4M5ZH

Crystal structure of broadly neutralizing antibody 5j8 bound to 2009 pandemic influenza hemagglutinin, ha1 subunit
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
226
structure length
220
Chain Sequence
EVQLVESGPGLVKPSDILSLTCAVSGYSISSNYYWGWIRQPPGKGLEWIGSIYHSGSTYYKPSLESRLGISVDTSKNQFSLKLSFVSAADTAVYYCARHVRSGYPDTAYYFDKWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin HA1 chain
publication title Antibody Recognition of the Pandemic H1N1 Influenza Virus Hemagglutinin Receptor Binding Site.
pubmed doi rcsb
source organism Influenza a virus
total genus 42
structure length 220
sequence length 226
ec nomenclature
pdb deposition date 2013-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m5zH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m5zH01
2GJ6A 2X4OA 3ZTJG 1NGZB 3FO9B 3WO4C 3WUWB 1KN4H 4M7LH 4P57B 3TBWB 5EA0L 4NJ9H 4PJIE 4F3FA 3WUZA 3BJLA 4I3GA 2VC2L 3LZFH 5AZ2L 2I27N 3WHXB 4WI2A 1T2JA 1D6VH 2B5IB 2DLGA 1SBSL 1EO7A 3P3YA 4Z95L 5GRUL 3T2PA 5IHZA 3S34L 4I0CC 1U6AH 1IAIH 5HYJE 5IMMA 2CKNA 2Q6WA 1KJ2H 3ZT6A 1WBZA 1NKOA 5TQ0H 3QI9D 5JPNB 1MFBL 1AHWC 3UZQA 3WFEH 2J5LB 3LQMA 4PJAA 1IL1A 3UROR 5HHQA 4J4PD 3H3PL 1BBJB 4X80L 4KQ3L 5E0QA 5I75C 3TLRA 4AEHH 5AYQA 4YBLB 5JQ6H 1HHHB 5BW7A 5TFSL 1ZLUK 3OKEB 1L6XA 4JKLA 1DCLA 3BXNA 5KSVA 4GKSA 3P9MB 4P2OA 1LO5A 4WJ5B 3WV0A 3OAYH 4QXUH 2G2RB 2JCCB 1WCBB 3LKPB 4H8WH 4Y2OA 1NBVH 5FDWB 1DQMH 4PRHD 2VDQL 4LLUA 3VFOB 5I73B 5CEYA 5E03A 5DMJB 3F7PC 5F70A 4IMLA 2XZAH 4JREC 3QNXB 2L7UA 3BPNC 2G9HA 3HS0A 2XN9B 3P11H 5DF0A 4KDTC 2DQCL 4Z7UB 2GIYA 3U0TA 5ACMA 2GY7B 1QBAA 4OLUL 5FF6B 3WIHH 4NZRH 4LVNC 3HUJA 1AD0B 4OM0H 4PYHA 5IFJB 4ONHA 4CVXB 2X4RB 5D2NB 5ANMB 3V0AC 1J1PL 1IGTA 4NQXA 2EDJA 4NQTA 2XT1B 4QWWD 4U1GB 4F7EB 3MLUH 4CVZB 1ZLWK 4G8FA 3V4PH 3ZZ1A 4YQXL 4Z76B 4RMSA 4HWEH 5DK0A 1U3HB 4D9QD 3GSQB 3E2HC 1LEGB 3VMNA 3TO4D 5DR5H 1HZHH 4O2FA 4F7PA 3K1DA 1M4KA 2BSRB 4OZGE 4J1UA 4WTZG 5D7LA 1KJ3H 5GGTL 1ZTXL 2IF7A 1KXVC 1BD2B 4PRAB 4XPTL 2VDNH 4PREB 3QCTH 4KU1A 3CDCA 4L9LA 2KPNA 5J6GB 4P2QA 2VLRB 4MGXA 3TIDB 1A6VH 2E9IA 5KSAC 1QSFB 1CE6B 1XGRB 2NX5B 3MLPA 1G7JA 2D7OA 2DQJH 3T65B 4IOFC 3IXAB 5T3XL 2A83A 4MXQD 1FFNA 1XR9B 1ZMYA 2AK1H 3HCVA 3HR6A 3MRIB 3VCLB 5I8KH 2E7LC 2AGJH 4NKOB 1TCMA 3KDMB 4KKCC 4DJMA 4DK3A 2YRZA 4WO4C 3PABA 4RAVA 1I8KB 4LEXH 4PPTA 3QXDB 1MAMH 1TCRA 4HJJH 2WINA 1DVFC 4C83B 2MPAH 1CFQB 4P4KD 2RIKA 5DVOA 4EI5D 4JHWH 5KSUB 5FIEA 4Q9RH 3MUY1 5ALCL 4BH7B 3GKZA 4XNXH 1AFVH 3NCJL 5I1AA 3VW3L 5L2KD 2EDNA 1T20A 4NHCH 4PRHE 4RAUB 5HI3D 4L3EB 3X11A 6CGTA 3OHXB 4JM2F 5FO8A 5J56B 2LVEA 3IDGB 3FCTA 4XTRD 5EZJA 2WLZA 3ULUH 4QRQA 3SQBA 1JGLL 2L7JA 4PJXA 1GC1H 2O5ZH 1NGXB 5MEPB 2AXFB 1IEHA 3KLAA 1A47A 4OUOA 4U1IB 3RL2A 4E0RA 3MGTA 3VD9A 1KJMB 3D48R 5JW5A 1NBQA 3PNWB 2DAVA 4XP4H 1W0YT 1F3DJ 4HKJB 3BW9A 3IDMB 4OM1H 4WTZA 2A38A 4KV5E 3W9DB 4YNYB 3LIZL 4UU9A 5IVXE 3TZVB 1JL8A 5T1DH 5GS2H 4OLWL 4D9QE 5CGYD 4U6HA 2VAAA 4U1KA 2H32H 5IEHB 3BWAA 5EA0H 5DJCA 2VL5A 1VKXB 1G1CA 4Y19A 4F7TB 1GXEA 1KCVL 3MV7B 5AZ2H 3VA2C 4ESKA 3GBMH 5DFVD 4CGTA 4M5ZH 3TA3B 5DEZA 3MV01 1KULA 3T4YA 3S34H 4NBXB 3QFJD 3V6BR 35C8L 1ZGLP 4LRNL 5F6IB 4JR9L 3OGCB 1CL7L 1MVUB 1MFBH 1J8HD 4HT1H 3VRJA 2QQKL 4OAWA 4GUPA 3RWIB 4X80H 4HLZH 4L1HA 1N3NB 4KQ3H 5D1ZD 8FABA 2R2HB 1CDGA 2FECI 3UX9B 2PTTB 4GBXC 2P45B 3MRPB 4JY4A 4PLOB 5TFSH 3OQ3B 3ARBD 5KANG 4OZFH 4ZUTA 4GRWF 2WBWB 3FJTA 5IV2B 5C0JA 4Y89A 4RZCA 1ZHLB 2D0GA 3ZDXF 2EXYC 5AAMA 3IVKB 3HZYB 1ORSA 1OTSD 3PV6B 4XCYB 2Z9TA 4PS4L 5I18L 2VDQH 4G8GD 4D0BA 4LPXA 4P2YA 1PYWB 5GS0C 1AJ7L 3C8KB 2Z91A 3EYVA 1INDL 5SX5K 5I6XC 3TNMB 1QO3A 3IETA 1M7IB 3NFNB 2DQCH 3RGHA 3RBGA 4RGMC 1FSKB 4UAOB 4XCEA 3QAZC 3ZE2F 4K94L 5BOPA 4XWOD 3UTZA 5MHSD 4DW2H 5MEND 1NCDL 3MNWA 2JF1A 2QSTA 1IGIL 4JHAL 43CAB 4R96A 1AGFA 3D3VB 2VERN 3VXSE 1MCFA 3C6LB 3IGAA 1MPAL 3QIBC 2OJZL 5GZOC 4Z5RA 3ULVH 4YZFE 5SWZD 2MHAB 2P5EB 4LU5L 5GGTH 5DHVB 2V7HB 1ZTXH 1QQDA 2DQFB 2YBRA 4EQ2A 2OYPA 2BY1A 4RAHA 2NY6D 3KPMB 3NH7H 2R56L 3NPSB 4P5TB 1JN6B 1JHTA 1OWWA 4ENEC 3ARGC 5DMKB 1JE6A 4F80A 1P2CB 2JB5L 2P8PA 1UQSB 1RJYA 1OY3B 4HS8H 4KKLD 2OR7A 4M6AA 4AEIL 3VDAA 5BJTB 1NCCH 3I6KA 3GO1L 3QFJE 1L7TL 4KMQA 2ARJA 5INDB 1R5VB 1HEZB 4KK6D 3RP1A 1QHOA 4HZLB 4PTTA 4UB0L 1T1WA 1J8HE 3K46A 4FNLL 5CMAA 1Y18B 2R29H 3NFPA 4OF3A 5ERWB 5H8DA 5CZVL 1U42A 3QUXB 2AV1A 4APQC 1MLBB 1YPZB 5IBLC 3OAZH 1BBDL 3WLBA 1S5HA 4JRXB 4G7YH 1A14H 2R4SL 4Y4KA 4JFDA 1ZKAA 4EDWL 3IDXL 3RPIB 3CDYA 5ALCH 5B3JE 1XIWB 5DJYB 4XAWH 4G8EA 1INQB 2R1YA 4HK0A 3VW3H 3QUYC 4KVCH 4MS8D 4X6BB 3MUGA 2BNRB 5JDSB 1HINL 2FWOB 4CADA 1S9XA 1NSNL 4MSWA 3X13A 4GW5A 5F72S 3LVEA 3EYUL 3VFVB 3VXTB 3QDJD 4NNXB 3HI5L 3O45A 3L3JB 3N06B 5I76B 4QOKA 3RUGE 1S7WB 3N85H 3VWKA 5FGBC 1C12A 1JGLH 1KBGL 3ZDYF 4F58L 1GH7A 1CLOL 4XI5D 1Y0LB 3DO7A 1WWAX 1ZHKA 5MHSE 2C3WA 4IDLA 1OAUL 4M6OL 3TGXA 2VLJA 1GAFL 4EXPX 2ITDB 3U36B 4MNHB 3Q3GB 2PYFB 5B8CB 4PD4K 1KB9K 1ADQH 4G6JL 3DV6B 3DJ9A 1LP9F 1E4XI 5F3HA 3DVGB 3A6BL 3GSRA 4W6YB 1EEYA 1YQ2A 2PYEA 3GGWA 1I1AD 1HXMA 5CFHA 2AJXH 2D4FA 1KCVH 3VGAC 4S1RL 1A7PH 1F11B 5DJ8B 5D5MA 2GSGA 