1NCOA

Structure of the antitumor protein-chromophore complex neocarzinostatin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
113
structure length
113
Chain Sequence
b'AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYDVGQCAWVDTGVLACNPADFSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HOLO-NEOCARZINOSTATIN
publication title Crystal structure of neocarzinostatin, an antitumor protein-chromophore complex.
pubmed rcsb
source organism Streptomyces carzinostaticus
molecule tags Antibacterial and antitumor protein
total genus 17
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 1ncoA00
2G0LA 2CBOA 1NCOA 1AKPA 1O5PA 1ACXA 2CBMA 2CBTA 2CBQA 1HZKA 1J5IA 2MCMA 1J48A 1NOAA 2G0KA 4JW3A 1HZLA 1J5HA
chains in the Genus database with same CATH superfamily
2QPEB 2H0JA 1WUNT 4W9HC 3UYRH 5L4JA 4FS0A 3O6KH 3RYMA 2OTWA 2OTWB 4OGXL 4URTB 2QLYA 1UT9A 1TJGH 3ROOA 4Z7UF 3MLRL 4L4TD 3E9TA 2YWZA 3ROOB 4KZEH 4N2NA 4G7VL 3ZSTA 4R83A 1E4WL 5C08A 5C08B 4OD2A 1NGQH 5CLTA 4OD2B 5FV1L 5LB1A 3K8KA 1ZLWK 1KIRA 4ZOAA 1KIRB 3OKYA 4L4VD 1DYZA 1HZHH 3N40P 2D2CC 4I9WD 4PJ7A 1WWBX 3N5AA 4YSRA 4N86A 3WKML 4AV5A 4EOWL 2C4XA 4PJIA 5JW4Q 4PJIB 1NKRA 4R7LA 4YUEH 4N3TA 3PPEA 1DL7L 2EEXA 1QUPA 3JWNC 3KYNA 3MGOA 4Z3JA 3KYNB 3MGOB 1CMOA 1FYTB 1DLHA 1DSYA 3O4LA 1ZA3A 3QORC 3QQ9D 1DLHB 3O4LB 1ZA3B 1LJMA 3I6SA 3NAAH 5FGCE 1V10A 4L1LA 1BOGA 1BOGB 2PPFA 1UGKA 2KZWA 5K5YA 1IEHA 5B39A 2DMGA 5B39B 3RWIA 1AO7A 1DQJA 5IJBC 2F7IA 3RWIB 1AO7B 1DQJB 4XODA 3AWGA 3SPHA 1GHFL 5F0LB 4XC1H 4C54A 2OMTA 4NQEE 2OMTB 1PTZA 4EXKA 3VTAA 4X9BA 3NJMA 3PJLA 2GAZA 2IH3A 4P9MH 2IH3B 3ZE2E 4XWGH 4HUCA 1WHPA 3WJLC 1B2WL 12E8L 1KV3A 4JFVA 3QIBD 1KB9K 4BFFA 4YSEA 1RUML 5IHLB 2G9HA 4J3OH 2G9HB 2HT3C 4HFUH 3PGDA 2OMYA 5L0QB 3PWUA 5AW3B 1CC3A 3PGDB 3PWUB 4C56D 4OD3H 2Z6FA 3TCXA 4CSZA 1H3PH 3AWFA 1I8IA 4GI8A 4YO0A 3QXVA 3UG5A 3S88H 1I8IB 4YO0B 1I8LA 3FQWA 3O2DL 4Y7MA 3FQWB 5KS9E 4U0RB 4XCFH 5I1GH 3VUAA 2GHWB 4XVSL 3CV5A 4AEIH 1R3JA 3HNTL 4LPXA 3MRHA 1R3JB 2EICA 4EPSA 1BHGA 4KITB 2FD6L 4MAYA 4Z0BL 4DAGL 4MAYB 1YMHB 1L7TL 3ECBB 2L8AA 3JVGA 3UG3A 1NCWH 3BLBA 2L7EA 2P5WD 3D8MA 3O9WC 3KDMA 5E2UH 1P4BL 3KDMB 4KUZL 2DQDH 3RB5A 2HJLA 1ETJA 2HJLB 1FHGA 4N0UE 4QHNA 4A04A 4JHWH 3AADB 1E5YA 1NANH 2ZUQB 4FZ8L 5CUSH 3ULUD 5B1BB 3WTXA 4HWEH 1DQML 2QR0A 1XL4A 3L5XL 4G5ZH 4LLMA 1IO4C 2PXYC 3CGTA 3EBAA 2G30A 4JFFD 3TVMC 3ETBF 3MBEA 4PRPE 1N5AA 2IDSA 1WS7A 1SM3L 3HLAA 1N5AB 3MBEB 5C0AA 3UTTD 5BV7C 5GS1A 3HLAB 3L5JA 5GS1B 5C0AB 3WFDL 3ZE1E 4XMPH 1ACYL 5HHVH 4QRPE 1F8TL 1G5AA 2VDOH 8FABA 5SWZA 3E8UH 2EDKA 8FABB 1IGJA 5SWZB 4Z9KB 3D33A 4QHPA 5JW4R 3DNKA 1JK8B 5KG9A 3QBTB 5KG9B 2FR4B 5FDWA 1X5KA 2M83A 4F5CA 3KW8A 3ULVE 4JG1H 2WIMA 3UTPE 3NCJL 1MRFL 5AW8B 5B21A 1JRHI 4KK5D 5JXED 4R26H 4PLOB 5IJCC 1KGCD 4LVHB 2ZNXA 4Z3HA 5I19H 5I26A 1OGPA 3UJJH 1BQHA 2OR7A 1BQHB 5LCVL 2DWTA 2O30A 5FGSA 1D7DA 2BVPA 2QKIC 4Y19E 2OJ1A 3OHMB 2BVPB 2JELH 3ARDC 3W57A 2J55A 3D9AH 1R75A 3LHPH 1E9OB 4R9HA 2CDFA 5KSBA 2FBJH 2CDFB 3QAZB 4ODWA 1AXTH 3D39A 4JX0A 4WWKA 3D39B 3EJPA 3W2DH 4NNXA 4WWKB 5DR5L 4JO2H 2WJ7A 1I75A 3FTWA 5J6HB 2OLDA 4MWFA 4H1LH 4MWFB 5GZOA 1XGUA 2FH6A 4P2OD 2R2CA 1XGUB 3MKKA 3TZVA 4E41D 1RZFH 3TZVB 2ZIDA 2ITEA 2RCSH 4DQAA 2E74C 5DS1A 1S4IA 4NZ8A 3HG3A 1TOXA 2XN9D 3O2DA 2OJEA 3TC9A 1BAFL 2OJEB 2CA4A 1WG3A 4B9FA 3RGBA 3EOBB 3NH7H 5HYQA 5AL8A 4PJEF 2XTJC 2BXZA 1NLDH 3K74B 1HYSD 3SE9L 1E4HA 3FCBA 4DVRH 1TXKA 2R56H 1WJ3A 3KWTA 1U58A 3D2UB 3V52L 3ML8A 2KKQA 4YR6A 4FNLL 4WKXA 3DLQR 1J8SA 3OKNA 5CILH 4YR6B 5T3ZL 4Z7QB 3OKNB 2CD0A 3FS9A 5A6MA 4GAGL 3P73A 4PLJD 5C6PB 3P73B 4JFOB 1Z5HA 3N06B 1HAWA 3GD1C 2V3FA 4KK8D 5EF2A 5IB2A 3IJSA 4XPHH 5IB2B 3IJSB 3NIGE 3SE4C 3MO1A 3ZLQC 4K3HA 3MO1B 2IDFA 3VFSA 3H9HA 6PCYA 2EE6A 3CZLA 3VFSB 3H9HB 3WNIA 5I0VA 5BOJA 1NM4A 2ZUVA 5AZEH 3MLZL 4HC1H 2XWXA 2IXQA 1M9SA 1YYLL 2IXQB 3SB3A 4M93B 3T9WA 3NJXA 4XNQA 2ZJSH 1IC7H 1MRDL 4XNQB 4Z8FL 4H2AA 2WCSA 5FS5A 5E6IA 2P24A 3V9CA 4QYAA 4GJTB 1X9QA 2P24B 1SQ2N 3FBKA 2H2PD 3E0GA 1BVNP 2R4RL 4HAFA 4M7KH 5C6TL 2NR6C 4GRWF 3F05A 4ZG1A 4YFLF 1UD4A 3D0VA 3DVGA 5GRJH 4RGOL 3D0VB 3DVGB 5C08D 3TYGH 2FVNA 5D2NC 2O61A 2MNWA 3AB0C 3B7TA 5I0DA 5BW7C 4ZX4A 4ZO6A 5DJCB 4OV6F 1C5BH 3BLPX 4PJGA 1R47A 4PJGB 4QXTA 3UPRA 5ERWA 1OZTG 4QXTB 3UEZA 3UPRB 4JEGB 2GY5A 3BX7C 4WEBL 3TV3H 2AV7A 2BVEA 3UC2A 2AV7B 1F58H 1HFUA 5KSUA 4YHIB 1ES0B 1O5DT 3SY6A 2Q2LA 1FYTD 1M3JA 5HY9A 2I60L 3NFSL 5DS8A 5HY9B 3O4LD 5D1QA 5DS8B 4Z7OB 5D1QB 1NCUA 5I28A 1PY9A 2MMXA 5F2FA 4AQEA 2BNUB 5EPMB 1JRHH 5IVZB 4DKEL 2ZOWA 2CH8A 2AQTA 4X8GA 1LE9A 3KWVA 4JRYA 4JRYB 2KH2B 5DHVH 1MCEA 1RPKA 4N6RA 5E9AA 4N6RB 1AO7D 3SQOH 4BELD 4XAWH 3GBDA 2A9NH 1F18A 4PCKA 5JIQA 3EYUL 5LXGL 2VZOA 1EQWA 3OAYH 4F9PC 2VW7A 2ZPKL 1HL5A 1NIFA 4JFDA 2EO7A 4Q6IA 5E9DA 1IGML 1I1AC 1YEFH 2BJMH 2DKMA 2H6OA 4JFDB 4Q6IB 2C9UA 4PJ9A 2FEDC 3U4BL 2PTTA 3O8XA 2XICA 3MRLA 3O8XB 2XHNA 5DFWH 2I07A 3MRLB 1TU2A 2V2TA 2IALA 1RP9A 2OMVA 4FQIL 1TU2B 4IU2A 2IALB 2OMVB 4QO1A 3ZJAA 5GGRB 2F5AL 3SGKC 2E4FA 3SDYL 3K6FA 4LOEA 5FUZL 3UG4A 3EYVA 4U7MA 3ARYA 2JH2A 3EYVB 1A7OL 