1NCOA

Structure of the antitumor protein-chromophore complex neocarzinostatin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
113
structure length
113
Chain Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYDVGQCAWVDTGVLACNPADFSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of neocarzinostatin, an antitumor protein-chromophore complex.
pubmed rcsb
source organism Streptomyces carzinostaticus
molecule tags Antibacterial and antitumor protein
molecule keywords HOLO-NEOCARZINOSTATIN
total genus 17
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 1ncoA00
2CBTA 1AKPA 2G0KA 4JW3A 1J5HA 1HZLA 2G0LA 2CBMA 1J48A 2CBQA 1J5IA 1O5PA 1NCOA 2MCMA 2CBOA 1HZKA 1NOAA 1ACXA
chains in the Genus database with same CATH superfamily
3CSYA 5F96L 1JZGA 1L7IH 3NQKA 5HGBB 5IVXB 3M1CA 4HUMB 4TS6A 1SLWA 3D1MC 1P5VA 2UWEF 4OLWL 2YBGA 2QV2A 1FAKT 2ZONA 1LEGB 3CN1A 3DX9A 3EYQC 3RP1A 2BOBA 4KFMA 4GBXB 3BP5B 1WBZA 2OMYB 3BKYL 1CTMA 2WQRA 2XJLA 4L5FH 3SDCD 3T0DA 5KYUA 1OM3H 4UUJB 5D4IA 4J3SA 4AYSA 4D2NA 4NQVB 5CINH 5HHME 4Z95L 2J4WH 2R2HA 3NSXA 5F0LB 2DQIL 1L6ZA 3B9VA 1WLHA 2YUVA 4WO4A 5AD0A 4YIQA 5D7IB 4ELKB 1TPXB 3GIVB 4FXKB 3UG3A 2CK0H 4R8WH 5IVXF 1A7NL 3WMQA 2WXNA 5GXBB 3TA3A 1J0YA 3QWRA 1XX9C 3F7VA 4JG0H 5BO1L 2ERJB 3FU9A 5G5DB 3TEUA 1UXLA 2ID5A 4OZFG 2EECA 4PW9A 3QWQB 4OGAD 3FU7B 2GAZA 4OT1L 3AROA 1RUPH 2DW5A 4MJIB 2OQJA 2X0WA 4CRPA 4HVBA 1UKTA 3B9KA 4X50A 1UUNA 1U36A 1D7CA 1HS6A 3WJMB 4C56B 2NY4D 1WVZA 4FQQB 3L5XL 2R23A 2X4QA 1MLCB 2D73A 2WLIB 3U30B 1ETA1 4HWBH 4L8BA 3HE6B 3UTQA 2NLJA 3ZTEA 3NPZB 3QXTA 5C0JB 4QAWA 2MPVA 2P28B 1YYLH 5HHVH 4I85A 2DMKA 2VN4A 2G30A 3DJZA 4NNYA 4JY6B 2WXOA 2H0JA 2XWTA 5JUEL 3GNML 1JMZA 3WJLC 1H0DA 1EO5A 3JZ7A 4NFCA 1UOWA 2P26A 4G80B 1C9SA 3EYUH 3HCVB 3QE5A 5F7YC 1D5MA 1RUAL 2HYMA 1HVXA 1QKZL 3QEHA 3MRJA 2IIJA 4X8JB 1EBAA 2BCKB 3QJHB 5BMFH 4ENZA 1RZ8B 2ED8A 3VI4E 2LLNA 3ILPA 4KK5C 2VQ1B 3K6SB 4CVZB 1ILUA 3GGWB 1UXSA 2HMIC 1CU4H 3EGXA 4LCIH 4PJCE 3UTSD 2ESVD 4Q9RL 2FAUA 2Z3FA 2JQMA 3A4FA 1ZT7A 4WI6A 4IBTA 1OP4A 2H1LM 2IADA 1R46A 2X7LA 2X42A 1EV2E 1KLFA 3ESOA 4JLRA 3T2OA 1S7VA 3KLDA 4XVTL 2Z65C 4O4YL 3THMH 2BLFA 1B6DA 4GS7C 3B7SA 5DTFA 1G94A 2Y24A 1OT2A 1EXGA 3O3DB 4KKBC 4KRMB 4XT1C 5SX5K 1F41A 4PP1D 1MCLA 3MRCA 4BCYA 4Z78B 3QZNA 3FT4A 4GBXC 1RFDH 1UXSB 4CL7A 5AKRA 1DUYA 2CLRA 1PZCA 4RFEB 3MBEC 3NIDB 5FW7A 2PUQT 1DANU 3HW7A 5EUKA 3PIQB 4JHVA 5TDNB 3ZKSD 5ICUA 4LSUL 4F2EA 2F9BT 4N8CL 3U6RA 1JZ5A 1NGXA 4DK3A 5C0RL 1VEOA 2ICEC 3O0LA 4JE4B 4ZUUB 2F19H 2AC0A 3EYFA 1KIPB 2NXYB 1TMQA 4OZHE 1ETJA 3TXAA 3CVCA 1EA9C 1YPZB 4HW6A 1PLGL 4KDTA 1KFGA 3ARBC 1JZHA 4IRSD 3OZKA 1FG2B 1UT1A 3OSKA 4LSTH 2R2BB 4TUOA 2M2DA 4TNVF 4H8VA 2Q86A 3UL4A 2R4SL 4M56A 3P3TA 5B21A 2PP9A 1QASA 1O6VA 2EEXA 2MCAA 3HAEB 4NWUH 2CGRL 3CFKB 3PP3H 3BP6B 1IGIL 3G6JF 4G1MB 4Q9QH 43C9B 3VXNA 1EIBA 1PD6A 1IAIM 2ODIA 4WU7B 3EJPA 4W9JC 1YY9C 2YRBA 3KGTA 1LK2B 2GVYA 3TBBA 4UV7H 2J57A 1U3YA 3VFRB 1OCRB 5C08B 5AW9B 3QUZC 2DL2A 4LFHG 5TPWH 1UM5L 5EO1A 1EAJA 2FH6A 3BVTA 4JANB 1JNJA 3GMPB 1BLNB 5GISH 1WD9A 2Q8BH 1BQHA 1MFCL 2DEYX 1NQBA 1FDLL 4F20A 3I84A 3BLKA 4NZUH 5DR5L 3QRGL 2DH2A 2P52A 3SKJH 4KHXL 3AM8A 1GY2A 4IRJD 2J72A 3HE6A 1ZIAA 5BRZE 3T8XB 2HVKA 4HAFA 4X8XA 2OMZA 3BAEL 3MNVA 2G5BB 1KJVA 3RJQB 4I3SH 4TN9A 1IGIH 3GXFA 4IKNA 1CDIA 1U91B 2ZAHA 4OCSL 2NY6C 4XN8A 3ZPDA 4FC3E 1X7QA 2FEJA 3AB0C 3KPQB 2RGSA 4NWTH 5IFJB 1KTJA 1Y1UA 1M71A 1R3JA 1V3LA 2W94A 4YHPB 5DJ8B 1M56B 3KPPA 3GSWA 1IBDA 1UD5A 3HCVA 3CDCA 4IRJC 1T5XA 2WUBL 1I1YA 4PSPA 3CDYA 1LO5A 2X38A 1BXAA 5GGRY 3FT1A 1OP5K 2AQ3A 1CBVL 2FLBT 1J12A 2I25N 2KZBA 4RAVB 4LPUA 2OL3A 2Q8BL 3B8YA 3UP1A 4LDEB 1MI5B 4WTZG 4MJJA 3JWDC 4JJHA 4MB3A 1S78D 3O2WL 3RWEA 4PH8A 4I9WE 3G6DL 3KS0H 43C9A 2E74C 3JWNE 3V6BR 3Q1SL 1QI4A 4ICXA 2CCWA 2JV6A 2B2XL 2OLDA 4JPIA 1JPSL 4X4ME 4CN1A 3TX4A 1NLDH 1LO4L 2RFXA 4JFQA 1KLGB 4NXSA 3SBPA 4AKQA 3VU2A 3VQLA 3ROOA 3TBYB 3RVVC 4FA7B 3N85L 2P3YA 1KJ2L 2K3TA 4OF5A 4ZQTA 3FONA 5I8KL 4G8IB 4OCXL 4JO2L 3BQVA 4B95C 2G4GA 2COQA 3PIQA 3U0WL 4Z3EA 5JORA 2G5UA 1IZKA 3HZMB 1UEMA 4CC4C 4PRHA 4ZRGA 5HHOB 4QRFA 2XHNA 2IANE 5IB2B 5T3XE 1NGYA 4G7RB 1KJVB 1TMCB 3S37X 3FT3B 4LCYB 4MXVE 5I1EH 3CPUA 3BAJA 4O4YH 3VFOA 4WI7A 2A9AA 3VD9A 3CFBB 4EN3C 1F90H 3IPBA 4MCNA 1Z9LA 2V3DA 1G0YR 3I85A 2FSDA 4LCWD 2Q86B 4F7MA 1QVOB 3DVGB 1MCHA 3QDHA 5FA3B 2AEQL 5K59E 1J5OL 2RCSH 2VMFA 2WWKO 5FM5M 4E41E 3UO1L 2XV2A 1KJMB 2DWDB 3LZNA 2WZ0A 2GTWA 5ECJE 3EGSB 5B38G 1QSZA 2WXQA 4N6RA 1REIA 5HHOE 1T0NA 1WCBA 2E8ZA 3FT3A 4LCYA 2OYPA 4M48H 1MAJA 1XGZA 1U42A 3EJYC 5GRVK 4FXKC 5GS0H 2X6CA 4LP5A 4IK6A 4LCIL 2OA9A 2YXMA 1W0VA 3BJ91 3HZYA 1OHZA 1I53A 2PCYA 4L8DA 4JPSA 2BY1A 3RTQB 2FQFA 4AVHA 4EUPB 1SUJA 3F5WA 4G6KL 5HHMB 3UJIL 2UZXB 4ELMB 1ZV5A 4G1EB 4CW1A 1FE8H 3RGVD 1G7PA 4ODSH 3WNNA 2IAMB 5K39A 5HDOA 1HQ4A 1RZ7H 3ZE1E 5IJDC 3CXHK 5JIKA 3KCPA 3MLWL 3X1NA 2JCWA 5K9KA 4G8EA 1UM4H 5C86A 3ARFA 4BWTA 2JE8A 4HIEA 4CKQA 2ATKB 1CK0L 3NIGB 2X9WA 3U30C 1DQJB 3IXTB 3KPQA 3UGEA 5IFJA 1CFTB 4PV1C 3S2CA 2QT6A 1OP3K 1YN7A 4O51B 4XHJC 4E9XA 4R7XA 1OM3L 