1NCOA

Structure of the antitumor protein-chromophore complex neocarzinostatin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
113
structure length
113
Chain Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYDVGQCAWVDTGVLACNPADFSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antibacterial and antitumor protein
molecule keywords HOLO-NEOCARZINOSTATIN
publication title Crystal structure of neocarzinostatin, an antitumor protein-chromophore complex.
pubmed rcsb
source organism Streptomyces carzinostaticus
total genus 17
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 1ncoA00
2G0LA 1HZLA 2CBMA 2MCMA 2CBQA 1NCOA 1J48A 1ACXA 2G0KA 4JW3A 1AKPA 1J5IA 1HZKA 2CBTA 1O5PA 1J5HA 1NOAA 2CBOA
chains in the Genus database with same CATH superfamily
4XO9A 1E8WA 1RZKL 2L0DA 3SOBH 3V4PL 1QFOA 4H5SA 3MRRA 3VYNA 2F19H 2YZ8A 4WK4B 1E4WH 2JLLA 3EXLA 2IH8A 2WTPA 3F62A 4J7RA 2EXSA 3UACA 3QEUA 1L7IL 4BH7A 2CQVA 2DIJA 3EOBA 4JG1H 1K6QH 1OY3B 2GQHA 1KJ2L 4JM2C 4FDWA 1L9MA 5J6SA 5KSAD 2JVUA 3OGCB 3QO0B 4LCCC 1A5FH 1I75A 3BDYL 2GJ6A 2FEEL 1RZFL 2FJUB 2BSED 3GMNB 2D8KA 1VSCA 3Q5YA 4KKLC 5DJCB 3ZDXB 2R0KL 1S9WB 3D85D 3CWGA 1H9DA 1UXWB 4PIBA 2ZOWA 2VWEE 5D72L 3KJ6L 4K7PL 4HWZB 1QTYT 3S37L 2ZCKL 3QC5X 2Z93A 2C1OB 4HJ0C 3V6FB 3LQAL 5I1LA 3CC5A 2CH8A 4KO6A 5CCKH 3PXHA 2OL3L 1YEEH 3VXUD 4QR7A 2H0EA 5HDBE 4YDMA 4K3EL 4WNJA 5FGRA 1MZYA 3UJTH 2EVJA 3DUSA 4OD2A 1J0KA 1IBGH 1QPKA 3S4SB 3APCA 1IGIH 3V95A 2H26B 3PWPB 5MERA 4ZUVB 3L4ZA 3PNWA 1SFHA 2XQYK 3CDZA 2OJEA 1U8HB 1WD8A 2MHAB 4EDWL 3ULVH 1M7XA 5E5UB 1IVLA 1HL9A 4Q2ZA 2F74A 4ZFOA 1WTGT 2D3NA 2VCOA 2FH8A 2ICWI 4OGXL 1RD6A 1UT1A 3QQ9D 1I9JL 2G5BA 4Q4EA 5TGBA 3L9EA 3BZFB 4KAQL 1AS6A 2EE2A 3REWB 4ABWA 4ECNA 5BZDA 3DO7B 3I2CL 1HHIA 1Q0YL 3EZJB 3MRNB 4OH2A 3Q7JA 4N1EA 1NLBH 5E6IC 3JV4A 3TF4A 4QYOA 1JE6A 3HZKA 4L5FH 3ARDB 3VRJA 4UT9A 2ZE0A 3C60C 4P9MH 5J6HA 3C6LC 1NCBL 4P07A 1XBRA 4OZGE 2YQ3A 1CD1A 2DQTL 4YXLL 3IKCA 5C0AD 2YFNA 1A64A 2D7QA 3MRDA 3DTXA 4GSRA 5KUMA 3U4BH 3CAFA 5T3XH 1NIDA 2ZTBA 3IJHA 3WS6C 4KKPA 3CXDL 3VJ6A 3IGUA 5LBGA 1X5LA 1S9VA 5H2BA 3HMWH 3MA9H 1UA6L 4RGOH 4F15B 1REIA 1RP8A 4MLIA 4PRDA 5LGJA 2WZ6A 1TR7A 4M7JL 4XNYL 3C5ZB 1HH9B 5DVOA 3KYNB 3P0VL 4XH2A 3Q8AA 2H3NA 3QJFA 2AVGA 4JN1L 3ALWA 3MV9E 3MLUL 4WCYL 4XOEA 4AE1A 1Q9KB 1DBJH 4HCRH 4LDOB 1UVQB 5K9KB 5HDBF 5C6WH 4Y88A 4A2LA 5KEZA 2FGWH 1K3ZA 4RZCB 2OMBA 2WYHA 2EICA 2Z91B 3EJUA 2M1KA 1T3FB 4KJYB 5GXBB 5DD6B 1FFOA 1QHQA 3OC8A 3GMRB 2NSQA 3O45B 1AZVA 3UIZA 3US0A 3R1GH 4YPJA 4P57A 3KPQB 4BSJA 4JKWA 3LKPB 3BAYA 2XIDA 3WTWA 2OFQA 4ZAKB 3L2NA 2A9CA 3QIUB 4OV5A 1ZS8A 1DFBH 4TQPA 2PTTA 2LABA 4Y2DC 3BQUB 1T2JA 3BVDB 1TPXC 3II2A 3WEXA 2BIPA 3QXWA 3X1BA 2R69L 5J89A 4OZIA 4TMPA 3UERA 2E3VA 4X99B 3HG1B 3VM7A 4LB8A 4MNQE 5I1EL 3BAKA 1INQA 1JMZA 2XX1A 4DUWA 1GVIA 1WVZA 1QUPA 4KXAA 5I0DA 2H7WA 3ZKMC 3S8WA 2CDGA 1F3JB 2WOYA 2HJFA 2X4NB 4GT0A 1O6SB 2V5YA 2A0LC 4OZGF 4QI3A 4A2GA 3RZCA 4OCRL 1KY6A 3SZKC 5I1AB 4LVHB 1YAIA 3L4VA 4Q58C 2FEDD 3GLAA 3IFOA 3QGVA 3QP3A 4EBQL 2MCPL 2P8LA 4EVNB 5JMRA 1KBGL 1NOAA 3MX0B 3KR3H 2ZX8A 5BV7B 3HHSB 3KDPB 4O58H 4HIHA 2F54E 1E50A 1NGZA 4JFED 3VA6A 4XC3H 5L4JA 1I8LA 3O2DH 4APQB 5C0IB 2W65B 2YD6A 2IH9A 2R56L 3OKEB 4QRRB 4YPGB 3K6SB 4UTAA 3PHAA 3L3HA 3T6XA 3B3BA 3FQNB 2JJUA 2AAVA 3UADA 1BAWA 3RVVC 4NN6C 2DWEA 2NSMA 3SZ6A 4X9HA 4HBCL 5CWSA 1OM9A 2FBJL 2NPLX 2WQ8A 3Q0HA 4I7ZC 3FUIA 4OBRA 5AUMA 1XF3B 1ZV2A 3NCYP 4ERSL 3CVHL 2A77L 1GJWA 5I76A 1SOQA 2W9EL 2X44D 4WI3A 3IDGA 2NT0A 4XODA 1URLA 3T1FA 1BVNT 4QJ3B 5DWUL 2LW3A 1BF8A 2FUTA 4EE2A 3NCMA 3NP3A 2OMYA 3DVNB 5D7JC 2FX9L 4P5MA 4XAWH 3TH3T 5T33L 4D3CH 4IOIB 2BY0A 1GZHA 5JW5A 1LEGA 4PRPD 3T4AB 1QFWH 2E46A 1FZKA 3EFFB 4FXKA 3AREC 4WFGE 2E8ZA 4ZPTB 1QSEB 4D9RE 3FSZA 3DROB 3CHRA 4U6YA 4H8UA 4PP1D 1H0DB 4FULA 2NX5D 4KK9D 1LNUB 1I3RA 3V0VB 1HX0A 2VO8A 4MZIA 3D07A 4QHMA 1RSYA 2X3CA 2WXQA 4O4YH 2MTPA 3E8UL 3VWJD 4R7VA 1L9TA 2YBGA 1CURA 2VDRB 2MQ3A 2E56A 3CFDA 4UQ2B 3CNKA 4NPYA 1MHEB 3AU0A 1U2YA 2BZCA 3NIFB 3EJCA 3UYRL 1FO0H 1GJUA 1MH5A 1P5UC 4XCCL 1TQCB 4DP2X 1JL8A 3RL1A 2G3ZA 4KJQC 2E4TA 2KKQA 4DETA 1G87A 1YEDA 4ZNCD 2GHZA 1PAMA 2ZWYA 4NSKB 4QRSB 3QI9C 4WHTB 4KRPC 5FW8A 4R97B 4X5WB 4FA6A 1AY1L 5EBMB 1LE5B 2WWNA 4FYTA 4W68A 3FFCB 3QUXC 2G2RB 2WK2A 4W70A 5D4IA 4XWGL 2YPLE 4TKWA 4S1QH 4LPVA 5DURD 4KKRA 4V33A 4HS8L 5CINL 3W9EA 4IRJB 3K2KA 1KNOB 5DSCB 4HIXL 3Q43A 1X7SA 3HE7A 1RUAH 2EDNA 1ZHLA 4R7DB 3NJXA 3QDAA 1X6NA 5D7IA 4E41D 1L9PA 3E6FA 4L05A 1OALA 2XNAA 3NRQA 3MJ8A 4ANXA 4F2EA 3KCWA 5DU7A 3Q8EA 1ACXA 3O6MH 1ETZB 2IPKA 4L4TD 3BVUA 5DO8A 4YQXL 1LHZA 1QUNA 1Q9WA 3B9KD 3FONB 1ZT7B 4A6YH 4E9RA 5ISZB 1MQKH 3VFSB 3MOQA 1NFKA 4GG8A 5JO5B 3O3UN 3ETBJ 4NNYB 4N0YH 2PW1B 5EZOL 4UQ3B 1EDHA 2P9RA 4LSSH 3MKGA 3V8OA 4AIOA 1X4XA 1HHHA 2BNRB 1KLGA 1JCVA 1K8DA 1P6AB 3GHEL 3HC3H 4NQVA 3TZVA 5ICZA 3V4UH 4GO6B 4I18A 3OX8A 5D96B 4NWUL 4NI6A 1P9MA 4BZYA 2VW6A 3WTVA 3BP4A 5E2UL 4YXHL 1XGPA 1RIHH 1WF5A 2HT4D 3RWHA 4IK6A 3JWDH 4H1LG 1I31A 1JXFA 5CBEB 1WSST 1F56A 3UC0L 2E7BA 3LRLA 4M48H 4KI5D 3L95A 3DJRA 2VC2L 3QWOA 5KOMC 