2XBDA 5HYJE 2Y69B 3FTYA 3JZ7A 1S3RA 5CFAA 4YHOL 2V17H 1LO0H 3T04D 3PFQA 1JGUH 2X42A 1YNKL 1S7SB 2WK2A 3RHWK 1SXZA 2OK0L 3PAZA 4ZFQA 4OCYL 2R0WH 4P2CG 3K6NA 2QKSA 5F1IA 3QUXA 4Z7NF 1E0OB 2CNZA 3ESPA 5F1IB 1Z3GH 1U6AL 2X6MA 3QUXB 4JZJC 4MAYD 4HGKC 5J6GA 1YEWA 4YC2C 1IAII 5J6GB 2ZKHL 4YMPA 5IT2L 3KLKA 1OCOB 1Y18A 2EDEA 1MPAH 3MXWL 3KLSA 1Y18B 1OALA 5H37A 5TFSL 1B3IA 3I6KA 5I66A 3I6KB 2AFNA 5I66B 5IFAH 5E94A 2F61A 2VZ3A 2Y6SD 2EDRA 3CXDH 1G84A 3T4AA 4X6CF 2ADIA 3T4AB 1UM4H 2ADIB 3STBA 5DMGC 1RZ7H 5H4YA 3EGSA 2X2HA 3EGSB 4UF7C 3L9RB 3MBED 4JFWA 3KNBA 3ZTNH 4TSCH 3KNBB 4W6WB 1XF4A 5C07E 5C0AD 1Q9WA 2IGFL 3HE6A 3SDCC 2P26A 3HE6B 43C9A 4LU5H 43C9B 3GZOA 4LMQI 2XZAH 3B8YA 4WNQA 4CVZA 1E8YA 1Q0YL 5C97A 4CVZB 5SWZD 5I8EB 1ZGLM 5CR8A 5DO2D 2LU4A 2BIPA 2NSXA 4QR7A 3PUCA 4H20H 3OKOA 3CN0A 3KJ6H 2W0PA 3QQNA 2QZ5A 3A6CL 1K6QH 2ZWLT 1B0IA 1TEFA 1MH5A 3ASOB 3EOTH 4ZOCA 4WU7B 5HVWA 1MH5B 2PTVA 4W1TA 1HC1A 4R97C 4A2HA 4LRNL 1CLOL 2H3NA 4MJ6A 1PZ5A 3WXVL 2VXVL 2H3NB 3DMMC 3CU7A 1PZ5B 4MJ6B 1UM5L 4LLVA 2C9RA 2O26U 4ZMVA 4YDLC 4LLVB 3K72A 5J11B 1FNSH 1M9WA 2PUQT 3GJFK 3CDYA 3K72B 4TVUA 5F9WB 4ODTL 1ZLWH 3ZL2A 2AERT 3L17A 2CBPA 4K8RC 1DQDL 2PPDA 2XLLA 4OZGE 1E5CA 1ILUA 4RETB 4A67A 4CVUA 4MB5A 3KWXA 2CGYA 2JJSC 4Q8BA 1SGKA 4RNRB 3FZUD 2YXVA 5B39G 5E03A 4XTRC 4U1LB 4WI5A 5TTRA 3LRHA 2XVLA 5GRUL 5HTSA 1ECYA 1NIEA 3JXAA 1T89C 4FZEH 3D39D 1IMHC 1CLCA 4WWKD 5F7UA 3LNGA 5C9KA 4R5TA 1F56A 3HC4H 2C9AA 5C2BL 1AXSB 1G1OA 2V0AA 2X6UA 5FGCB 3ULVL 5CU9A 5D72L 5EORL 2ROXA 5GZOD 3KYKH 4O02H 2QDWA 4YBQD 1QR1A 1X4YA 4HYTB 3TZVD 2F19H 2XVBA 4FG4A 5M7QA 1QR1B 1URLA 5BUGA 3PDOA 2WANA 3DRQB 4CC4A 3PDOB 4AXWA 3PWVA 3ME0B 4AXWB 1UZ6F 1R6VA 3P0YL 4X8XA 4PCSA 1SVBA 1AS8A 4WENB 5BQ7A 2V9RA 4KKLC 5BQ7B 3BH9A 4QHKJ 3BH9B 1AGBA 2DB8A 2YQGA 3CFMA 1AGBB 1NMBH 1SMDA 4M7LT 3LRLA 1N64L 5LAXA 4HBCL 5LAXB 1UENA 2K8MA 3L1EA 5AAMA 5T8IA 2YOAA 2VDRH 2ZKYA 3D2UD 2CK0L 1KF9B 2GCYA 2ZXAA 3P4MA 5GSVA 3SOBL 2GCYB 3V0DA 3V9EA 3WKPA 5GSVB 4LRIA 4X6FB 2MWCA 4LCYA 3V6OE 4I89A 2DIEA 1YN7A 2GBUA 4LCYB 1YN7B 5EMYA 1HK6A 4Y9GA 4BFJA 5JORB 3CZEA 1OGTA 4G42A 1OGTB 1QBBA 1S6NA 4M6AA 4G42B 3PP3K 4BEIA 3H6JA 5CGYD 5CZKA 3ORJA 4N2KA 1KT2A 5IREA 5IUSA 2B0SL 1ETZA 1BBDL 1ETZB 5I5MA 5DC4B 3FH7A 3WIIH 1RZJH 2HA1A 2NY1B 5KS9A 4QXWA 5KS9B 5AYTA 4HJ1A 4KQ3H 2FYVA 1D6VL 1JFHA 2FUTA 2R2BA 3Q8BA 5C2UB 2R2BB 1D5ZB 3FSOA 1QLEH 4ADIA 4FLHA 3CHOA 1IAIH 1RZGA 3DRTA 3QEQE 4M02A 4WRLA 1RZGB 2AXJA 3DRTB 4GFTB 2K70A 3UJIL 5SWSE 4HS8H 4GO8A 2V5YA 2C7UB 1IZKA 1FVCA 2XQYA 2DLEA 4O5LL 2NY2C 4XP1H 4GINA 4IGBC 1FA4A 4N0UA 3NSFA 3ZHFA 4N0UB 4PY7A 2ZWZA 5ABAA 2DS4A 4TVPH 5FKAA 5FKAB 3I9GH 4PRPA 2FCBA 1BZ9A 4IS6A 1D9KC 2GSGA 3VYPA 4IS6B 5L8LB 1HL8A 1XB3A 1EWHA 2VZUA 4HU2A 3MRNA 2QADB 2X3BA 3Q6FA 4F8LA 3MRNB 3Q6FB 1Z9PA 4QRPA 4XI5D 4IOFC 4QRPB 2VXUL 4WKZA 1Q1JH 1BQHG 4WKZB 1FH2A 2Q9OA 2ODIA 3CLEL 4NN6C 4AKOA 1TEYA 4AKPA 4FULA 4JQXC 2C1OA 3J2PA 3NSCA 1TO5A 4HIIA 5IROC 3IFOA 5D1QD 5ID0A 4BQCA 3IFOB 1GW0A 5ID0B 1OCWH 1MLBA 2CO3A 2EEFA 2Q20A 5AB0A 1MLBB 3IAGC 3Q1SL 5K9JL 2RQ8A 3VXTB 2E3VA 4PJCE 4BK4A 3MX0A 4L9LA 4H13C 4ODUA 3MX0B 3DARA 1J48A 4L9LB 4ODUB 4JRYD 3UDWC 1KCSH 3X14A 2DQGL 4WW2F 2DLTA 3X14B 3A4AA 2YAEA 4ODHL 1A8JH 5CN1A 4PGBB 5E1IA 3E2HC 2G60L 1BLIA 2G5BA 3QISA 4B9KC 5A3IC 4Y19A 2G5BB 3KS0H 4YIQA 5LNDA 4Y19B 3NPSC 4OZHF 4WFHE 2MCPL 3MRGA 1OF2A 3ABMB 3MRGB 3CQPA 5EN2A 3WFBH 1OF2B 2XZQL 5T3ZD 5EN2B 4JFDD 3G9AB 5DDHA 2FEEL 4JHAL 2BSCA 2C1PB 1E5UI 4F33B 3PHAA 3QW9A 4ZMNA 1J0YA 2XZCH 3S35X 3MJ6A 3O8XD 5K59F 1LEKA 2XTJE 1LEKB 2YK1L 4NGHL 5FC9A 2HT2C 3BAEL 4UT9L 5I6MA 2DYPA 1FV1A 4UQ2A 2DYPB 3UCQA 1MXGA 1FV1B 2QPDB 3WLWC 4ZSOE 3I75A 2Z1PA 4PRIE 2FT6A 3I75B 5C0EA 3QA3A 4X5XA 5HGGS 5C0EB 3QA3B 4X5XB 2WJ5A 4XZUA 4XZUB 4P2QE 3V4VL 3U46A 5DK2A 3KM1A 3U46B 5DK2B 4D94A 2JCCE 1S9YA 2ZWNA 4S1DD 2WUCH 1XEDA 3A6BH 3QUXD 2AQ2A 4M6NH 4RBPH 5I73C 4IBVA 3UIYA 5IBTL 4HZLA 1Y6KR 2UXVA 3TO4A 3VFRA 4G3YH 3TO4B 3VFRB 3VFGH 1GIGH 5DSCA 4H5SA 5CF3A 2HRHA 2PCYA 4AT6A 2IGTA 3LB6D 4AT6B 1JN6A 4N2EA 5CCGE 4FFZH 4LBEB 1I1YA 1I1YB 2RJMA 3WIAA 1N18A 4L29B 4NP9A 4XZ4A 2PO6A 3RP1A 2PO6B 4G80A 3ESOA 4TNGA 9CGTA 2V6HA 4G80B 4ZODA 3ZYOA 1QUNA 3ULUF 1OO2A 2AI0L 3HE6D 1QUNB 1H6TA 3LKQB 3U2SA 5MI0B 3U2SB 5D2NE 5LXVA 4U2ZA 3ZDZF 2P7TB 3U1SH 2HT4C 4UQAA 3RL2A 2RHEA 4Y5VC 3RL2B 2B77A 3C60A 3C60B 4M3KB 1BQRA 1PG7H 2BH0A 4J3OC 3O6FC 3FPYA 3ARZA 4LASH 2N56A 1AQMA 5DK3A 3CIAA 4XPGL 3FUNA 1YC7A 4UYPA 3U82B 2Y22A 2E7LA 2QSQA 1CZ8L 3KG5A 1CBJA 3HZ3A 5D71L 1F1GA 5ACZA 3K2UH 3QUML 5ACZB 1T2QL 4ZMOA 1UM6H 3ETTA 5E6SB 5HJ3A 2HX8A 3DX6A 5LHDA 5HJ3B 1MF2H 4CADA 2P8PA 1QHPA 1KY6A 3DX6B 2BOCA 1LE5A 1LE5B 4RSVA 2A0LD 2BOCB 5FHBL 4JCLA 2I5YH 4FA6A 1NAMH 1I7RA 3WENA 2D4DA 1MCDA 1I7RB 1U30A 4U1JA 2BHZA 5EOCL 5LNEA 4U1JB 4KZDH 3QWQB 4LDEB 5C0RH 5KUKA 4HCRL 5AW5B 4UT9A 4CMHB 3AY4A 3UJTL 1I1FA 4I18B 2X2IA 1I1FB 1JGDA 3BDYL 1RIHH 3K2MC 1JGDB 3OKKA 5CJOH 4BWWA 1EANA 2FSEB 3OKKB 4L5FE 4N0CD 2NLJB 4XB3A 2A73A 1DDTA 2GFBA 2IPUG 3L6FA 1QSEE 2GFBB 2Z1KA 3L6FB 4MVBD 3RVTD 2NW3B 4C4KO 3V4VA 3J27A 1BJMA 2UZIL 3MLTA 