2AXFA 1LYQA 1NEZA 1ADQL 3LKRB 4YHYC 3ATEA 2C9PA 4L4VE 1Z6JT 4PY8J 5E6SB 4B7IA 4ZW5A 1AXSA 4UDUB 4BJLA 3ME0A 5J0BA 1IC4L 4PY7B 4UAOB 4RAVA 3MN8A 3A3YB 4AVIA 3BP7A 4FXGC 2YAQA 5C0AE 1A4BA 1IAIL 1NCIA 2H9GB 1IFGA 1GL4B 3N41B 4IU3A 5EZIL 3FRPG 3QG6A 5TDOA 4KMQA 3CLEL 1H5BB 5DDHB 3L8QA 3NZ8A 2WANA 4NUJB 3PL6B 4XRCA 1W72H 5EO9A 3C2AH 4H4NA 3LXBA 2AJ3B 2YQ3A 3CFTA 3GEFA 5B39G 4GG6A 4UQDA 2X53A 4Q4IA 2AXFB 2DEWX 3ZKXB 4BFOA 2VQ4A 4PTUA 4LZKA 4OIFA 3KCWA 3LCYA 4M1CC 3UERA 3F62A 2XN0A 4IGBD 3SD2A 3M46A 4OGXL 5E6ZA 2WZ5A 3W3BA 1JTOA 4NKMA 4W81A 5BCAA 5BV7L 4PD4K 2QVTA 1AKPA 2Q76A 1I4FA 2LW3A 3GTTA 4FE9A 4WFGE 5F3BB 5L8LB 3VD2A 1FGNL 2AHIA 3L7EB 1U3HD 2XZAH 2B3IA 4D9RE 4DJMA 1P7QA 4X9HA 5A3IC 1VSCA 5D93B 1BFOA 5DHXB 1I3GL 1DTUA 1TETL 5SWZB 3HJEA 4ZS7L 1JZEA 1KIRA 2LLLA 1FNHA 3B9AA 2VSDA 4JFFE 3BP4B 5EF1A 2FVNA 1MW3A 1PKQB 2C9UA 4NKDB 2F68X 5JYMA 4U4IA 7FABL 1KDJA 1DVFD 3UTOA 4NKMB 1MCPH 4K3EL 3S96A 1XGYH 2C9XA 2FRGP 1O6SA 4NQED 4ONHA 2BC4B 5HI4C 2BVEA 3MQIA 12E8L 4OF0A 2IGFH 5D1XC 4Z7VA 4TLTA 2JJTA 2VL5B 4M00A 3NYKA 4P9MH 3PXJA 4KKAC 4OLXL 4PRAB 3C8HA 2PN5A 4TV3A 2QJDA 4IRZH 4I1RA 1RVFL 1XSKA 1MHEB 2QEJA 4ZUVB 5FYJH 4LAQH 1OP3H 3V0JA 1MNNA 3CFUA 4TNWK 1XH1A 4N87A 3WENA 4LSDA 3K80A 1F6LL 2OK0H 4LESA 4A67A 1PX3A 3CXHJ 4XO5A 3ULVD 1U3NA 1DE4B 1I7UB 5MEPA 4E42B 1EHNA 2HG5A 4XCFL 3F5WB 4AQ1B 2BC4A 3G04B 4RWHA 5JMOC 2APXA 4JGUA 5DZJA 4LCUA 3HPJA 1KELH 3MKGA 3JV4A 4W9CC 1M6OA 2GCYB 4ZFFB 3WO4B 1CC3A 1OKEA 4NN5B 4OW6A 4Y19E 3IU4L 3LN4B 4P5KA 4IS6B 5IW6A 1BXVA 2EQDA 3KPNA 2DMCA 1WDAA 5LHDA 4QRRA 4HDIA 2KHAA 2VDOH 3F01A 4ODUB 1AD0B 2H6PB 2KQMA 3FRPB 4RSVA 3PU7A 4U0RC 4ZPTA 2XNAB 1F5WA 4M61B 3L3DB 1BD2E 4IRJB 1HH6B 1DBMH 4NO5A 2KS0A 4FFZL 5FYKL 4W4OA 4YHKL 4PJHB 1A6ZB 2R9HC 4A66A 1AH1A 1W6LA 2R7EA 2AJSL 5HDQH 5BNXD 3MUY1 4F3FB 3CSBA 4KMTL 5ESVB 4G42B 5CGMA 3OD3A 4NRZA 4LCVA 5IESL 1XR9B 1G7QB 3U4AA 3PRZA 5KYXA 4NHCH 3S2AA 3IBEA 2EXWC 3KD4A 4ABUA 3PL6A 3VAEA 4LEOB 2QVMA 2YXFA 3T4YA 3MXWL 2WBJB 2I9TB 4TTGA 4P9HL 4EIUA 4PJXE 3V0WH 1AGFA 3IJ7A 3BZEB 2HPTA 4Z7OB 3QR2A 3HMXL 4XN2A 3EXLA 1BCIA 1AGEB 3ABGA 3CX2A 4Z5RB 5IR1B 4Z77A 2XZAL 1YNLL 4FL4B 4N1CA 3FUJA 4ZMOA 1F2XK 1JCKA 2CWRA 2YD9A 4I18A 5G55A 3K2UH 5BXFA 1M4KA 5CLYA 3VM7A 3AY2A 5D6CA 3T0EB 4UTAA 5FHBL 4F8QA 1M1SA 1XF4B 2WIIB 3HI6L 2EILB 2VN5A 3Q2NA 1BF5A 3HG1E 4G8GA 4HUXA 3BC9A 1AOHA 4BIKA 3DMMB 5KJRL 3GSQB 2QELA 4OZFH 3BAIA 1BFSA 5EU6B 3AS0A 4XZ4A 1JPFB 3QJXA 1AD0A 2H6PA 5GS3A 1H0DB 1OD7A 2FJGB 4KKNA 2GJ6B 2I24N 1J05B 2E9BA 3MOBL 1DJIA 4LXFA 5AUMB 5BV7H 2FB4H 1ASPA 6CGTA 1SNRA 1RZKC 3CXDH 4JPQA 4RSYA 3MNZA 3L3OB 1IT9L 3V4VB 3UXFA 1DJYA 3F6LA 5KAQG 3S36H 3BWUF 1JNLH 4JM2D 5ABZA 1F3DH 4FXGA 6PAZA 4G9FB 1MN4A 4FMVA 5ESAB 1SY6L 4HIJB 4KKPA 4M7ZC 4V2CB 1TTCA 2F1AA 3T3ME 1JZ6A 4C83B 3BRDA 4MD0A 3DVIA 2UX6A 3MRHB 1T3FB 3Q8CA 1TCRB 1KCUH 4G7YL 3D39A 4IIQA 4R5VA 5EIQA 4ZYKB 1NCWL 2IXQB 4LLWA 3IDXL 1MW0A 1DO5A 3WJJC 3DETD 4YHOL 2E7HA 2W0FA 4G8FB 3D34A 3W82A 3ZYJA 2WD0A 4IGBB 1UGNA 3VYNA 12E8H 4GMTL 4XNXL 5E1QA 3LV3B 3RVUD 2F6AA 1YDPB 4P5MB 4QRAA 1IQWH 3TT1H 4FTDA 4QTFA 5ITBL 3GK8L 3WG7B 5ESAA 4BBWA 4Z7NB 1LP9E 3T0EA 1X5MA 5B3SB 4OZIF 1MRCL 3DX6B 5FFLA 1P53A 3QAZC 4H25B 5F8QC 4ZSOE 1KJ3L 4S1SL 4XMPH 3GPEA 5TQ2L 4G80A 3TASA 2XQYA 5FYLH 2PR4L 4BQ8A 2N7SA 2P9RA 3KWXA 1F2QA 1C7SA 1BZOA 3CHXA 2F61A 2F7OA 4TQEH 4UNUA 4UAOC 4AM0A 1GGCL 2VDPL 3L95A 3QS2A 3ECUA 1YY8B 3EYVA 1URLA 3WTSA 4KHTH 1ET5A 2WLZA 4NUGH 4MQSB 5C7XL 1X4XA 2AJZA 1XR9A 2J1ZA 4KJQD 4EZLA 1WZMA 3BAWA 3NIDE 1PX4A 4L8BB 4N2CA 5AVQB 1QRND 1EHLL 4MX7A 3BPCA 3DX0A 3UYRH 4Y5YB 1I85A 1M7DB 1KENH 4NAQA 3BGFB 1N5YH 2X6VA 1NIFA 1D9KA 1TO4A 2Y1YA 1T0MA 3DX4A 1Z32X 2WCSA 4G6KH 3TEYA 1L4IA 3F7KA 3CMOL 4XNQA 3HE7C 2VJXA 2ADIB 5KVMC 3KM2A 4OZGB 5HHMD 4N20A 5IQ7L 2BNRA 5B1CA 1BQUA 1E65A 4NI3A 3SYCA 3TNMB 5D1ZI 1E9OA 2DKUA 5A6MA 3B83A 5D7IA 5GGUA 4ELKA 5HDBB 3E6FB 1J1OL 5D93C 3NMEA 1U6AL 1BM3H 4PBVC 2HFFA 4Y19B 2FLMA 1G6RL 1OSYA 2F08A 4N90D 2FJFB 1RL1A 3ULUC 5IGXL 4IKJA 4UIMA 4AQ8A 1MFBH 1A7RH 1GMEA 2VRKA 3D6GA 3U4KA 3ZYIA 1H9DA 4P2QA 3GHBH 3SDXF 1WC7B 1CFMA 4X8CA 3ABMB 1OPGL 5AVTB 1YN6A 5I8KH 4XH2B 1A9BA 3CCHB 3EAKA 2BNRB 3HR5A 4OD2A 3ASNB 1Y1DA 1KB9K 1E9OB 5HDLA 4HS6B 5FXCH 1NGPH 4GRLA 3ASWA 8CGTA 3KBFA 1JZ4A 3A22A 2VC2H 4N2EA 2NX5B 4G9FE 5DD3H 1JRHH 2IH1B 2IDTA 4PS4H 4OQ1A 3L2NA 3VFPB 3UGXA 1A9EB 3MRPA 1HWGB 4RA3A 4G6JH 4HSCX 1M42A 5F6IC 3KNBA 1TQWA 1TZIA 2G5RA 3WUZA 4ILDA 2ZG2A 3EHBB 4MXQC 4AQAB 1E4XH 3IRZA 3UYOD 1HCFX 3BD3A 2NT0A 3MJ8A 1DFBL 3FU7A 5CZVH 3KWTA 5IHUL 5EO0A 3NSYA 3NA4A 1I8MB 1GGIL 1HIML 5F93C 1KGWA 1ZA6A 1BDYA 3B3BA 1DQML 4QYOA 4F7EA 3IJHB 1IM3D 5A2KH 1BZEA 2WKLA 1NAKH 2IH3A 3NCCB 1Y18A 3N42B 1XXDC 3V0VB 3RY4A 2C26A 4HUNB 1BEYL 1OTTC 5DK0A 1C1EH 3GSVA 2ALWA 3HS8A 4HXBH 4NKIL 4KXDA 1JTTA 2C5DC 2N0MA 3ISWA 3RVXC 3LRKA 5B1JA 3BO8A 2J73A 3BYTA 3CHRA 3QIWD 4DIXA 4F57L 3H4HA 3CSPA 1RZJC 1FFNA 1MI5A 2NUPB 2O6PA 4NC0B 5EU5B 4YXLH 1JGEB 1DVZA 2NW2A 4UIKL 4ZBJA 3WGVB 1UOKA 4KI5F 4M8QA 4OB5H 3VXOA 1CFNB 4OCYL 7PCYA 1QLFB 1XR8B 3NJVA 1NGXB 5FV2A 1U8LB 3AT0A 5DMGD 3DYMA 