1NCOA

Structure of the antitumor protein-chromophore complex neocarzinostatin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
113
structure length
113
Chain Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYDVGQCAWVDTGVLACNPADFSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HOLO-NEOCARZINOSTATIN
publication title Crystal structure of neocarzinostatin, an antitumor protein-chromophore complex.
pubmed rcsb
source organism Streptomyces carzinostaticus
molecule tags Antibacterial and antitumor protein
total genus 17
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 1ncoA00
2MCMA 1AKPA 2CBTA 1ACXA 2CBQA 2G0KA 1J5HA 1HZLA 1J5IA 2CBMA 1HZKA 1NOAA 2G0LA 2CBOA 1J48A 1O5PA 1NCOA 4JW3A
chains in the Genus database with same CATH superfamily
5CGYD 3GMMB 1A25A 4KMLB 4Q6IA 1XH3A 2D7PA 2JMRA 2MRYA 3NOIA 3LZNA 2VZ3A 1QRKA 4DUXA 1E4KA 2OL3L 3D2TA 3QUXD 4I5BA 1GYCA 1ZLUK 1EHLL 2MTAA 3CUPB 4J3OG 4JPVL 1JTPA 3MV9B 4ODTL 4DWHA 4U31A 3C60C 5D2LA 3WSQL 5I75C 4HXBL 1NOLA 2EUVA 2ZXGA 3WN5C 5DD3H 5DJ0B 1F4WL 3PHOA 4HS6A 4JFPA 4EZKA 4OLZL 4ZS6C 2AQ2A 1TZIB 1A4KB 1ESOA 2XZAL 3IJ8A 3WKML 4U1GB 3FCSB 2CO7B 4P4KC 4LKXA 3RWGB 3EO1B 4JX0A 3EYOA 2CDEA 1UEMA 3Q44A 3AUVA 4HJ0C 2G2RB 4HWBH 2C4FT 4FG6D 4TSCH 5F93C 4EXPX 4FQQA 3ARBC 4DQOH 4W9JC 2BP8B 3GSXB 1R5WB 3EOAB 1NWOA 5I8EA 4ANKA 4C83A 4IGBB 3CFIC 1AP2B 1EBAA 3HI5H 1K6QH 3DJRA 4L3EA 3W5MA 2R0ZL 5ALBH 1D5XA 3QUZB 5J6SA 2DYRB 3D0AA 1WBYB 2KZKA 2VZOA 4UM8A 4PRAA 1AANA 3ROLA 5IHZB 4N8VG 4K2UL 2HFGH 5I8OH 3DVFA 1EFXD 5GS0L 3W0WE 5HBBA 2AKRA 4MJ6A 5IBUB 1U8IB 4Z5RB 1H9DA 4PYGA 1J8HE 2PPCA 4OIIL 4QHLB 1RZQA 4KHTH 5C0GA 2VC2B 3AWFA 4M1DL 5D7LB 2PLTA 3BW9A 5L2JA 4G9FE 5F1IB 1WBXA 4NRZA 2HJKA 1G4RA 2QR0A 3GKWL 5TH2B 5ITBH 5ELIA 5HI3C 4KHXL 1NDTA 4E41E 3VVWA 4UM9A 4Z7OE 1UT1A 5T8IA 4Z9KB 1OAXH 3TBTA 3ARZA 1JFQL 1HXYB 3QORD 4TNVK 3ABKB 3THMH 3QPQC 4FQ2H 4HT1H 5CM1A 5G5DA 4F91B 4BQ6A 4M3HA 1CTMA 4FQLH 2VR8A 4DFIA 3G5VA 2W59A 2Y1ZA 3GHPA 2F58L 2CK2A 2NY1B 3MODH 5B1JA 4N0CD 4KGLA 5FUOH 2BS8A 1MFUA 4WWNA 5CMAA 3NTCH 1SEBA 5C3IA 3BKCL 4WU7A 5LAXA 2ZSVA 5E95B 3RIFF 4AWJC 2Z4TA 2EECA 3SDDC 4F2MA 3AXIA 2ATKA 2XN9E 3A6CL 4OGXL 2A6JB 2BIPA 2W9EL 3S37L 1MN4A 2R29L 1IGTA 3G08B 5IZ7A 1PDKA 4NO2B 3SDCC 1UFGA 3U1SL 3GZKA 1QLEH 3K2MC 4U1HB 1WAAA 4WNQA 4FFYL 1S7RB 5CS7A 5KVDH 3ZT6A 2ZP9A 3VWKB 4ATTA 2O72A 1X5MA 1ETZA 4LIQH 4OIBA 2AK1H 3BJ91 5FGCB 1E9QB 4YPGB 4HPHA 5BS0B 1U3HC 2UYLA 3NACH 4Q58C 4R4BA 4YHYB 1SJEA 1OAYL 3JWNG 1KB5B 1KT2B 3MUHL 1QFUH 1MFCL 2YK1H 4L0YA 2V17L 1A4CA 4K7FB 2MKLC 4F58L 1KGYE 2Q3ZA 3F64A 3GLZA 4KVCL 2L7QA 4KXDA 3SEPA 4NZUL 1JYNA 3IGUA 4LEXL 4U6HA 5HDQH 3QXDB 3C6EA 2K7PA 4EUPA 1DANU 5E8PA 1A6TB 3ULVD 5HHQA 4LCVA 3O8XA 2ATPB 3CLEH 3BESR 2CNZA 4CN1A 4MZ2A 3F6JA 4QHUB 3M45A 3PCYA 2HKHH 2AI0L 3QFJD 4L8CA 3P3TA 4ZNEE 5TDPA 4IIZA 4Q89A 1BXAA 5JPNA 1PZ2A 4YLCA 4K3EL 2DTSA 4EQ3A 1IBBA 2XXCB 4M5ZH 4UYPA 4HCRA 1BQ5A 1VGEL 1ZV2A 1MHEB 4CC4C 4BJLA 5E08L 3QEUA 1XF1A 1I8LA 4IJ3B 1NBVH 4M7LL 3FT2A 3BGAA 4PTUA 1FO0A 3TWCH 4Y1TA 4ICXA 5ICYA 3TO4B 4L1LA 4MHHI 4NI6A 1BECA 5BRZA 1CD0A 4LCUB 2CHDA 5IJCC 2R8SL 4APQA 1OY3B 2DMHA 3MFFA 3Q48A 2NPLX 3JV4A 1URLA 3DBSA 1FNGA 1TVHA 2OMZA 4AI7A 2XQYA 4FL4B 4G83A 4G42A 3RWDB 2FX7L 3MR9A 5IGXL 4DGWC 3EG9B 1W0VA 1Z3RA 4U6XB 4U6TA 3TCLB 3EYUH 3PHQA 2OXGA 4UT9H 3F8UB 2MIZA 3FRPB 4AM0A 3QZWA 1K2DA 3AQDA 1J86A 2R1YB 1Q9LB 1T1ZA 3LQMA 5L4IA 2LTQB 1N26A 2G3ZA 2WLNA 3K5SA 2IPKB 3T2OA 1HHHB 5E5LA 4ONGH 2G60L 3HW7A 2K9FB 3CZNA 3IDYB 2OSLB 2IFGA 4QF1A 2P1YA 2D9CA 5D7IB 4P05A 3CFNA 3TIEA 3UTTD 2IPUK 2QSQA 4LSSH 2APFA 4GP8B 5IW3A 3GMLB 4PSRA 4JO4H 1MNNA 1Z5LA 2DW5A 3W39A 4H26A 1FFTB 4QHNA 5BRQA 3U6XS 1TJMA 3AB0B 4F7TB 2N3JA 2E4FA 43C9A 5LKNA 4JE4B 1S7XA 2DQHL 3LEVH 4YZWA 3QJRB 5D6DC 3UG4A 4PRHA 1HQRA 2R1WA 4B7LA 2J8OA 4U7SA 4XHJC 4XNYL 3T71A 1IBDA 2X4PB 5T3XH 2E4TA 4FABL 5A2LH 1JPGB 5DVMA 4KI5E 5KSBB 1TSRA 4OCSH 5IW6B 4M6OH 2WUCL 4JY5L 2GAZA 5ESQA 4XP4H 1NC2D 3VMPA 3VA6A 3OZ9L 3G6JE 2Q1EA 1T89C 5IJDC 1UZ8B 1UB6A 5HI5D 1SOQA 5F7UA 2A0LC 4N6RA 4X6CA 1CDJA 3VYNA 4PGEA 3EOTL 4QRRA 3EF4A 7TAAA 5DF0A 5KTEH 1AH1A 4QXUL 4IU2B 3UPRB 2F18A 4K5MA 3O2VL 5MENE 2NY4C 5DRZB 1G4MA 2EC9T 4D9LH 2VMDA 3WD5H 3Q6GH 3CHQA 1XEDA 3PRZA 4N2NA 4AIEA 2ICCA 1F11A 4IBQA 4AEHH 1QBMH 5IJKA 5IMLA 5ISZB 1MXGA 2DWDB 3RDTC 3VU1A 3HG1B 5BO0D 3QIBC 2EYTA 4MNGA 3BPNB 1E2WA 4YHPB 2YQ3A 1AVAA 1IAOB 4GKZB 1OT4A 3MJ6A 5BMFL 3B2DC 3H9ZA 1KCSL 1T1WA 1AJ7L 3CCHB 3SDXE 1VLXA 2B20A 1YEEL 4ZSOB 3FHAA 3M07A 3BAJA 2PO6B 4JRXB 4Y19B 5KYXB 3H9HB 4GINA 5GRWA 5MERB 2H4EA 3A23A 3SPGA 4X4XB 1KSRA 3KE0A 1P6AB 3F5WB 4UOZA 3OLEA 3UTQA 4FYRA 3HS8A 4PJIA 5H37G 3BAIA 3C5SB 1BAFL 2N0KA 1KGIA 1UH4A 5F3HB 1NM9A 3SBWC 4YVUA 4M4PA 1N8ZA 4MDJA 3V0AC 5LXGH 1TJGL 2ADIA 2EYSA 2HFEB 1AKJB 1BEXA 1CK0L 1LMKA 2PWGA 2OZNA 1FL6A 4IS6A 4ONFL 2N1KA 3BN9D 3HR5B 3O4OB 3CVHA 5KVDL 4UINH 4KUZL 4IQHA 4Z0XA 4OD3H 5BOZG 3D6GA 4J8RB 5F97E 1VSCA 4HGMA 2V4LA 5HYSA 1SNRA 2VDML 3PL6D 4P9MH 4TLUA 5GHWH 1HOEA 2DTMH 2XYCA 2IJ0C 4WDIA 2E76C 4Z7VB 4I2XE 5C0AD 3TTSA 1SJMA 5LN8A 1JGLL 4DO4A 3K71B 