4LO9A 4DFHA 5IUCA 1VDGA 3MLTB 2VDNL 1M7XA 3SKJH 1ADQL 3BDBA 3T0BA 3ZU8A 4F7EA 2DQHH 2X0WA 4F7EB 5T3XE 5IJVA 3LEXA 3Q5OA 4P23A 5IJVB 3LEXB 4MNHB 2X38A 1IGYA 2BERA 4P23B 3H53A 1IGYB 4ABWA 2NZIA 1ZRUA 3D6GA 3HKZA 4NQTA 2DF3A 3R4RA 1BWMA 4HK3J 3NCCB 1OTSD 5DEGA 1BXXA 4BHUI 4FA7B 4TTDC 2YKLH 1YRKA 2X5PA 2F1BA 4PRAA 4Y5XC 5H37G 3ARFA 5FCUL 1I7ZA 4GMSL 1IT9H 3ARFB 4JO4H 1I7ZB 3G6JE 1QFWI 5HYJA 3C6EA 2H4EA 5HYJB 5CINL 4Z7WE 4GXUM 5AOKA 2R39A 4HJJH 1KBPA 2NY1D 2V5TA 3D4CA 3Q9PA 5DD3H 2AEOA 4F7CB 2XN1A 3LN9A 4Y1SA 3RPBA 3ZHLA 4HU8A 4OZ4A 1PD1A 4LSDA 4OZ4B 3JYCA 4UNUA 1U3NA 4MQXD 1FDLL 3VWKC 5B22A 1A6VH 3QNYB 2KDYA 2BVUA 1WFUA 3IDJA 3AG2B 4PP2B 5DO8A 2HFGL 2KMWA 3IDJB 2FZ3A 1YECL 3TEUA 3B2DC 2FZ3B 4H44C 4D9RE 3QE5A 3NZUA 2DBLH 3B34A 3GDBA 4Q9RL 2CMRH 4Q9QL 5F7WC 5GGVL 3EAKA 3X1NA 4NJ9H 4M4PA 4OKVA 1TSHA 2WTPA 4OKVB 5AOZA 2K0RA 2J2ZA 2J2ZB 4F1ZA 5DJ8A 1QKZH 5DJ8B 3V10A 2EYSA 3QUMA 5D5ME 2EYSB 3QUMB 5IVXF 4KTDL 1ZHKA 2J6EL 1WTLA 2ICCA 5C07A 4FJ6A 2ZAHA 5C07B 2QADD 1KCVH 1N3NB 2BFVH 2C3XA 2BIOA 4QRPD 2AQQA 1YZZA 2VN3A 4ZNEE 1G9HA 2YQ2A 3ZL4H 4MRBA 5CJQL 1AG6A 1B6DA 1PNDA 5EEVA 1NIBA 3HPJA 3HPJB 4WWPA 5BV7L 4XHJD 4BFIA 4BGDA 1EK3A 4HCRA 3GHBH 1KN4H 5ICYA 2NT1A 2PW2A 4WTZA 2R69L 3D5OF 4OLWL 4XVUD 2PW2B 2GTWA 3SY0B 5ICYB 3ULVD 3MSPA 3RFZC 2GTWB 1CN4A 1VFBA 3BFOA 3VFUA 3CVIL 1VFBB 3FN3A 3JVFC 3VFUB 4XPAH 3OR6A 1TVBA 4PSRA 3OR6B 1TVBB 1TPXC 5FFOA 1ZDQA 3CFDA 3QORA 4UZUA 3CFDB 3QORB 4L37B 1KTLA 3MRPA 4OZGA 1KTLB 3GRWH 3MRPB 4OZGB 3L3IB 4ZBJA 5CP3A 1ADQA 2VDNB 3LN4A 2HFEA 1U8PA 3DUUA 3LN4B 4G7RB 3MQIA 1U8PB 4Y19D 3DUUB 4FMFA 4LEOA 4LEOB 1BLNB 5AALA 5GRXG 4DTGH 1RIUL 4Q14A 4TPRH 1Q0EA 2BIQA 2X53A 4NBZB 15C8H 1QO3A 1T0NA 4NOBA 1HJBC 1QO3B 5KSAC 2X87A 4EO5A 3B37A 4WHTB 1KLGA 4PJAE 1BA9A 1ORSB 1KLGB 1S7RA 5GRWA 3MR9A 2DYPD 1S7RB 3SSGA 3MR9B 1UWYA 3WJLA 4UI2A 4LZKA 4XOCA 1AKPA 4MXWH 1HCYA 3P40A 3IVKB 5D7LE 5B3JE 4DP1X 2KERA 4J6RH 2LLLA 2I9TA 2F1AA 2I9TB 1IQDA 2AK1H 1IQDB 3VFNA 1JI2A 1EEYA 2FJSA 3BKJH 3LN5A 4GXVL 2OW7A 1EEYB 3LN5B 1IRAY 3V6OA 3M8OH 1TETH 2GBAA 4MB4A 3R06A 3OAUH 3MAWA 3R06B 2CGZA 1GY1A 2YD3A 3TO4D 4B97A 4YFLI 5A6IA 4K3EH 1U8KA 5AEAA 1U8KB 1BQSA 1LILA 4WUKL 1X5XA 3AZUA 1KEML 1QFWH 3RPIA 4RRPM 5L8KB 3P4OA 4UWQB 3FN0H 3L16A 3RPIB 2XQYG 4EMZA 1A3QA 5LQBL 5AFAA 4GLRI 2PO6D 3V5HA 1CCZA 1WFOA 3O9WB 4IOIA 3V5HB 4IOIB 1NMAH 1JJUA 4YSOA 2EIZA 3MRBB 4H0LC 4XP5H 3TX4A 4NPYA 5BZXA 2ZICA 4NPYB 5D4QA 2LVCA 2BO0A 2PXYA 2PWDA 3QEQA 1KZYA 1CGSH 3QEQB 2PXYB 3TVMA 5SWSA 3AG1B 3IJ7A 1JK9A 3TVMB 2ADJA 2ICWI 3C60D 1JK9B 5SWSB 2H26A 2ADJB 5BV7B 4DGWC 1KB5H 2H26B 4G8IA 3AS1A 4WY7L 5HVHC 2O6CA 2AEPL 2R69A 4G8IB 4ZDHA 3RTQC 4PJFE 2MPAH 1A6TB 4ZDHB 3CFIC 4U6YA 4X8JA 4OLUL 4U6YB 2AQSA 2KL6A 4X8JB 4Y9FA 4QLWA 3LIUA 1RL1A 4F37F 2FECI 1CUOA 1IC4H 3APCA 4QUOA 4G6KH 4P0DA 1HHJA 3UTZA 3QUGA 3UTZB 5EEXA 5F0JB 4LSTH 4PB9H 2VDKB 4LVEA 5AZ2H 2C9PA 1DBJL 1GPOL 1P1VA 2N7SA 3LH8A 1MLCB 4UT7L 4IW4C 3BJLA 3ZRSA 1GVIA 3KM2A 4IBZA 1F2QA 1ZAGA 1RZKH 2YUWA 2EP6A 3Q2NA 1X5HA 1S9KC 1CLYH 1IGCH 4KDVA 1LLAA 4ZX6A 1ZS8A 3SYQA 4D3CL 5EEUA 1N2RA 3IFLL 1ZS8B 3PXLA 5TPWH 4YSAA 1N2RB 2QKIB 1F4YL 3ARDA 3N41B 3W56A 4M48H 3ARDB 5EIIB 2OW6A 2EIDA 2IAAC 1OAUH 3V0IA 4PJCA 3WD5H 1L5GA 4PJCB 1L5GB 4GG6B 4YHZL 4NCDA 3D05A 5F72S 3LXBA 4WJKB 5ADOL 4XO9A 1LO2L 1NAKH 3U9PH 5BOZG 2BHUA 4RFNC 1AZZC 3MRIA 2G5UA 3NFNA 4RX4A 4WGVB 3FTXA 3TLRA 3MRIB 3BKML 4OCMC 4DGIH 4LPVA 3R19A 3ECQA 4NKQB 3SDXB 1NCGA 4P23D 5SX4I 1NFDF 3SPVA 5DJ2A 3SPVB 5CAYB 2IFFL 5DJ2B 1L6PA 3BPOC 3DYPA 4AMKL 4U7KA 2FWLB 3SOTA 2EUVA 5AOJA 3M88A 4KO6A 5AOLA 3ML9A 4PBDA 2XTJB 2ROYA 4FHKA 1G7MA 4QGYA 1G7MB 3ZE0E 1HOCA 4XH2A 3ARFD 4XH2B 3QCVH 4L5FL 4PRIA 3C2AH 4YZFF 4Q9CA 3T6ZA 3VSVA 1BXUA 5HYJD 2YC1A 1GCFA 1DN2A 2BINA 2R27A 2YC1B 3JT0A 2AEWA 4H88L 4YXLH 1CXLA 2ZCLH 2GQHA 4P2QA 4N6QA 4P2QB 1I9EA 4XPTL 4A66A 3FCSA 1F4HA 5DGQA 1MFNA 3FCSB 2WOBA 5IW6A 2P80D 3SE4A 2JCCA 1MIEL 3QR1A 4OCXH 5T3XL 1NJ9A 2JCCB 4BINA 4BIKA 2P5EB 3BC9A 4V1DE 1NJ9B 5EU7C 4KVNL 1VZIA 4IU3A 2DQCH 3T2LA 1WT5C 3KPQA 2HJKB 3KPQB 4GRWH 3APNA 2JKIS 1V3MA 2QVFB 1VACA 1VZHA 1AVAA 3L4VA 4HV8A 2EE2A 4HV8B 1CXKA 1JPTH 3CN4A 1N10A 1EZLA 4KI5C 5EOCJ 3IMUA 1AI1H 3FSVA 1ZSHA 3DTXB 4XP6H 1AANA 5DFTA 3TURA 4GLRH 4PWIA 1KTDA 4OBSA 4KXAA 1KTDB 2MSPA 5C07D 4P4RA 4OUUB 3K1DA 5T1DL 2VMFA 4P4RB 3ZDYB 3BSZH 5DJZB 5ANME 1D7CA 4RIRA 4FFVC 5D2NA 1KELL 4LOVA 4DN4L 4RIRB 3HNVL 4M7LH 5D2NB 4IK6A 3AB0B 2Y1YA 3MBWA 5BW7A 2ADYA 3MBWB 2ZX8A 4GQ9L 4UANA 3CDFA 5CHNA 2YXWA 5TQ2H 4WCYH 4GKSA 2DDQL 4GKSB 3FFCE 5FLVA 1Y07A 2DH3A 1MN4A 3TT3L 3HC3L 1EXHA 5I6PA 1J0KA 1IC5L 3S37X 4FTVE 1INEH 3NUKA 3TWCH 1XCXA 3FT1A 4OBRA 3LD8C 1RZJC 3QORD 3CMOL 1JZ2A 2RH0A 3QSKB 4M43L 1NPJA 2A6DB 3WFHB 1QTPA 1TF4A 2Q3AA 3L2NA 1OSZB 1ONQA 1IGIH 3VFOA 1ONQB 3VFOB 2VW6A 2WXGA 5I1KH 4Y2LA 1RVFL 3GI9L 4ELME 1ZANH 4FD0A 4JR9H 4NI6A 2I32A 4WDIA 3HI6L 4K8RL 1A4CA 3LS4H 4WDIB 2CRYA 5TE7H 1BJ8A 5KVGH 4MASA 4LSQL 3K0YA 5HDBF 3G5XA 3FONA 2CUMA 1DEDA 2IPKA 4WGKA 3G5XB 5GHWH 3FONB 3RDTC 3SE3C 4F9PA 4YDKH 5KYXA 4EBQL 2ALWA 4RDBA 5KYXB 3Q05A 1I1AA 1C5CH 4XT1C 1N6VA 