2AJZB 3QIWD 3HUJE 1WICA 5KVFL 4ZDHA 4L3AA 5I0ZA 4M8UA 3C8KB 4NOBA 5E8PB 3A5VA 4NKIL 4P59L 1UADC 2G3NA 2W9DH 4YS4A 2VLRD 4GJTB 3DWTA 5SWSD 4PRHD 3W11D 2OMWB 4MHHG 5KBLA 5CILL 2C9XA 5LO7A 5T1LB 1EFXA 2DQDH 3CE1A 1QEXA 3K72A 3KLLA 1X9RA 4U1HA 2GT9B 4IEFA 2WVUA 4JPIA 2VAJA 5DJDB 1KEML 5HGAA 3OQ3B 3RUGE 4GS7B 1W0YT 1XH3A 5CGBA 5B21A 3WIHL 2ZCHL 3BZEB 2OJZH 5FYJL 2NY4C 2YD1A 3U0PB 2GJRA 4P23B 2JK5A 3CJJA 4OJCA 5KBPA 5LBVA 4X5RA 3SQRA 1T4KA 3NSCA 4QXUL 2R2HB 1IIIA 4GIAA 2RJMA 5DRZA 1BP3B 1F4WL 5JQ6L 4KKBD 4W9IC 1IC0A 5HHPA 1HCVA 1R24A 1O5DT 1XT5A 3AU1B 5I1IL 3MRFA 4U6VL 1N6UA 4Y89A 4Q89A 4HA1A 3FT3B 1PEWA 1HSBB 1DBKH 3EDJA 2CAKA 4FRWA 1MXGA 4FE9A 3TOPA 1ED3B 5EO0B 4BIKA 2VXQA 3EJQA 4Z7OB 2QJDA 3N43B 5IEHA 1M7UA 5JYLA 5BW7A 1RZJH 2XPGA 3I9AA 1AP2A 2YSSA 4PJ8D 4N8CH 2ILLA 1BX2B 2VDML 3BKMH 3LMJH 2ZOOA 3F01A 4XMLL 3UTPE 3RVTC 3GF8A 3Q6GL 4LT7A 3HUJF 4G7VH 1JZEA 4RCAA 1KULA 1V10A 1UFGA 1IBFA 4Z7VB 3BGFB 1LJMA 2GW5A 4P2RE 3QORA 1BZEA 2VWEC 4MA3A 2L7EA 4QXGH 3OHXB 4Y9FA 2VR7A 1QI4A 3D39E 3EYFA 3IU4H 4HKXB 2V9QA 1Y0LA 3RVXD 3CZLA 2VDKH 4F5CA 3IRCA 4HCRA 1Z9NA 1BYPA 5JIKA 3BSGA 1QR1B 1KPRA 4GRMB 5D7KE 4GH7B 2DWYA 2FH6A 1SJXA 3CSTA 1NBCA 3MXWL 1KJMA 1A9EB 3CFIC 4PJHB 2FVNA 1R4XA 3BLKA 3IJEA 2CBQA 3VRLE 2PABA 4OCXH 2BRRH 2VMJA 1NBYA 3WN5B 4F7TA 3H7BB 1S7QB 4HS6B 1CFQA 4XP6L 4LQFH 1YNKH 2QLVB 3WTXA 3FQ4A 3GSQA 2A6JA 1QLFB 4ISVA 2P8MB 1E28A 1MCNA 2AV1A 1CXLA 1XCQA 3IFPA 1GYVA 5B1BB 4YAQA 4JRYA 2NNRA 3HG3A 2ZX5A 3E9TA 4BFKA 1DBML 2X1WL 4UAHA 2DQFA 2CIIA 4RDQF 3B6SA 4H4NA 3O6FD 4DW2H 3PWNB 2IG2L 1SQ2N 3IBOA 4JFYA 2ZKMX 4X8GA 2L8AA 3BN9D 4JG0H 3UTSA 1T66C 1BECA 2MKWA 4IMLA 4S2SB 1VB9A 4JAMA 1ZIBA 4JHVA 2OKMA 3QJTB 3VFPB 1MFCH 4RGMB 3QNZB 4J23A 2FT6A 1RH8A 2NNFA 3N1FC 1MNNA 4A55A 1N59B 5D9SB 1O6VA 3NUKA 1UACL 4QOKA 5C6TH 1MREH 4S10A 4LLYB 4U2YA 4Z3FA 1VA9A 1G6RA 5FX3A 1LO0H 5EOQH 4DTGL 1NC2A 1R46A 3ZTNL 4FQJH 4Z8FL 4M6MH 4GAYB 2CGYA 3KJ4B 5KSVB 2F58H 3EGXA 2R9HD 4L23A 4U3SB 4ES9A 1NMCC 2FT7A 2R39A 3O2WH 4UMGA 3AM8C 1KPUB 5BJTB 4PG9B 1KBVA 1HXMA 3OKYA 1DCEA 2PP9A 3KBHE 4Q6IC 15C8H 1WZ1H 5MEND 1OAZH 3O2DA 1WQVT 2H0PA 1HKLH 4QNPF 2HX7A 3L3JA 3MLVL 2FECI 1MCJA 2FSDA 2GY7B 5C0CB 4F37F 5MEPB 3BGMB 5E99H 5BS0D 3LEVL 2BSBA 3RJOA 3Q9PA 3BAWA 2KQNA 4IBYA 3CHOA 4UZSA 1T5XA 3VRLF 3SO3C 4HGWB 3GS0A 1FUNA 1A7PL 3LEYL 3B3IB 1S9YA 1A7BA 4HUVB 4Y1AA 4ZX4A 5IR1B 1T4WA 4LCYA 2ERJB 3X12B 2WIMA 3M45A 3QZWA 2NYYD 4I48A 4PRIB 4ZQKB 3FQTB 3MUZ1 1IC4L 3VXMB 3RWIB 2ZPKL 3ZJAA 1BG9A 4PJFB 1CU4L 2Q9OA 1A47A 5J1AA 4NQDD 1IC7H 1TT6A 1AMYA 4R0LA 4YL9A 5IQLA 1QNZL 4QJ5B 3F85A 1ETA1 1SLWA 2WLMA 3RTLA 3EYUH 2VITA 1PEZA 3O0RH 3QS2A 1I3VA 1E5CA 1PMYA 2PO6D 1J87A 3DRTB 3RWJB 4TQEL 1CDUA 3PGDA 1U3HD 3DVFA 4LESA 2QQQA 3TEXA 2GFBB 2UXFA 3WY3A 1CIUA 3AWEA 1OXYA 4M1DL 1KCVH 3NK3A 4JCLA 2EINB 3GMPB 4N0RA 3R06B 3FTGA 4G83A 5A2AA 1FO0A 4ZO6A 2CCLA 3TT3L 3QEHA 1LDSA 2DBJA 5KG9B 3N91A 4H8WL 4OZHB 3C2AH 1U95A 43CAA 1Q0EA 4OD3L 1FNEB 1IC5H 4M61A 2Q2EB 4HPHA 1BXAA 1T20B 3PS6A 5BCAA 1FFPA 2WSDA 6FABL 5DHYB 1MHCB 2HLFC 3X1EA 3U0TA 4B7IA 4UOZA 3PF2A 2XSKA 3T0ED 3B2XA 3VXRA 2ROYA 1F3DJ 1MCBA 3E1ZA 4PJ9B 3DMMB 3ZN6A 4P4RB 2J44A 1CGWA 4G3YL 1CVSC 3P0GB 2P24B 3BEWA 4PJBF 4ONHA 1CGXA 1F1GA 1T0NA 2VDNB 4G6AC 3RDTC 1FWXA 5DFWH 5IJKA 2DEWX 2OMTB 4A7VA 3MUGB 3U2SA 1Q9LB 4WEBH 5DUML 1FIGH 3DO3A 2HH0H 5MHSD 5LVEA 3B9DA 4X98B 1NGPL 5EIIB 4DGWC 2PWGA 5E00B 4FQXB 4X80H 4Y19A 4YOKA 4NFBA 2V2TB 5CHNB 3D85A 2XWTB 5DJ6A 5IROC 4N6RB 4QHNB 2L04A 3HKFA 1F97A 1JK9A 4WHYH 5JNYA 3KXFE 4HJGB 1KYUA 3QDGD 3LS4H 3GTVA 1NIEA 3QULA 1W6WA 3ZYJA 1UKQA 2GK0A 3I3EA 4F1SA 2A99A 3MV7E 2JELL 4ZD3H 5B7FA 1INEL 3T04D 3CBKB 3VXUA 5HGDB 4PLKC 3FO9A 4J12A 4PJ7A 5EU7E 1BZ7A 1OCRB 3ET9F 4AH2A 3NIFE 1MEXH 4BFGA 1AGEB 2X70A 3EFOB 4FQPA 1DUZA 1I3GL 1JGEB 1KY7A 2BHYA 3AFLA 4XNZC 3VI3F 4I3SH 3UGXA 1A6ZB 2V2WA 2VLLB 3QXAA 3NBNA 2XZAL 2ZWSA 1H3GA 2BVUA 5MEOA 2VZSA 5CS7A 1HXYA 3CHQA 4C4BA 1VCAA 5DZLA 1AO7E 3BSHA 4K3DH 5ACZA 1UM5L 3FT1A 4Y5VB 2DQ6A 1B0GB 3GBMH 4LOUD 5C3TA 4L18A 43C9B 3AS0A 2YGOA 4HIPA 4WUUB 4WU5B 5AYTA 1A25A 5EU5B 2N7AA 4Y4KC 2JI3A 4JY6A 5B7EA 1A1MA 3FU8A 1AGDB 1DN2A 3RPIA 5IW6A 1CGSH 3OMIB 1D6EB 4N0FA 3MFFB 3X11A 3ZDYE 3BJLA 4GSUA 4DKDC 5IBUG 1E6JL 2XA8H 2IJ0C 3FU0A 2Y6SC 4OI9A 4Q4IA 5INDA 3DJTA 4ABUA 3JTBA 1FF5A 5B39B 1N9PA 2OZNA 4K5OA 2OSLA 1QBAA 3LVEA 5D6DC 1E5UI 5IHZB 1QAWA 1HEJC 1TETH 1JZIA 4DP8X 4OIIH 3PABA 5C08D 3AY2A 4TL4A 1CFMA 5ENWB 3UABA 3TVMB 3RJDA 4B53A 2BVPB 3NVQA 5SX5K 1T7ZA 1KTJA 2IALA 1JRHL 4F7EA 3MNVA 3SKJL 5C0JA 3SDCB 1S7SB 4BK5C 5AZ2L 4G9FB 4UB0H 3DOSB 4CADA 4HHAA 3KH3A 1NCTA 1EGJA 2CM5A 2JIXD 4U05A 3MLTA 3MNWB 2R2BB 3UTZB 2MPAH 1IU1A 4DUXA 1AZRA 1JYVA 2NY2B 3T4YB 1KCUH 1S5HA 3HRZB 1W6LA 2J73A 2JKIS 3EHBB 3A4EA 4HYTB 4M3HA 3F00A 3O3EA 4XVJH 1XDTT 5F1KC 1WUZA 3TPKA 2FB4H 3TIEA 3D4YA 5E6ZA 4JVUA 4XP9L 4YHLL 2VISB 2D7OA 3KH4A 3L3GA 4FMFA 2FHBA 2JJVA 1D5ZA 3QNFA 5F7BA 4YWGH 1DQQB 4L9LC 3VGBA 1SBSH 1UUSA 4Z7NE 1KG0B 4PS7A 3SE3A 3UAEA 2B1HH 2F54A 3ZDYF 2WQUA 3QHFL 2VB5A 1F8TH 3T3MB 1CXKA 4HOMA 4UM8B 5B1JA 3WUWA 3N04A 1FYTD 2W59A 4G2AA 