1LLAA 4QEGA 3IETB 4YNYB 3QDMA 3EFFA 1ZWIA 4K9EH 4KO9A 5H35A 2ZF8A 3FUHA 3KR3H 3ECBA 1W2KT 1CFSB 4BQ9A 2HLFD 3RNQB 3ULUL 3BPOB 3ULUC 3ULUE 3JWOL 1GZHA 3JWOC 4XBEH 5KAQF 3FU7B 1FL5A 4UQEA 2E6PA 2VDNL 1MAML 2OMUB 2WTRB 4PJ9A 2Z7ZA 1X9QA 5DS8A 1XR9B 3U79A 5KVEL 1PLBA 3SCMD 2VR9A 3EYQD 3PP4L 1XCTA 4NUGH 2AHIA 1J0HA 2FX8H 2ITEA 4K4KA 3IFPA 4X80L 1IT9L 3U25A 2DLEA 5FO7B 2DEYX 3KYOA 5ADOL 1TTGA 1QYGL 3LQAL 2P8PA 2QQKH 1CXLA 1OTSC 3T0XA 1AHKA 4S1DD 3J27A 1QLRB 2XQ0A 2KLTA 4WK4B 4N3UA 2CHWA 3SE4C 1C5BL 1CYGA 4WSGA 2ATAA 1HC1A 1U21A 3O9WB 5FPIA 4GQ9L 5DFVC 2H9GB 3RL2A 3VXPA 4JZNA 4P46A 1SMOA 3A4AA 4JO8A 2EIEA 4MA8L 3RVWD 4D0DB 4XI5C 2EKSB 4DIXA 4TSAL 3QJFA 4GUOA 2BIHA 2RMNA 3BH9A 2KDYA 4R90L 2WCGA 3MRDB 3ZTJH 1LEGB 4QRTA 3MRLB 4TQEL 3KGRA 1IARB 1IFGA 1T7WA 3BWUF 2BY0A 5GS1A 2UY7A 3E6HB 4R83A 4QRPA 4Y5XB 4TUJA 2H26B 3MPCA 4UV4L 2C9UA 2FJGB 3VFMA 3UYOD 3L1EA 4NQXB 2AV1B 5KN5B 2FGWH 2W88A 1CXIA 2VXQH 5EN2B 5HDBF 3TCTA 3W2DL 4EO5A 1IGFH 2A6DB 4OU3A 4DZ8B 3P0GB 4MNGE 1WFNA 1I8AA 4TVPH 3T0BA 2ZOKA 1KLUB 2OK0L 1U8QB 5D1QA 3UERA 2NY5H 1RHFA 3OL2A 5IK3B 3SDYL 1ZLVH 1KNOB 4X6EB 5EU5A 1A1NB 3GHEH 4OGYL 2E7LC 1SM3H 2QQLL 1ORQB 1NEUA 1S9KC 4G1EB 3L4CA 3MRJA 1X7QB 2EADA 4N2FA 4XNAA 3VI3E 3UBXA 4XNMB 4P3DB 5E94B 5GZND 3VXQB 1U36A 2OX5A 4Y4KA 1A7PL 4ZUWB 2X53A 1U0QA 4S1SL 1WYJA 1WHOA 3JWDH 2FT8A 4G3YL 2GJJA 3A3YB 3BZFA 3IPBA 4IRZL 2HH0H 4QCIA 3II3A 3O6FB 2BSBA 4JN2B 1EHAA 2AEQL 5GGQH 4MJIA 4U4IA 1FVCA 4R97B 1RK7A 2P47B 3IMVA 4Y2DC 3SQBB 1J87A 4WHCA 2FL5B 4AT6A 3B2PA 1FFNA 2Q76B 4JM0A 5T3XD 4K7PY 1Z9SA 2BVUA 3MRGB 3UC2A 3ORJA 5CHNB 5IIEA 1U4EA 2IAMB 3TURA 5E2UH 4LCIL 3AS0A 1I7UB 3WXWL 1UXSB 4TNVF 2A9MH 4IYKA 4GW5A 1G7LA 4UQBA 3EAKA 2W65A 1Z2KA 3CN0A 4PGBA 2XRAH 3PJSA 5KYYB 1QEWB 2Q7AA 4W81A 3U1QA 1SYVB 4E9WA 1IJ9A 5EB9A 1OP5H 4TOYL 1X5HA 4F15B 3HRZB 3P4NB 2VLJB 2MCPH 1NIDA 3S88L 3VH8G 3FT0A 3VACA 2E7MA 4M62H 4PY7A 5HHMB 4XMZA 5HYFA 5AVWB 1QR4A 4OCYH 2D0GA 4GG6B 3EYVB 1M7UA 1H3TA 1FGVH 2EH8H 2GCYB 4LLDA 3VGDA 2FHBA 4X7TA 2IEPA 3VXUB 3WNKA 4YHML 1IV8A 3BP5A 3W1ZA 4D8PA 1JP5A 1OGAA 2FATH 3DHJA 5HJ3B 3V52L 5E8DH 4XGZB 2CE6A 2EACA 4K71B 5HYJE 2DLFL 4G7VL 1E5CA 1VFOA 1MCRA 4V1DE 5SV3A 3ZR6A 5AFAA 4NEHB 4CADB 3HC2A 4O2FB 4Q9QH 1L3WA 3PWPE 4JFDD 5HGHA 5HYSG 4Z7UB 2QTVA 1S9XA 2DWXA 2Z8RA 3NZHH 4WV1B 1KGCE 4CJ0A 4C56E 3JTTA 4K3JH 5L7XL 5IT2H 2C9PA 3SQOL 1UG9A 3ZKMC 3P4MA 3IMRA 1KLFA 4OLYL 5FV1L 1ZT1A 1GZPA 2PTTA 5EHFA 4L4TD 1H8SA 4JO3L 1JV5B 4OCRH 4MLSA 4PJCB 1HAWA 3RKPA 3UYPB 4ESKA 2VLKA 3ESNA 4P4RA 4UTBL 5ANMB 4MXVF 4FD0A 3NH7L 1UWGH 4XRCA 2MQCA 1HSBA 4XX1G 1ZVYA 4NGHH 3EBGA 4F8LA 3QULA 4O2CB 1NGPL 3CFDB 2FH8A 2PETA 3WFHA 5I18L 5BO1H 1OTUD 4AZ8A 5KSUB 2YQBA 1ND0B 3GSVB 2ETWA 1YPZF 4RMTA 4YHLL 5CD3B 4AM0Q 1QHPA 4NXSA 5C7XL 1M9SA 2W60B 2BWDA 3DGCR 5FYJH 1H3PH 1J0ZA 1ZHLB 2X09A 2E7CA 3DI3B 5SWQB 1GC1H 2ID5A 4ZXBB 5D1XA 3NEXA 2Z93A 1JI1A 3OAUL 1GY2A 4QJ5B 1P5VA 4GXUM 1BG1A 4NUMA 4WUUB 1TITA 2P5WE 2WQAA 3L1GA 4R0LA 3QCTL 2PYFA 3NRQA 2AJYH 2YRBA 4XBMA 2IIJA 2FQDA 4HIHB 3MCLL 3WDHA 4I1PA 5ERWA 3BKJH 3U82B 1FV1A 3B1UA 2CLVB 4KKNA 4ODXA 2KPWA 5DQDH 4HUNB 4IMKC 4A39A 2A3TA 2L7UA 4HDIB 1SY6L 5I0XA 3OXRA 4NWTL 1DQMH 5IHBA 3KPMA 4JO1L 5K59F 2OAAA 1GPOH 2ARWA 4L1TA 3II2A 4LLVB 4ZJ9A 1OCRB 2WKGA 4PJAB 4XZUA 4E0RB 4CC0A 5D7JB 2W07A 1NFDA 1I3RB 4OI9A 1AZVA 3WHE1 2QVTA 1E6JL 1R3KA 5CD5D 4PJ8D 3CPUA 2AJXH 3FFDA 3RGVC 2BVYA 5F2FA 4YO0A 4Y5YB 1AQKH 1AGFA 1U58A 3O41A 3Q8EA 3QZBA 3GMMA 5B8CA 4CJ1A 1RIUL 1HI6A 3KNBA 5EUOB 1I8MB 2X3CA 1MI5E 1Q0EA 5B7MA 1T21B 4JKMA 5EZIH 1SGKA 3G5YA 4MQSB 3J7HA 1S78D 3MV9A 1WRFA 3BT2H 4B3EA 4R7NB 2OW7A 3VNZA 3D7PA 3DX3A 3Q1SL 5DA0B 4KQ3L 3BUDA 4BFIB 3KWXA 5DJ0A 5KWYC 3TNNB 4UZUA 3V6OC 2H8PA 2R7EB 3CG8A 4DP9X 1JGUL 3QS3A 2DS4A 2C3WA 3CZLA 4WFGE 1TZIA 3VDCA 5KJRH 3NIDE 4XMUA 4F9LC 3FCSA 2CO7A 5KSAC 4J39A 4XN7A 4X98B 3EO1A 4TL5A 4XR8C 2DWSA 2GKIA 4TSBH 3ZR5A 5LAPA 4F3FB 3D4CA 2QDWA 2G2RA 4RBPK 4HOMA 2BSDA 3QUGA 2VW4A 4KY1H 1CE1H 3TT3L 3HUJE 1NGZB 1DUZA 3AQXA 4ODVH 3QJHB 4OR1A 5HD8C 4ATWA 4YFLI 4KKLD 4IGBA 4AKPA 1AP2A 1PW3A 3D2UD 4RFOL 4W6XB 3VD7A 3WE6B 3C2AL 3C5XA 3L81A 2DLGA 1XF5B 3UMNA 4B50A 2XWEA 3MUGB 4RDQG 3K2UL 4KK9D 4GLRI 4XNUH 5BV7B 4LASL 5IHZA 1AI1H 4FMFA 4KTYA 1VACB 2B5IB 1DCLA 2BP0B 1GGBL 3INUH 2OULB 4JO2H 1U8IA 4Z5RA 3LD8B 3MOAL 4JY6A 4QHLA 2GI7A 1JS4A 4WK2B 5D7LA 4XMXA 4LARH 2Y5TA 5EZOH 2W0LA 5F1IA 4DGVH 4OFYA 2ZCKH 2PTUA 2YEVB 4M02A 2EDYA 5CIPB 5K9KA 3QIWD 1HXYA 2ORBL 1RUAL 4B27A 2CPCA 1A1MA 4D9RD 5BVPL 4LSUL 1T66D 2HZHA 4G6AD 3ZRSA 3P0VH 5SWSE 2X5PA 3EJQA 4WENB 1TU2A 1MFMA 1AGBB 5IJVB 1A9EB 1FN4B 4B95C 1MCSA 2AQRA 3SB3A 4UILL 1FI8C 2XVKA 4W9EC 4I0PA 4LRIA 4OZHE 3LN4B 1ZLUH 5E2TH 2VXTL 3RPIA 3TBCA 3CQQA 3KL3A 3II1A 3OHXB 4GQZA 1K8IB 4FG4A 4NIYE 3ZU8A 3GXFA 4R5XA 4Z1PA 2CNYA 2VR3A 4ICWA 3EDKA 3IN2A 2LOEA 3NSXA 3G08A 5CXPA 5TFSH 4WUKH 4JDZA 1L9NA 4NO2A 12E8H 1ZE3H 1UZ6F 4PQXA 4U1HA 2DWYA 2PF6A 1E27B 3VGBA 3PQYB 5F7HA 5DJCB 3LEXB 4NLAA 1TLMA 1NFDE 3OKOA 4BSVB 4RZCA 1E9QA 1U91B 3WELA 3QUYA 1A1OB 1ZHKB 3OX8B 4A04A 1AYRA 3GRWH 3GM8A 1UJ3A 1KB5A 1KT2A 1TNMA 