2ILLA 1I1AB 2Y06H 3L9YA 5I1JL 2ZD0A 3BD5A 3G9VA 3TWYA 3AJ7A 1QSEA 4FXGC 2J5WA 2BVYA 5BJTA 5BJTB 1OTUC 1SYSA 2WNWA 4OGAC 1QTSA 1SYSB 2XV3A 2CRZA 2HT3D 4R3SA 3SGKA 4R3SB 1P6WA 2DQJL 5IG7A 1R0AL 1RCYA 2OMZA 5IG7B 3HHSA 5SX4H 5TE6H 4PGZA 3IYLW 5EC1B 1WAAE 4FNTA 3KVQA 1RMFL 1WSST 1Q94A 1JF5A 1Q94B 4P05A 2W9DL 2B15A 2ZF8A 5E8DH 2IAMB 3SBWC 4GNKB 3ZY7A 4XNMA 4JZJA 4QIRA 2B4CH 3HHMA 2OTPA 4JZJB 2W8CA 4OUOA 3G6JA 3QDME 4YC2B 3G6JB 2PWHA 4EIBA 2EEBA 3BP6A 2VDQL 1D5IL 4M00A 4WU5A 1IKFH 3BP6B 3E6FA 4QMEA 1XXDC 4WU5B 5TK4A 3E6FB 2FNBA 1H9VA 1GZQA 3O9WD 4N28A 4WTWA 1SLUA 2X7LA 2X7LB 2ZXEB 3AM8C 2X4SB 3PQYB 4LARL 1K5WA 3FDWA 2WLJA 2Z35A 5JHLL 5A2CA 1FHNA 2Z35B 3QEQD 2PXYD 3P2TA 5T1LA 3JYBA 1N8ZA 3LKRA 3UBGA 5T1LB 3WCYA 3LKRB 3TVMD 1WICA 3FSAA 5SWSD 1HL4A 4N9GA 4E9YA 1J8RA 4N9GB 4AQ8C 4BE6A 5EEZA 2DAVA 3SDCA 1RK0A 1OP4A 4O9HL 2VL5A 1RK0B 3IKKA 3C9NA 3EGXA 2XXFA 3C9NB 3O11A 1FVDB 3EGXB 3GO1H 3O11B 2CRMA 1A6WH 1P7BA 3GKWH 5T33H 3RWDA 5CKAA 5J7CC 1CR9L 3INUH 3LKSB 4D0CA 4WTZG 4MMYA 1NUFA 5D5MA 1TMCB 4MMYB 1KGJA 5D5MB 4YWGH 3ZL1A 4LVNC 4HALA 1JZ3A 3TGXA 3MRMA 4BFGA 1MAML 4R97B 4U6VL 1OOWA 1WPCA 4P59L 5CSZA 2CLRA 2FLMA 3H9SE 3DMMA 1X7TA 3VXUB 4C55A 1OKEA 3DMMB 2WXRA 4F15C 4PB0H 3F5WA 1C1EH 1U2YA 3F5WB 4L1BA 4ZNEA 4YDLB 3MUJA 1SY6L 3NZHL 3LEYL 1J5OH 2DIAA 3SGJA 1WGVA 2HG5A 1OVZA 5T5FH 2F18A 2JJSA 1U8NA 1J1XH 3KHOA 4KPHL 2ZXQA 4K3DL 1U8NB 4DO5A 1SEBA 3O41A 5TGBA 3ARDD 3O41B 5TGBB 4TF4A 2DQMA 2LW3A 3ALPA 4POYA 5HYSA 2EH7H 3IDXH 1GGCH 3DGGA 1CXHA 1FGVH 1T89A 1MCRA 5CSBA 1IBFA 3DGGB 4AOFA 3UC0H 4FG6C 5ENWB 5GRVL 4EN3C 2FGWH 1ETA1 5GJSH 3AS3A 3N1FC 3HN5A 5IESL 3SD2A 4HXAH 3EKCA 4RX4D 4WFHD 3VI4E 2IWEA 3HFML 4Y0GA 4N0YL 4QHUB 4GFXA 1WS8A 2Z3FA 2YSTA 1WZ1L 3MV8E 1T83C 2R8SL 2ZYSA 1FE8H 1JGVH 4AVKA 3RIFK 3LQZA 3L7EA 1QNZH 3LQZB 2JWYA 2AHIA 3L7EB 2XTJD 4PJAA 3HR6A 3UYRL 4PJAB 4JO5A 3LY6A 3I9PA 3WY2A 3O6KL 5FYKH 3DGCR 4MXQC 2H32A 1F90H 1IE5A 2D7TH 4JKPH 4X42A 1MNUH 3FYIB 3RRQA 1TJGL 2VDQB 5D7LA 2KZ1B 3DX0A 5D7LB 3VXPB 3WTTA 4KZEL 4OI7A 2JKTM 4DEWA 2VDMH 4P2QD 2D9CA 1VKXA 4PUBH 3F83A 1VKXB 5DUJA 1P0SE 4TLUA 2NRDA 3HMWH 3VG0H 2QV2A 1NGQL 5JHLA 2P5ED 4FQ2H 4JRLA 3A23A 4UB0H 5G55A 4AVJA 1ZT4A 4OCWH 1ZT4B 5MEQA 1XGRB 5FGBC 5MEQB 1JVOA 1Q9LB 3WUZA 1JDDA 1HZHL 1HILB 3FRPA 5EO1B 4G1MA 3BW9A 3FRPB 5AW7B 2ZP9A 4G1MB 3BW9B 3V5DA 4ZUSA 4ZUSB 3V5DB 4F37K 4B50A 4PJDB 3I50H 4UOQA 1MOEA 5FA4B 3OAZK 1HXYA 2ITDA 5CBAA 4AK1A 2O5NA 3RWFA 2Q10A 3KLDA 2FK9A 3RWFB 1OAYH 2YD2A 5FLUA 3NAAL 2NR6D 2X6AA 3D85B 4FQJH 2NY2B 2BNQE 4IGBA 3BIBX 3WO4C 1K85A 3N1MC 3KAAA 4KU1A 2VXQH 3RX5A 5KW9H 3N43F 2WYZA 4PI2A 1SY6A 4NP4H 4Q2ZA 4KDTC 1U8QA 2ADFH 2VO5A 3OMIB 4Q2ZB 3U83A 1D9KA 1I9JH 3L7FA 1CGUA 1D9KB 3L7FB 2XWJA 2ICEC 3WNMA 3OXSA 2XWJB 4PJFA 4TS6A 3OXSB 4XC1L 4PJFB 1GKOA 4HJUA 4LSRL 3BEWA 3ARUA 1IGFH 3BEWB 1KYUA 4YFEA 1WCQA 4P9ML 4PJHF 4NN6B 1FNGA 3AW5A 1VPOH 4I1RA 3SKNA 4DOHE 1FNGB 2VCOA 4JJHA 5EIIG 3SPCA 3I6GB 1W0YT 3U0TA 5J8OA 1SOXA 3U0TB 3HAEH 1U3ZA 3QK0A 4HFUL 3X12A 1HH9A 1HINL 2H5UA 3X12B 1KYOJ 1HH9B 1NICA 1U92A 3P02A 3R1GH 3IF1A 1U92B 2AVGA 4NQCB 4F91B 5B7FA 1JYWA 3UDWA 1HU8A 1H3PL 3PU7A 1VZGA 4X6DE 3S88L 2IDTA 1QSFE 4YDJB 4HOXA 1VFOA 1D2PA 2A9BA 4XCEA 1OAQH 3ZHDA 5I1GL 4XCEB 3MJGX 1CXFA 1OB1B 3E2HB 4M5TA 4MA3A 4AEIL 3EXJA 4MA3B 3CX5K 2EDHA 3I9IA 1E7UA 4LCIH 3NPSB 1FG2A 1OHZA 1PS3A 4XBPA 1TEGA 4XBPB 4JRXE 4N1HB 2WTOA 4UTBL 3IS0X 3SKMA 1I1AD 4HUVA 3SKMB 1NCWL 5D4HA 4HUVB 2FEDD 1NOLA 1ZCRA 1F4AA 1K3ZA 1JV5A 1QTYT 3ARGC 3EYSH 1JV5B 2NX5E 1DUYA 1F4XH 1OB0A 5F1NA 2X1XR 1DUYB 1ECZA 3PG2A 1K2DA 5F1NB 4DIXA 5T3XD 5E24E 4QEGA 1K2DB 2AJVH 3EFDH 2Z0BA 4HWEL 5C70A 2X3AA 4G5ZL 3U6XA 4YDNA 5CGBA 4QRTB 1TSRA 3PWNB 1E9QA 2XN0A 1KPUA 4QAMB 5DUPH 2F53E 3RI5F 1KPUB 5LG1A 3OMNB 4HLZH 4XX1G 5JDSA 2QHRH 2YN3A 1NBVH 5M95B 5JDSB 3H7BA 2IAMD 3H7BB 3HOGA 3W5MA 4H8PA 4XMPL 5HHVL 4OLYH 5GGUA 5I73B 3ZE0B 2VDOL 5GGUB 3E8UL 3M7FB 4JS7A 5DJ0A 2YD7A 5DJ0B 3OZ9L 4M5YH 3AGWA 1NH6A 2X2YA 3VD9A 1JD7A 1BQ5A 3IWUA 2WUBH 5DHDA 3PQYD 5AB1A 3HG5A 4KY1H 2Z91A 4LOFA 4ISVA 4KI5E 2Z91B 1EO5A 2A83A 3FU9A 1GAFH 1UKSA 4ISVB 4KV5F 4V1DA 4R26L 2X6BA 5DMGD 4KQ4H 4OCSL 4UV4H 5EU6E 1JPST 2HX7A 4PSPA 5T1LD 3BJ91 1BREA 4OLXH 3KPLB 5I19L 1JZDC 2L7UA 3UJJL 1A1MA 4D9RD 2EEDA 1A1MB 3X17A 2FT7A 1FFTB 4KUCD 2C3VA 4GG8A 2YLKA 4NNPH 2C3VB 4GG8B 2JELL 3DHMA 3OD3A 2EDXA 3D9AL 3LHPL 3W38A 1DUZB 2FBJL 5TK2A 3WNPA 2NCMA 2GIMA 1AXTL 2WLIB 1HTYA 3AT8A 4Y5VB 3W2DL 1DZ0A 3DX9A 4JO2L 1DJGA 4J3BA 4DN3H 4F8NA 3DX9B 2XI9A 3NCBB 5KTEL 4FE9A 3O6FA 4X5RA 3O6FB 4LCWE 5ANMA 4Q6KA 3VXUD 5ES4B 5ANMB 3DMMD 1AR1C 1B0GA 1RZFL 2P3YA 5F8QC 2RCSL 5BXFB 1B0GB 3A67H 4BK5C 2ZAGA 2OQJB 4PRNA 1O7SA 2EH8H 4ZMZA 4K8RD 3ILPA 3FFCA 3NH7L 2CRIA 3ILPB 3FFCB 2PP9A 4BM7A 5IMKB 4PIRF 1NLDL 2ZP0T 5GS2H 3EJCA 4IRSC 4XTRD 5DRWB 4FA8A 1HEHC 2X12A 3CFBA 4DVRL 4UTBA 4PGJA 3F7YA 5JZ7C 2BY1A 3CFBB 1J5CA 4X8CA 4FTVA 3F7YB 3RX9A 4FTVB 5CILL 4U2YA 2NDFA 4IMKC 2XC8A 2APSA 2VR9A 3S5LA 3UBFA 4NRXA 4GI9A 3S5LB 4NRXB 1JZIA 3VMNA 1A25A 3FO9A 3MLPA 3FO9B 1K9TA 1U3JA 3GJEA 1JZGA 4XPHL 3GJEB 3NEOA 3T8XB 4FN0A 2BS8A 4TVPE 