3LHPL 2Y07L 5CWSB 4GLRH 4YIQA 4JDVB 5AUMB 2XY1A 3QUZA 4HGWB 2GI7A 3IF1A 4AY0A 1CQKA 1VFUA 5T1MB 3WS3A 1TETL 3ALWA 3UBXI 3BI9X 1CL7H 5E8PA 4NN6B 1KPUB 1EFXA 3C5ZC 1IEAA 5D9SA 3U6RA 5EIIA 2Y5TB 3VFWB 4MZ3A 2VLKD 5EUOF 4GAJL 3EZ8A 3QIUB 3T1FB 5CEXA 4BKLB 3QO0B 4PJ5D 5JXED 1D3CA 3O4LA 1I8LC 3QEQE 1J1OL 4FHBD 1OW0A 4CU6A 3LPWA 1Z5LB 3BP6A 3MRRA 5KVEL 3SGDH 4QRTB 1GCFA 5D4QA 1CU4L 5DD5L 3WS6A 2VLLB 2XIDA 2XXCB 1BPVA 4PS4H 4YWGL 1V5JA 5I18H 3FO1B 1ZLUH 3LEXA 1B2WL 1UM6L 3MV9A 1AJ7H 1I4FA 4NFCA 1INDH 3ARDA 1JWUB 4K8RD 4P23C 4JLRB 1X5AA 5DJDA 4MNQB 5HYFA 1EEZA 1TZHB 4QO1A 2E7HA 2A6KA 4K94H 4NJAL 5TE6L 1UB5A 1MCKA 4LSDA 3ULUD 1NCDH 1WICA 5CEZL 1YYML 3DURB 2HKHH 3L7FA 4JHAH 3VRIB 4NN7B 1CXKA 4D8PA 5EWIL 1N7MH 3PJSB 1AP2A 5EU6A 3FZUC 3RIAK 3SCMA 5IG7B 2JELL 4P59L 2W38A 4QRSA 4Q9CA 3ILQC 5K9KB 3CFIC 4HUKB 4FG6D 3QH3A 4NNPH 4YLQT 4LU5H 4AJ0A 1XGQA 5GS2D 1AHWA 2Q7NA 1S9YA 4S1SL 1BFOB 1E4JA 3OF6D 2R56H 3ZE0E 4TUOA 3MMEA 4DZBA 5E8DL 4XP9H 5LJYH 1A64A 3MR9A 1Z3GL 3IFNL 4AT6B 1G7PA 4AEIH 3MA9H 5GGRY 3S6CA 2DQEL 3U83A 1I1FB 5ETUA 3VFPA 3HG1B 2P5WA 1B0GB 1ZT7A 4RX4A 4XP5L 3T2NL 2NYYC 4OCWL 1S9VB 4OKVB 4GG6A 4UB0H 4QRPB 3SDXA 5I17A 4FNLH 1MCLA 3MRBB 4FTVB 4NCC2 5AD0B 1RJZB 3I75A 4X7CC 2VLKE 3FAWA 4PBXA 5IW6A 1BBDH 5DRWA 1CGXA 3RWHA 4I48B 5CJ5A 4N0CD 1EVTC 5I1HL 1PX4A 2AI0L 2VDRL 3VMOA 4EDWH 3B8YA 3IDXH 4I4WA 1CXHA 2NY5C 3MBED 3CFBA 25C8L 5GISL 4X6EB 2VQ1B 3WNKA 4R7DA 4Y4FB 3MSPA 1SVCP 2R39A 4L3AA 1ZGLB 4WV1C 1HINH 1T3FB 5BRZB 2EC8A 1W0WA 4HIJA 5CJXC 2DQGH 4Y2DB 4FXKB 1KFAL 1BIIA 1QLRA 3MQIA 2HT3C 4UTBL 5IVXF 4ELKB 4JQXA 5C6WH 1YEKL 4NQDD 3V5KA 4PGCB 2EDHA 3T4AB 4U1LA 4BFIA 2H8PA 4UDUB 4RA0C 1KBGH 3CMGA 4JCMA 3RFZC 3DROA 4M5YL 1UYWH 4M8QA 2X4UB 4O00A 5MEQB 1CLOH 5EN2B 3ULUE 4W6XB 1OAUH 2EYRB 2YRPA 3CLEL 1IAKB 1XZ0B 5DHVH 4PLKC 2VITA 4HUXA 4URTB 2WUBL 4ZPTA 3PHSA 4XB7A 3MNZA 4I0KA 4PP2B 5KSAA 1JGEB 3UO1L 2EIEA 1GAFH 1JBJA 2HVJB 1T21A 5SX4H 1UA6H 2R4RL 3PG2A 1DN0B 4LKCB 1T66C 3DUUA 1KIQA 4NZDA 3VWJB 3WN5B 4AK1A 3MREA 4CBPA 1W8NA 4PJBF 3L7EB 3OB8A 3C8DA 3V6FB 2ORBL 3DV4B 2YK1L 3ULVD 4QHNA 3SGJC 5A16A 3LD8C 2I5YL 4KMLB 4EUPG 5K59F 1HILA 3DGCR 3LAFA 2VO5A 4JEGB 4Z7WF 4S1RH 1C16A 4LOUC 1EEQA 1ZK9A 2D3VA 1DVFA 3G9AB 1MI5A 1MAKA 1OP5K 5EUKA 3H9SB 1NBYA 3GSNA 5E56A 2JIXB 3C6SA 4KTYA 1TETH 4JQIL 3OR7B 2BVPA 4XXDB 3GMNB 4RISL 2RJMA 2VZSA 3PQYE 1BQLL 4GAJH 4PRBB 4KJWD 4F9PC 2XFXA 3BUYB 3OKDB 4X9FA 5IMLA 1C5BL 1H8NA 5GRJL 1HI6B 2CO7B 4ZO7A 4HF5L 3I85A 4BH8B 4YJZL 2PR4H 3TIEB 5GGUB 4H8WC 1A6ZB 4RFEB 1CQYA 1WWCA 2Y1VA 1GVIA 1AD9A 2NW2A 4Z9KB 4M48H 2JJWA 4ZD3L 1CU4H 3MACH 5IHBA 1U8HB 1NJ9B 2H3NB 5D6DC 2YEZA 4W70A 5C0FA 3BEWA 4P3WA 2R9HD 4R4ND 2XN9D 2YKLL 4DEPB 3MYZA 4PJIA 1Q1JL 5E99H 4U0RC 3SDAD 3CMOH 2EKSB 4JDTL 3VJ6A 2UVEA 1B2WH 1UM6H 4YXKL 1XMWA 1DBBL 3IRPX 3ET9F 3L3HA 3O2DA 3DRTA 4KTEL 3VXOB 4NQDE 3BP4A 2R2BB 1Q9LA 5TE6H 1XCQA 3GSWB 3ZYZA 1T22A 5HYJA 4ZS6C 4YGVB 5TE7L 1TVDA 2F58L 3N1FC 3EJYD 1A9BA 5HVHC 1GIGL 4RGNB 2BHUA 4Y5VB 2OR9H 2CK0H 5HHNB 5SX5H 3ZT5A 4P46D 1K4CA 1U2HA 3JVGA 5C0ND 3K4ZA 1XAUA 3F65A 3O0RH 3T8XB 3DWTA 3HA0A 3QDGB 4KJQD 2Y72A 4HWZA 5EWIH 4UILL 3PE9A 3V5HB 2CR3A 5TF1L 1CGWA 1HHIB 4ODVL 3MXVL 2D0HA 4P59H 4G80B 4Z0XA 4LLQA 3OKMA 1NCAH 3CX5J 5DA4A 2VLRD 3DMMC 5IF0B 2FHFA 2ZUUA 4OIBA 1QSFD 4GG8A 2NX5D 3WXWL 4S1SH 2R1WB 2XZZA 4I13B 5DVLA 3L3KA 1IGJA 3ULVE 5I0DA 2FSEA 1DLHB 3T0AA 3RWCA 2FEEI 5C09D 1Z3GH 3IFNH 5DRXB 2HN7B 2VABB 4P2RA 3S3PA 2V2WA 1A6WL 2Z92A 2DQEH 3Q6FB 1J12A 5B39G 1J5OL 5DFWH 1GRWA 3T2NH 4MJ5B 4OCWH 4YAQA 4JVPA 4DUXA 1ZHBA 3UYOD 2PW1B 5ADPH 2X89A 3L95A 5EO9A 3SE9H 2JLLA 1BLNA 5I1HH 2AI0H 4LPTA 4U7SA 2ADIB 4ELMF 2JCCE 3PWNA 2V7NA 2QLVB 4DGYL 4EN3B 5GISH 1NANH 3BP7A 4G9FB 5F1IA 1XF2B 4L3ED 1M7XA 4OZGA 5ELIA 1MFAL 2Y6SD 2Y25A 4GW4A 3MBXL 3IJSB 5IJVB 2XN9E 2HJLB 1KFAH 1D5MB 1GC1C 4LCUA 4Z7UE 5C7XL 1YEKH 1UCBH 1TVBB 2AS5M 1SHMA 1U8QA 2BVQA 5CHNB 2C3VB 4M5YH 3ZLQC 1OD7A 1AE6H 5D2NE 4AM0A 5ANME 2X9WA 4DVBB 1U93B 3H9YA 4FG6C 3TFKC 1OP9A 3KJ6L 4TPRL 1W72B 3QI9A 3TZVD 2ADJA 4X83A 3P4LA 3HI6L 1NFIB 4U6TA 2MCG1 2CDFA 4J4PA 3FT3B 4LPVA 4XMLL 3BIKA 1T5XB 2OL3A 2R4RH 2X7LB 3WEXB 3HRZB 1BWMA 3BAEH 4BQ8A 5JZ7D 1BD2E 2J12B 5FFLA 3MV7D 4IOSD 4NO5A 3BDYL 1G7LB 4I3SL 4NZJA 1INEH 2YUXA 2VLRE 2YK1H 3BZEA 3DX9B 3D39B 3TA3D 4XBPA 1QSFE 2I5YH 5GPRA 1L9NA 2NX5E 5B39A 3D25B 1RQ5A 1EUTA 5ISZB 1BREA 4PRHA 2NY2C 4TNVF 4CMHC 3DHMA 4G43A 1TQBB 5TDPA 1RUKH 3NOIA 1K85A 2AEWA 1RK1A 3CVIH 4N0CC 5EB9A 4RMVA 3QG6B 4R7NA 3UTPD 1MCOH 3DX6B 2OXGA 1YN6B 2YPKA 1ACYL 5FKPB 5IWLC 1QKZL 1BQLH 3MRDB 5J11C 3BYTA 4HWBL 1CTOA 3E8UL 3TBVB 4WUKH 5D6CB 3PL6C 1DANT 5J1AB 1QR1A 5T5NF 4CN1A 2NZ9C 3CFCH 2E9WA 2VQUA 2XTJB 3BH8A 1A0QL 3BKYL 1R3LB 5IVXA 1DBJL 2AW2A 2C7UB 5D2LB 2ZOLB 5IB4A 3K8LA 1WIOA 3QUMB 1P4IL 2V5RA 1IT9L 4HG4J 1F4HA 3HTLX 4L3EE 3UDWA 2YKLH 1QNZL 1Q1JH 1UFUA 4IRZL 4JDTH 4CVUA 3HI1A 5LGKA 3OB0K 1SY6L 2EDYA 5ESAB 2DMCA 4YXKH 2VZVA 2DKMA 4QY8B 1DBBH 2DIAA 4WI5A 2CRZA 4KTEH 3CFDB 3ZHKA 3KPNA 3BDBA 4ZFZB 5ID1A 1MJ8H 3MRCB 4BM7A 5TE7H 4LK4A 4LQFH 4MQXD 2F58H 2ARWA 4MD5A 1SJHB 3DYMA 2HMIC 3OKNA 3RPKA 4UQ2B 3RHWK 