4M8VA 1T5KA 3HE7B 4MJJA 5C0BD 1XGUB 1MUJA 4K7FA 5A40E 5IB3A 2YUZA 3HG4A 1H3GA 2NW2A 4ZFGH 3BEWB 1ODUA 2GY7B 2K78A 1ZVHA 3MLXL 5F0PB 4WF7A 5KUKA 1A6TA 3DSFL 3FT3B 4N1CA 2ATPA 4JFZH 3WDJA 1MFAH 4FKHA 5IR1B 1NKGA 2WLHA 3KVDD 4CMHC 1J1XL 2M2DA 3H42H 2UV3A 3L3JB 1I9EA 3LEYH 3KPLB 3EH5B 4MBOA 3EJYC 5AD0B 4N26A 3MDJA 1RUML 2OI9B 4AEFA 3QRLA 2Q5BA 1S7UA 4Y4FD 4X5XB 2FLRT 3CSBA 1B3IA 1CLVA 3GBNL 3OJDB 2ITFA 5FYJD 2P28B 1IGMH 1SJHA 4LCUA 2OP4H 3P69A 3QO1B 3LXBA 3SBPA 2NT0A 1ZDSA 1HNGA 2BX5A 2WXNA 3DVGA 4L8DB 3RWDA 35C8H 2V3FA 3QB7C 1YEDB 1QEXA 2J1XA 5F3FA 3EG9A 4P59L 1FBIH 1MWAL 2LU3A 2DV6A 3TCLA 1UC6A 5A3ID 3Q06A 2LU4A 2VMEA 1VFUA 2V3EA 3MUY1 2G9KA 3MACL 2R1YA 4PJ5D 4F8OA 3KPOB 3LS5H 4NC2B 3D8MA 5MEOB 3WO4B 4HK3N 4FTVD 2APXA 4HAGA 3SKMB 4ZUVA 1P7BA 5GGRY 2B9AA 4NQSA 1QSFE 1TTBA 2QADC 4M6MH 3AREC 1Z0MA 2OSLA 4QLWA 4GLRH 5IVZB 4K7PX 2XQYK 4QXWA 1VFBB 2H32H 1MF2L 3VFOA 1T04A 2D03L 3FF8A 5D6CA 3TZVA 5I1AB 4TTGA 1EAQA 5ID0B 1UFUA 4R2GC 1E4XL 4S1RH 1TQWA 3HI1B 4NC1C 4CAGA 5EZLB 5IOPA 4ZTOH 4F7TA 1INQA 4QRQB 5I19H 1P1ZB 3Q5OA 4EOWL 3F58H 32C2B 4ZS7L 3HZYB 3QORB 1I9JL 1RXLA 4PG9B 5HHNB 1CMOA 1G9EA 5AAMC 1X5AA 4D7BA 4Z7QB 2FNBA 1RCYA 3UMTA 2X0VA 1JPGA 1NICA 4R4ND 4P2OD 3TT1H 5KSBA 4J3OF 1BM7A 5FWQA 4X9FA 1R24A 2IWKA 2VTFA 4Z78B 5GGVY 2NX5B 1AMXA 1OF2A 4LCYB 1DVTA 1KC5L 3EJCA 5F70A 1UM6H 5T1KD 4KMTH 4LMQE 3C6SA 4HKJA 1NL0H 3NCYS 4OTXL 1PSKL 3HC3H 5C0CB 4IU2A 5FGCE 5BS0E 4RA3A 4WCYL 3GIZL 2BVQB 1CXHA 3D18B 5DRZA 3ZHDA 1JNJA 3CK0L 1ET7A 4IJTA 1EJOL 3LRLA 2ENQA 3MLUH 3SDAC 3TVMA 2IGLA 2Q8AL 4MNQD 5FCUH 4JL2A 3VXSD 1C7TA 2BLFA 5IVXA 3IFOB 1AOHA 4ODHH 5CJOH 5GGRB 5FEBA 3TEWA 1NAKH 3MLVL 3Q7JA 5IMMA 3NJMA 3RWJA 3VVVA 5ISZA 2A4EA 4EKXA 1P84K 3DMMD 3EIFA 2TSAA 5HVHB 1WCBB 5DJAB 5GZOA 1UA6L 2O6PA 1RQ5A 3KM2A 1LO2L 4YHPA 1RZJH 4GKZA 3DROB 1M6OB 3ZDXF 1UD3A 3CCHA 2YPVL 1X5YA 3M6DA 4XB3A 4JRXA 5KYXA 4Y19A 3H9HA 2NR6A 4TQ8A 5MERA 4JKPH 1T7YA 3V7AE 1X5IA 4X4XA 3VGEA 1KCLA 1TZGH 4Q4IA 1XZWA 3CBRA 3US1A 2XZZA 3C5SA 3KAAA 5HGGS 1JUFB 1IAIL 4F5CA 4R26L 5F3HA 3QFJB 4P0DA 2B4CH 4ZRGA 1I1AA 2BZDA 4HIEB 1JG9A 4LVOC 2RFXB 2Q8BH 5F6IB 3HR5A 4NFBA 1Q1JH 2UWEB 2YD8A 5GQBA 1GTFA 3VO0A 2LQRA 5F9WC 3U6XA 3MNWB 4J8RA 2XIDA 3BD5A 1BQLH 3QQXA 3CH1B 3EBHA 1LK2B 2UZIH 5IB5B 3VTAA 4S0HA 4PV9B 3VFRA 4Z7VA 1KN2L 2FHCA 2R0WH 1NEZB 5E6IA 4KWUA 4CMMB 5C07B 3OKYA 5CLWA 3GLEA 1F4XL 1GJIA 5C08A 1KFAL 3CU7A 3IETA 4YNYA 5DR5L 5I76B 1IFHL 4I0CC 1G1OA 1QX1A 3I6SA 4PWIA 2LFGA 1Q90A 2VGLM 4JK0D 2I7SA 2X7LA 3N9GL 5D7IE 2W38A 5EU6A 3QIUD 3ARXA 3FU7A 1PJWA 2OR9L 2WTRA 4ANXA 1ZA3A 3PWNB 4NQTA 5EIVA 1XR9A 4WO0A 2GBTA 3SE6A 2UZXB 5FA4B 1CC3A 4OF7A 4JCWA 3I6LD 4CKVX 3QZOA 5DJYA 3S4SA 5L9DH 1AZCA 1CFNA 4NENB 5FO7A 2J44A 1A9BB 1G6VK 4RGND 3UPCA 3IKCB 4FGMA 5KSBE 3QJTB 1QLRA 2IOOA 5DYOA 4ZD3H 1G6RB 3WEAA 3O9WA 2Z31C 2H9GA 1A6UL 3NCWA 3OV6A 4H8VA 2PP9A 5TPWH 4KJQD 4DP5X 4UB0L 2XC8A 3U0WH 1QBAA 3MRIA 4N90D 4ERSH 2F5BH 4TTDC 4IIQC 1P7KB 3C6LA 3T1FA 3EYSL 4XP5L 4F8PA 2JKXA 3L5XH 1LEGA 1NC2B 2BXYA 3BKYL 3KLAB 3MRLA 3IU3A 4MKTA 2YC1B 1KXHA 4JM2C 5JHDE 7PCYA 3O2DH 3CDGA 3E6HA 3LKOB 5BQ7A 1T03L 3ABMB 3MRPA 1DBBH 2H26A 4Y5XA 5G4OA 1L4IA 4ODWA 3V0JA 5CP7B 3GLDA 4NQXA 3O6ML 4NQDD 4WFEE 2IGFH 2HLEB 5KN5A 3WENA 2WM0A 4HWEH 5ISZE 5EN2A 1YY8B 2A6DA 3HG1E 1SZNA 4JJHA 2L3BA 4MVBD 4AK2A 4XXCA 1KLUA 4GG8B 1U8QA 1X5GA 4H8QA 5E70A 4ZSOE 1BEYH 2EH7H 1KJ2H 2CKBH 1ZANL 2AXGB 1MOEA 2GUYA 2Z6FA 1CDHA 5DT1L 3EH2A 1KNOA 3CFQA 2XA8L 1A1NA 5DMJB 5F3BB 4URTB 2P42B 2HRPH 5GRJL 5C3LD 1XHHA 1NGWB 4Y9CA 4NZTH 4G1EA 1LJMA 4G5ZL 1X7QA 1IKNC 2Q7YA 3VXQA 3LTVA 4PW3A 1U33A 2FWLB 1LGVA 1D5BB 1F0LA 1OZUA 2N1TE 5DRNB 5CO1A 4J3VA 5HY9A 3UJJH 4RAVB 4ZUWA 5T1JA 4IKKA 1MFEL 3T2PA 3GMNB 3GTTA 4ZMWA 4AGOA 1YEIH 3BVNB 5AVRB 4HBCL 3QPXH 5BJTA 5C2BH 1R17A 1ECYA 3IVKB 4MB1A 1TEYA 2QQNL 1E2ZA 3LDBC 3QDHA 5LGHH 2XA3A 3RVTD 5CGMA 4M1GH 4MRCA 1HHGB 3MRQB 4MYWB 1JZJA 4KDWA 2JJTA 4Z7VE 2HVBA 5FM5M 1AC0A 4FFVC 1JAEA 3ABZA 2YD7A 4ELDA 1TOXA 4JNXA 3PGDB 4CILA 5D4IA 1QPKA 4EDWL 4XN5A 4FHKA 3RP1A 5F1KC 5G55A 1RZIB 3Q8FA 4BFNA 3BGMA 1UVQA 1OIOA 4GIAA 2D7TL 2EIJB 3PL6B 5KYYA 1KEMH 1OP9A 1QEWA 1Z1WA 3KPSB 5BZWB 3UROR 2KHAA 1SYVA 1DQTA 2GBUA 5DU7A 4ZFZB 2E7BA 1S3KH 1D5ZB 2ITDB 2X40A 4GRWF 3OLGA 2IV8A 1P7QD 2VITB 3HRZA 5JIMA 1T5XB 2JIXD 4OB5L 1AHWC 5EOQH 3P4NA 4XNQA 5EOTA 3WNMA 4LSVL 2Z35A 4GRMB 2CGRL 3FFCA 4KITB 1CYXA 2QHLA 2Z9TA 5HPMA 2NY2C 5DI8A 4DN3H 4GG6A 2NXZC 4I88A 3OZLA 1RJCA 3EYVA 2XZCH 1MQ8A 3V0VB 2H1LM 3APMA 1T2QL 3VXUA 4ZX3A 4ZMYA 1MW0A 4R5VA 4U4BA 4S2SB 4Y0GA 5HJ3A 4H20L 3RBGA 1DQLL 3SZKC 4H25B 3TYGH 4XGZA 1EJ8A 1IAMA 2F53B 4BFEA 1N19A 3F7LA 5AW2B 1KBGH 3SCMB 1QHQA 2BNQD 5FO8B 1JK8B 4CADA 1IBGH 1UACL 2XZQH 1WZLA 1ACYL 2RCSH 3N1QC 4O2FA 4XPHH 5DO2D 4RVBA 3COOA 3ARPA 2FJUB 4WV1A 3GS7A 1NBYA 4MA7L 3QJXA 1FVDB 4HETA 2ZJSH 3IDXH 4XMLL 2VL4A 4R5TA 4YH6A 3SO3C 5KVGL 5L2KD 2R29A 2HAZA 5KVGE 1WWWX 3SDCA 4X8XA 4FFWC 4AENB 4H8PA 3JYBA 4I48B 5B39A 1E8ZA 1JV5A 1YYML 2XYBA 3UYPA 3ZDZE 3P73B 1U3HA 5ANMA 2YRLA 4PI2A 3U30B 2LHAA 3B3BA 2QV4A 2VXUL 3EFDH 3EJRA 1DJHA 1NMAL 3C08H 2R9HD 