XN9B 4DOHB 3QIUB 1IRAY 4R4ND 5FO9B 4P49A 3QAZB 3FQUB 5BO1L 1UM6L 3TJEL 1KIQB 5D7SL 5ICXB 3QT2A 4HFWB 4D0BA 3B9KA 4YIQB 2VZUA 4XPAL 1SMAA 4ZOBA 4GW4B 3VFPA 2DDQH 3LHPL 4DN4L 5HI3D 1JGDB 4PJGA 4RFEA 2PYEB 5E8OA 5I8OL 3GMNB 1I3UA 1YYMH 4JG0L 3F7VA 4XAKD 1FNGB 2LV4A 4P23B 2WBKA 3DURB 4K7PX 1G7LA 5MENB 4FZEH 1RQ5A 4LLDB 2HA1A 3IDMA 3KYKH 4F37K 2BRRL 1KPUB 4ODWB 4MX7B 3R1GH 3C2AL 5DMKB 4PV8B 1S78C 3HS0B 3OL2A 5IESL 2ZOKA 4PJ8D 5GRJL 2X5PA 4N5EC 1AY1L 2GW5A 4R9HA 1MCLA 3AMKA 2Y36L 1XR8A 3TH2T 5ADPH 1ES0A 4LSRL 2AJUH 3GSNH 3L3OA 4OCSL 5K9OB 2DQUL 1FSKB 1YMHB 5JO5A 2Q7YB 5H37G 3MRKB 3QO1A 3MLVL 4IDLA 5F89A 3VXQA 1U95B 5T5FL 4GG6E 3C87A 3VDCA 1B3JA 1T04B 3TVMA 1BFVL 1J1XL 4RMSA 4Z7WF 3HZMB 4LPUA 1I9EA 3KPRB 4EOWH 1U8NB 3OPZH 1JYXA 3U7WL 3CX5J 2V17L 2P5WA 4HX1B 3FQTA 3EOYG 1EEZA 5DD6A 3RPKA 3ZKQD 3QXTA 1B4JL 3QEQB 2X4UB 5F7LB 4QGYA 1TTGA 3BH9A 4O00A 1QEWB 5I18L 3E0GA 3VXRE 1YY8A 2AK1H 2GEEA 2AJZB 1B0GB 2EYRB 7FABH 5T5NF 5HVHC 5DLMH 1VFMA 1DQML 4IEFB 1DLFL 2XN9D 3D5OF 5M7QA 2XN9A 5KJRH 1KELH 3T2OA 3QIUA 4Y7MA 5FO9A 1Y6KR 2EDTA 4NUJB 4WFEE 1HILB 2AK4D 1KIQA 3FKUS 5ICXA 4YHOH 4HFWA 4HGKC 4YIQA 3RIAK 3L5HA 3PWPE 4OGYH 1CL7L 2G5RA 4GW4A 1JGDA 3GSNA 2PYED 2YN3A 5BXFB 1P4LB 3GMNA 1UVQB 4PP1D 1S7SB 1T83A 1FNGA 4Z7NF 4P23D 3ARGD 3LEYL 5BVPH 2SEBB 5MENA 2O5YH 1MFEL 3VD9A 4LLDA 4I3SL 3NPZB 4LCCB 4DN3H 2QSQA 3V4UL 1HIMH 1KPUA 5BQ7B 1RZ7H 5DMKA 1UH4A 3QFDA 1NFKA 2CK0H 2EDHA 4YEFA 1KJ2L 3MRFB 5EC1B 3JZ7A 1KLGB 4PV8A 3HS0A 4YZFF 4M1CD 5LVEA 1O0VA 4DZBB 4F58L 1G6RB 2J88H 1YECL 3ZDYE 2Y5EA 2W0FB 4GAGH 3KR3H 1WAAF 4TTDC 1BIHA 1U3YA 4JKLA 1MSPA 5K9OA 4NZRL 1YMHA 4ZOAA 2Q7YA 3MRKA 3CU7A 3R8BB 3GGWB 5SX5H 3V8CA 3ZO0A 1U95A 2MKLC 1RJLB 1NCTA 3HE6D 5FYJD 1QSFB 1QUNA 1T04A 5F6HJ 5FCUL 2ZUSA 2XPGA 4W6YB 2VXSL 3HZMA 4KDTA 4OLZH 1FL6B 3KPRA 1U8NA 3ARBC 2A9MH 4HX1A 1JZ5A 3QEQA 2X4UA 2AJXL 3MRNB 5IP4A 3UZVB 2GKIA 1Q94A 4HGWB 3S96B 4A6YB 1QEWA 5F7MC 3OV6A 4PRID 4LFHD 1G6RH 2AJZA 1B0GA 2EYRA 5KSVB 4L8CB 2APXA 1WSST 5DD3H 2X44D 2C4XA 3SBWC 2Y72A 2VRAA 4PJ7B 4NUJA 1WAAA 1ACYH 4QF1B 1HILA 4DGIH 1XFPA 5BVJB 4X4XB 5IW6B 3V2AR 4KMTL 5T1KA 2IG2L 1WUNT 1HHJA 3WS3B 4L3AA 5BXFA 2OK0L 2F8XC 1P4LA 3LQZB 4NBZB 4YAQB 1JYVA 4CJ0A 1UVQA 3RDTB 1S7SA 5CWSB 5SWZB 3NZ8B 1UKSA 4ODHH 5I74C 2SEBA 2BVTA 3EYOB 4LCCA 5K9QG 4NN6C 4A6YH 3CJJA 3UPAA 5BQ7A 1WLHA 2O5ZL 4NN5C 3MRFA 5EC1A 1REIA 1UGNA 2ID5A 1DBAL 4DZBA 3CFKB 2NR6D 3JUZA 1G6RA 4TUOB 5GRXG 2NCMA 4XPFL 1XCQB 1DVFC 2W0FA 4P46C 1Q9OB 2XTJE 5GRUH 3E1F1 3KHQA 1OPGH 5CZKA 2EXYD 4M7ZB 5F7EL 1JNLL 3GGWA 2XT1B 2WUCL 4AQ1B 3F58H 4P59H 1P7QB 2R9HC 1RJLA 1CN4A 3ILPB 1FNAA 1QSFD 3Q3GB 1QSFA 1FLRL 2E6PA 5BV7B 1NAKL 4QHMB 1V5JA 5FYKL 3FQWB 3CK0H 4XWGL 1FL6A 1NC2B 3BKJL 5J3HC 3SKNB 4Z7QE 4FQIL 3HTLX 2BZDA 5GQBA 1WBZB 3MRNA 2BMKB 1NCBL 3DVGB 3S96A 1LE9B 4A6YA 3QCUH 5DD0L 3NAAH 1BEYH 2ENYA 1Q9WB 1I3VA 3MLUL 3CDCA 4L8CA 1UJ3B 4EKXA 4KFZC 3L1OH 4OCRH 3OF6D 3K8LA 5IMMB 3Q0HA 1NBVL 4PJ7A 1RPQA 2R4SH 3L9RB 1X4YA 2XQYG 4QF1A 2OR7A 5F7HA 5JDJA 4X4XA 2NX5B 4LVOC 4D0CA 5BV7H 3HC3L 2HG5B 1NUGA 3EYUH 2X1WL 3LQZA 3LMJH 4EQ3A 2VDPL 3CMGA 4YAQA 3QI9D 3RDTA 4UOJA 5CWSA 5SWZD 4FMKA 5CEZH 5ECJE 5SWZA 3NZ8A 5C1MB 2NTSP 4WHYH 3EYOA 2HFFB 5BS0B 2W9EH 3ARDB 3UYRH 5I19H 3VFGL 1A21A 3H0TB 5E9DB 4XBEL 1JF5A 4YQXH 2B1AH 5FUCE 1KN2H 1YEKL 5F1NB 5I30H 3MV8B 4HPOH 3VFUA 3CFKA 1U8IB 4TUOA 4I3RL 4Z7VB 1K6QH 1MFBL 4RQQB 3FO9B 5FGSA 3BT2H 3PHQB 3N9GH 3TC9A 1XCQA 4UT9L 5C0BD 1Q9OA 1AO7E 1G1CA 1U3ZA 4KPHH 1A7OH 1MHPL 4HUXB 5CINL 1CXKA 3GO1L 1URLA 4K8RD 3G04B 1P7QD 1EPFA 4AEHL 4IDJH 3ILPA 5KG9B 2DM7A 1KIPB 5FV1L 3BJ91 4XVSL 4QHMA 3FQWA 1MIEL 1NC2A 2HT3D 3SKNA 2B4CL 1IAOB 4H8WL 4LAQH 3IF1B 4LDEB 4LSUL 1ZSDB 3VWJC 2KKQA 1CDHA 5D8JL 4OCXL 1K8IB 5C3TA 2A9NH 1KIRB 3DVGA 4RGOL 1LE9A 2P5EB 1Q9WA 2YSSB 1UJ3A 3FFCB 3D1MC 3AB0C 4XCYB 5I76B 4XP5L 1N3NB 1QBML 4PB0H 1U8QB 3DXAB 4P2OC 4KQ4L 3VI4F 1KB5L 4G8GE 2YC1B 4MCYA 4OZHE 3GK8H 3E6FB 2NX5A 2X6MA 5F6IB 4IM8A 3DO3A 1FIGL 1QLFB 2HG5A 2JIXB 1RFDH 1YC7A 4LIQH 5INDB 3PWVB 2VWEE 4KK5C 3BZDA 1A7NL 3NCJL 4NC0B 5SV4A 5GZND 4YDJB 1S5HB 4PJBB 2HFFA 5BS0A 3ARDA 4Y19D 1C1EL 1WBXB 1ITBB 2J8OA 1A3RH 4P4KC 4TQEL 1E4KA 1RUPL 5HSFA 5E9DD 3H0TA 5I1GH 1GYAA 3V9FA 4O5LH 3QYCA 1IT9H 2WZPD 4YFEA 2YA0A 3N85L 5JIHA 5F1NA 5H94B 3VWKD 3MV8A 2JCCB 5FUZH 4OQTL 1U8IA 4KJWD 4MXVF 3ARSA 4NN7C 4Z7VA 1T7ZA 3C8KB 4RQQA 3FO9A 3I2CH 3PHQA 4HDIB 2DJSA 3C08H 1M71B 1ITCA 1RZFH 3CD4A 2BHZA 1E6JL 4YHKL 2BRQA 2IBZY 2FIRT 4HUXA 1NCNA 1I9JH 2YKLH 3SDAC 3W82A 1LO3H 4ACPA 4PLNC 3K3QA 5KG9A 1KIPA 3IB4A 4S1DD 1IGCH 1WWWX 1LO0H 1P1ZB 1N6QL 3QCVH 4TUKL 3QWRD 3WIHL 1IAOA 3IF1A 2DD8H 1P53A 4XCEB 5TGBB 3VMOA 4PJBF 1K8IA 2Y7QB 1BZ7B 2LTQC 4Y4HC 2I60H 2OYPA 1KIRA 2P5ED 2VDQL 4S1QL 2P5EA 1MH5B 2ESVA 2ZSVB 5IKCB 2YSSA 3FFCA 3UJJH 2BSRB 5DK0A 4XCYA 5I76A 1N3NA 4KKCD 1U8QA 1WIUA 2AEWA 3DXAA 8CGTA 1T89C 3VH8B 1DL7H 5I75B 2YC1A 3EBAA 3QA3B 2VUOA 4PGEB 2OBGA 3E6FA 4PJCB 3UJTH 3RRQA 3WLWC 1QLFA 2JIXA 2ZKHH 1T2XA 