3D3VD 1ITBB 3DX8A 3HHRB 3C6LD 1FV1B 3P2TA 5F9WB 5I2IA 1RZJH 2AEPL 4F7CB 1QBML 4UILH 5TF1H 4NOFA 2P5ED 4IRSB 3MXVH 4HUWA 4PY7A 5EO1A 1H15B 1OAQH 4U1HB 1ZHNA 4C57C 4KY1L 4P4KA 4DCQA 2J5LC 4P5TD 5CINL 1FFOA 2DQTL 3C5ZA 3MV7E 2WV3A 5IW3A 3UTOA 4OFYA 3SKMB 1IZKA 1U58A 4ZYKA 1PSKH 6FABH 2WUCL 3V4UL 1HQRB 4RRPG 3T04D 1IC7L 3T0WA 3TBYB 4QNPE 2A73B 4M3JA 1X4ZA 1R5IB 4N0UA 4YBLC 4KJWC 1AGBB 3BE1H 3ARFB 1I8LA 4FQLL 3TV3L 2ZCLL 3MJ8A 4JPIB 4L8DB 5DQ9A 3F6IA 5F3BB 1IC1A 3CK0H 5FUOL 5GGQL 2MSPA 2D9QB 3WFHA 4GKZA 1S7RB 4JRXD 3ROOB 5JNYA 4ORZC 3QUML 3V6ZA 4ZAKD 3ZT7A 1ZS8A 3NN8A 5H94A 4R4NC 5HD8C 4F37K 1OF2B 5DD0H 4MD4B 3RZCB 5FYKU 1KPRB 5HGBB 1YEGH 1RMFH 4H1LG 1X4XA 1LO3L 5I74C 4DUWA 1SJEB 3WD5L 4BUHA 4ZMAT 5J6HA 1UXWB 4ZQKA 5J9PB 1I1CA 2FHCA 3JWNC 5IM7B 5D2NC 2GTWB 3Q48A 1PQZB 5EH1A 4B50A 2HTKD 4FFYL 4PJ9B 1MFAH 1BQUA 1JHLL 1F58H 3KPSB 3EO0A 5HGDB 1H3PH 4U6VH 3SJVB 5ICYB 3MBXH 4GMSL 4U1GC 4K3GA 5HGHA 1EO8L 3TH3T 1PVHA 5H2BB 3B9DA 3GRWL 1Q0XL 4LFHD 5C7XH 2W65A 1U3HC 5AG9A 2J6EL 4FXGB 4UT7L 1JF6A 5H35A 5JW4R 3PWPE 4CJ0A 5MEOB 2Y36L 1A7QL 2PXYB 3OXSB 3QFJA 3WIIH 4WEUD 1RZKL 4OSUL 5DUBB 1LE5A 4MXWL 3C9NB 2DMKA 2GK2A 3KJ6H 4GAFB 5K93A 5GJSH 3P4OA 1J8HA 4KROB 1LD9A 2YD4A 3GMMA 3B43A 4X6FB 4JPWL 4XMLH 2IH3A 3V8OA 2BVOA 1T7VA 1NC4B 4X7EC 1PY4A 1W8OA 2P5EE 3AREB 4NRZB 4PJDF 2ATPB 4OV6F 4RRPA 4O2CA 3EYFA 3L5XH 1AXSB 3BDYH 4I3SH 1WLHA 3MRHA 1VHPA 3JWOL 1SYSB 4LSVL 4AENA 4KK5D 2QQQA 4IBLT 2DWDA 3UTSB 1H5BB 1R24A 1FAIL 3O8XC 1BQHG 4MQ7A 1IQWL 3MRKA 4I0PB 3PGDB 3JTTB 4KZEL 3K3QA 3T0BA 2JB6A 3N50A 2FD6L 1NQBA 3RUGA 4L4JA 3EFFB 1U92B 4X98A 1IARB 3BKCL 4J8RB 4OB5L 43C9B 4N5ED 3C5SA 4YHLL 1KG0A 1ACYH 4QHUA 3RTQC 3QIUD 4D3CL 1FYTB 1QKZH 4H1LA 1RPQA 1K3ZA 1YPZE 2HJKA 1A3LL 2VUOA 4HWBH 4JN2A 4OLYL 4WV1A 3E8UH 1BEYH 4HFWB 4OD2B 5CJXA 5F89A 1WBXA 5HJ3A 1A0QH 1YUHB 5HI4D 1J0ZA 1MCBA 5DXWA 1DBJH 5J13B 4NP4H 2VE6A 4ONOA 4RWYH 1MOEA 1KT2B 4MVBD 1IT9H 2BNRE 3SGEI 3MLYH 2ICWI 4M7KL 4OLZL 1MCSA 2DLFL 4IRZH 4YBQD 1HKLH 4FABL 5D93B 4K94C 4CJ1A 3MCLL 2AXHA 1W72H 2H2PC 2MCPL 3SY0B 4KRMB 4WEBL 1UWEH 5KW9H 2Z93B 2WQ8A 2H2SD 2W91A 3IKCA 4GRMA 3AS2A 4I2XB 2VLMD 1OAXH 4XMKL 1JPFB 2IADB 4QRUA 3TCXA 1XF4B 3FTGB 5T3ZH 4XHJD 2A74A 4Q97A 3SGJA 4K3EL 2AEPH 3U1SL 3G08A 3FQUB 1QBMH 3P40A 4MXVE 1KTKE 2VZ1A 4NUJB 1GL4B 4DTGL 3QJHB 1KJ2A 4D0DB 3SDCB 2DICA 1JNLL 3AAZA 4QCIB 1G6VK 2EICA 3QEQA 1KLUA 4FXLA 1VGKA 4KY1H 3QXAA 4BQBA 5EPMB 5I1GL 1BQHA 1XGUB 3UTTB 2DQTH 4I1NB 3F58H 5C0GA 4XNQB 3T0DA 3MRGB 1TJHL 3V4UH 3AS1A 4F9PA 1R5WA 5DRNB 5EZLA 2NTFA 4ODWB 4Z0BH 3HG1D 1SYVB 1SBBA 2CR6A 4WNQB 4XVTL 3B9KD 3STBA 4ZFGL 4FQLH 1QRNB 2ZCLH 1MREL 3V7AE 4Q6IB 4NO3B 4QRPD 3W5NA 3V0WL 3FN0H 4FTVD 1R3KA 5FUOH 4W4OC 5GGQH 1CVSC 2FIRT 5D6DA 1CGSL 4AYFA 1P4LA 1FIGL 4QKXB 5GS3A 3C08L 3ECBA 2R2EA 1FN4A 3QUMH 1VADA 4LDOB 1UADC 5FOBB 3H7LA 4JFQA 2OMNA 1NBZB 4TVPL 2OZ4L 4XGZA 1S9WB 1N59A 5TH2A 3IAQA 3WIHA 1LO3H 1FSKC 4X8JB 4XX1E 3NCMA 2ATKB 4NM4H 3D0LB 3OTTA 3O3BA 4JY6B 5D1QB 3MLRL 1W0VA 1NH6A 4WU7A 4HCRL 4GAGL 2RHEA 4M9OA 4FFYH 4Y2DD 1JHLH 1Q8MA 5IBTL 4GMSH 5E9DB 1SVZA 3U2SB 3C6LC 3LB6C 3S4SB 5CBAA 1I1AA 4U1JA 1F3JA 3BEVB 1KCKA 3RVTC 5C9KA 1Q0XH 4MNQE 2J6EH 4UT7H 1NC2B 1NUDA 3C8HA 4RSVA 4PLNC 3G5XB 4AQOA 1A7QH 2VLME 4OSUH 5D7IF 4U2YA 3KHQA 1T4KA 4J7RA 1HCVA 5E95B 4GW1B 3REVA 2NXZB 4XXCC 4ODTL 4P5TC 4IOIA 1K2DA 5F7EL 2CLZB 1AGCA 1U8MB 1UXSB 3NVQA 1LEKA 2I07B 2VLKA 3VWJD 3LQAH 4OCLC 2R1XA 3LKRA 1CICB 3TN0D 1RAMA 5F71A 5DQJA 5JXEA 2ID5A 3IJYA 5EBMB 1AC6A 3LN5A 2EXWC 4DN3L 4PFEA 1MHCA 1C08B 3GMQB 4HX1B 2MQ0A 1G9EA 1YYLH 3JWOH 5K9JL 2IPKB 3QUXC 5E6YA 3H6JA 5DJAB 4F57H 1LK2B 4FQQA 5KVFL 5HHPB 3FQXB 1FAIH 3H9SD 1JGDA 2JIXD 2XYCA 5HTSA 3O3UN 1K6QL 2A9NH 4PJHB 2ZPKL 4EOWH 3HG1E 2FD6H 3CXDL 1OAKH 3QHTC 3H2WA 1UENA 1S7UA 1XIWC 4OB5H 1ES0B 4OZFG 4HJ0C 4QRPE 4YHLH 3R4DA 2EDTA 3KR3L 3LH2H 3HC4L 4FTVE 3PV7A 5CSZB 4D3CH 3HN3A 3MLWL 4OLYH 1A3LH 5KBNC 2DM2A 1K9TA 4NKMA 3MROB 3L3DA 4NSKA 1KB5B 3PGFL 3LRHA 1AI1H 2C1OB 1MVFA 1B9ZA 2ZSWA 3QJFA 2YD3A 1MRCL 5DTFB 1QFWM 1L4IA 5ID0B 4UOJA 4NOBA 4KVNL 4YK4B 5I1IL 1S8DB 3ZKXB 5BRZE 3WLWC 1BZ7B 3MNVB 4M7KH 3BHBB 3F7YB 3QQ4B 2QHRL 4OLZH 2A1WL 4XPGH 2DLFH 4TSAH 2F74B 2CIKB 1NGWA 4BZ1L 3WUWG 3MCLH 2MCPH 4WEBH 3NZHL 3OF6A 2HP4A 3GSXA 3HLAB 2H32A 4EDXA 4HHAA 2AKRB 2QQNL 4N9OB 5HGAA 4RGND 3MOBL 4XMKH 1KUMA 5BVJA 1CTNA 4NO2A 3OB0H 4PGJA 1VACB 2HTLD 3QDGD 1BZ9A 3KLSA 4WCYL 2EDEA 2V2XA 5KVMC 4X8XA 3VD3A 3ARYA 3U1SH 2PO6B 3BGMB 4KK5C 3BSZL 1IC5L 4YXHH 1PKOA 5IFAH 2CSPA 1JNLH 2HLFC 2HWZL 2VZOA 1XT5A 1ND0B 3SE3A 4P2CG 1T2QH 3OKLA 4CDGC 5TDNA 4JPKL 1QA9B 3O3EB 5GGSA 1TJHH 1KNOA 4HUUB 3ZE1E 2IFFL 4OZFA 1CDCA 3PL6A 2IBGA 3H9SE 1CIUA 2PCPA 1FVDB 2EDBA 4XVTH 2AJYL 4UQ3B 2I9TB 4ZFGH 3H8NA 4NDMB 3WKNA 1KB5L 4KI5D 3V0WH 2DQHH 2IFGA 4NQDA 5HI4C 1RJCA 1FL5B 1CGSH 1A5FL 1FL6B 4OZIF 4QYOB 4OIAA 1D5BA 3C08H 4XP1H 4MVBC 3VH8A 1AQDB 5C0RL 1T03H 3I3EA 1HSBA 5A2LH 5F9JB 5L8LB 4MJ6A 1QLEL 1FVEA 1FZMA 1Z9MA 4HKBB 4PGEB 4M62L 5I8CA 4WFFD 1WQVT 2OZ4H 4EN3D 5F7DA 3CGTA 1ORQA 4G9FD 1KIRA 3ZKMC 1NGZA 5AEAA 1YEEH 3FO9A 4HKZB 4TTDD 4XB8A 4YFDB 4HCRH 3MYJB 