2ZKXA 3L08A 1AIZA 4NT6A 4JM2D 1DVZA 2Z4TA 2BHZA 2R23B 1QQDA 2A4EA 2KC0A 1S2EA 4C55A 4FHJA 4NCC1 2K1MA 5IV2A 3O3AA 4KKLD 4Z78A 4JRXD 1K8IB 1MI5D 5I5IA 2EEBA 2Y72A 3PWVA 3D18A 3HNSH 1BLNB 4P06A 1JGUH 3BH4A 5SV4A 2VXUH 3EGSB 4N2EA 5BO1H 5DEJA 4UU9A 4ZOCA 4C59B 4FQIL 3BUPA 4HU8A 3PQYD 5E7FA 2KPNA 5FECB 4NQEB 1MPAL 5A16B 3IYLW 3CFQA 3I74A 5T3ZL 5LQBH 3QDJA 4GEJA 1J8HB 5E6RB 5JQIB 1DBBH 3KL0A 5C0EB 2PPEA 4OSUL 3RPBA 5LN8A 5JHLL 1LGVA 1O9VA 3FU9A 4OLXL 3EYSL 2MCG1 4UNTA 2VLKE 2X88A 2HJKB 4XVSH 5DK2A 5FYKE 5F44A 1FE8H 4PN6A 4HK0B 4PVBA 1ZHKB 1S3KH 1GGTA 3DX7B 4OJDH 3VFRA 1QSFD 1ESOA 1FRGH 3P1VA 3N9GH 1O9WA 1P6FA 4L8SA 4PMFA 1I8UA 3IXTA 1WAAA 4Z7NF 2P8PA 4PJHE 2BJML 2VL4A 2ATAA 4CN4A 1IIKA 1TLMA 4L4JA 1A1NA 4MDJA 5E6ID 5FKAB 5HTSA 3T65A 2I60H 1KYOK 3D0LB 1T03L 5KVGE 3VXNB 1WBXB 3EAKA 3VXSD 1OAUH 1G4MA 3C60D 3QQ3A 5KVEE 5D1ZI 2D7MA 4N28A 3C6LD 1WLHA 4PJGE 4P5SA 3BIAX 6PCYA 5DT1H 2Y69B 4M9PA 4V1DA 4MS8C 2I9TA 4BZ1L 4NO3B 1A9BA 4YUEL 5A6LA 1UJ3C 1YJDL 2DKUA 1NL0L 4X6BA 1AE6H 5E2WL 5DRWB 1XF2B 4WFEE 1JFHA 3M7FB 5IWLC 1UYWL 2QQNL 3IXAB 3HZYB 1I9RL 3V7MA 2ICCA 4IM8A 2HWZL 2Q8AL 4ICXA 4C56E 3DHUA 3ARBB 5EH1A 5GIRB 3ZTEA 2ZCZA 5IB3B 1DQTA 4XC1L 3BSZL 4DT2A 1TYRA 1XZ0A 1Z3GH 3KWWA 4TS6A 2NRDA 4N24A 3O4LD 4KO5A 1ID5I 1NFIB 4HSAC 3BFQG 4KY1L 3WJJA 1JPFA 3ZTJH 2XVLA 2FO8A 1OEZW 1DTUA 1YNTF 1WAEA 1LMIA 3HZMA 4PUBH 1GMIA 4L4TA 2CPUA 2HKAA 2Y1AA 3B2VH 7FABH 3B9KA 4XP4H 5EU6E 5SWZA 1KTRL 3QYCA 1PY4A 4NUPA 1OGAB 3HMXL 5KBMA 1KZYA 4Y2DD 3QEQE 2DYPA 2B5IB 5IJDC 2IQ9L 5LWYL 3VD2A 5BQDA 3S88L 1SVCP 4YSPA 3D87B 2XPZA 5CN3A 1QVOA 1EO5A 1MJ8H 4JZNB 3X3FH 4XE0A 3BAXA 4TVPE 2QGDA 5DS2A 3VI4F 4R26H 5GJSL 2R4SL 3QIUC 3BVXA 3NACL 4UOW0 4GKLA 3ZKMD 2ITFA 5I15H 4ELME 4YMPA 1ZA3A 1AD9A 3FB6A 3EDDA 5JXAL 1Q1PA 4N2OA 1OK0A 2G0LA 3KPRE 2A0LD 4MYPA 5CMAA 4XXCC 4QIRA 3SE9L 5TQ2H 4AV4A 3RHWK 2V4LA 2NW2A 3WLBB 3IAQA 2BNQB 1SY6L 4QXWA 5L8LB 1NMBL 3QEGH 2G5RA 5F21B 4AQAA 1ZLEA 2ENPA 4MWFB 3CUPB 5B8CB 5F88B 3VMOA 1U8LB 1KJVB 3BKCH 3UG5A 3ZR6A 3P4MA 8PAZA 4B9GA 2AJUH 5F9WB 3VFMA 3LEXA 2JH2A 4BFRA 5CP7B 2D0GA 3SPHA 3FXIC 2BMKA 5BRZA 4MNGE 5E9AA 3OMNB 3NJIA 2AEWA 2ZXCA 4BSWB 4X0NA 4PH8A 4DCQA 1NCAH 4MAZA 5BV7C 3W2DH 3ISYA 5CCGE 3T2PA 3RVVD 2PW2A 1EEQA 4O51B 1EUUA 3U48A 3B37A 4N8VA 3WFEH 1XGTA 5IB1A 1PSKH 4APQC 1CDHA 3LX9A 3CDGB 1G7IA 4FMVA 2KERA 2GBUA 4FG6C 5HI3C 4FI8A 3KS0J 3NFPA 4GBXB 5AYUL 1DJWA 1HINL 2DOCA 2ICWJ 4ONGL 2GTWB 1MCPH 2VMFA 3KBPA 3TA3B 5AKSA 1JN6A 4JPQA 4QWWC 3MROB 3QR1A 1NEZA 2WXLA 2Y5QA 2QDVA 4ZQTA 5I71B 1RUKH 3ELAT 4Z9KB 5D7JD 2Z6FA 3LNGA 2NY0C 5KVDE 1A4BA 3APDA 4GMTL 1FFTB 2DS4A 1XHHA 1FH2A 3W9DB 4GW4A 3H53A 4PM1A 4OGZA 1XVSA 5EC2A 3ARED 2P46B 4BEIA 4KTDH 4RAUA 5I1DA 2WBXA 3TNNA 3TTSA 2CGRH 3TYFA 3HI6L 3N42B 4JFZH 4LE8A 4E42A 1E7VA 4JLRA 5E1AA 1YYCA 2N1KA 1JF5A 4BCYA 3DIVA 1E4XI 4ZFOL 2WQXA 1OT2A 4G42A 1TNNA 3L3OC 1FL3A 5AVZB 1ECYA 2RAMA 1S4IA 1R3JA 2WY3B 4J1UA 5J1TC 2YPVH 2X2JA 3VGDA 2K9UA 1VPOH 1DVFA 4KJQD 4GUQA 1SM3H 3MBEA 5D1ZB 2Y7SA 1MIEH 1NUNB 4R8WL 3K80A 4CRPA 5M7QA 5EU7C 4F8PA 5ESQA 3WAJA 3QI9D 4JGMA 1D9KB 1JI2A 4KRPD 3JTTB 5CD5C 2VXSL 1DCLA 1ONQB 3O3DA 1YYLL 1TIUA 3A67H 3GRGA 4FJ6A 4P46C 4XNDA 3QUXD 4HG4J 2TSBA 1BIHA 1OSZA 2J72A 3KYMA 4PJCE 3FO1B 3V4PB 1VFAB 3ZDWA 1MIML 1FVDA 5JUEL 1DJHA 3WY4A 1A6VL 1JHTA 1NC4A 4HEPA 4I5BB 1T0MA 3ZU8A 1AZCA 3AS2A 5KAQF 5TK4A 1KJ2B 2CO1A 2VDOH 4EDXA 2XACC 5CEZD 2AQ3A 2P43B 1RL1A 1OARL 3L3KA 5F7UA 3O9WC 1X4YA 3DLQR 3G5YA 2XTSA 4P49A 3WKML 3EGDB 3LY6A 3OPZH 2EYRA 3DXAB 3CV5A 1CG9A 4UYQA 1PKQA 3UTQA 2BSRB 2D7TL 3QDMA 1KXQA 4M5YH 4MA7H 3HR5A 3JV5A 4G8EA 4A7QA 3AUVA 4NZRL 5GGVY 1FSKC 4TVUA 5EUOE 3VX1A 4Q6KA 3SKNA 2I32A 1AR1B 2OL3B 1MRDH 2WTOA 3APFA 1V7NH 1SLXA 4NHUB 3PHOA 1A4KA 3TO4A 3B9EA 4OLUL 5GSVA 4PGBA 3WEMA 5IVXE 3V0EA 5A7EA 5C9KA 5IOPB 3IS0X 4X6CE 4NPKA 2YQ2A 5GGQL 1N6QL 4ZJ9A 1H5BA 2F6AA 4AL8C 4Z7WB 2H2SC 4FTVA 2NR6C 3OKNB 4CA4A 4AUUA 4WFFD 1H15B 1YUKB 5I1GL 3K81A 2EECA 4A2HA 3GBEA 1ZLUK 4OBSA 1YLBB 1B3IA 2BIHA 3OLDA 4JQIL 1JOIA 2Q0ZX 4OJFH 2HLAB 3MJ7A 4PJBA 5D96C 2LTQB 5DJZA 1J9TA 4FQHB 4GUPA 1IBBA 1OAKH 1MLBB 3O6LH 3BH8A 4J27A 5KVEH 3I6KB 2JKWA 1CYXA 1VACA 4DEPC 5K9QG 4LCIL 3GUTB 4JM0A 4QRPE 2NY6C 1SN0A 1TEYA 4I77H 4PJAA 4XCYB 4JKKA 4Z5RB 2VDQH 3EG9B 2OMXB 3LDBB 3ARQA 4FKHA 4XMPL 5E6UB 4PBVC 1Z1WA 5IB4B 4IKKA 4TULL 3H9SE 3QFJE 1DBAL 3GEWB 3BE1H 3P3YA 3SQBA 3ISWA 5DQDH 4PS4H 1WCQA 1X5IA 4XGZA 2DMKA 3NIDF 4KU1A 1BGXH 3M7OA 5IHHA 1FGVL 3H9HA 2GI7A 4K2UH 2NY4D 3D05A 3U7YL 4LLWB 5J13C 5D7LE 4AM0Q 4NQDA 3ESMA 2BSCA 4WJG3 4NENA 2P47B 3G5ZB 3LCYA 4UTAL 4QAMB 5SX4H 3LJ3A 1BFOB 3BVWA 2YAQA 5T5NG 1AD0A 4BYHA 1NUFA 5IGXH 2FL5B 4YSAA 1NSNL 2Q10A 4R9HA 4CBPA 1TMCB 3NEXA 3U4KA 4GAGH 5A43C 2PO6A 2NUTB 1U92B 4NX0A 5KSUA 5AOZA 1UUNA 1EBAA 3VG9B 1IV8A 4GKNB 4PYGA 1VKXA 5F6HJ 3VI3A 2AC0A 1ZEAH 2X42A 1WGVA 2EC9U 4BZ2L 3FJTA 2EUZA 5DRNB 3O4OB 4TSBL 1V7MH 1JZ7A 4ZFFA 5IVXF 3T2NH 1XBDA 1IKNA 3OPUA 3FH7A 4X6CF 3T9WA 1X9LA 1KBPA 5E51A 4AEIL 1LO2H 2O5XL 5EU3B 1E5AA 3IMSA 4P4KA 4XXDB 2XN9B 1FLTX 4FQQB 1YZZA 4PGZA 4JY4A 1NCCH 4TV3A 5CGYC 4QRTB 3MR9A 