4M5ZH

Crystal structure of broadly neutralizing antibody 5j8 bound to 2009 pandemic influenza hemagglutinin, ha1 subunit
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
226
structure length
220
Chain Sequence
b'EVQLVESGPGLVKPSDILSLTCAVSGYSISSNYYWGWIRQPPGKGLEWIGSIYHSGSTYYKPSLESRLGISVDTSKNQFSLKLSFVSAADTAVYYCARHVRSGYPDTAYYFDKWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin HA1 chain
publication title Antibody Recognition of the Pandemic H1N1 Influenza Virus Hemagglutinin Receptor Binding Site.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
total genus 42
structure length 220
sequence length 226
ec nomenclature
pdb deposition date 2013-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m5zH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m5zH01
4XVJL 4JKKA 2XTLA 1NDGB 3SGDH 4NO3A 1MRCH 1T89A 1JZ2A 3TJHC 4KTEH 2VMFA 3ARTA 1TQCC 3T0AA 3VFTB 5J3HD 2QQLH 1ZHKB 4NZUH 2BVYA 1T2QH 4MDJB 1CGSL 2YD7A 1A14H 2YD8A 1ZLUK 3WKMH 4BKLA 4OUUB 1BQHA 4F7MA 2H8PA 1W8NA 4GH7B 4DTGL 4JAMB 1QHOA 4MA8L 4G9FB 1HWGB 43CAA 2GTWA 4FQQB 4YDJB 1BF2A 2ZUQB 1M7IB 1KC5H 5ADOL 3FB6A 1OQXA 4U0RB 2Y6SC 5LXGH 1Y0LA 3EAKA 1KFAH 5D1QB 2XQYG 2CMRH 3EYOB 4YNYA 5KVDL 3MV9B 1DBJL 1WFTA 4E42B 2VDPL 5IHZB 3EYSL 3WIHL 3MJ9H 4RFEB 1QRKA 2R56L 5FGRA 3PHSA 1AQKL 1FAKT 1H3VA 4KFZC 2V2WB 2ZSVB 4LPXA 4IOIB 3GM0A 5FYLD 4CVXB 5FHBH 1OGAD 3CDGA 3QH3B 1KYOJ 3BP6B 4R90H 3FO1B 2DQCL 1CL7H 4YGVA 3FO9A 1II4E 3CAFA 3RX8A 1G7MA 2YR3A 4D94A 4NRYB 4FMFA 2ENSA 4PJFB 3VFUA 1VKXA 3KPMA 1EHXA 3MRBA 2B1HH 3S36X 5FGCE 5DTFA 4APQA 2EO9A 5DD1L 2RGSA 3R4DA 5AUMB 1FVEB 2DQJL 3QXVA 3B2VL 2XKNA 2Y1VA 1Q94A 4MCZA 5D2NB 3QIBC 3TPUB 1JYXA 1EJOH 3V6ZB 3O41B 2XXMB 3L3DA 4XZUA 1I9JL 2HAZA 3KLHD 1HQ4B 3RVUC 4PP2A 1NLDL 1GGCL 3ZE2F 1W0WB 3BN3B 1X6LA 1QSEB 4M00A 4EI5B 3BOVA 2OZ4H 4M3KB 3I6LD 1LEKB 4TNVF 3ARUA 2ADGB 4JM4L 4C56D 1G9NC 2NNAA 3LKSA 3JTSA 5ICYA 1D9KD 4JGUA 3ETBF 3MACL 1M7DB 1A7NL 5D70L 1S7RB 1MAJA 3ARGD 2WLZA 4N0UE 3HS0B 1CU4L 2YS4A 1T03L 3M07A 1PD6A 4JN2A 3ZE0E 5EUOF 3ARSA 5EN2A 2F58L 3O2DH 5C1MB 1VHPA 4OAWA 3MV8D 4LCCC 3SGDI 3SO3B 5HD8D 5GGTA 2FIKA 3WFCL 5H35A 3LH2H 1ZHLA 1UADC 4X4YB 3ESUF 2FCBA 