2R4RL 5INDA 2VXQL 1CE1H 3HUJB 3PWVA 3LKQA 4P5TC 3KPSB 2WIIB 3BX7C 3QEUB 4JFYB 4U6VH 5FF6B 1FGVH 4YDJA 5FGBC 4U6YB 1S5HA 4PJBA 5TFSL 4WW2C 1P4BL 3GNMH 1WBXA 2XICA 2F54B 3EJZD 5JOPD 3MODH 1NKOA 2J6EA 3WSQL 2Q3ZA 4KMQA 2CLZB 4HWZB 4JGMA 1N4XL 1MEXH 1FG9C 5F3BB 5H94A 2JCCA 2EIBA 3PP3H 4NJAH 3C8KA 4JEGB 4MA7L 1JRHL 5D7JC 4HDIA 4IOFC 1M71A 5J0BA 1R0AH 4MJ6B 4XC3L 1OAUL 4YPGB 4ZFZB 3BYYA 3RVTC 2JJTA 4KJPD 4HUNB 4CW1B 2NY7H 2L7JA 3P30L 1A5FL 2R0KL 1NLDL 4OCWH 1INEL 3M8OL 3X3GL 4FABL 3RA7L 5AAMA 1LGVA 2EDXA 1P1ZA 3VFVB 3AXLB 5D7LE 5C92A 1F42A 1FO0L 4H5SB 3LIZL 2Y7QA 3MLZH 1V7NH 1BZ7A 2M8XA 4QRRE 3IDJA 1H3TA 4OV6F 1U92B 3OR6B 1MH5A 3DGCR 1KNOB 2ZSVA 3BQUB 2BSRA 3CXHK 4S2SB 1CBVL 1JZ6A 3D48R 2QEJA 5DRNB 1JZ8A 3BRFA 1AGFB 4N8VB 4MXWL 1KJVB 4S1SH 3VH8A 5AG8A 2AV1A 3ZE1E 3OR7B 2GQHA 3QA3A 4PGEA 4QHUB 3HB3D 3O2DH 1IGIH 4UBDC 4XXCA 2AKRB 1NGQH 1GZQB 4CAGA 3NCCB 3HUJA 2R29L 4I2XE 3KPSA 2AEQL 1LWRA 3QEUA 4JFYA 5FF6A 3BGMA 2MJWA 3O2VH 4U6YA 5AG9A 1LHZA 4RFOH 4WTWA 5FUCC 1A1MB 1EK3A 2F54A 5I8EB 4KWUA 4M6OH 2CLZA 4GRWE 3TO2B 3GMOB 5F3BA 4Q97A 2IGFL 2QSTA 3PL6C 3CDGB 1F2XK 2CJUH 4PG2C 1G0XA 4LP4A 2VSDA 4MYWB 1JPSL 4HGMA 4MJ6A 4YPGA 5HGGS 1KCRL 3GEWB 4ZFZA 5IVXB 1EHLL 1HCVA 1G9EA 3M07A 4CW1A 1WCBB 3RGHA 1A14H 4NBYB 4X7FC 1CGTA 5HYJB 2O5XL 4NCC1 3CFDB 1KJ3L 1YNKL 4F57H 4LPYA 3MJ9A 1S7RB 4U0RC 2GJ6B 4KKBD 4Y4KB 2GSGB 3I6KB 3AXLA 3VFVA 1WEJH 2FDBP 4LSSL 1YN7A 1JNHB 3WFDH 4HG4J 1AP2B 2APVA 4BELD 4H5SA 4DKEL 5IQ7H 4JFHE 3UTTD 4XCCH 1U92A 3OR6A 1KNOA 3BQUA 2R23B 5JW3H 4ONGH 2VIRB 3KJ4B 4S2SA 3Q1SL 1ZEAL 5DRNA 3JVGC 1AGFA 5MHSD 4N8VA 1KJVA 3UYOD 4U3HA 4UAOB 4L9LC 3OR7A 1INDL 4WIQA 1KACB 5IVXF 1FBIH 2ZJSH 4QHUA 1MRCL 1WITA 1HHKA 3MRCB 2VWEC 1MCHA 5D5MB 5ILTH 3MRPB 4OLXL 2AKRA 1T03H 4HHAB 4Z7UB 3ZKSD 5ADOH 2E9IA 4OQ1A 4LCUB 4BZ1H 4O2FB 4U1KB 1XIWD 3SGJA 4LASL 4IMKA 3HRZB 2BNQB 4GMTL 2FSEB 4EN3B 1DQLH 1A1MA 1FNEB 2J7LA 4FG6C 4P2QE 2FZ3B 2G60L 1ZTXL 5I8EA 3ULVH 1QRNE 3KPNB 2NY1C 4XAKE 3SE3C 4YFDB 2OL3H 3TO2A 3GMOA 1AC0A 3CDGA 2CIKA 3ZHDA 4QXGH 4Z7OF 4FFZH 3QDJD 4FFYH 1U8OA 2BVQB 5IVXA 3GM8A 4NP4H 3VXOB 3K46A 1WCBA 5KVDH 5C0DB 3QUZD 1Z6JT 1MUJB 1YEIL 1H3PL 4YHZH 4BSVA 5HYJD 4X6BB 5HYJA 3CFDA 3V8OA 2LABA 4L4VE 3IKKA 2GJ6D 3X13B 1CDUA 2GJ6A 4Y4KA 1IEHA 2GSGA 4LF3B 4ELME 3I6KA 4M62L 1R3IH 1VGEL 4LSTL 4WENB 4E41B 1JNHA 4QWWD 2QLVB 4PJ5B 4XNQB 2VLKB 2Q1EA 3RX5A 4R2GB 3GI9H 5F7KC 2AGJH 5EOCL 1UG9A 3QJHB 1CLYL 3MLYH 5IFAH 2R23A 3O8XB 2VIRA 1NMCC 1RMFL 4I0PB 1U2HA 2JLLA 1R3HB 1AHWB 1CXFA 4OIIH 2AJVL 4N5UA 3Q48A 1A7PH 5KOMC 4KTEL 1GRWA 3MRCA 1EFQA 5I15L 3BKYL 3UO1L 1L0YA 1JTOA 4JZJC 1RURH 5D5MA 3MRPA 4H20H 4HHAA 4Z7UA 4IBLT 1BWMA 2HRPL 5LBSL 2AK4E 2LU7A 4LCUA 4O2FA 4U1KA 1ZGLB 2ZG3A 1JCKA 4JFFD 3HRZA 4JM4H 1W72B 2BNQA 5C2BH 4EN3A 1AXSB 4XP4H 1BJ8A 2IH3B 1CL7I 4RMWA 1FNEA 1HINL 2DI8A 4GLRH 2R0LL 1VESA 4NUGH 5EORH 3KPNA 1R3KB 1T66D 2Z8WC 1S9VB 1FGNL 2KQNA 4PJXF 1MJ8H 5FGCE 1UXSB 4NQEB 2FH6A 1S3KL 4JR9L 1AD0B 1QA9B 2HKHH 3HI1B 2AJSH 1M4KA 2BVQA 5KSBE 3VXOA 5IHZB 4LEXL 3QCTL 1QFUH 4OF8A 1MAJA 5C0DA 3VGDA 2J8UE 4XB8A 3TCXA 1MUJA 4U7MA 3G6AB 4X7SH 1D6EA 2N56A 4MAYC 4X6BA 1E6OH 3MC0A 1PG7X 4JO1L 1ZLWK 5KW9H 3X13A 1UM4H 2VZ1A 5B3JF 3WJLC 4Q7DA 1FPTH 4E41D 5JXEC 5IJKC 4PJ5D 4PJ5A 1J12A 4XNQA 5DDHB 4Z78B 3LS4L 2VLKA 4R2GD 3MPCA 5FYJE 5EOTB 2FJHB 5BRZB 4UINH 1JHLL 2DM2A 3QJHA 4HW6A 4X6EB 2VXUL 3O8XA 4M3JA 3DVFA 4I0PD 1T2QL 4I0PA 1D9KC 4DVRL 1KFAH 4CVXB 1R3HA 1AHWA 3L3DA 1TITA 5KANI 2Q87A 5E1AB 2L4OA 1FORL 4JAMA 4XPGL 4RAVB 4PRIE 4YFLI 1OQOA 4XTRC 3DMMB 1D5XB 1ZAGA 2EH8L 4M43H 2YD1A 3QIBC 1KN4L 4OZGF 4QXUL 4P9MH 4DQOL 5CJBA 4Q0XL 4WCYL 1OT1A 4X6DB 4YPJA 4LSVL 1ZGLA 4S10A 3S37L 4FQLL 2DN7A 5L6YH 5I9QC 3DARA 1W72A 4LQFL 1AXSA 4DK3A 3MRDA 1F6FB 4ESKA 1Q72L 2C26A 3ZT7A 4WHDA 1I1FB 4K23L 1R3KA 3NTCL 2DQJL 1S9VA 4NKOB 4RMUA 3U0TB 5L2JA 2F19H 3IS0X 3CSGA 1NFDF 5EOQH 2QL1A 1QFHA 4EDWH 1UXSA 3IAGC 4NQEA 4QTHB 4F2MB 1AD0A 1QA9A 3VXUD 3H2WA 3WJJC 4MHHI 3B6SB 3FQNB 1LK3L 2CD0A 5BO1H 4PS4L 1UM6H 3MLWL 3TJEH 5D7SH 3ZE2F 4OZGA 3G6AA 4JO3L 1YC8A 4XPAH 4LSQL 2VN7A 5DA4A 3X17A 3LHPH 4DN4H 1FC1A 2N4IA 5I8OH 4L4TB 5HI5D 4JG0H 4PUBL 4HBCL 1OM3L 4P3WA 1U8LB 1FDLL 2AXFB 4HC1A 1N0LA 5DDHA 4Z78A 1CR9L 4JFDB 3S7GA 4MA3B 3O6FB 2NY2B 1ODAA 2OM5A 2FJHA 5EOTA 3W9EB 1C7TA 3RVVD 4EIGB 5BRZA 4FQXD 5CJXA 1A02N 3WFBL 3C2AH 5INCB 3VXME 4X6EA 5IESH 1IEAB 5T5NG 5F9WC 5HHQB 3ISWA 1CDJA 4Q58C 5GRJH 4CVXA 3MACL 1AY1H 2NXZC 1F6AA 2BK8A 4KY1L 5E1AA 4YC2C 4F7MB 4X9FA 1QPPA 2W0LA 4R4NC 4LSRH 4RAVA 5FXCH 3DMMA 1D5XA 5ENWB 5FA4B 2CUIA 2DQUH 2DBLL 4TVPH 3MLVH 1LP9E 4YHIB 3UAJD 3FZUC 4BFEA 5T5FH 1IARB 4HCRL 1Z3GL 1IQDB 4OI7A 4X6DA 3OAZK 5HI3C 1BFVH 1J1XH 2EC9U 3BOVA 2DQTL 1CZ8L 1T7WA 4TRPL 3U7WH 2V17H 3T1FB 4AM0B 1A64A 3L5JA 1FHGA 1B4JH 1WCQA 1I1FA 1W0YT 5DT1L 2YPLE 3U0TA 1JNJA 5I18H 1TPXB 3NCFB 3F7PC 1JI2A 5L2KD 3O9WC 3WL9B 4OFDA 4QTHA 1DQMH 2FIKB 3U9PL 1DLFH 1OWRM 1FIEA 1KJ2B 1OD7A 5KOVC 3OKMB 5HGBB 2PO6B 3RX7A 2EDDA 3B6SA 3FQNA 4PJ8C 