1RLWA 4BK8A 4BUGA 3BKJH 1OTTC 4EIBA 3RVTD 1QKZL 5TF1L 4BELD 5TE4L 4PVLA 3N55A 5I8OH 4KH9A 4NO5B 1G1CA 2R1WA 3MCLL 4Z77B 4MYWB 1OSPL 3NJFA 3G5VA 1X9QA 2AJ3B 3UPAA 3P2BA 4PV8B 2J6EH 4JZJC 1IEHA 4LLDB 5E2TL 4HFUL 1UXMA 5CSGA 4BINA 3V4VL 3WOVA 1TCMA 1WS8A 1KXTA 3BP5B 4NRXB 1WBZB 2XZQL 1ZLSH 4AQ1A 1XCTA 3ETBF 3BGFC 1G7MB 1IGFH 1M2VB 1X5ZA 1T7XA 2O5YH 2UY7B 2XZCL 3NCCB 2AQ2A 1BJ1J 1CN4A 3UG4A 2NY5C 4N0UB 1FZMA 2D4DA 4ZUSB 5FKPA 3NRFA 4M4RA 4X8JA 5AL0A 5B38A 3D34A 1DJIA 5LAXB 1BQ5A 3H2PA 3A47A 3MU3A 5HYSG 1QZNA 3CFCL 5T5FH 3ABLB 3KGRA 3DSNB 3MBXH 1ES0A 3NYKA 5CCHE 1PY0A 1KWKA 2E7CA 5CR8A 1FDLH 5GJTL 2VIRB 4ZTOL 3WNIA 1Z2KA 1NH6A 1KEGH 1F90L 5DWPA 3PAZA 5CZVL 1KACB 4RFOH 2YO3A 3BEVA 3WN5C 1BQSA 2OR9L 3PFUA 2WBJA 4I1PA 3EFDH 4TOYH 3QXDB 4KO7A 1T66D 2XQYA 5JHDB 4UV7L 5J6GA 4AG4L 2QEJA 3RYMA 3BW9B 4PV1C 4TUKL 3FC8A 2ZWZA 4F80A 5IZ7A 2OLDA 3GS4A 1L6XA 1RVFH 4HT1L 4J6RH 2VJ8A 3SQOL 5KUKA 1B2WH 4MMZB 5L6YH 5HI5C 4N6QA 5EN2B 4KZCA 1AHWB 2OMUA 4HWUA 3NCXA 4HV8B 4B60A 1FH5L 2QKSA 1HAWA 1LO4H 1PDKA 4XN4A 1V8HA 4Z76B 3K6FA 1WC7B 1UWGH 4F8OA 1XR8B 5LCVH 4RGMC 3LKOA 2YRBA 3SEPA 3B7YA 2C9PA 3OTTA 5DK0B 5HGGS 1WA2X 1S7VB 1QRNB 2AXFA 2IDQA 3IJYB 5ITBL 4JL2A 1I1CA 4QHLA 3RX8A 2FEJA 3IE4A 4JQVC 3V5HA 4HHWA 3SOBL 1EWHA 1GKEA 4JKPH 5E08H 3MBWB 4Y16C 2F19L 3GB7B 3VXQA 1UGNA 4F2MB 5SV3A 2XY2A 3M07A 3HLAB 5AW8B 5J9PB 4XX1G 1F2QA 4JG1L 1UEMA 1G9EA 1K6QL 4PBDA 2H0JA 1BBJA 1UD5A 2GB2A 3MMEB 1P84J 4G82A 1PNDA 4WTZA 4N5EC 4U1NA 5HHOE 1A5FL 2FSEA 2ZXAA 2AERT 5ICYB 1T89C 1FFQA 2C9AA 2B4CH 2P5WE 3S36H 1MDAA 5L2KB 4I2XB 4IIQC 5AKVA 1MLCA 5C08A 4XZUB 1FPTH 2GIXA 1JNHA 4HUMB 4E5XB 4XCNB 4MNQD 3S3PA 1VFBB 2YLHA 3QRLA 4DKEH 2JCCB 3P30H 2UWEB 1I1AC 5F9JB 2IVFC 4GG6A 1FNGB 2ED6A 5CCKL 4JUTA 4Q6YA 1YEEL 4J3VA 1AQDA 4NRZA 3A23A 3UJTL 3ARTA 3WSQH 4M9OA 3UTTE 5BO0D 5IP4A 3W0WD 1AGCA 1M42A 3UMTA 1IBGL 4PTTB 3GSRA 3KWTA 1IGIL 5E7BA 1IM9B 1VRSA 5DUBA 4U1LB 2HG0A 3GSNA 3WNJA 2VUOA 3EH3B 3VD5A 3ULVL 3VFWB 4NRYA 1XGRA 4N8UA 2EIZA 1DSFH 2IPUG 2VL5B 3P4OB 5H4YA 1SMDA 1P7QB 1MOEA 5JDSA 3VX0A 3BP6A 4MMXA 4GW5B 3RIKA 4WWNA 3TH2T 3UYPA 3D69A 1GS8A 2CALA 4JJ5B 4OV6F 4KFZC 4RRPG 5DD5H 3V6ZB 5HI4C 1KGWA 1NLBL 1IM3A 2ROXA 3US9A 4D8OA 2IAMA 1O5PA 3IETB 2HLFD 1DEEA 1YAZA 4L5FL 2ENSA 2ZF9A 3DI2B 5T1KB 3VWKB 3BAJA 3NQKA 4K3JH 4QGTA 4XN5A 4PCYA 3U0WH 4P9ML 5FFOA 2H4EA 1ZDQA 3JYBA 4N2DA 2ZOTA 2YD8A 3MRBA 1CICD 3TV8A 1LO5B 3O8XA 1QWUA 5I6NA 3MV8A 3U4BL 4ZPVA 1L9OA 4HPOH 5T3XL 2WXPA 3CFTA 4TNWF 1G4RA 1U8IA 3D3VA 4G6AD 1NQBA 4PY8I 5E6YA 3RDTD 3HMWL 3SGKA 3MA9L 4DK3A 1Z5LB 1PLAA 2XBDA 3GLEA 4NNXB 3EDEA 4RGOL 4QT5A 3ILQC 3D33A 2CKBB 3DPBB 2NXZC 1BEXA 4LVOB 3ZMEA 3I9GH 1KCSH 1J12A 4YLQT 2YEQA 1IKFH 1DBJL 1NPJA 4HCRL 3QYMA 4WFGD 1H3XA 3CQFA 4ODBD 2EDRA 1E65A 2BP8B 3LOWA 1LDPL 3Q5TA 4U49A 1MI5A 2NNAB 5IROD 1M3JA 2FGWL 3ARXA 3LKSA 5TDOB 4AQ8C 4EIGB 1W0VB 3TJPA 2YJLA 4U3HA 1WFNA 2AEPH 1TYJA 2FO4B 2GCYB 2OPCA 4XBMA 1SJHA 3H9ZA 3K4ZA 4ANVA 5FOBB 2PCPA 3BIBX 5L7XH 4PLKD 3S97C 3QZPA 2HSIA 2LHAA 1TQTA 2XWXA 1DFBL 1EJOH 3PHQB 4CGTA 1IGTB 2LVEA 1FL6A 4PS3A 4ALAC 2ZUWA 2ZXQA 1HJCA 2LU5A 1T7WA 3ZK0A 4OM1H 1MFNA 3LKRA 5DRXB 2B4CC 4HMEA 5E94B 3RIFK 1E2ZA 2P4AB 1MHPH 1A6WH 1XSKA 4BWUA 1JTPA 4NDMB 4RGNE 2D2OA 3N1MC 1U33A 3IFLH 3VI4A 3PV6A 3MRCB 2YPLD 5IB2B 4NBYB 4MCYA 5DVPA 5GGUB 4R7LA 2X9ZA 4M43H 4GAFB 2Y4SA 5JIIA 2PR9A 2Y2TA 2V7NB 2HRGA 1XF5B 2ZXEB 1QEWB 4NM4H 4PLJC 3QJRB 4BFNA 4F8NA 1W0WA 2Z7UA 4KZEH 3GLZA 3P73A 2Q5BA 4Y4KD 5KZCB 3S34H 5GGRB 3I9IA 3KR3L 3ZHFA 3PJNA 4Y5VC 4HFWB 1S7RB 4CILA 4O58L 3F5WA 3ZPDA 5D1QE 2F9BT 2VDMB 4LCWE 3H0TA 4XC3L 2A6IB 5C07A 2HZHA 5JA8B 1NCDH 3BPCB 2Y6SD 4FNLH 4Z0BL 5HHNA 5I8KH 3RP1A 1KB5A 4DERA 1C5DA 1T80A 4D2NA 3OR7A 2DWXA 1DDHA 3PREA 1BYOA 2FIKB 2VQ1A 4F1ZA 2QR0A 3TFKC 1URIA 5E4AA 5L88H 2P5PA 3I3DA 5DUPH 3GD1C 3OB0K 3HNVL 4XN9A 3RJQB 3FB5B 3MCKB 2CK2A 2R0WH 4PJDE 3SD5A 2WANA 2ZAIA 3GJFB 4IHOA 4EN3A 5EO9B 4ZUWB 3SIKA 1AYRA 1WDAA 5IQ7H 4M3JA 4H0GA 3TVMC 3GPEA 4XPHL 4HKBB 5D55A 1J8RA 4AVKA 5F9DC 4U4IA 4XAWL 3H55A 2O1AA 4D3CL 3NN8B 1WT5C 2D03H 5IB5A 2EKJA 4EXKA 3IMVA 1I8MB 1T6BX 2HFEA 4N1HB 5FDWB 1JV5A 2VERA 2DMHA 2J6EA 1MJJA 4G8IB 4FLRA 2QGEA 4YHNA 1ORSB 5JIHA 3IU3B 4O4YL 3BH9B 3H42H 1GZQB 2IBGA 2BP0A 3CFBB 2NY2C 1DJZA 1F58H 1XIWA 2Y7NA 5ES4B 1WG3A 2DN7A 3HRZC 4QKTA 1TEGA 2R1YA 5CJXC 1MRFH 3IJ9A 1YNLH 3GINA 3B5HA 1FO0L 1ZLWK 1HL5A 4N1CA 5EFIA 4PS8A 1Y6NR 2QQLH 4GLRH 5EOTA 5TE7H 2QKIA 1EEUA 2BDNH 5F7LB 2EIEA 3MRIB 5C3LD 3L4WA 4PJEF 4U6TA 3VAEA 1HCFX 4AMXA 2W5PA 4MJIE 4YN3A 1BEYH 1DQKA 2B3IA 4HWBA 4LPXA 5G4MA 5G5DB 1SN2A 5T5FA 2W95A 4X4XA 2BWQA 1OLZA 3L48A 4GT7A 4YHKH 3T0AA 1IAOA 1KBWA 2YRLA 2GBVA 1K2DA 3F58H 4HZLB 3FNKA 4WFHD 4GW1A 4R7XA 2ED8A 4NQXB 1AGBA 4S1QL 4O9HH 1QPPA 4ZFZA 1RHHA 2C9UA 3RWDA 3NGBB 4ZSOA 2QT6A 1L9QA 4PJDF 2BHFA 1DJXA 1WBYB 3B2MA 1HWHB 1RUAL 4YDVB 3RY6C 2AW2A 3CLFH 4Z7UA 1MHHB 1EZSA 3IVKB 3G9AB 2HFFB 4TUOB 2EDWA 3RL2A 5EC1A 2IMMA 3KL5A 5KOVC 1AXSA 3VFUA 3UTPD 4WDIA 1YUHB 3KBFA 3IDMA 4NBZB 3WD5H 4OKVA 2CHNA 4H1LB 3O6ML 2LU4A 4L3CB 3IN2A 4BGDA 4U6HB 4AXWA 4A6YL 1FFNA 4P2RD 1MQKL 