1EXHA 4O2CA 3CFDA 3DGGB 4KTDH 2CJ3A 2XPYA 1ND0A 1E5YA 5BZDA 2Z4QB 3GSVA 1U3NA 1MIEL 1NCOA 4IHBA 5CD3A 4B9CA 4L3CB 4WKZA 1VFAB 4AIOA 4XMPH 1ZHLA 4O02L 5LQBL 3LZRA 1WFOA 3KPNA 4ZXBA 4RMRA 1TCMA 4IRJC 1QZ1A 4BA0A 4NC0B 2GUOA 4WUUA 1KN4L 5ICUA 3DV4A 5K9OB 4L8SB 3KPRD 2Z1KA 2R2HB 1J18A 4HIHA 3I02B 3VFTB 1UD8A 4LHUD 4BV1A 2X4QA 4CC4A 4ZMQA 1QTPA 5CCKL 2AXHA 4RESB 4X5LA 2W92A 3B7TA 4HDIA 1YNLL 3T6ZA 4AYMC 4AC4A 2QSVA 1W16A 5ICXA 4LLVA 3UAAA 2YOAA 4A2FA 2CO6A 2YGPA 4PJAA 2BP3A 1XWVA 5D7JA 2IDTA 2CRYA 4N5ED 5JXEA 4P23D 3GMQA 2OL3H 3K46A 2UZYB 2AQ3A 1TJIH 2G2PA 4FCHA 4M4RB 5EBWB 3VE0A 4Y5YA 1IU1A 1QW8A 3PV6A 5CILH 5FOJA 4QT5B 4A63A 3ETSA 2G5BB 4NHUA 4XBPA 1H0DA 3KJ6L 2Y6SC 1YSOA 2DICA 5EUOA 1I8MA 1KTKE 1T21A 3ZX1A 2IAND 5LNEA 1KXQA 1SVBA 1AC6A 1IZJA 2KPNA 1EGJH 2O5XH 4W9ZA 2VLJE 4JM4L 5D7SH 4JHBA 3CDZA 4A6YB 4BFIA 4PCTA 2R7EA 3MRCB 5CSBA 3PWJA 5HHME 1I75A 4I9WD 1PYWB 4PGDB 4XP6H 1AR1C 3VW3H 4YL9A 1G43A 3SOTA 3TEUA 5J1AB 5FYKL 3HHMA 4LNRB 1LTXA 4X98A 1AOZA 1XH2A 5FYKE 5D6DA 1CQYA 2JCCA 3ZE1F 4F3FA 4FEMA 4V33A 4AW7A 4J4PA 2AV7B 4A7GA 3A4FA 3UZQB 3QJHA 3M1CA 2P49B 2XOTA 4LLWB 1DBMH 3GSNB 4IBLT 4DKEH 1XIWD 4Z7UE 2QJDA 5LDSA 5DJ8B 2Q3XA 3HPJB 3T1WA 5I73B 3OTTA 3NA9H 2R56H 3LYRA 1XF5A 1T89A 3HTLX 3MUGA 3U7YH 1CUOA 2VDOL 2H1PL 4NAJA 4WO4C 4ZPVB 1JWUB 3G04B 4G8GD 2BP0A 3LX9A 1A7NH 4JFDB 4AMKL 4PJCE 1INEH 1G5AA 1ITBB 1ES0A 1OWWA 4LGRB 3MRKA 2ZKMX 5I1HL 1BAGA 3BWUC 3QEQB 1Q1PA 2FE0A 1MLBB 2D7MA 4UQ9A 4DCQB 2MHAB 3SDAB 2N56A 3N44B 5DC2A 2DIBA 1HXKA 3E8UL 3OPZL 1TQUA 4PV8B 4AXWA 1Z0NA 1A3LL 4JO5A 3ATAA 4KJWD 4L4TB 3V0DA 1PX4A 3UBFA 3KLSA 3NQKA 5IB1A 5BMFH 3RDTA 3U9PL 4DN4H 4ZAKD 1PEWA 1YMMD 3RY5A 5L4JA 1E4WH 3VCLA 3MJGX 5E51A 3ARTA 1AGBA 1NAMB 1QRNA 2A74B 2B15A 5HHPB 2YEZB 4OGXH 3F6LA 1QO3B 4HS8H 4PGCB 5I24A 4WUUE 4W9HC 4BZ2A 3D4ZA 2OMTB 2VUYA 3LN4A 3WFDL 4DO6A 1SFHA 3CFJB 3PAZA 4XT1C 3TH4T 3QI9D 3T3PF 4XWOC 1J11A 3OHXA 3WKQA 1U8OA 2WLIB 2ZWLT 5IBLC 1WD8A 3IDNB 4PJIF 2XACC 4QLRA 3L08A 4XO8A 3KWUA 2DI7A 3NGBC 4HIJB 1E8WA 4FAAB 4ELMB 1XDTT 3WAJA 1PD6A 1E27A 1DN0B 3U7WH 3AS3A 4TULL 4PAZA 3LEXA 4BSVA 5IUSA 1ZHKA 4DP6X 1TJHL 2J56A 2ZYIA 4RBPH 2ED8A 2VR6A 1I31A 2VDRH 3HC4L 2PP8A 3QA3B 3DHUA 5BW7A 1SPDA 2FEDD 4WW1B 2V37A 3EADA 3HE7A 5B3NA 2FQEA 2XWXA 3VXOB 3Q8AA 4AL8H 2WINB 1A4AA 2HB0A 3BEWA 5C0RH 2I5YL 4ZQKA 4QXGL 1E5BA 3C09B 5CEZD 5H4ZA 5T1MB 5E2VL 3ARUA 4BK4A 3IFNH 4PJ8B 1S7WB 5F96H 2EDKA 4XAWL 2OW6A 1JVKA 3AG4B 1N5YH 2ARJB 1H8LA 2JF1A 3BO8B 4HC1A 5EBGA 2F5AL 1NCCH 2FUTA 1VPOL 3NP4A 3UAEA 3L3JA 2F54B 1BVNT 1XEUA 3UTZA 1XGYL 4CGTA 1WS7A 2OTPA 4E42B 4LO9A 1FZMB 3FW6A 2FWOB 2P43B 5C0NC 2NY3C 3O45B 2R8SH 2BZ7A 2AJSL 4H1LG 4JHWL 2CRMA 1A14H 4JVWA 1Q72H 1H5BB 4PD4K 1HZKA 4DNLA 3OB0H 2FYVA 2BY2A 4KKAC 1DVFC 2XSKA 4BBWA 4QJ3B 4GFTB 3FPYA 3WKNA 1UKSA 1FGNL 4Y4HC 1QI5A 4JQXC 3T3MF 5GGTL 1BFSA 2GC4C 2Q0ZX 1NGXB 4LPYA 3B9VA 3RWIB 2DQIL 2CGZA 3AM8C 1AO7B 3D12B 5BV7L 3L2LA 5L0QC 3FXIC 1HINL 3KYMB 4YXHL 4QYOB 1U6AL 3I6GB 2G60H 5BNXD 3RWCA 3QO0B 5BUPA 4GW4A 1XFPA 2WW8A 5GJTH 1X9LA 1JXDA 2YXVA 3L2NA 5F7DB 2CIKA 2WN3A 3D2UB 4XCFH 4NLHA 3KPOA 2J20A 2XXGA 1GTNA 5IV2B 2H2SC 4ODSH 3QDGD 1MJJB 5DDHB 1CE6B 4LDCA 4IEFB 3POCA 1BSIA 2W8CA 4B41A 1WIOA 5D93B 1HKLL 2GTZB 3QXAA 5IVZA 1Z3GH 2Z92A 3IDJA 1JPSH 2D31B 3EFOB 1WVZA 5AVSB 2EE6A 4JREC 4KH2A 3TF4A 1E0OB 5ID0A 1FG9C 3U36B 4DO5A 3PAYA 3GDCA 4BHUA 2CO4A 3HI1A 5ILTH 1R0AH 5KYUA 1J0YA 4IOFC 5CN2A 4AJVA 4FABH 5I2IA 1IGIH 3E1F1 5KANI 1TYEB 1JNNL 32C2A 1F45A 3HZYA 3T6WA 3QDJD 3KXFA 2E7LA 4NQQA 4PG9A 5HHNA 4LSQH 4N0YH 3H7BB 3V8OA 4CNIB 4AYSA 2H3NB 4A2LA 1LK3L 4G2AA 1TJXA 5E1GA 1QP1A 2F8XC 5IHWA 4FI7A 3NAAH 1HCFX 3E80A 4X6DA 3ILQD 1ADWA 4O5LH 3TEXA 3H0TA 2NX5A 1JERA 4LCYA 3ZHFA 3M8OL 1B2YA 1L0PA 3FB7B 4WGKA 1EO8H 4M03A 1FVEB 3AW5A 5E4EB 5A6MA 3R4RA 1SN0A 3PQYE 1N68A 2VM4A 3C5ZD 3HCVB 4NNYB 5C0CA 4EUPH 1W0WB 3CZGA 4HUMB 2BVQA 4HSAC 1NCJA 4Y2DA 3N3EA 1W72L 1A6VH 2PPAA 4XWGH 4U3SB 4EI5D 4JUTA 4CN6A 4KDVA 3EHBD 3UTSB 1MRDH 5DRXB 2BJML 4QOKD 3IFOA 4FQHA 5IW1B 4L05A 3BSGA 5EWIH 5GGRA 3P11H 4GSDL 2W9DH 5CLTA 5GRVK 3D39E 4MCMA 4AYDC 1QAWA 2XKUA 3AWEA 4JKLA 1U8LB 1P0SE 1HH6A 5T33H 4RDQF 5J13B 4X8JA 4LOUC 2NCEA 1WGVA 4E9YA 1UM4L 4HCRH 3RUGF 3FONB 5CGYC 4PUBL 3B2UD 3IMSA 2CBOA 3KS0H 4HJUA 4M5TA 3IF1A 1CCZA 4UOW0 5BVJB 4AKOA 2HT2D 3MJ9A 4HV8A 1HL4A 1FO0H 3PDOB 3QUXC 3GXPA 1BM3L 2Y5QA 2ZUVA 5I1GL 5J11B 1N5AA 1IEAB 5T5FL 3UACA 1BQKA 2IBGA 1PG7H 3QFJA 3QRFM 2BVPB 4PJEA 2FO4A 2DM2A 5KS9F 3GD1C 3MLWH 3QJOA 3HAEB 3QHZL 4HIEA 4BUQA 2X6MA 4XTRD 2O93L 1IAKA 5EA0H 3I50H 3N5AA 1T1YB 1EFQA 1ZMYA 4KH9A 3GXDA 3VXTB 3L9EA 2ODHA 1UGNA 3MNWA 2NTFA 5TK4A 1XF3B 4Y4FB 2VDLL 3MXVL 4G82A 1ZTXL 1YAZA 1LK2A 1CXKA 2GYSA 3WEXB 5IB5A 1ZTXE 1MAJA 3ATFA 1GGCL 4PV9A 5J3HC 3TONA 2XG5B 3FO2B 1NEZA 4WTXA 2RQ8A 4CMMA 5C07A 1FNAA 5IQMA 4BQCA 1PTZA 1FZKA 2F8OA 2MCAA 5DEZA 1MAMH 3CPLB 4DK3A 2CR6A 1OAZL 4AYGA 4L0PB 1FIGL 2HTKD 3PP4H 4HQQH 5J1SC 3OR7B 3MLTB 3TU6A 1THAA 2WXKA 3S6CA 4XVTH 5EU4B 2YAEA 3SYAA 5AOZA 4PJ5B 1BDYA 3EH4B 4B6ZA 1CF8H 4LP8A 1TMCB 5E2WL 5AZEH 1P4UA 3PWNA 3VYPA 1JHKL 1KB3A 3LMJL 