2V5MA 5E24E 4X4KA 4U4BA 1ES0B 3ESMA 2EDEA 4IOSD 4J8QA 3X12A 3BUQA 2JCCB 3IFNL 5LAXA 4Y2OA 5C07A 2ZOLB 3CVHL 3GSXA 3REVA 4FNSA 4X42A 3P9MB 5K1VA 3GMQA 5F3FA 2BOCA 2GSMB 1KACB 3EDKA 4HCRH 1FVDA 2Z7WA 1J9QA 5D72L 5C6TL 1LILA 1ZA6B 3KLLA 4AL8C 1QA9A 3MLUL 1DQQB 2QBWA 1LNUA 3KE0A 1NC4D 1MG3C 5IK3B 3MRMA 3PCYA 4P0DA 4DKDC 5DD0H 4TM9A 3LH9A 2BK8A 4P2QB 3A6CH 2H1XA 3JUZA 1QSEE 2H0PA 5EU7C 5KS9E 2XFXB 4PLKC 2OSYA 1TTGA 2XRAH 1VJSA 2EAEA 3BLPX 2YPLA 3DMMC 3OB0K 2UZPA 3GM0A 4TKWA 3L6FA 4ZO9A 4F7TA 4B9PA 1WAAF 4DVRL 4PRBA 1RCYA 1C12B 4AEIL 4A7UA 2X4RB 1FI8C 5FEBA 3BUPA 3FHEA 3FFOA 4HPYH 1XIWB 3VGDA 3WNPA 3WFHB 4XN1A 4RESB 2NSQA 1VADB 5EUOF 3C09B 1VA9A 5BZWB 5MP6H 3PUUA 3GMLA 15C8H 3N1QC 4GKLA 5BJTA 1P5UA 3BEWA 1RZPA 3EYSL 1T66D 3C5XA 2W88A 1I85C 1A1NA 4PR5B 1TF4A 3APNA 3DJ9A 4Y9BA 2HJLA 1A25A 4O02L 1UHVA 3HN8A 3VE0B 1H15B 1HHKA 1NAKL 2W38A 5JHDD 5A40E 3EFFA 3WFEH 3B2PA 3L1OH 1KB5B 2ODHA 2XTJE 1VLXA 4ISVA 4I4WA 2R4RH 5DD3L 3AY4C 3DJRA 3MRNA 1U8QB 2XX0A 4IGBC 5DJAA 3TO4D 4NBZB 3AB0B 2YC1A 4AYMC 2G75B 1XD1A 5CLXA 2OMBA 5CJXC 2OXGA 1KBVA 4APQC 4GKOA 1HZHH 5D2NC 4MAZA 2QZ5A 1UOLA 1NGZB 5LCVA 2NXYD 3QFJA 4BHUI 5I8EB 2ZSVA 2FJHA 2WXFA 3F7YA 5GGQL 5FO9B 4M6MH 1CGTA 2JXMB 3M6DA 5GS1C 1W0VB 2X12A 3CHPA 3DV4B 5DZAA 3CU7A 5EU4B 2OMUA 2Z6FA 1QTPA 1T6WA 3TJEH 1FNAA 4ONHB 2AW2A 1CO1A 5JDJA 3AMLA 1ZWIB 4OKDA 4D9RD 2J4WL 4WI3A 1D6VL 5B4MC 1NLBH 5EDSA 1E0OB 4I88A 3GBLA 4KI5C 1X9LA 1NCDL 5GRZA 4F8LA 3CSTA 2PO6A 2YWZA 5HI4D 4CVWA 4OF7A 5AOKA 2KLTA 4H0HB 3NDZE 3NDYE 1K4CA 1OGSA 4GSQA 3VA6A 3QUKB 1IBHA 4XP5H 4G7QB 5T5FA 4BSVB 4KKAD 3GI9H 3UPRB 4FQHB 4KRLB 3VTAA 5BS0B 1PS3A 1R5WB 2VR5A 2Z31C 4K23H 2ZKHH 1G87A 4UM8B 2Q0ZX 3LB6C 3LKRA 4R97B 4JO1H 1I3RA 1JRHI 5FF6B 2BW4A 2YSSA 4CKVX 1H15A 3UZQB 4JN2B 2HRHA 3PV6B 4E41D 1ZVSB 3BVNB 3TIEA 4X0KA 1MCKA 4OCWL 1DSFL 3SPCA 2FNBA 3Q43A 1LJMA 2YEZB 4OJEH 5ESQB 3US0A 3HJ0A 5I23A 1KIRB 2DQHL 3FONB 3VRLF 2R0ZL 1T7ZA 3ZXAC 3KLQA 4CGTA 2MOGA 3VXTB 5E8NA 4NUJA 3BT2H 3QUXC 4HIQA 5DT1L 1NBQA 5AZ2H 5I18H 1HZLA 3C60B 5F9JA 1A1MB 5BVPH 4LO9A 4MHHG 3RY6C 3K8KA 3VFOB 4TL4A 3ECVA 3A24A 5TF0A 1CIUA 1QR4A 1S9XB 5I8OH 4MNGA 5GZND 3MR9B 3IRPX 4S1DD 4G42A 1K4DB 3QUMB 4O02A 3O2VL 5DJCB 2OMXA 4PJDB 2PCPB 1ITBB 4Q56A 3TT1L 3MRIA 2PTTB 1OCWL 4HIEB 2B0SL 4TXVB 2I07B 3VD1A 2CA4A 5HD8C 3BH9B 3GSNH 5A16B 3INOA 1MJ7L 3DUSB 3OGOE 5IMMB 5F9JB 3PWJB 5LXGH 2F5BH 4CMMA 2AJUH 4ZFGL 1QWNA 3C12A 1JP5A 2D0HA 1G1YA 3PPEA 1TVBA 3L5JA 2NY5L 5C0NC 2VT0A 4K9JA 1L9SA 5LGJB 4LSRL 3VXRB 4Z7NF 5F9WC 3UYPA 4PPTA 4WNJA 2I32A 1V7MH 2OMXB 3QIBC 4PJDA 4PWIA 2MNWA 5MEQB 2YN3A 1QEWB 3AU0A 3NEEA 3RGVB 3W11D 5DO8A 1ORSB 2VIRB 2X4SB 4FI8A 4M62L 5LN4A 4S1QH 2CCVA 4XP1H 4F37F 1IEAA 1PLAA 5TE7H 4PGEA 4PJFA 4TL5A 4IQHA 4XCEB 5FOBB 3UEQA 2PPCA 3VH8G 1MZYA 4LRIC 2VLLA 1H8LA 3BUBA 1L7TH 3NCXA 2VGLM 5CBEB 1CGVA 1W8EA 5DWUL 1Q9WA 4M5ZH 4HKBA 4NPKA 4UOW1 2XRAL 3AS2A 2HKFH 2K8QA 5AKTA 5CEZE 2EP6A 5EU3A 4JFEB 4AEFA 5AB0A 3BRFA 2VE6B 4L4VA 3RGVA 1BOGA 4QRSB 5I1GL 3HRZC 4OM0H 1MWAA 3ZHFA 3WTWA 5TE6L 4QXWA 1J9TA 1PZ5B 1A64A 2Y07H 2BNQA 4HU2A 4GQZA 4NRXB 4L1SA 4J3UA 3WV0A 5JO5A 1NKOA 5K9QG 5SX4I 3MJ9L 4HHAB 4PD4J 4I13B 4MJ4A 1ADQA 4U6YA 3BAKA 1DFXA 3FUKA 2VDRL 2AKRA 5CCHE 3TH3T 2DQFA 1AZBA 1CE6A 1N68A 5L7XH 1CR9H 1FFOA 1IE4A 3OR7A 3ZKMC 1BWMA 1S8DA 5ENWB 1H6UA 4J3OG 4HSAC 3S4SA 5K93A 1RU9H 5FYKH 2PXYA 5KSAD 3FXIC 2J2ZA 1XCTA 4K3GA 4ZG1A 3CIQA 4XP9H 4P48A 1ZVNA 5I26A 1EUTA 4YBLC 4NM8L 3AWGA 1TQCC 1DBAH 3LEXB 3BKMH 1YJDL 1E28B 4Q9QL 5SWZD 3HUJE 5IW1A 3LZOA 3X3GL 4AW4A 5JW5B 1AGFB 3NN8B 1UH3A 1F6FB 1CIDA 4F5CA 1DQLL 5DMYA 3ZDZE 4YHNB 1RFDL 1GCFA 2ZOOA 2L0DA 3TFKD 3BVUA 2CBMA 1IGCL 2Y6SC 4G5ZH 5CP3H 4EI5A 4P5KB 5IW6B 5KSBA 3ZE0F 1G0DA 2O1AA 2Y72A 4JZOA 2EKSB 5C0CD 4YIQB 4FJ6A 3T0EE 5FX3A 2VXVH 1K8IA 3DWTA 1FZJB 4ENEC 1NWOA 4PRDA 3WUWG 5E8DH 1E40A 1IVTA 2VAAB 1BIIB 2VXQH 1HEZB 1FYTD 3H3BC 4JRYE 4ZK8A 4LT7A 1GVIA 2MNJB 3VX1A 1PG7H 5HJ3B 3PAVA 4KVNH 3WFDL 5JQ6L 1U8IA 1ND0A 3HUJB 4HK0A 1HU8A 1BPLB 1F00I 1RZIB 5GGTH 1J0HA 4X80L 3ARBB 2X4OA 4EO5A 5EMYA 1V3MA 4MJIA 4V11A 1L0QA 2FJGA 2XWXA 1A3QA 4OJYA 4IRSB 3X1GA 5BRZB 2P5WA 3H0TA 4NQQA 3HAEH 5C09D 2VDRB 3JVGA 2R0WL 3CH1A 3AS3A 3VRLE 1FVEB 1MCEA 1YEGL 3AMKA 3D85A 5ANHA 4AIOA 5KYXB 1RAMA 3FN0H 1QFUL 5DFTA 3IKCA 1ORSA 2VIRA 3GLZA 3MV01 3LQAC 3ZE0B 1KGYE 3OWEA 1MFDH 3WUWB 1GGIH 1HIMH 3FRUB 2C9VA 3STBA 2Q7YA 1WBZB 4JFED 2OKMA 5DQJA 4KDWA 1UEYA 3MOAL 4NO5B 1MF2L 4AIXA 1D5MB 2H3KA 3ET9F 4PJ7E 2X4UB 1NGQL 3EOTL 3HBGA 5IROA 3JTSB 3TNNA 4GKSA 3RJDA 2QSVA 4ZS7H 1ZHBA 1R0AH 4PRIA 2F18A 2BDNH 4ERSH 4Q9CA 4R90H 5D7HA 1E43A 4Z7AA 1T4KA 2H45A 3QFGA 4LSVL 5HYQB 1ZLDA 1XGYL 3BSZA 2VXUH 2BNQB 3GKWH 4NZRL 4XCNB 4JHZA 5IVZB 4QOKB 4AVJA 3B34A 5I5JA 1NIEA 4IKLA 1AI1H 3WIFB 4MB4A 2BVOA 3PABB 1HHHA 4HUUA 3T0BA 1O7DC 2KBGA 5E6YA 4ZW8A 3L1EA 1GW0A 5EV7A 5ID0A 2OZNA 4Q6IC 2NY0D 1PZAA 4ODHH 4Y1AA 5H2BB 3OJ2C 4PEEA 3KWWA 3CFJB 4ODSL 1KLUA 4JFHE 4Q6YA 4NZFA 4LLQA 1EGJL 1INEH 4K15A 3U9UA 4MD0B 4PJ5D 4H88H 4XN7A 1I7RB 1CGSH 1MCOH 1WFIA 4IMKA 5BUGA 1ADQH 1D9KD 1DDHB 2DV6A 5T3ZH 4HWZB 1FSKB 1CICC 