3RA7H 4BQCA 5LCVA 4XNAA 3STZA 3D39D 4G9DB 4HUXA 5GSRA 4N0YL 2EO1A 1GGBH 1RUPH 3BZDA 1AS7A 3QHTC 1RK0B 4IJTA 5HXMA 5F3HB 4D8PB 1QRKA 3STLA 1LEIB 3S3DB 2H47C 3DJSA 4UTBH 2QVTA 5AAWA 3V4UL 3QS3A 1B6UA 1Z5YD 2X2IA 1VGKA 4OF0A 1UA3A 2H9GA 4I8DA 4DGUA 3TL5A 5KSBB 3PWPD 4QD2E 2V17H 1HNFA 1RIHL 1ZHBB 4ZUTA 3RTQA 3JWDL 4JFEB 1G9NC 1XEUA 2J56A 2UZYB 3D25A 3ZSSA 3FT4B 4JDZB 4M48L 4YIQA 3NH7H 2UX6A 5GS0C 5L2JB 1IGCH 2Z92B 1M6OA 1CTOA 4OI7A 2OXHA 2VM9A 1MCWM 1KCBA 3KNBB 2D31A 1F11A 1DQDH 1EK3A 3F04A 3SKOB 4JFPB 2W9DL 2CO6B 3HFFA 3MPCA 1OKEA 4RNRB 1F3RB 4UDTA 5F89A 5FHAH 4FXGA 3WI9A 5KYWB 1SXSA 4FCHA 4NKQB 3FU3A 4JHUA 1FZOB 2P7TA 4MS8D 2MFNA 4PJIB 2DQDL 2NSXA 2UZXB 2BERA 4ONFL 3EO1A 4X0KB 3QUXA 1QATA 2CUIA 2BWIA 1NFDB 2OX5B 1E4KA 3EH2A 2C3GA 1T1XA 3HBQA 4MQ7A 5HJGA 2DKMA 2OJZL 3TBTA 3D2UD 4MKMA 3L1GA 3C6SB 4TRPH 3SPVA 4YVUA 1DR9A 2DLGA 4G43B 1NPUA 2ATPA 4HIEA 5ICXA 4NO0A 1EDQA 2R1XB 2C3VA 3BWAB 1Y6MR 5DJAA 4XOCA 2NX5B 5DEGB 5C2UB 1F2XK 4ODWB 1R19A 3ZDXF 4B9YA 3VWJB 5KYXB 1O75A 2IXQB 1G7QA 4MKTA 3CX5K 4QRUA 4A1RA 1DBKL 5FGCE 1SVZA 2Z31C 4WV1B 4N22A 1JDCA 5F97E 1J1PH 5IMLB 4WI0B 3W5MA 3WFDH 3P2DA 2WCPA 1RZJL 3GZOA 3RWFB 1KB3A 4W6YB 4GFXA 4JY5H 3RY5A 4N8CL 3BKML 3LMJL 3I6LE 2A6DA 5CIPB 5GPRA 4EN2A 3KM2A 4G7VL 3QIUD 2QSTA 4ODUA 3UL4A 3WFBH 3CLEH 2B5IC 4OAWA 4QXGL 5I1CH 4EI5A 3H8NA 4LSRL 2NXYC 4DUVA 1A8ZA 4FFYH 2AKRB 4JUSA 4PJ5B 3IU4L 2AZUA 2X0VA 3G6JA 3MRLA 1JXDA 1HTYA 5GGSY 5I17B 1CDJA 2X2HA 2VDKL 2X0UA 4ENEC 3GRWH 4H8PA 3L5WB 4JMXA 5G4OA 2HUHA 2D4FA 4OB5H 4IGBA 3V0HA 3SDYH 1XMWA 5AZUA 4ZYKA 5LUMA 1HSAB 3E9UA 2KLSA 1JV2A 4M3KB 4UNVA 4E41B 4AVHA 3IGLA 4OCXL 3FQYA 2BRRL 5D8JH 4IIZA 5LAPA 5B8CC 4V2BA 4LQFL 1DQVA 1YNKL 1AZBA 4FLQA 3QRFM 3LRSA 4LASH 1PNCA 1S7XA 4JGUA 1NJ9B 2A9BA 3VD1A 1GSKA 1II4E 1P5VA 4PREB 4RDQG 2J2ZA 4U3CA 4PJXF 5T1MA 3SPIA 4APQD 4DW2L 3MN8A 3K8LA 4AUYA 5I66A 2BCMA 1V27A 3P77B 4JG0L 4QRRD 5F7WC 5HHQB 5IQMA 4HOXA 3L3DA 4FG6D 5HI3D 1PYWA 1JD9A 4HD9A 1KCRH 2YA0A 2CIKA 3SDDC 3SDAA 1MFCL 3L6FB 2IQAA 4Y2OA 4QWWD 1AI1H 1BD2A 1MCCA 1TZGH 4JX0A 3ES6B 4L3EE 4UYPA 1GTNA 1XH2A 3WN6A 4F7MB 2NY0D 1WZAA 3LPPA 5C6TL 4QTIH 4JDEA 4DGIH 3QIWB 3TBSA 4MB3A 4FQJL 1VAHA 1RIVH 2ORBH 3TA3C 1KBBA 1C1EH 1L0QA 4YGVA 1TTGA 2F58L 4H26A 1U8JB 5I71C 2WIIB 1NICA 3QQ4A 4W9FC 3O2WL 4Y5YB 2J71A 2VLRB 2EDLA 3V9FA 1JPEA 5SWSB 3W38A 15C8L 1WZ1L 4G1EA 1OAZL 1HKLL 2XVBA 2Q3ZA 2XY1A 4ODHH 1DQMH 1G0DA 3LKQB 3RKPA 1W91A 2FWOB 3KXFD 4RX4A 1BM3H 5E99L 4NZTH 2W07A 3MZGB 4R4BA 5IVZA 5I75C 5INCB 3ESNA 1DL7H 3MV7D 3PLYA 3EOYG 4NO2A 4Z95H 1CVRA 3MLZH 1HL4A 4WW1A 3S96B 4M7LT 4YGAB 4XOAA 3RU8H 2WLYA 1HHKA 1K4CA 1YEHH 1YQVH 5D2LB 2OMZB 3T08A 4PBWD 1WRFA 5CD5D 4OTXL 1IL1B 1N5YH 1PBYA 3DOIA 3HI1B 3SDXE 4P46D 1ET7A 2NTFA 3NK4A 4PWFA 2R2EB 3HE6A 5FYJE 2LU7A 2LR4A 1PZAA 1A3QA 3I50H 3P69A 5J57B 4RGNC 4NN7C 3H2WA 3CSYA 3HFMH 2YRPA 4OLWL 1AO7D 3ZHDA 4QDGA 5C70A 1E8ZA 2APSA 4EOWH 5FIEA 3EYUL 1OF2A 3O0RL 1P1ZA 3F64A 3SCMA 2ZX9A 5DHVB 3O9WD 5DVNA 1HESA 2ZUVA 5FHBH 1L5GA 4PJ8B 1N19A 3VW3H 4MCZA 1OW0C 2JTYA 1KCVL 1IEBB 4G8GA 3UO1H 1R3KA 2PPDA 3L4UA 1FC1A 4X4KA 3WNOA 4JREB 1IBYA 5D1QC 4I13B 1SEBA 2E9BA 2VDPH 4TUJB 3C2AL 1CGYA 1IC5L 4YDIH 1S9XA 3PP3H 1YY9C 3NABL 1VZIA 2QPDB 3KPLA 3KYAA 3DJ9A 4YDJB 1XGZA 1H3WM 3ZMNA 1J05A 3IDNB 2CBPA 4OQTH 1TUPA 3MA7A 1BQRA 2EQDA 2H2SD 2NR6D 5H94A 3LQAC 1SZNA 3GNML 4JN2A 5CN1A 1AR1C 1CLOH 1QABA 1X44A 4DWHA 1TCRA 2FHFA 2X4OB 2ZUTA 3ESVF 3M1BB 2FQEA 4DVBA 5HHOA 1N6VA 2PXYB 2FR4B 1EHAA 3IBEA 4HLZH 2HFTA 2Q7YB 3SDXF 2CRIA 2OTUB 3C12A 1N0XH 1CO1A 2EH8H 1P4LB 3CN0A 4D9LH 1OAYH 3OMAB 2DM2A 1QA9A 2NY6D 1OK8A 1MF2H 1FIGL 2EIDA 2HH0L 3O6FB 2X87A 3EH5B 3BWZA 5I16A 2VZ1A 4LARH 4X80L 3UEQA 2IH3B 2LTQC 4IMKA 2HT3C 3WNMA 1F4XH 3DSFH 5E1HB 2ICEA 5D6CA 2J1YA 5CD3B 1MVYA 3KVPA 3LS4L 2QZQA 1ZA6B 3D51A 2W0FA 2QVMA 4JO4H 4ZD3L 4CUCA 4CW1A 5C0BB 3PCYA 1J86A 2YOAA 4JFFE 1OO2A 5CXPA 4DH2A 5E9DE 1LP9E 1WCBB 3W0WA 2ZUUA 2DH3A 5AW9B 2FJFA 3HS0A 4HKJA 4QHUB 4ANWA 3DIFA 3SJVA 4UNUA 4GB9A 4TLUA 3DX8A 3LPFA 3WJMA 1AFVH 4I3SL 4JO5A 4NQCA 4X9FA 2H32B 1UM6H 2HN7B 3Q06A 3NFNB 5IBUB 4ZX5A 4YJZL 2HUEA 1HQ4A 1BQHG 4FFWC 5E5MA 1XCWA 4K3DL 5BS0B 2VLJA 3FRUB 2WN3A 3NJJA 4P3DB 3C08H 2IO5A 2ATKB 1GYCA 3LNFA 1C7SA 4NUQA 5CGYD 1D5BA 3GBML 4R7NA 3FSAA 1AKJB 2Z3FA 4YL4A 3DA0A 4V2CB 2WWOA 2J5LB 1OTTD 3O4OC 4Q0XH 4WLCA 3GIZH 1RKRA 1BHGA 3FUDA 3SHSA 1E8YA 1SUHA 2E7LA 2CJTA 4DGVH 1N2RB 2XZZA 5HYJA 1RUMH 1XAUA 4S0SD 4XMZA 3V5DB 3ILPA 3JWNH 3WY2A 2H5UA 5E5RB 5TD4A 1UB5B 4GKOA 4I4WB 3KYKH 5IVOA 2BH0A 2CZNA 1CGSL 3UAJC 1BFSA 3KPNA 4L0PB 3KWVA 3TEZA 4O5LH 4HIJB 3V2AR 2XA8L 4P5TA 3WGVB 4YNYA 5BOPA 3B8YA 2XIBA 2J7LA 4LCUB 1PQZB 1ZSDA 5FM5M 2FD6H 1TETL 5DZJA 5F7DB 5GS1A 3DGDA 2WYIA 2V3DA 4OIIL 4DPRA 2CDFB 3VFTA 2BRQA 1TZIB 3HVDA 5D1XA 1K4DB 3MREA 5FYKD 1W9XA 2XFXB 3C5SA 3C9NB 2AEQH 1MAKA 1U3HB 4Y4HB 5C0DB 3EH4B 2MOVA 1WFIA 5D71H 1I1YB 3BYTA 1EAQA 2PPCA 2VSDA 4YEFA 1RERA 2Y5TA 5EZLA 2GTZB 5IK3B 3ERXA 3CMGA 1T1WB 2ZYHA 2P3YA 4UB0L 3GZQA 2JV6A 4OLVH 3HAEH 1HC1A 5IT2H 1ZV9A 4C8XA 3R8BB 1U36A 3MRRB 3FOMB 4KPHH 2NY1B 2YN5A 1OGTB 2MPAL 3S3BB 