4FTVB 1L9SA 1KGWA 1MHPH 5FA4A 1CR9H 4NJ9H 3LIZA 2NY0D 3CFMA 3S7GA 2VXVL 1VCBC 3R8QA 4Q0XL 4NENA 1SN5A 5AAPA 5I74B 4Z7QE 4NHCH 5I6MA 3QUKA 3L3OC 2A6KA 5IJBC 3IKCA 4PREB 5F7YC 5AVUB 3ZVVA 1WZAA 2JB5L 2PMZA 1DP0A 1GYWA 2GFBB 4WI0A 3IGKA 1RK1A 4N0CC 1RLBA 1G6RA 4DGYH 2DQEH 4KPHL 3TBSB 1AGEB 3A4DA 4L2LA 3MU3A 2YAOA 4UCFA 5AVVB 4YWGH 3VQ2C 3WUWB 4BK5A 2WQVA 2VSKB 5I5IA 1SY6A 3FF7A 4L3ED 4TNFA 2VR7A 2AW2A 1YNKL 4P2OB 5D70L 2KBGA 1NCDH 5I8KL 4OGAC 2G4EA 4XOEA 2BVOB 3UBXI 5DUML 3KLAA 1YQVH 4MJ4A 4MRBA 1E8YA 3NZ8A 1BW8A 4N28A 1EJ6A 1Q94B 4WHTA 3G9VA 5T1KB 4EVNA 5F7AA 5IBTH 5CP7A 4LEBA 1RPKA 1IM3A 5LBSL 5T3ZL 2VM9A 4AYBA 5T3ZE 5EUKB 5CWSB 4DPRA 1YY8A 5T5NG 4YZFF 3V7MA 2FJFB 4NN6C 4OLVH 4UM9D 4GO8A 3VXSB 2QMKA 4MNQB 2WVVB 1IUZA 4XO3A 2WBKA 2WXGA 4NQED 4EPSA 1DL7H 2ALWA 8PAZA 3V4PB 1CVRA 3RIAK 3MNVB 5EF2A 3W11D 3CSTA 4WI5A 5F3BA 1BJ1H 2WVTA 3SE3C 3ULVL 1XO8A 2IV9A 3DMMB 4TKWA 1ANUA 3V6OA 1P84J 1HVXA 2COVD 3GZOA 1NGWA 4AOFA 4C8XA 4DP8X 1RUKL 4MCZA 3ULVE 5CUSH 1BZQK 2VQ1A 3NJIA 1CLZL 4GXUN 2H5UA 4HCFA 4JMXA 4XCCH 1UD2A 3B2XA 3ULAB 2X4UA 3LKRA 3QFJE 2RALA 2J8UE 3EO9L 4DKDC 3AU1A 3GMNA 3MLYH 4EN3C 4JMNA 2WKOF 3BVNA 1C12B 3CDYA 4QGYA 4AVJA 3L1OL 4GPVA 4HP5A 1DO6A 2WB1A 2UWEE 2WZ5A 1G84A 4QGTA 1Q4NX 4HLEA 2MQ0A 1HHGA 3G5ZB 3RE0A 2ZOLA 2Y2YA 3U46A 4HA1A 1E40A 1FNLA 2XWCA 4O51B 3UG5A 3ARWA 3V6ZB 1J9TA 2ZXWB 4OCLC 4NBYB 3CVIL 3MOBH 2QFRA 2V8LA 2XVGA 4PB0L 3P2DA 3CZEA 4FP8L 3CWGA 2XETA 3BPLB 3RNKA 3KGSA 1FF5A 4IDJH 2I25N 3KPSA 5BZWA 3VD4A 3SJVB 1SEQL 4ZFZA 4Y9GA 2VITA 3BZ4B 5EEWA 2FIKA 1O9WA 2DQGH 3O8XD 2RJMA 5E99L 5AW4B 1QTYT 4GRMA 3CZFB 2GK0B 3EOYG 4AV4A 4CSZA 4KNSA 5ESAA 5BOPA 1ASPA 1HIMH 4WY7L 3RJOA 2ZNWA 4BSWA 2H6UA 3D4YA 4BFJA 3QCUH 3UTTE 1KTRL 3OC8A 3FSVA 1OSPH 2CD0A 4S2SA 1CFMA 4P5TC 1HZHH 4G6JH 2B77A 2F53A 4ANWA 5FO8A 4YXLL 4WWID 1JK8A 2OMVB 4WQOA 3F7RA 4J3OC 4OY9A 5E1AB 5J9PB 1J0IA 4WHYG 2CDGB 2R2BB 5IVOA 3WG7B 1Q38A 3WGVB 5BRZD 2NUTB 2WWMD 3S35X 4APQD 3OMNB 4RGNB 2CSPA 3OKEA 2O1AA 5T1DH 4AZUA 5DC9B 4AG4H 5E8EB 3RL1B 4AENA 1DQDH 4TN9A 1JF6A 1F1AA 2FO1A 2XV2A 4XNBA 4H44C 4H2CA 4JFEA 3D0LB 2R15A 2WB7A 5I9QC 2G4GA 1S5IH 3SD5A 1Y07A 4IU3A 3VUAA 1BYNA 2Y72A 3F83A 4BKTC 1AQ8A 4HWBL 4TSCL 3L5WA 4WI2A 15C8H 2X44D 2CUIA 3VFGH 4DQOL 4ZQTA 3P1VA 3O6KH 3ERXA 2XU9A 4F33B 3HI5L 1ZT7A 2IH9A 1K6QL 4NT6A 2PCPB 4MNHB 4U1NB 5ALBL 3ARYA 1X3DA 4KDTC 1WITA 4MJHA 4PJFE 3REVA 3SO5A 2VJXA 1UD6A 2WCPA 3EGSB 4OBRA 3GMOA 3AACA 3I74A 5I8OL 2EXYD 2PPDA 1ERNA 2X3AA 4PRHD 4JO1H 4HJ1A 4LU5H 4PP2A 5DJ2A 5F89B 5K9OA 2R2HA 4KHTL 4GOSA 3DSNA 1SVCP 3KLDA 4ZOCA 2Y23A 5ITBL 3AMKA 1RJLB 3KJ4C 2DN7A 1INDH 3S36X 4X5PA 1U93A 3JSSA 4Y88A 2FK9A 3EH1A 5CN1A 4A7UA 3SBQA 4FTDA 1OAXL 1BVLB 3PE9A 2DQCH 1WTGT 3QXTA 5EIIB 1FHNA 5HGAB 5CEXA 3THML 4J5VA 5CEYB 4FQ2L 5CJQH 4HT1L 1RIUH 1HCZA 1N0XH 2C4XA 1M2OA 1OSYA 5CZXD 4QRRD 4FQLL 4PVMA 3BN9C 2PXYB 2UZYA 4AQEB 1NGQH 1OOWA 4OZGA 3CFEA 5EBWA 1A64A 2GTWA 3RBSA 5FUOL 1NMCC 1NCTA 3NTCL 4QT5A 3D52A 3FUFA 2G5BA 2J88H 1I1FB 2HP4A 2X2HA 2P8LB 1JPTH 3T04D 3ELQA 2C7UA 4OKDA 4FE9A 4UV7H 5C0AE 1RIVH 1KCRL 1M7IA 3ZL4H 3UAFA 3T0VA 4HMDA 5J12B 1E6OH 5EORH 2K0RA 2YA1A 2X70A 1IBHA 4EIBA 3HZ3A 3O3UN 1KIUB 2E75C 1LO4H 3MRCA 1QLEL 1YPZB 2P3YA 1KELH 4K3DH 4Z0BH 2HLFC 3K6OA 3BAEH 3LPPA 3P9MB 5FUCE 2KMWA 2W80C 4ONOA 1PYWA 4PGDA 5TDNB 5KVDE 4LIQL 2AK1L 3EJZD 5J1AA 3NACL 4LNRA 4IKIA 1GGIH 2ZG1A 3FH8A 3KMDA 3FULA 1QFUL 5CINL 2JIXB 3ULSA 3QZLA 2YK1L 3VG9B 2NDFA 4ZMTA 1SBSH 3FQWB 2GITB 3FOMB 4NRYB 4OT1H 2AV7A 1PQZB 2FSEA 1SXNA 5HDQL 4ZPTB 2I85A 1GW0A 1HXMA 1T0PB 2ZXEB 4JPWH 2ZCZA 3RI5F 1H6UA 3CLEL 5EG6C 5D71H 4MKMA 4S1DC 3HBGA 5AZUA 2IQ9H 2GY5A 2HKHL 3RTQB 1UQSB 2PPEA 2OZ4L 1U8KB 2OBGA 2VZSA 4JFDA 5PAZA 2HMID 3ZDYF 4FQ1H 1GH7A 3TN0B 2DKSA 4N2MA 3QEQA 4M5ZL 3SPVB 2RTTA 3FB6A 4DCQA 3RVWC 2MHAA 3SDAA 4PV8A 4HKBA 1HYSC 5JXAH 5D72H 2WANA 3ECUA 1ZCRA 1NBVL 3QDMD 3FO0H 4M29A 4HEMA 3TWCL 4HLZH 3N1GC 1FYTB 1CN4A 5MEPB 4F7PB 1BYPA 3K6SA 4WW2F 3TESA 3T65B 5FUZH 3H54A 3IPFA 3ZIMA 3ZKXC 5DMGD 4X6BB 4LK4A 4PJ9D 4KKPA 1S7SB 3ZRFC 2WXFA 1H9VA 2A74A 3QJQB 2BSRB 3ETBJ 3EYUL 1JWMB 5HHPA 1QO3A 1TVDA 4UT9L 5IFHH 4I8DA 1XSJA 2FEEI 4MCYB 1O6SB 4JFQB 4JZJC 1SOKA 3N85H 1BZEA 3S5LG 1HEHC 1DBAH 4Q52A 4ONGL 4LPTA 1ZSDA 3L3GA 2W0FB 3BUTA 2WLIA 5CSGA 3BP7A 2DYPD 1MJ8H 5GZNC 4LSSL 1UYWH 2CUMA 3E2HB 4HGWA 4OIAA 4N87A 2YXMA 5AVXB 4JO4L 2E8YA 2X6CA 2JJSA 1DN0A 4OFKA 4P46D 5DJZA 5JIKA 1G7HB 4LHUB 3FMGH 3HZVA 4OCNC 4WI7A 2O6EA 1D6VL 3QA3A 4RSYA 3LEVL 2LV4A 4HUVB 3BAWA 4Y9BA 1BFVL 4U0RB 1CGWA 2NY6C 1NCAH 4LPXA 1J1XH 4K3HA 1B4RA 3KDPB 4QRPD 1T5WB 3CN2A 5T3XL 4XOBA 3VD2A 5T3XE 5J7CC 4XO9A 5L4MA 1OD7A 5T1MA 5JOEA 4OCSL 4OJEH 4PJ8A 4M6OL 5CZVH 1HEZB 1KY6A 5C09A 5LCVA 4XP4L 3UYRH 5IVNA 1OANA 4NZFA 1GS6X 2CXGA 4PJGE 2ARJA 3BO8A 3SKOA 4A6YL 5IROC 2E9WA 2DMKA 3HPLB 2RACA 1FFOB 3NCEB 2F54A 3R0NA 1JV2B 1V7NH 1CGSH 4X4ME 5D1QD 4KQ0A 3STZA 2JFCA 5AOLA 5KTEL 4E42A 5TGBA 2FWOA 3P77B 5BOJA 4JLRB 1RJZB 2A9BA 2CZNA 2QLYA 4PW9A 3HB3D 1KF9B 4XC3H 3CMGA 4BEIA 1JXGA 2IANB 2FECI 1RUQH 4JEGB 4PFEA 4D9LL 2J72A 4RETB 3Q6GL 3WD5L 2G3XA 2QZ5A 