2DLHA 4NFDA 1JWUB 2F8OA 1PMYA 2Y7OA 3B2VL 3SDCB 5LO7A 3TVMB 1EO8H 3C6LD 3L1FA 3O8XB 3QJHA 1JZJA 2D03H 3RX5A 1KXTB 35C8L 4YR6B 4P5MA 1KCRL 4K94H 2PYEB 4YC2C 3BIAX 4L2LA 3LHPL 2NNAB 1WBXB 5I15H 2JJSC 3VMNA 3MYJA 5J1AB 1MCFA 3LEYL 1S5HA 2X7LB 3VFNB 1ZLUK 3R1GH 4WU5A 5E08L 1U8IB 2GUOA 1RLWA 4Y4HC 3A67L 3HNVH 2ICWB 4MGXA 2N4IA 4O58L 3DK2A 2HWZL 5DC2A 5EORH 3EFOB 3H56A 1XZ0A 2EIJB 2GABA 3P0VH 2DICA 2JQAA 1J5OH 1DN2A 3ABKB 4F8OA 2YD1A 3PHSA 1YQ2A 4P3CL 3PWVA 4HKZA 15C8L 1J1XL 2CGYA 3SPHA 4S2SB 2PWGA 2WBKA 5F9OH 4FP8H 1DDTA 1F90L 4F5CE 3HMXA 1RZGB 4PW4A 3P30L 1IBGH 3HZKA 2KMWA 1Z5HA 3HHRB 4L4TA 1T5WA 2PXYC 2HT4D 3MU3A 1E3ZA 2JVUA 4UU9A 1XGQB 4MTMA 4CAGA 1XGUB 2J25A 4Z7VE 1T0MB 1BECA 4M8UA 4XXDA 1SYSA 2ADFL 1FCCA 3DGDA 1CXFA 3LDBB 4OGQC 4DP2X 1SMAA 1B88A 1RI8A 4PJGB 1KN2L 3O0RL 3TZVB 4WGKA 3H9YA 1CL7H 3LAFA 2AP2A 4Y16A 2NY2B 4KK8C 1QLFA 1XR8A 4GQPH 4BSWB 3DOIA 3QZOA 3POCA 1YCSA 3QXAB 2O61A 5F7HA 3EOBB 4PJFE 3ATFA 2VZUA 3IU3B 2P1YA 2NQDA 4NNYB 4QRPB 3MBXH 4XC3L 3GC3A 2FB4L 4K7PY 5GISL 1NMCC 3I02B 3O3AA 4WUUE 2VXVL 5LG6A 4U6XA 2X4TB 4L05A 4MA8H 3RKDC 5CJ5A 3BPLC 1AHKA 4TUKL 4QWWC 5DMIL 3SJVB 4N8VB 1XZ0B 5T5NF 4DGVH 1QBLH 1J87A 1U8KB 3VFWB 3VRJA 1CT8A 4PCKA 5GGTL 2FSEB 3UZEC 5I0YA 2CLZB 4NT6B 2WCPA 1AO7D 3DV6A 3SDYH 2IH1A 4OCSH 3ZHKA 3QS3A 3L45A 3UROR 3WEXA 2JI3A 4QRPA 4YBQD 4BFFA 4CNIB 2GEQA 1MJUL 2NY2D 2Q8AL 3CVBA 4OAWB 2G75A 3KYNB 1LE5A 4JK0D 3O9WB 4FQIL 1EO7A 4WW2B 3H2PA 4RIRB 1SF3A 1IILE 4G9DA 5DURD 1GPOL 4WGVB 1A6AB 5HDQL 3QCVH 8PAZA 2WLYA 1M2OA 4PJAA 2Y3NA 4R3SA 2JTYA 1ZSDA 2WWOA 3K72B 5DJ2A 5TH2B 4ZMVA 1HL5A 3MLPA 1I31A 1D7BA 4JAMB 5I66A 3Q7JA 3ARYA 3DVNA 5AG9A 2NQCA 1QWUA 2EVHA 3VXMD 3JUYA 1GGBH 4YDLC 3K6FA 1QPKA 2R51A 1JPTL 5AW3B 2Q2LA 3ZQ9A 5DHYA 2Z64C 2G9HA 3FQNB 1HXYB 2ZKYA 3VJ6B 3AGVA 2CBTA 2X05A 4YDJA 2AQSA 2Z1PA 3F64A 3AQDA 5I6PA 1A66A 3S3SA 4AYFB 1K4CB 4IJ3B 2WP3O 4BFIA 4NIYE 1MXDA 2YD0A 5JW3H 4OLUL 4X99B 4PHXA 3RNKB 2W65A 3RPIA 4TULL 3SCMB 2QPUA 1VIWA 2KT6A 5C0EA 3W9EB 1CU4L 2CIIA 4H8WL 4QKTA 5EOCH 4O00A 5SWQA 1DANT 3ABLB 3IGKA 3CK0H 4P2CG 3EYQD 3IJHA 1P84K 4X5WA 4X4YB 3T2NH 1KN2H 2N3JA 4OZFA 3UDWC 4Y16D 1N9PA 2XQBL 1RURH 2VISB 3BZFB 5DA0B 1XBDA 1HINH 1UZ8B 3AVEA 3B7UX 1K8DB 4JANA 4QHMB 4QUOA 5F1IA 2TRYA 5CCJA 4JKWA 2KERA 3P0VL 5L4FA 1INQA 2BOCB 2I85A 3H6JA 4I0PB 1LLAA 4UYPA 2CH8A 3FQXB 4QYAA 2K4AA 4WWKA 4PWHA 3QUMA 2HVKB 4O02B 1HOEA 4WFFD 4GAJH 1JN6A 3BPOB 4FABH 4LSPL 4XNMB 1OPGH 3DUHA 4Y4KD 2OX5B 3I75B 5E8OB 1DQMH 2IGLA 2DIEA 3UBXG 3F12A 4J1UA 2XTSA 1N67A 1U8MB 2OXGB 1AZNA 1K8DA 3SGEH 5ADPL 1DO6A 1ZRUA 4MWFB 5EF2A 4WY7H 3S97C 1D5IH 1SFDA 1XF3A 1NC4A 4NLAA 2QSQA 3R1GL 4QRQA 3D69A 3ATAA 3SBQA 1A4JB 4MYPA 2YEZA 3JWDH 1UH4A 4DT2A 3P3RA 3DLQR 4HOZA 4JO8A 5EBWA 3OKYA 3P4OA 3V2AR 2RIKA 5BV7B 4RMSA 3HIZA 1XQ4A 2ZT9C 3SIKA 5C07D 1V05A 4PJIE 1HL9A 1Z2KA 2Z7YA 4QY8A 4NKOA 2AI0L 3MRMB 3ARDC 4YSOA 5F9DC 4FKEA 1IC4H 4YHZH 1AXTL 3EBIA 1YJDC 4KRPC 2YPKB 4X6EB 4ZSOB 1UM6L 5PAZA 3ROOB 2CK0L 5C3LD 5JIIA 1A0QH 3M07A 1VCBC 5LGHL 2EDTA 4L1LA 4UNTA 1TTUA 2ZXDA 2PYFA 2CM5A 3TA4D 3B6SB 3TBVB 2R39A 2VL5A 3W57A 3UZQA 2H32H 3RI5K 4RRPM 2DTMH 1LEKB 2ZX5A 3TIEB 5LVEA 4BINA 3JV6B 3DBSA 2QR0B 4RMTA 5HHOA 5G2NA 4B60A 4PJCA 5KEZA 1FYHB 4PJDF 3EZ8A 1AI1L 5HGAA 5GZNA 1RUML 3ZX1A 5KYYA 2NW3B 5FO9A 3AG2B 4P9HC 4NQSA 5HI5C 5L4MA 4WI4A 1MUJA 1KCVH 2V9QA 1H3VA 5E9DD 4ZTOH 4L5FL 4J4PD 1EZUA 4LKXB 4F7MB 3NK3A 5A2AA 1E5UI 4D0BA 5D6DA 4N2HA 1AC0A 1A2YB 4PMEA 3L7EA 3NEOA 2WOYA 4JFEE 2F7QA 4MQ7B 3EJQA 4JFDE 2Q3XA 2GK2A 2VABB 3KPLB 4GYBA 2BDNL 4PGCB 4FHBD 5IEKA 1IAOA 2FYVA 1XCTB 3KH4A 5MEOB 4YHMH 4JNXA 3P4OB 2Y7SA 3LN5A 4ZXBB 2ZCKH 3C6SA 3VD7A 1PZ3A 2OXHB 4N0CC 5F1NB 4AGNA 4FQHA 1T6BX 2EDWA 2Z8VC 3JWOC 3SGEI 1AIFB 4PI2A 1HSBB 5IP4A 1MG2C 1KYOJ 1OZUA 1PSKL 3TT3L 3FFCB 3PY9A 5AAMA 4GI8A 2NUTB 4KOBA 2AJYH 4PRAA 5CF3A 1N59A 5C0AA 3OL2A 1XTMA 2Q76B 2FWOB 4M43H 1FZKB 2TSAA 3WHE0 4C56D 3QG7H 3UJJH 2LFGA 5ADPH 2X6MA 4GIOA 3LN5B 2IFFH 4PVMA 4MS8C 1TENA 2JKXA 1BIIA 2VAAA 2ZG1A 1ONQB 3CDGB 3TN0D 1AGDA 1X5GA 1YN7B 4O51A 3P40A 4JO3L 4BGLA 3KHOA 4NGHL 3DX2A 1VHPA 3DRQB 4R6UA 3FZUC 3IDNB 3H42H 1G7LA 4OF8A 3T4AC 1LO2L 4FI7A 3ZRCC 3FQWA 2VZVA 4BQCA 4WW2F 1SMOA 4PWJA 1HWWA 2VZSA 3WIHL 5I74C 4IU3B 3T2LA 4FTVA 5GRXG 3RZCB 5I5IA 4R4BA 4ANVA 5B3NA 3ZK0A 2WZPD 2D7PA 1D6EB 3ZTNL 1HEJC 5A2FA 1HXKA 4HUXB 3PQYE 1OGAD 2Q7NA 5DK2B 4PJHF 4Y1AD 5TGBB 4KFZC 4Q9BA 2Y22A 3L2MA 4XNDA 3JQOB 1YEEL 1NKRA 1B3IA 1OAXL 1XBRA 3LQZB 1UWXK 2XN2A 3LH2H 2Q10A 2CO7A 2VR3A 5ANME 1ERNA 1QHOA 2R7EB 2P4AB 1J5DA 1SJXA 4NBYB 5AKSA 3EF4A 3HHSA 1HHJB 2LQRA 3HI5L 2WUBH 3U2IA 3M88A 2HT3D 2B08A 2JF1A 3RVTD 5LCVL 2LR4A 2DQFB 4FNPA 2EYSB 1WBYA 3MJ9H 3B2XA 5EHFA 4QWWD 4NPJA 3GZKA 1XF5B 2VXTL 3DXAE 4JFZL 2YAPA 4HCFA 3D50A 1I3VA 1EMTL 1ML0A 4LL1A 3T6WA 2DB8A 1CN4A 4IJ3C 4Y2DB 1FN4A 4V1DB 2DLFH 1D5XA 2IALB 4YVUA 3TEWA 3HLKA 4PGDA 3ESVF 2PW1B 3U9WA 2CBPA 2Z35B 3QRGH 2BNRD 1KB5H 4PRHE 2GT9B 3DSFH 4DVBB 2BVPB 1SM3L 3MV8A 4WI2A 4GINA 5B8CB 2ZWKA 2YMTA 4YDVA 3BEVB 3CVHH 3MRLA 3DPBA 4ATTA 5IWLA 1YC7A 2Y7LA 4LSUH 2BIOA 3MLSL 1G6RB 3SDYL 2HVBA 