1NCOA

Structure of the antitumor protein-chromophore complex neocarzinostatin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
113
structure length
113
Chain Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYDVGQCAWVDTGVLACNPADFSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of neocarzinostatin, an antitumor protein-chromophore complex.
pubmed rcsb
source organism Streptomyces carzinostaticus
molecule tags Antibacterial and antitumor protein
molecule keywords HOLO-NEOCARZINOSTATIN
total genus 17
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 1ncoA00
1J5IA 2G0LA 2CBTA 1NOAA 1J48A 1O5PA 2CBMA 2CBQA 1HZLA 4JW3A 2MCMA 1J5HA 2G0KA 1HZKA 1AKPA 1ACXA 1NCOA 2CBOA
chains in the Genus database with same CATH superfamily
2ZUYA 4UU9B 5EBWB 4AUJA 2YAFA 3UAAA 1ZK5A 5FYLH 4UV4L 4YDMA 4N8UA 2WTOA 3MRRB 2VAJA 1CIUA 5FOJA 3ZSTA 5ALCH 4F8QA 4Q58C 1HJBC 1AO7A 4YC2C 3VXRD 5T5FH 1EFXA 3V5HA 5IMLB 2VERN 4K55A 1MW3A 1ZLVK 5LB1A 4MNQB 4QOKB 3FB5B 1WFIA 5E00A 2DQTH 1IKOP 4JZNB 4HJTA 1MCPH 5KBMA 2R0WH 5EBLA 1JF5A 1KCVL 3WNMA 4JFFB 4KTDL 5DEGB 4DAGH 3U6RA 3H53A 4XAKE 4FLQA 1ZD6A 2WSKA 1CI5A 3R7QA 3HPJA 4U4IA 1UKTA 3KEHA 1HCVA 2Z8SA 4PJBB 2WJ5A 2CPCA 1A4JB 2V3FA 3DVGA 3MRRA 4NQCE 1YC7A 1HXMA 2VLKB 1F00I 4JFZL 3AFLA 3GDBA 1FJ1A 5A2BA 2Y2WA 4UQ3B 1ML0A 2YZ1A 4HUUB 3VFNB 4XNMA 3WKQA 4LHUA 3ZE2E 1EDQA 3H9ZA 1GXEA 2LVEA 4O5LL 4PYGA 3IFNL 5CIPB 4A67A 3U25A 3UTSB 2YR3A 4JM2F 5J1TC 1WLHA 4U2ZA 5EFIB 4IRJD 4R84A 2VXTH 1MCCA 3B5HA 5AAWC 4GW4B 1IGIH 2YAHA 3RDTD 2DL9A 3TIEB 2PP9A 4W1TA 5D7JC 3IU3B 2CKNA 4MQ7B 2GCYA 2YUZA 4GSDH 2K0RA 4GPVA 5T1JA 5FF6B 3MRCB 4LCIL 2HX7A 3TBYA 1D2OA 4U33A 1RK7A 4PJHA 3HG3A 1JI1A 3QA3A 4X7CC 3QJZA 5JHDD 4PVLA 4LMQE 1QA9B 5C3LD 2J12B 4DOHB 2R0LH 4XNQA 5HYSA 3B7UX 1PCXA 1QMUA 3NCJH 2WXOA 5DMKA 3SBQA 1BLNA 4LGSB 4XNUH 4Y5YA 4IQHA 1UYWH 2Y7OA 4KITB 4OFPA 4HGKC 2OW6A 3VRJA 2CRIA 1OE3A 2R2CA 4JKKA 4CSZA 1S7UA 4A6YA 3ES6B 4UB0L 1VZGA 2ZCLH 4YSUA 2GJRA 1OP5K 3V5KB 3E80A 3P9WB 5AB9A 2CR0A 1GAFL 3KXFA 2PP8A 5C9KA 1INEL 4CDHA 1OW0A 1I8UA 5JR1H 5I73B 3CFJB 4X4YA 4QTIL 3QJXA 1G7JB 2OFQA 2H0FA 1BOYA 2V8LA 3IVKA 2ZXGA 5FA3B 4WO4C 4WV1C 1F18A 4ZUVA 3SDYH 3IBEA 3WY3A 2W95A 5DR5L 4FQCH 2IFGA 5KVGE 3TBCA 1TVHB 1CLCA 4HZAA 3CVHA 4EDXA 3IGUA 4POYA 1IUZA 3VXUD 4OLXH 3FUJA 1FLRL 3H2PA 4M8VA 1BVKA 4OF6A 3LRSB 1QFOA 4Z0XB 1IM3A 2GSGA 4N68A 5CZVH 3M7FB 3POCA 2ZICA 3SQRA 4ORGB 4ZAKB 3KWTA 2B2XL 3EYQD 4PJAE 5PAZA 3WUWG 3UAJC 5AENA 1X5HA 2AK4A 2E6JA 3FO1B 3RVXD 2GUYA 5IFJB 5EN2B 4RGMB 3L95A 3FMGH 4R4BA 3PGCB 5D2LF 3T2LA 3TH2T 5KSBA 4BZ1A 4JW3A 1MEXH 4DGYH 1UZ8B 4PB0H 2VQTA 4JRFA 1O0VA 1XGQB 2BS9A 2A2QT 4OZHA 4F7MA 3C5ZC 3RX8A 1ZDQA 3D4ZA 3DGGB 1NEUA 2UX7A 3L6FB 5G4OA 4Z0XA 1QQDA 2V33A 4HIJA 4PBXA 1QHQA 3K4ZA 4N2LA 3SOTA 5EU6B 1MHHA 1GMIA 2XSKA 3CSYB 1K2DB 1ZANL 2VRAA 1RIHH 2WPGA 4LHUG 2G5UA 3HPLA 5CWSB 2YUVA 5L4FA 5EDXA 2JKTM 1O7DE 4IIZA 1K5NB 1NCNA 3TZVD 1KIUA 2OMNA 1A0QH 5A6LA 3QEQD 1UA6L 2ATKB 3B9VA 4H1LH 4J2XA 4M61B 2EE2A 2W9LA 3FTZA 2L7EA 3BGFC 3FNKA 1NDGA 3ZSSA 3U9WA 3QUXA 4KY1L 1SVZA 3GBML 1W2KT 4LSTH 3T2NL 3GSWB 1TTAA 4S1DD 1QI4A 1WC7A 5DRXB 4J8RA 4GOSA 4KKLC 4MZIA 3TF4A 4JFQA 3Q5YA 4R4FL 1OZTG 1XB8A 1QWHA 2PW1A 3BGMB 4L3CA 5D1XB 1VGEL 2OMTA 4E5XB 4NKIL 2F18A 2C7FA 4GO6B 4PJIA 4LEBA 3WEBA 2B08A 1Q9LA 1ZT7B 4LLQB 4F20A 3QHFL 4YDNA 4AC4A 4MA8L 3WUWA 5CGMA 1FL3B 2H6PA 5AZEL 1YEKL 3MLXH 4P06A 5GGRY 4MB4A 3QUXB 3B7SA 1YQVH 4W81A 5F88A 5DYFA 3WHE1 2FRGP 3KW8A 2X42A 3NFNA 3DX3A 5FV1L 3WIIL 4D2NA 3WO4B 1IEBB 3QUZD 1LEIB 1KCSL 5AB2A 1QD0A 1QI5A 1SDDA 1AHMA 5HI5D 1D5BB 1JGVH 1R75A 2HG0A 3LZQA 4Z7WF 1W8NA 4BDVA 4YSOA 2YPVL 3B8YA 3IJHB 3NJJA 3CHPA 1UM6L 4J3BA 3S3PA 3TBVB 4P2RA 3NEXA 1E9PA 3OKMA 3MLYH 3QEUB 1XIWD 2OX5A 3I50H 2JTDA 1LE5A 5IVXE 4O5LH 1QLFB 1R24A 4JG0L 1KT2B 3QUHA 5T3ZH 2J7LA 2KBGA 2AF2A 4XP4L 3EO0A 3P0VH 1K4CA 6PAZA 1XMEB 8PAZA 2GYSA 3ZZLA 1CD1A 2CIIB 4JQIL 3ZE1E 3S7GA 4A55A 1XD1A 3POHA 2O5YH 4PBVC 4GT0A 2BVTA 2DH2A 3ZUCA 4QI3A 2EZ0D 2X7LA 3CDZA 3GRWA 5EEXA 3O6ML 3LB6D 4Y5YC 2NYKA 2WWKT 1BQ5A 2NDFA 3NA9H 2G5BA 1N5AB 4NERA 4ZS6D 2VIRA 4XODA 2XWCA 3ISYA 1WUNT 5EIIB 5LNGA 1FNLA 4N2AA 4Y2OB 1G1YA 2OS7A 3R0NA 2BP3A 2C3XA 2QKIB 1H9VA 1GHFL 4OZGA 2VQ4A 4PG2C 1MAML 2WMPA 4JM4L 3HUJE 3L81A 4UDTA 1RFDH 5E2UL 1NC2B 3D52A 4S1RL 2RCSH 4M8QA 1ZV5A 1KBPA 2OPCA 1G4MA 4G2AA 4Y4HB 2YS4A 3CLFL 3GMPA 4FG0A 4OBSA 1SFHA 1GGBL 1MNUH 2FX8H 3BLPX 5IY5B 4ZFGH 2HVKA 1OAUL 1A5FH 4RWYL 1WGOA 1IQDB 1IM9D 4FGMA 3C60C 1TJGH 5LNDA 3FS9A 1CK0H 3WELA 1Y6NR 3HC3H 5IGXL 1BM3H 2O26U 2WTPA 1EAQA 1P4LA 2EYTB 4WFFE 3QXUA 2A4CA 2OSLA 4ABWA 2WJ7A 4YXLL 3M46A 2GITB 3SE4C 5FYKL 4I3SH 4GUPB 4KGJA 4TOYL 2WYIA 2BMKB 1AGEA 5FKPB 1QRNA 5B38B 3BSGA 4OCSL 3WMQA 4PJHE 4GKNB 2EUVA 4I1PA 1JZ7A 2XKSA 2JJSC 1OP4A 1L6XA 5IT2L 1XF3A 3D3VA 4G9FE 3RX7A 1SUJA 2N01B 2WIIB 3UOAB 3VVVA 3G5YB 4MRBA 2VQ1B 2CHNA 3VXRA 3JV0A 2C9PA 1HL5A 3IFLL 3BJLA 1KN4L 4MMXB 3S2AA 3FU6A 3IFOB 5ERWB 1CGXA 5D1QD 3CZEA 3FH7A 5GZOC 1BBJB 5KZCD 3L1GA 3DV4A 4L3ED 3MGAA 3AWGA 3WE6A 5HD8D 5LXGH 1GKEA 1S5HB 1KBWA 4XMTA 5B39G 3OMNB 