4KX7A 4Y9GA 5LN4A 3GEFA 3VFVA 4YHZH 5I9QB 1KCUL 4P2QE 2C3XA 2OYKA 3CC1A 2XX0A 1N26A 1GC1H 5F6IB 2QSQA 4XVJL 1A4JB 5HI5D 4D0BB 4FFYA 2FB4L 3ECVA 3QFDA 1TTBA 4KXZI 1WE5A 3WKPA 4Z3JA 3WE1A 4ILDA 3B2DC 3GRWA 5CLYA 3TESA 2CHXA 4YWGL 1CFSB 3O11A 4JEGB 3DV4B 4QXVA 4Y4FC 4WFED 3E38A 5I24A 5E8OB 3VD3A 4DZ8B 1SBSL 1C8QA 1R0AL 1HE7A 1KFAH 4C56D 3W39A 2B1HL 1KIRA 1F8TL 3KLQA 4PJEA 3MRQA 2IEPA 3HN8A 4Y16D 4AJYV 1CF1A 4QRFA 4OD2B 4PWHA 4PMEA 1IFRA 3GSWB 3QJXA 4Y4KA 3LN4A 4Z3GA 3RWGA 3FU6A 1A6AA 4AJVA 4HS3B 1RU9H 3AY4C 5EEYA 2LV4A 1F4AA 3QDGB 3DIDA 2IBZY 4N5ED 5DJ8B 3WELA 5H35B 5EU6D 2VN3A 3FT0A 3EW3B 5D6DA 3UDWC 2RBLA 2BOCA 4C83A 1DUYB 1S6NA 2H0FA 1DDTA 4LSPH 1CF8H 4I0PC 3WAKA 2X4RA 4XN1A 5CU9A 4P3CH 1U2HA 3OKKA 3HNSL 1HHIB 4UMSA 3UP6A 4XMUA 1JGUL 1CLZH 2VXUL 1MG3C 5BO1L 1MZZA 5GRYA 1KYFA 3GMMA 4TVPD 3RNKB 5EU4A 1I1AD 2WD0A 2YMTA 3ALXA 1IAII 4G6FD 2CBMA 1NANI 3D4ZA 5D2NE 5LQBL 3DTUB 1WA0X 1UKTA 1DBBL 5JPNC 5DEFA 2C7UB 2J4WH 1U3ZA 4W6WB 1ZE3C 4MX7B 5JORA 3IKCB 1QI3A 4L4VB 3OSKA 3ZYOA 5CEXA 4WHDA 5AZEH 3FH5A 1MRCL 3CFJB 1TFPA 2DLHA 2JXMB 2YK1H 4PJ5E 3PWLB 4XVSL 1NDMA 3CFKA 1FE8L 4JPVH 2CLRA 2H41A 4OCMC 1TJGH 5LGJB 4JFDA 1S3KL 2WO3B 5E8NA 1TKWB 3VUAA 3N9GL 1IGJA 5FA4A 2EE0A 1WEJH 2X4TB 3GMLA 1U8OA 3V6OA 3NTCH 4K4KA 4GXUM 3PJSA 2WZPA 5HI4D 3OM3B 4XZ4A 3UOAB 2I60L 1E2WA 3C87A 4EI0A 1YMMA 2N56A 4WU7B 1OAUL 5CU5A 4L8BA 1OD9A 3EJZC 3KDMB 4GQPH 1NCHA 2WB1A 2WXIA 3U1PA 3VDBA 4P57B 2ITCB 1DE4A 3IN0A 2J8OA 5DT1L 4U31A 1GHFL 1K5NA 1CS6A 1ZS8B 4YK4B 3VWKC 5KYYA 6PAZA 1AE6L 2H6PB 1B0RB 2IFGA 1I7RA 5CBAB 4IU3A 3K71A 2QL1A 5AL8A 3ZVVA 5TH2A 3TO2B 1T0OA 3ILQD 4ZTPH 2EYSB 2NXZD 1J0JA 4KY2A 2I7SA 4YR6B 3D0AA 1MCQA 1M53A 4UT7H 6CGTA 5I6LA 2CDGB 3O3BB 1PLBA 2X89A 1Z3GL 3FT2B 4AW7A 2GEEA 2BSSB 2D7PA 3AG3B 2EEDA 4APXA 3DHPA 3QO0A 4BD4A 4FG2A 3IFOB 4N2FA 4PUBL 5F7AA 3B2VL 3HC4H 3GMNA 5GQBA 7FABL 3GSUB 1ZD6A 3D30A 5DJCA 4XP4L 1S9WA 4XRCB 4MJ6B 1UXWA 1A7NH 1U4FA 4MMYB 4P05A 1DVTA 5AVQB 4OF5A 2PYEE 4HWZA 3AXHA 2XC8A 4JDVB 1KXHA 1YPZE 3DRQB 5FW6A 1HKFA 2C1OA 4FXTA 5K9QI 4WO0A 1KN2H 1MJ8L 3X3FL 3FZUC 5KTEH 2BVQB 2DQGH 4R26L 4ZRGA 1FYTB 2BZ7A 5IG7B 3L5IA 3RFRA 3S4SA 3WTUA 2DWEB 3BD4A 5I15L 2DTSA 5J3HC 2H26A 4ZUVA 1QO3B 4X9IA 4F3FB 2WKOA 5EZJB 4XN7A 4F7CB 1U8HA 1EJFA 2MHAA 3D50A 4JM2B 3RX5A 5I76B 5TQ2L 4PLJD 2VZVA 1MQ8A 3PU7A 4LCCB 4Q9RL 3QEGL 4X9YA 3ISRA 4ELKA 1FG2B 2YXWA 2HG5B 2I24N 3BKCL 3NIGB 1YEJH 4JRXB 2ZNWA 3REWA 1JPSH 2AF2A 2AJUL 4U1GC 5EZPA 5BPPA 4A38A 3GM0A 3C8DA 5BOJA 5IHWA 4WUUD 3ZUNC 2VZ3A 3I9PA 1WIPA 3ECQA 1M1SA 4CVWA 3PQYB 3QJHB 4MS6A 3U6XA 3ARDA 2CUMA 2PCYA 1PZCA 3PGFH 4GIOA 1I3RB 1NCAL 1Q72H 1Z9SB 2L3BA 3VSUA 3W2DL 5IIEB 3FULA 2CLZB 3BYYA 3FQRB 3V4VB 4B0MM 4WF7A 4AKPA 2VZOA 5D5ME 3TFKD 1YY8B 3CDFA 3CFDB 2J8UB 3WFEL 5C8JA 1PSKL 3D0VB 4LGSB 3F7YB 4PJXA 1TQBC 2AP2A 1SNRA 4RIRB 4WNSA 4Y5XB 5T3ZE 2AK4B 3LAFA 2VSKB 3AAZB 3OKLB 1MCPL 1HH9A 3C5ZA 3KYNA 4QXTB 1G7HB 1VZGA 2OR8A 3UBXA 1QSFB 1MJUH 2OCFD 4TN9A 3TVMD 4UQBA 1Q9KA 3EH1A 1RUKL 3SYOA 4KFMA 5H37H 4YC2B 4W4OC 3ATEA 3FCSA 1UVQA 3MACH 5K9KA 1ZGLP 2OYMA 5DGRA 5E6IB 1OWWA 2DMCA 5F9AC 4RZCA 2G9KA 3WIIH 2UY6B 1WAPA 5B3NA 3V4LA 4KJYA 1T3FA 4KTDL 2N0KA 5DD6A 3VQ1C 4JHZA 4EJ1C 3WO3B 4PPTA 2CGRL 3C60B 3FHQA 3GMRA 4QRPD 1KLFB 5EEVA 3O45A 3C6LB 25C8H 3W9EB 3FSOA 1BMGA 4TSAH 2Y0SA 3KPQA 1R3LA 5DMGC 1JMXA 2NY2D 4ZAKA 4LEEA 4F9LC 1YC8A 3H9SD 3FBQA 3QFJD 2MTAA 4X7DC 3L3IB 4L1SA 4UIMA 3BQUA 1JHLH 3Q2LA 2XNAB 3NEOA 2YPVL 3EYQC 1VPOL 2HT2C 3A6CH 1SM3L 4X99A 3HG1A 5D7LD 4DP0X 1MIEL 4X7CC 1JZJA 3U30C 1FLRH 1OHQA 2X6CA 5HVWA 3U9UB 4GG8B 3LQZA 5C0BE 4UI2A 1F3JA 2X4NA 3BUIA 1OSEA 4N2MA 5ALCH 3FO0H 5F7MC 4AYBA 2H3KA 3HAEA 1HHHB 5D5MF 4FKEA 9CGTA 4WW2B 5I1AA 4NHCH 3GKZA 3MNDA 2B0SH 4P5RA 1D3CA 1O6TA 4I18B 1OM3H 2YOCA 4EVNA 2CXKA 1T1ZB 5EEWA 3MX0A 1RJCA 4JFQB 3H6JA 3HHSA 4ZS7H 5CFHA 2VDOL 4Y9CA 4Y2DB 4QRBA 4P5KB 5TFSH 3AG2B 3L95B 2VR8A 7PCYA 2W65A 1RURH 3KPSE 3OKEA 4YPGA 5CGTA 4QRRA 3LN5B 3NGBC 4MAYA 3K6SA 3RI5K 1CLVA 3OPZL 1OCZB 1UWXK 1N4XH 4O02B 3L2MA 3QIBC 4D0CB 4KKZA 3FQNA 3RGVC 2FE0A 4IOSD 2EDFA 3VYOA 4B5ZA 4G6KH 1XB3A 4X6DE 3TH4T 3H1ZA 4AV5A 4Z7QE 4MA7L 4M5YL 4HHGA 4LP8A 1MW3A 2X9YA 1XF3A 3SGEI 3T8MA 1D5XB 1MFMA 1YSOA 2NY5L 1MRDL 1BFTA 1V7NL 5A6MA 4JPIB 1UOVA 1JXJA 2KDGA 1KT2B 1P4IH 4MXWH 1J8HD 1RK1B 3ZE0B 1XH3B 4FQCL 3CHSA 2F8XC 2F8OA 5IJBC 2X4UB 2QSCH 3DVNA 4DAGH 4H0IA 3UXFA 1IGYB 4H8HA 5AOLA 1GS7A 4IOIA 4Y9BA 3M88A 4M93C 3PWJB 5I6PA 3T4AA 3CQQA 2B9BA 3EFFA 5J11C 3KW7A 3E6HB 5GS0D 4ZPTA 1QSEA 3LNHA 1SDDB 3DROA 4OJFL 5ELIA 1RAMA 1H0DA 3GHPA 4ZMNA 1LNUA 1NCNA 3V0VA 1IARB 2P49B 4R5TA 1LK3H 1OAKL 1TTRA 3MO1A 4R3SB 3O6LL 5KVEL 4WWKC 2MOGA 4Z3HA 5KS9B 4P3WA 3LPGA 3Q05A 3EUUA 4I77L 5B7MA 1NFAA 1MHEA 4L8CB 2AQ1A 2VDQL 4X4MA 3BI9X 2CWRA 1E9QB 2ED9A 4H8WC 1BAGA 2DF3A 4HJIA 3BE1L 4BHUI 4J3OC 5DQDL 2F8IA 2RMNA 4PS4L 3CFMA 3SE8H 4OF8A 5LNEA 4EXPX 1BGXL 2Z9TA 2COVD 2GJ6E 4K2UL 4NSKA 1N5AB 4WHTA 3AACA 1LE5A 4NIKB 5EBMA 1FAIH 2ZCLH 1TVDA 4KOBA 1MXDA 2Z65C 5IJCC 4K94H 1ND0B 4YSSA 3FFCA 5D7EA 1Y6KR 1LQSR 5IGXL 2I27N 3AREB 2G2RA 4K15A 2YD7A 3EYFB 4Z7QF 