1VPOH 4KI5E 4FF9A 2VC2B 4LEBA 4OD1H 4HJUA 3VW3L 1L9MA 3SKUD 1ZTMA 3QPQC 2XQ0A 1WT5A 4F57H 2K9FB 2HJKA 2FT8A 4HUWB 5G4NA 5ACZB 2ZPKH 4PP1C 3QHFL 1AR1D 1CQKA 3FFDA 1IEBA 3QDJA 3WLBA 3X11A 1UWGH 3JTTB 1FF5A 4K2UH 3R8QA 2VM3A 4UIKH 2AJVL 3VXPA 4EKXA 4Z8FH 4GAYB 2R2EA 2ARJQ 5GJTH 2B3RA 1BX2A 1UJ3A 5FYJL 2OYLA 4O5LH 4C56A 1KPVB 1LK3L 1NDGB 4AIZB 3MMEA 1FG9C 4N1EA 1S8DB 5BOPA 1TQBB 3IS0X 4UB0L 4ADGA 4FFWD 1R33A 3NJKA 3EJRA 1YC8A 3BESR 1UD8A 1Q9WB 4QPEA 4W9IC 5B7EA 1PG7W 2PWHA 4FXLA 5JPMB 4ZAKD 2VKXA 3KLAA 1CICD 5CJQH 1SXZA 2QQKH 3OG6B 5I0DA 5EZPA 4EPSA 1WA1X 3F7VB 2G3ZA 2B59B 1GZQB 2Z7ZA 5D5ME 4M62H 3TFKC 3CZFB 1KPUB 5JZ7D 3N50A 2Y9RT 3QIWA 1CJYA 5A2LH 3FDWA 3SQOL 3CJJA 1B0RB 2O6DA 4KC3B 5ISZD 5F21B 4NB7A 3R4RA 2WLKA 5E9DA 3Q2LA 3QEQD 2V9UA 1KBGL 4F2MA 2XIIA 5GS2D 1FFOB 1EVTC 5E1AB 1ILSA 4ZXBD 2WQAA 2Y5QA 3IKKA 1YEFL 4E0RB 2EDXA 2ZXWB 3RWHB 5D7JB 3L5HA 1CDBA 4TNVK 4LLUB 1KN4L 1YEJH 4GFTB 4OCLC 3X1BA 1DR9A 4GO8A 3SGDI 5I24A 4Q52A 1X5JA 4HEME 3MYZA 1F4YH 4QHPA 5F7LB 4JUTA 2BP3A 5CJOH 2ESVA 4CVXA 5IB1B 2R2HB 1F58L 1R5VA 3RU8H 2CJUL 1MJ8L 2DM4A 1JVKA 5FCUH 3S36X 4X8JA 3CH8A 5FGSA 3SDXB 3LSOB 1NUNB 3FN9A 1E5BA 3NJMA 4ONGH 4N90E 2FGZA 4FQ1H 3ARUA 1OD9A 2QFPA 2WTRB 4G9FD 3QYCA 1EEZB 3L4VA 4R4FL 1NCDH 4KO6A 5G5DA 3RPIB 3RWHA 3LVTA 1F11A 2LU3A 4BGDA 2XN9A 5FO7A 4JVPA 2KC0A 2X3BA 1TFPA 5I8CB 3T08A 5BZXA 2JWYA 3O11B 4HYTB 3Q1EA 5D1QA 4HKJB 3LNGA 3MFFA 1ZHKA 3LNHA 4PJEB 3ECQA 3OKLA 4XP5L 1E3FA 2J71A 2KH2B 4N9OB 5FWRA 1FH5L 3QNZB 3TJHC 3ULUE 4HK0B 3IXAA 4AYID 1I8KA 4FA8A 2PETA 2ZICA 4RZCB 2GUYA 3VCLB 3JV5A 1F4YL 3GMRA 4TVPE 5AW6B 5FYJE 3QFDA 4G71B 1JTPA 2FHCA 2YKLH 1U8CA 3QULB 3PNWB 1P4BH 4UU9B 2ZKXA 1NANI 2FJSA 3B9KD 4IOFD 5HHPB 2DQHH 2GSGB 4UQEA 3LKNA 3VQ1C 4U0RB 3AUVA 4GS7B 3FBQA 2ZCHH 1IT9H 1K9TA 1EWHA 4GBXD 3ZRSA 1MSPA 4FQCL 4LLWB 5BOJA 4I18C 3ELAT 3H9HA 4YAQA 5ICXA 1BA9A 3IDMB 3S3CB 1KGCD 2BCMA 1DVTA 4M1DH 4WRLA 5L88H 1CBJA 1KPVA 1P6AB 5DQJB 1JNNH 1CLYH 5GIRA 1ZLSH 4N2IA 3QWRD 3PJSB 3GMRB 2J20A 1A22B 1TQVA 1XEDA 2VLRE 1NBYB 3MRGB 5E2VH 3LB6D 3HAEA 1CTNA 1PIGA 2W9DH 1A9EA 2E4TA 1MCBA 4E9RA 5ABDE 3JTBA 4PJ6A 4KJWC 1CFNA 2B1HL 3CBJB 3L9YA 3BKCH 5IFHH 4JY4B 4YDIL 1UA6L 3FHAA 3VI3E 2ZUQC 4JLRB 4YPGB 1CFBA 1EPFA 3QQ9C 4UDTA 3REWA 2XN9B 2WNWA 3T4AB 5HXMA 1GYWA 2VLKE 2XWTB 3MJ8B 3ZMRA 1J0JA 1HL8A 3OMZA 2E9GA 1NWPA 1I7TA 4MA3B 4FZ8L 4OZHF 1LWHA 1JD7A 3I3BA 3ZTJH 1G5AA 4FGMA 3IMWA 2A7BA 3DV6B 1G7IB 1KV3A 4URKA 3MRGA 2QV4A 4Z6AT 3TZVA 2OMWB 4Q97A 5KBMA 4YJZL 1PG7L 4F9PA 4KRPD 2CKBB 2VDMB 1A6UH 4PJAF 3EADA 5ILTL 4IEFB 5CJQL 5BRZD 4G6MH 4IIQC 3T8XA 1ZA3A 3IDYB 3PWUB 2X28A 4FQJH 4GQ9H 4ZDHA 4J3OF 3VFNA 4OZIB 4OUOA 5TDPB 3RUGE 3KYOB 5D1ZB 5E99L 4TTDC 3DJTA 3QUMH 1C5DB 1HN1A 5EEXA 1J8HB 1KCSH 2X41A 4LVNB 3VXMA 5DGQA 5DLMH 3LKNB 1DJZA 3CC5A 5I1KH 5EU6D 3TN0C 2ZWSA 4XB7A 5DJ8A 4BH7B 3SCMD 3NAAH 3T0VA 1NMAL 3OHXA 3VXUB 4ODBD 4NCC2 4KJQC 1UOVA 4OBRA 5IQ9B 4S2SA 1KCBA 4FFZH 4AWJC 4JQVC 4RGOL 4G7VH 1YPZE 3IGAA 2X4RA 1MLCA 3NIGF 3OF6D 1FJ1A 4HLZG 3O6ML 5EEWA 2FSEA 1D5ZB 2A99A 3TC9A 3BZ4B 2B1OA 4ZPVA 4JMXA 3F8UB 3QIBD 3F7QA 4FI6A 1WTGT 2CRIA 2YMXH 2EE6A 3BMWA 1P5UB 3BEWB 1ECYA 3RVUC 4WHTB 2EC9T 1P7QD 5D1ZD 5HVFB 1KT2A 3F3HA 3NSFA 5DC0A 2ZUWA 4OD2B 4KKQA 3SSGA 2BIPA 1CYGA 4K0OA 3IFPB 5CGTA 3DPDA 1SVZA 1AVAA 3IAGC 3RDJA 1RPUA 3D0VB 3QNXB 1W0WB 4JRXE 1NFIA 5E5LA 1OSPL 4ZUWB 1SJEB 2J8OA 5EBWB 3KPRB 2OYMA 4DK6A 1RVFH 2AQPA 1SDYA 3BIBX 5FHAH 3SGJA 4LEEA 1DBAL 4WJ5A 3HZMA 4PGBA 2ZD0A 5HSFA 3PWPD 3BD5A 1NCGA 5I19L 2IGFL 3GBDA 3QFJB 5CGBA 2EDBA 2V3FA 3KEDA 1MY7A 3VFMB 2C9AA 5I9QC 4TVPH 1Y6NR 3S5LB 1LO5B 2Z91A 4JKNA 3L9RA 4ZZFA 2IAMA 4DZBA 4BH8B 3W2DL 1T22A 1AMYA 5I6MA 4JFZH 4QHLB 3GMQB 3B9KC 1T7XA 4HK3N 4U1NA 3F05A 4BELD 4LLDB 3IMBA 1GA2A 3PL6D 2LHAA 2AAAA 1AQ8A 1ZKAA 3DGGB 4MS6A 3P4NA 5TDNA 4FQ2H 1D5ZA 4J23A 4HWNA 1JD9A 5KSAC 2X4PA 2OW6A 5BQDA 2ITEA 1M3IA 1CF1A 1Y0LA 3MCKB 1NOFA 1XL6A 1A6AA 3IMUA 7FABH 1TEYA 1SHSA 2ZQKA 3RE0A 2XBTA 3DGCR 1AHWC 4ADIA 4FERA 1FAIL 2G3MA 3P3UA 4YSCA 1IBBA 1E27A 5J12C 1JGEA 3RHWF 3VGAC 1P1ZA 2NNXA 3CVDA 3KBEA 4L4JA 4OJFL 3V4UL 2A0LC 1T03L 4HHGA 3QI9D 4WEBL 4LAQL 2F53D 4XNMA 2BPBA 3FQYA 1H3TA 1TITA 5T33H 5T5NG 2WGNB 3WFCH 4XPHH 3T6XA 5I1HH 1ES0A 3HZVB 3PYCA 3MLRL 1CQYA 2DYRB 1PZSA 5JUEH 4M93B 4PJ9A 1AQKH 1ZE3H 1XF3B 2LAAA 1E8YA 2IOIA 3S5LA 2JMRA 1O6TA 2EZ0C 4LMQI 4P2AA 2DQGL 4PWGA 1CLZL 2G4EA 1MCJA 4DZBB 5DHEA 2OTUB 4YC2B 4PJIA 3Q9QA 5C9JA 3DO7A 1ZLVK 1T20B 4L3AA 5E9NA 2IMNA 1M05A 5DD6B 2W9EH 1L0YA 4IHOA 3DHMA 2E7LA 3DVNB 4L3EE 3LMJL 5AAWC 2CMRH 2WM0A 4WTWA 7PAZA 3BSZH 5C7XH 2DYPA 3MDJA 3APMA 1IO4C 4GH7B 1ONQA 1B4LA 2B15A 3W9DB 1E3XA 4IKIA 4BUHA 4Q14A 1IC5H 4GG6B 4X83A 2KKQA 2PYED 4HMDA 4UINH 5AW2B 1EAPA 2P8MA 3FQUA 5JXAL 3V8CA 1FO0H 3IFPA 3X17A 2YAFA 4L0PB 3BN3B 2NY3C 2QVKA 1GAFH 5IEHB 4ODVH 4U1HA 4NZ8A 2Y06L 3AWFA 2IV9A 2CCLA 3CMOH 3OC5A 4JRYD 5D4QA 3G5XB 1AXTH 3FB7B 4ZUVA 2DD8H 4DESA 2COVD 2Y7NA 5BZWA 2HWZH 5EORL 2BMKA 4ZT1A 1TOXA 5LDUA 5F6IB 4CSSA 2VO5A 1YEKL 2E5EA 2XPGA 2X4SA 5CN2A 4R7DA 3ZIMA 4FFWC 4O9HL 2OXHA 2CD0A 5F1NA 4OZIE 1UCBH 3QJSB 3U2JA 