4GAGH 3WUWA 4P57A 3TBWA 3P9WB 5I1EH 3AMKA 5IBTH 4HS6B 2ZUQB 3BZ4B 3WHXA 4XHJC 2P42B 1R3IL 1VGEL 3QIWC 4YUEH 3RDTB 1QPXA 2I60H 3TYGL 5EBWB 4LDEB 1VFAB 3BKMH 5IIEB 4BSVB 4RGNE 5JPNA 2DS4A 4PJEE 5F6HJ 5T1KB 2M1KA 2UWEF 3QDGE 2YUZA 1BBJA 4JHBA 4Z7VF 4ODTH 1YN7B 2Q3ZA 4QEGA 5JLZB 3B4NA 2D9CA 5T3ZD 1YEJH 5EOCH 1HHHA 4L8SB 4WHTB 1E4XH 1KJVB 3OKEA 3PWVB 3IDIB 3P9MA 4NN5B 4DKDC 4WJ5A 3NA9L 4U1NB 2G2RA 3EDJA 3GDBA 1WCQA 1G9MH 2JCCA 1WCBA 3LKPA 3RGVC 3TCLB 5ISZD 4TULH 5K9JH 2ZKHL 3MLXL 5FDWA 1B4JH 3SDYH 3VFOA 3B5GA 3K80A 1KOAA 5KVFH 3WHE1 1BX2B 2IC2A 3QNXA 2XN9A 1K6QH 3ZYIA 1T7WA 4QXTB 2EC9T 3CXDH 3N1MC 4Z7UA 2Y4SA 2DKSA 2J8HA 4W68A 5FF6A 4KQ4L 4KI5E 4Y4FC 3KR3H 1AD0A 4EI6B 5IFJA 4CVXA 2X4RA 5D2NA 5ANMA 5FHAH 4JKMA 1QR4A 4ZNEE 2XTJD 4Y2DC 3U7YL 4AMKL 4F7EA 2X4QB 3N1GC 4CVZA 5KS9B 5LCVL 1GGTA 4Z76A 3W82A 1U3HA 3GSQA 4WWKD 1LEGA 3F7QA 3LKQB 2IPUK 4G9FE 2MMXA 2BSRA 5I1IH 2D0FA 4X5WB 4K55A 1BD2A 1WZ1L 2DM3A 4PRAA 3MRMB 4KK9D 4PREA 1N5YL 4Y4HB 2EIBA 5J6GA 2VLRA 2A1WH 5IUSA 3HZKB 2WBJB 3TIDA 1UC6A 1TTGA 1QSFA 1CE6A 1C8PA 1XGRA 2NX5A 3V52L 1DJSA 5ICZB 1ADQA 4MWFB 3T65A 5J3HD 3IXAA 4X5XB 2CUMA 5FECB 3S37H 2QQNH 3WN5C 1XR9A 3RY4A 3MOBH 2DRUA 1RIUL 1G7QB 4J6RL 4MDJB 5BZDB 3MRIA 3VCLA 32C2B 3QQ9D 4NKOA 3KDMA 4Y88A 4RDQF 3BO8B 1I8KA 3QXDA 3BSZH 2BVUA 3HE7B 4JM2B 1IC5H 4C83A 5HYSB 3K4AA 1CFQA 5T3ZE 2DLHA 3QA3B 3ZL4H 4NUGH 5KSUA 1P5UA 4KRLB 4BH7A 2D03L 2NY4C 3D39E 3UYRH 4FFZL 2B7DT 4JPKH 4N1HB 5IEKB 3R1GH 2V2TB 2JJTA 5ISZE 3ARFD 5FYJU 3MRNB 4NBZB 4RAUA 1DQQB 4JDZB 4L3EA 2WWKO 4JO1L 3Q5TA 3OHXA 4NCDA 3IDGA 5I16B 2AJYH 3RVUC 1KB5H 1P7KB 3DSFH 1A3QA 1DUZB 1AC0A 1AGDB 4OFIA 3SO3B 3CUPB 1KXQE 3FT4B 4X6DB 1NGXA 2IQAB 2AXFA 5MEPA 5CUSH 4U1IA 1A5FH 1KJMA 1PY9A 3PNWA 2FHBA 2F8OA 4HKJA 1F8TH 2NZIA 5A2JH 1QLEH 3IDMA 2G60L 3SE4A 2XTJE 4M62H 3IB4A 2ILLA 3W9DA 4YNYA 5D1XB 2YZ8A 4XZUB 3TZVA 3I6GB 5E2VH 5D2LE 3KPSD 1JF5A 5F93C 4F7MB 2C4FT 3SJVD 5IEHA 4GXUM 4LGSB 4S1DD 3FQNB 1VKXA 4F7TA 3BDXA 3MV7A 2H6PB 3ALPA 1T89C 1R3IH 3WKML 1VGEH 2XWTB 4O51B 3TA3A 4I9WD 4QT5B 3RBSA 3TYGH 2PXYD 4W81A 2NPLX 1MJ7H 2HRLA 3KJ4B 4ZOBA 3AM8C 1J86A 4P9HL 4GRWB 1FZJB 3OGCA 2XI9A 1MVUA 3WBDA 4KROD 2EDWA 1UZ6F 5CBEB 2GUOB 5I66B 1H3WM 2Y9RT 1B4RA 3RWIA 1A8JH 2FH6A 1N3NA 1NC4D 4KGJA 4XVUD 2R2HA 3PXHA 4HPYL 3ARED 3MFFB 4X0KB 2PTTA 4GMTL 5DK2B 3KLDA 3V0VB 2XWJB 3MRPA 1IC4H 4WTWA 4L4TB 3CSBA 3RI5F 1F3RB 2DJUA 4XP6L 3U9UB 1RULL 1Q9KB 4UBDD 4M7ZB 5IV2A 3VXQB 1ZHLA 3IVKA 3HZYA 3CFKB 4LMQI 1N5AB 2P24B 3PV6A 4XCYA 1NMAL 2ZKHH 3B9EA 3MLXH 3N1QC 4I8DA 4WFGD 4ALAL 3RZWA 4S0TD 3MRJB 1CFNB 4U33A 1CT8B 3GI9L 3OAUH 2WP3O 2EIDA 1PYWA 4HEME 1F6AB 4OZHF 4NM8L 1OAYH 2D31B 3C8KA 3GHBL 4MHHI 5DWUL 4JPVL 4OV5B 1JTPA 2BY3A 3TNMA 1M7IA 3NFNA 5IMOB 3GMRB 4KKNA 3HFML 4PJ8B 1E0OB 1FYTD 4EN3C 3O2WL 5HSFA 2KKQA 3QB7C 5A2IH 4KQ4H 2C26A 5ITBL 3WFDL 4M02A 3MZGB 3QDMB 4TTDC 3VE0B 5GS1B 5E94B 3VFUB 4LFHG 3U7YH 43CAA 3D3VA 4AMKH 3C6LA 3U4AA 5LCVH 1FC1A 4DGVH 1RZ7H 3HAEB 4ZDHB 3B5HA 1Z2KA 4R0LB 1T1XB 4IHOB 2MHAA 2P5EA 5D72L 1R3JB 3B3IB 5DHVA 2V7HA 3KPSE 1WZ1H 2DQFA 1DFBL 3OR6B 1K4DB 1N5YH 3P0GB 3SJVE 2YPVH 1FVCB 3KPMA 4POYA 3AY4C 2B8OT 1HK6A 5FYLH 4OLXH 4P5TA 1JN6A 3V52H 4DVRL 3ABZA 5DMKA 3GKWH 1P2CA 1JZ8A 3ALXA 1UQSA 2Z4QB 4HBCL 5E00B 3KYNB 2QHLA 4UV4L 4I9WE 5BJTA 1JHKH 5J1TC 3KPQB 4Y8AA 4RDQG 4J3WA 5INDA 4NT6B 1FQ9C 1R5VA 3PWLB 1HEZA 4HZLA 5IJKA 3EDKA 5ERWA 1Y18A 5SWQB 3QUXA 4I18B 5DJXB 3HB3C 1MLBA 3HMXA 1YPZA 3V7AG 4ZXBC 1JUFB 1IEBB 2MNUA 5E24E 1EAJA 1GSMA 1TQBC 3KWWB 4JRXA 1DN2A 3A6CL 3O9WC 3GB7B 3RPIA 1XIWA 5DJYA 2D03H 3UJTL 1F3DH 1INQA 1VSCA 3JWDH 4FFZH 5E4EC 5KVDL 4X6BA 3UTSE 4ONFH 2BNRA 4OCNC 5JDSA 1ZT1B 2FWOA 4PJCB 4KJYB 3GNML 4IIQB 4WDIB 3VFRB 3VI3F 4XX1G 3VFVA 1QRND 3VXTA 4NNXA 3L3JA 4Z8FL 5I76A 2XTJC 1S7WA 5DA0B 4GFTB 4M9PA 3FOMB 4YX2H 4R2GB 2IBBA 4OF0A 4UUJB 4X7FC 4Y5YB 3RWEB 4O58H 1LP9B 1FYTE 4HLJA 4V2CB 1Y0LA 1NLBH 2HVKB 2F53B 5F7HA 1MY7A 3RNKB 1RK0B 3UJIL 2W59A 4PJFF 1NMBL 2G60H 4MA1C 2EEDA 1I9IL 3C09B 4EUPB 2ITDA 5D1QD 3U36A 4MNHA 3HNTL 3GZKA 3Q3GA 2PYFA 5B8CA 5IFHH 3NCYP 3DV6A 3GSNL 2QKIB 2HFEB 1FNGB 3DVGA 5E9DD 4G5ZH 2KDGA 5F9WC 4PIRF 5EUOB 4OF7A 4ODXB 3QQ9C 1TFHA 3RIFF 1NC2D 3VRLE 2J1KA 2PNDA 3WKMH 1F11A 2CGRL 4LVEA 4IRSC 5DJ8A 2GY5A 3EGSB 4UT9H 1RZKC 4YDKL 4I2XE 5CWSA 2GW5A 4JDVA 5AUMA 4HGWA 4WW2F 4P9HH 5T1MA 5A43C 2K1MA 4GAYB 3GJFK 1KPUA 2Y5TA 4HQQH 3VFWA 3S37X 2VNCA 2AQ2A 3T2OA 1FC2D 3QIUA 4HPYH 3P4NB 3T1FA 1SJVA 3W39B 4BKLA 3QO0A 4GMTH 4KDVA 2EEBA 2ED7A 5AZEL 2ZUXA 5FA3B 3JWOC 2OP4L 1Z5LA 2VUYA 3O2DL 4XP6H 1XGYL 4QRTA 3UTTE 2VLLA 4DUVA 3VD7A 4FA8A 3U82B 3FO1A 2KH2B 2VWEE 1U8NB 2JJUA 5K33A 4KKAD 3RZCC 2GTZB 4NM8H 4ONGH 3K74B 3GHBH 4JPVH 3BRFA 1JWUA 4JLRA 4AIZB 4MNQA 5IT2H 1FPTL 1TZHA 3O2WH 1T83C 5ALBH 5LBSH 4AEEA 4YC2B 4PJ9C 3T3PE 4FQIL 1X5XA 3ARWA 5ITBH 5EDXA 3W11D 3DURA 3RJDA 3VRIA 2KUTA 1AQKL 3P77B 1E28B 3Q1SL 3HC0B 1OM3L 3MCKB 3PJSA 4F8TA 4OD3L 4FFWD 4BQ6A 5IG7A 3BVNB 4E9LA 1RHHB 5K9KA 3U4BL 5D72H 4M7JL 1XCTB 3L1OH 1BVKB 3BP5B 5FK9B 5D7JC 4GRWH 2IAMB 5E9DE 1QSEB 1BFOA 1WV7T 4WHYH 5KSBF 2LU7A 5FHBL 5E7BA 5KTEL 4JFEB 1GGBL 4FRWA 