1U91B 5EBWA 5SWSD 2Z4QB 1ZLDA 2O4EA 2BNRD 2E27L 5EZJB 2J8OA 2UUDH 1FVEB 4MA3B 1ROWA 4NAMA 3UJIL 1MN4A 4RETB 2W65A 4PJ9A 2ZONA 2P8LB 3KR3H 3CLWA 4KVCL 3QFJA 1TUPA 4N24A 1LO3H 2KLRA 4U6HB 3AABA 4V2BA 2QDVA 1PZ5A 2GTZA 4M93C 4LKCB 1DQLH 1RUAL 3GIVB 1U33A 5CJQL 1WIPA 5E5LA 5L4IA 5MI0B 2FB4H 2X40A 1MWAB 3FQWA 4WFFD 4MXQD 1J0HA 2GK0A 2A9CA 5GSVB 4YBQD 2EUZA 3VGDA 1O9WA 1U4EA 3L4XA 3HR5B 2YQ2A 3SCMA 4G7YL 5DJXB 4Z77B 1KV3A 3E8VA 2GFBA 5AVUB 1LWRA 4MHHG 3LEVL 1QP1A 5EZLA 3MJGX 5BVJA 1WCBA 3GIZH 2WW8A 2WLYA 3DROA 2CGRL 3RWHB 1HH9A 2Q3XA 3TVMD 2CXGA 3CSBA 2W0PA 3ATFA 5DQ9A 1A64A 1UA6H 3KGUA 4IBLT 4JJ5B 3A6CL 5A2IH 1Q9OA 3UYRH 1CLZH 4Z7NB 1T0MA 3AB0C 3NA4A 3FPYA 2I7OA 1KFAH 1QFPA 4X4YB 2Z35B 1E2ZA 3FO0H 3Q2NA 3M45A 1TITA 2D7MA 3IS1X 4W4NA 2VZTA 2CR6A 1NPUA 1BVNP 4N1CA 3TN0D 1UT2A 4ZPTB 4HJUA 5GHWL 3V7MA 1J5OH 3EOTH 1CFSB 1KLFB 5D7HA 2WTRB 2F0CA 2YMXH 2J8HA 3IDMB 4X7SH 2CBTA 3LH9A 2M83A 2VLMD 3NSYA 1QASA 2AXFA 5IBUB 2XQYA 3ETBJ 3KDMA 5F7LB 5KVFE 1AHKA 2PTTA 1EHLL 1HZLA 2VXQL 2P5EA 4LSSL 5CP7A 1FPTH 1JFHA 4X80L 4QHMB 2ZUTA 4AT6A 3O9WC 3T8VA 3ASNB 4H0HB 3TVMC 4QF1A 5CJ5A 4EN3B 3I6LE 1YEFL 5BNXD 2WQUA 2A6IA 3LCYA 4UQ2B 2ED8A 3RVTD 1UWGL 3KPTA 3QDJE 2H0EA 2NY5L 3C6SB 2YD3A 5F9DC 4YXHL 5HVGB 5C08E 5DD1H 3V55A 4K8RD 3DRTA 1AR1D 3MGTB 1WBZA 4L18A 4HBCL 2ADJB 4JUTA 1FZJB 1JPTL 3AMLA 5KTEL 4ZBJA 1E4KC 1BF5A 3QCVL 5DLLA 3V4LA 4X8CA 4HDIA 1TKWB 1S7RA 5IMOB 1KY6A 3RWEB 1UFUA 4PLJC 4JPVH 4LASH 2ZSWA 3OKOB 5HGHB 3T65A 1SXBA 3U2IA 3BEVB 4XCYB 3HNVH 4E41A 1HWHB 2J8UB 2Q76B 4KU1A 4X6BA 3EYVA 4PRHE 4GKZB 2FL5A 4TQEL 2CUAA 5KSUA 4KJWD 3SJVB 3SGKC 1C1EL 4G59C 1ORQB 4HIEB 1E4HA 4M9PA 4OM1H 1C16A 3PWUB 3G04A 4WDIB 5E9AA 1XCWA 2FLMA 3B2UD 5IB1B 3HCVB 1D5IH 1CE1L 5K93A 1BWWA 1MCIA 3BUBA 1A7PL 1I7ZB 4KROB 4S1RH 3DMMD 4N1EA 5TE6L 5IQ9B 4FG4A 3X3FL 1MFAH 3PWPD 1A6VH 1P5VB 4HCRL 2XN0A 3P2BA 3L3OC 4Z0BL 2XQBL 5FYJE 3PGDA 2OI9C 4PRAA 4RESB 5AKVA 1SDAB 4FDWA 2PWHA 2ZUQC 2UZPA 1AANA 1S2EA 2PXYB 4X6BB 4RISL 4Z7NF 3SCMB 3CDFA 2BK8A 1JD7A 1U8CB 1IFHL 4YXHH 3V0VA 4WEBL 4ZO6A 3KAAA 4AGQA 1MCOH 5F1NB 2Q9OA 2YAEA 4N0YH 1J8HE 3MV7D 4L4VE 2AVGA 4WUKL 2EDLA 1A65A 3RFZC 4OTXL 2EXSA 4QRTB 4A63A 2GJ6A 3A67H 4AV0A 4D9RE 2EIMB 4A38A 4NO0D 1P5UA 4Y7MA 1TTRA 4ODTH 2OBGA 3O6KL 2QPEB 3NCYP 4N8VA 3PGFH 4M5YH 4NFBA 3LKSA 4U1JA 3TYGH 4URKA 4LPWA 1BZQK 1KG0B 4PJBA 3D4GA 3LKRA 3K81A 2IBBA 3BQUC 5DJYB 4PVBA 1R33A 1DVFC 4YC2B 2DQIH 2NX5B 5D7JB 1NGYB 4J6IA 5E5MA 4PJGA 1BJ1H 3L1OH 4MMXA 3BSZL 2HFEA 1WC7B 5DRXA 3UJJL 1DUYA 2VR9A 2E9IA 2H9GA 4G42A 1UQSB 1WV7T 4PS7A 2GW5A 3NPSB 4FQ1H 4FULA 1IAOB 5D6CA 1BFOB 4ELKA 3VYPA 3RNQA 3CDCA 4NHCH 4HP5A 2AS5M 3NCMA 3SDAA 5E9DB 3VFTA 3RIFF 3L2LA 4GAYB 4RGNB 4DUVA 4ZS6C 4ADGA 2DYSB 1F6AA 3U7AA 3LKRB 5LGHL 1CU4L 5EUKA 2WNWA 1VF5C 1AZNA 1NGYA 4FFYL 1MCNA 2I69A 4HV8A 4A2DA 4NB7A 4HEPG 1DBBL 3W0WB 2X9ZA 2ZSVA 2M8XA 3MV7E 2DQTL 1ADWA 3A6OA 3GSUA 4XPTL 4ZUSB 4WK4B 5FKAA 5A6MA 4A7TA 5DHYA 2HFFA 4OFDA 1CDYA 3C5JB 3HR5A 4LLVA 4HWUA 4QWWC 2QMKA 3PWVA 2JB5L 3MRIA 4JFHD 1PLCA 3NSXA 5GRYA 1OQOA 3APCA 4G83A 1FZKA 4WWKC 3QEUA 1JHLL 4YDKH 4PP1D 1LE5B 1JP5A 3U4AA 4N5EC 4QHNB 5L6YL 1G9NL 3VYNA 4OCLC 5T1MA 1HWWA 3O0LA 1CN4A 5FO2A 5LDUA 4Q6YA 3V8OA 4L48A 1MRFL 4AM0Q 3O11B 1F4YH 3SYOA 1SYVB 1WYJA 3QO1A 4ZXBD 1T1YA 1N8OE 3QZBA 3A5VA 2OJEB 5EZIL 3ASWA 1JRHI 1U91A 2WLLB 2AXWA 4H7VA 4CBPA 3LDBC 2CDGB 2F1AA 5BS0D 4P99A 5AW6B 5C0FB 1RUPH 3C8KA 2NYYC 4X6CF 4JHAH 3RP1A 5JW4R 5IROD 3MLSH 1OARH 4RMWA 1NGXB 1P53A 2Y1AA 4F9LA 3P0YH 4X9HA 3PYCA 1SM3H 1Z6JT 5F6HJ 5ERWA 2NNAA 2YEZA 4N90E 1E4KA 3PF2A 3DVIA 5A16A 1JS4A 3T65B 1K6QL 3HA0A 4U3SB 4DO4A 1FIEA 1BQHB 1XO8A 1A3ZA 1SHSA 4GIOA 5IM7A 5FO8A 2MOVA 3OLEA 3TA4D 4DJMA 2P1YA 3MBEC 4GQZA 5L2KE 4PMEA 3RPIB 4L4VD 4QXTB 1AGCB 3TZVC 3ZMEA 3O2WH 1PZUB 1OHQA 3QO0B 1A0QL 1ERNA 2C4FT 4HSAC 1VFOA 3MXWL 4EJ1C 4WU5B 2NX5A 4I2XE 4XP5L 1F3RB 1G84A 3TBWA 1TT6A 2C3GA 3V0DA 3ZKND 2N1KA 4NJ9L 5FA4A 5J6GB 1ZGLB 2AAVA 1HL8A 4HU8A 1UACL 3WTWA 5D2NC 3SBWC 3MUY1 1QHPA 4PB9H 1I8KA 2DMKA 3MYJA 1I1YA 1TYEB 4C4KT 4X9FA 43CAB 3NCCB 4JG9A 2N56A 4PD4K 2D3NA 4OKDA 1XH1A 4PY7B 1FORH 5DC0A 1NBCA 3FF7A 3FQTB 3RZWA 5KTEH 5BOPA 5FB8B 1TQTA 2XBDA 2EVFA 5FAAA 1MHPL 2BNQB 1OEZW 1NGZA 1JF1A 3GKWL 3W56A 2QHLA 2IDSA 5PCYA 3CIQA 3QQ3A 3S36L 1MFMA 4X99A 1OAJA 2FBJL 2HG5B 1FNGB 3VXNB 1P69B 4WJG3 2Z35A 4ZK8A 3LN9A 4MVBC 3FMGL 2ZCZA 2CRZA 3F2LA 4Z5RB 4FYSA 5F0JB 3O3BA 4OUOA 3WAJA 3VQ2C 4X9GA 4MD0A 1GGUA 1JNLL 3CH1B 3X12A 3RNKA 4WI5A 5CKAA 2UZXB 5JPMA 1FYTA 5IWLC 4P4RB 1G7PB 5GRJH 4KQ4H 1OF0A 1KTLB 1AHWB 5HGDB 4L1HA 2R56H 1J05A 2BP8A 4N0YL 4F37K 4WSJA 1AQHA 1OGSA 3EH1A 2DKMA 3L95B 4K7FA 4MMYB 3O3BB 5HTSA 2ORBL 1DVZA 3BAIA 4NQDA 4QCIB 2APBA 3U46B 1FNSH 2CMRL 4ELME 3U4KA 2AV7A 1USZA 2QMJA 3PV6B 1CGYA 2XWDA 4W9HC 4Y1AD 5E2WL 5J1AB 1YNKL 3AS2A 4ANVA 3FTXA 2EIKB 2DPKA 1OAXH 2PPCA 3NSJA 1YEJL 1Z3RA 1I3RA 5JOEA 3ABLB 3EJRA 1QHOA 5C3IA 1KY7A 3BLKA 3VH8A 1HHKB 3Q8BA 2Z8RA 1FBIL 1WQVT 5D6DC 4TTDC 1UZ6E 3HS0B 3P3TA 4H26B 5C0CD 4NUGL 3RDTC 4LDOB 2NZ9C 2RQ8A 1CFTB 1PKOA 1U41A 5LKNA 4WFGD 4JG5A 5EF2A 3L4WA 3S37H 3CFBB 