1UKTA 4ELMA 1L3WA 4R7DA 4ELMB 1U21A 1MVYA 2DWYA 3ILEA 3L3OC 4R7DB 3IMBA 4RFEB 4HC1L 1RV6X 3LRKA 4KKLD 3APFA 1F6AA 4RCAA 5A43C 1F6AB 4DVBA 1XR8A 4LDLB 3K80A 4DVBB 1XR8B 2ZJSL 1IC7L 3CXHJ 4LMQE 1ZLSH 3V0JA 5J1SC 1MG2C 5EO9A 2VDOB 4E9QA 1L4IA 5IVOA 5EO9B 3WAKA 3V7MA 1JWUA 3KEHA 1JWUB 5B4MC 2J71A 5CEZH 1XAKA 1PD0A 1NWPA 3LOWA 4OAWA 5D7LD 3WJMA 4AW4A 4WW1B 2YMTA 3WJMB 4FI6A 2WHVA 5EG6C 3VRJA 4K5MA 3VRJB 5F71A 2JXMA 5GRJL 1WBZA 5D7EA 1QLFB 2JXMB 1MCPH 1WBZB 4Y5XA 2IBZY 4YDVA 3BKYH 4Y5XB 3TYGL 1KXVC 4YDVB 1D6EA 1BXAA 1SXSA 2E6QA 4M6OH 1WAAA 2B1HH 1AMYA 5KVFE 2KYIA 1RZKC 2FH8A 4BFNA 3QRFM 1C5BL 2KHAA 4BK8A 4F7TA 2R9HC 2XPGA 4F7TB 2XPGB 4WSGA 4YXHL 1CIDA 3CVCA 4I77H 5DI8B 3VWKA 4XXCC 3RY5A 3VWKB 4I0PC 3DXAE 3QDMA 3TV3L 1A47A 1F58L 3L81A 5F3FA 4YLBA 4PG9A 3T4YA 4PG9B 4A2LA 5GGSY 3T4YB 4ZNCD 2JB5L 2X70A 4H1LA 2X70B 3D85D 2NY2D 4H1LB 4LSVH 4WFFE 1P7HL 1JRHL 4XPFH 2DICA 2EE3A 1DBKH 2BSRA 3FO2A 5IHUL 2BSRB 3FO2B 1A4KA 4W9KC 1A4KB 3K5SA 2WQAA 5DZNA 1LEIA 5DJXB 1LEIB 1OM9A 5ALCL 1D9KD 2Z8SA 3SQOL 5DD5H 1BZ7A 4XAWL 2A9NL 1R33A 2GITA 1KACB 2QBWA 4OV5B 2GITB 4IOFD 2H8PA 2GJZA 2H8PB 5DZVA 2B16A 5EV7A 3VFTA 2GJZB 4DGYL 1T0PB 3VFTB 4UIKL 3X11A 1YEFL 2BJML 4JQIH 3LSOA 1OQXA 5F7YC 3P4LA 2J88H 1KWKA 5IROD 2PF6A 5HYSG 4TSAH 1A02N 5KBPA 4AGOA 3H9SA 6TAAA 4GUOA 3RFZB 1LYQA 3H9SB 4XNDA 5I76A 3IGFA 3B6SA 1DVSA 2VERN 3FCTA 4NQCD 5I76B 3B6SB 1FI8C 3FCTB 4LSPL 4WEUD 1N6UA 3LPWA 1RPUA 2C3GA 4CRPA 2PKDA 2V17L 4BZ1L 1LO0L 4AVHA 4NWUH 1ZT1A 1JGUL 2DL9A 5A3ID 1CS6A 4JNXA 1ZT1B 4KO5A 1YCSA 2GC7C 3Q0HA 5CIPH 3BAIA 1JHTA 1Z3GL 35C8H 3NP4A 1ZPUA 5GIRA 3VB9A 1JHTB 1H19A 5GIRB 4A55A 2WXHA 5FOBA 2UZPA 5F9OH 5ABDE 2RR3A 2WWKO 5FOBB 1MPAL 3ZTJH 3TN0C 2ZCKH 1DQQA 1DQQB 5KSAB 4AQOA 4ATTA 1M7IA 2H6PB 1RULH 1PKQE 3Q7JA 5IFAL 4APQA 4P2RB 2HT2D 2HPTA 4TLKA 3CXDL 3VI4A 5IWLC 1MNNA 2GSMB 3WLWD 2ENYA 4WIQA 3V95A 5IQOA 3EW3B 2WPGA 1RZ7L 1H3VA 5EA0H 3EFFA 2YAHA 3MV8A 2DJ4A 3EFFB 3MV8B 3FOMA 3ZTNL 1DJYA 2QQQA 4TSCL 5B1JC 1OE1A 2XKNB 3II1A 3NJLA 4NFDA 4KMLB 4LU5L 3WJJC 3MLUH 3IRCA 2DKUA 2R7EA 1UEMA 2XZAL 1QFUH 3FRPG 1SOQA 3MVSA 4K5NA 1XR9A 4ZJ9A 4BZ2H 4DKDC 4AV0A 4K2UL 5CJBA 1K4CA 1XR9B 5I0YA 3DIVA 4YSSA 1MW0A 3FTZA 4H20L 1EHLH 3KJ6L 1DN0B 4W6YB 3WDHA 4B53A 5FOJA 3EOTL 4WWNA 1S9XA 2WBKA 5I8KH 1S9XB 3CUPA 5I5IA 4X7TB 3CUPB 3QPQC 5DUBA 4ODSH 5DHVA 5C8JA 1X3DA 5DUBB 5DHVB 3LZLA 4Z77B 4GKLA 4WI8A 5AVWB 3PJNA 3S8WA 3L5WA 2VJXA 3L5WB 3DSFH 1AACA 5HYEA 3L13A 4F24A 4M7JH 4YL4A 1MAKA 3OAZH 2HT4D 2BP5M 4FZEL 5ECJE 1ROWA 3N85H 5I5JA 4QYOA 3HC4L 5TE4L 3RTQA 3TASA 1HL9A 2BNQA 3RTQB 4J3OD 3O6FD 3U2JA 2BNQB 1OD7A 2J8UF 3IGAA 2VABA 3LMJH 4N2MA 3IGAB 1ODAA 2VABB 2F19L 3E3QC 1T6BX 3IN0A 2VLJA 3GSWA 4Z95H 5LN8A 1GW6A 2VLJB 3RAJH 3GSWB 3ISRA 5H94B 3WEMA 3UZVA 4BZ1A 3UZVB 3MNWA 5K9KA 4RMTA 3MNWB 5K9KB 1J11A 3T0EE 3FFCD 5JW4N 1NMBL 2QPFA 1I7UA 2CU9A 2Q0ZX 4F7PA 4F7PB 2B4CC 2Y1ZA 5F6HJ 1BQLH 1MHEA 3P11L 3S3SA 1MHEB 2D73A 4X0NA 3NT0A 2VDRL 1JV2A 4Z7UE 5IK3A 5IK3B 3WKNA 1ZLEA 4FTVD 5DRZA 5BS0B 1AKJA 5CLYA 1G1KA 5DRZB 4DOHB 4XC3L 1AKJB 1OD9A 3WEXA 1J9QA 3HG2A 3PWPE 3IAQA 4YBHA 4FABL 2YJQA 3CMGA 1RK7A 1L9OA 3FQUA 2DJSA 2ZWSA 3FQUB 3ILQC 4ZW5A 1JXDA 1YY8A 4FI7A 5J9PA 4GG6F 2EDDA 3AUVA 3WEOA 5J9PB 3RI5K 3U1PA 2BRRH 5DMJB 4X6DA 3BP5B 1QSFA 4JDVA 1WZMA 5I1IH 4X6DB 3C6SA 3TEZA 4QJ4B 3WIIL 3C6SB 5DA4A 5FM4A 3QZLA 1UH4A 2CM5A 4A7GA 2EYTA 4KQ3L 1VCBC 1JZ5A 4UYQA 1PYWA 4RFNB 1OP5K 2AJSH 1YUKB 3SDXF 1QLEL 3VCLA 4LL4A 4JRXA 2QSTA 3L4XA 1JDAA 1Z66A 3M6DA 3QO0A 3QPKA 4JRXB 4Y9CA 3VCLB 1IAIL 3QO0B 4LPUA 5E7BA 2W81C 3WELA 2TRYA 3BPOB 3RPKA 4HS8L 5B1CA 3RNKB 3ESNA 4ZX5A 2RMNA 2NX5A 1U2CA 3RA7H 4NLHA 4TTDD 2NY7H 5CS7A 1JXGA 2DWEB 2NY3C 4GB9A 2NUTA 1SHWA 1CE6A 1N9PA 4DF9A 2MQGA 1CE6B 4N87A 4TVPL 4CBZA 1KJ2H 2E9JA 2DZEA 5TJWK 4HWBH 2VUKA 3UPAA 3I9GL 2F53A 2DY2A 2IG2L 2F53B 3BESR 5KBDA 1KIPB 4N25A 4NO2A 1NEZA 4FQLH 4DESA 4NO2B 5HI4C 3T8MA 2Y23A 4PGDA 4PGDB 3QHFH 4X5QA 2J20A 1TTBA 4B5ZA 1CD1A 1KPRA 1G4RA 3VWKD 4HGWA 1SFDA 1CD1B 5F7DB 4HGWB 1QABA 1WT5A 5EUOF 3RGHA 1W72L 3DX8A 2EDTA 3BP7B 3DX8B 3VSTA 2QMKA 5J12C 2QEJA 4OM1H 5L88H 1O9WA 2VGLM 1YHPA 4TQ8A 5EHFA 1OCWL 4WO4C 2Q7NA 4ZMQA 5E08L 3I9AA 3HCVB 2NY6C 2WXFA 4GRMA 1OWRM 4PBVC 4GRMB 4DT2A 5JMRA 4J3OG 2ADGA 4NUMA 1TQCC 2ADGB 5I16B 2LR4A 1ZD6A 3C8HA 4AIZA 4AIZB 2FJUB 3ZDYF 3ZGIA 5AB9A 2E47A 4XMZA 1LDSA 2LLGA 3BMWA 4TOYH 4QGTA 3QJQB 1MZYA 1EHKB 2OA9A 3MLSH 1CF1A 3OLIA 3R0NA 4NIYE 2AKRA 2VDRB 2AKRB 2C9QA 2WSPA 4XXWC 3WFBL 1PEWA 4EVNA 3B5TA 4EVNB 3II3A 4P4KA 3D18A 3GMQA 4XMVA 3GMQB 1DFBL 1GL4B 3PAYA 1UZ8B 4LCWA 1J9SA 4HKZA 1S5HA 1SVCP 1T66C 4KC3B 4HKZB 1S5HB 3H9SD 1U8OA 2XG5A 1I9RH 3CHSA 4JGNA 4I5BA 1U8OB 4XO3A 5J6SA 3S5LG 5LGYA 3UMTA 3ZQWA 4EIGB 2GT9A 1RIVH 3M1CA 4C83A 4C83B 2LU5A 3LD8B 4GAJH 4DSYA 3OQ3B 1WZAA 5EEYA 3DJZA 3WSQH 5I8OH 3QZNA 1G7HA 3UZQA 2EDLA 1G7HB 3UZQB 1TTGA 4IKNA 3NN8A 5HP5A 1CE1H 3KLLA 1A1OA 1QLEB 1A1OB 2HTKC 3IDNA 3A6BL 1IBDA 1NFAA 3HG1A 3IDNB 2J7LA 3HG1B 3MDJA 3VB8A 3QXAB 3K71A 3K71B 1CFBA 2K1MA 5IF0A 3AT0A 3D0AA 4G3YL 1UD8A 5IF0B 5KSAD 3VFGL 4NRYA 1W15A 2MH4A 3DUHA 2ZX7A 