3S8WA 2BH0A 1H5BA 5CAYB 3OLIA 1N2RB 4QXTB 4ZX4A 1WFTA 4LAJH 3HFFA 3GSNL 1X44A 4K73A 4AEHL 4P59H 1RERA 5EO0B 1QBML 3K81A 5TQ0L 4L29A 3ARDC 3F62A 3NQIA 1T20A 1VADB 1BOGB 1NGXA 3RWIA 2FD6H 2W0KA 4RAUB 3ZTNH 1SXBA 5IF0A 2VC2H 3APDA 1AO7A 5A2BA 2Z31A 4OZIF 1QQDB 5A2FA 1A6WH 1CGUA 3T4AB 3ZYOA 4MJID 2VH5H 3QO0A 1FORH 3TYFB 3DWTA 1RULH 3MLPA 2EVFA 1G7MB 4JFDE 2FJSA 4U3HA 2CKBB 4MBRA 1V10A 1H6TA 2VCOA 1XMEB 4LSPH 4JFOB 4X99A 1A7RH 1XGQA 2J4WH 2XI9A 3TV8A 1EXGA 4JM2A 1VJSA 4TS6A 5DDHA 1UCBH 4H88H 1M71A 3BQUC 1M2VB 2A9DA 2ITCB 1DTUA 2WLZA 2XTJC 4IEFA 1DJSA 4G8GB 4BFGA 4L4TE 1J1OH 5LXGL 1CFTB 2R1XB 4PWKA 3UBGA 1S4IA 3ALWA 2D31A 4FYTA 4KX7A 3TEZA 4OJFH 4ORZC 4UINL 1T0OA 2XT1B 3U36A 2XN0A 5GIRB 4OGQC 3OC5A 1PF3A 4GSXA 4HCIA 1XGRB 1E67A 4LCWB 3ZZLA 1FAKT 2WLLB 3GTVA 1I8IB 1NAML 4HW6A 3NIGE 4GS7C 1KLGB 1OTUC 2EDRA 2ZUWA 3N04A 4JKNA 4P9ML 2D7OA 1WT5C 2DTML 4JCMA 4A68A 1RHHB 2R0KH 3JVFC 3ZJAA 5LVEA 3UZEA 4ZAKB 5FW6A 1E42A 1ROWA 1YMMB 3MX0A 1OGAD 4JFWA 4JZOA 4LPCA 2MTPA 2ZXBA 2C3VA 4S0SD 1UUNA 4PU2A 4XB7A 5EO1A 4K9EL 4K9EC 4OUUB 1BQHB 2X4TB 3KR3L 1KB5H 1B6UA 4DEUA 5JDSA 2ICWA 3FB7A 1PD0A 2WGNB 4AH2A 2XV6B 1FVEA 4XBEL 4ELME 2OTWB 3IXTB 3FN9A 3V6FB 3DTUB 3DX7A 3QI9B 2EO9A 4FXLA 1VESA 2ZYRA 2GSGB 3HCVA 3U9UB 1J12A 3PIQB 1XD1A 2LVCA 2AGJH 3MCYA 4NUGL 5DJ6A 4NKQB 5HVFB 5D2NB 4U3SA 3HZMB 5E56A 3UTSA 5B1BB 2O5NA 4MDIA 2ZTBA 2VLKD 4JRYA 2P48B 1MXDA 4I3GA 3RU8H 5IW1A 4PP1D 4XVJH 1BZ7B 3WY3A 1R46A 3VTMA 2X6VA 3QH3A 2XWRA 4ZMOA 4RQQA 5DZNA 1JGDA 1OSZB 1F8TL 1KOAA 3OBAA 1R19A 3V7AG 3KWWB 4KKBC 5FOBB 1S6NA 3BSZA 3ZY7A 3O3DB 1AHWA 2NW3B 2UUDK 1SUHA 2XX0A 5EOCH 5D1XD 1E9OB 1IEAA 1AS6A 4I4WB 4YGVB 4XO4A 3RG1C 2ZNXA 3VRLF 1SVZA 5IFAH 1AGCB 3L4WA 3M7OA 4XPGH 5J6GB 2B7DT 3N55A 2EIBA 4IRSB 2X89D 3JVGC 3HAEA 4GW1A 3D48R 3HS0C 2FGWL 2VXQL 4K23H 3HG5A 5LGJB 1IGFL 1AZRA 1NDGB 1QSVA 3KGTA 3TBVB 1ADQA 1VB9A 1L5GB 4YSEA 1UXWA 4TVPL 4P5RA 1NLDH 1DSFH 1G7JB 1XF3A 2WXIA 3FRPG 4Y4FA 1QNZH 2YPLA 3H7LA 4FN0A 4PD4J 2NY5L 3FH7A 5AOJA 1MVUA 3GHEL 3C87A 1D7FA 1DE4A 3FQNB 1SM3L 2HFFB 4G1MB 3DO7B 2V7HA 1D5IH 2PYEB 1UB5B 4MAYB 4FXKC 1FNEB 1PMYA 3WS6A 4B9GA 3A4EA 3FJTA 2OM5A 4AGPA 1FG2A 3MLTA 3T6VA 1XB8A 3ESMA 2A9NH 2F7QA 4G6MH 3JWDL 2YUWA 3JWDC 1F90H 4HPYH 2HT3D 3VFNA 1TQSA 3L9RB 5I6XB 4ZO8A 3MV9D 2EZ0C 3IYLW 5GGQL 3LPWA 4ABQA 3SY0B 3L45A 1QWHA 2O5ZH 2WJ7A 4C4KO 3BJLA 4N8VB 5G4MA 5AW6B 3QR1A 3UAJD 3QIWC 3FQ4A 3QWOB 1QA9B 3LZLA 4JFFD 4O02A 3ZKSD 3HNTH 1Z9PA 1T66C 3OQRA 4D9RE 1Z9NA 5E8NA 3ME0B 5E2UL 3C12A 2M26A 1EAJA 3BN3B 3JYCA 2A9ML 3C5JB 2GFBA 4GAYB 4NKDA 5BZZA 2VO8A 4P5KB 4DH2A 1Z9OA 2LU5A 5B4MC 3TBSA 1AGEA 4RRPG 4HISA 5D7EA 1OTTD 3QDJB 4IGBD 5EBMA 3WUWA 3RKDD 3EH3B 4E9VA 3V5DB 3TNMB 5DD6B 5FK9A 4B5EA 4QKTA 2MCPL 4P2OA 2E47A 4ZMLA 3LPOA 5CJ8A 3TA3C 4M62L 2BVOA 4FQPA 3HBPA 1P7HL 1WUZA 1I7ZB 5J8OA 1J8SA 4OCYL 1DJIA 4R8WH 3K6NA 3OXSB 4E36A 1FGVL 2EH8L 1Q94A 5E6SB 1E3FA 4JFHD 3K6DA 3D05A 2Y3NA 4AUUA 2EKJA 2FATL 3X14B 4GI6A 3C2SA 3WY1A 2F8VA 5E8DL 2FYYB 1AXSB 2FQFA 4HUXA 4TUKH 1AMYA 5SX5K 4N2GA 2TRYA 3BHBA 2HCZX 3C5ZB 5D7LD 3Q0HA 1GL4B 5CWSA 4CSPA 5GS3A 3GJFA 2NXYC 4OFYD 4E5XG 4M1CC 4Q9QL 5DK0B 3VXSA 3SKNB 4EI5B 5C0BE 2XQBH 4BE6A 3PWVB 3NZHL 1IKOP 4WI6A 4GAGH 4QOKB 43CAB 3V4PA 3V0WH 4K3JL 3MNVA 5IT2L 3RHWK 4V2CB 4U1IB 1TT6A 2ZICA 3NESA 4KXCA 1OW0C 3I6KB 3ARGD 1GVIA 2YD4A 4FJ6A 1I4FB 3W9EB 4E9RA 1ML0A 2CBQA 2E46A 3R06B 4OCRL 5E6YA 3SYQA 1PZUB 3FB5A 1F00I 1CGVA 3AQZA 2MJWA 4I0PD 3I9IA 3IRPX 5ETUA 2I60H 5JW5B 3VMNA 2XN2A 4BGDA 4A7TA 1CJYA 4NGHL 5D1ZB 4OJYA 3FPXA 2KL6A 4YSCA 3FQUA 2B8OT 3DETC 5BO1L 3DVNB 2ED6A 4G59C 1Z6JT 4OZFG 4DQAA 5E00B 3V0EA 1MIMH 4BH8B 4YS4A 4ABWA 1K9TA 2O6FA 3G5ZA 4XOCA 2Y2TA 5FYJL 1H3PL 4KI5F 2V8MA 5FYJE 3RY6C 2IH3B 1D7CA 4JL1A 1RU9H 4O51A 3TLRA 2QTEA 1GC1C 4WO4A 4ZW8A 3V6ZA 4UT6H 3G6JF 3QUYD 1LEIB 3JTSB 4F8NA 2FZ3B 1RK0A 5EFIB 4AQAA 1I3GH 4HKXB 3SPIA 4LEOB 2YXWA 3P3RA 2AJYL 4DP4X 2Y7QA 1NPNA 1DJYA 5A3IC 4L9LB 3GINA 3BKJL 3SJVA 5I71B 5DQDL 4YC2B 4JPSA 1K8DA 4R6UA 5DWUH 4GKSA 5IQ9A 3ISYA 4PJ5E 3BZ4A 5H4YA 2JKJA 2F19H 1DQML 1DQLH 3CDFA 4MA1C 1GPOL 4FTVE 4NZDA 2GK0A 4UUJB 4OJAA 3RFZB 1YEWA 5AYUH 1OL0A 1N59B 1BOYA 1OCOB 3ZIYA 1XH3B 1GZQA 1ED3B 3NP3A 4FLHA 4I5BB 2AJXL 5H94A 1TQCB 3BYYA 3AADB 3S97C 2VDRB 3SPCA 4IW4C 2DL2A 1AQKL 2ARJQ 4DGUA 3K91A 5GRZA 4QHMA 3SDXF 4GKNB 5E4OA 3VA2C 5D2LB 5F9JB 3CQPA 1UOLA 2YRZA 2OMVA 4E9TA 1JZDC 4LHJB 3WL9B 5J9PA 2HVJB 2CDGA 1JE6A 1EJFA 3F7KA 1CBJA 4HS6B 1LE9B 5JO5A 3IMTA 5AKVA 4LFHG 5EZIL 1KACB 2NUTA 4DEPC 3OR6B 3DHMA 1ZLWK 3BT2L 4LKXB 3E8VA 2YKLH 4NPYB 3EYOB 1PX8A 1ZV9A 2X9WA 4NN5C 5DZAA 3LKQA 4Q6KA 5E8EA 1LQSR 3RL1A 4ZTPH 1X5FA 2EQDA 5A7BA 3WIHA 5KJRL 3BLPX 5HHOE 3GF8A 5I8EB 4C83B 5D7KD 4F7KA 4PM1A 5F9DC 4TSBL 4MYPA 4N1HB 1MQKH 3EJPA 3BGFB 3TH3T 4ZUTB 4EF3A 5FO9A 5A7EA 1HILA 4KY1L 1CE1L 3FRUB 4ODVL 4UM8B 4UWQB 2YFOA 4PRAB 2YAFA 2BHZA 3VXSE 4XP1H 3HIZA 4HUWB 4MNQE 4F33A 2AKRB 4TLSA 4U1NA 3S3JA 3TZVD 2WXPA 2F08A 4XNUL 3BW9B 3FQTB 3MV8A 5CCGE 4PLJD 2E6JA 1TPXC 3N2JA 2QR0B 4B96A 2DJ4A 4C4UA 2H41A 2VWEC 5IG7A 4OF5A 3INUL 3ULUF 4JO2L 3VYOA 3E7JA 3LJ3A 