5FLVA 1OB1B 1KWGA 4EQ3A 1QSFA 3BSHA 5ALBL 1IGFH 3F7YA 5HY9B 3GSWA 2H2SC 1RKRA 5E9NA 5J6SA 1YMHA 3TO4A 5ICYB 4N2OA 3L5HA 1A6AB 1Z9PA 2QQKL 2VDPL 3KPSE 3DI3B 1OGAB 4NM4L 1RZ7H 1F1GA 2J21A 3L08A 1CR9H 2XBTA 4TSCH 4UIMA 3C8KB 3EG9A 5AALA 3LRHA 4DK5A 2FIKB 3P3RA 5DO2C 1XCTA 4KRPD 1XHHA 4HUXA 5DJ8B 2DIJA 2RFXA 5BXFB 4ELMA 3HIZA 3L6FA 3P4OB 1G9EA 2A6KB 4RRPG 4HIJB 4X8JA 3DIFB 2Q3AA 3W2DH 3P0GB 2VAAA 3HVNA 3V95A 3IDXH 3VXRE 1DN0B 5I15H 5GRVL 4BSVA 1JPSH 1I31A 5IFJA 1IAIL 4MTMA 4JANB 4ZUWA 5F0LB 4HHAA 4BKLA 4MXWH 1RZGA 1KCRH 1EDHA 2QDWA 2X87A 2V2XB 4TVSa 5AL0A 2QTEA 1ITBB 4RGMC 4M3KB 3CDGB 1IGTB 4PJDE 1WUZA 4ZMXA 1N0LA 1P7KB 5CS7A 4F8TA 3H2QA 2VJXA 4LCYA 4P3DA 5C0GB 1VEMA 1LQBC 4YSDA 4UQIM 5JIDA 3ZDZE 3FUNA 2PP7A 4NQCD 1NLDH 2M2DA 4M9OA 4RZCA 2GI0A 1E4WH 4XPFL 3V6OE 3NA9L 1DEDA 1GVIA 3CBJB 1FZKB 2VDOL 3CTTA 3FRUA 4LB8A 2ZAGA 1J8KA 2QADC 1CI3M 4HK3J 4AY0A 3KM1A 2V2WB 1ET8A 1FV1B 2NY6C 3RVVD 5I73C 2X2HA 1ETJA 1QPKA 2VH5L 3EJYC 3VNYA 2Z93B 4YSRA 5AAMA 5CU5A 3ULUF 1K8IA 3B6SB 4X9IA 1FYHB 2PTVA 2DQUL 2JQMA 4YHPA 5DFVD 4F2FA 1J8RA 2DL2A 1DO6A 4ONFH 1JNHB 3UPRA 2WXRA 1F4HA 2VSCA 2ARJB 3FH5A 4UILL 4NQDE 4Y8AA 5DEZA 4CNIA 3DX9B 2V0AA 2ZAIA 4P5TD 1JPFB 5LQBL 3EXJA 3B2UC 2FJUB 3I9GH 4NP4L 2OSWA 2C9SA 4YSAA 4PWHA 1QSFB 1R1CA 1QA9A 2MCG1 4XNYL 1DUYB 2CDFA 4H1LA 1S7TA 2XPGA 3HJEA 3OKNA 1SYVA 3QGVA 3IFNH 4HCRA 4LFHG 4D8PA 2IG2H 1UGKA 5T5NF 3BWAB 2J8UF 3IGKA 3SKNB 3F62A 1E42A 1NFIA 1TQBB 1YPZF 4J6RL 1XGUA 3AGWA 2EYSB 2MNUA 3LHAA 5CU9A 5D1ZC 5GZNA 4HLEA 3MRLA 5HYJA 4TSAH 1S7QB 2HJKB 1JK9A 3GGWB 1SMOA 5MEQA 4ODHL 4YZWA 4PJXB 5GGUA 1I9JH 5HJDA 1CZ8H 1CDJA 2BY2A 3U82B 2F1EA 5CGYC 4PJCB 2JKSA 5FYKE 4Y7OC 4P4RA 3QUMH 4ZFOA 4MQTB 1KBVA 3M1OA 5TQ2H 2IBZX 1UASA 1G9MC 2CSPA 4HUWB 2YD2A 4JQVC 4MZRA 2EXWD 4PJIF 3VXUE 2A1WH 2NY1C 3N1FC 3TEXA 2NY5H 3KLHD 3PDOB 5KVEH 4JFXB 1J0YA 3CXDH 3HPLB 1F41A 3O6LH 5A2JH 1U3HD 4IKNA 3W3BA 1NUNB 4G7VH 1I7TA 4JRYA 4HS8H 3GMOA 1DQLL 5D55A 2CO7A 1YECH 2XXCB 3FN3A 4IJ3C 5FYLE 3UC2A 1G1OA 1BQSA 4OF7A 2YXVA 1RZKL 4BK8A 4ZMAT 4C8XA 2XFXA 1YO4A 1JIBA 2JI2A 2R56L 1H6TA 2ZCHH 3ULUE 1UZGA 4DKEH 4HGWB 5IMOA 2B59A 3FO1A 1RZFH 4RZCB 2F54B 4PD4J 3SE8H 3JV4A 5K9QG 3EYUH 5KVFL 1ZSDA 4X7TB 1LMIA 2IGTA 4M3HA 43CAA 2WXMA 4HFWB 3F5WA 4AQ1C 3A6BL 4HIEA 2X4QA 4LNRB 4RAUB 3EYOB 3PFUA 5IW1A 5AQ0A 4OGAC 3ZGHA 3AMKA 5MEPB 4HWZA 2Y1ZA 1H6EA 1R3HA 3MA7A 4L29A 4JMXA 4N2IA 1COBA 5DJDA 1FFNA 4TV3A 1A6ZA 1E3FA 4ZNEA 2JCCA 4URTB 2I27N 4APXB 4PLJD 1BAWA 3BH8A 5I1DA 3QS3A 5HHOB 5HHME 2VL5A 3C6LA 2G9KA 1OAXL 1G7LA 2HRPL 2DI7A 2YC1A 3S0PA 3QI9B 3QDME 3K1KC 3PV7A 4GQQA 1LM8V 3CXDL 1AAJA 2WOYA 3GXTA 4GKOA 3CSGA 2XQBH 3ATBA 4U6TA 2HVBA 5D7LD 1U8CA 1YPZB 3ZZ1A 2XNAB 1JDAA 4QAMB 4S0TD 1AGDB 3CPLA 4NPJA 1KXQA 5BPPA 4NC1C 1JVLA 1XB6A 3C87A 2E9JA 4Y9BA 3N9GL 1MZYA 1TDQA 2PTTB 4HIIA 3MGOB 4LQ1A 3LEXA 2CHXA 3QQ9C 3X11A 4AIOA 3BPCB 1X5ZA 5GRJL 3FQNA 1JWUA 2IPTH 2XKNA 1OVZA 1CFQA 2C9RA 3IWUA 1KN2H 2GSMB 3ARPA 4F7TB 4LCCC 1HESA 1WBXB 3GM0A 3D39D 2FHBA 4Z7OE 4XVSH 4L4TD 2B77A 2VR4A 3I85A 4EQ2A 3TBYB 3PAUA 4S0HA 2OTUB 2UZIH 1MRDL 1URLA 4IJTA 3KYMA 2WYTA 1CDHA 2OMVB 3W5NA 3DO7A 3US9A 5D1ZB 4UI2A 4QGTA 2IH9A 1GSMA 2D73A 2Q1EA 2EQDA 3BDYL 3N6YA 3NCYS 4XOBA 2PCFB 5F7MC 4PS3A 1YZZA 2H45A 4WHYH 4R5VA 1AFVH 3NESA 4YE4H 5E5RB 2IALB 4LXFA 3SE3A 3TO2B 3SGJC 4F9LC 4YSEA 2DEYX 5JW4M 5E51A 2YD8A 1LO5A 1KF9B 4UAOC 1MWAL 1PIFA 3O6FA 4JFWA 4TYUA 2K78A 2CM5A 3QVAA 4EAEA 1H0DA 1KGYE 2VDQL 4D8PB 5GRUL 1MHCB 2JIXD 3ZOAA 2X10A 3VFPA 3VA2C 1EXUA 4OD3H 3MLTA 4GRMB 2PXYA 3QUYA 5C0CA 4PRBA 4LF3B 3PJSB 1OWRM 2PTUA 2JXMA 1X4XA 2Z31D 1ZT1B 4Y16D 1CE6B 2L8AA 3VRLF 3AM8C 2E7DA 1JPFA 3NOIA 4MQXC 1XR8B 1FZMA 1PG7H 3EFFA 3NT0A 3MLVL 3O6KH 4AEEA 3GSOB 1ZGLM 5IEKB 3RWCB 1ZANH 1BIHA 2OJZL 4JEGB 1X5KA 1LGVA 4AL8H 1T6BX 5C9JA 1A6TA 4GG6E 1R6VA 3BPNB 1RJZB 4FQ1L 2FD6L 2PYEA 4ODHH 5TH2B 2KZBA 4X7DC 3A3YB 2RTTA 3DSFH 4C83B 1WTLA 4E9RA 4PCKA 5DRWB 3BHBA 3L1OL 1UUSA 5F1KC 1EHXA 3VI3A 1D5XB 3IB4A 4F9PC 1KYUA 5HJGA 3H2WA 5MHSE 2C9VA 4NNYB 1BQHG 2HH0L 4AYFB 1GC1H 4YPJA 5E5MB 3SGEI 1G9NC 1EO7A 4JY5H 4JFDD 5E6IC 2M26A 1SEBB 4R7VA 3B9KB 3ZL2A 4N25A 4PJXF 4XH2A 3UROR 3QIUB 4AXWA 4YEFA 1MOEA 1CD0A 4E36A 4JFPA 2V5SA 3UTZB 3BD3A 2JI3A 1QSVA 2WVVB 1NBVL 4FN0A 1LJMA 3QORB 3ZKMC 4IGBC 1IGJB 2Y7QB 1RPUA 1H3UA 5L8JB 2DQFA 4JPIB 4TNVK 3MZTA 1NMBH 4DGWC 4HXBH 1FG2A 2R2HB 3BQUA 1JPGA 2LTQB 3TT3L 5EOCL 4BQ9A 2SEBA 3D34A 3FW6A 3KHQA 4DKTA 5L2KB 2WN3A 3UG5A 2QVIA 2YPVA 3ET9F 2Y72A 4RX4A 4X4KA 2R1WB 5IQOA 4NUJB 1XT5A 1ZA6A 2CDEA 1AIFA 3N0AA 3EDKA 5DHYB 5ACZB 2DQMA 4YAQB 1XMWA 4RGOL 3P9MB 3P3UA 1RU9L 3ML9A 4K3JH 2N0KA 1A7BA 1PMYA 3JTSB 2FHFA 4MXVE 2MCPL 3BP6B 1KOAA 4NN7B 5JIQA 1SYSA 4P2QB 4W9CC 5HVHC 1G0XA 3L4YA 3T3MB 1WK0A 4FQPA 3BD4A 3U83A 4EI6A 3DK0A 2A6JB 4XVOA 4D3CL 4Z7QB 5EZOH 2P8PA 3WIFB 1RURL 3B2DC 1VFAA 2JF1A 4AGLA 5C0NC 4IOFD 4E9TA 4MJ4A 3C09B 5KYNA 3VWKB 5DJXA 2UXTA 3ARYA 5T3XD 3VFUA 2NXZB 2UX6A 2BJMH 3ZK0A 1E7UA 3VQ1C 1XGUB 3EBAA 3HB3B 4XMVA 4ZFFA 5F0MB 3PJSA 1A4BA 1QX1A 4Y2LA 4KAQL 4QXWA 1IBFA 4LLWA 2WB7A 2A9DA 3C5ZD 3RE0A 3MRCA 1XH2A 1YQ2A 