5LKNA 5DWUL 2GIYA 3V0WL 4MJIE 1EGJL 4YUEL 2IANA 4G9DB 1CL7H 2DLFL 2YD7A 3GDBA 2EDOA 4GS7C 3MROB 4Y5VB 2UY7A 1TCRA 3K8KA 5C0BE 4L4TA 2JE8A 1ZXQA 4LLYB 2YD3A 3WKML 3LEYH 1P6AB 5IROC 2F9BT 2HJLA 3QWQB 3U30C 1MFEH 2AXFA 3FN0L 2EDYA 2W9DL 4OZIB 4JFDD 4WI7A 4JFDA 4RGMC 2WUBL 4MA3A 3O6FA 3W9EA 3V4UH 1I85A 4NO0D 3TZVD 4KTDL 5INCA 5MEQB 1KJ2H 1JGLL 1L9MA 3HR5B 1IEAA 1IGFL 4F58H 5HHQA 1V3LA 5IBTL 5BMFL 1YECH 3W81A 1I1YB 3TIDB 4F7MA 2FATL 3T0EB 4HXAL 2W38A 5ENWA 4PP2B 5FA4A 3B3IB 1PAMA 4NZRH 3TO4B 3CXDL 1XGYL 4YHIA 4I18C 4K07A 2E5EA 4PV9A 1ZT7A 4LPXA 4NNYB 4K55A 3QH3A 1IQDA 4TPRL 5FCUH 3PHSA 1T7VA 5E4EB 4YBLC 1IAIL 2VXSH 3RY6C 1T1XB 4PP1C 3MUZ1 4P23C 5EU6E 3ARGC 5C0EB 3T1FA 4AM0A 1K3ZA 1LMKA 1SVZA 3DSFL 3EO0B 2AJXH 1IGTB 4OZIF 4QT5B 2HMID 4CJ1A 5D96B 4TYUA 4WW1B 1L7IL 3NCBB 2YD8A 4U1JB 3WL9A 4YXLL 2FIKA 3W0WB 1KJ2A 3SKJL 4Y19E 4YFLF 1MI5A 1KSRA 3OKMA 4M1CC 5HGBA 2A73B 2PO6A 2OS7A 2VR4A 4MAUL 3G6JE 1QSZA 4ZTOL 2NYYD 1C16B 2P8PA 4KMTH 3SKOB 4G9DA 2IG2H 1NGYB 1MWAB 1MCQA 3MROA 2OK0H 5F96L 3DHMA 1VB9A 3MBEB 1J18A 4LLYA 3HE6C 1OP9A 3BGFB 3MRMA 4GJTB 5FB8B 4RAHA 4R0LC 2ICEB 1S7TB 4F15B 3QDGB 4OZIA 2EH7L 1UA6L 2W1NA 2PTTB 5L0QC 4Y16B 1QFWI 2EKSB 2M26A 3P11L 2O5ZH 1MRDL 5EZLB 4MMZC 5MEQA 3F8UB 3GMPB 3VXTB 2F5BL 1EHXA 4NOFA 3HR5A 4HIHB 5GISL 1HKFA 4PGJA 1DBAH 1ZLWH 4WEBL 3NIGE 3RNQB 4QLRA 1I1YA 3TIDA 4XPFH 4OIBA 4Y2DB 3T0ED 3IDXL 3T0EA 4JREB 3MMEA 3MTRA 1A6TB 1QFWM 1QSED 4PP2A 3B3IA 1JMZA 1VFUA 3TO4A 1ACZA 1QR4A 2XWTB 5F7EH 3NOIA 1JNLH 1QO3B 2WUCH 3EOBB 3SDDB 2UY6A 2ITDB 3KPPB 1FLRH 5KZCB 1A1OA 1NAKH 3MNVB 1MCJA 5FYKH 1T0NA 1T1XA 4XWGH 4FQQB 3BKJH 3SGEI 4FQIH 4Y5YB 5C0EA 4ZNEE 1RIUL 3KJ6L 2BNRE 3MRIB 3EO0A 1IGTA 4UT7L 1J8HD 1NCBH 1DFBL 1FG2B 3S5LG 3VE0B 5DD0H 1MAML 1AGBB 4WW1A 3LEVH 2HJFB 3MLUH 2DAVA 4I8DA 4U1JA 3W0WA 1NBVH 1FYTA 3PQYB 1BVZA 3QRGL 5A16A 4U1GB 2A73A 2AEIT 2NR6C 5SWQA 2V2TB 3MRRB 6FABL 4WI6A 5DRZB 1FAIL 1KCUL 5DURB 1C16A 1MCPL 1WWBX 2G9HB 3SKOA 1SQ2N 3FB8B 5ETUB 1NGYA 5F1IB 1MWAA 2EXYC 3GMQB 3HC3H 3CLEL 1EVUA 1NAML 2VDPH 3MBED 2GSIB 2PXYB 5CGYD 3RVXD 5FYLD 3BPCA 5FB8A 2ICEA 1S7TA 3AC0A 3QDGA 3VFTB 2GY5A 4Y16D 2PTTA 3EDKA 4Y16A 4QHKJ 4EI5B 2EKSA 5D2NB 3VFGH 3H3KA 4XBEH 5EZLA 1T22B 3GMPA 4HS8L 4NZTL 3VXTA 4FFWD 5DHVB 3ZHKA 4EUPH 2XZQL 4NZJA 1YEKH 4HIHA 3CVIL 2XY1A 1JWMB 4I3RH 3RNQA 4Y2DD 3OWEA 4Y2DA 4UT9H 5BW7A 3PDOB 5J12C 1FYHB 3FQXB 2AVGA 1MHPH 3NA9L 5CINH 3QIWC 4P9HC 1KB5B 2YD4A 3RZCD 2XWTA 3BHBB 3BPLB 4IRSD 1QO3A 2HFTA 3EOBA 3GO1H 2N7BA 3SDDA 4AEHH 1FZMA 3DX8B 3KPPA 1UH3A 5KZCD 4CU7A 4QOKD 4XVSH 3FRUB 5I6XB 4HV8B 4NYLB 1KB9K 1MIEH 3QI9C 4FQQA 3DUUB 1F4XH 4RZCB 4NC1E 1KYOK 2B4CH 2C4FU 4H8WH 4B50A 4LSUH 4WI8A 3MRIA 5D8JH 4RRPG 4OCXH 5D1QB 1I3GL 3WDJA 2FEDD 3MV7D 1FG2A 4RGOH 5DMGD 3VE0A 2IEPA 4Y1AB 2HJFA 4JB9L 3S5LB 2IMNA 3PABA 3BEVB 5D72L 4G8FB 1U9KA 3PQYA 4XP5H 3OAZH 2PKDA 3TBYB 3LSOB 2DKMA 1QBMH 5JOFB 5FO7B 1T5WB 4KQ4H 2D0GA 2V2TA 3MRRA 3QXAB 1KB5H 4CN6A 3PG2A 5DRZA 3ALWA 4W68A 4KK8C 3V79C 2FO4B 1NCWL 2G9HA 4PRHE 3FB8A 4PJ9D 1HXMB 5F1IA 3GMQA 1EJOL 1JZ7A 1FIGH 2X4TB 1DBML 3HI5L 1K4CB 4K8RC 3B43A 4NO3A 3QWOB 2GSIA 2F8VA 2PXYD 4JVWA 2FECL 1A7NH 5FYKU 3NCJH 1TTUA 1P5VA 5LGHL 3TBTB 4DKFL 3CH8A 4FQ2L 4K7PY 4ZXBB 2P47B 3VFTA 4PJEE 3C60B 2HT3C 1C1EH 4EI5A 3QZWG 4TQEH 4N0UE 1RUPH 4G43A 5D2NA 3UYPA 4C59B 1A9BB 1T22A 3N85H 1HN1A 5DHVA 3D69B 3QDMD 3UDWC 1ZA3B 4OQTH 2X9XA 1JWMA 1K9TA 2W07A 3UTTE 2C3VB 4JFXB 3KNBB 3PDOA 4JFEE 2RGSA 4XHJD 1E6JH 3MNWB 4FP8L 1U3HB 4YHKH 4C56E 3Q6FB 4AJ0A 1W0WB 1KB5A 3BHBA 5I8CB 4OKVB 3WNOA 1NC4B 3DX8A 1MFDL 5CSZB 3FRUA 4YDKL 5A2JH 4HV8A 2DJ4A 4NYLA 3BPOB 1V7ML 3FO1B 1BVLB 3TM6A 1N6QH 3DUUA 4MA1C 5E7BA 4RZCA 5FOJA 4TUKH 3WIHH 4ERSL 3EJYD 5GZNC 5CP3A 5D1QD 1ZKAA 5D1QA 1R3LA 1IKFL 2CDGA 5IBLD 5D1XD 2HT2D 2VDQH 3LD8B 4KDWA 4P3CL 4S1QH 1S5IL 4Y1AA 4ZAKA 1K2DB 5IG7B 3MO1B 3QPQD 5E6ZA 2E7LA 1OQXA 3S5LA 5EDXA 4G8FA 1CGYA 4N0FB 2X4SB 3TBYA 3FMGL 3LSOA 3VWKC 4BQCA 4JPVL 5JOFA 5FO7A 1T5WA 3T65B 4KJWC 2J2ZA 3OHXB 3QXAA 2VLJE 4OQTA 3D2UB 3QFJB 2PYFB 3NN8B 3MJ7B 2FO4A 3HZKB 4RMQA 3SGEH 3O3BA 4XPTL 4XNZB 3G5VB 1HXMA 4J3SA 5DQDL 5ANME 2X4TA 3S3PA 5CZXD 1Z9LA 2R4RH 5E00B 1K4CA 3BN9D 2VXQH 4MA8L 3QWOA 1KLFA 5KSAD 1UWGL 2H9GB 5DC0A 1ZVYA 4S1DC 4LSDA 3U46B 1J87A 3QXDB 5TFSH 5IB4B 4ZXBA 3KPTA 3C60D 5J1TC 1P4BH 1VDGA 4UV7L 3C60A 3VA2C 4CDHA 4TOYH 3O4LE 3WIHA 2LU3A 3WSQH 2CR6A 1JNNL 4HKZB 1A9BA 5C0AE 5CIPH 1N4XH 3QZWB 1IBGL 4RMTA 4O2EB 4PJHB 5C07B 4CRPA 5KVGL 3D69A 1ZA3A 1U8HB 3OAYK 4MA7H 1JRHH 4HWEL 2C3VA 4JFXA 4L1DA 2IFFL 2H8PB 4XC3H 1OAUH 5HHMD 4KKCC 4XI5D 3MNWA 1U3HA 1AC6A 1H0DB 3Q6FA 2D9CA 2H2SD 1W0WA 5I71B 3P30H 3DV4B 3OG6B 5I8CA 4OKVA 1VACB 2R0KH 1OGAE 1NLDH 1NC4A 1INEH 3M8OH 3EZJB 1GZPB 5CSZA 3X3GH 5DMYA 4FABH 1C5CL 3RU8L 4JFOB 3RA7H 2VDRL 3PIQB 1HE7A 3UTSD 4ALAL 3CGTA 4X7DC 3FO1A 1BVLA 3WE6A 4LCWA 3UTQB 3IDIB 4DKDC 5CJ5A 2DYPD 5D6DC 2VISB 1T7XA 2PETA 1FO0H 3V52L 4XP6L 3LIZH 1G9MC 2A1WL 5CMAA 2EDQA 3ULUD 4HWUA 4BSWB 2GITB 3ARVA 