3UZVB 1JHKH 2VDML 1OP5K 2XFXA 2OJZL 4V1DB 3LS4L 3FCTB 5T1KB 2F19H 2IQAA 1XT5A 4LSRL 1UWXK 3R06A 4XTRD 3B6SB 4LCCA 4XCNB 2BOBA 1OAZL 3GI9H 4BH7B 2EYSB 3SE4C 4DGVL 5FF6A 1KTDB 4KK8D 4WFGD 4NKMB 2DI7A 4KJPC 2GTZB 4GAYA 5HVHC 2ZPKH 3E2HB 3KPRB 1CDJA 1NQBA 2G5BB 2H2PD 4HMCA 4F7CB 4LHUA 4Y88A 3MROA 3FQTA 2VABA 4U6VL 4IS6A 5EO0B 4P5TB 1BZQK 2R9HC 4DW2L 3BD3A 4OLUL 3SE4A 5JIPA 3ZT6A 1TENA 4XRCB 4FFZL 3QHTC 1N7MH 3RZWA 1N8ZB 1U3HB 3V6OE 5E56A 3AS1A 2D9QB 4YAQA 5J11B 3OKOA 2I9LB 2NX5A 3RFZC 3SDDB 3IDIA 4MA7L 3TBYB 3UTZA 3KYKH 4XNYH 3H0TB 1CL7I 3IRPX 5AAWA 8FABB 4I9WD 4QRQB 3Q1SL 3LQAL 1A1MB 2B4CH 3MLYH 4JFYB 3UDWC 4OZ4B 2HT4D 2H6PA 3TV3H 2BJMH 3EHBC 3IXAA 3ESVF 4BQBA 3BPNC 4LASH 4YZFE 3V4PL 4MCYA 1FDLH 2ZOKA 3ARPA 3UROR 2BNRD 3OR6B 1G7JA 3X13A 4JR9L 5EUOB 5I6XC 5IROC 2X9WA 1YEDA 1BEYH 4UT6H 3VWJD 5FYLL 3UDWA 4BZ1H 1P4IL 4TUJA 4K3JH 4JQVC 3HFMH 3MREB 4E5XB 1AKJA 1AO7B 3FHAA 3P11H 1W2KT 4XXDB 3O2WH 3EFFB 3OR7B 4B7LA 4BQ6A 2C4FU 5I1IH 1BF8A 3T77A 4HS3A 5K9OB 5CEXB 4TSCL 1WWBX 4XAWL 5FGBA 3SE9H 3D69A 1PLGH 1TXKA 2EIZB 4AEIH 4CGTA 2AEPL 4JQXC 1CDHA 3EW3B 1JJUA 1VPOH 4LU5L 4JQVA 4QRUB 4KKAC 4BK5A 3VD5A 2BRRH 2DF3A 3O2VH 3V0AC 1R6VA 3CU7A 4A6YB 2ADFH 4KTYA 1RULH 4KV5E 3K8MA 4BFEA 1I7ZB 1ADQH 5C9JA 1Q9LB 3MRGB 4I0CC 4HPYL 3QQ4A 3HZMB 4L9DA 3U7AA 5BZDA 1V7NH 5L2KD 5E9DA 4LF3B 3RVXC 3IFLL 1MI5B 4MQ7B 4X7DC 3PWVB 4PJ8C 5EORH 4YEEA 1U8OA 3VXUA 3NCEB 4IRSC 2Q7NA 5D7IF 4XVTL 2P4AB 3PNWA 2RCSL 4JPKH 4S1QH 3L3OB 5TFSH 1Q9KA 2CUIA 5MHSE 1CXEA 2DD8L 2GJ6D 2VLJB 3BZFA 2QADD 2E6QA 4F9LC 5GZNC 2JB6A 2J2ZA 4JFDD 4PJGA 1M6OA 4DVBB 1D9KB 4IRSA 3NN8A 1KXQE 3ARGB 5BV7H 2JB5H 5DJXB 4Z7VF 1GOHA 1FAIH 1QTYT 3DRTA 2LTQC 3AU1B 4OJFL 1ZAGA 3UJJL 3MV8B 1IQDA 5A2IH 4F58H 1LE5B 2PYFB 3DIFB 4Z7OE 4Z7UA 4MMZC 4XVUD 5JIIA 1FIEA 1DUYB 1LE9B 1WZMA 4HH9B 1HINH 4MHHG 4XP6L 2D7MA 5DS8A 2ILLA 4MD5A 1GZPA 1DSFH 4LAQL 4LCWE 4G5ZH 3CFBA 3DXAE 1HNFA 5DD5L 5BVPL 1I7UB 3WE6B 3ZTNL 5HGDB 1B0GA 3SJVE 5C0RL 3N1MC 3QAZB 2A0LD 2J8UF 5F7YC 4N5UA 2WIMA 2VDNL 5J1TC 1XGYH 3WS3B 5BO1L 1OM3H 4XPFH 1QACA 1DQQA 3L3HA 3UO1L 4M48H 5FA4B 3ZDZE 2RFXA 1KJ3H 3HKFA 4NQCD 1ZT1A 1N0XH 5IG7A 1IQWH 4LLWA 1OF2A 5DF0A 2Q3AA 4EKXA 