1MG2C 4M61A 1LWJA 1NCUA 1FFPB 4FMVA 1CDCA 2VL5B 2LAAA 4NQEB 4PN6A 4QTFA 3QP3A 4PRDA 6CGTA 4LARL 5EZOL 4DGVL 5TQ2H 1E28A 5G5DB 1RJLA 4OF6A 3T08A 2QFPA 4GBXB 2ZCKL 2P24B 3BWSA 4Z7AA 1C5CH 1DVFA 4TPRH 3ZZQA 5I0YA 1BVLA 5HGAA 5IEHB 4Y4HA 2JQZA 2X10A 3ARDB 1YUHB 2K7QA 1N64H 5CEYA 3BP4A 3QG7H 1SEBB 4U3XA 3P0VL 3P30H 4WU7B 4LBEB 2OR7A 5LAXB 1KWKA 3REWB 1R3IH 3HZKB 1AZUA 2ED9A 3P3UA 2PXYA 3K2KA 2D2CC 4MD5B 1MNUH 3AFLA 4PV1C 4G7YH 3DX6A 3DXAA 3AROA 2WGXA 3TVMD 3ZE0E 5J5EA 3V9EA 2BNRA 1MRCH 1PDKB 5D96B 3V4UL 1BBDH 2UY6B 1EAPB 1JRHI 2NNFA 3F65A 2LGNA 5JW4N 3JV6B 2UYLB 4R4BB 3VM5A 5TFSL 1MW2A 2A73B 4WUKL 2NYYC 5EH1A 12E8L 1F58H 1KIUA 1ZE3C 2DQJH 1YPZA 4QHPA 3K74B 4N8PA 3P9MA 5TDNA 3QIUC 4U6HB 3QHFH 4JRXD 5JA9A 4FQIH 4Y19D 4A2EA 4GQQA 2WCSA 1GHFH 2NR6D 3WI9A 3GRWL 4Z3HA 5IFJA 4I1NB 2OCFD 3BVWA 3BUPA 5HHQB 5H8DA 1SLWA 3O8XB 5T5NF 2GITA 1PZCA 4JY4A 2FJHB 6PAZA 1PQZA 4J3SA 3N1FC 1J5OL 2NLJB 4ZFGL 1H19A 4K7PH 4L8CB 4ZPTA 5AYTA 4KUCF 4A2MA 2QSCH 5TDPB 1I1AD 1JHTA 1UA7A 3I6LE 5IM7A 4G8EA 2F6AA 5JPNB 4JFZL 3VI3F 1MFAL 1T80A 4HX1A 4RGNE 4F8TA 2YS4A 4TV3A 3H42L 1BVKA 4NN7B 4X6DF 3RTQA 4MMXC 3UL4A 5AB9A 2V5SA 3LEYL 1G7QA 4X6FA 4OJDH 2HX8A 2DM3A 3WV0A 4EBQH 4GFXA 2BCKB 5ICYB 3TN0A 5B38A 3SPVA 1IGJA 4PHZA 4YGAB 5FYKU 1UATA 1W72A 5E6ID 1YYLH 4N90E 3R1GH 3OM3B 4YN3A 5CP3H 1ACCA 3MFFB 5C08D 1FNGB 1TVHB 2OMZB 4MS6A 2BVEA 1R3JA 2IPTH 4Y16C 1JNLH 4I0KA 1FYTA 1W0VB 3Q2WA 3KWVA 5MEPA 1DN2A 1IGML 3BEVB 3S3DB 2OXGB 5EU6D 2YA2A 3QYNA 4GQRA 1Z5YD 4CGUB 2HKAA 5FFOA 3WFDH 4HYTB 3VGGA 2BY3A 4X6BA 2XKSA 3UO1H 4NQDE 5JIIA 1F3DH 35C8L 1S7SA 3IDUA 3PP3K 4F20A 4KKZA 1FBIL 2FCBA 3CZUB 1RH8A 2WBWB 3RWHB 4MCYA 1O6SA 2VISB 4OAWA 1SJXA 3DX0A 5JYLA 1KYOJ 3LS5L 4QPEA 4OQTH 3HRPA 2X4NB 1Z5LB 3W39B 4WRLA 2ESVA 3AZUA 4QHNB 2AXFA 4XPTH 2ZG2A 4M6ML 1UKQA 3MYZA 4HHAA 4HJEA 3E3QC 4X9IA 5IMKA 3E3QE 1Z9MA 4Z95H 4PRHB 1HQRB 2R1WB 2BINA 3DYPA 2XV3A 3FU3A 3GZQA 3O9WD 3LRSB 1RZGB 2XIBA 1G7HA 3OJMB 1U8JA 4S1RL 3SYOA 3VWJC 1IO4C 4ZTOL 3KEHA 2OCJA 4YSRA 5JIHA 5ALCH 2D9QB 3C6LD 1E90A 1QPXA 5I19L 5ESQB 4HOZA 3BVDB 2GAZB 3F58L 4YMPA 5F7MC 5AB1A 4HUVA 1KBPA 1A5FH 3FQYA 3RVTC 2NZ9D 5DC0A 4UBDD 1OE1A 1L0XA 4N6RB 3DPBA 3ZDWA 1OAKH 2AJVH 2V3DA 3PGFH 4AV0A 4XNXH 2FVNA 4GP5B 3TT1L 4QRRB 1EV2E 2UXVA 2GJRA 4IKJA 4Y2OA 2EIKB 5JPMC 3AITA 3Q9PA 1S7VA 3N50A 2AVGA 4WSJA 1DLFH 2Q7NA 4JHWH 5LGHL 3HPLA 1FFOA 3KZ8A 2ERJB 4JQVC 3L3DB 4JDTH 5FCSH 2H7WA 1JV2A 4KMTL 4Q8BA 3U4KA 3MGOA 1KIPB 1NL0L 2MFNA 5E9NA 1I53A 1F11B 3HC3L 3W3BA 2RR3A 3D3VA 3MAWA 3P3SA 5IMLB 3IAPA 5T3ZD 1FSKB 5FLVA 5GS2D 1JRHH 3MLUL 4RAHA 4ZS6D 5M94B 1FL3A 1NC4D 5FCUL 1FCCA 4KTEH 4QXTA 3S98A 3NZUA 4ODHL 4P4KD 5CJOL 3FS9A 4Z7WE 2D4DA 1DUYA 1NAKL 5C0IA 1V8HA 3L3OA 3AAZB 3I75A 3T3PB 3ARFC 3QWRA 4FHBD 4BHUI 2AMGA 4KROC 1BOGA 4B9ZA 4RAUA 1IL1B 3I85A 4L4JA 1RZJL 1VCAA 4JPKH 1RZJC 4CBZA 1QQDA 4PJIB 3X12B 2EEBA 2VE6B 4HF5H 1SDDA 2P5EA 5F6HJ 1XCQA 2BNQE 3B7YA 2VN5A 4JKWA 4OM1H 3FTUA 4U1LB 5CIPH 1G7MA 3ZMRA 1PJ9A 1N8ZB 4JKPL 1AZBA 2WMPA 4Y5VB 1R3HA 4JFOA 1TZGL 4C55A 5FLUA 4K3GA 3CVHB 3HE6C 1EAOA 4MWFA 1TMQA 5L2KE 2F9BT 4AGMA 5FKPA 1M2VA 3K72B 2ITCA 2AQTA 3IJHB 2Y36H 3KDMA 4G8GA 2B4CL 4HAFA 2QVIA 5FDYA 2DAVA 5HYSB 4MJ5A 1CFTA 5F7EH 2IO5A 5HI4C 2Q8BL 1MW1A 3T0WA 4RFNB 1IBZA 1YLBB 2DI9A 2WYHA 3T2LA 5DD1H 5AB2A 5GIRA 4Z3FA 1QSZA 4OLUH 1Q1JL 5HI3D 1FJ1A 3ZTEA 1XGRA 4LCWA 2ENPA 3FTWA 5F0LB 1BQLL 2QHRH 3EW3B 3FHQA 1N9PA 3FFCD 3QDMB 1SFDA 1ZWIB 3EFFB 2UZIL 3FZUC 2EO1A 1F97A 4J28A 3KLQA 3HFMH 5I5MA 4AQ1B 2YR3A 3M8OH 4Z6AT 1SLVA 1M3JA 2COQA 2VSCA 4ZAKA 3VXUD 4WEMB 1KIQB 4HMEA 5JW4Q 1CI3M 1N6UA 1VDGA 2VDKB 2VERA 3I9AA 4PJ9B 3KW8A 3VX1A 2J1WA 5EULV 2GJ6A 1BQHA 3ASWA 3B56A 2BSTB 1XCTB 1ZA6B 4NPKA 2WPGA 4M7LT 3SE8H 3T8XA 2WWNA 1O5DT 4EN3A 4POYA 5FR3A 2KQNA 5DMIH 5CCJA 2OTWA 3IXTA 1MCOH 3KPRE 2BIMA 3T2QA 2F0CA 3T3MB 5FFGA 3TIDB 3IMBA 4YVNA 3Q5YA 3T0EC 3HUJF 5I1IH 2C1PB 3PIQA 4N2OA 4LSRH 4YHKH 4QRUB 5D2NA 3SDCD 3SPJA 2WLJA 4B9FA 4LRNL 5AZ2H 4YXKH 3G6AB 2DYPB 3QC5X 4HC1H 5L9DL 4Y89A 3MV01 5EF0A 1N7MH 1U3HD 3KM1A 1BZ7A 3VXPB 1J5HA 2WSPA 4P46B 3RIKA 3H6JA 2IDQA 2K4AA 4P23C 3QARA 3L7FA 3QJFB 3DPDA 1DQKA 5AEAA 3HMXA 2E6QA 3QNYB 1MCCA 1RJYA 4QRTB 3GPEA 4UDTB 5TPWL 3FTYA 3H9SA 2Z91B 4R96A 5GS1B 2UY7B 4EXKA 3O3DA 2V2WB 4LPWA 1CFQB 2F5BL 4QRPB 4ERSL 3N41F 2GC7C 4DVRH 1G9NC 3VFMB 5I28A 4JHUA 3EYFB 2BHUA 5FC9A 3ZYIA 1PZBA 4YFDB 4BGLA 3ISWA 1HEJC 3L5XL 4ZXBD 1E9OA 2A9CA 2IANE 4YGVA 4I4WA 3KYKH 1AGCA 3O2DL 4DKAA 4WTZA 2KC0A 4YX2H 3D5OF 3SODB 1DBBL 2ZOKB 4P5TA 4LCCC 4IRSA 3HR6A 4I18C 5I8CA 3GUTB 5DGRA 5ES4B 2IGFL 4I9WE 4OFIA 4HWEL 5LGJA 3HB3B 1OAQL 2BRRH 4S0TD 4L1DA 3TBVA 3ATBA 1LP9A 1L5GA 1OCCB 1X4ZA 4Q9CA 1AXTH 4OZHF 3MRJB 1G7JA 1MH5B 1BX2A 2ADYA 4P2QA 1QKZH 1T3FB 2MPAH 5DQ9A 1BEYL 2OX5B 2EH7L 1KJ2L 2CKBL 1XIWC 1FIGH 3Q3GB 4UAOB 3FQNA 2HRPL 4G1MA 4KRPC 5FHAH 5JXED 4FLSA 3DO7A 1LDPL 2L0DA 2PYEA 4NZTL 4MAYA 1K72A 4QCIB 5AOKA 2BSSA 5C6TH 1JHKH 2D3LA 4MJIB 3UJJL 1FVCB 3HBQA 3NJHA 2ZUYA 4HOWA 4TUUA 4YSSA 4TL4A 2R23A 4G8GE 1SMAA 2ZPKH 5CF3A 5DC4B 3S96B 3CBKB 1YEIL 4YHZL 1HX0A 1PY0A 4DOHB 4Y2NA 3BRDA 5E9DD 