3G6AB 1Y0LB 2YMXH 4IYKA 3UC2A 3CVIH 1QFPA 3P3SA 3G5XB 4IRJA 5DSCA 1KNOA 2PUQT 1ZEAL 3OG4B 5DLMH 2BCKA 2DLFH 3V0IA 3RY4A 2VDNH 4JO1H 1V7ML 5CF3A 4R7DA 3T2NL 4LOFA 1KJMB 4WI4A 3K3QA 1KB9K 2Z31D 4NQTA 5FYKU 1LO2L 3MJ9A 1P5UB 4EMZA 1C08A 3ZZLA 1NBYB 5CNHA 4NXSA 1GL4B 1NCCL 3MYZA 1ETZA 2C1PB 1JZFA 3HA0A 3CK0H 3CLWA 1XFPA 3FONA 3GJFK 1J5IA 2P5WD 3GSQB 3IDJA 3BKJL 4ISVB 5ISZA 3T1WA 3MFGB 4X7SL 3VFSA 4A04A 1XCQB 1T5WA 4DJMA 3QI9B 4HC1A 4YAQB 3OLIA 1QLRB 5I8OL 4KRPB 5JO5A 1OGAD 5HYSB 4NNYA 2F18A 2PW1A 1DJYA 4BCZA 2TAAA 3ARUA 2OYLA 2G0KA 3B6SB 2J6EL 1I1FB 2K3HA 2KT6A 5I2IB 2NXYD 2BNRA 3TLRA 4GFTB 3K0YA 3ULSB 2Y06H 5DVKA 4U0QB 2M8XA 1ZAGA 2B20A 1J9RA 2EYTB 4ENED 4Q56A 4N2CA 1ZLSL 1ADQH 2DYSB 5AOIA 5D2NC 3M17B 3UTTD 1CD8A 1JHKH 2EDXA 4WI8A 1IGFL 1CDIA 4ODSH 2O5YL 3C5JA 4H0HB 4ODXA 4W9ZA 1UM4H 2AQQA 1OP5K 2PR4H 5CBEA 4G7SB 1QBMH 2BNQD 4K7FB 1E9OB 1H8OA 3A3YB 2PYFA 5FW7A 1NC2B 2AJZA 2MJWA 4I89A 4AV0A 5I0XA 1OGPA 2CA4A 2DQEH 4TTDC 5T5FL 3OL2A 1BVLB 3C8KA 1ZRUA 5CUSH 5E8PA 3MBXL 2Q76B 5EOCJ 1WZLA 4CC1A 2OP4H 1FDLL 3OKMB 2DI9A 5IEKA 3R4DA 2XG5B 1KEGL 3MRGB 1ZS2A 3CSFA 2OMWA 3ILEA 4RFOL 2HKFH 3TJHC 5T1LA 2WXHA 4R4FH 4AJWA 4GOSA 2BIQA 2WINB 3EFDL 4TOYL 3OV6A 2NCMA 5D7HA 1ET5A 1IAMA 2IANE 3I6GB 5DJDA 5I74B 3WV0A 1TJHL 3LIZH 1VADB 3SDDD 5HPMB 2A4ZA 1NCIA 4GSQA 3VFOB 4OI8A 5AD0A 4ZW8A 4CJ1A 1G1KA 1RVFL 1Z32X 3B1UA 4J6RL 1ZT4B 3DPDA 1B2WL 3U0PA 3UPRB 4P23A 4BCXA 1ILUA 4IBZA 5DVLA 5FC9A 1T6VN 3MTXA 1AVAA 1LO4L 3IMWA 5FYLH 2QADC 1FJ1B 1UWGL 3BWUF 2E59A 3H85A 1BF5A 2K0RA 3TA3D 5LCVL 3VMPA 3KPTA 1CYWA 2Z64C 2YD3A 1NIAA 2OS7A 4OZIE 2K8MA 5EA0L 3BZ4B 2XKNB 1MAMH 3L8QA 3U36B 5J1AB 3L16A 3J07A 2OULB 2FATH 4KRLB 4PR5B 3FF8A 1HSBA 4JKPL 3JVGA 1X9UA 4K94C 4W9EC 5HDWA 5E08L 2OXGB 1A1OB 1ED3A 4MBOA 2EUXA 2VITB 1CK0H 2H1PH 1RCYA 5HJ3B 1BZ9A 3LKNA 4N3TA 4DKFH 5DS8B 4U1MB 4YSCA 1BX2A 4FCAA 2WVVB 3C8HA 2YAFA 3RIAK 4ALAL 3MGTB 4Z7VA 2B4CL 2GKIA 5AB2A 2MCAA 2Y2YA 3ARFA 5C6PB 1T04B 3OHXA 3ZE1F 2NZIA 1FPTL 4X6EB 4FQ1H 1NAMB 1FNAA 3OG6B 3MVSA 3ARPA 3X3GH 1FFPB 5KYUB 4XN2A 2MQ0A 3O2VH 4DKEL 4RGND 3P30L 1G7JB 4JCMA 2XWZA 3U0TB 1QR1A 4GRMA 3V6BR 4ORGA 1ET8A 1NCUA 1DANU 2JJTC 2DLEA 1A9EA 3N0PB 3WSQL 1MCLA 2EIBA 4AGQA 4M00A 3DI3B 1KGXA 3WN5A 1RQ5A 1E5YA 2YGQA 3ARGC 3H7BA 5IFJB 1EEZB 1HEZA 4WO4A 5BXFA 2KPWA 4HS6A 4J6IA 4HF5H 1J48A 3THMH 4ONHB 2P52A 5IHLB 1KOAA 4FFVC 1QLFA 2NLJB 3WHXB 1F42A 1WHPA 4ZMLA 5A2BA 3RGBA 1DSFL 4JO2H 3B8SA 4XNBA 4IBUA 4NQSB 1NGYB 3R19A 2A9AA 3U2SB 3JV0A 3LXAA 5D1QD 4AJ0A 4B9FA 4LCWD 5GZOC 4OZIF 4KRNA 2KL6A 2MNJB 4I87A 5F0PB 1PY9A 1XTLA 2ZSVB 4TLKA 3S36X 1V55B 4Y19B 4S2SA 1SUJA 5DD5L 3RB7A 1MY7A 4A6YB 1YY9D 2DQHH 5DTFB 1THCA 5HDBB 2G4GA 3IM1A 4KVCH 3VFPA 3NA9H 4HUUB 3LH9A 3L17A 3QNZA 2R59A 3N44F 4JREC 3QULB 1CYGA 1YEIH 4K3JL 4OW6A 4XBEH 1N59A 5DGQA 5D9SA 5DZNA 3RDJA 3AMLA 3U0WL 5IQ9B 1NLDH 4LLYA 1AR1D 3S5LG 1OLLA 4JO3H 1P1VA 3BRFA 1YHPA 4HPOL 4WTXA 2XXCB 5KSVA 3F7VB 4RQQB 4PQXA 4P9HH 1FNFA 4AVIA 4NN5B 1KPUA 5BJTA 4PG9A 1RHFA 1W72H 4B95C 3G6DH 2GBAA 3I9GL 3LXUX 3L13A 1VERA 2PXYC 5C0CA 1IKFL 2SODB 1BOGB 3WFHB 5L9DH 5MEPA 3U2IA 4WK0B 2HT3D 5ACZB 4JDTH 4N2NA 2LLGA 4RWHA 6TAAA 3FTUA 4IW4C 2E75C 1BMWA 2ZX6A 4L8DB 4OZGB 2IV9A 4HGWA 2BSDA 1MN4A 2AEPL 3NQIA 3WXVL 2BFGA 3S2CA 1Q0XH 2XQBH 3B3IA 5EHFA 4HUVA 4YE4H 1TZHB 2JJSC 5IR1A 1IFHH 5L7XL 5JPMB 3X12A 1KMGA 2EDQA 4JY6B 2UYLB 4MJHA 4ZQKA 1A1MB 4PRIA 5CSBA 2MCMA 3S98A 2VMEA 3DX6A 3FQTA 2XTLA 5D7IE 5DR5H 1DFXA 1EJOL 3V0JA 3WJLA 4N0FB 3VXMA 3X11B 4C4UA 3RWIA 1P4BH 2PNDA 3MV9B 1NMCB 4PJFA 4MJID 4OM1L 5AB9A 4TM9A 1Z5HA 1YJDC 2ICES 4TNVK 3DX0A 1MHPL 4XPGH 3FCTA 3SPCA 3IFLL 4FFWD 3DRTA 4NAJA 1TZAA 3ZZ1A 3RWJA 1CTNA 5GGSB 3NJVA 1OL0A 2GFBA 5HYQB 2QTEA 3BD3A 4M43L 1XSJA 4EIUA 2V9RA 4F7EB 1UCBH 3JSSA 4NM4L 4X83A 3JV6B 5C0JB 1NGXA 1O0VA 4J3SA 3GMPA 2E5EA 3R06A 1RZIA 4C4KO 4KZEL 1FVCB 5GS2D 4HHAB 1RULH 5KG9A 1SJMA 3DGGB 2IDFA 3LSOB 4OZHA 2BC4B 4LHUD 3S34L 3MLTB 3VM5A 1FNEA 3RPKA 4IRSC 3V9EA 1T20A 5FGBC 4Q97A 3DX9B 3UAJD 1Q9OB 3IB4A 5E70A 5DHYA 1MHCA 1NCDL 2A1WH 2E9JA 3KLHC 3TN0C 1F4YH 2DTMH 4FNLL 1ZVHA 5AEAA 4Z7WF 4ZX6A 5I8KL 4H2CA 7TAAA 3L7FA 4LEXH 3O3EB 4UT9H 4L29B 1A7OH 1PW3A 1I8KB 2EEAA 2TRYA 2VXTH 4PJ9A 3DMMA 3TIEB 4A2EA 1WD9A 4DHLA 2ZSWB 5A1AA 1I8IB 2YGPA 4P4RA 4XWOC 5F0MB 5GHWH 5KVMC 5L88L 5DUPL 3FFOA 2P24A 4GKZB 2DL9A 1SLVA 1G9NL 3WIAA 4ZMXA 2R0WL 3UFIA 3NSDA 2OMTA 4AQ8A 1ZTXE 5D7IF 4BFFA 2DD8H 1FAKT 3MUGA 3OD3A 2F54B 5IQ7L 4IK7A 1Q9LA 2LLLA 4PEEA 4YBHA 5C09A 4NLAA 4X98A 2Y36H 3HTLX 5EIIA 3CN2A 4Y4HC 4W9LC 5E00A 4FQXA 3ULVE 3TGXA 3UZEC 4OF7A 1DO6A 4ZO8A 5AOJA 2V2TA 2XWTA 2D03L 2YC1B 4J4PC 1XXDC 2APFA 5JXEC 1HU8A 4N6RA 4QHNA 3V7AE 3RFZC 1JBJA 3SY0B 4YSUA 1FNHA 4HJGA 4NT6B 4GRLD 3AT8A 2GJZA 4PB9H 3OZ9H 1MAJA 1YMHB 2FYVA 3DURB 2NY1C 4HOZA 3L5XH 2XFGB 3UJJH 5HGDA 1CICB 3H42L 2GUYA 3MRHB 5IV2B 1F58L 5I9QC 2F0CA 4AGPA 1S3RA 1ADQA 4L5FE 1AGEA 1EANA 4Y4FD 3VXPB 3EFOA 1PTZA 1MRFL 1YNLL 2DZEA 2XTJB 4MB4A 4OT1H 3RDTB 2YMOA 5F6IC 2QQLL 5TE7L 2JF1A 2JE8A 3KHOA 1QZ1A 2BDNL 5EO1A 2VLLA 1S46A 2KH2B 3ABMB 4PFEA 4EZJA 2AK1H 5BVJA 2KI6A 2HRPH 