4DW2L 3EJZC 4JFFE 1K2DA 5IG7A 4N0YL 5IV2B 2XRAL 3MO1A 3DVIA 1FCGA 1CBVH 2X4SA 4OF3A 4MXWH 3T65A 2YEZB 3D2UD 3OHXA 3QFJD 3D2UA 2BVPB 3QFJA 5C9JB 4RBPK 2PYFA 4KI5E 3NN8A 2WINB 3SE9L 3MJ7A 3HZKA 1JK8B 1F3DH 1FFPA 2EC8A 4KJPC 3QHFL 5B8CC 3G5VA 4PTUB 4RFNB 2FLBT 3GSUB 2FJGB 3OAUH 5E00A 3GHBL 3HKFA 1U8KB 3HAEG 4LGSB 2R29H 5E8EB 4F7EB 4G5ZL 2RIKA 4RWHA 2AEQH 4ZDHB 4Y2OA 3WNLA 5B39B 3U46A 2LFGA 3QXDA 5IB4A 1MCOL 5F9OL 3QG6B 1XZ0B 4TN9A 1XF5B 5KVEL 2P49B 1B0WA 1J1OL 4HKZA 2HWZL 3QZWA 4TNWK 4X9IA 4NFDA 4O2EA 4PJHA 2FNBA 2IGFH 1H3WM 5C07A 1SBSL 3UX9B 4H0GA 5F72S 2EDNA 2ICWI 1U8HA 5JW4M 2XZAL 1IMHC 1L6XA 4LNRB 4JE4B 4HFUL 2H8PA 4YBHA 1EHLH 1KCRH 3UBXB 4OLUL 1H0DA 4DKAA 4WU5A 4QXTB 3ZT6A 5DUBB 3RX8A 5JOEA 3DV4A 5DA0B 2ZUVA 3H9SE 1RIHL 1VACA 3K2MC 4PJAF 3HB3C 4X4ME 2O5XH 1TNMA 1KJ3H 1GZPA 1YNKH 4NC1C 4JFOA 5A3ID 2GFBB 3PIQA 4WI4A 2WAHA 4LSSH 3UTQA 5D7IE 4OT1L 2VISA 4I4WB 4DKEH 5C0CB 1CICC 4UOW0 3ROOA 4PYHA 2QBWA 4BSWA 2GITA 5HYSG 4L3EA 5HYIA 4XPHL 5IV2A 3O6LL 3Q1SH 1F3JB 2KZWA 3FRPG 5BCAA 1Z0NA 5JHDE 4KXZI 2YEZA 2BVPA 5C9JA 1INDH 3RWGB 2WINA 1DQJB 1JK8A 2MOVA 3RTQD 1MRCH 4HS3B 4L8DB 4PTUA 3GSUA 2FJGA 3EFFB 4OLXH 5F7NC 1U8KA 2AJYL 2PUQT 1MFCL 5E8EA 4F7EA 5SV3A 1BM3L 4ZDHA 4NQXB 4LASH 1MCIA 4J3UA 5B39A 4GMTH 2A74B 4KKBC 2XYCA 4DGYL 2UVEA 5ITFB 5LQBL 3QG6A 1XZ0A 3KYMA 1QNZL 2D7NA 1XF5A 2G60H 2ZUUA 1ZTXH 4WFHE 3UZQA 5HVHB 3HNTL 1DJSA 5GHWL 1TLKA 1GSMA 4B0MM 3IGAB 3D0LB 1P69B 2OZ4L 5GSRA 1TJGL 3FHQA 3SDYL 3DYPA 4OGAD 3A6CL 3UBXA 1N2RB 2M1KA 1TIUA 4QXTA 5DUBA 1H3PH 4F3FA 4HJGB 4KI1A 4AIZB 1N7ML 3OX8B 2CXGA 4ONFL 3MUGB 3PWUB 3NCYS 3S35X 2GFBA 3SDXE 4X7TA 3BAEL 1YMMB 1XT5A 3EDDA 4M62H 1VGEH 2FWOA 1PKQB 3GZKA 4LSTH 2E7MA 3NH7L 1XIWC 1NMAL 5DVKA 4CDGC 2P46B 1CYGA 2CQVA 4I4WA 3MUHL 1MJJB 5C0CA 3BN3B 4LVHC 3LKRB 3ZE0F 1E4WL 4X9GA 5EOCH 3BDBA 1SVCP 4I9WD 1CLYH 2PCPA 4D9LL 3T3MF 4JFQB 1IAKB 5DYOB 1II4E 5CEXB 1CFTB 1F3JA 1RMFH 5EUOB 5JIPA 5K33A 5HVGB 1G9NC 1YEHH 3TJHD 3MLRL 2AJVH 2CIIB 3DUSB 3AREB 3RWGA 5H2BB 1DQJA 4X8XA 4KTEH 5I15H 1UQSB 1GPOL 3BKYH 3UO1H 4S1RL 4HS3A 4L8DA 3BD5A 3QUZC 1ZT4B 3EFFA 4J1UB 1OF2B 3SHSA 4EQ2A 5E56A 4KJYB 3ARBB 2HRPH 1BJMA 1A6PA 4NQXA 1FRGL 2VYRE 5IGXL 2A74A 1P84K 3BO8A 5ITFA 1HINH 5HGDB 4QWWC 5J57B 2R0LH 5HI4D 1FGNH 4RGND 1NBQA 1D6VL 3IGAA 1IAMA 1F97A 1BWWA 1MCCA 2NQCA 1S3KH 2QV2A 4JR9H 2R15A 2VZVA 1X5KA 4PD4K 3IKCB 6CGTA 4C57C 5E6ID 1Q1JL 1DEDA 2HTKD 2RR3A 2JTDA 4CBPA 2CLRA 4LEXH 1NANI 4M4PA 4YR6B 3QCTH 1N2RA 4UAOC 4NKMB 4GH7B 3U7AA 4AIZA 2AABH 5T3XE 3OX8A 3MJ8B 5I74B 4JO1H 4I48B 3MUGA 3WKNA 3PWUA 1YMMD 1YMMA 1JV5B 4NN6B 3OAYH 5DD5L 1PKQA 5AZEL 3QHTC 2G5BB 1IZKA 4ODSL 4NN5B 3LS4H 1MJJA 2A6IB 5JIIA 1HNFA 3LKRA 2CSPA 3BMWA 1JHLH 2L7UA 2BOCB 1TJHL 4QRUB 1F4YL 1EHNA 1T66C 1VGKB 3GFUA 4MQXD 4JFQA 1IAKA 2VXUH 5DYOA 4CU8A 5CEXA 1DUZB 1CFTA 4K94C 1DVFB 1T2QH 4KI5C 5EUOA 4DVRH 4X6CB 4TTDD 1OAYL 3F7YB 5CD5D 5TF0A 1FORH 2CIIA 3ARED 3DUSA 4XPGH 3TT3L 2IPTL 2P5WE 2UWEB 4RWYL 2VXTL 3KS0H 5H2BA 4XRCB 5FUOL 2DB8A 5FYJL 2EH8H 1OAZL 5C0RL 1UQSA 1PZUB 1MCBA 2CRYA 3RUGB 1KN4H 1XMWA 4QXUH 2AV7B 4DQOH 4GFTB 1ZT4A 2X89A 4J1UA 5JDSB 4Q0XH 1OF2A 4WCYH 2MCG1 3ARBD 4KJYA 3ARBA 4LSVH 2ED7A 3S37H 4FQLH 1A7QL 5I1LB 1P7HL 3H9ZA 4LQFH 5B21A 3VW3L 1MCFA 1Q72H 5HGDA 4K23H 1U8PB 3NTCH 2DQJH 3V7MA 5I1CL 3ARZA 5JW4Q 2BHYA 3SBWA 5CBAB 1LEKA 4M6ML 4Z7WE 1BF8A 3VFMA 4NFBA 4JVUA 3MZTA 3IKCA 4E42B 4X6CF 1LK3H 1ORSB 1QHOA 3I6LD 4PS4H 3MLWH 4YR6A 3V6BR 3VA6A 3TWCL 4YXKL 1EIBA 4I5BB 4NKMA 4G6FB 1WIPA 4JO3H 2C5DC 5EIIB 3MSPA 1ZA6A 4LSQH 1CGVA 5H8DA 3MJ8A 1J0KA 4I48A 4PUBH 3AGVA 3IDGB 4HBCH 1OM3H 1QSEE 1JV5A 2VDNL 1FDLH 2ICCA 1A3LL 3QUYD 4XNXL 5J13C 5E24E 2G5BA 4TNWF 3IFLL 4O02L 1CR9H 2A6IA 3LCYA 4XCFL 1FFRA 3DROB 3WFBH 1CD8A 4BQ9A 2BOCA 4WDIB 4XX1G 2FRGP 4QRUA 1J1PL 1A4JB 1KC5L 1VGKA 5CJOL 1HQ4B 3UTPD 1DUZA 4Z7NE 5EWIL 1DVFA 2MQCA 5IMLB 5JTWA 4X6CA 1HOCB 1CD1B 3MACH 4X0KB 4GG6B 4JZOB 5DEZA 5IVOA 4KY1H 2UUDK 4GRLC 4G7VL 2UWEA 3OG4B 2R9HD 3RKPA 4M1DL 4XRCA 2DBLH 4OFPA 5JW4R 5TJWK 3RUGA 2AV7A 4PJIF 5JDSA 4HCRH 1I9RL 1Z3GH 1CE6B 2DQGL 2DLTA 5GGSY 3KDMB 3T0WA 2DQTH 4WFFD 3VXRB 4NO2B 1CZ8H 1KGCE 4XXDB 5HI5C 3VWJB 1LO5B 15C8L 2ZG2A 4TRPH 1WAAE 4UU9B 1IKNC 1NCAL 2VE6B 3CX5K 4BUGA 3WNPA 2H26B 1U8PA 3AB0B 2WQ8A 4FXLA 5J8OA 4FQXC 5CBAA 2QSVA 2FJFB 4P2OB 3PWPB 4U2YA 1UWXK 3RWHA 3U9PH 4P9HL 4OD3L 4YE4L 5KVFH 5KN5B 4E42A 4UB0L 3GRWL 2G75B 1ORSA 2QQNL 3ZYIA 5DWUH 3TIEB 5HYQB 4ZMAT 5KVMC 4G6FD 3V0WH 1F11B 5HHNB 1EGJH 4YUEH 4OFVA 5EIIA 4LK4A 2DLFH 1UADC 3O45A 3UAJC 3WYRA 1TZIB 4JKPL 3WKMH 2XFXB 4HCRA 3ZKXC 2NY6D 4P4KB 2AXHA 5IB2B 3FN0H 1WQVT 2QADB 2W9DH 2JJUA 4OM0L 3C09C 4P5MB 5KS9B 2WUBH 4KROD 1MPAL 3T2PA 3KLHD 4QOKE 1BFOB 4KTDH 4WDIA 4UUJB 4NN7B 1A4JA 3ZT5A 4OJFL 4Z5RB 1JGLH 1HQ4A 1UXWB 5KANG 2DBJA 4HBQA 5IMLA 5C09D 3SE4C 1IGFH 5E1HB 1HOCA 1CD1A 1QHPA 3C6LD 4X0KA 4GG6A 4JZOA 4PBXA 5IBTH 5BMFH 3MV7E 1G7JB 3OJMB 3FONB 2FATH 4K8RL 3SDAB 2V7NB 4HXAH 5IBUG 1BOGB 4P0DA 3CXDH 1XGYH 2EXWD 5DHYB 