5C2BL 3L9RA 1WV7T 3OAZH 4UF7C 1J05B 3EUDA 4DK6A 5K5YA 4XC1H 3BFOA 2BOLA 2Y07H 4M1GL 3SY0A 3PGCA 3RUGB 4N8VA 3CHPA 4GW5B 5EC1A 2W65B 3QUMB 3QWOA 2HG5B 5F71A 3UADA 3PJSB 4GRLB 4PJXE 2R0LH 3K8LA 4RX4A 1YMME 4M7ZB 4C59B 4FXGC 3RY4A 5SV4A 5I15H 3P54A 4P2AA 3TO2B 3QXWA 1CL7I 4XHJD 4J4PD 4GAYA 2BC4B 2BO0A 4P5KA 4PY7B 2Y69B 1KEML 2MKWA 4JFXB 5F1OB 4QD2E 3QDJA 5KS9B 1S3KL 3LRKA 1UUSA 4PW4A 2UUDH 2WLKA 3F2LA 2YD1A 4R3SB 3BP5B 5DD6A 5EOQL 1OGAB 4D8PB 1XB3A 1G0DA 1HWGB 4UIMB 3Q1EA 5E1QA 1TR7A 4YBLB 5KBNC 3WNLA 2A0LD 4DJMA 4DN3L 1I7ZA 2DWEB 4M8QB 5DURB 5MI0B 5INCA 2DYSB 4BELD 2XZCL 3R19A 5HGHB 2BFVL 3WKYA 1KXTA 1WWBX 5I1JH 3TYGL 1UWFA 4Z18A 2NY4D 1KZQA 3MJ9H 1OO2A 1GS8A 2PP7A 5FO2A 4FFZA 3ZO9A 5DEGB 5LGKA 2PN5A 3VFWA 1IBGL 2XZQL 2HUHA 2RCSL 3P4MB 4XAKD 4XPHL 5DK0A 1TVBB 3JUZA 3EGDA 4PLNC 1A7QH 1GZPB 1QVOB 1ZIAA 1HYRC 2VMFA 2PTTB 4QWWD 2JI3A 3GGWB 2ZJSL 3IDXL 43CAA 3FUIA 3RDTD 2OKMA 4FG0A 2OMXA 4U1IA 3QIBD 3CN4A 4YSAA 1XB6A 5CEZE 3D25B 2C9RA 2OCCB 4NOFA 2D4FA 5GGVH 2IALB 1HE7A 1I4FA 3GC3A 3W9EA 5K9QI 3N0PB 3MNZA 1QRND 3WFHB 3ASOB 2WQUA 1KYFA 3GJFK 1RZKC 3N42F 4XMKH 4LSTH 2ZQKA 5GJSH 5JW5A 2AF2A 3EFDL 4PWEA 3C08L 2WNWA 2OJZH 3Q8BA 4TVSa 5D1ZA 5F21B 4LVNB 1TG8A 1V3KA 4KTDL 4P3WA 2EEXA 1EXUA 2J3SA 1DVXA 4ALAC 5EEYA 3QDAA 3HC0A 2CLRB 4R0LB 4XXWA 1M1SA 2PYFB 5DGQA 3BXNA 4XMPL 4MA3A 1GS7A 1VF5C 2PCFA 3QR2A 5DLLA 4ABVA 5ERWB 3CHSA 1LEIA 1HJCA 5A2KH 5EFIA 1NUGA 2WOBA 4NNXA 4HKXA 2NNAB 2XWBB 5AL0A 4WIQA 3HE7D 1WCQA 5E99H 1SMDA 1SQ2N 2D7NA 4UU9A 3V4LA 3I9PA 1HNYA 2WUBH 3L5IA 3LIZH 2WIMA 4GSRA 4L9LA 4XZUB 4HFWA 2WYIA 2JCWA 3IJSA 3AG3B 3RVXC 4XMWA 4XPAH 3MNDA 1BZ9B 1P6FA 2Y06H 5AUMA 5DHVB 3FFDB 3RFZA 4WLCA 3AY4C 5E6RB 2WXMA 3QDGE 2Y0SA 3DYMA 3HN8A 1JZ8A 1U58B 1AGFB 2CRIA 1IEHA 1YEJH 3QAZC 3LXCA 4WTZG 4CSSA 1N59A 5B8CB 4YXLH 1XD0A 2VAAB 1WO2A 5JQIB 1G6RH 1ED3A 1HI6B 2WTOA 3KNBB 1YEKH 2YLKA 3TXAA 1JK9B 2YKKA 3VI4E 1TJIL 3G5YB 4O4YH 1EEUA 1FH2A 3QWQB 1DBKH 2VIRB 5CILL 4GKNA 5F9JA 5CZRA 4DFHA 3IWVA 1P9MC 1U8NB 5K1NA 1Y6KR 3CE1A 1KENL 4CVWA 4LVHC 1A6ZA 3WL9A 2HVJA 2H8PB 1IVLA 1TENA 2WO3B 5FDWB 1PZSA 1HHJB 4AK1A 4JFFB 1LE9A 3Q13A 4J6RH 3QDJE 3OR6A 4J2XA 2R2CA 3IT8D 1EGJL 1T4KB 4NPYA 2O5XL 2AQSA 5D7SL 3FTZA 3OQ3B 2GT9B 5DFVD 2C8NA 4Z8FH 4ZFOB 3DTXA 2ZUUA 1DUZB 4XP6L 3PWUA 1EWHA 3VW3L 4XI5D 1L3NA 1CL7H 3ILEA 4FZEH 1N6QH 2HX9A 5I1DA 3RX8A 1A6PA 3H2WA 4IM8A 3H53A 4X5RA 4MB4A 2H0PA 4ISVB 4MMZC 4ZUTA 1DYZA 1D9KB 1O6VA 3FRUA 4RSVA 2NCMA 1G0YR 4DKEL 1DBML 4GEIA 1DQVA 3EHBC 4WEUD 4HUWA 5GS0C 4JDEB 3HG3A 5FGBC 4QOKE 3NA9L 2R56L 4RA0C 3BUYA 4JY6B 2H47C 2CHXA 3U7YL 3L4VA 5IROA 1S7QB 2AQ1A 3FQTA 3V5HB 2Y5TB 1L9TA 5D7IF 4AEIH 5KBKA 3JWNE 1G9MH 3U0TA 1A7NL 2EDNA 4O2EA 1INEL 1YRKA 5K9KB 3B2UC 3MZGB 1FFPA 1U30A 1ZLSH 3KWTA 2VL5A 1O7SA 1BXVA 3NIFE 3QAQA 4HWZA 4NRXB 4NQEA 1A1MB 3KXFD 3CFCL 2H3XC 3D87B 4YK4C 1WBZA 3LH2H 4YAQA 2ZOWA 4KX8A 4QIRA 3FYEB 4GBXA 4W70A 3ARGB 2P24A 3DLQR 3IRZA 4K94H 3VD3A 1TU2B 4D2NA 4V2BA 3NSCA 1C7SA 3ZSSA 5IEHA 1LMIA 3VD0A 2NX5D 3ARDA 1BBJB 3FTSA 4AYFB 1YUHA 1E4XI 4DN4L 4I0PB 1U8PA 3FH5A 5A6LA 5B1AB 1IEBB 4LBEA 1E4WL 3VAEA 1WWCA 3REWA 2F74B 3RPIB 3HZKA 2C9QA 3O3AB 2B3RA 1G7PA 4MD5A 5C0CD 3ELAT 3GYRA 4OSUH 3ZRCC 1ZJAA 2C3HA 4W93A 5DVNA 4Y2DD 1KCRH 4WWKC 4HS8L 5H37A 5I1CL 3OPUA 2PW2A 4RMQA 4JDZB 1I8UA 2AFNA 4ZW6A 2UY6A 1AZNA 2VDPB 1ZLWH 1UA3A 2GW5A 4MMYB 1EAPA 2CH8A 3MRNB 4NM8L 3V0FA 2YLHA 3BQUA 3LN9A 3OKOB 4HEPA 4XN4A 4RZCB 3U9WA 3NDYE 1P5UC 3JV6A 3QUYB 1KB9K 1T22A 4JM2F 1UJ3B 3K80A 1NMBH 2A73A 5CINH 4LAQH 3FQRB 5DO8A 5AW7B 1MUJB 4Q6IC 2H0JA 2HTKC 2IOMA 4ZZKA 5IB3B 3U7WL 2NW2B 2YWZA 1QSED 1W80A 4A1RA 1LYQA 4MB5A 4G7QB 2VDRL 3WJJC 2HLAB 4PJ6A 3K3QA 1WT5A 2AEOA 1YNTF 4MAUH 2HJFA 1UJTA 2FJHA 4MZ3A 4OFVA 3BVTA 2ZP8A 4AL8L 5D2LE 4AL8C 1D7BA 2NLJA 2YFNA 3L48A 5C0RL 2NY0C 2OZ4H 3HN5A 4X4YB 2QEJA 3IFNL 2O30A 4Q2ZB 5F96L 4BWUA 5AB0A 3DX4A 4B9JA 3ZLQC 5JZ7C 2D7QA 1N5YL 4PG2C 2OV0A 2X05A 3HBZA 1BA9A 1BIHA 1NCCL 4ZG1A 1L6PA 2GK2A 3EZJB 1CIUA 1S7UB 1ASOA 3GSQA 3DIFA 3MXWH 2BCKA 5BUGA 1TYJA 1SJHB 5D7HA 3ZKMD 2D3VA 4QXVA 5IY5B 4MS8C 4QKXB 1A14L 5C07D 4ZDHB 4L3EE 2CHZA 4C4KT 3DVGB 1Q72L 5F88B 1JBJA 2VZUA 3UIZA 1TEFA 4AC2A 1FRGH 2G3NA 2FAUA 3ECVA 4KK5C 4MLIA 3BEVA 2JTDA 2QVKA 4P8QA 3PAVA 2LW3A 3V4VA 1FH5H 4DKFH 4MX7A 4I3RH 1SJVA 1QOKA 4B3VA 1AQMA 3LXAA 4ZUVB 4NQSB 1KXVA 2HPOA 3B3IB 4OI8A 2X1WL 3UH8A 1EVTC 5GJTL 3RWHA 2VISA 2BOCA 5TTRA 3O6LH 1F6AB 1U92B 4NQEE 4XCFL 3VFOB 2R2EA 4JE0A 1T04B 1RD6A 2FO8A 3KVQA 5D6CB 3TZVB 3UGEA 2X4NA 4ODSL 3W11C 1A8ZA 4NQCB 1MY5A 3KD4A 2YPKB 2GHWB 3HNSH 5IOPB 1INQB 2ZYSA 5CBEB 1ZGLA 1D6VH 3WEOA 4Z3EA 5I5RA 1RIHH 1Z3GL 5BXFA 2GPZA 1B4LA 3HS0A 1JPSL 1PKQB 1ID5I 1WC7B 1DEDA 3ILDA 3S5ZA 1EUUA 1BFVH 3BDBA 3CIQA 4OVUA 3LRSA 1RZGA 3O2WH 2R69A 5ILTL 1CDBA 1R0AL 4KI5C 4F2ME 1OARH 25C8H 3GPSA 3B43A 1IGIL 1TYRA 1R24B 3ZGHA 1XTMA 5JYMA 1V7MH 2NNRA 5F0JB 3VSTA 4A6YH 1OF2B 2ZUXA 4LSQL 3ZDYB 1XR8A 4N0YL 7PAZA 1NUNB 3JZ7A 5I5JA 1WA0X 5FWRA 1HCVA 5IMOA 4FXKA 3CBJB 3C6SB 1WK0A 3M86A 1WAAE 3MRBB 3MUJA 4HKJB 1A66A 1IM3D 4N2EA 4X7CC 4HD5A 5DZVA 3NAAL 3OKLB 1N67A 3Q01A