3M7OA 4NRYB 5C0GA 5ABZA 3HPLA 4RZCA 5C0GB 3HPLB 3GBMH 4P2RD 3RDTA 4MA1C 2DYSB 4FERA 3RDTB 1CGTA 3V6FB 2ATAA 2X4RA 2WWOA 1MFDH 2X4RB 2PWFA 5FYJH 3MJWA 2UXGA 4FXGA 2V7HB 2RQEA 2YEVB 4FXGB 3VA6A 3MV8D 2FWSA 5I1HL 1TQVA 4GIAA 1MDAA 43CAA 4C57C 1M56B 1XCQA 43CAB 4JGUA 3GXPA 3EGDA 1TITA 1CBVH 4DK3A 1JXJA 3EGDB 1UT2A 1W72A 4WW2C 1W72B 1KGIA 3QRGH 1QWNA 4KJYB 3SBQA 2X41A 3NZ8A 3NJVA 2XA8H 3NZ8B 1D5XA 2OTUA 1D5XB 2GSIB 1M57B 2OTUB 4NN5C 3SBWA 5CP7B 1IBBA 4LASL 4HS3A 4HHAA 4JKKA 4FGMA 4HS3B 3G5WA 4HHAB 1NLBL 2D7OA 3LZNA 5JXAL 2JQZA 2XUWA 3OGOE 5D6DC 1CFTA 3DOIA 4H1LG 3REWA 4APXB 5F3BB 2L7JA 1CFTB 2YQ3A 2WBXA 3REWB 4DKFH 3H9YA 1K3IA 2UX7A 3K2UL 4PJEE 1E2WA 1UM6L 3GMRA 3FTUA 1K5NA 1VGKB 1HQRA 1OHQA 3GMRB 1JCVA 1K5NB 1MF2L 1HQRB 4W9EC 2CLVA 1GTFA 2LGNA 2CLVB 1LMIA 1FO0H 2I5YL 4BYHA 3DXAA 4QHMA 5IHHA 1NAML 2F74A 3S5YA 4QHMB 3P3SA 3TA4D 2F74B 1X5MA 4FQQA 3L45A 4IDJH 4FQQB 3T5WA 1AZNA 1G94A 4HOZA 3IMVA 3CSPA 4KUCF 4AQ8A 3ARSA 2YO3A 1Q8MA 5C0RL 3RTQD 2GJ6E 2BNQD 4PCYA 3VFVA 3D25A 3VFVB 1JNNL 3D25B 1TFPA 5DK0A 1T7YA 5IMMB 5DK0B 4M5ZH 3QNXA 2G3NA 5K9QI 5AAWC 3QNXB 3FRUA 2VLJD 4TN9A 3FRUB 4JM4H 2AMUA 1YEEH 5T5NG 1FF5A 4LVNB 1JHKH 2F15A 1UVQA 2JI2A 3PP4H 2APBA 4RWHA 1UVQB 3LZFH 4X9IA 3SKJL 1OL0A 4K5OA 1WGOA 3CU1A 4F15B 4CMMA 1N4XH 1KXHA 1QVOB 2W95A 3MNMA 4LP4A 4MDIA 4CMMB 4MDIB 2YSSB 3J07A 5BS0D 4P5MA 3BVDB 1OARH 4M29A 4P5MB 2WMPA 1AKJD 4GRWE 2AJUH 1JF6A 2WMPB 3AVEA 1QFOA 1T0MA 1BZQK 1T0MB 3X3GH 3QH3A 3QH3B 4YHLH 1BM7A 1G7IB 3U2IA 1IT9L 4JO4L 4U05A 3T77A 2WD0A 3T77B 4UINH 4DP9X 3OTTA 3N1QC 4IKLA 3GTTA 1CFVH 4HJJL 4EN3B 3SYOA 4OTXH 1E50A 4FADA 3E38A 5DD3L 2ISDA 5GGSB 1UATA 2HMIC 1JPSH 3OF6A 1DFXA 5FV2A 1AZVA 2ZG3A 4JANB 2O5ZH 2XZZA 4GKNA 4FAAB 4GKNB 4UOW0 3REVA 3ALWA 1A6VL 4JRXD 3REVB 3GXMA 1CTMA 3B2PA 3NABH 3F58H 3MUGA 1USQA 1T83A 3MUGB 3S2AA 1VERA 1PLGL 4XCNA 2D3NA 1PKQA 3QQ3A 2A77H 4XCNB 1PKQB 4QRUA 3QQ3B 1KXTA 5JPNC 4QKTA 4QRUB 3OZKA 4WHCA 2EIBA 3B9DA 1NDGA 4NJ9L 2VQTA 2ZQKA 2XWCA 3MRRB 4ZUVA 2VWEC 4I8DA 3QCTH 4AYID 5D2LB 1CLZH 3B2UC 4D0DA 2CHXA 3C5ZC 3HI5H 5F7MC 4D0DB 4I13B 2F53D 5IB5A 4ZTOH 5IB5B 3NJFA 2ZSWA 1KCVL 2ZSWB 4S2SA 4MDRA 2PLTA 4S2SB 1NAMA 3RWEA 4DEPC 1NAMB 4YXKL 1I53A 4R6UA 2NNCA 3RWEB 3UL4A 4CW1A 1UXMA 3VXSE 3P77A 5AVXB 5FGBA 4CW1B 5I6NA 3P77B 2EDOA 3HN3A 5KUMA 2ZUTA 3ZL4L 4KK6C 4JMNA 5EO0A 1LVEA 5EO0B 3TJPA 1IKNC 1AJ7H 5KVGE 3U6RA 2Y5EA 4PJDF 3GHBL 3EFOA 4G70B 4AC4A 1KN4L 3U6RB 1FZMA 2WKOF 4X7FC 1FZMB 1TZIA 3NBNA 2NSQA 4HPYH 3B2MA 1IFRA 4KI5D 2CXGA 3HRPA 4XPAL 4YQXH 5D7JC 4L4JA 4PJBB 4W9ZA 2Y4SA 3CFJA 2XY1A 4ZFOL 3CFJB 5GZNC 1WIUA 4JDEA 1YNLH 1IB5A 4JDEB 3EJYC 1VFUA 3GRWL 4I88A 4K71C 4E0RA 4B9CA 4E0RB 4Z7NE 1M7UA 3WO4B 5JIIA 3BISA 3OMZA 3QDJE 4IKKA 3QP3A 1Q72H 3MCLH 1U33A 4HWNA 5J4MA 1WWAX 4FFVD 3UP6A 1K72A 4DTGL 1SJVA 2ZX9A 3N1PC 4TPRL 3Q2VA 5DHMC 4Z76B 15C8L 3CJJA 3NACH 1FL6A 2QQLH 4G2AA 2ICEA 3TTYA 2P48B 2ICEB 5E1AA 1RFDL 1CI3M 2F7RA 4R8WH 1ZLVK 4X6CE 3B2XA 4CBPA 4HHWA 2Q8AH 1TNMA 3GXNA 4MXWL 4WLCA 5GS3A 3WMSA 3ASNB 4ZO7A 4N1EA 5IGXL 4MLSA 3CN1A 1L9TA 1OIOA 5A7EA 3T0EA 3KLHC 2ZYIA 2DLIA 5I6LA 4J6RL 5AW6B 4CN1A 5EF0A 1M6OA 2C9VA 1FNFA 4B7LA 2AK1L 1Q9OA 4MRCA 4X4XA 4WAFA 2DWXA 3OB8A 1SLVA 5BRZE 2FE0A 1JNHB 4NFCA 2MCG1 4Z7UA 2BNRE 3BKJL 3H85A 3HG1D 4Z7UB 2GTZA 1UFGA 5KJ7E 2GTZB 4ELDA 2WQRA 3M8OL 3VNYA 1WO2A 3AU0A 1U41A 3IJEA 1LO5B 3ZR6A 3PWPA 2VISA 4OIIH 2A4EA 3IJEB 4JE0A 2Y7QA 3PWPB 2VISB 4K3EL 2OFQA 2Y7QB 5DEFA 3C08H 4G9FE 1T2XA 5DEFB 5EZOH 3U0WL 4MBRA 4PVBA 3QWRA 3AMKA 5C92A 4HMDA 3PHOA 3RDTD 1F13A 1OT4A 3TBCA 4WFGE 1QFWL 2GUOA 4E36A 4TVPD 5L4IA 3FN0L 2GUOB 1OAKL 4G6AC 3I85A 4KHTL 3RDJA 1ODUA 3HZMA 1BIIA 3HZMB 4MJJA 3ARGA 4ECNA 3ARGB 3LKPA 1OTUD 1YYMH 5LLIC 2WCPA 4OGAD 4RSYA 1NMAL 2YUVA 3TS8A 2R23A 2CK2A 1DDHA 4YHNB 2R23B 1YQ2A 2PETA 2MHAA 1DDHB 2YA1A 3QEGH 2BWQA 3QJHA 1OP5H 2MHAB 2XT1B 1XIWC 3T0DA 4UCFA 2FQFA 1RPQA 3EO0A 1NEZG 4E9LA 5AW0B 3EO0B 1BPVA 5D1ZI 5FECA 4HPOL 5FECB 2OBGA 1TZAA 1W80A 7FABH 3TH4T 5IQ9B 1KB5L 4K73A 3BRGC 5JNYB 4ZUTA 3S36H 3CX2A 3CVBA 4XN8A 2WXJA 2CJ3A 5TQ0H 3T6WA 1UZ6E 4J8RB 2X4OA 3E1ZA 5EBLA 2W59A 2X4OB 1IC4L 5IBLC 4ZFOA 3P3UA 4G6KL 1R5VB 3GJFA 5E8NA 2VSDA 4ZFOB 4AWJC 1PX4A 3GRWA 2VMEA 4LSTL 3LQAH 4PB9L 3VFPA 3VFPB 4AEHL 1RD6A 1ZKAA 3P9LB 2IC2A 4HSAC 3K6IA 4ANXA 4S0HA 4MSWB 2VC2L 3K46A 1DANU 2QSCH 1RZKL 5JQ6L 4F8PA 1ZTXH 3Q6GH 1O0VA 4L3EE 1CLYL 1UJ3C 4XB7A 4NHCH 1A3ZA 4FL4C 3ATBA 5HDQH 1NEPA 4ZZFA 4WFFD 5TPWL 3AITA 4J39A 4M48L 3L1OH 1OAUL 3EYFA 3WD5L 3EYFB 2UUDH 3HZYB 4QRAA 4AJYV 1TKWA 1KCKA 4M7ZC 3VXRE 4YE4H 1TKWB 3FF8A 4Q4EA 1NAKL 1INDH 3NIDF 5INCA 2VE6A 1ET7A 3U9PL 5INCB 2VE6B 3GMNA 4DGIL 3GMNB 1AR1B 4B0MM 2R1XA 1XGYH 4HUUA 4JZNA 5E00A 4MJ5A 1RP8A 2R1XB 3BKCH 4HUUB 1GS8A 2DJMA 4MJ5B 4EZJA 5CGTA 5PAZA 2DLGA 5ESVB 3DJ9A 5E23A 5I0ZA 3O3BA 2CGRH 2VLKE 3O3BB 1FP5A 2EDQA 5DLLA 4BHUA 1BXVA 1QQDA 1SXCA 4IRSA 1I3VA 1QQDB 1TMQA 4Y4HC 2IGLA 4IRSB 4MQ7A 5DZOA 5DFAA 1F5WA 1SEQH 3AU1A 3QCVL 2X4UA 4OLVH 1R3LA 3C2AL 1S7WA 2X4UB 1R3LB 1Y1DA 2B14A 1S7WB 4FG6D 2DL2A 4EN3D 4UZGA 3BWZA 4YXLL 2ZCLL 3JUYA 3WN5C 2DI8A 1PW3A 2MCAA 1PNCA 