3BH9A 2JKRM 3VVWA 1UCTA 2TRYA 2H1PH 3FCTB 2I9TA 3AREA 5DK2B 4PJ7F 5G5DB 5B1KA 1INDL 3O9WA 4YHOH 5LCVL 3SYQA 3GK8H 5FKAB 3N1QC 1FWXA 2ZUVA 2VWEE 1OPOA 4FNTA 1PY9A 3FQ4A 4M8UA 2DQJL 4NZUL 4AMXA 5GS2D 4CAGA 3OAYK 2VZ3A 5DJZA 2ZWKA 3ARUA 3EYOA 1JFQH 5KVEL 2OSXA 3GIZL 2VDPB 3E1ZA 1I3VA 4PRPB 3OZLA 1MIEH 1DQJB 1D5MB 1RZ8B 1SN2A 3KBEA 1EEYB 4LEOB 1BX2A 3HMWL 3SE3C 2GAZA 4PRNA 4I77H 1CD9B 3HG4A 4K7PX 4YNYA 1O9ZA 3OD3A 4EZJA 4XAWL 2PYFB 4X7EC 3QAZC 2ZX7A 1PD1A 1Q94A 3QG6B 3UTOA 4V33A 5B3SB 4UQCA 3OHXC 4N2NA 3VJ6B 2H26A 1YYCA 3LZNA 4DKEL 2QPDB 2ZT9C 4EI5C 1MDAA 5CEZE 5I6KA 1OCWL 4IKLA 4Z7UB 1T4WA 1AZRA 3GTVA 2ATAA 4KKCC 5J3HD 3KCWA 3CU7A 4PLKC 1RUMH 3B43A 1W91A 5DURB 4JVPA 1P4LB 2EYTA 2SEBB 4A66A 1SJXA 4KI1A 4FP8H 4HIIB 4TRPH 5EORH 5T1DL 2JQAA 1G1CA 4EKJA 1GY1A 4R9HA 4RFOH 1R9FA 3EOAB 5C2UB 3WLWD 1ZEAL 4AQOA 2DYPD 2HT2C 3EYVB 3L1FA 2NY2D 3IXTB 3GSNH 1VGKA 2ZOKB 4AJVA 1RK1A 3KBPA 4TKWA 5D7IF 1I9RL 1UZ8A 3CD4A 3M17B 5GIRA 2ODIA 1BXXA 3GSVA 2QGEA 3ULVF 4WGWB 2XCMC 3GXDA 4N2GA 4NZRH 5HDRA 2I07B 1QBLH 1WZ1H 4AQ1A 4D9RD 2V3DA 3RVXC 3QS2A 5AAMC 5B39B 1EAPA 3HNSH 5J1SC 5F0PB 1I1AD 1N64H 2Q7NA 4Q4IA 3UADA 3UXFA 4QXUH 4RRPA 1ZA3B 4ZT1A 2AGJL 5H2BA 4BA0A 4PRAB 1MFVA 2JCCF 2HKFL 5IQ7L 2WVVA 1UH4A 1U8QA 3O4LE 3VWKA 2G2RB 3MBEB 3FTSA 4OD1L 4FG6D 2UWEA 4GRWE 1GTNA 2WKOA 3I6KA 3NCFB 4LNRA 1EWHA 4GXUM 2MCMA 5DCCA 1RP8A 1S7UB 1T1ZA 4A6YB 1HNGA 1SZNA 2B4CH 4NO5B 3FU5A 5LAXB 3MNWB 1IGMH 1IBGL 4JHBA 3ARBB 5K33A 1WITA 4IRSA 1BGXL 5TE6H 1CJYA 3HE6C 6FABH 9CGTA 3DI2B 3CC5B 2CGZA 2ZKYA 4K3HA 5J11B 1HH6A 2ZF9A 4LL9A 2YKLL 3S8FB 2IAMA 2X4RB 4RA3A 3UIYA 1Y7VA 1XGTA 1PSKH 3DVNA 3RIFK 4H88L 4ZPVB 4YSTA 3HBPA 5AVQB 1KTCA 2IWFA 5CGBA 3W57A 1NCHA 1OE2A 4JG1H 1IKFL 2VXQA 3FCUB 3QFJE 1P6AB 1QBMH 2JQZA 5D4HA 1KJMA 2N4IA 1S7WB 3M1CA 4PQXA 1LK3L 5C0BB 1XL6A 4LARL 1MCPL 4M6OL 2AJUL 3CIAA 1YEHH 1XX9C 1MCWM 4F7CA 5FCUL 2C1PA 4CKQA 2DKUA 1V10A 3P3SA 2GY5A 1FNEB 3OC8A 1BZEA 2JTYA 4HJ0D 5SWSA 4EIBA 4BCXA 5H8DA 3MVSA 4MDIB 5DYOB 5AVSB 4FAAB 3G6JB 2R29A 3BD5A 4LK4A 4IBVA 2NSQA 5DS8A 4KVPA 3X17A 3SB3A 3HLKA 5FWQA 3K6NA 4N2CA 4U1NB 2W0LA 1NPNA 4KVNL 4UOW0 3SE4A 2Y6SC 3TV3H 5I1HH 2X89D 4P04A 4U1GB 3QXAB 1IMHC 2C34A 3G6DH 4ODXB 5B7EA 5AW7B 1U92A 3KPMA 3JV6B 1ED3B 5E03A 3NBNA 1QTSA 5T33H 2EE3A 4MB5A 2G9HA 3VXMA 2XTJD 4UF7C 4UOJA 3AZUA 4PGBB 4D0CB 1PZ3A 3BVVA 3GK8L 2JJTA 3HG1A 3WFBL 2VT0A 5BS0E 1ZWIB 1JF1B 4FNSA 3K8LA 3OJ2C 2ITEA 5DQDH 3TFKD 4HWNA 3E8UH 5JOFB 3AG2B 2VDPH 3QUML 1QRNB 1VA9A 4PJ9C 1U2CA 4ZMVA 4P07A 5KSBB 1E8ZA 3I50L 3KBHE 2GC7C 2R7EA 4DO5A 1QRKA 4LPYA 2VMJA 3TT1H 3SKOA 1A3QA 2FQDA 4KK6D 3SD5A 4LPCA 4PS4H 2WWMC 3SZKC 3V6OA 5I30L 2C5DC 3LKQA 3K71A 1MRCH 1QWUA 4WAFA 1QATA 4AGOA 3LMJH 2VDML 4XP9L 3FDWA 1CDIA 3P4MB 3CPUA 5JA9A 5HVFB 2ZXDA 3IAPA 4P5MA 3CHRA 1S9WA 3ZE0F 4XZUB 3IJYB 4JGMA 3SDCA 5I1EH 2J6EH 3AU1A 2LLNA 2GBVA 2IPUK 4UTCA 2TSAA 1XF1A 5K9OB 1KGCD 3WSQH 4ZXBA 5IVXA 3D48R 1GL4B 4LZKA 5EB9A 4E2OA 2WIIA 5IW6A 3O6MH 2R9HC 3P0YL 4KKPA 4XXCA 4LGPB 1NCDH 2V9RA 1KGJA 3QDGB 2GB2A 3PCYA 4N0UE 2E8ZA 3WTVA 5DFAA 4E41D 1WPCA 1A66A 2FK9A 1KBKA 4PJ8D 1M53A 1X4ZA 3FCSB 2NNCA 3QWOB 2AMGA 5DJZB 4KDTC 4LP8A 4JO1H 5FYJL 1CLOL 3HC0B 1MRFH 1WCBB 1H9DA 3IJ9A 2FE0A 2WWOA 2X5PA 4I3SL 1IQWL 3ZL4H 3RBSA 1E9OA 4DZBB 5B1BB 4YDKL 2R0ZH 2QHRL 2LTQC 2X6BA 4OIIH 5B1JC 5C6WH 1TJGL 5ESVB 2DBLH 4W9GC 3KYAA 5JHLA 2GK0B 2H3NA 3HNSL 4NC2B 5CM1A 3EJCA 4B53A 3WKML 5JYLA 2D03L 2H1LM 1YEEL 2P28B 4QD2E 5KUKA 3QORD 3NZHL 4K3DL 3WY2A 1LNUB 1S7XA 1U8NB 2WLIB 4HMEA 1AXTL 4OZHF 3APDA 1A1OA 4PIRF 3VGAC 1UM5H 3C5ZA 3QIUC 4JLRB 5IIEB 3QIUD 2DWTA 1FFPA 4OZ4A 5EA0L 2H32H 2D7NA 1U2HA 3CVBA 2P9RA 1A7RH 1LEKA 4EI6B 3P11H 3W0WA 3WKNA 3OXSB 3TU6A 5T1LB 2RGSA 4H44C 5LGKA 1NMAL 1VCAA 1NICA 3SDDB 4H4NA 1DQMH 2BVPA 1YN6A 1YYLH 2F8VA 3F7RA 1NFIB 2HRGA 3O2VH 3RTQA 4NDMB 3AREC 1WFNA 5DJCA 3AW5A 1SMDA 3U6RB 2F7QA 4WTQA 3BZ4B 3MBXL 1JPST 2Z92B 3T6XA 3QC5X 4JFEB 2APXA 2V7HB 1WEJL 1UH2A 3VI3B 4Q0XH 3HHSB 3SDXE 2FB4L 2ZXAA 2DIEA 2BVYA 5AD0A 2XVLA 4ECNA 1TKWA 3HZVB 2EE9A 3OL2A 4KVCH 4P5SA 4UNTA 4WWID 2VISB 3RWDA 7FABH 4KFMA 2IXQA 2B1AL 3AACA 5MERB 4Y16B 1LO2H 4N0FB 4HOZA 1CT8B 1LQSR 2BDNL 1FSKC 2QQQA 3O6FC 3ZDWA 5C8JB 2UVEA 3HS0A 3ZDYF 2YXMA 1ZAGA 3QNYA 1SJEB 2WOBA 4WRLA 2D7TL 5BVJB 3V0JA 1ASQA 1H8LA 1BFSA 2XNAA 3OKLA 5FYKU 1YAZA 2HUHA 2LOEA 3EO1A 4UM8A 4FXKC 1KEGH 1NCJA 2JV6A 4LOVA 4CC1A 1OP3H 4PJIE 1WWAX 1EAPB 4LL4A 5DT1L 2O5XL 3OPZH 3KPRB 4LP4A 5EC1A 1GOGA 3WHXB 2OZNA 4PJ7A 5TQ0L 1ZHBA 5I71B 5C0EA 3QRLA 1E4WL 3FB8A 5E94A 3VI4A 2FEEI 4LCWA 5SX4H 3AQXA 4YPGA 1G9HA 2EDBA 5D1ZD 5DMIL 1XQ4A 3FHAA 2BRRL 3FTVA 1S78D 4UINL 2KKQA 3IRPX 3IDJB 4X6FB 3QXDB 1KJMB 2AQPA 3RDTA 4MMXC 3NPZB 4H5SA 4G6MH 1UT1A 4NQVA 4L4TB 4P5KB 1NBQA 2B59B 1AZCA 1G7QA 3MUGB 4Y4FB 4AE1A 5I16B 1S5HA 4K9EL 1W0WB 1P4BL 4N2MA 4ANWA 3MRKB 2I7SA 1B3IA 4BGDA 4GS7C 2HAZA 2WWNA 3KW7A 2ICES 2XICA 3PQYE 2DWDA 4S1SH 4BBWA 4QEGA 2EILB 4XO8A 2BY0A 2VDRB 5D7KE 1KTBA 3U4BL 3V0GA 2W9EH 1A8ZA 1AD9B 2FZ3A 4B7LA 4TNEA 4AVHA 3OLDA 3UO8B 4S11A 2FYVA 3ZTEA 3MV8B 3BAXA 4HDIB 1ORSB 3Q44A 2W92A 2ZWLT 2V7NB 