4K71C 3FB7B 1H3VA 2VB5A 1QBAA 2R69L 1EGJA 1TZGL 3TF7C 1CE6A 4TPRH 1I3RB 3KDMA 3VXRD 5J6GB 1GIGL 4NO2A 3MRQB 4XXDA 4HAFA 5GS2D 3VWJA 1LO5A 2BSTB 3CU1A 3QNZB 4UU9A 2LTQB 4Y4HB 3FAWA 4K3HA 4CNIB 2X4RA 4M6NL 2VE6A 3DSFH 3D25B 3LEXA 4KKLC 4WFED 2H26A 5I1HL 2N1KA 1PZ5B 4S0SD 4TNVF 5KS9F 3D85D 4LMQE 5CEYA 1H3XA 2FECI 1N6UA 1L7IH 1ZHNB 2FEEI 2AQ2A 4P2OA 3TZVC 3PWPA 5CJQL 3DO7B 4MHHG 4YXLH 3SKJH 1FNSL 5KN5A 5C08D 4DGVH 2YZ8A 4MAUH 2G75A 5DEGB 4ZTOH 5HYQA 5L9DL 1CTNA 3QEGL 1F11A 4DJMA 1CIUA 2O26U 4P5TB 4JHBA 1CK0H 3P0VL 5F96H 1OLLA 4EJ1C 5IFJB 1BAFL 1TZIA 1HH9B 4WW2B 3CDFA 3GB7A 2XFXA 4UDTB 4P4KD 4P4KA 5IB2A 2QADD 3MA9L 1FC2D 4TVPD 1HZHL 2EH7H 1UA6H 4P5MA 1ZMYA 4NC2B 4WHCA 5KS9A 4BA8A 3L3KB 3P11H 4POZC 4R97C 5GJTL 1BFOA 2XTJB 1MRDH 4UUJA 1NKRA 4JG1L 3RWEB 5ESQA 4Z5RA 2F5BH 2RB8A 5D7JB 1UXWA 5GISH 3G5ZB 3FL7A 1ZHLB 3ELAT 5DFWH 2FLRT 4WEBH 3REWB 3QG7L 1G7JA 3FONA 3IDXH 3SDAA 2V7NA 5CEZE 1BOGA 1VFOA 3EDJA 1LK2B 2NYYC 3P4OB 1OTUD 5DHYA 5IBUB 3FB7A 5TF1L 1MHHB 3MLTB 4Y5VC 1I3RA 5J6GA 5CKAA 3MRQA 5DZOA 5GS1C 3ZMRA 3HRPA 4WW2F 2WANA 3CMOL 2V5TA 3QNZA 4Y4HA 1NEUA 4CNIA 1RIUH 3BD3A 3KJ6H 2P7TB 4XMLL 3D25A 1DFBH 1PZ5A 1JGUL 1MAMH 2EEBA 1ZHNA 1X5IA 3DO7A 1CG9B 1T89A 3QHZL 2Q86B 5EZIL 1YNLL 3A67L 1Y0LB 3QRGH 3T04D 5IF0B 3RJQB 3DI3B 4MXQD 4OCLC 1QZ1A 5DEGA 4JM2B 1CFBA 4XZUB 6FABH 1J0IA 1FAIH 1KCUH 2EZ0D 3KYAA 5BS0E 3RHWK 1MCPH 5HHPB 4XBGB 5HDBF 4P5TD 2VN4A 4P5TA 4HIIB 1DBBL 1T80A 1YA5A 2CR3A 3CLEH 4ETQB 1G9ML 2C7UB 5FGBA 5IFJA 1NAMH 1HH9A 2IQ9L 4WW2A 4HD9A 2D4DA 4CMMB 3NGBB 4UDTA 4ZQKB 3VI4E 2J6EL 2JK5B 1ED3B 4G8IB 4RCAA 3BUTA 1NH6A 3BWUC 2APWA 3PL6B 1EAPA 5FHAL 2XTJD 4WU7B 1MREL 5E6YA 4HS8H 4NZTH 3RWEA 5D96C 5D7JA 4GKOA 2XZQH 3B83A 3CDYA 3CVIH 3RZWA 3G5ZA 3S34L 1ZHLA 2A83B 4H26A 5JA8B 4LIQE 3REWA 5EBMB 4BH7B 1AQKL 3NBNA 1QR1B 1I7TB 5LCVL 3NA9H 3S4SG 1LK2A 4L8BB 1ZT1B 3LH2L 3P4OA 4HUWB 4GXUN 4U0RB 2NLJB 2ESVE 1OT2A 1Y18A 4MXVE 4CKVX 3MLTA 4MD5A 4MNQD 3MBEC 2Z8SA 4KH2A 3U2SB 2VL4A 5CGYC 3RVXC 1GH7A 3AAZA 4AT6B 2P7TA 3U36B 3SOBL 1I3GH 1IC1A 4IRJB 5KBNC 1SJXA 2WBJD 3EOTL 4PTTB 4JB9H 2PW2A 1BECA 1CG9A 2WM0A 2Q86A 4JY4B 2EDBA 4LNVA 5D72H 4FFWC 1BZ9B 4FFVD 4L9LB 1Y0LA 4UTBL 5IF0A 3K2UL 5LGJB 1B0RB 4JM2D 3BFOA 4JM2A 5EULV 4XZUA 4PJBE 3LKSB 5HHPA 3CUPB 5F70A 1DSFL 4NQCD 4XBGA 1NCWH 1PG7L 2XV6B 1QBLL 3C5JB 4LLMB 1EJOH 1QACA 4HIIA 3HI5H 3WCYA 3WUWG 3RZCC 4J3VA 1I7ZB 3QDHA 4ETQA 2C7UA 4IRSC 4AEFA 2BXZA 3R8QA 1UWXH 5DGRA 4CMMA 1O7SA 4ZQKA 1H5BC 2VR9A 5LGHH 2JK5A 4G8IA 4DKFH 2NY1B 1I1AD 4FQ2H 2E7BA 4NM4L 2QR0A 2DI7A 2FBJH 4CMHB 4Y5YC 3QQ9D 4OZFB 3NPSC 5GGRY 1DQQA 4OLEA 3PL6A 4MDJB 3D3VE 5I8KL 1AGEB 1AO7D 4WU7A 2YN5A 3W9DA 4PG2A 1NGZB 5DF0A 2FEDC 5DMGC 4N8PA 2K9UA 3ZKNC 5JR1L 2E8ZA 5JW5B 2A83A 4J12A 4AK1A 3TV3L 3RBSA 4CUCA 5EBMA 4FP8H 2CGRL 3DGGB 4BH7A 1QR1A 1I7TA 2Z93B 5T1LD 3MJ9L 2Q8AL 4L8BA 1ZT1A 4HUWA 3X11B 4EXKA 1MFDH 4PJ9C 3ARTA 3O3EB 4ZTPL 1IC5L 4PGCB 3VGAC 2EYTB 4QRTB 5K59F 3M17B 1V7MH 4OZFH 2PXYC 3U2SA 4V2CB 5ISZE 4ERSH 4AT6A 3NZHL 2VLLB 3U36A 3TA3D 4YK4C 4IRJD 4D94A 1IKFH 1JUFB 4G8GD 1NMCB 2H6PB 3NABL 2VKXA 4P3CH 3JVGA 1S5IH 3SEPA 1S8DB 4PTTA 2E6QA 2CO6B 3S36X 4ZO9A 4NHUB 4JY4A 3C8DA 1CF8L 3PV6B 1BZ9A 4KUZL 4L9LA 2I07B 1KULA 3FMGH 5LGJA 1B0RA 4JPVH 4ISVB 4ELKB 3LKSA 3HFML 5CZVL 4XGZB 4AG4L 5I1IL 1UKQA 4XHJC 4B7IA 3C5JA 4RNRB 4XPTH 4LLMA 1JE6A 2NMSA 1TVHA 1UKTA 4GAJL 5DQDH 3DX7B 1I7ZA 4MA8H 2QQQA 2XKSA 1JI1A 1WVZA 1UWGH 3WUWB 4LHUB 4YHNB 3L3GB 4J7RA 3SE3A 4UV7H 3CVHB 3U4EB 4OZFA 1G9NL 3EJYC 4MDJA 1AGEA 5C70A 2XG4A 1JNNH 1IGYB 4URTB 1NGZA 3RJDA 4POUB 1HH6B 1IBGH 2AP2A 4XP9L 3WFEL 5D1XC 2NW3B 2HT2C 5KVGH 1G7PB 2A6JB 5JW5A 1KUMA 3LZFL 3QPQC 3A0OA 1RU9L 4HWEH 2X2YA 4APQB 4H1LG 2IFFH 3D39D 4Z95L 4PJFF 2Z92B 1ETZB 3DGGA 4MAYB 2Z93A 3N1QC 4AEIL 4JY6A 2BXYA 3FT3B 35C8L 2DTML 3MRGB 3O3EA 5TPWL 2ED8A 5CSGA 1C5CH 4QRRB 3RU8H 1K4DB 4PJDF 2VDRH 4PGCA 5CZXC 2EYTA 5I1KL 3M17A 3BN9C 1A4KB 4ALAH 2ARJB 4XNMB 5KSAC 2EC9T 4BQ6A 5FA3B 2VLLA 3V52H 1KPVB 4XP6H 1FFNB 1XGUB 2A1WH 4FTVB 4AZ8A 1JUFA 1EEYB 2H6PA 5E5MB 4GW5B 1A8JH 1D5IL 4U3XA 1J5OL 1D9KB 1OAQL 4JHZA 4BFIB 2AQ1A 4DW2H 5F3HB 1QPXA 1S8DA 4N0YH 2XWBB 2XRAH 2BNUB 4NHUA 4JQIL 3PV6A 1KTDB 3BP4B 2I07A 4PJFA 4F9PC 4W6XB 4ISVA 4I3GA 4RGNE 3JUYA 1BQHA 4ELKA 1HKLL 2DMKA 3QIBB 1GHFL 4XGZA 3SE9H 1INQB 5B38B 4XI5C 4NHCH 3QHFH 4RNRA 2H2SC 3EYVB 3DX7A 2DQHL 3GHBH 5I9QB 1CVSC 2E27L 5D1ZD 1IFHL 4GRWB 4G5ZH 5FM5M 1U36A 3WUWA 1G6VK 5CGMA 2ILLA 2CDFB 4LHUA 4YHNA 3L3GA 5IVXE 2R1XB 4K94L 4MMXC 1MCOH 5F9OH 3CVHA 3U4EA 2APBA 5KVEH 3PXHA 4V1DD 2HWZH 2YA2A 1IGYA 2YBRB 1OTSC 5DJ8B 1HH6A 5CUSH 3ULUC 1SBSH 2NW3A 1G7PA 4BJLA 3JV0A 2XZAH 3DHJA 4APQD 1LVEA 3KAAA 4HFUH 4MAYD 1ETZA 4MAYA 5D7LD 4OLUH 2FX9L 4U1HA 4J3XA 4B7LA 3MFFB 2X10A 1RIHH 3FT3A 4GRWH 5D71L 3WJLA 3MRGA 4QRRD 4KUCF 5GIRB 5JXEA 4QRRA 4Z7OE 5D93C 2YXMA 3OKLB 5IJKA 1K4DA 1BBJB 1A4KA 2ARJA 4PFEA 1IM9D 2D31B 4Y8DC 5FHBL 2ZUQC 3SCMD 4OT1H 5A1AA 3BMVA 5FA3A 2X1PA 1QTYT 1KPVA 1RJYB 1FFNA 1XGUA 4FTVA 