4QD2E 5AVTB 3OF6D 2UY7A 3RVUC 4IMLA 1V7ML 3FH5A 4F7KA 2DQTH 4IMLB 3DX4A 4P9HH 3QJTB 3HE7C 3MOBH 2DQCL 4KI1A 3L3OB 5AYQA 2K6ZA 4R4BA 4R4BB 2AJXH 4YLQT 1KB5B 1N6QH 2CR3A 2WLMA 5E8PA 2JTDA 4Q0XH 4HUXA 5E8PB 2A2QT 1JPTL 3HVDA 4HUXB 5E2WH 1GOFA 2E4TA 4MXQD 3NCFB 4LLAA 3OVUB 2ENJA 1S3KH 4XP6L 1KC5H 1P7KA 1XGQA 4OZHE 1P7KB 1RXLA 1A2YB 2QT6A 5C86A 3Q8EA 2R1YA 2WVVA 3BSZL 1KXVA 5DJ6A 2CKBH 2R1YB 2WVVB 1J9TA 5DJ6B 4FG0A 4U6HA 3I74A 1U8LA 2VC2B 4M7LL 2QFRA 1U8LB 3QI9C 5K59E 3FULA 4TMPA 5TQ2L 4WCYL 3M1OA 3IGLA 4LCUB 2A9AA 5CD3A 4I0PA 4I87A 3VGAC 1YUHA 1SJEA 5CD3B 1PZ3A 4I0PB 1YUHB 1SJEB 2FECL 3AC0A 1MFVA 1ZK9A 4MBOA 3MCG1 1EJ6A 1INEL 1CI5A 1EO8H 1EBAA 2NDGA 3OX8A 4M61A 4PJEA 1EEUA 1N0LB 3OX8B 4M61B 4PJEB 3ETSA 2WW8A 4C56E 1YAIA 1THCA 1INQA 2E5EA 5SWQA 4YEFA 5SWQB 3FF7A 3AS2A 3D3VE 3MJ7A 3MUHL 5C0CE 3MJ7B 1IGIL 3Q06A 3HS0C 5IKCB 5KYWA 4N2FA 2EEAA 1MI5E 3Q5TA 4X4YB 1HHHA 5CKGA 5I1KL 5KYWB 1HHHB 2IOOA 1ZANL 5DHXB 3FN9A 5ISZE 4TQHA 1RJCA 4YX2H 1EPFA 5E7FA 1URZA 4O2CA 5HHME 2ED8A 3LS4L 3GZQA 2BW5A 4O2CB 5BPPA 5TE7L 5KVGL 5C0IA 2GJ6A 2YEQA 5C0IB 2GJ6B 5IB4B 1XTLA 1MRCH 4KJQC 3BRFA 3THMH 1OCCB 2D03H 5GHWL 4R4FH 4JM0A 2V33A 3GKZA 3HUJE 2N59A 1C5CL 2Z7WA 2Y06L 4CA4A 2QFPA 1HESA 4GEJA 5HDOA 1ZV9A 3VG9B 4X5PA 3EJRA 2EXYC 3K6OA 2DQIL 4R96B 3ULUE 4C8XA 1GJIA 5LNGA 2K6YA 3WLBB 2ZE0A 3PAVA 4G43A 3ZDZE 4N22A 4O4YH 4L18A 4G43B 5DQ9B 5EU4A 5I18H 5EU4B 2ZCZA 5TE6L 1FL5A 2FSDA 4ES8A 1FL5B 4GI6A 5E56A 4E42B 4WI0A 3COOA 4GRWB 4C4UA 2OJZH 4WI0B 3LPGA 2CE6A 4PV8A 3PWPD 4PV8B 1A5FH 1MCOH 3AGVA 1MFBL 1SBSL 3VGDA 3QWRD 2B4CL 3QCUH 4OVVA 3NIFF 1IX2A 2M8XA 1WC7A 3GSNH 4XMUA 4XN7A 1H3GA 2ARJQ 1WC7B 4Y8AA 1KIQA 3TN0A 4PBXA 3BGAA 4JFZH 4PG2C 1AYOA 3TN0B 1IKFL 3FKUS 1MY7A 4UZSA 2IO5A 3ARGD 4UV7H 5GISL 4NB7A 1NUGA 4JHVA 1E5AA 3BSZA 3P0GB 4UU9A 1DANT 1TJHH 1HWGB 4GY4A 4UU9B 5CCJA 2AITA 5HJDA 2AZUA 3KMDA 5AVSB 1MCBA 1LWHA 4HS6A 4MCMA 4HS6B 3L4ZA 4ICXA 5GGTL 3C87A 2ICWA 5AOMA 1U9KA 4ESKA 2PYFB 2ICWB 1OP3K 2TRHA 1WEJL 4XMXA 3NTCH 1HWWA 3R8BB 4CSSA 3VD2A 1JHLH 1B9ZA 3TBWB 3WJJA 5JIMA 1UA6H 2XTLA 3GO1L 2ITCA 2AXHA 1A6WL 2ITCB 3GKWL 3WI9A 5T33L 2E7MA 5CFHA 3BP4A 3INUL 1Q9KA 3BP4B 1Q9KB 3D4YA 5DLMH 4I4WA 4YWGL 4E41E 4I4WB 2WQXA 4EE2A 4UTAH 2JQAA 2OMXA 4CJ1A 4NDMA 2OMXB 1UXWA 4NDMB 1UXWB 3MRCB 1H3XA 2E8ZA 4PB0L 4R90H 4KGLA 1HX0A 1C1EL 3FB6A 1WZLA 5FGRA 3FB6B 1H8SA 2YWYA 1BMZA 3LEVH 5F3HA 1HHIA 5LGJA 3QZBA 5F3HB 5LGJB 5T5FL 2MFNA 1J1XL 4G6JH 2R4SL 5HBBA 2SEBA 1XT5A 5EIIA 1NL0H 2SEBB 5C0JA 3JWOH 5C0JB 2YMXH 3T71A 3UO1H 1SXBA 3IDXL 1GGCL 1FGVL 3FUMA 4M1DL 2Y36H 3MA9H 4L1DA 4HK3N 4KMQA 2FGWL 3VQLA 1DVYA 4HJGB 1MVUA 4LQFH 5IW1A 1GOGA 1MVUB 3QDJA 4DW2H 3QDJB 2WSKA 3NMEA 3ETBJ 1IAIM 2BSEA 4EJ1C 2HKHL 1AR1D 5C6WH 1MDTA 5F96L 3GUTA 1LL1A 1E28A 1R1CA 3V6ZA 1E28B 3V6ZB 3P4NA 2OSLA 4QY8B 3V4PH 2OSLB 2HZHA 1X4ZA 1FE8L 1JGVL 1I85C 2EC8A 1MW3A 1QNZL 4X6CA 3P30H 1X9RA 4X6CB 4XMWA 1DP0A 3V4UH 2ZXGA 4IRSD 3EXLA 2F0CA 3WV0A 5FYKL 1PKOA 1F90L 1MIMH 3FT4A 3Q8AA 2D7TL 5IVXE 3FT4B 3TIEA 1Z9LA 3TIEB 2WKGA 5LAPA 2OPCA 4JO8A 3BQUC 3DOSA 3T2PA 2B7DT 3DOSB 1E6OL 1QI5A 4HZ1A 1TUPA 2XTSA 2DKSA 2VDML 4PUBL 3WU1A 1NIDA 4IJ3C 4N0RA 3VG0L 3BO8A 1PSKH 4ICWA 4YE0A 5BRZA 4LFHD 3TNNB 3BO8B 2AJZA 4BXVA 2BNRA 3EJTA 5BRZB 4FQ2L 2AJZB 4UB0L 5MEPA 5GGTA 1FZOB 1RJZB 1RUKH 1IAKA 3HLKA 4PJIE 2GBVA 5MEPB 1IAKB 3MU3A 4AJWA 3QIUC 5AUMA 3DROA 2JTYA 3BGFC 1FBIH 4MS8C 2VRAA 1WYJA 4G9FA 4JCWA 4PH8A 4G9FB 2A9ML 4HKJA 4KNUA 1FYTE 4U33A 4HKJB 1KZQA 4N5EC 4F92B 1EMTH 1SRDA 1YNTF 1DVTA 2MNJB 5B4MD 3LH2H 1L9PA 3P2DA 3CCHA 1HNFA 3CCHB 5GRYA 5D7HA 2BY3A 5FYLH 2Q6WA 3TA3C 1ZMYA 1A7NH 4D9QD 5T1JA 3GK8H 2VTFA 2GB2A 4FQJL 1H5BC 2F8VA 4O58H 5LUMA 4AGQA 3B4NA 2NY3B 1Z9SA 4KAQH 4QXVA 4DUXA 3LYRA 2VXQL 5KW9L 1Z9SB 5IFHH 4UOZA 3N2JA 5J1TC 3ZDXF 1ZLUH 4P04A 4B95C 2FWUA 4J23A 5CSGA 1E42A 1I9JL 2H0FA 4ZS7H 3HMXH 5C1MB 2XYBA 2R9HD 3MRJA 3V0WH 5FB8A 4PIBA 3LKOB 3MRJB 3VD3A 5C7XH 4HAGA 2J1YA 4FKHA 5DUMH 3V9FA 4MB3A 4I0PD 1IGFL 1X5GA 2B20A 3NCWA 3FU7A 1X44A 5H2BA 2KLSA 3FU7B 5E4AA 1VPOL 1MQKH 3X3FH 5J12B 1AHMA 2V8LA 1E4KC 2LFEA 3JQOB 2FRGP 4QXGL 2HTLC 3AQXA 4WO4A 4G8FA 1GSKA 3SE8H 4RGNC 1ZJBA 4G8FB 4AMXA 1JPGA 2NY6B 5C0FA 1RAMA 5C0FB 4ABUA 4GUPA 4CGTA 1L9NA 3ZT6A 4GUPB 4H8UA 4ZQKA 1TQCB 3C12A 5IJDC 4ZQKB 5DXWA 2N0KA 3PS6A 4L3EA 1BZ8A 1OAQL 4L3EB 4OQTH 5DWUH 4ZK8A 1IAOB 3UCRA 2GJ6D 4AUYA 2R0KH 4CKVX 1T1XA 4JREC 1T1XB 2FTAA 4FLSA 3EO9H 5EOQH 4F58L 1TYEB 2HP4A 1I9IH 2FL5A 1J0HA 2FL5B 3VXRA 3K2KA 3KXFE 3VXRB 1BBJA 4PJ8C 5J57B 1BBJB 1L0YA 1U8HA 3C5XA 3OG6B 4TNEA 5CEXA 1U8HB 3KVDD 5CEXB 2VDMB 5M94B 1KCRH 2A1WH 1F4XL 4K23H 2OZ4L 5GGQH 4X83A 3HKFA 3TJEH 2VLRE 2AJVL 2YGOA 1XVSA 2UX6A 3Q9QA 3EFDL 5FUOL 5C0AE 1C8PA 3KYOA 3GMLA 4Y2DC 5AVZB 2PTUA 1K8IB 3GMLB 1WWCA 2VLKA 4LFHG 5DUPL 3N42F 2VLKB 4OT1H 5KN5A 4TUOA 2QHRL 1NBVL 4TUOB 1E9PA 1ASOA 1E9PB 1QYGH 3K8LA 3RWCB 1X5FA 4OLYL 1CGXA 5GPRA 3MLVH 2ICWJ 3TESA 1S46A 3BFQG 2BM3A 4M5YL 2YD6A 3POHA 1AQKH 1E7VA 3TN0D 2ZF9A 2IBZX 2E7CA 4IRZH 4PV1C 2FIRT 1J7VR 2Y5TA 2ICES 1AHKA 5IQNA 2Y5TB 2WYHA 4Q4IA 1RH8A 2DPKA 3ISYA 1QW8A 2QL1A 4MA1B 