1V5JA 2XWEA 1BZ9B 2EDNA 3HNTH 3I74A 1GY1A 4LCUB 2QTVA 2NY0B 1ZJAA 2JB6A 5IREA 4AC4A 2K0RA 3KWUA 2XTLA 2K9UA 2DQIH 5K33A 1U93A 5FUOH 1RUPL 1YY9D 2X70A 1W15A 4NQEE 2FWOA 4R5TA 5MI0C 1SVBA 3NSJA 4P99A 4X6CF 2AVFA 5ID1A 1OGAE 2JFCA 4HDIB 3QQXA 1MIMH 2A9NL 4NNXB 4OVUA 5KVGE 4YX2L 1SF5A 2F58L 4F7PB 2I07A 5ALCH 3W81A 3HKZA 2R2CA 3IDGA 5DUPH 2XWBB 4QY8B 1R3LA 4WKZB 4ACTA 4WTZA 4BK5C 4Y7MA 1K72A 1SBSL 3L1OL 4NRXA 2NYYD 1IFHL 1E8ZA 3IDNA 3MRRB 4X7CC 5HHNB 1O9ZA 4CADB 4N86A 1ZTXE 4QXUL 3UP6A 5DO2C 3WS6C 2Q3AA 4F27A 5ITBH 8FABB 3MOBH 5D96B 5C09A 4HPYL 1TJMA 4L8SA 4TQEL 3V4UH 2BNQE 2QZQA 2A73A 1XDTT 1LXMA 2IG2H 2X3CA 4HZLA 5CBAB 3UBXI 4G5AA 3VFUA 4HPHA 4PY8I 1E4KC 3WKYA 5JIPA 1THCA 2XX1A 4QR7A 5F3HB 1N59B 1F6AB 1R3KA 3GSOA 1BFOB 3AADB 2PO6B 2XWZA 3NFSH 4X8GA 2FYYA 2Z4QB 3QI9B 5AVXB 5L2KA 1QRNB 4I89A 4LKCB 3FSAA 2VW6A 2ITDA 4Q7DA 3O9WD 4M8VA 4XPGH 1AP2B 4GP4B 1NLDL 1X9UA 5CAYB 4YXHL 4DGWC 1BJMA 4HCRL 5DYFA 2P49B 1ZOXA 2VITB 3QRFM 4XMKL 1AE6L 3V4PL 1GIGH 3I6LE 2JCCF 5FUZH 3FU5A 2IBBA 4BM7A 3EJUA 4UANA 3QZBA 3O9WC 2OZ4A 2HH0L 3DIDA 3B2UD 5DD0L 3GIZL 2IQAA 4OTXL 4OJFH 3W2DH 3CU1A 4AUJA 4JKPH 4I1NB 4MD5B 2AV7B 2R1XB 1LDSA 1JIBA 2VR9A 1J5HA 2BRQA 1P7QB 3N40P 5L0QC 5D1QD 1MVUB 3QDAA 4NO3B 1OB0A 1MVFA 1JYNA 4X98B 4S0TD 4CC4A 4X6FA 1IEAB 1OAJA 4PGEB 4PJCB 2G60H 3SE9H 4MMYA 2P8MB 4N0YH 1MFCH 4YGAB 5AW8B 4LLMA 4HJSA 3WE1A 5TK2A 3HPJB 1G9NC 3K6IA 3B7TA 3L3OA 4RVBA 2D7NA 3V4VL 3U7AA 3APDA 5INCB 2X2JA 2YPVL 2YK1H 2E7DA 3O6LL 4RGNB 1WWBX 2HRGA 4MNQD 2CHNA 4L0ZA 1HNFA 3NCMA 1KGCE 4JHBA 3BN9D 3SEPA 3QBTB 1F6AA 4M61A 4RCAA 4HIIB 4XZUA 2IXQA 3U4BL 2OMVB 1X5ZA 5MERB 1NCHA 3EG9A 1XXFC 5IMKB 2L7EA 4ZFOA 1JPFA 4GUOA 4MVBC 3T0EC 4CN4A 5JA8B 5B4MD 1JL8A 4X7DC 4IDJL 3S98A 3MMEB 1BVNP 1MCNA 5HPMA 4MAYD 2HRPL 3II1A 4X9GA 1A6WL 5INCA 4NOBA 1S9VA 4OB5L 2GJZB 5KAQF 1R5VB 3UYPB 3CZLA 5BQ7B 3WMSA 3FH5A 4ZTPL 3OJDA 32C2B 3TJHD 3KPSB 3MVSA 4EKJA 1X9RA 1DJSA 4AYBA 1WPCA 1AIZA 4XZUB 2VW7A 2Y69B 1LEGA 1LHZA 4UNIA 1TJHH 4M4PA 1R47A 3KPOB 3ARZA 3GM8A 4NGHH 5DEFB 2KUTA 5DUBB 2EE0A 3FRPA 1U8HB 1HXMA 1ZV9A 3L3IB 2NY6B 3MRHA 3ZDYF 4J5VA 3OR6B 3D9AH 3GLDA 4O2CA 1I8IB 2VTFA 3IRCA 4K3EH 3UG4A 2LAGB 1KTKE 5TE7L 3BKCL 1RPQA 2Q6WB 3TBSB 1FFPA 1TKWB 3QDMA 3US9A 1QUPA 5DVMA 5DZOA 4ZS6D 1NBZA 4XVSH 3SKMB 4G8GD 4PV8B 1S7TB 1E6JH 3CX5J 1G7HA 4Y9FA 4PLJC 4PWKA 3V10A 3HE6D 1QI3A 4LKCA 5AVYB 3TYGL 3SDDA 2OP4L 2VMEA 5IF0B 3T3MF 2IWKA 2VDQH 1B4RA 1A3LH 3RFZB 2VAJA 1YUHB 4ANKA 4JO3H 1YEDB 5FO2A 3DPBB 5E70A 4TVPD 1NDTA 3K6DA 3L3GA 4QRRE 4U1MB 3SDCA 5KZCD 5GRJL 3NJGA 4NC2B 3SGKC 5AYQA 1CFQB 1RP9A 2Y6TE 3QJRB 1NGWB 5D71H 4YBHA 5E99H 4YFEA 2ZUYA 3MRCB 1NBYA 4HF5H 4GAAA 4B9IA 1IBYA 1MHCB 4P49A 4MNQA 5DT1H 1C7TA 3I6KA 5DVLA 3FN3A 3MROB 3JTTA 3VG0L 5C0ND 3S5ZA 5KBKA 3TT3H 1RULH 3MV7A 4Q9RH 1YA5A 1W72B 1VCAA 4NZTH 4YDKH 4MKTA 5J13C 2EDLA 4BFRA 4WGWB 1W72L 1T7VA 3QIUC 1A3RH 2I5YH 4K4KA 2ETWA 1T2XA 2X4NB 3MJ7A 4Y1AB 5DUMH 4XCCL 2HPOA 3BQUB 5HYJB 4NO0B 4UOQA 4AQOA 2NY1C 5TE4H 4Z7UF 2NNCA 3W39B 2FD6H 3LRGA 3MNZB 2Z0BA 1FO0A 1WHOA 1E4KA 2XZZA 4HAKA 2RALA 1AFVH 4GP8B 5ICXB 4HUWA 5ACZA 3HNSH 3IFOA 3KEHA 1WEJL 3VA2C 2PABA 3AFLA 2AI0H 3OLIA 1LTXA 1QX1A 2MOVA 4L3CA 3AQYA 5SX4H 4NQDE 4R4FH 4MA7H 3GMPA 1JXJA 5FGRA 5A1AA 3EH2A 5CSBA 3KW8A 2PYEA 5FGCB 2Y2WA 2AMGA 3NABL 4TTDD 1JYVA 2CXGA 5DQDH 1BAWA 2B7DT 4JFXB 5B1JC 1JWSA 4B41A 3ILPB 3K6SA 4P5RA 3B5GA 1IM9A 4JMNA 5TE4L 3P3YA 2G5BA 2XOTA 2XZQL 3DROA 4I5BA 2NY7H 4KK9C 4B9KC 3HC0A 3CUPA 2EIBA 3VI4F 3ASOB 1AHMA 1BGXL 4Z18A 3F7RA 4AQEB 1QO3B 4LDOB 5J7CC 3WAJA 4CDGC 1FYTB 4LE8A 5I1DB 1BZ8A 3TV8A 4D9LH 3QB7C 2GJ6A 4FDWA 3RWJA 2ADIA 1J11A 3KBHE 3JTSA 3H3KA 1DZBA 2DQJH 4WZ9A 2IPKA 4PJEF 1RIHL 2BS8A 4G72B 1WO2A 2C3HA 3TYGH 2GEEA 1H8SA 1ZK9A 4GNKB 3BUYA 1QBMH 4G9FA 2MHAB 4QHNB 3TJPA 4A2DA 1XH0A 2E7BA 1KV7A 5E94A 2M1KA 3QORC 2W9EL 2MPAL 3GLAA 3TU6A 4OIAA 3PL6C 3VDAA 1NAMB 2DIAA 4P2OA 3N85H 4Y1SA 2OCJA 3JVGC 4HXAL 4JB9H 3PP3K 3NIFF 4RIRA 4R7LA 2J6WA 1E50A 4L3ED 1YPZA 2AQNA 1HHGB 2DZEA 3KJ4C 3U0WH 1T03H 3D3VD 4ENED 3UJIH 3QHFH 1ET7A 4FULA 4OKVA 2VSMB 4GJTB 4P3DB 3IE9A 4Y8DC 2DJ4A 5EOTB 1O9WA 3O81A 3QULA 4LOFA 1RV6X 1OT1A 1U21A 4LQFL 3VXME 1NFKA 4L4VD 1GYAA 2B39A 3D25A 4PJ8B 3KNBB 3KGUA 4EQ2A 2FQDA 3WHXA 3KXFA 5E03A 2BSRA 4ZTEA 4KKBD 1TG8A 3QEUA 5CUSL 3VGEA 2IAMD 4UQAA 3VVVA 1BVLB 3ZKMD 3BE1H 3IM1A 3KYMA 1GR7A 4RISL 2EUZA 2UV3A 4ABQA 1DBBH 5F44A 5EUOB 5I0VA 1VACB 1TU2A 4HGWA 4B9GA 4MAUH 1EJOH 3QUXB 1WRFA 1MIEH 3GTVA 4F15C 5SWQB 1YECH 3DNKA 4XI5D 3LRSA 3KXFB 4DO5A 2ALAA 1YMMB 2EUVA 1LEIB 3CQQA 5D5MF 4PUBH 2HJLB 3E6HB 4A04A 2HRLA 5T1KD 2XFXA 1FL3A 2APTA 2ZXQA 3BVVA 3DXAA 1O5PA 4MNHB 4R3SB 2V7NB 4J4PA 2YAHA 2Z9TA 4EN2A 1T22B 4H8QA 1NIBA 4APQA 2HG0A 3BKML 4LQ1A 4TSBH 4WV1B 2YMXL 1ET8A 2WQ8A 4C54A 2KPWA 4LHJB 1NCJA 4IBVA 4G8IA 1HHGA 1CCZA 3PLYA 3ZL1A 1SJHB 4HZ1A 3VXRD 1D7FA 3B7RL 1IGCH 5E2TH 5J06A 1FIEA 3SBWC 1PLCA 3BWAB 4D8PA 4M6OL 5C0JA 3DUUB 2E6JA 5CP3A 2HFTA 3IU4H 4JPVH 1AO7B 4F24A 4X0NA 5ALBL 1IMHC 1ACYH 3GMNB 3U7WL 4TQPA 1MI5E 3MI6A 5CD3B 4PR5A 3A0OA 2VDQB 3IWVA 3SCMA 3BXNB 5SX5H 1OY3B 1IM3A 