4PGBB 5IR1B 1CR9L 4R3SB 2VMFA 5FCUL 4AT6A 1P84J 4HUNB 4UV4H 2Q8AL 2VDML 3GMPB 1I1FA 1HOCB 2ESVD 5IW1B 2WAHA 2Z8VC 3HG1A 1EZVY 1B0GA 4S1QH 1WFUA 1S9VA 2DJ4A 2PO6D 4CDHA 1ETZB 4OKVA 4X9IA 5GGVY 4KC3B 4QRPA 3FFCB 3MRBA 1E4KC 1H5BC 4FTVA 5FB8B 5AD0A 1RJZA 4I0PC 1DBAL 2D7QA 4XPFL 5HDQL 5DLML 5DJ0B 4I48A 4X9BA 3MJ9H 2QADB 4PBWD 2YD8A 3GBLA 1J10A 2XG4A 4C55A 3TO4B 2EZ0D 1UJ3B 1N0XL 5JW4Q 5F6HI 3UJTH 4X6EA 5F44A 2VQ1A 5T33L 4Y4FA 3S96B 4N9GB 4IRJC 3GJFB 1ZGLA 3QEUB 2AJ3B 1T3FA 1YEHH 3OKOB 5BRZA 3GNMH 4K7PX 2EDXA 1ZWIB 4Y2DA 4PJHE 4FXKA 1WFTA 1J87A 4XC1L 4ELKA 2B39A 4PGCA 2W9EL 3T4AA 4UDUA 4HXAH 4GS7B 5J13C 2K7PA 5A2KH 5C08D 2X4UA 3HAEH 4PJBB 5MEQA 2CDGB 4HXBH 1UACL 3D9AL 5EN2A 1CFSB 2EYRA 1UB6B 2V5YA 1IAKA 1XZ0A 5D93C 4Z7WB 1NMBH 4PP2A 1JGEA 1I9IH 3WJJC 2XA3A 3OG4B 2HVJA 3ESVF 3HNTH 5C0DB 3CPLB 2BHYA 3PGCB 1DN0A 3RVWD 4LKCA 4U7MA 2LABA 4EI5B 1FFOB 3WN5A 3VWJA 3MLSL 4PRIB 4NWUL 4R97C 15C8L 1QBLL 2CK2A 3L7EA 3V6FA 3DV4A 1MCHA 4JG1L 5I8EB 2RBLA 3UMTA 1A9EB 4NQVB 5L2KB 3RDTD 3PWUB 4HG4K 5I19L 4ZFFB 4U05A 4AL8L 3DGGB 5BW7C 2CKBB 1YA5A 5CS7A 2CGRH 1KELL 3SDCC 1MFEL 3DIFB 5F96L 4P2OC 3RJQB 1B6UA 1H0DB 3NIFE 5FYLD 4MA3B 3H9SA 1AXTH 2EH7L 1WGOA 2JIXA 4WTXA 4DK6A 3OR7A 1MHHB 1Z9LA 4MA8L 4K3HA 1NCBH 4XXDA 1JTOA 1S78D 4H26B 3ULSB 3GMNA 4N0RA 3QO1B 1F6LL 5C1MB 1QG3A 2WQRA 4PRBA 4Z7NF 4G3YL 3CSPA 3BUYA 3OKDA 2VWEC 4XWGH 3REWB 1HI6A 4LVHB 4BH8A 1KENL 3TIEA 5GGUA 2ZUTA 4RFNB 1A6ZA 4RFEA 3NABL 2IG2H 2OP4H 3NCEB 1XGYH 4BSWB 4WW1B 5L9DL 1U8HA 1NJ9A 2H3NA 2AEQH 5I71C 5LGHH 4YPGB 2BX5A 3KVQA 2WSKA 3F6LA 3PDOB 2DI9A 1MIEL 2EKSA 2BHZA 2O5XL 1LO0L 3U0WL 3VXPB 5CILH 3FB7B 3G5VB 4MCYB 4XNZC 3VXOA 1FPTH 5D1QC 3O4OC 4EUPH 2R2BA 4JGJA 3TO2B 3GSWA 1NL0H 3P30L 4YGVA 5CLTA 5C2BH 1NGYB 3SKJL 2NNAB 4Y5VA 1PBYA 5HHNA 1AQKH 4PJGF 1QFUL 3T8XA 3QDGA 4QXGL 2IPTH 3Q1SH 5D1ZB 1KF9B 1JNNL 3SKNB 4CU8A 1AGEB 3V5HA 4LSSH 1HHIA 4OD3H 4ZO9A 3BX7C 3IDJB 2NY7L 1D5IL 5CZXC 7FABL 4G80A 1ZLSL 1WEJL 2ZZUT 3U4BH 1BMGA 2P43B 3ARBB 4Y4HD 3AM8A 4L3CB 2N7AA 2B2XH 3CVHB 2GEEA 4Z78B 3RAJL 1YC7A 5IF0A 2WBJD 3JUZA 2A6IB 3HPLB 2DKUA 4ZO6A 2NXZC 2GYSA 5ECJE 5FUCC 3IAGC 2R1WA 4G8GB 5FHBH 5KTEH 3W0WD 5L0QB 1GGBH 3WXVH 1DLHA 1BJ1J 4N0YH 4NZTL 5KJRH 5DRXA 3QRGH 1T7YA 2HN7A 2VABA 1CICC 3T3MF 3Q6FA 2M8XA 5DDHB 1FFQA 4OUUB 1DEEB 4ELMB 3X12B 5FYLE 1UH3A 1ZA6B 5BV7L 2EDKA 4MJ5A 4WY7L 1A3RH 5EG6C 3DI2B 1CCZA 3HE7D 4JM2D 4RMQA 1A6AB 5MENB 1TJGH 2PW1A 2D7TH 4XPFH 5HDQH 4ZNEA 5DLMH 1FFPB 2YA1A 4H0HB 1SQ2N 4O5LL 2OQJB 5D7SL 3LKNB 5LG1A 2ADIA 4P99A 5SWZB 1N0XH 3TPKA 4EN3A 4HWBA 4MD0B 1Z9OA 4G9FA 1XF2A 1QUNA 4QTIL 4EQ3A 5JOPD 2NY6B 5DMYA 2MKWA 4UOW0 1C1EH 1IAMA 1OB1B 5E1HB 3IJSA 3IS1X 5I9QB 5IJVA 3GM8A 3W11C 2FZ3B 1F4WL 2HJLA 4XC1H 1D5MA 5EBGA 1FE8L 3AC0A 2W9EH 1TVBA 1OTTD 3VGDA 1OQOA 1OSPL 5CHNA 4PJ7F 2C3VA 5GGVH 3QISA 4OZ4B 3L3IB 4YK4C 3ARXA 2E5EA 1I9JL 2BDNH 4DVBA 3QNYB 1U93A 3H0TB 1UACH 2F54D 3D9AH 4MYWB 1WTLA 4AG4L 1W72A 4OFKA 4UOW1 4RFOH 1B3JA 2R23B 5D1XD 3IFOB 1I1RA 1G7HB 4PGDB 1NFIA 2R0LH 3FT3A 4HDIB 1T5XA 4Y16B 2UY7A 1MCWM 2X7LA 3WEXA 3HRZA 5FAAA 1W2KT 1MCPH 3WCYA 1PG7X 3MLSH 4NWUH 1G7LA 4K71B 5EOTB 2FIKB 1UEMA 5HHXH 3DX9A 3D39A 4MQTB 4OT1L 2N7BA 1BECA 4HEPG 5I19H 4FOMA 1AR1C 4AL8H 4IMKA 2A9ML 3D25A 4C56D 3K1KC 5ISZA 2GFBB 3P9LB 1KELH 2ARJQ 2E9JA 1HHJB 1MFEH 1VEOA 3FRUB 2R15A 3QDJB 5JHDD 4L4VD 1BVZA 1N6VA 3EBAA 2C1PB 3QQ3B 4GXUN 5JPMB 1CGVA 3JBG7 1CD0A 4HGMA 4LPCA 3QG6A 4UINL 3EDFA 3DX6A 1PX3A 1YN6A 2ZNWA 5FKPA 4LCCB 4LQ1A 3WSQL 2XY2A 3DECA 4ZOCA 3MRDA 4G3YH 2FO1A 1EHXA 4RWHA 3HZVB 3I02B 3WJLA 5ILTH 3TBVA 4L4TD 3LEYL 5D6CA 3GJFH 4M6NL 5J1AA 1KENH 1XGPB 2NY0B 3OZ9H 5INCB 3NABH 3JZ7A 1M71B 3G6JF 1R3LA 1KN4L 4M7LL 1VENA 4U49A 5CD5D 2C7UA 5D2LA 2ZOLA 5L9DH 3QUMA 4XBGB 1CD1B 1FORL 4BSJA 1X44A 2ERJB 2C4XA 5DEFB 2AJUH 1MIEH 4G7VL 1UJTA 3UCRA 2O5XH 5ESAA 1IAIL 1LO0H 3JXAA 1I3RB 4QY8A 1KJ2L 3CFDA 4HIIB 5TQ0L 5F7KC 4ZFZA 1J7VR 3WFEL 3QDMD 5C86A 4JB9L 3P30H 2J8UF 3MRCA 1P6FA 3RVWC 3O6KL 1GGCL 4X4ZA 1SJHA 4UQ2A 1MH5B 2RQ8A 1CGUA 3ZYJA 5EZOL 1FV1A 4NPYB 1QFUH 2J6EA 2BZDA 3MFGB 3NTCH 4F7CA 1JNNH 3UJJL 4PJ5B 2NY7H 4IRSA 1D5IH 4CU7A 4S2SB 7FABH 1CI5A 1H15A 2CKBH 2X70B 1I7RB 1KEGH 4U1HA 3MLZL 1HHGB 4Z6AT 3RAJH 1U8KB 4I5BB 1ZEAL 3SKMA 4JFXB 1L7IL 2XG5A 5HGGS 3ME0A 1HQRA 3IDUA 4LRIA 1KPVB 3TBYA 4Y4KC 2A73A 1R5IA 3P11L 4NZTH 2Q8BH 1AGBA 1CIDA 3FRPG 1NGQH 3ARFA 4MCZB 1VPOL 4YFLF 4GRWE 3VG0L 3WIHL 2VB5A 4NZRL 2K3TA 5DZLA 4JPIA 4L5FL 3ZDXE 4L8DA 5F3BA 5BV7H 5F9DC 4M1CD 2X4NB 2FJGB 5MI0C 4V1DB 1IM9B 5TE4H 1MY5A 1S7RA 3MLUL 2BXZA 4FQCL 3ROOA 3VWKC 1A7NL 4HWEL 1OF2A 3EUUA 2D7PA 4MD4A 3RZCA 4L4TE 3SN6N 4HIXL 1KPRA 5DR5L 5HGBA 3LKSB 4O5LH 5D7SH 3QWOB 4MMXC 3ZE2E 4FQXD 2NLJB 1SJEA 5EZIH 3LMJH 2IAND 1ED3B 1UXWA 3AU1B 5J9PA 3QCTL 1JZ2A 5SWSB 5JHLL 1OCWH 5IM7A 2GTWA 1PQZA 4PJ9A 3KPSA 1RU9H 1XH3B 5HGDA 2W07A 3SJVA 5ICYA 3HMWL 2DQJL 1U8JB 3FB8B 4ODBD 1I9RH 1M6OB 4R2GD 4OCSH 1F4WH 3QEHB 5H2BA 2VAJA 1FE8H 4CVWA 3LQZB 2F5AH 2V5SA 4FXGA 5A3IC 3EYQD 4HV8B 2AK1L 1OSPH 4PJDB 3RKPA 4YDLC 3VFGL 4S10A 3BQUB 3WE6B 5MEOA 3BZFB 2F53D 1JWMB 1TZGL 2PXYA 3D0VB 1I9JH 3OXSA 3NFSH 