4NEHB 4YSCA 3W2DL 4EZKA 5I30H 1NEZG 3II3A 4GT7A 5FGCB 4C56B 1RUQL 1AMXA 5D7LB 4KQ3H 2QSQA 4L0PB 2CO6A 5A6IA 1PZDA 3TC9A 2LE9A 3PIQA 4IJ3B 4NDMA 4YQXH 5DJCB 4XZUA 5I1JL 1KIPA 5IF0A 1RZIB 1X5JA 3QZMA 2VLJA 4ATTA 3VSVA 3QI9C 3WD5H 5C0FA 4N2KA 1I8LA 2IWEA 1I3GH 3TCTA 5IJBC 4R3SA 3IDYB 1TMCB 4OLVH 3C6EA 2WXJA 3ZKXB 2R1YA 3CVIL 3L4TA 5EBGA 4R97C 1DDHB 5HHOD 4PWFA 4GY4A 4G8GB 4WZ9A 1M6OB 1XF4A 4WFEE 4Q14A 3P77A 2NY0C 3AY4A 3IDNB 5H4ZA 3FONB 4NOFA 3VXUA 3TTSA 2F54A 4GEIA 1EERB 4M5TA 2X70A 5TF1L 3SYAA 1I7UB 4AJYV 5HHMD 2BO0A 3F7PC 3U6XS 3V4UH 4NKOA 5BZWA 2JKXA 1NGWB 4CNIB 1NPJA 4ZTPL 2VXSL 1JDCA 1EK3A 4NN7C 3VO0A 2NXYC 2VIRB 4HUUA 3RWGA 3HE7B 5I28A 5IQNA 3HG1B 4RLDA 3Q05A 1OO2A 2DQDL 4R4ND 1OT1A 4NWUL 3BFQG 3OGCB 2IV9A 3QJVB 3DBXB 4P23D 3HC4H 5DRZA 2X89A 2BVPB 3VFRB 1T0NB 3SE9L 3DV6B 5BO1L 2XOTA 4MNHB 4JFFA 4BH8A 1HXYA 3MRPA 2AQ2A 3EO9L 4YN3A 3AS3A 3GHEL 2ENSA 3DVFA 5BVPL 3ESMA 4M1GH 5F8QC 4I0PD 4TLUA 1OHZA 3UJJH 5GGVL 1U42A 3D1MC 4JLRA 5IIEA 3NZHH 1CE1H 3ULUD 3ASOB 4HZLA 2WAHA 4U1NA 1QNZH 4PR5B 2GAZB 4PRNB 2AJSL 9PCYA 4WI0B 4JNXA 2KMWA 4NO3A 4DESA 1BQLL 4JJHA 1IEBA 4P2YA 4Z7QF 4NAJA 2KC0A 1TF4A 1UVQB 3QE5A 3UZQB 1RJCA 5FK9A 3G5ZA 5E7FA 1A14L 3N40P 1P0SE 1HIML 1FNGA 3TLRA 4OFYA 1QPXA 1XD0A 1I85C 1VB9A 2KDYA 3OQRA 4LBEB 2YARA 4PJBE 4K7PL 5L88H 2K3TA 2OLDA 2W59A 3RJDA 4E41E 1G7HA 3U1SL 1CQYA 3QJOA 5ICXA 3ZRSA 4Y1AA 1HKFA 2BNUA 3PJLA 1WO2A 1ES0B 4J4PC 1HI6B 3F65A 1V3MA 1K4CB 1X5YA 4RBPH 3PABA 4JFQB 5T1KD 1D5ZA 4Y8DC 2OMTB 1I1YB 3G08A 4W93A 2HFTA 3DETD 3DVNB 3RAJH 3NRPA 1BEYH 4IBSA 5HHNB 1UM6H 3KHOA 3WTUA 3GFUA 3LY6A 3QRBA 3MRMB 1HEZA 4ATWA 1KGUA 4LEEA 2J73A 1IAIM 1BAGA 1OTUC 1QWNA 1P4UA 4HOXA 4XMXA 4PRHA 4DPAX 3LS5L 1XF5A 4QRRB 3QWRD 3FU0A 3GHBH 3VFGL 4HCIA 1GSKA 3D9AL 2ZCHL 4IBTA 4EI5D 5EF1A 1MVUA 4GQPH 5I19H 1QBLL 5DGRA 3L7FB 3SDDA 3FUMA 2D2OA 1KB5H 2GG1A 5JW3H 4S1QL 5E24E 4ESKA 1X5IA 3B9KC 4L3EA 4TQEH 5GGTA 4YAQA 4UANA 3JWOC 1DR9A 3U0WL 5K9JL 5LN4A 4FFTA 3WLBA 2A99A 1MCHA 3MROB 4MVBD 3RVWC 1N12A 1XGQA 4PHZA 4WENB 4YSQA 5I6LA 4QRAA 4NQCB 4WTXA 4XAWH 3GRWL 4XE5B 2A1WL 4JUSA 2R2BA 5DRNB 1N59B 3UGUA 3O6FB 4G6FD 2CRMA 2IV8A 2Y7LA 4M29A 1PSKL 2F74B 1MFBH 1WAAE 2G0KA 4L5FE 2O5ZH 1KJ2A 3LN5B 2ISDA 4ABUA 1HINH 3JXAA 3A4EA 2X0VA 1JBJA 4PV9B 3OB0H 1KYDA 2PW2A 3CU1A 4FNLH 2HKAA 3IJSB 1KIUB 1MJ8L 5K9KB 5SX5H 1L7TL 3O41B 4RA0C 4WEBH 4QCIA 3U46A 3AJ7A 3FHQA 3PP4L 5FGCE 4C56E 3EGSA 1U8LA 1G9NH 3TBWB 3ABMB 1YEIH 1E30A 2H1PL 3TONA 3FC8A 1AZZC 2OTUA 3SE8L 1DHKA 1R47A 4RGNC 4XO3A 4L9LC 1EJOH 2JE8A 3F83A 4XH2B 3FSZA 3VG9B 1KTJA 4HJIA 5EBLB 4F8LA 3QQDB 4UUJA 3CWGA 3STLA 4AIZB 4LPTA 5FOBA 4OLVL 5FO8B 2WXFA 1OGAD 5TH2A 2P5WD 4OU3A 1KIRB 2QPFA 2UXFA 3HE7D 4JCLA 1GYCA 4AQ8C 5I1JH 4FQLL 1D5MA 1RZ8A 2EADA 2P24B 4AV4A 1XSOA 4KRMB 4P46D 4MJ2A 2EC9U 5KYWB 2R2EB 3M86A 2E0PA 1ET7A 1P6FA 2Y3AA 1MQKH 2GIMA 3VXME 2V37A 1BYPA 4LO9A 1F4WL 4P5MB 3QW9A 4G80A 3L3DA 3H0TA 2HWZL 3NIGE 4RSYA 4DPBX 1MJUH 2NW3A 3D39E 1NLBH 5C0CB 4HUCA 2JXMB 1DQVA 2DQCH 2X4SA 4HAKA 4POZC 1I8MA 3TCLB 1AMYA 6TAAA 4F15B 3U36B 5EIVA 1WWWX 3G6AA 1SLUA 1WBYB 4KXBA 2D9CA 4ZFGL 3WN6A 3L7EA 1NCOA 2V7NA 4TL5A 1IEAA 1HHHA 1XR9B 4ZW5A 3QFJD 1BQHA 1A3LL 4OD3L 2XKUA 1LTXA 1TTBA 4H25A 2ALWA 5AVTB 4PJEE 4XVUC 3E8UL 5FW8A 3OLGA 5ECJE 1WH0A 3MV8D 4Z7OF 2BOCB 1PPIA 1UWXK 2F9BT 3QDMD 3UABA 4GIPD 1HSAB 4H8UA 2EKSB 4MD0B 4OZGF 3HRZB 2R0KL 1YY9C 4JMNA 2O61B 2NY4C 4PR5A 5LVEA 3DUSA 3NAAH 3MUZ1 2KLSA 2J88L 4M5ZL 1L3WA 4P0DA 5H2BB 2ZX8A 4F80A 3BDYH 2Y7SA 4DERA 3U30B 3JV5A 1YNKH 2BFVL 1YMME 1UWFA 4PV9A 4QTHA 3NCEB 2EC8A 2YRZA 5DA4A 2D31A 1HCYA 3FRPB 4CADB 2DTMH 2ITCB 1NC4A 1OAZH 5C0RL 2I24N 4XI5D 5IVXB 2J6EL 5E8NB 1HSAA 4N22A 1QFWI 5L2KA 4Z7IA 1DCLA 1ZY9A 2HFGH 3GBLA 2EDHA 1KYAA 2R69H 2BNQD 1CGUA 4DCQB 4N2FA 4FHKA 1XF2B 3KYKL 1WCQA 4WI7A 2IQAA 5FIEA 3ILQC 1JYVA 2WBJB 4YL4A 3ARFA 4Z1PA 1NCCL 1P1ZB 4N8CL 2MNWA 2J8UA 4E9WA 3KPRD 3H54A 1UM4H 2WHVA 1I7UA 4JM0A 4APQB 5BO0D 4H0LC 1CG9B 1BFVL 2QELA 3BAJA 1SOXA 1KCRL 1EJ6A 5HHQB 3BZFB 2E75C 3HG5A 4HF5H 4I4WB 3BE1H 2L4OA 3RWFB 2OJZH 1RV6X 3CBRA 3VH8G 2ATPA 3SDCC 5GJSH 1KTLA 3OSVA 5F1OB 2BWQA 3WTXA 3HUJB 2Z91A 1IIIA 4MYPA 2D03H 4HW6A 5HYQB 2X44D 2ICWJ 1Z9SB 4U3SA 1X5MA 4P3CL 1RJZA 2PO6A 3L3DB 2BSRB 4JRWA 1FGVL 1T0NA 2MJWA 3ZY7A 3VFUB 1I1RA 1UM5L 5IF0B 3SKUD 3L3HB 1T7WA 4ZS7L 1BVLA 3QJUB 2H47C 4YX2H 2H32A 1P7QA 2BP5M 2J4WL 5IUSA 3WIAA 1GGCL 1PW3A 3QRGH 3LHPL 2XY2A 4NQEB 3C8HA 3V9FA 1DDTA 3X13A 1Y18B 2VERA 4OFIA 5IB2A 2XN9E 5EEZA 4JFED 4FMKA 4LOEA 4P05A 4ZODA 4GRLC 4WTZA 4OLXL 5JNYB 1KTDB 3DTUB 3H8NA 4TOYH 1SQ2N 3II2A 2B1AH 5DDHB 3DECA 2W0KA 1T1YB 1P5UB 3F04A 4M7LH 1OAQL 3ZX1A 4BQCA 2FL5B 3CFMA 5KSUB 4YUEL 4U4BA 3GMPB 4OGQC 3MLTB 3PWPA 2GPZA 3GMOB 3SY0B 3B4NA 5EO9A 2E7MA 1J5CA 1RZKC 1OK0A 3DPBA 4GKSB 2P52A 4MCZB 4P2RE 4ZXBB 3ZTDC 5FR3A 3G6JA 3LX9A 3RTQC 2CGYA 2OR9H 3C5SA 4X98A 4IBZA 4L3EE 3ARRA 3S97C 3EFDL 4PJCA 4LMQI 2H0JA 3D2TA 1IT9H 4ENZA 3K6IA 2JJTC 1KYOJ 3RWIA 4OY9A 2HTKD 2LHAA 4ZMWA 2G3XA 4KTDH 1ZSDB 1DJYA 1J1OL 1CGSH 2MPVA 3GXNA 3B2VL 3KD4A 1VEOA 3GZQA 3GNMH 1YAIA 2V9QA 1CGVA 3I9AA 4ZO7A 