3E7JA 1NFKA 2VXQA 3CN2A 3L3JA 3B9VA 1F42A 3SCMC 1GAFL 2E7DA 3L3JB 3MLWH 3BAYA 2WAHA 3V5KA 4KQ4L 4UV4L 1UWEH 3V5KB 4LAJH 4OLXL 4AQAB 5FFGA 3BGMA 3STLA 3H8NA 2D3VA 3BGMB 4G8EA 3STLB 1KBWA 4G8EB 5BVJA 5BVJB 3DVNA 3DVNB 4WW2A 4WW2B 1OWWA 2R2EA 3LRGA 1T21A 2R2EB 4JFHE 1T21B 1BVZA 1THAA 1TQBC 2CWRA 3CD4A 2ZG1A 4BFKA 3S34H 3CFEA 4DN3L 2QGEA 3IFNH 5D1XC 4OZHA 3HAEA 2IH1A 1MG3C 3HAEB 4NN5B 3QJSB 2UXTA 1GGTA 3WY1A 3VACA 1NFDE 2KPWA 2AQ3A 2A99A 1UG9A 1BAWA 5D6DA 3A67L 3EDEA 3QPQD 2E7BA 4E9WA 5KBLA 4P2AA 3FQRA 2CR6A 2BRQA 3FQRB 3QJFA 3BI9X 3QJFB 2VMCA 4Y1AE 1YQVL 2EH8L 3GEFA 4X9HA 4YSTA 1F0LA 3MNVA 1BM3L 3L1FA 3WDJA 2K8QA 1EJ8A 3IDYC 3NG5A 3NOIA 4XNXH 2R29H 4YZFE 1N5YH 2F5BL 4FLQA 5HXMA 3ZZLA 4NEHB 2I27N 2YGQA 5ACMA 5ACLA 1KY7A 4GW1A 1HXMA 4GW1B 1HXMB 4XHQA 4W9LC 1J05A 3MACH 4KKBC 4D8OA 4C56A 4XOAA 4UMGA 2PW1A 3KH4A 3B83A 2PW1B 2OZ4A 3D3VA 3QDJD 2B59A 5C0CA 5KBNC 3D3VB 5C0CB 2B59B 2A9CA 4QTIH 4EDWH 1MJ8H 1AHWC 1MFUA 1MI5A 2BSED 2IMNA 5AAWA 1MI5B 2ZCHH 2AABH 4AE0A 5ISZA 4LNRA 5ISZB 3TU6A 1ZIAA 2OSXA 3EDFA 2BK8A 5DVLA 1LK2A 4I3SH 5HHMB 3IU3A 4A38A 1LK2B 3IU3B 1FZJB 2P52A 3UMNA 4XB8A 1ZLSL 4JUTA 4BQ8A 1UCTA 3QIWC 2CIKA 3IDMA 1I3GH 2CIKB 4IM8A 3IDMB 3VO0A 4HIJA 4HIJB 5AVYB 3F62A 1ZVHA 1U8CA 3CSFA 2XIBA 1U8CB 4MD5B 4CVWA 3QUZC 1TZGH 2EO1A 1NCJA 1G7LA 5EBGA 1G1YA 1RU9H 2C4FT 1G7LB 2Y6TE 3LQAC 3RZCC 3UGXA 3ILQD 1IQWH 2JQMA 3OSVA 5FUCE 1MCPL 3BKYL 5MEOB 4OJYA 5BRZD 4DZBA 4DZBB 3HZKA 4M6OL 4GYBA 4OF5A 3HZKB 2B1HL 1AQHA 3P54A 4ZW3A 2ZX5A 2EIKB 5IOKA 2B1OA 4FJYA 5IM7B 2XWDA 1EUUA 3LNHA 4G9FD 5HHNA 5HHNB 4LIQH 3M1BA 4I77L 3M1BB 4PWGA 3MTRA 3QEUA 3PIQA 25C8L 3DUSA 3QEUB 3PIQB 2M26A 2NXYC 3DUSB 4HIHB 4ZO8A 2AVFA 4CAGA 4ONFH 5L2JA 2HWZH 3OLEA 5L2JB 1JZ7A 3US0A 4MKTA 4P99A 3W0WE 5JPNA 1T1WA 3EHBC 2H2SC 5JPNB 1YO4A 1T1WB 3KJ4C 4LSVL 5CJ8A 1PPIA 4HT1L 4PREA 2NY3D 3F7KA 4PREB 3AXLA 4X9YA 5D2LF 3FBQA 4KJWC 3AXLB 3IDGA 3MROB 3JT2A 4HOMA 1NC2A 3IDGB 4DKAA 3IM1A 1NC2B 2WBWB 2WNGA 3C5ZA 3MXVH 5ECGA 3C5ZB 3LQMA 1XO8A 3OAYK 2X6VA 4QF1A 4QF1B 1OP3H 1USZA 5HDBE 3K6SA 5DD5L 5HI4D 3RZWA 5L4MA 4Y5YC 4WZ9A 2F68X 1TLKA 4RMVA 4N68A 4DEPB 5KSAA 4MZIA 1MEXH 1O7VA 2WP3T 3PGCA 4GP4B 4GS7C 5DC9B 3CC5A 3PGCB 1Z2KA 2VDLH 3CC5B 4JQIL 1UWXH 2QTEA 1YAZA 5E5UB 1IKNA 3BVXA 3EO1A 4E41A 3PY9A 2N4IA 2J88L 3EO1B 2GHZA 2WZ5A 4GAYA 1J9CT 4GAYB 3VH8A 1X5JA 4JKMA 4TSAL 1YLBB 1RJYA 3W9EA 2NY6D 1RJYB 4G8GB 4TYUA 5CMAA 4PJBF 3VQ2C 3W9EB 5D7JA 2Y2YA 5D7JB 2VXSH 4X7EC 5FYJE 5GZNA 2OXHA 1UD3A 2OXHB 4IBYA 4GO9A 2JV6A 4L3ED 2JK5B 4K71B 4NWUL 1DBAH 3UBXI 6FABH 3GBNH 2CHWA 3ATAA 4NZFA 3VE0A 1M71A 2ZX6A 4HUKB 3X1EA 3RLSA 3VE0B 4QHLA 1M71B 4QHLB 3BDXA 5FYKD 1MJ7H 1RUMH 3MRFA 3QRLA 35C8L 3CG8A 2X44D 3GUFA 1L9SA 3MRFB 2ZUYA 4PJ5E 2MKLC 1EEQA 1UACL 1IM9B 1KPVA 2FQGA 1KPVB 3BLKA 3VXRD 3BAJA 3FC8A 4F80A 1RULL 2G2RA 3UZEC 3GMOA 3HI1A 1DJSA 4B60A 3GMOB 1T66D 1BMGA 4AGLA 3ZYIA 3D4GA 2MOVA 3PPSA 1ML0A 5D1ZC 1D3CA 2DRUA 4B9JA 4Z0BH 4NKDA 5EA0L 4DAGH 2YRZA 2LAGB 4NKDB 3NA9H 2VLKD 3MUUA 5JIPA 1BVLA 1IARB 1BVLB 4FFWC 5ID1A 4RESB 4I2XE 5ID1B 1BF8A 1HVXA 1P4BH 1XX9C 2HTKD 2Y25A 4KUZH 4ZAKC 1QFUL 4BZ2L 4QRQA 5IVXA 5IVXB 4QRQB 1JGLH 2VUOA 3ZT5A 1EHLL 3ARWA 1U93A 2UY6A 1U93B 2UY6B 3PXJA 1PBYA 1XGTA 5I6OA 1XGTB 1SUJA 5IHZA 1DCEA 2WVUA 1ZVYA 1SM3H 2VN7A 5IHZB 5I8KL 1CFSA 4ABVA 3WFDH 3PUUA 3FB7A 1XZWA 1CFSB 3AABA 1DVZA 4N0FA 4XO8A 3FB7B 4H8VA 4YK4C 4N0FB 4ODSL 4V2CB 2GPZA 1F8TH 1MW2A 4UNIA 3QFGA 3CPLA 4Y16C 3CPLB 4AVIA 2GKIA 3DSFL 1FYTA 1XIWA 4L1TA 4U1IA 2NQDA 1XIWB 2TSAA 4V33A 4FDWA 5C0BB 4M7JL 4U1IB 4XX5A 5AVQB 2UVEA 2H47C 3K0WA 4A7TA 2WOYA 3ATFA 4GBXC 3MGTA 4JQIA 3RURA 2YBGA 3VRLF 3MGTB 1O6VA 2GIYA 4KVPA 3AQZA 5FK9B 5G5DA 5F9AC 5G5DB 1IEAB 3N0AA 4X80H 2VAJA 3Q44A 1CLVA 1M42A 4ZFGH 2B3RA 4PJ6A 1ZY9A 1UTDA 1JZ8A 2H7WA 3U30C 2D7QA 3RAJL 3WG7B 1XTMA 5BO1H 3ECWA 2BIMA 3GXIA 2Q7AA 3KLAA 1OAZH 2EUZA 3KLAB 3L5HA 4NBYB 2AQRA 4RGNE 5CIPA 3QEHB 4Z3TA 5CIPB 4JMXA 1BQLL 4HLEA 3OB0H 5C3TA 2DH2A 2BZ7A 1N7ML 2P43B 4L8DA 2K3HA 2YA2A 4L8DB 4NQQA 4NM8L 1UJ3B 4AUUA 2ZONA 5SX5K 1N19A 4FL4B 4ZMPA 4F2FA 2D4FA 3BUIA 2EVFA 3D3VD 5C0CD 5TDOA 1LO3H 5TDOB 3T3PF 1MI5D 2BIHA 3QG7H 2BRRL 3SE9H 5ISZD 3EDKA 5I1IL 2L7QA 4M7ZB 2A3TA 4H0GA 2BOBA 1GZPA 2VIRA 3N40F 2BOBB 1GZPB 2VIRB 5HHMD 3V52H 4PP1C 1YMHA 3ECBA 4FNLH 4AYFA 4AYFB 1HT6A 3GBEA 3U7WH 3ARXA 3SYAA 4RMUA 4W9CC 2OZNA 4GAGH 5T1KA 2FO4A 5T1KB 4BZ2A 2FO4B 2F1EA 3UYOD 2MQCA 5DYFA 2COVD 1CD9B 3SYCA 3KXFA 4JO3H 4YHKH 1F6LL 4ZI8A 4JN1L 3KXFB 4X6BA 2Y1VA 3RU8L 1G9EA 1JPEA 4X6BB 3MYZA 3F7PC 1BOYA 4Y4HA 4DFIA 3RA7L 2NY7L 4Y4HB 2VLRA 2CUHA 2VLRB 3MLXH 3DX3A 1BQUA 2Z4TA 3ESUF 3F8UB 1YEJH 1I1CA 1KTRL 4HWBL 1P5VA 4AZ8B 3ATEA 1P5VB 3WN5B 2HMID 4YSUA 4FQLL 5I0XA 4DP6X 4K55A 1JK8A 2C34A 4QOKB 1C7TA 3I3BA 4PJHE 5H37H 2XOTA 2HPOA 3JWOC 3HE7A 3X2QB 4W93A 3HE7B 1C5DA 4RGOH 1PCSA 1C5DB 4MHHI 1C16B 2BVQA 2BVQB 1AGCB 2ATKB 3Q48A 1FC1A 1FZKA 4OM1L 5L88L 1FZKB 4K7PX 4NZJA 1YEIH 5DHEA 4FRWA 3W1ZA 4Z7WF 4LAQH 4OSUH 1OAJA 2AAAA 3S37H 4TULH 1JZ6A 1HCZA 3HAEG 3ABLB 5JW5A 3B2UD 1NC2D 4H8HA 5JW5B 3C5ZD 3ZMEA 1C7SA 1E9OA 2EO9A 3ZZ1A 2I60H 4TOYL