3QDME 4ODSL 3ARPA 3X3GL 5DUBA 3GMLB 2IH1B 3JUYA 1D5ZA 4LEXL 1MAML 3C9NA 3R8QA 3CVHH 1EIBA 4KXZI 1VFBB 2MPAL 1BVLB 4N1EA 4RIRB 4X6FA 5JQHC 1EO5A 1N4XL 1J9CT 5C0IB 4Q9RL 1NC4A 3AREA 4NRZA 1KACB 5CJOL 2ATPA 2XKNB 3NPZB 3U79A 3B9AA 3JTSB 1YNLH 3AROA 1H3TA 3MBEB 1AXSA 2DI7A 4BK5A 1HYRC 3BN3B 4K8RL 5KG9B 1HDMB 1SYSA 1Q9OB 2D4DA 5I30L 2H41A 3DBXB 3UTSA 1E4KA 1H5BA 2A9MH 3HE7C 4JM2C 3RWGB 4P9HC 1RIVH 3ULUL 1EV2E 2XNAB 4I0PA 3PGDA 3JTTA 2YWZA 4HIHB 2VYRE 3WS6C 4X6CB 2FEDC 5EU4B 2O5ZL 4CNIB 3EFFA 1U92A 3LS5L 4WI6A 4J8RA 43C9A 1CD9B 2LTQC 1YEFL 5I1KL 4XP4L 1DQJB 3WSQH 1FYTA 3S35X 1Y6KR 3C2AL 4CMMB 5D70L 2BC4B 4HFWA 2UZXB 2DIBA 3LEYH 4OD2A 2P48B 4M6NH 2P8LB 5J7CC 3CD4A 5F7MC 1YUHA 3R06B 2VDKL 3ZDYE 1F4YL 4NQEB 1KT2A 4MX7B 2P46B 1FORH 2AV7B 3GBML 2CLRB 2OZ4A 1CBVL 3ARUA 3QT2A 3SCMC 4M5ZL 3LRGA 3P0YH 3D69B 4G7VH 1YEDB 4JKWA 3MRFB 3LEVH 4RBPH 3SY0A 3WJJA 2Z93A 4HCRA 2BY2A 1LP9E 3KYKL 1I8MB 4HT1L 4I2XA 4JB9H 1JPFA 3S4SG 2IADA 4JFPB 3UEZA 3O6KH 1GGCH 1XF4A 1EZVX 2F53E 4JY5H 3FTGA 5F8QC 2WZPD 4YHML 5EZOH 1FNFA 4BFGA 1P7QB 3FQUA 4NUJA 5BQ7B 3LDBB 3QJHA 3UJJH 1I85A 3BN9C 4D0DA 3SDCA 3KLHD 1XF1A 4YHNB 4QCIA 1DLFL 1AO7D 3OKKB 4ZNCD 1YY8B 3GEWB 3R0NA 3GUTB 3MLZH 2IAMD 5EPMA 2XKUA 1QSED 1EAPB 1UWGL 4V2BA 1MAJA 1XGUA 4OIIL 3EJZC 3UTTA 2CRIA 5EUOE 4JFED 4PG2C 3VXNB 1ZEAH 4LHJB 1L7IH 4XNQA 3U9PL 1F6FB 4N8VB 4P2RE 3MRGA 1HN1A 1RI8A 1F4XL 5IGXH 1ONQB 4M93B 5DRNA 5DJ6B 4UV7H 3KAAA 3U46B 2Q86B 3SDAB 1DQDH 1OPGL 4ODWA 1SYVA 1CE1H 2MKLC 1VPOH 4WNQA 3EHBC 2IQ9H 2CRYA 4E41B 2BY0A 1QRNA 2X1XR 3VG0H 4Q6IA 4L5FH 4NO3A 4DW2L 2DM4A 5JR1L 3FFCD 3TC9A 3CDGB 4LARL 3GBNH 5CD5C 1N64H 2VSCA 1T2XA 2GCYB 1X5FA 4LHUB 1QD0A 4JQXC 1O0VA 3WNLA 4FQCH 2C9AA 2LV4A 4M61B 1A7NH 4N1CA 4P46B 1NFDF 3SDDB 2QADD 5L2JB 5FOBA 2G75B 3F12B 3IU4L 5M94B 1U95B 5C3LD 3M45A 1LGVA 1NBZA 2ICES 3ULVL 4HIXH 1S9WA 3IYLW 3RA7L 4PJ8C 4X8JA 3GI8H 1WAAF 2ATKA 1S7QB 3D0LA 1MWAB 1IJ9A 3GM0A 4JY6A 2BP3A 5D1QA 1A1NB 5I75B 1KLFA 5JHLH 1QVOB 1T1ZB 3CZFB 5D7IB 3NH7L 1EPFA 5GS1C 1FNEB 4YEFA 3DUSB 5KS9F 3HMWH 3CSGA 1M05B 5E9DA 2FDBP 1CZ8L 2BOBB 3U2SA 4HS8L 1KV3A 2V17L 3S4SA 5I1LB 3BEVA 3ZYOA 1NCCL 5C09B 1NC2A 3K2UL 2ZCKH 3VFGH 4ZUSB 3G5XA 1OAZH 5TDOB 1TZGH 2VTFA 2OI9C 3ZDZF 3B2UD 3X3GH 4ODSH 2R29L 4RQQB 4JREB 3BPNB 1PLGL 1YECL 1A4JB 3DLQR 4GW1A 3QXTA 5BS0B 2R8SL 1ITCA 4JFHD 3O2VL 2CLZA 4G7YL 5FM4A 1U8MA 1A14L 1UXSA 2I07A 1FGVH 4WI7A 1N4XH 3RKDD 4PRID 5E8NB 2XACC 1CICA 4XAWL 1I3UA 2GAZB 4GSDL 5DJ2B 5CJOH 2DWEB 4LEOB 4KVCL 5EBMA 4LBEB 1VFOA 3H3BC 4HX1A 1C08A 3GMQA 1FRGL 4EBQL 4K8RH 1QSEE 2FO4B 5I30H 2IPKA 4M1CC 4WHDA 4I18C 1IVLA 1JRHL 5DJAA 4JFEE 1WIPA 3QPQC 4P9ML 1LK2A 3N9GL 5DHXB 3SBWA 5HHPA 3FQXA 2BNQD 3N85L 4XCNB 5CGMA 1ZANL 3AUVA 2D7MA 4PJHA 1H8SA 2UYLB 1B6DA 1MCCA 1X5JA 3LS5H 4XVJL 1AY1L 4LSRH 4ZFOB 1ES0A 3BGFB 1YEFH 5GZND 5I1KH 3FFCE 4D9LH 1JZ7A 4RCAA 5CSZA 1A02N 2FX8L 4RGOH 3C2AH 4OTXH 4IIQC 5D70H 3U4EB 3MROA 5J12B 1KB5A 1NCWH 5HI5C 2C1OA 1RUMH 4MJ2A 3WNOA 1ADQL 1LDSA 4PUBL 2L4OA 2YXMA 1C7TA 1RURL 5DTFA 4BYHA 4X6DF 4WO4B 4ETQB 2VDKH 5ID0A 1F4YH 1MSPA 2VSDA 3JVGC 1S8DA 5CJ8A 2AJXL 2PUQT 2R69L 5C0EB 3VI4F 1BZ7A 3MNVA 4R9HA 1A7PL 3BHBA 1CBVH 3F7YA 3QQ4A 2OTWB 2X10A 4X99B 2F74A 3C09C 2CIKA 3BISA 3CU7A 3JSSA 5F88B 5DT1H 4JO3H 3D6GA 3HLAA 1GOGA 2AKRA 3KYKH 1F45A 1FGNL 2LU3A 5E2JA 1A7BA 4PJBE 1VACA 1ROWA 5K59E 4YHMH 4OGAD 4PD4J 4H20H 4Z7WE 1KB9J 4E5XB 3RIAF 1S7TB 3BRDA 2BOCB 2PO6A 3BGMA 5IB3B 2CXGA 2BVEA 4JFHE 5GSVB 4K9EH 5I1JH 1DLFH 1I7UB 3DOSA 3MLTB 1ND0A 1BJ8A 1URLA 2NY3C 4PRIE 4R90L 4BELD 1UWGH 1OSZB 5IVZB 4OIIH 2E8YA 3D18B 4UNVA 5L2KE 4N0UE 3NCBB 1QA9A 5A2FA 3QWQB 2G5RA 4OZIB 3MCG1 3O3EA 3U9PH 1QBBA 4ZFOL 4PY8I 1F4XH 3E1F1 2RFXB 4HUUA 3Q5YA 1D5XB 1OPGH 3L9RB 1FVDA 2YSSB 4UQ3A 2I9TA 3GHEL 4NDMA 4XPAL 4MLIA 2IJ0C 5JR1H 2X42A 1N6QL 1QFOA 5FM5O 4LARH 2HKHL 3PP4L 4PRPB 3ARVA 4CW1B 1WISA 1FL5A 3QXWA 1OGAB 3QULB 4NWTH 1FL6A 3FL7A 4QYOA 2V9TA 2YUWA 3DVNB 1AQDA 4X4XB 1N7ML 1QOKA 3DTXB 1TXKA 4J12A 5F9JA 4A6YB 5KVGH 4P2QD 2GSIB 4JANB 1T0PB 1ZE3C 3IU4H 2BSTB 4MA7L 4HKBA 4PR5B 4NC1E 4PGEA 1FL3B 4NNPL 2P7TB 4FZ8L 5EC1B 3RA7H 1S3KH 3K8KA 5E70A 3TH2T 4OFVA 5FOJA 1I8IB 4YC2C 2VXSH 4HKZA 3QI9C 3FQTB 3MYJA 3S7GA 3B6SB 1J0IA 4GBXB 3BUTA 4OGZA 1TITA 2UWEB 4J4PC 4HS6A 3BZ4A 4XP9L 4Z7VB 3G6AB 1CZ8H 1J0JA 3MA9L 2V17H 2YWYA 1NMCC 4K2UL 2ICCA 2M26A 3RDTA 5EBWA 4Q6YA 1VFAA 3K2UH 4LCWB 3QPXH 2E6PA 5IIEA 4BSVA 4Y8DC 2A2QT 1R3HB 1IGYB 3W9EB 5T1KA 1PLGH 3ES6B 5I1CL 1YECH 2IAMC 3DYPA 4FMKA 4H88H 2VJXA 4MJIB 3GJEB 3IDNB 1G1YA 4N68A 1YN7A 2R8SH 2D7NA 4Y16D 5JLZA 2MTPA 3O2VH 3KPPB 3QAZB 4N90D 4ZAKB 5MERB 4L8SA 4WHTA 4ZUWB 3DUHA 5CJQL 5LVEA 1KJVA 3KYAA 2VH5L 2O61B 3PWVA 3HC3L 4GSDH 3IDIA 5DC9B 2EIZB 2BMKB 1I7TB 4U1NA 4NKIH 5HYSG 4TSBL 3TCLA 1FRGH 4EBQH 5ABDE 1Q72H 4G8GE 1PEZA 3QIBB 3MOQA 1IRAY 2DQGL 1JRHH 3FFDB 3ZKND 4P9MH 3N9GH 4OCYL 3CCHB 1BX2A 4QWWC 2FATH 4GLRI 1ZANH 4RNRB 5HY9B 5EU5B 1JF1B 4ELME 1CL7I 4QXTA 4A6YL 4D9RD 1RY7B 1UYWL 3TO4C 1LNUB 1UJ3C 3UDWC 4XVJH 1AY1H 5MENE 4PJCF 4EI6A 3ARGB 1D9KB 1N26A 3W2DL 2FX8H 1CF8H 2OJEB 1QFWL 3IT8D 2NY0D 2DMBA 2GHWB 4XCFH 3AS3A 