4U6XA 4YHLL 1AGCA 2ORBH 2AJVL 4PWJA 4NJAL 3UZEA 2CUIA 2B15A 4Q74A 2D8KA 2IF7A 1SYSB 4LLDB 1F6AB 2O5XH 3OPZL 4P2QA 4WI8A 5DEJA 3SD2A 5FS5A 5B4MC 2NUPA 4HKJA 3VI4E 4K94H 2AXFB 4Z9KB 4GFXA 4DGUA 5A3IC 2WQ8A 4AYFA 4J4PA 2O6CA 4R26H 1SM3L 4UNUA 1S6NA 4Y19D 3NTCL 4PJ8B 4JZNA 1SY6A 1HH6B 3I3BA 3PWLB 2XVKA 1WVZA 2EXTA 2VLRB 2HKHH 3DIVA 4FTVA 2OAAA 4XPGL 2DMGA 1DP0A 4QY8A 1SGKA 2BOCA 3KJ6L 3MTXA 4AH2B 1I7RA 1TZHA 4RVBA 5SV4A 5IVNA 1HJCA 5EO1B 1N2RB 4DUXA 2NXYB 4DGVL 1KBGL 3MV01 3D2UD 4PV8B 3Q8EA 2E9BA 2FGWL 4NIYE 4XB3A 1JGVL 1KXTB 2CBOA 3NJHA 1LEKB 4RAVB 3HRZC 4YFLF 2NX5D 2P5EE 2H3XC 1DQDH 3MFFA 3GS7A 4PB0L 5KYYB 4MNGB 5E8EA 4P2OD 4OV5A 1Q8MA 1N6UA 3IE4A 4DPRA 2W9EL 1SOKA 1MG2C 3GB7A 1N19A 3RILA 1I9RH 2UZYA 2Y2YA 1CUOA 2EIJB 2V5RA 3IU3A 4MX7B 1KG0A 3J07A 4JFUA 1GC1C 5FHBL 4F7EB 1XEUA 1U3NA 2X4TA 3OAZK 1O9VA 5A2AA 2F7PA 3Q2VA 5FO7B 4JKPL 4YGAB 1IV8A 5D8JH 1TTUA 3VXOA 5FGBC 3K4DA 4PG9A 5GS3A 4YSPA 3GQFA 2A77H 4LVHC 2WZ6A 3BSZH 3OJVC 1T21A 3T04D 4ODUA 1Z0MA 1I1AA 4PV1C 5F7AA 1AH1A 1JNNH 2GTWB 5ID1A 2OK0L 2WLMA 3RPIA 1TVHA 2MWCA 3JV6A 4IOIA 3VFTB 1GA2A 2HTLD 2CA3A 2B4CL 1KLFA 4JFTA 3DPBB 4X5RA 1U8IA 2MRYA 2ALAA 3KCPA 4NNXA 2Y0SA 4ZNCD 1EZLA 1CYGA 4F1ZA 2A6KA 4LVEA 2ZYRA 5TQ0H 3FCBA 2R59A 2VAAB 4IOSA 1OAKH 1MHCA 1TTFA 4K5OA 3MLWH 3U7YH 5KG9A 2P45B 1OZUA 1DSFL 2AJZA 2NY7L 3RTQB 3H9SB 5I6XC 4Z7VF 3LZRA 1ULVA 4N3UA 3G9VA 5LDSA 1U3JA 5CUSH 3SKJH 3LKSB 1TJMA 1T5XB 1GS7A 4L5FH 4GRWF 4U1GC 3ZHKA 1CFNA 4PJHF 3L9YA 3RVVC 2AEPH 1YECL 3F6IA 1DJXA 4H8WC 4PN6A 3B1UA 1OXYA 1WP6A 1FFPB 3WJMB 3VD2A 1E43A 3ZIYA 2JB6B 3K2IA 3V2AR 5ID0B 4J3XA 5DHEA 1X7TA 4M6NH 4DOHE 1TEFA 2DMCA 3WNOA 3FRPG 2C3VB 2YPVH 4AQAB 5JO5A 4V11A 5HYQA 4OGAD 4DO6A 4QRBA 3BO8B 3P4NA 3JYCA 4RFEA 4GBXD 1V8HA 3LNGA 1P7BA 1IAMA 1PZSA 2Y06H 4QXUL 1RQ5A 1KCSH 3QDJB 4U05A 4EN3D 2AV1B 5LBSA 1F4AA 5JXAH 4NZRL 3EO1B 5D96B 3G5YA 4K94L 3VU2A 2E4TA 2RFXB 5C08D 3QZOA 1MFNA 1KXTA 3P9LA 1DYZA 4L8BA 3O0RL 2OM5A 3H42H 4G80B 2EH8H 4ZTOH 1CDBA 3WIFA 1ZVSA 5AW2B 4KJPC 4M43L 3KGSA 3T8XB 4OZIB 4X7TA 2JFCA 4LEXH 3BVUA 4WK2B 4IEFB 3LB6C 4MA8H 2CG9X 4CU7A 3ARBD 3BZEB 5DO2D 2WGNB 4HEME 2OMYB 4M1DL 1OWWA 3B34A 3O8XD 3VX1A 4M4PA 4O2CA 3HW7A 1XCQA 5DSCA 3TVMB 1G7LB 3ZRCC 4NBYB 3QI9A 1NKRA 5CR1A 3EYFA 1QACA 4KNTA 1LL1A 2F53E 1OY3B 3WKMH 1RFDL 4FHBD 3ILDA 1I1AB 3M07A 3ZTJH 3K0WA 1BIIB 4FE9A 5IESH 1U36A 5IP4A 2WCGA 2P8MA 1EXGA 3BWUC 1F6LL 3WXVH 1S8DA 1R5IA 3QT2A 1LO4H 3P30L 3DGGA 1M1SA 5DHXB 5CD3B 4I48B 5GISL 1QEXA 1P6WA 4W9LC 3RUGE 4AOFA 3FSVA 2NY2B 2IANB 1KELH 1TR7A 1PNCA 3H9SA 1ESOA 4JFZH 3SGKA 3CAFA 3TX4A 2D31B 1E2WA 4ZPVA 2XACC 3WEXB 4AMKL 2IOMA 2JH2A 3HFMH 1KFAL 5ANME 5ADOL 4YHIA 1C12B 2G5BB 3RPBA 2UZIL 4MA7L 3EGXB 3ZE1B 1PLGH 2OCFD 4UMSA 1MHPH 5DJ8A 5KZCB 4HH9B 2V2TA 1J5HA 3P4OA 2KL6A 3GF8A 2PLTA 4M1DH 5M94B 4N20A 4DH2A 3KDPB 4G71B 4P9HC 3EZ8A 4DEPB 1LP9E 5I6XB 2VMFA 3PL6A 4AQEA 1E27B 2WXKA 4TNWK 4UTAA 1Z1WA 1KPVA 4LVOC 4N3TA 2DH3A 4K71C 4UQEA 1Y6KR 4M4RB 3PDDA 1FO0B 4MFHA 1N10A 4XMPL 1U8KA 3RU8H 3S6CA 5AYTA 2K9UA 4PRPD 5DS8B 1NDMB 1CPUA 4FNQA 4TLSA 4B95C 4YDZA 5T3XH 5G4MA 2I9TB 2IH1A 1LO3L 5I5RA 1G7MB 1NBYB 3CVHH 2COVD 4NUJA 2AEIT 2YC1B 4HKBB 3PREA 1BG9A 5AVZB 1S9WB 5BO1H 1ZVSB 1EV2E 3BGMA 4L3CB 4KDTA 1XCXA 3SO3C 3V8CA 3HS0C 4G3YH 1IZJA 2MCPH 5J06A 4Y4HD 2YGVA 1PZAA 1ZCRA 2Y3NA 4PP2A 3HFML 5D2LE 4F58L 4QYOB 1FL3A 1Z9OA 2XWBA 3K46A 3NH7L 4IU2B 1N0XH 1KACB 3MNVA 4J27A 5D7IE 3PHSA 4OR1A 4CMHC 1SNRA 3P54A 3VACA 2NDGA 2YGPA 5D72L 1DSFH 1JGIA 2OL3L 1BBJA 5J4MA 3GWJA 2NXZD 3IFPB 4KKZA 2R83A 4H0GA 4J3OH 4OF3A 1OP5H 3MMEB 3PUCA 4PGDB 1U8OA 5LJYH 4MYWB 5M7QA 3HE6D 1R34A 4CN6A 1E5YA 4EE2A 3GRWH 4FQXA 1CYXA 5JW4Q 3LVEA 5I1HL 3UG4A 3VD9A 5T5NG 4M61A 1CXLA 2FLBT 3NIGB 4Z7VB 3D08A 1X5AA 4HT1H 2OX5B 4P2QD 2OXGB 1NJ9A 5E4OA 3UEQA 3V5KA 1FJ1B 5JXEC 2LABA 5C0CE 3RPKA 4ZZFA 2VITA 1FYTB 3NDZE 4PRIE 3X1NA 3IRCA 1HCZA 4UM9D 2W60A 4JX0A 5IBUG 1UKQA 2LLGA 3AAZA 3TFBA 3IFPA 1A21A 1QEWB 4ICWA 4JZJB 3F7VA 3BEWB 3LKPB 4G9FD 4N4YB 4FA6A 5I8OH 2E5EA 1RXLA 5FV2A 1WT5C 1DTUA 4OF5A 2F53A 5ACLA 2DQFB 5BZWB 5CSZB 1F42A 3GMRB 3LVTA 2X12A 4Y4FC 3G5XA 3VG0H 4JAMB 3BVXA 3QUZB 4YIQA 5MEQB 2QVMA 5IW6B 5IROC 1WFMA 4X5WA 4WY7L 3EDDA 2VLME 5FHBH 4RWHA 4JO5A 1MQKL 2G75B 2VDOB 4NI6A 2W9DH 5JMRA 3VFSB 2XBZA 1HQ4A 1XGTB 1UXWB 1ODAA 3TBBA 3FT3B 2P5PA 2LU3A 4KTYA 5TE4L 3RG1C 3VMPA 1KIQA 1CFVL 2DV6A 2J71A 3B9KD 3EFOA 4RDQG 4Y19E 5E6IB 1IC4L 1OCOB 2FIKA 5ANMA 1GGYA 2HFGL 4JFYA 5ILTH 5INCB 1NAMB 5KJ4A 4RMTA 3CFNA 1CBJA 4N5ED 1PCSA 4PV8A 4G6KH 3AY2A 4MZ2A 4TL4A 5JIMA 4JE4B 4QRRA 1OAZL 5GZND 5C0RH 2XTLA 4X42A 2EACA 1T3FB 4OCXL 1IFRA 4AENB 4EZMA 5E8EB 1WA1X 2EIDA 2R4SL 2IAMB 2EDTA 3HNTH 4XPAH 3TZVB 5D6DA 1VADA 2VKWA 3E2HC 2DMBA 4I9XA 3S96A 1N5YL 5AB0A 3MLXL 5FCSH 4GKNA 3GXFA 4OZGE 3U0TB 5IVXF 3UP1A 1DJZA 1C12A 4HS8L 4XMKH 3S37L 5BVPH 1N6VA 3MO1B 3KWUA 1IILE 2W07A 3QPXL 4ALAC 3ESOA 5IJDC 2MMXA 5KVDE 3DUUB 4PJFB 1H6UA 3QNXB 2CM6A 1IL1A 3APMA 4OFVA 1GIGL 1MCJA 3DX6A 3R7RA 3DJ9A 25C8H 4M6MH 5DJ2A 5EOQH 1JYNA 1QR1B 1JG9A 1E8YA 3X2QB 4AI7A 2OMXB 2EDNA 3LQMA 4Z3HA 3GJEB 3K80A 4ZMNA 