2JELL 4Z7WE 4MFHA 4XVUC 3T0XA 4NAMA 2R2BA 2J5LB 2NY6D 3TIDA 5MHSD 1RJCA 2LVCA 2HUEA 3QR1A 1JS4A 4AGPA 3H9SD 1RSFA 4I4WB 2F1EA 4TNGA 3PHOA 3K81A 1P4LA 3DOHA 1CYXA 2TSBA 1DEEB 1NDMA 5CMAA 5GZOA 5C07E 1QATA 3PWUA 1UUSA 4EUPA 3RWGB 5D5MB 1UQSB 1ZE3C 4LHUA 1FQ9C 3KPTA 2IFFL 1I3RB 4E9SA 3H7BB 3X12B 3P11H 2TAAA 3MUGB 3FTSA 5TE6H 4PJ8C 2IQ9L 4MAYB 4EJ1C 5DTFB 3VXUE 2XJKA 1D7DA 4DP7X 1KZYA 2ZJSL 4L0YA 1E27B 2D8KA 4LIQE 25C8H 4YO0B 1FVDB 5B22A 3C2SA 2LU5A 4MYWB 4C55A 2G2RA 1EH9A 2AITA 3PQYA 2RJMA 2R1YB 4G6ML 4JCLA 1TJIH 1RH8A 5E0QA 4F58L 4LARL 2DS4A 2CNYA 4Z7WA 3VXSD 4YHYB 2VQUA 1U91A 5BZDB 4L9LB 7TAAA 2D9CA 4JY5L 2DLIA 3IDUA 2B4CL 3B9EA 4OLXH 1OM9A 4PREB 4XO9A 1S9XA 2YGQA 1IAII 4XXWA 3S34L 3TWCL 4GSUA 2O26U 3DXAD 1WUZA 3K72A 1RK7A 2ADGA 2PPFA 3QZWB 3EHBC 4PCSA 2NYYC 2FHBA 2PTUA 5CFAA 3SDXE 1IC7L 1UATA 1QHPA 4P2RA 4U6TA 4J27A 4CN6A 5J57B 4F2FA 3V52L 5MENA 2OW7A 1T20A 4PIBA 1HXYA 1WIOA 1XCQB 3EJZD 3GS7A 5B1KA 3Q3GA 3N41F 3VI3F 3MFGB 3F12B 1CD1B 3BIKB 4H8HA 5DVKA 3C6SB 3MZGB 3BSGA 2G2PA 1JDAA 2HAZA 3HG1D 3LYRA 5FOJA 5GSVA 4J6RL 2Y0SA 1A7RL 3WY2A 1I9JL 4NM4L 2WTOA 4Z7VF 4HETA 3VWJA 2VITA 3QXUA 1TJGH 3FOMB 3BSHA 2O30A 4GI9A 5J8OA 5T3ZL 3VG9B 4S0SD 1IGTB 4MMXC 1S9YA 3RX7A 1P1ZB 2UWEE 1RK1B 4FQCH 4PB0H 5KYNA 1A4JA 3MLZL 4D8PB 4FQXD 3LHPH 4H20L 1U9KA 3FB7A 1FCGA 2CA3A 5DQDL 2C9SA 3QARA 5TDOB 3HLAB 3QEQA 1SYVA 2GJPA 3IJ8A 4OCNC 4KTYA 4TSCL 4ETQB 1PD1A 1AHWB 3V7AG 1C08A 3HRZA 1BBDH 2K4WA 4M29A 3RL1B 2IDCA 4FKKA 1F56A 4AV5A 4FQLL 3FOMA 1SQ2N 3GT6A 1YYCA 3LS4L 1FH5H 4H8UA 4KKCC 3K8LA 3CG8A 3LPFA 1JZ3A 4J6RH 2NY2C 5BW7C 3QH3B 3HE7D 3C9NA 3X3FH 4ANWA 1R0AL 4YSUA 1Z3GL 3NZHH 4WUUA 2FEEI 4JZJC 2VOTA 4XNYL 1SLXA 2R9HD 2PYFB 2F8XC 4G8EB 4EDWL 1FLRH 3FC8A 2ATAA 4Z95H 3HNSL 4WK2B 4NZRH 3O6FB 4HIIA 2ZOWA 3IT8D 4KX9A 4P46B 4ONGL 5HYFA 4PJFB 1ZJBA 5FYKE 2P7TB 5B39A 2PCXA 5FOBA 4FJZA 1P7HL 3QJVB 3QUYC 3QORB 1TZOA 4MXVF 4E2OA 1KYAA 4PJ9D 3UBFA 8FABA 1XGRA 2FBOJ 4PYHA 3C9NB 4PP2A 3TOPA 3GKWL 4JFFB 4Z7NE 2JJVA 5E1HB 4WY7L 1JV5A 4QNPF 1KTCA 1IL1B 1KCWA 2R4RL 4YMPA 2A6KB 4XRCB 4BZ1L 4R7DB 4XPAL 3WOVA 4EOWL 3WN5C 3ZR5A 3IMSA 2Z4QA 3QI9A 2SEBA 5F7WC 3AW5A 1NM4A 3V0GA 4YVNA 1MCQA 3EGDB 5IBLC 5AB2A 4KROB 3QEQB 1YEHH 2P80A 2V2XB 2X2UA 1LMIA 3WFCL 4NZDA 1M9SA 3EIFA 1RY7B 5CINL 5FM5O 3UBHA 3KGRA 4UYQA 4DGYL 1PZDA 4ZNEA 3FO2A 3WDJA 3ZE2B 3OKNB 3QZWA 2BHYA 5CEYB 3EDFA 2ZJSH 4ORGA 4Z7OE 3U6XS 4MBRA 3QGVA 2VO8A 5EFIA 1ZPUA 5DRXA 4P5TB 3I9GH 4OY9A 2JK5A 4QJ4B 4WKZA 2XWRA 1DBKH 1GYCA 3RGHA 3EG9B 1CICB 3SE6A 4I3SL 3IF1B 3LNEA 3AREB 3NZ8B 3RKPA 1PKQE 3QUKA 1IKOP 3FW6A 2AK1H 3GQFA 2VLLB 4C4KO 1Q8MA 3D12B 1HH6A 2VERN 4QLWA 4ABVA 5LBSH 3IGUA 4OGZA 4FLSA 1H6FA 1ZT1A 4KZDL 4YLQT 2BNQD 1T6VN 4C59B 3GD1C 1QTSA 3F83A 5J13B 4Y5XC 5JLZB 4DGIH 2L7QA 2XCMC 3E1F1 4MD4B 5JPNB 1S7RA 1OTUD 1KCLA 5T5FL 4G8GB 2OYKA 4WKXA 5EFIB 2WB7A 1JE6A 4QHUA 4D0CB 1SMDA 4L3FA 1AG0A 2VABA 5KSUB 2FGWL 2WBJD 5CD5D 4Z76B 3OTTA 3O45A 2D7TH 3I3DA 1QAWA 4S1RH 4DOHE 4Z3FA 4OGYH 3KH3A 3AT8A 3AY4A 1FRGH 2V5RA 1XVSA 3CE1A 1ZLEA 1TDQA 3G7TA 4E42A 2VLME 2OMVA 1B2WL 3PWPB 4WDIB 3IWUA 4ANXA 1Z9SA 4BFKA 2BHUA 4OZHB 2Q9OA 1BWWA 2XYCA 3VDCA 3U4BH 3R0MA 3ZUCA 4Y7OC 3FMGL 1HHJA 1OSPH 5HYIA 4P46C 3E2HC 5INDB 3T71A 4FXGB 3N43B 4KHXH 2JELH 1PLGH 4N8UA 5KSUA 5DHMC 2WXRA 4IDJH 5L4IA 2IEPA 2VE6A 4L4VB 4Z3IA 2D0GA 1KIQA 4QRUA 3WDHA 1QFWL 4BRJA 3TV3L 1DN0A 2JH2A 5CCKH 5ABAA 3KPMA 3O0RH 4X98A 3QDMD 3RFZA 5L2KB 1GJUA 3T6QC 1QPPA 4BQBA 4OZHA 3UC2A 4MZRA 1JAEA 1MCWM 3G5YA 3OXSB 4M3JA 4KY1L 5DHVH 4DP5X 2DDQL 2EYTB 1MW1A 4Y5VB 3FOLA 3QUGA 3VFSB 3L3JA 3D4YA 4UV7L 2ZF8A 2A6IB 2EADA 3C60C 4FFYH 4XP4H 3I9IA 1DLFL 1A4KB 3NFPA 4PI0A 1YNTB 2ENQA 1DFBH 3BEVA 2V6HA 4PJ7B 1SXCA 3VWJC 2C1PB 3P30H 2Y1AA 4QRPD 4N8CH 3ATDA 2EC8A 2A6DA 4PV8A 1K5NA 1HEZA 5CEZL 1KCSL 3HC4H 4K5PA 5F89A 4AK1A 2NY4C 1KPUA 5DYOA 2ZZUT 2YSTA 4PW3A 2QHRH 3WLBB 2OMYA 5DSCB 5F70A 1BHGA 5JXEA 4OLYL 1G9NL 3S88H 3TN0B 2VC2L 4B9JA 3T8VA 5D1QB 4F8NA 3MHZA 5EH1A 2P5WB 2ZUSA 2A6IA 3H0TB 2O6FA 4XPGL 3I2CH 4NWUL 5D2LB 2QKSA 3V4PA 1ZLWK 3WNIA 4RGMB 3T3MB 1X5FA 3ZL2A 1X4ZA 2FL5A 3L3HA 3FUEA 4P4RB 4XMKH 3KJ4B 2Z93A 4CVUA 5TF1H 3S35L 3MODL 3TA3B 3D2TA 4P5TA 4Y5YA 1JZFA 1AZZC 3GGWA 4FFVC 1OCWH 4NJAL 1MHCA 2JKWA 3QIBB 2YARA 1OK0A 3RVWD 4PJ5E 2ENSA 1MQ8A 4JRXB 1YEHL 4AGOA 2NYKA 4GIPD 3NBNA 2V37A 2GJ6E 3OR6A 4N2LA 2R8SH 4J3XA 3IJEA 1YNKL 1ZT1B 3TNMA 1UZ6F 1J8SA 1GCYA 1K2DA 1OP9A 4KTDL 3ULSA 5C0IA 2DIJA 1YMHA 1Z5YD 1LO3L 2QQLH 3G5YB 5EOCJ 1OT4A 4AM0B 5C6PB 1GSMA 4Y5VA 3TBTB 5C2BL 3NTCH 2LOEA 1A7OH 3EFDH 4XMTA 2FCBA 3ZYZA 4XBEH 2ESVE 4LDLB 4J3BA 4U1LB 4XPFH 4HJIA 1R9FA 4L4TD 4WO4B 2DH3A 2X09A 3QRBA 1YZZA 3R19A 1RERA 1WK0A 5FECB 1T89A 1FPTH 1U30A 3H3PL 4LCCA 1X5XA 1RZQA 2BERA 1RJYB 2V8LA 4WIQA 5MHSE 5IQNA 3QNZA 2BVQB 1DP0A 4MDJB 2NTFB 3MRJB 3UIYA 2YUWA 5IOPB 4LRIA 1FG2A 4TUOB 4ZTOL 4QGYA 2WBJC 1FE8L 5CD5C 5EUOA 5K9JL 3TO4A 4JFOA 3GRWH 5HHVL 4YPJA 2VZTA 5EU5A 1QLEB 2G0LA 2P24A 4NNPL 3GLEA 3HC2A 2UZYB 1KBKA 4UI2A 4DKTA 3QEQE 5LN8A 3GFUA 2B4CC 1PKOA 5AZEL 1DN0B 5FLVA 3BFQG 5DS8B 3C6LC 4P2OB 3LN9A 5DD5L 1T4WA 4YEFA 