2EDRA 1EEYA 4MZ3A 4OD1L 4L4JA 5F9WB 3U0WL 1D9KA 4BFIA 4NKIL 5TE7L 1BX2B 2XWBA 3LDBB 4XPHH 2BNUA 2NXZB 4Z7UE 3O6LH 5GGVY 4YC2B 4ZUWB 3SDXF 4A2MA 1FVCB 2DIAA 1KTDA 3BP4A 2J5LC 4Y88A 1T0PB 2FHFA 3L5XL 4R4BB 3QIBA 1R24B 3DBXB 3CFBB 5TH2B 4EIZC 1INQA 5B38A 1KCSL 4HWBL 4JHWL 3BXNB 4KK9D 1ZVHA 4PGDB 3EYVA 4P2QB 1W72L 3NCYP 3P0YL 1QRNB 2AJYH 2FD6L 1MFCH 4O58L 4ONOA 1VKXB 4CL7A 3TGXA 1BM3H 2EDEA 3HNVH 4R90L 2CDFA 3BP6B 5EBLB 5A3IC 4HKBB 2ARWA 3T0XA 4DGYH 2R1XA 3AS3A 2GAZA 4RMRA 5LQBH 1QNZH 1C8PA 1JHKL 3HNTH 3O9WB 5GHWH 3T0DA 2YBRA 1LEIB 5DJ8A 4OF7A 4QYOB 2FR4B 2AI0L 5F88B 2YUXA 3WJJA 3T4AB 4PJ8B 1IC7L 2OZ4H 1GC1C 3BW9A 3VGGA 3EHBD 3U1SL 4G6AC 4NM8L 1TJGH 3WV0A 3SDYH 3B9AA 4QHLB 4HUVB 2YWYA 3A6CH 4ELMB 2VLRD 4GS7B 3UTPE 2Z0BA 1MRFL 1FH5L 2ZCKL 5GS0D 1MIML 4HLZH 3MFFA 4PJXE 3RTQC 1N7MH 4JFHD 2BY1A 1WK0A 4PJGF 4ONFH 2EE9A 4HC1L 5GIRA 3U30B 3OKLA 3WXVL 2CRMA 4WV1C 4YDLC 3BAEH 1VENA 1S7XB 1VCAA 4RGMB 2DQIL 5FGRA 2D31A 1JHTA 2DMCA 1ZK9A 3VGEA 3NH7H 1S9WB 1NMAH 4LFHG 4X5WB 3TBVB 3UP1A 4JO2L 1N8ZB 1RJYA 3LKPB 2YA1A 5CFHA 1E4WH 1BX2A 3THML 4D9LH 4IS6B 2NXZD 3CZFA 3EDEA 4ZG1A 1Q0XL 1Z0MA 32C2B 5B3JE 4ZUWA 3CFCL 1FVCA 1RUAL 1A7BA 3K1DA 2KH2B 2OZ4A 2AK4B 3HLAB 3FZUD 2EEDA 2WIMA 4R4BA 1R24A 3DBXA 3CFBA 4I18B 5TH2A 4XAWL 3LB6D 4OGAC 5ALCL 1GPOH 3BXNA 4S1RH 4ZS6D 1FL3B 4P2QD 4PGDA 4LQ1A 3C5ZD 4P2QA 4YBLB 1QRND 2RBLA 1QRNA 1NCCL 4NQEE 1VKXA 3SQOL 4LMQI 2OLDA 3ARGB 3MUJA 4CN4A 4DK6A 1FRGH 5FGCB 3HN3A 4KKNA 3I9GL 5EBLA 1YPZB 3BP6A 5IGXH 4HKBA 4O2CB 5C0NC 3OKDB 4MCZB 5ICZB 4HQQL 3O9WD 2K7QA 4YDVB 5KSBB 3F5WB 3O9WA 4OZGE 1D6VH 3GUTB 1LEIA 2FR4A 1D5ZB 4QRPD 5F88A 2DLHA 2J8UB 3RKDD 3MX0A 1EO8L 4H25B 1AIFB 4PLJD 5DMJB 4OI9A 3T4AA 4PJ8A 2IADB 5DI8B 2X1QA 3GSQB 1P7KB 1Q1JH 3BIBX 3EYQC 5ESVB 4YHPB 4L4VD 3MRLA 4PRPE 3DNKA 1T20B 3S3JA 4HUVA 4ELMA 4P4RB 3TJHC 2XOTA 3VFNB 1NFDE 5C09E 5BRZE 2HLAB 1M6OB 3HE6B 5E8NB 3MLSL 5IROA 4R0LB 5JIKA 4K3JL 3MV9E 5KSUB 1S7XA 5DD5H 5L0QB 5AZEH 1AE6L 1EFXB 1S9WA 4RAUB 1LE5B 2VH5L 8FABB 4ODSH 1XAUA 4RSVA 3ZE2E 4X5WA 2P8MB 4OLWH 3TBVA 1N8ZA 3RWJB 2C4FT 3LKPA 2D03H 5JLZA 2FHBA 1CFSB 1RUML 4X8JB 1DZBA 4PRIB 4GKZA 1TJHH 1WFUA 1XF3B 1F4YH 4ZSOE 4LCYB 5IW3A 3B8YA 5HI4C 4IS6A 1FNLA 3GBNL 4RGNC 2XKUA 4KZEL 32C2A 4CU6A 4HUUB 4JDZB 1OAYH 4HULB 2F15A 4QKXB 5GXBB 3FQUA 2AK4A 3HLAA 3TT3H 2IPTH 4RWYH 4I18A 5E6IC 2VXTH 4MLSA 2HTKC 5FUOH 5FYJH 1OAZH 4ZODA 5C0RH 2F5AH 2PYEA 1FL3A 5C08E 3RY6A 1UH2A 1L6ZA 3LKNB 4P23A 3ARGA 1WTGT 3DURA 1E0OB 4WFGD 1A7QH 1PQZB 2XQYK 1YPZA 1AD9B 2RFXB 1XCTB 3VW3H 4O2CA 1KCLA 1VSCA 3OKDA 2BCKB 3O0RL 4MCZA 4ODWA 5ICZA 1TNNA 2R1WB 4MX7A 3A6OA 4YDVA 5KSBA 3F5WA 5I1CH 1DCLA 2IANE 5LAXB 4GXVL 3GUTA 1D5ZA 2J8UA 2P24B 4M6MH 4H25A 2ZNWA 4TVPE 3G9AB 5DI8A 2IADA 4R8WL 5K9QI 4MQXC 3GSQA 2MFNA 1HWHB 1P7KA 4NWUL 5ESVA 1NSNL 4E9LA 1T20A 2MWCA 5CD5C 3D9AL 5EZOL 4P4RA 4TUJB 3TWCH 4YXKH 1ERNA 3O41B 3AREC 5EBWB 4XX1E 3VFNA 3DX9B 1M6OA 3HE6A 5E8NA 5AWNL 3ILQD 1DBKL 4R0LA 5KSUA 3BE1L 1CWVA 2VDNH 4NDMB 4M6AA 4U49A 1EFXD 1A3LH 1EFXA 4OSUL 4XNXH 1LE5A 2GK0B 3IFLH 5E8PB 3V6ZB 8FABA 4XNYL 2P8MA 2Q20A 3PWLB 4Q9QL 4XCFH 3RWJA 1T0MB 4QY8B 1YJDC 1CFSA 4X8JA 1X5FA 4PRIA 5J9PB 1XF3A 2UZIL 1J1PH 1KC5H 4LCYA 5CJOH 1JYWA 1NGWB 1LP9B 5EWIH 5J12B 3DSNA 4HUUA 4JDZA 4ZNCD 1T6VN 5HGAB 4DCQB 2A77L 4M02A 3QIWB 3OXSB 4G7VH 3Q6GL 3UEZA 4L5FL 4M1DH 5H37H 4NQTA 5FDYA 3Q5TA 4XNUH 3QSKB 3N1GC 1EV2E 3QI9B 1I9RH 1M1SA 2DQGH 3LKNA 2YPLB 4LARL 4KRMB 1AXIB 1PQZA 1CS6A 1MI5E 3OZ9L 1AD9A 2RFXA 4WI2A 15C8H 4C83B 1XCTA 1NCAH 2BCKA 2VJXA 2W91A 3QUYC 2J1KA 2R1WA 4G7YL 4J3TA 5FDWB 5TE6L 5BVPL 5LAXA 5IB3B 1KLGA 7CGTA 4MJIB 2P24A 4IHOB 4MJ4A 4P9HH 2X09A 4OD3H 4P57B 4PJ7F 4UB0H 5C0BB 3GRWH 2D4FA 3IJSB 1EHAA 1MWAL 2QQNH 1W0VB 4OZIE 4TUJA 2P8LB 2J88L 2OQJB 3BKCL 3H42L 5FYJU 3O41A 4K3DL 5EBWA 4UMGA 3DX9A 3JV5A 5E2VL 5LG1A 5FYLL 5E70A 5D2LB 4BK4A 5FKAB 4H0HB 5GGSB 1NCDL 5E08H 3DETD 3VXMD 5CS7A 4JKPH 5E5UB 4TSCL 3EUUA 4R7NB 4NDMA 4QEGA 2GK0A 5E8PA 3V6ZA 4OM0H 1YQVL 1QVOB 3PWLA 1MPAH 1OD9A 4HGWA 1T0MA 5CLWA 4QY8A 2Z4QB 1GL4B 5J9PA 5KSVA 4MNQE 2PW1B 4G6JL 4H0IA 4OJFH 3OF6A 1NGWA 4H88L 4X4ZA 1LP9A 1NGXB 4EI6B 1G7HB 1LILA 1XR9B 1CDGA 5HGAA 1CLZL 5DJYB 3EO1B 3QIWD 1IEBB 1EH9A 3QIWA 3OXSA 4WJ5B 5BVJA 4K8RH 3MLXH 1DANU 5IW6A 2DQEL 1KCKA 3GRWA 4HXBL 5EU6B 3WS3A 4JRYD 3SJVD 3QB7C 4JRXE 3H9YA 2R69H 3QI9A 1TZGH 4MA1B 2YPLD 4PRAB 2YPLA 1BD2D 5BOZG 3HE7B 1FYTE 1GIGH 1X5JA 4P2CG 4NQCE 4C83A 4AENB 3BRDA 1NLBL 1X6NA 2NY6C 4Y19B 1MHEB 4M6NH 4FQCL 3BKML 5FDWA 3G6JB 5I1HH 3LPFA 1B9ZA 4KROC 5IB3A 4MJID 3KLHC 3VWKB 1H8NA 5CJQH 4IHOA 3EYFB 5HBBA 4LL9A 2HT4C 1FNSH 2YD6A 4KK8D 5DGQA 5C0BA 3GMMB 3IJSA 3C6LC 1W0VA 1HWGB 1ZLVK 1U41A 2P8LA 2OQJA 5EU4B 3NCEB 5L9DH 1MCEA 3QEGH 2NZ9D 1IC4L 4N8CL 4NNXB 1P7QA 1HYRC 3P0VH 4HWNA 3Q3GA 5D2LA 3HA0A 2CKBB 2Q7NA 4UV4L 5FKAA 4D8PB 5GGSA 2EXWC 1A47A 4F37F 3GI8L 4YNYB 3QDAA 4P2RD 4GKSB 5DUPL 4R7NA 1BOYA 5EH1A 1J86A 3ARRA 3MA9H 5CSBA 1WBZA 3QULB 1HZHH 3FT2B 2BMKA 1P5UA 4U6TA 1QVOA 