3NIFB 2AJXH 4OCNC 5D71L 3QUYB 4LLQA 2DDQL 1C16B 1CFVH 1IBBA 4WDIA 4E9YA 4EXKA 1FL6B 2IADB 5DGQA 5G4NA 1YPZA 3NJVA 1DVFD 2COQA 3GSNA 4J3VA 4WFHD 2GBAA 4PY8J 3T2NH 5M95B 3UAEA 3T09A 4WJ5B 4IOFC 3ZE2F 3FSAA 4WO4B 3EYSL 4WV1B 3HS9A 2VDQH 1Q1JL 4WWKB 3OAWA 2HRPH 4P2QE 5HDOA 3SGJA 2KHAA 2VMEA 4AKQA 2D3VA 2XXMB 3WLBB 1D7BA 1R3JB 3LQAC 4OM0H 2BERA 5GS0D 4NIKB 3JWNC 3MACH 4MB1A 2NSMA 4XC1H 3DX9A 4XNXH 5CLWA 1JHLH 1MI5D 2XUWA 3S8GB 1EO8H 2C3WA 1KXVA 1S9XA 3CK0L 5TE7L 5GS0L 1N70A 4YHKH 1ZE3H 3RRQA 2AQ3A 1LE9B 5TF0A 2J1ZA 1JV5A 3C60A 4F91B 4H20H 1OSZA 1WAEA 4ZJ9A 1HYSD 1AI1H 5EU3B 2N59A 2XXGA 1FHGA 3FFDA 5D1ZI 4J3UA 4LCCA 1TZIB 3DDFA 3CUPA 4P23A 4Z3IA 3NP4A 5FF6A 1LO0L 4YBLB 5D7JA 4A1RA 4GP5B 3KLDA 1UD4A 7PCYA 3O8XA 4IU3B 4J39A 3HN5A 3NJGA 5F6HI 4YR6B 5GGSY 1UOKA 5FWRA 1BQLH 1AS8A 1I9IH 5T1LA 3QI9D 1B0IA 4R26L 3DYMA 5LGJA 1INQA 1K9TA 2JLPA 4ANUA 4I9WD 2IPKA 2IDFA 4Z77A 5GGQH 4GRMA 1N8ZA 4I0PC 3QH3A 4OZFB 4F92B 1HEJC 4JGJA 3ZMNA 2JLLA 3RFZB 5TGBA 2ZYIA 3BT0A 4IRJB 1E6JL 4OGYH 4QRPB 4MQ7A 1TLMA 2CKBH 4N0RA 5F3BB 1CU4H 2IEPA 3EH3B 1EEZB 2YD4A 3D25B 1CFBA 3OKKA 4OIBA 1NANI 1QBML 4FKKA 5FM5O 1KBBA 3WMSA 4B9FA 4UV7L 4CSSA 3Q06A 2WXPA 1WS8A 4L1TA 2VZ1A 4MAYC 4ETQA 4PTUB 3VWJA 3GXMA 2HUEA 1MIML 4KI5E 3I02B 3BKCH 2R23A 2FJSA 4WFGE 5HVWA 4LLVB 1T2JA 4ACPA 1TETL 3ARGC 4JRLA 2X4UB 1YNTF 1VFBB 1O75A 4YDIL 2W80C 4BWTA 1V3KA 2OI9B 3WFCL 5ABZA 2FQFA 2YJQA 2XI9A 5DUMH 4ALAH 1ADQL 2Z9TA 1P4IL 3O4LA 4MNQD 4QOKD 3VSTA 5KN5A 3IFOA 2ESVE 4A37A 1G94A 4HJGA 3RKDC 1UJ3A 4KJYB 1AYOA 4N6RB 3DV4B 4BE5A 2NTFA 1HKLH 1U3HB 3QO1B 4GS7B 2H2PC 4GSXA 4HLZH 3UBXB 3WHE0 3RIAF 1KN4H 5ADPH 1ZIAA 3H7BB 2VMCA 3I74A 3I02A 2RHEA 2VDLH 1G0YR 1SUHA 5HYJB 3T6VA 1IVLA 4YPGB 1RULH 3M17A 2B39A 4L8CA 2QBWA 5EU4A 3NABL 2W91A 3WO4C 3BPNC 4PRPA 4QHNA 5CEZL 1MCOL 2R2HA 1J8SA 4GXFA 3VFOB 4OQTH 4PJGB 1J88A 2B5IB 1SXCA 2FJFB 2HH0H 1NUGA 3N91A 5JTWA 2P5WE 1ECYA 2N1TE 3BWZA 5C09B 3WFZA 4S10A 1KYFA 1Q1PA 5F9WB 1VLXA 3D3VE 4NQSA 1QR1A 4G5ZH 4IMKA 3MRGA 1A14H 4L8SA 5JQ6L 4IMLB 5HYFA 1Z5LA 2IJ0C 2PYEB 3H3BC 2GJ6D 3EOTL 3Q2LA 3V5DA 5F93C 3OHXA 3ESPA 4PJFE 1UCBH 2RJMA 1T7VA 3SGEH 4BFBD 4PSRA 2K4AA 2AABL 1I7RB 3WJLC 2BXZA 1F5WA 1IE4A 2OP4L 4X5WB 5CKGA 1QFUH 3WXWL 5CJQH 4B5EA 1T04B 3GSQA 4R7DA 1A5FL 1A7NL 3DK2A 1K8IB 3FB5A 4W4OA 3X3GL 3HZVA 4RAVA 2EIEA 3IKCA 2I9LA 2Q7YA 3FN0H 5DXWA 3VFGH 2FR4A 2NT0A 2ZP8A 2R0ZL 4WI3A 5C9JB 4NZTH 4XWGL 2OYMA 3R19A 1XAUA 5AEAA 3CVDA 1Q9KA 5GZOD 1QFWL 1BQKA 3V4PB 3D0LA 1ID5I 1P5UC 5I2IB 3PL6C 2WQRA 4Z8FL 4Y2DD 2DLIA 3V10A 1HL9A 2HJFB 3MJ9H 1K3IA 1LO5B 3H42L 3F8UB 3FJTA 4M7ZB 3BYYA 1AQKH 3OAUL 2PABA 4JK0D 3LZLA 3ZYIA 3CFEB 4YFEA 3B2PA 3KMDA 4HJEA 3QQXA 5DUJA 4X4ZA 5A2KH 1OCZB 1B0GB 1DANT 5F9OL 4D9QD 3S35L 3GMQB 5DYOA 2XG5B 2K7QA 4U6XB 1IGFL 2CKBL 1RVFH 4WNJA 4K3EL 4GAAA 3Q1SL 5D96C 1AO7E 2BY3A 3W9DB 1WZMA 4OSUH 4M7JH 5F88B 4GW5B 4A2MA 1FRGL 4KJYA 4GI9A 5IWLA 4XOEA 3W39B 3S88H 2QV2A 3CFEA 5FUZL 1JWMB 3F7VB 1WZKA 1EO5A 3LKPA 5EBMA 4Y4KD 2WQSA 3EBGA 1FCCA 1IZKA 3FCSA 2R39A 3IKKA 2K45A 3NJMA 3NSFA 4ZFZB 4PJEA 4LASL 2ITCA 1F02I 5E1AB 4HSQA 2WBJC 3MXVL 2XC8A 1ZMYA 1DQQA 1PZ2A 3MUUA 5SWZB 4XHQA 2OV0A 3BLBA 4H13C 4XCFL 4OLZH 3BJ91 1FNFA 4PY8I 4C4UA 5I1IH 1NL0H 1F13A 3ILEA 3MV8A 4FNUA 4N6QA 3D0VB 5LQBH 5EG6C 4JPVL 4XCCL 3HAEA 4KY1H 1HDMB 2GBUA 2R27A 3Q5TA 4AJ0A 4M8RA 1OSEA 1UXSA 2VSDA 2Q10A 2X70B 1T80A 2Y07H 3QAZB 2AZAA 4YHZL 1SMAA 5CD5C 3MRFB 3QH3B 1Q72H 2NQCA 2QQLL 3FSOA 4OZFA 4A68A 1CGWA 3PHOB 2IANE 2E4FA 2X1OA 2A9NL 5EF3A 1B4TA 2ADJA 4JE0A 4U7MA 4XHJC 3VA6A 1A6ZB 1H6FA 1G7HB 1PU0A 3BKJL 2OSLB 3IETB 5CJOH 3VGGA 3TEYA 2ZX5A 1AHWC 3IE9A 4KRNA 4MSWA 2EEDA 2Z91B 4F7KA 2FATH 1HHHB 1XR9A 4OLWH 3REVB 4W70A 1BXAA 2ED9A 4NM8L 4PJAF 3UP6A 3IMVA 3OZ9H 1ZLWK 1MI5E 1LDPH 2VDOH 4G8IB 3HKFA 3GD1C 4V1DB 2BSEA 4JRXA 2WYZA 4WVRA 2AAAA 3MLUH 4DP8X 4GW4A 3JVGA 1KENH 4Y5VA 2WLHA 1P4IH 4DP9X 1I4FA 5EO0A 3BN9D 3N1MC 1IM3D 1PLBA 1QYGL 3LPWA 5DZVA 1DVFA 3DHJA 2F54E 2CE6A 3FH8A 4HK0A 3D50A 2EIZB 4WWPA 3U7WH 2ICEB 1IC5H 3IJEB 3DIFA 3IPEA 4G72B 1AHWA 5HGDA 2ZAHA 3GKWH 4O58H 1KJ3L 1SY6H 3W81A 5TE7H 3UZQA 4JDTH 3TJEL 3H7LA 4GSQA 3N5AA 4MHHI 3SPJA 1TCRB 5JHAA 4ODBD 4GQ9L 4ERSL 4GIAA 3CDZB 4R90H 1ZKAA 2Y07L 1IBHA 2VLRA 4TS6A 3SCMC 1YY9D 1WFJA 1UWEL 4BH7A 2YPLA 1UD3A 3CMOH 5EUOA 5FUOH 1HE7A 2DS4A 1F8TL 1DBJL 2NY3D 2BSSB 5T3ZE 3CHQA 2X2IA 3LQAH 4YLQT 5CMAA 3OAZH 1P7QD 4K07A 1L6PA 1F4XH 4LAJH 1QW8A 2EH8L 2P3YA 4ZTOL 1IEAB 2X38A 3BXNA 3EOBB 3LRKA 2OA9A 5H94A 2A83A 2NNFA 1DJSA 4HT1L 3GJFB 5HHVL 3KYKH 1Z32X 3HKZA 1UURA 2FUTA 3O2WL 5C6TH 5IHWA 2AMUA 2ZUSA 3HMXL 4PJBF 1AGDA 2CAKA 3CPLB 4GRLA 1YA5A 4PJXA 5DUPL 2R1YB 1VCBC 2BWIA 2ERJC 5EEVA 4OCWL 4PJHB 2WO3B 4IS6B 4KJQC 4OCMC 4BUGA 4FJZA 1S3KL 5DK2A 1M7IA 1SJMA 1IC7L 4Z7QE 2BIPA 3U9PL 3G3LA 1MCEA 3JWOL 3CZFA 1UA7A 2MCAA 4Z7OB 3ULAB 1T03H 4OFKA 1Z3GL 5DS2A 1T7XA 2A83B 2F5AH 3VUAA 1XB3A 1BVNT 4JL1A 4KROC 3U0TA 3F7QA 4D8OA 1IFHH 3MFGB 1IGIL 3H6AA 1MLBA 3NSCA 4L8CB 4XP4H 5KYXB 4W6WB 2FNBA 2Z0BA 5I17B 1O7SA 1FFOB 3AC0A 5KJRL 1U8PA 1GYAA 2NYZA 1T83A 4LFHD 1RZFL 5KOMC 2GJJA 4IBWA 2GVYA 