1VFMA 2CUIA 4R83A 4O9HH 3OKDB 1FLRL 2R27A 4M3KB 5LNGA 4QOKA 1W91A 4OZ4B 3C8KA 3EH5B 5ICZA 4PJEA 2VLJB 2WHVA 3L95B 4XBPB 3NFPB 2R0LL 2WB1A 5A2CA 3LTVA 1EGJA 3C5JB 2X6BA 1YMHB 1WBXA 3GZPA 4GOSA 4WWID 4NO0D 5EEUA 3FN0L 5JXAH 2UWEB 4UQ2B 5K9JH 4OAWA 3CFJA 4JDEA 2PPDA 4XMXA 4DKEH 2UUDK 1U8CB 1UYWH 4NC1E 1D5BB 5JNYB 4LMQE 3WY3A 4RMWA 3FZUD 1OAQH 2OTPA 2NNFA 3BPNB 3QWOA 4RAHA 4CBZA 2BP0A 3BQUC 3UG5A 1ZSDB 1KG0B 4O2EA 4OD3H 1I9IL 5MP6L 5AUMA 3BP5A 4PIRF 3ABZA 3N9GL 3EO9H 4XNBA 4DWHA 2ZOUA 5JW4R 5E51A 5T1LD 3K0WA 1LO4H 4F58H 4JRXD 1T4KB 3BKYH 2GSIB 1QLEL 5CN1A 3BSZL 4YDJB 2V17L 1AFVL 2DJMA 1X7TA 1F11B 1DQTA 1E7VA 1PDKA 5D1XB 3GIVA 4FXKA 4EF3A 1VENA 4ZO6A 5KUKA 3OMAB 1C5CH 2O5XL 5EF3A 1WC7A 4BKTC 2W07B 4WCYL 3VD4A 5HJBA 4KMLB 2V7HA 3GSXB 1A4AA 5IBTH 3HMWL 3POHA 2YZ1A 4QCIA 5JOPD 5SWSD 3MGAA 4H8PA 1ZANH 3E38A 4I0KA 1DVFC 1FJ1B 3ENEA 4XP9L 4AOFA 1DSWA 3AG1B 2D7QA 4DVRH 1DQQA 3TGXA 1IE5A 3ULVH 2XTJB 2XBZA 3CHOA 3ZHDA 4D9QE 1X5IA 1A3LL 4YO0A 4X4YA 5JMRA 4Z8FL 1I9EA 1SN2A 5HY9A 2J88L 4DCQB 3FPYA 4GY4A 2ZCLH 2ZX7A 2VXTH 5E8EB 4I0CC 1M71B 1IUZA 1R3JB 4GSDH 4DQOH 2BWDA 1LK2A 2EH7L 4FOMA 4G5ZL 2XSKA 5AOJA 2E7MA 5F88B 3ZT5A 3BX7C 1E4WL 6TAAA 4UB0H 1KDIA 2JCCA 1AR1B 3G6JA 4K8RL 3HPLA 2VLKD 4B27A 1IGFL 1TJHL 1BF8A 2D3LA 4JFTA 4Z78A 4O2FB 1HYSC 2MH4A 3BGAA 3V9FA 3V4LA 2IH3B 4OGAC 3DHUA 1SHMA 2DQTH 4KPHL 4MZ3A 4CMHC 1CDHA 1S5HB 4HJ0C 4UQBA 4MRBA 4NM8H 4MJ6A 4ZUUA 1JF1A 1F3JB 4KKLD 4ZAKB 3NVQA 3QFJD 5C0BA 1WZKA 2ZCLL 1X7SA 4I2XB 1X7QB 2X6AA 5DJZB 3U4EA 5CR8A 3RURA 2BOLA 1NBVH 2O6CA 2UVFA 1LO2H 5TH2A 2XACC 4PB9H 4ALAL 3IMTA 3Q6GH 5T1LB 2WO4A 3CFKA 1ODUA 4LPTA 4N2OA 2P44B 4LVOC 4P23C 4Q6IA 2DRUA 4S1RL 1PLBA 1W0WA 4LHUD 1CXEA 4Y5VC 3CTTA 4N3TA 5I76B 2PO6D 4NRYA 4X5XB 2EDYA 3UO8B 1V7NH 3LEVL 3FNKA 3MBEB 1WITA 3SZKC 1OAXH 1XGPA 3OKOB 5EO1B 4EZJA 1EXUB 3LXUX 4MB5A 1A9BB 2OJZL 3CCHA 4JDTH 3VD0A 3CFDB 2AK1L 2DBJA 3ZDXE 3DSNA 3QUML 5IQOA 5LBVA 3QUXD 3GIZH 1HHKB 1OTSD 3Q9PA 3MAWA 4KTGA 2C9QA 2ZOKB 1OB1B 2R0KH 4GXVH 2OMTA 3IMVA 4MCZA 2WQXA 5IFHL 3B1UA 2WBXA 1X5AA 4LP4A 3FO9B 1H5BC 1TYJA 1KF9B 1F13A 4W9DC 2NZ9C 3P0GB 3L7FB 1FA4A 3AU1A 1WD8A 2YC1B 3BH8A 1PJ9A 1I1FA 3TA3C 3ZDYE 1TTAA 3L81A 1ZDQA 3GSWB 4JKPL 3B3IA 2A4EA 4CILA 4EMZA 2XN9E 1KOAA 5I18L 4Y4HA 1W8NA 1ZT4B 2P5ED 3CDFA 4PRBB 5E4EB 5GRVL 5C08A 3CFBA 4JJ5B 1YEIL 2VH5H 2VB5A 5GGTA 4DQAA 4P4KB 3QR0A 5CZRA 2OMTB 1QZNA 2VLMD 4FP8L 3PWLA 4K73A 3WKMH 4N6QA 1F4WH 5JQIB 1IAOB 3W9EA 1CE1L 3H9SE 4XO8A 5JHLH 1QLEH 2DPKA 3D3VB 1LD9A 3ARFB 1TTFA 3WO3B 4DN4H 1AR1C 1QQDA 1P4LB 5ANMA 2X1OA 3H2QA 2WMPB 2Z1KA 2C4FT 2NR6D 2VJ0A 1RZKL 3OKKB 1XCQA 2WJ7A 1HCZA 1XO8A 2YA2A 1CFVL 1IBZA 3B3IB 4PJIF 3RZCD 4DKEL 2WLLB 2MKLC 1RK0A 2AJUL 1MCWW 4LP8A 5E2VL 4XODA 1B0WA 1NFDA 3BFOA 3FAWA 4WSGA 4OH2A 1GHFL 2QFRA 1OQXA 4F7TB 1IM3B 3SDAD 4YSQA 4BUQA 4F8TA 4ORGB 3PV6A 4NDMA 3QSKB 1TCMA 3W0WE 3AG3B 1YVLA 3MLVH 1OTUC 4HWUA 5AALA 1YG9A 4LEXL 4HK3J 4G82A 2FLRT 5GGRB 3ROLA 2LT9A 4KHTL 5TQ2H 5JW4N 4ETQA 4YLBA 2EDHA 2GTQA 3PGFL 4X6EA 5F7UA 1QBML 3MGOB 1KGXA 2D03L 5KS9F 2Z8SA 4OVVA 3HB3C 2EXTA 2FZ3B 1QVOA 4QMEA 2BY2A 4W9HC 5I6OA 3ZTCC 1THAA 1J9RA 3QIUD 4JG0L 5BO1H 5JHMA 3KPSE 3C5ZD 2GCYA 3LS5L 4Q6IB 4ZMQA 1ETZA 1SBSH 1RZFH 3GTNA 2QR0A 2R0LH 4R2GB 5D1ZC 2FATL 1HQRB 3PXHA 5H37H 4C56E 5AVUB 1TZ8A 2WW8A 3ZHNA 4H26A 2DMGA 5C6WH 2IBGA 3GMMA 1EGJH 3I50L 3W56A 1MVUA 4DERA 1XGPB 3MLVL 3OKOA 3D7PA 2NX5E 3CDZB 1UZ8A 1AQMA 1VF5C 1EZVX 2HKAA 2ICEA 1E6OL 2XVLA 1UJTA 2E6QA 1E4XI 3DX8A 5HI3C 2FTAA 3QA3A 1LO0H 1ZPLA 5D71L 1Q0EA 3ZTJG 1G7PB 4S1SH 3UX9B 2H6OA 3S36L 2CJUH 4Y19D 5F6HJ 3MV9E 1II4E 3HBPA 3MLRH 3P2TA 1ZHLB 3BAYA 3T1FB 2MKWA 4MCZB 1FZMB 2Y23A 2ZSWA 3PS6A 3VG0H 4OQTH 4H26B 5MEQA 3EFDL 4A37A 4PRDB 4E36A 5AWNL 5PCYA 1KB3A 3PQYD 4PGDB 4XPFL 4M6AA 5K59F 3V5DA 3UO1H 3EGSA 4HJGB 1SOXA 4AY0A 1H9VA 2WXIA 5EBLB 4LF3B 1CZ8H 1NH6A 4X4XA 4I77L 5IUCA 5TF1L 5KJRH 5EEVA 4Z23A 3DIVA 4UM9A 3E8VA 4B3EA 5F71A 2EYTA 4NN6B 2WO2B 2K7PA 4I9XA 3MLTA 1KNOB 5IEHA 2G0KA 1IC5L 2A73B 5CS7A 5TK4A 2Y1VA 1UWEL 2QADD 3E3QC 5DC9B 1BSIA 1IGTA 1XF4A 1HSAA 2CJ3A 2WIIA 3T3PE 3VNZA 2GJJA 4P23A 5DRWB 1MWAB 3MA9L 3ZIYA 4IOIB 4LSSL 2A74B 1T83A 3CX5K 4PGCA 5IEKB 4PJ9C 2VDNB 4GKNA 4PJHE 4TLSA 4Y2DA 4A68A 3IN0A 4WJKB 1PYWB 2FJHB 1ZS2A 3KR3H 2V2WB 2ATKA 2AXJA 1DE4A 4K8RC 5C3IA 4OI7A 3AZUA 1F8TH 2C7FA 1Z5LB 4FFZA 3S5YA 3V6OC 1YHPA 2DLTA 3FB6A 3QA3B 5I1IL 5DFVC 1U58A 4HC1A 4N5ED 4DP1X 3S8GB 5DJ6B 1F4WL 1KMGA 3SO3B 4KKRA 2JIXD 4LBEA 2OV0A 4JY5H 2DJUA 4ODXA 4WWKC 3WYRA 2AVGA 3MLUH 2F7IA 1O75A 2PCPA 2J6EA 3LNIA 3DECA 4JGJA 4PJDE 4XOAA 2EXYD 4WO4C 4YK4B 1AZCA 5IMOB 2P80D 1KY6A 1Z0MA 2AEWA 4KMTH 3VXPB 3HE7A 2CHWA 3LDBC 4M02A 4Z5RA 3RWCA 5IMLB 1R5WA 3V0HA 5TFSH 2GY7B 2Y1ZA 3KPRD 2XXMB 1RURL 5IUSA 1L9QA 1U2CA 4B9YA 2P48B 1SXBA 5FK9B 1QSEB 5KS9B 3VACA 3UTTD 2E3VA 3FQWB 4N2AA 5IM7A 3NEXA 1HWHB 1L9PA 4KQ4H 4PGJA 4HIHA 1CF8H 3SYPA 5FYKU 1KGIA 2EEFA 4H0IA 4R7VA 3GSQA 3L4YA 2WVTA 4YUEH 5SWSB 1USZA 1NC2B 4Z3TA 2EDKA 1FNGA 1JV5B 4OCYH 4EBQH 3WMPA 4JFDB 4QJ3B 2Z35A 3DYPA 2EDOA 2D0FA 4HH9B 1A6TB 3TBWB 1GKOA 2ZUUA 1MCIA 4JVUA 4F7CB