5T3ZD 1F3DJ 5GJTH 4LRIC 3UDWA 1MCNA 2PW1A 4JG1H 1AJ7L 1SJHB 2IQAB 3L7FB 5IMMA 3JTTB 3PP4L 1NGXA 1S7WB 4EI6A 4KVNL 1G7HA 3ROLB 4OV5B 1XR9A 4Z7VF 4PG9B 3L9RA 5EBGA 1W2KT 3MZGB 5DJYA 3EO1A 3QG7H 1IEBA 2MHAB 4WJ5A 5E8DL 4NRYB 1AR1D 3RY4A 2VKWA 1HHIB 3ZDZF 4JFPB 4M4RA 5EU6D 1A6VL 2BNRB 3BZFB 4KMLB 4KVCL 5TF1H 4PRAA 3HE7D 2GHWB 3HE7A 3PQYE 1E4XL 1CT8B 4K9EL 4AENA 3CMOH 1LQSR 1EERB 3N06B 4Y19A 1GGUA 1NBZB 4XMLH 2QADC 5E9DA 4J4PD 3G6JA 3KXFD 1QFPA 4F9LA 3KGRA 3K4AA 4BSJA 1JGUH 3NFPB 3VWKA 1G0DA 3QHZH 1KTLB 3RIAF 3EYFA 5EZIH 2VAJA 1YNLH 3A67H 5CP7B 3R06B 3U48A 1RHFA 5JUEL 1JPGB 3GMMA 3WIFB 3E2HC 5B8CB 4X7EC 5EU4A 2HLFD 2W92A 3ARFC 3G04A 4NNXA 4LVNC 3S35L 4HJ0D 5JZ7D 4WI3A 2CKBA 1DBBH 4D8PA 5IHUL 1G9MH 1OTUC 2FX8L 3D39E 3O3UN 5MEOB 4RX4D 2IQ9H 4YNYA 3UROR 1EJ6A 4JQXC 5GZOD 2Y25A 4GKSA 4JDTL 3QWRA 2J6EH 1SEBB 1TENA 1YY9D 4ORGB 1XF2B 1ZSDA 3QULA 4OBRA 2ZWLT 1CXEA 1KYOJ 5FHAH 3WFCL 3O4OC 1MREH 1SJHA 3L7FA 3EJJX 3JTTA 4ODBD 1S7WA 1RK1B 2EO1A 2JCCF 3S34H 3ROLA 4OV5A 1AQDB 3TFKD 4PG9A 1UYWH 3MQIA 3RI5K 2MHAA 4HPYL 4NRYA 4DUVA 3NVQA 1IQWL 4MXQC 1EO7A 2VZ3A 1AQKH 1JPST 5DEFB 5LCVH 1HHIA 4JFPA 3CX2A 2EZ0C 3LH2H 3HC0B 2BNRD 2BNRA 3BZFA 1KEGL 3MXVL 3C9NB 1X4ZA 2BFVL 3NIFF 5D6DA 2B20A 4NPYB 1CT8A 1OVZA 5F9JB 2BOBB 1CICB 1UFUA 1I8MB 3ULUL 1NBZA 4N0RA 1A6AB 3QQ3B 1ZOXA 3S37X 1IE5A 3NFPA 4L9DA 3EOTH 4PRHB 2IBBA 2XTJC 2Y06L 3CFJB 1KTLA 2DIJA 5CP7A 3R06A 4UTBH 3K2UH 1JPGA 4V1DE 2DQDL 5EIQA 3WIFA 3JV6B 5B8CA 2GJZB 5DJAB 3WUZA 4KGJA 1JGEB 2F53D 1DSFH 4GUPB 4RIRB 4PJCF 1PG7H 5EO9B 1QBLH 3BIKB 4PJEB 1SJEB 1I7UB 5EOCJ 4N0UB 5MP6L 5MEOA 1UEMA 3HUJF 5DJ6B 3KPQB 3LN4B 1DQTA 1IILE 4XVUC 2H32B 4OIAA 1SEBA 4ORGA 1XF2A 4XCEA 5TGBA 1MVUB 2C9AA 4NM4H 5IQ9B 3UTTB 3VDAA 4KV5F 1HNGA 5I8KH 4PY7B 1HHGB 4FNLL 4PRBB 5IKCA 3LPGA 3L6FB 2B5IC 4C56B 5JNYB 3R0NA 2WBJC 5JR1H 1RK1A 5HHOD 1AQDA 3GIVB 4HMEA 1UZ6F 4GLRI 4QHNB 4HK3N 2Z31B 4FFVC 4LCWE 1FP5A 2P1YA 2WQRA 2YRLA 3VFWB 1WGOA 2CGRH 2DRUA 4JM2C 4M7LT 4PJCA 1Y6NR 3HCVB 4L8SC 5DEFA 5ACMA 3QUXD 2PN5A 1MFAL 3MJ9H 2Q8AH 3GHEL 3HC0A 2OSLB 3EDFA 4XP1L 3BD4A 1RHHB 2H32H 2VXVL 4ZTPH 2WIIA 1IC5H 1XIWB 4HK0B 4NO5B 1U2CA 4WO4C 5JORB 1CICD 5F9JA 2BOBA 4HMDA 1CICA 4LVHB 1I8MA 3NGBC 1TQCC 2EIDA 3QPXL 5GGRB 3NZHH 1A6AA 1GC1L 3QQ3A 3PWNB 1I1AC 4HWZA 2VLJB 3NABH 3QQ9C 4PRHD 4IIQC 3SO3C 3P4LA 5E5RB 3CFJA 4Y8AA 1BFTA 1CF8H 3QDJB 3V0AC 4KUZH 5ANMB 4YHLH 4G9FD 1MEXL 3WDIA 3DLQR 3JV6A 3NFNB 2ICWJ 2GJZA 2J4WL 5DJAA 3HFMH 5CZVH 4AG4H 3QUZB 2OMBA 4ZS7L 5I1IH 5L8KB 1GGIL 2P43B 4GUPA 4RIRA 4N1EA 5EO9A 3BIKA 4PJEA 4GAJH 1SJEA 1I7UA 4N0UA 2NY7L 4PY8I 4EZMA 5TQ0L 1OARL 4MB5A 4N1HB 5DJ6A 3KPQA 2QKIB 3LN4A 5C0AB 2VLRE 5JPMB 3OGCB 5F7FA 2H32A 2CKNA 3MA7B 5BJTB 1MVUA 3WHXB 5IQ9A 4M93C 3UTTA 5B4MD 4M03A 2C3WA 3ARWA 2D7QA 1G9NH 3KS0J 4JFED 3ZZ1A 4PY7A 1HHGA 4PRBA 2WP3T 3L6FA 3TA3C 4C56D 4IRJC 5JNYA 4HIJB 5FK9B 4XP9H 3WFEH 1VEOA 1A7RH 3QNYB 5F9AC 4XC1H 1SMOA 1OGAB 3GIVA 3U83A 1RU9H 2Z31D 3GSXB 4QHNA 5DJ0B 2Z31A 4JHAL 3SQBA 2NXYD 4Z95H 3VFWA 3HCVA 2ATKB 5C8JB 2OCFD 4AEIH 4J3WA 5DXWA 1OSZB 2OSLA 5ESAB 1GZQA 4L3EE 5I17B 3OJVC 35C8H 3SDCC 1CU4L 1RHHA 2DTMH 5AZ2L 5TPWH 4U6XB 4N68A 1XIWA 4HK0A 2COQA 4NO5A 4U33A 2DKUA 4JFFB 5I1KH 5JORA 4PR5B 1C08B 2VC2L 2V9TA 4UOW1 5MI0C 5GGRA 3VGHA 2VLME 3N1PC 5EUKB 3I3BA 3PWNA 2VLJD 3IFOB 2VLJA 4CMHC 5L7XL 4PJAE 3B9EA 3IDUA 2I24N 1D5IH 1J5OH 2PR4L 1DUYB 1OAQH 3P2TA 4JQVC 3HMXL 3IRPX 3KHOA 3ULVF 1CDBA 2B0SL 1RAMA 4M6OL 1FLTX 3QDJA 5ANMA 4M7LL 4LPWA 4H8WC 3DJ9A 4KRNA 3NFNA 1HKLH 4QRPE 1GHFH 3GSRB 3QUZA 5KTEL 4GAYB 2DTSA 4OD2B 5D5MF 3O4LD 2JJSC 1MVFA 4X99B 2DQHH 1S7RA 2E27H 1A14L 4Z7UF 1ZLSH 2QKIA 5C0AD 1IFHH 5C0AA 2V5SA 5JPMA 3OGCA 1AP2A 3PUCA 1OW0C 3MA7A 5BJTA 3RVWD 4YXHL 3MGOB 3WHXA 4K94H 2H41A 1QRKA 1D7FA 4GXUM 3MCKB 3P77B 1P2CB 2VITB 4HIJA 2NY4D 5FK9A 3GM0A 4U7SA 5A2IH 3QNYA 1KIUA 1OGAD 4XCCL 1OTTD 3GSXA 1IGML 5DJ0A 4PGZA 3GMLB 2OP4L 1Z5LB 3F6IA 1A6UL 2ATKA 5C0CE 2FX9H 4MB3A 5C8JA 3PGCB 4X9BA 5D7IB 1SJVA 3DUHA 3MYJB 1D3CA 1OSZA 5ESAA 3QO0B 5D71H 5I17A 4MDIB 1BQLL 4U6XA 5J13B 1OAXL 3WDHA 5FECB 4JFFA 2A0LD 1A3QA 4PR5A 1VA9A 2FSEA 5D1ZC 4HJJL 3WFZA 4Y89A 1CGWA 4PBVC 5FHBH 2P48B 4DFIA 2UYLB 2FZ3A 1NQBA 3I84A 1TDQA 3DI2B 5EUKA 5JHDB 3IFOA 2IPUK 1F4AA 5EU7E 4KI5D 4OD1H 3MOAL 4WFGE 2JJVA 3HZYB 1DUYA 2WSKA 4FXKB 3U0WH 1JZ4A 1EEUA 4NKIH 5TE7H 3RI5F 4Z0BL 5TQ2L 4GRLB 3U0PB 1CDCA 3VGFA 5M95B 3B2UD 3VXUB 1RI8A 1LD9B 1JF1B 3D87B 3V5KB 1AI1L 3O81A 2ZNXA 4UQ2B 3WS6C 3H8NA 1FE8L 3KG5A 5HY9B 3L5XH 3WXWL 4APQC 3GSRA 1J9CT 4YGVB 4GAYA 3ZE0E 1KCSH 1A0QL 4HK3J 4HWBH 4JHWH 2X42A 3IDNB 2YUWA 3C5SB 4RA0C 5IOPB 3T3ME 4NQUA 4LOUD 1W72H 4X99A 3P0YH 5HDLA 1M7DB 2FD6H 4O58H 2FO1A 4LF3A 3UPRB 1WT5C 3LQAC 1YJDL 1RJCA 4E41A 4QO1A 2OX5A 1SM3L 1NBYB 3K4ZA 3MGOA 1DLHB 1TVBB 2ZCLL 2FX7L 3LY6A 4FQXB 3EO9L 3MCKA 3P77A 3SCMC 5DJXB 1JHKH 2LVEA 1P2CA 2FHCA 3ARPA 2VITA 1KEML 4UQ3B 2AI0H 1EDQA 3HG1D 4KQ3L 3LRSB 4P2YA 3H9SD 3V6OE 1IC7H 1RZJC 3S88L 3MLYL 5C7XL 4HKXB 3U1SH 3GMLA 