2YR3A 1UA6L 5A40E 2Y06L 2X4QA 5ICXB 5KS9A 1JK8B 4I77L 4PUBH 5DYOB 5SWZE 1RURH 4U6XB 3LKQA 4MXQC 1NDMB 4G42B 5J1SC 3E6FB 4EJ1C 4APQB 4X5WA 3T0EB 2R69H 3MRMA 5JO5B 4Y4HA 2Z31B 5DI8B 2F5BH 5E2UL 3FHAA 3TT3L 4KZDH 3HZKA 1RUPL 2WBJA 2IWGA 5C6TL 2G5BB 2DQDL 4R6UA 5ICZA 4K3JH 3HMXL 2AERT 4MWFA 4P4KC 2H1PH 5EOQL 3SGKC 5B4MD 3QUYB 4X5XA 4EI5C 4JKPH 5FECA 2DL2A 1MCIA 1FGNH 3RKDC 1G7QA 3DX7B 4MDJA 2W60B 3A67L 3EO1B 5BZDA 32C2A 3A6OA 1GZPB 5LAXB 1DR9A 1A1MB 5F7YC 3AXLB 4G8IB 3BO8A 5JXAL 2B1AH 3BT2L 2PR4L 5CGTA 1FHGA 5HI3C 4WHYG 5DMGD 3HE7A 4JM2A 2IPUG 5HYSA 1CWVA 3QA3A 4N90E 4XTRC 5JORB 4M48L 3OL2A 1CS6A 3I50L 3MACL 3OJDB 4R90H 2ZSVB 1LE9B 1MEXL 4YH6A 1Q38A 2DLEA 4M1GH 5IQ9B 1CDBA 5IEKA 3RWJB 2V2TA 5E99L 4ZUVB 3CMOL 2C3HA 4KJPD 2BERA 5GZNC 3MRNA 1DQQA 3CFJB 2WWMD 1LILA 4JDZA 4WHCA 2I24N 3QDJE 2P8MB 4WUUB 2LE9A 5BV7C 4NC1C 5I16A 4X9GA 1EXUB 5HVWA 3GHEH 2DDQL 1P7KA 4XPAH 2HT4D 4X9HA 1MHEB 4V1DD 1DUZA 4D9RE 5CKAA 1IM9D 5CGYC 4P3CL 3QBTB 5GGRB 1AGDA 1N6QH 4D0CB 3CUPA 2OR9L 2CK0L 3FT4A 4X6DA 3DO3A 2IQAA 1CG9B 3DNKA 3PP4H 5FUZH 2YHGA 3O0RL 3D2UB 4XAKD 1ZVHA 1R6VA 4YFLI 2JJSC 3O11B 5DFVC 3CFEB 2NR6D 4MA7H 2BSSB 1JI1A 5D71L 5D1XA 4XZUA 1NCAL 4FZ8H 5SWSD 4AH2B 1GJIA 3I6GA 3ZHDA 4JM4L 3QXUA 2QSVA 2ADFH 4F7MA 1JYXA 1FIEA 5HVFB 1T6WA 3OJVC 4HFUL 3T0XA 2BK8A 1BF2A 1VFMA 3IJHB 3QDHA 3HAEG 5AG8A 3SOBH 3FQNA 1MCQA 1JNJA 4G6KH 2XV6B 5D1ZC 2H6PA 2AK4B 4K2UH 2XWTA 4O51A 3BQUD 1JV5B 4QT5A 2A0LD 1WTGT 4BJLA 1UVQB 3MJ7B 1JZ5A 1PW3A 3ARBC 3B9KB 4HWNA 3WFCL 1FZJA 1C5CL 2ZG2A 5ADPL 2ICWJ 5CBEA 3VD4A 5I1CH 1OTSC 2GUOA 3VXSB 5I66A 2CRMA 4PG2A 5D7KD 4HGKC 4P23B 4WEMB 4M43L 3SE9L 4PRNB 4POZD 4PJ5E 5SX4I 3MFFA 4X0KA 2A6JB 4OZHB 5DK2A 3V0VA 2XWJA 5CJQH 1U9KA 5E5MB 3FB6B 2VH5H 4L4TA 3HC3H 5JHDA 1JPGB 3U9UA 2YRLA 5BXFB 1Q9KA 4LP4A 1VERA 1IM3B 4XWOC 2UUDH 5SV3A 3VXQA 4FQHB 4TSBH 3CFKA 3JV4B 3Q0HA 1N5AA 2P24A 1B88A 3RIFK 3VD5A 3TBTB 1U8OB 3MRJA 1CFNA 4OCYH 4DQOL 1CT8A 3MJ9A 1UCBL 5SV4A 3P4MB 1F6AA 4C58B 4Z7QF 2W9LA 2D31A 3CH1B 4OV5A 1FDLL 4A6YH 1P84K 5IMOA 1AE6L 2H26B 2QEJA 3GMRA 3MUJA 3QCUL 4PJ8A 2AP2A 4V1DE 1YMMB 2DQUH 3ZHLA 4OD1L 1Q9WB 3W2DH 2NY6C 3QDMA 1QFWH 5GIRB 3VE0A 5GS1A 4FP8L 1CYGA 3CU1A 5E94A 3VFUA 4OCRL 4WIQA 4LNVA 1ZOXA 2Y06H 1OTUD 4TRPH 3BAEL 2CJUH 3NGBB 4H5SB 1UZ8B 3AVEA 4I77H 4NQED 4Q2ZB 3S3SA 3WNNA 4KKLC 3HAEA 4ZDHA 3H3KA 5SWSE 4R0LA 1INEL 1VEMA 1T1XA 4IHOA 3TN0B 3VDBA 4TUKH 1CDIA 1R3JA 3QUZD 3B3IA 1YY9D 3LPFA 3OR6A 1K4DA 4KK6C 2YUVA 4FQ2H 8CGTA 2P44B 1FVCA 5CLWA 5E2UH 3TT3H 1RUPH 5C6TH 2DQDH 5GS0H 3EKCA 4R26L 5BMFL 3HMXH 1RUKL 1BP3B 3LPGA 5EOQH 5E00A 2Z4QA 3CVIL 3KYNA 4PJDE 1BFVL 2RGSA 4RMUA 1MCOL 4ZO8A 3KPQA 3O4LD 4KWUA 4NT6A 4K71C 1P7QD 3MRQB 4LSQH 3A67H 3PWLA 5D8JL 4M03A 1P4BH 5KAQF 3OKYA 4FQPA 3AB0C 4MS8C 3NIGF 4Y5XB 2FBOJ 4WUKL 5SWQA 5J0BA 5JXAH 3BT2H 3QZWB 4I18A 1XF5B 5DJXA 3CFCL 5EU3B 1JUFA 4JZOB 1IEBA 2FJFB 3KWWA 4EVNB 3I50H 1QZ1A 3TEUA 3GB7A 2UY6A 1CDJA 3ARDD 1MEXH 3I84A 2IBZY 2ICEB 5FXCH 5LGJB 1YNTB 4GJTB 2AQ3A 4LCCC 4XI5C 1MNUL 1JPST 2H9GB 2ZUWA 2BVTA 4QGTA 1ZT1A 4PJCA 5BCAA 2AABH 4KJYA 4IIQA 4WDIA 5GJTL 3VFRA 4E41D 4PJFB 4KMTL 4LSTH 4HH9B 3LN4B 3KPLB 3MRLB 4MDIB 2DJSA 1MJ8L 3NACL 3FOMA 2DDQH 4LQFL 3LD8B 1TNNA 1IQDB 1OT1A 3R8BB 4GRLB 4P3CH 4UUJA 3MLVH 4Y5YA 3RWEA 4LHUD 2JE8A 1LP9A 1MFCH 2WLYA 1XF3B 4Z77B 3SPVB 3WDIA 3SDDD 4R8WH 2ERJC 1RZJL 1I1AC 2HVKA 2F53A 3AMLA 3KNBB 3RNKA 1RK0A 4PJAF 2XKSA 1Q94B 1DE4B 1OAQL 3UPAA 4EUPA 5D71H 4K3DL 1MQKH 1MF2H 3X3FL 2WP3T 1NANI 4NQEE 4JM4H 4WW2B 1F2QA 4EXKA 5JA8B 1IAOB 1KTDB 2EEAA 2QKIA 2HFEA 4WGVB 1FNGA 4HFUH 4EZMA 2YD7A 3QWRD 1HXYB 1LO4L 2OTPA 1PSKL 4B5EA 4F33B 6FABL 1NEZB 1WBYB 4G9DB 3EO9L 5EUOA 4ODXA 3BE1L 3GSOB 4A2MA 4OF5A 3VFMB 2VDLL 3MXWL 1IKNC 5JXEC 1I75A 3EGSA 2IALB 1NGPH 5C8JB 5DMGC 3CK0L 3WFCH 1C5CH 4GAYA 4C54A 5BS0D 1I9EA 3WDHA 2R0WL 3P0VH 1K5NB 4OJFH 3HE6B 2OTUB 1O7SA 2X4SB 3EYOB 1KC5L 3HUJF 3MGOB 4XBEH 3WIFB 5DD0L 4M43H 4OGXH 2A77H 1RZIB 3FQWB 1YEGL 3P4NA 4KJPC 1RMFL 3W39A 2EYSB 3H42L 3QR2A 1ZVSB 4JQVC 1P1ZB 3STLB 3TP4A 3TH4T 5HVHB 4K8RC 4KK8D 5FA3A 4ZTOL 3HNSL 1VDGA 5JOEA 1EGJL 1E27B 1B90A 1F58L 1KIUA 3G5ZB 1H3PL 3ULUC 4U6VL 4NNYB 5DUML 4NIKB 4HS3B 1U8NA 4OBRA 4DQOH 1MUJB 1PKQB 2E7CA 1M7DB 5E8EB 1BWWA 3DMMB 2GTZA 3ARZA 3RX7A 4E41E 2X5PA 1L0YA 2DL9A 1FDLH 4AIZA 2J7LA 3QCUH 1S7VB 3WIIL 4GQ9L 5ESQB 5IB5B 1GHFL 2QV2A 4OD1H 5GJSL 1X6NA 2WNGA 5F7UA 4K7FB 3JV6B 1PEWA 4FP8H 5KSBB 3P77A 1E28A 4OCRH 4KKCD 5TGBB 1AKJB 3HC0A 4YHOH 5DD6B 3MCKA 4WO4D 5DS8B 5IMKB 3BVNA 2VZUA 1RHHA 3L5XL 4ZPVB 4HUMB 4P49A 5D7IE 1XCTA 5JDJA 1JZ6A 1BVKA 1TJIH 3BP5A 3EZJB 4D94A 1FH5L 1WITA 5E5UB 5FK9A 4U3XA 2IAMA 4DN4H 3O6MH 1QSEA 4NKDB 3BD5A 4R26H 5BMFH 4JFEA 5C09E 4PGBA 4UNUA 5IR1A 2O93L 4R3SA 3SE3C 3T77B 2QTEA 4POZC 1BFVH 3BPOC 3VFTB 3GMPA 4UDTB 2FR4B 4RMRA 1A4KB 2B0SH 1HOCA 5KAQG 5IW1A 1F02I 3MBEC 4JGUA 3IDYC 2KQNA 2VR4A 4QF1B 2OR8A 3TVMB 5D8JH 1ETZA 2BJML 5BS0E 3OGOE 1BEYL 4PJXF 3FFCA 5FB8A 2RCSL 2DD8L 1TZIB 2HRPH 5DJ0A 2YD2A 4NP4L 5K9OB 4RWYL 3U0PB 1MELA 3CNKA 4WWKB 3TO4A 2VR5A 1UJ3A 1H3VA 1RZ8B 3MLYL 1DQTA 3E3QE 3S96A 2AJZB 4N9GA 2VXTH 1JYWA 1MNUH 2DQIL 