5T3XE 1ERNA 1TVBB 3FS9A 4URKA 2AS5M 1RPUA 1OE2A 1BEYL 5GGTH 3ARVA 2VRAA 3TBVB 4YHKL 3T71A 1EO8H 4ETQB 1B0GA 2CUAA 3F58L 4OFYA 4XCEB 1VHPA 2DJMA 2XN0A 4QHKI 43C9A 3SGJA 2UV3A 4O9HL 1BOYA 3FYEB 4F5CE 2CE6A 4RMBA 4WU5A 1H8NA 3ZKNC 3LPWA 1YN6A 3ZDZF 4UQDA 2CCWA 4MVBC 3AROA 4YDKH 3IXTB 3LIZA 3QRBA 4I0PD 1AGDA 3CLFL 3V5KB 1E27B 3GM8A 4WKZB 3VACA 3FAWA 1D6EA 3MFFA 1KENH 1WTLA 4P0DA 4XNZB 3L9RB 1BF2A 4UTCA 5I8CA 4CVZB 5A2KH 4KV5E 4N9OB 5I6KA 3RVWC 5B39A 5IHZA 3BWUC 5L2KD 2AVFA 1PIFA 2F53A 3CSBA 4DN3H 4D0DB 3D1MC 3DOHA 3PDOB 4JRYE 4LBAA 1TQSA 4NNPH 2Y3NA 5EPMB 3RA7L 5ENWA 3TVMA 3BDBA 5L4FA 5DI8A 5LNDA 1LM8V 3TBYB 1GGBL 2BVPA 3ZT7A 1RUPL 2I9TB 4XXWA 5T1JA 4G8FA 4I9WE 4L37B 3MV11 3UTSE 1XH0A 3UYOD 4FC3E 5DJ2A 4X6BB 5I1HH 3LH2H 1T2QH 1CIDA 3SDCA 1S7SA 3FUJA 4UTBL 4GXVH 3B1TA 4G9FA 5B4MC 3DOSA 1RZKH 2YQBA 5I5MA 2VW4A 5KBNC 3OWEA 4F57H 5D4QA 2R2BA 4QPEA 1FV1B 3UTZA 1W16A 4QOKE 5AOKA 4K5NA 1MCOH 3QAQA 2OMVB 3MGOB 3T4YA 4OFDA 3HPJB 4LRNH 3S35H 2R29H 1XEDA 5CJXA 3NH7L 5I23A 1H6FA 1IGCL 1P7QD 4UINH 4BUQA 2C4FT 1SFDA 2ARJB 3EJZD 4W93A 2VISA 2N59A 5HHME 3BHBB 5FHAL 1OOWA 2Y24A 1E30A 2XWDA 3AXLB 4JM4H 1CLYH 4JCWA 5SWZB 2BSTA 4LL9A 4UANA 2AEOA 1DQQA 1JF1B 1H3UA 4KNQA 5D72H 5D4HA 4G5AA 3TNMB 3VWKD 4KKCC 5MEQB 3U1SL 4LHUG 1CR9H 1KG0A 4LLMB 4L3ED 3NSYA 1BQUA 2P44B 2W88A 1EERB 2ZYRA 1CD9B 1R5IB 3FTZA 1BWWA 3NP4A 4UM8A 2XT1B 5CGMA 2Y7QB 3P9LB 4Y1AE 3MHZA 5JQHC 2CHWA 3HUJB 1NKGA 4YK4C 4TRPL 3FAXA 4N0CC 3MC0A 1PFOA 2WB7A 1RP9A 5CMAB 4NJAH 2BNUB 4PP2B 2WLJA 4FZEH 2R23A 2Q6WB 1V5JA 3WDIA 1I9JH 1MUJA 2BP3A 3IGAB 5EULV 2VR4A 4LNRB 2EXYC 4WTWA 3NCEB 1ZSHA 1K8IA 1A0QL 3RB5A 2J1ZA 3F84A 3OF6A 1Q0YH 2XV2A 2AITA 3EGSA 4L9LB 2JCCF 1J1PL 1SYVB 2UWEF 4NFCA 3UBFA 3GMQB 3WFDL 5BRZB 3QUHA 4HUKB 4JY5L 1X6LA 5I6MA 4NQEA 4KJPC 1GJIA 3FZUD 3BISA 1Q94B 4ES8A 1J8HA 4CMMA 1NBVH 5BQ7B 2W1NA 1OP3H 2EKSB 3BT2H 1I8LC 2EDMA 3NSFA 3SD2A 5FYJD 3WFBL 5J3HD 4N8VB 4KTYA 5I1CL 5CEYB 3LNIA 1GGIH 2XN1A 4FFYL 1ZJAA 1W72A 4PGEB 4HK0A 4EF3A 3AABA 4N5UA 3QJQB 2GVYA 4GUOA 2WLNA 1EUTA 4W9GC 3GRWL 1PAZA 3ABKB 1MFBH 3DX7A 3P0VH 4S11A 2IIJA 3VXRE 4HIIA 3MLUH 4OB5L 3SDYL 3QUZB 4ZW7A 3L2LA 1AR2A 4WI2A 5FKAA 3REVB 3WIFA 5D8JL 2QDWA 3D0LA 4FLHA 4JPKH 5AG8A 4AENB 4KMTL 1BBDH 4WENB 1WBXA 3VXNA 4RMWA 1T83C 4LASL 4P2RB 1BQKA 4OZ4B 5KZCD 3EO9H 1KIQA 4KDTA 5DD1H 2Z35B 1R5WB 3D39B 4MFHA 4UILH 4UZUA 1FGNH 3B34A 5E1AB 1C5CL 1Z9PA 1U3JA 4NO3A 4QUOA 5JA9A 1E4XH 4Y19E 3RI5F 2AABH 3V8CA 1QLEH 4YVNA 5DRWA 1J11A 3HIZA 4F20A 1KCRL 1XF2A 4NAMA 3U6XS 4IJ3B 1DVFB 4KI1A 3VTTA 1ZTXH 3MBEB 4FNSA 2Y07H 2WBKA 3HZYA 1QYGH 2P42B 5FM4A 1NBZB 4IBQA 1AI1L 2XV3A 1TZGL 2X4QB 1IZKA 2X1XR 4OGAC 4NYLB 1L0XA 5ESQB 1LE9B 3ARBA 2Q20A 5IB3A 2PPAA 3VXUE 3BVNB 3GFUA 3UIYA 4S1SH 4PY7B 3ROOB 1IQDB 1CGTA 4PJ7E 3O3DB 4Y5XC 2ZX7A 4QTIL 4DGIL 2ADYA 2QHRH 1NFIA 3CVDA 2QVKA 2ORBL 4Y2NA 1C1EL 4GXFA 3WENA 4E5XG 2DM4A 1J7VR 4QY8B 1FVDB 4K7PY 1QBBA 1TZOA 4YC2C 5F7NC 4K9EH 3P02A 1G7PA 2IDUA 4YBQC 5DMGD 5ABAA 5JW4M 4ODHL 4XNMB 1GKOA 1DQML 2XV6B 1UJ3B 2VXQH 3H54A 3OXRB 2WUCL 2JKRM 2ITEA 1BM3L 4JMNA 3MUUA 3K46A 4F58H 3EYQD 4U3XA 1TOXA 2HT2D 4A7GA 2Q8BH 3DDGA 4Z95L 4JZNA 3G5YB 3MLZL 2DQJH 4JFFD 3RU8L 3D2UB 1YEHL 5E9DD 2ZAGA 4J39A 4FA8A 1N5YL 3QWRA 3KGSA 3GIVB 3QYNA 1XZWA 2COQA 1IJ9A 1KYDA 3IDXH 4XT1C 1JXKA 1P0SE 2WLIB 2AJSH 1N7MH 4C58B 1A14H 3SKNB 3WO4B 4LNVA 5AOMA 4K8RH 3WLBA 1UB6A 5C0AE 2BNQA 4GNKB 4RZKA 1A4KB 3I50L 3QUYA 3CZFB 4HKZB 4MWFA 4EQ2A 5E0FA 1KXVC 2XETA 1U8LA 1KJVA 3HFML 2FAUA 5C86A 3OXSA 4AYGA 3D2TA 4V11A 4OUUB 2IANA 2DIBA 3INUH 3MRPA 4L48A 1W8EA 2BP5M 12E8H 2OTWB 1KIUB 4WW2C 3RQ3A 4QO1B 2CKNA 4OCYH 1FBIH 4FZ8H 2FIRT 4N90D 4WJ5B 3TZVC 3OAYH 4O00A 9PCYA 5FHBL 4W4NA 4XMVA 4Q9CA 3CU7A 4PJ7F 4I18C 2WWKO 3FQXB 3MJ7B 3QQDB 4Y7MA 4BSWA 3VW3L 1B4RA 3QIBD 1BDYA 1P2CB 4GUPB 3RGVD 5F1NB 3UO1L 3BH8B 3VFNB 3L4XA 1M7IB 1M7DB 4O51A 3ROLB 2VDPL 4RAVA 5I73C 5FCSH 2UZIH 1X4ZA 2WXKA 3CDGA 3T09A 3NPSC 4BE6A 1Y7VA 2SEBB 3FB8B 2BHUA 1QFWM 1N70A 4YDIL 4GBXA 1JZGA 4MRCA 3BMWA 2GTWA 3SQBB 1L3NA 1IB5A 2P1YA 1RJYB 3MROA 2XWEA 5GGTA 4OQTL 4FADA 4ZTEA 1DVXA 4FGMA 2EXWC 3H9HB 1KTBA 1JDAA 2D3JA 3DVIA 4KUCF 2YD9A 4TLTA 3TA4D 1CLOL 3W9DA 1G6RH 4XB8A 3GZKA 3GK8H 3CH1A 4XE5B 4NM8H 3P40A 2X6AA 2GITB 1U6AH 2WPGA 4XNXH 5K39B 5KSUB 2CO2A 4AI7A 1N0XL 2VQ4A 1ULVA 1PVHA 1WHOA 2EH8L 2YUZA 4WWKD 2ESVA 5PAZA 4D9LL 4EPSA 5J8OA 1OAYL 3ULVC 1AIFB 1MF2L 2D3VA 2FWUA 2WW8A 3KVDD 2E9WA 4H20H 4P2QD 4L0ZA 3BPNB 2NDGA 1FN4B 4NLHA 4YZWA 2E8YA 1F4XL 3DSFL 1SOKA 2MKLC 5F70A 4GI6A 5ICUA 4J3OD 1F1AA 4NP4H 5D1ZA 3A4AA 3H7LA 4N2HA 1BQHB 5E2JA 5FGSA 3FFDA 4RSVA 2O6EA 1ZT1A 5F2FA 1M4KA 2MRYA 1D9KA 2NY0B 4JO4L 2EZ0C 1JYNA 2FCBA 5ESAB 3G5VB 2JB6B 3T5WA 2DM7A 3WDHA 2PPFA 1AGFA 5BW7C 1E67A 1HFUA 2GIYA 1Q4NX 2XTJE 3FU7B 5C9JB 5JLZA 3EOTH 3FO1A 4G71B 1VFAA 4M6AA 2EEFA 3V4PA 3NOIA 1KXTB 3R4RA 2A3TA 1AFVL 3JZ7A 3QG6A 4I5BA 3VD7A 1UM6L 4WI5A 3ZKXB 3QDJE 2R29A 2WTRB 3FO2A 1UWXH 3FL7A 1KPVB 3L3OB 4K8RC 3KXFB 4NZFA 1FZMB 2E4FA 4AMKH 5HVFB 2CKBH 2H8PB 4OCLC 5GS3A 4NKMA 3C08L 2FJGB 4B9PA 2DIAA 3UPCA 3MV7B 1J5HA 3GBNL 1F45A 3EGDA 1PX4A