4NM8H 1OB1B 1Z5LA 1FN4B 3JSSA 1MRFH 2IPKB 3PGCA 5D7IA 1FH5H 2ZCKH 3ARYA 3MREB 3MYJA 2HAZA 1MIMH 2DL9A 5F7DB 1DTUA 1OAKL 3QO0A 3RL2B 4MDIA 2R1YB 3ZKXB 5FOBB 4HWBA 4HC1H 4KK9C 4XVTL 3WXVH 5FECA 4RMVA 3MR9B 3C09B 5C0IB 4GBXC 2DQIH 3BEWB 2IH3A 2UYLA 4WVRA 5IEKB 3K4DA 3BP5B 3FO2B 4JO2H 5JHDD 1NGPL 5L88L 3T1WA 4KHXL 3HZYA 3FJTA 4FXKA 3FOMB 5L2KB 3THMH 3C6SB 3JBG7 3ETBF 4GRLD 1Q0XH 1PLGL 4GRLA 4U2ZA 3VMPA 3U0PA 3CFCH 3HI1A 3WHE0 1RUAH 3WO4C 3VXUA 1LD9A 1JF1A 1AXTL 1WICA 3QUML 3V5KA 4R7DB 5IHZA 5E2WL 3GKZA 4UQ2A 5HTSA 2YRZA 3EHBC 4K71B 4XAWH 1RUQL 2LU4A 2NTFB 3IDNA 3C5SA 5IOPA 2QTEA 3D18B 4WFHD 4WWKD 5GS0C 3BDYL 2ADIB 4HZLB 1M7DA 3T8XB 2Q8BL 1YEDB 1NCCH 1WZ1L 4X6DF 3SQOH 1IKNA 3UPRA 3F7QA 2HVKB 1U8JB 3I9GH 4IMLB 2ATPB 1NBYA 1QQDB 4HIEB 2BRRH 1DLHA 1TVBA 2DLGA 4NO0B 4HQQH 4FQXA 3RQ3A 3TZVB 4YWGL 1JTPA 4UQ3A 3VFOB 1MCKA 1EVTC 4EEEA 3LRSA 1EO8H 2EE3A 3CH1B 2X4PB 3LDBC 1BVKB 2VQUA 3V4VL 3WNKA 2FL5B 2Y36H 4Z18A 4HKXA 4MNGE 1OB1A 4OCSH 3RWFB 1FN4A 2IPKA 3VD7A 3VRJB 1MCSA 3MREA 2GTZB 1E4JA 3LB6C 3PV7A 5F7DA 2HN7B 2IPUG 3RL2A 2R1YA 3MLSH 4MD4B 2A38A 5FOBA 1YEGL 4ZS6C 3BRGC 25C8L 4K3JH 2Z35B 3C5ZC 2AXGB 3K74B 3MR9A 5C0IA 4X6CE 4O9HL 2C3HA 5DC4B 3OSKA 4JRYE 3BEWA 3SJVE 1AE6H 2VAAB 1OL0A 4R97B 2VH5H 5IEKA 3NACL 3BP5A 4PRDB 3G6DL 1U91B 4NKOA 5KAQF 4OF5A 1BD2E 4F7PB 3SE4A 1RUMH 1U3JA 3FOMA 4LPCA 5L2KA 4LEOB 3C6SA 4F2MA 1OOAA 3GBNH 4KRPD 4KZEH 4KRLB 4LCIL 4F8QA 3B4NA 3RKDC 3KPOB 5TE4L 4PLJC 4R7DA 3ZSSA 5CKGA 5HHVL 1JN6B 4BQ8A 2NTFA 1JYNA 5DD1L 1NUFA 2GTWB 2J8HA 3D18A 2ZCHL 1RY7B 5GS1B 2ADIA 3B9KD 4HZLA 2LAAA 3T8XA 1YEDA 1U8LA 2HVJB 4GO6B 3CLFL 1MLBB 2HVKA 3GSNB 1U8JA 4KKLD 4IMLA 4Z7WB 2ATPA 4I3SH 1GGBL 1QQDA 4HIEA 1CLOL 3MRBB 3O0RH 5E99L 1ZANL 4ODUB 4NO0A 3KYNB 3TBSB 12E8L 3TZVA 4PJIE 4GXVH 4P2RE 3VFOA 1P4IL 3CH1A 2DMBA 5T3XD 3QFDB 4R8WH 2X4PA 3QJFB 1BVKA 2FL5A 1J10A 4LRNL 4NWUH 1J8KA 5T3ZE 1NSNH 2ED9A 5E94B 2KDGA 1QSEB 5K9KB 3D9AH 5EZOH 3RWFA 4YBQD 4FRWA 3VRJA 2GTZA 5H35B 1YDPB 2A6KB 1UCBL 2HN7A 3PGFL 4NFCA 4HEPG 4NCDA 5AWNH 1Q38A 4MD4A 1DBKH 3JXAA 1B2WL 3O2WL 4TVPL 2Z35A 2AXGA 2V7HB 3BE1H 4D3CL 1MNUL 3C8HA 4FQJL 4R26L 4LGPB 5L8JB 4ZFFB 4POZD 5EU7C 2VAAA 4OSUH 3TVMD 2XPGB 1R3JB 4WUUE 4XNYH 4PRDA 1J8HB 1U91A 4Q9QH 2P42B 5C0FB 3V4PL 4F7PA 2P5WD 3S36L 4ZOCA 1RIVL 2UZIH 4LEOA 1E4XI 3IXAB 1CD0A 1N5AB 1Q94B 1ZE3C 2OR9L 3KPOA 1KBGL 3KXFE 3RL1B 2A77H 1BJ1H 4M7KL 4NKDB 1JN6A 3Q6GH 3QIUD 4GG8B 4L5FH 1N0XL 2WNGA 1V3JA 3ESUF 4C4KT 4Y5VA 2GTWA 2Y6SD 1PY4A 5GS1A 1Z2KA 1UCTA 3ME0A 4LARH 5EU3B 5T1KB 2HVJA 1HHJB 1MLBA 3ILQC 5IMOB 2IWGA 4GMSL 1J7VR 2VZOA 4Z7WA 3OZ9H 2BJML 3MRBA 3T77B 4ODUA 3KYNA 5MEND 4G7YH 3TBSA 5TE6H 3V6OC 4DAGL 5FM5O 5CILL 5EIVA 1XH3B 5HYFA 3TCLB 3WN5C 5M94B 3T4YB 1F3RB 4I0KA 1F90L 2XXMB 3QJFA 3RGVC 2JF1A 5DC9B 3LN9A 5E94A 1DQDL 3RWCB 1MWAH 1QSEA 2X1XR 5K9KA 2Y07L 3PJSB 4XH2B 5J56B 3BKCH 5KS9E 3H42H 1U0QA 4K3DH 3RZCB 2R0ZL 4IRSB 4J3OC 5H35A 1YDPA 2A6KA 2XA8L 2Y9RT 5E2VH 4NNYA 4QRQB 4QGTA 5FYLH 2I26N 1T3FB 1G7IB 2B8OT 2RJMA 1H5BB 4HUKB 1NCDH 4QOKB 4ZO6A 2V7HA 5D9SB 2WBWB 4TSCH 3P4MB 3S8WA 3NPSB 1MJ7L 4ZFFA 4IJ3C 4ENED 1R3JA 4QT5A 5JPNB 1YQVH 1J8HA 1N64L 5C0FA 3KPRD 3MV7B 1CTOA 4WHYG 3U82B 1OSPL 4KK6D 3QEQD 2EE2A 4G6JH 3IXAA 4H88H 1N5AA 4F7TB 3B9VA 3ZYJA 5A2KH 2HFGL 2RCSL 3MV01 1RZ8B 1CLZH 3RL1A 2YPVL 4WRLA 4ZUTB 4NKDA 3MOQA 5IWLC 1KGCD 4GG8A 3PWJB 2DQEH 5C71A 4UILL 4PJ9B 4HXBH 1QFOA 5HDOA 3VGAB 1JRHI 3MBEA 3ZL4L 5T1KD 1FNHA 5EU3A 4D0CB 1UB6B 5IMOA 2F53E 4DEPB 3DETC 5HDQL 4YK4B 3PP3K 5GGTL 3TH3T 1NLBH 3T77A 4MGXA 4FQCH 3BKMH 4YHYB 3QBTB 2D7OA 3VGBA 1XH3A 5J1AB 2XQBL 3Q2CA 5IMKB 3OKKB 4X80L 3QDMB 3TCLA 4LVEA 2IH1B 3T4YA 1MFBH 1X4XA 1V05A 3VI3E 4ZPTB 4M61B 2BY2A 5A2FA 1A6TA 2PTVA 2OR8A 3RWCA 3VFUB 3PJSA 4XH2A 3RZCA 3QISA 4IRSA 5LXGL 1IC4H 4N8CH 3GSWB 2ITDA 5HHOE 4QRQA 1T3FA 1G7IA 4UV4H 1H5BA 4QOKA 3MNVA 3GI8H 1N59B 3CCHB 4UNVA 5ACLA 4OZ4B 5D9SA 3HPJB 4IRZL 3P4MA 5DUPH 4Y5YA 3KVQA 5DHVH 5JPNA 5HDBE 3ZHLA 4OGZA 3MV7A 5D1XB 3ZKND 2K3TA 1AGBA 2R2BB 3AROA 4O4YL 3P9LB 1AJ7H 3DYMA 4YEEA 3MOBL 3PP4H 5JQ6L 3VG0L 1JZ2A 4XT1C 4F7TA 5HD8D 4JPWL 5JA9A 4KVNH 3LEVL 1CLCA 2JELL 1RZ8A 4PGBB 1QOKA 5CAYB 4ZUTA 5E8DH 3PWJA 5GRVL 4R6UA 5ETUA 5T1DL 5ITBL 4PJ9A 3IFNL 1JIBA 1A6VH 4G9FE 1RV6X 4MCYB 5F97E 2VUYA 2NZ9C 4QTIL 4KVCH 3S3SA 2PXYA 5EA0L 5J7CC 1GAFL 4HIXL 4OGXL 5KSAB 1MCWM 1UB6A 4S0TD 5CP3H 4RDQF 1E4XH 4D9QD 4K9EH 5FIEA 2BSED 3RDTD 3PGDB 1X6LA 1RZKC 5J1AA 1AFVL 4BM7A 1BBDL 5IMKA 3OKKA 3QDMA 4HS6B 2IH1A 1JZ3A 4BYHA 2CUHA 4ZPTA 2BVOB 4CGTA 4M61A 5JUEH 1RZGB 2YD9A 5HHMB 3FQXA 1BMGA 2E9BA 2ORBL 4ZPVB 4HT1L 1PYWB 5ELIA 3W2DL 3GSWA 1AR1C 3VG9C 1EBPA 5D4QA 4J2XA 3S35H 4MVBD 3UBXI 1FZKB 4HKJB 5IHUH 3SY0B 1F2QA 2FX8H 1N59A 3CCHA 3UTSB 1I9IL 2DI9A 2HFEB 4OZ4A 3HPJA 4U1MB 2AXJA 2WWKT 3OKOB 4FOMA 4JDTH 3HE7C 3SGKC 1LDPL 2DYPB 3MCLL 5DUML 1AKJB 2IAMC 1FL5B 1NC2D 5JW4N 1F4XL 5D1XA 3WFCH 1BLNB 2R2BA 2HH0L 5E7FA 2CPCA 5CEZD 1YEEL 4I1NB 4JGUA 4J4PC 3P9LA 3GSVB 4F9LC 4B5EA 3BEVA 2OTUB 5HVFB