1HKLL 3GJFA 3QEUA 2AJ3A 1NUGA 2E7MA 2WIMA 3OKOA 1U8PB 1W72L 2ITCB 2VXQL 5GJTH 2X1QA 3RY6A 2Q20A 4KMTH 1UWEL 5KW9L 1ZWIA 5GRVK 3QHFH 3V6OE 5IOPB 1MRFL 4U6YB 3WNMA 3LOWA 1OAXL 3NACH 1WK0A 4PRPD 3PQYB 1OGAD 1QFPA 4JFOB 5T3ZL 2ADGB 2Y7QB 4PJBA 1BOGB 4OLVL 2HG5B 2NY2B 2CDGA 3ULVC 2B5IC 3TNNB 3V5DB 4NCC1 1MFDH 2ED9A 4MAYB 5ACLA 1CFSA 2YOCA 3RL1B 1UB6A 1JIBA 4XMPH 4MB3A 4Z7WA 1N8ZB 4HMCA 4K3DH 1CLYH 2ZCHL 4WI3A 3CPLA 4L9DA 5C0DA 3X3FH 2JKXA 3PGCA 4GBXD 3SGKA 5JMOC 4HPOH 4L29B 4EI5A 2VISB 2DYPB 1CFTB 2J88L 5E1AB 3F58L 4PRIA 5CCKH 1C5DB 1LO4H 5I8EA 1A9EA 4NQVA 5L2KA 3EO9H 2EXYD 3TPUB 3PWUA 3ARRA 4ZFFA 4Z0BL 1BFSA 3DGGA 1BIHA 2CKBA 4LCWD 2VDLH 3MXWH 4FQJL 3DIFA 4DKFL 1H0DA 3FN0L 3OXRB 4MA3A 2O5YH 4YDIL 5GS0D 2XZCH 2BNUB 3UTPE 4B7LA 4MJID 5HXMA 5I73C 1MHHA 3SHSA 2R0WH 1CD8A 4H26A 2YMXL 3ULSA 1FAKT 5HPMB 2APFA 3QO1A 2CQVA 4AIXA 1KC5H 2R9HC 4UIKL 5GGSY 4M93C 3SDAC 4NFBA 1WFOA 3REWA 3H42H 2CXKA 4LNRB 5L6YH 4NM4L 1HQ4B 4PG9B 1KCUH 3NCCB 1LDPL 4ZTOH 3HNSH 3DETD 3QIBD 1EGJH 2FGZA 4NRXB 4BSWA 4WW1A 2X9YA 5GZOD 4OZIE 3GIVB 3EJYC 2AXGB 2EYTB 5DUMH 4YPGA 2JK5B 4GOSA 4P46C 5FKAB 3SDDC 2QR0B 3PDOA 4PJGB 5C0NC 1E6JL 2JJSA 4KJQC 1CXFA 3VXPA 3FB7A 3G5VA 4MCYA 1DP0A 1EHAA 4ENED 3ARGD 1D9KD 3QYCA 2XQYG 4GQ9H 4PRPE 1GHFH 4PLJD 3TO2A 1D5ZB 1OGAE 1JVKA 1MIMH 3UPRB 1NGYA 3D3VE 4ISVB 2NNAA 3F5WB 1EJOL 2P47B 2VZTA 4OCXH 5HDBF 1RFDL 1TNMA 3NZ8B 4CAGA 4NQCB 5D1ZA 4C59B 3SKNA 3LQAL 1AGEA 2A6DB 2YXFA 2Q87A 3IDJA 4APQD 4HW6A 1OGTB 5IBLD 3T0ED 1ZVYA 3QRFM 4Z7OE 3ARBA 1HH6B 2Z31D 4L3CA 1YYLL 4MZ2A 3CVHA 4YHPB 4Z78A 1JFQH 5CIPB 1CFVL 4PV8B 2UWEE 1FH5H 2A6IA 4F57L 3HPLA 4Z7VE 2CMRL 1A21A 3B83A 4G8GA 5I74B 5T1LB 4M6MH 3QUYD 1FLRL 2A9NL 3KGRA 4EOWL 2BFVH 1OAKL 3FKUS 4LCWE 3JV5A 5DDHA 2AJVH 4OUUA 1DEEA 3LH2L 4ELMA 3X12A 5DEGB 2JJTC 1ZA6A 2FECL 4KK8C 4MJIE 5T5NG 2BJMH 4XRCB 2LFGA 1OP3K 3E3QC 1A6AA 1P9MC 2Y6SC 5MENA 3DARA 4JRXE 1AI1L 2RB8A 2RCSH 5J89A 2DD8H 4X6CF 4BZ2L 1RVFL 1A6TB 1FFPA 3V6OC 2BRRL 1ZA3B 3S88L 3F7RA 5FGCB 3WL9B 2OQJA 3LKNA 4FS0A 4LCIL 2GJZB 4PJ7B 5SWZA 3BGFC 4JAMB 4PRDB 4ZUUB 2MFNA 2W0FB 4MD0A 2C5DC 2UZIH 4XPGL 1E6OH 4WUUD 2DQIH 4TSAL 3FAXA 2J2ZA 3SE4C 2ZOKB 2VXQH 5J12C 1OB1A 3TZVC 1HCFX 2FZ3A 1MRFH 3DRQB 3WMSA 5DRZB 1XR8B 4DKAA 5D5MF 3VXUB 5JZ7C 3D2UD 4P4RB 5L88H 1TMCB 3L3IA 4OZ4A 4Y0GA 1J18A 3FT2B 3FB5B 3O8XB 5GRVL 4OLVH 3QNYA 3S8WA 3H0TA 1U41A 1KTLB 3TA3C 1L9MA 5DZNA 3C5ZD 5JIHA 2R23A 3IFOA 4OFYD 4YXHL 5IFAL 3NIDF 1G7HA 4PGDA 2EDFA 5F6IC 4HDIA 3GSVB 4ZODA 2ZCHH 4Y16A 3RTQB 5I8OL 4QLRA 1T2QL 2BSED 4WI4A 3MV8B 3OG6B 4OI8A 1WC7B 1WWWX 3T0EE 3H9HB 2J88H 5IB1B 4HJGB 4FZEL 2C3GA 5DVMA 4X4ME 5EOTA 2FIKA 2AK4D 4F9LC 1GZQB 4M3KB 9CGTA 3BH9B 1DBML 2GFBA 3P9LA 3CLFH 1LK3L 3I3DA 1HHJA 4FQJH 5IROA 3FRUA 3QDJA 4DKFH 4UZGA 4ZSOB 2DQHL 4LIQH 2C1PA 4YDIH 5HHVL 3QQ3A 5JPMA 3G6JB 1G0XA 2CLVB 3VXSD 1MJJB 4B41A 1MCRA 5GSRB 1QSVA 4P23D 2ZG3A 4X7TB 3O6FB 4XP1L 2YMXH 3UBXB 1ZT4B 3DXAB 4PV9B 2HJFB 1T03L 4LCCA 5AYUH 4UIKH 3TF7C 1DUYB 4OCMC 4JG0L 5HYQB 3QP3A 3HZVA 3I02A 4MNGB 4YO0B 5FA4B 1J8KA 4UAOC 1HHKB 1XGPA 3ELAT 4CUCA 5INCA 3VMPA 4P5KB 4HIEB 1LDPH 1YEEL 1TTFA 2VC2H 1M71A 3FZUD 3B2VL 3QFDB 5HDLA 5I1EL 1V3MA 4QTHB 2J8UB 5K9QI 1VB9A 1SBSH 2VN7A 3ILQD 4MQXC 4Z95H 3LS4L 5GRUH 4XBGA 4F8QA 1CD1A 3BMVA 1GOHA 3K0WA 4WUUE 2VXVL 1OLLA 4YUEL 5DEFA 1E6JH 2I60L 2PN5A 1JYNA 4KUZL 3BKML 1I3RA 1G7MB 1WZKA 1LEIB 3H3PH 3O3AB 1YMMD 4HIIA 3VFNB 3X17A 1KYOJ 1I7ZB 5DZOA 2PETA 1HWGB 3NPSC 3Q6GL 4WFHD 5B22A 1NDGB 1EJOH 4P48A 1BJ1H 1MH5A 4NPYA 1RFDH 1DL7L 2NYYD 2X6MA 4KTDL 1YEJL 3L6FB 4GG6F 4KH2A 5EOCL 3SDXF 3ESUF 4MHHG 1E4XL 4QHMB 2OM5A 4PJ5A 1IKNA 4S2SA 2X70A 5HVGB 1I7RA 3MZTA 3BRGC 1OWRM 1G9ML 5IJKC 1L0XA 3VFSB 1MCWW 4TULL 1HHGA 1UZ6E 1CFVH 1B4JL 1U8KA 3SDYL 3LSOB 3VXRB 2IBZX 2VZ3A 3J7HA 4I5BA 1KIPB 2CMRH 1GGYA 1OVZA 3ORJA 3KXFB 4JFXA 4LKXB 3K2MC 2AK4E 5JW4N 2XPGB 5E08L 5ITFB 4XT1C 3STZB 1KPVA 1FLRH 1MCJA 1UKTA 4POUB 4ZAKC 3PWPB 4OLUH 1TQCB 5IP4A 1X3DA 1BM3L 3L5WB 4Y7MA 2CD0A 4MCZA 4JQVA 3C60B 3UTQB 1JGUL 1J1PH 3G6DL 2HT3D 5C0BB 4PTUB 4DWHA 5IKCB 3E6HB 1JPSL 4WU5B 5LQBL 5FHAL 2E6JA 4YQXH 2X4NA 2FJGA 3DETC 4OLEA 5FDYA 2HTKC 4V1DA 3CSYB 1IM9A 3SKUD 2GJJA 1B0RB 4X4YB 4OZHE 1EJ6A 4BZ2H 1RVFH 4JFFB 4XPTH 2BRRH 4GQPH 5CZKA 4PLKD 3S88H 3LKSA 1T04B 3QWOA 2DTML 1G84A 2NLJA 1FZKB 4LCIH 1ED3A 3ZSSA 3AU1A 2ENYA 3LN9A 4JZJB 4JGMA 5SWSA 3HRPA 1D9KC 1T66D 4PLJC 1J0KA 3LKOB 4CN4A 4LLDB 2XA8L 1XH3A 5T3XH 1U8JA 1DBKL 4ETYA 3FB8A 5C07B 5B8CC 1M6OA 1FNHA 1A6PA 3QEHA 4GRLD 3S37L 5DHYB 3LQZA 1G7IB 4OI7A 4HV8A 4LOUD 1UM4L 4PJDA 3L3OB 2X1OA 1NCTA 3BQUA 1YMME 2HAZA 2ESVB 4JO2L 2FLRT 2XQBL 3BZFA 3WE6A 1JWMA 2CIIB 3T0EC 5ACZB 3QEQD 3D0VA 1T7XA 3GMLA 2IH1A 2Z31C 2H45A 2J3SA 3PHOB 4WFHE 5CIPH 1VFBA 4QHLB 1BVLA 1PDKA 3UZEA 5IK3B 4RIRA 3ZL4L 3NCJH 4NUGL 5C0IA 4GKNB 4TN9A 4NN6C 5I8OH 2F8VA 3UYRL 3CC5B 2XKNA 3R1GL 3JTSA 4N5EC 4FZEH 3MBEA 4LL9A 5KN5B 3MOAL 4E42B 4LF3B 5KG9A 3QIUC 1EFQA 1HDMA 1Q9OA 1WZMA 5E5RB 7CGTA 3DBXA 3RWGA 1DBMH 1LK3H 1NAMB 2XNAA 3KYMB 3V4VL 3DSFL 4PJIF 4HIHA 4X6CA 5EU4A 4XPBL 1ACZA 1JWSB 4HH8A 4N8VG 5IVOA 4BA8A 3QSKB 5HHVH 3HE6D 4N8CL