5F7EL 2X9XA 4DZBA 2R29L 2YEZB 5LBSH 3NIDE 5IEHA 3B9AA 3V9CA 1U3HA 4GUPA 1AP2A 1VFAB 4AW7A 2F5BL 2H2SD 1B2WH 3QIBD 4K7FB 4ZFZA 3RWJB 3KPPB 3DX7A 4R5XA 1EMTH 3EFOB 4YFLI 3HPJB 3KYNB 2WP3O 4BK4A 3DRQB 5I5MA 3CHOA 1GHFH 1V27A 3QSKB 4XGZA 4B50A 4JGUA 3KPLB 5CEYB 4OZ4B 3Q2CA 3GTTA 4WUUE 2EIZA 2WZ5A 3BP4B 3K1DA 4XAKD 4MJIA 1KC5L 3US0A 1UFGA 2BNRA 2YGOA 4PHXA 1UA3A 5B1AB 5HI3D 1A7OH 3HJ0A 1H0DB 4WHCA 3RX5A 1JF6A 2F74A 2ZSWB 3OKOA 4WGVB 1KB9J 5HGHA 3VSQA 4FFYH 4TQ8A 2P44B 2VWEC 5SWZE 1HHKA 1IJNA 1BJ1J 4PGDA 3WTTA 4HUMB 3GSXA 4QAWA 1A47A 2GTWA 5ID1B 2HT2D 3QB7C 2WLLA 4GLRH 4B9GA 4JPIA 1NCAH 1JGEB 4K3DH 5K9KA 3S37X 3DOIA 4LBEA 1R5WB 4G8FB 3OF6D 1WBZB 3FOLA 1E28A 3HZ3A 4OGXH 3TNNA 3ZO0A 3QRFM 3JTTA 4U1IB 1UB6B 4AEHH 4WUUB 4CVXA 2PWFA 3NDYE 4HGWA 5C0AE 3ROOA 4NKDB 3K5RA 5DUBB 2B2XH 3TPUA 3FTYA 4TF4A 5HHXH 2L04A 2EO9A 1F1AA 4HH8A 2YMXL 1SEQL 1PNDA 1KBGH 4G5AA 2IO5A 1J18A 4AK1A 1I3GL 3CUPB 3O3AB 4WU7B 1U8JA 5A2LH 4CA4A 2ZNXA 1BD2D 3T4AA 5ICUA 1RMFH 3EJZD 3BZEA 4R7NA 1E6OL 1HK6A 5AW8B 1ILSA 2KI6A 1L9QA 5D7LE 2X3AA 4G6JH 3JT0A 4NLAA 3QR0A 3LHPH 2QZ5A 4FKHA 4RGND 4ICXA 4LPVA 4PWIA 3DXAA 3TN0A 2P7TA 1LD9B 3LKNB 5E9DD 1NCDL 3IWVA 5C0AB 4E9LA 3NJIA 2UUDK 2FT6A 4Z7WB 3B3BA 3G7TA 5D5MB 2E7HA 4E42A 3WIHA 1I1CA 2ZYSA 2KPWA 1KLGB 4G9DA 2NY7H 4OQTA 1YEGH 3UTPD 2C4XA 3WV0A 3OTTA 1KGIA 5DEFA 5DD0L 2D0FA 2WZPA 3GJFH 5GJTH 3F58L 3NPSC 1JUFA 2VDMB 4JFOB 2BVQB 4UTAH 5FM4A 3ZJAA 2H6PB 4JFFE 1NCWL 1LDSA 3FQTA 3VGEA 1SBSH 1UEMA 2EE0A 2NUPB 1WBYA 2KZ1B 1AD0B 2YIHA 1KULA 1UYWL 3O11A 3PABB 4HCFA 3IDNA 5I1GH 4KNQA 3C6LB 2DBLL 5HVHB 4FKEA 1RUAH 5BRZE 4NO0B 4HIQA 5E8PA 3SDXF 1W0VB 2QSVA 4GFTB 4O2FA 1D5IL 1RLBA 5EN2A 1E67A 4XRCB 1USQA 4PGJA 2XVBA 1VPOH 1J86A 5JIHA 4MXWL 1VHPA 2KS0A 3DRTB 3MGTA 4UZSA 1J5OL 2F8IA 6CGTA 4HETA 1YNTA 1PLGL 1X5XA 3NCWA 3KLQA 1ZLEA 1SHMA 2AKRB 4HJGB 3V0IA 5FUOL 1GZQA 2VYRE 1A3RL 3MRHB 3FO0L 3MNMA 1LO0H 1A7RL 4D7PA 1N6QL 4J7RA 3SCMD 2CHDA 2PXYD 4HJSA 5J9PA 4GXVH 4IBUA 1SLVA 4FQQB 4Y4KA 1CT8A 2E3VA 2Z65C 2MNJB 2YD6A 4LPXA 5TE4H 5FOBB 5HGGS 3QXTA 3PWPB 4JPWL 4KV5E 5DVLA 2AQRA 1ZK9A 5LCVA 4DF9A 3AADB 1AOZA 4KROD 1MF2H 2B1HH 5KS9E 1E9QB 4ZW8A 4OIAA 4AYSA 3PAVA 1JWSB 1QSZA 5D2NB 4X6CB 4NT6B 3SJVD 5L2JB 2FJHB 3T1WA 3J7HA 2KUTA 3V6BR 1KGXA 2H8PB 3DHUA 5EBMB 2G2PA 3QPQC 2E9WA 1IJ9A 2IBZY 3B3IA 3OXRA 4OW6A 3ZKMD 5JPMC 2H32B 1B9KA 3LIUA 1FE8H 4N0CD 2I5YL 2UWEE 4O4YL 1ZLUH 5HYEA 3D4CA 1C7SA 1JD9A 1SXNA 3RA7H 3KZ8A 4C4KO 4Z7VE 4N86A 4I89A 3WNJA 2P5ED 1OB1A 3ULUC 3LYRA 2A0LD 1YMMB 3N04A 3QEQE 3RWFA 5GSRB 4UZGA 2A4EA 3D9AH 3FBQA 4OZIE 1RK0B 2AFNA 2ATPB 1EAOA 3VWKC 5MHSD 2NUTB 3VW3L 2AJ3A 5GSVA 5DJ6B 4XX5A 1K8DB 1ZS8A 1JPSL 2BP0A 2J55A 1O6SB 3NG5A 4WKXA 2H5UA 2PPAA 4HAGA 5I82A 1S9YB 3IS0X 1TQCC 4LVNB 2FO1A 2AQ1A 4C83A 2I60L 1FL6A 2IADA 2IVFC 4KK8D 4WEUD 2VZOA 4MA7H 2GHWB 5FGRA 2XV0A 2ADFH 2Z4TA 5AYUH 4LEXL 3WENA 3P02A 5EUKB 1F58L 2VW4A 1AZUA 1P84K 5KYWA 4ORZC 2YFNA 4WGKA 3FT1A 4XP9H 2VMDA 1QPPA 2VISA 2XVGA 4J6RH 4P48A 2BLFA 3RWDB 3DYOA 1A7QL 1EEQA 2X2UA 2NR6A 3CSYA 5DMKB 2XG4A 3LN4A 1AKJD 4UBDD 5ETUA 4D0BB 3E6HA 4JFVA 4XWGH 1KTRL 3VTAA 4PPTA 1OM9A 3QDJA 2XWJB 4TPRL 1VENA 4GSDL 4G43B 2XFGB 4MS8C 4R2GB 1OB0A 3GSRA 3BIAX 2I07A 2AVFA 1NTDA 2AEOA 4MB3A 5HPMA 2N0MA 2UYLA 5CSGA 4AENA 1SDDB 5JYMA 1LMKA 2ENQA 3RWIB 4JO4H 3W11C 2OJEA 4ONFL 2CHWA 2R23B 1QSFE 2HFFB 1KNOB 4KQ3L 2ESVD 1INDH 1VACB 1UD5A 4YHOL 1DBMH 3MRQB 5JZ7C 2QLVB 2HJKA 3LSOA 3DC0A 2G60L 1WAPA 3C2SA 5CD5D 3CZSA 2HVKB 4MCYB 1M05B 4JN2A 4Q97A 3JT2A 5JHLL 4YO0B 3TGXA 5D4JA 2FBRA 4Z7AA 2BNRB 2HLFC 5HPMB 4NI3A 3PQYB 2BVOA 2PETA 4JHWL 2BP8B 3F01A 5DDHA 5IROA 1U8HA 1LHZA 1KXQE 1BAFL 4WW2A 1OF2B 3GRGA 2RCSL 2O6EA 4MQXD 2EDDA 3FN9A 1NCCH 4N8CH 4L3EB 4OVVA 5DK3A 4GUOA 1XZ0B 3S96B 1WISA 4TSBL 5JHDE 5D1QB 5DMIH 5E23A 1GPOH 3MNZA 1I3UA 4O02A 1XBDA 2WCPA 4JL2A 4FOMA 2O93L 1OGPA 4HCGA 5L7XH 3HI6L 1MY7A 4N85A 1X6NA 4WW1A 5E1IA 5I0XA 1KGWA 4DVRL 1JZ2A 1XAKA 3LH2L 3C75A 2DQDH 4PRHD 4HGMA 2Q8AL 3RGHA 4GH7B 5IFHL 1HXKA 4IRSC 4XXDB 5JMOC 1RD6A 4FA7B 4BUQA 2G0LA 1U2YA 3BVDB 3MODL 1ZHLA 4RIRB 4KRLB 4KUZH 4XX1G 3NH7H 4UM9A 4F5CE 3QBTB 5LO7A 3GB7B 4AIEA 3PAZA 1RUQH 1A1OB 5SV3A 1V54B 3TCLA 1JZIA 4JY4B 1BW8A 4JG0H 4BCZA 1IM9B 1AOHA 3SDAC 4ZD3L 2JCCB 3H9HA 2EDEA 2LU5A 4CC0A 3DOHA 5AZUA 2VL5B 5ISZE 1CLVA 3AU0A 1A6PA 3FUDA 3FSWA 2EJ1A 3KPQA 2AK4B 3FO9B 1JCVA 4UAHA 1DZ0A 4L9LA 1S7SA 4MAYB 4YWGH 3WN5C 4PFEA 2WLJA 4HAFA 1IGJA 2XV3A 2Y7QA 4QY8B 3B5GA 4XC3L 4AH2A 4B9IA 3EOYG 1LK2A 2H2PD 4OJEH 3ULVL 4M1CD 3S34L 5DI8A 1EBAA 1L9OA 3DUUA 4PJ8C 4PJFA 3SHSA 3BWUF 1WD9A 4YLCA 2CIKA 5ISZB 1CGTA 4XO5A 1TZ8A 3IMSA 1EUTA 1YLBB 4WEMB 5HGAB 4FFWD 2GHZA 2NT1A 3RL2A 4MD4B 4AGNA 1Q94B 3QG6A 3TJEH 4MNHA 2K8MA 4ZNEE 3TA3D 4AV5A 3BIKA 2UXGA 4LSRH 4AG4L 4RGOH 3GS4A 2BIOA 3MA9H 5J57B 1T83C 2VABA 1IC5L 2EXWC 3D09A 4Y5XC 5IJKC 1YEGL 1CBVL 5DD5L 4GG6A 4BRVA 2EABA 5CF3A 5ICZA 4P4KA 5CINH 1ZGLP 4L1DA 5KYUA 2OXHA 1U93B 4JDTL 4OJDH 3HOGA 3IJEA 3L5XH 5LNEA 2R8SH 5CCGE 5JORA 5EU6E 1VEPA 3K2UH 3P4MA 4R96B 3VWJB 4WWKA 4RMQA 6FABL 4Y9GA 1SHXA 1F3JB 3G08B 4PYHA 4TVPD 4QHKJ 4LCWB