1GCFA 2X40A 4KQ4H 1TMCB 5J6HB 3HLAA 1CLYH 3JXAA 4MD4A 4Y19E 4X7FC 5GGQH 4PRID 1NEUA 1B3JA 1JNNL 4HUXB 4NKQB 3QNZA 3RJQB 3M1BA 4KI5C 5KW9L 1CGYA 3EO1A 3B5TA 5D7IB 3U48A 4GRLC 4HJ0D 4N1HB 1I3UA 2JJUA 4S2SB 5F7EL 2R4SH 2AJVL 2W0FA 3OAUL 1GC1L 3HG1A 4ZO6A 4Q6IB 3THMH 3RWHB 4H1LG 1R3JB 1NBQA 1RJYB 4Q6YA 2ATKA 1EUUA 5ICXA 5EZJA 4WI8A 2IBGA 3C5JB 2R2BA 4JB9L 5C0AA 1NC2A 1LK2A 5DRWA 4KU1A 5A16A 3MLPA 4MYWB 2AEWA 4RX4A 4Z7VB 1K8DA 2IGFL 3V7MA 2BNRB 3ES6A 3UAJC 5IW6B 3BKCH 2VYRE 4LIQL 2XWBB 1RSFA 1S9WA 1Q1JH 3AM8A 4C58B 4K3HA 5I18L 3DO7A 3VW3H 1V05A 1ETZB 5DD3L 3QEQD 3BQUD 5KJRL 4PJ7F 3W39B 4ODVL 3TT3L 5BXFB 4NQEE 3O8XC 3Q5TA 2J8UB 2WUCL 2VERN 4L8BA 4ODXB 3MUZ1 5KOVC 3OQ3B 2XQBH 1EZVY 3OHXA 1DQDH 5D96B 4I3SH 3AREB 1N5AB 2CKBA 3HPJA 1F90L 5DD6A 5L2JA 1EX0A 4K07A 3KHQA 5I8CB 4XMKH 5C0BD 4W4OC 3SKNA 4NBYB 1RMFL 1UWEH 4MNGA 1K5NA 1F4HA 2YN3A 1TTUA 2Z4QB 4KHTH 3O8XA 2GKIA 2OTPA 1KIQB 1W8OA 5F7MC 4W68A 4Y4FD 4BSVA 2Z92A 5L2KB 3VG9C 2GJZB 2I07B 3QO0A 3ZKXC 1I4FA 2VR5A 1CK0L 1RVFL 4QRTA 2QQKH 4F7PA 4M7JL 1S3KL 1IAMA 2IG2H 2OM5A 4J6RL 1RI8A 3CXHK 3OKNB 4NFDA 2FATH 1JN6A 5DJ2B 3OJDB 3RKDD 4O02H 4D9QD 3IB4A 2GJ6B 2VITA 1WLHA 1HILB 4LVHC 5C92A 5HYSG 5GS1B 4JFDB 3BMWA 3QG6B 3K3QA 3C08L 4AMKH 1GGTA 3A6CH 1LVEA 1TPXC 3DUSA 3KJ6L 4J12A 1AD9B 5TH2B 1BQSA 3LD8C 5ELIA 3WO4C 4PRNB 1QFWL 1UA6L 2B2XH 3G08B 5DRZA 1HCVA 2A9NH 4Y7MA 5GRWA 2W9DH 2F53A 1WQVT 1ZT7B 1DBML 1OAYH 4XX1G 4ZXBA 3BO8B 4PJ7B 3GMQA 4OFDA 3F7QA 3QXDB 3D25A 4PG9A 3JWOH 1IGJB 4JEGB 1JZ8A 1KCKA 4ETQA 1JWUB 2MPAL 1JFQL 2WZPD 1IARB 2PKDA 5DC0A 5EBMA 4G8GD 3HRPA 3D48R 3V2AR 5F72S 1NMAL 2YPKA 1A6ZA 1F11A 2X4RA 4MAYA 2ITDA 3ZTJH 3BDYH 1IGIL 4M1GH 3JWDC 4GG8A 4I0PA 3VCLB 5IMLB 5I1LA 3GMOB 4QOKD 2W65A 1KN4L 4JJ5B 2FLRT 1XH3A 2VH5L 5D7JC 1CLOH 5EZIH 4NQCB 1YEKH 4M03A 5EOCL 3VD9A 1WC7B 4QF1B 4DCQA 4PGCB 1U8NB 3MV7B 2MMXA 5FAAA 1T0MA 4PJEA 1C1EL 3LZFH 4PRIB 3OGOE 1OHQA 4HG4J 1AXTH 4ODUB 1QBLH 1AIFB 5D7JA 1SBSH 5DEZA 1SQ2N 5HGGS 3MLUH 5JPNA 1HQRA 5C0CD 3L5XL 3QZWB 4JHAL 3S3PA 4WI7A 2OMBA 4DN3H 5BS0B 4KMTH 2H41A 3SGJC 3QT2A 5E2VL 4GLRH 4O58L 5HHPB 1J8HE 4YX2L 4NM4L 3PJSA 5KTEH 1A3RH 1EAPA 2P5ED 1WIUA 3C9NA 2FEEI 4LPYA 4G6AC 3UTSD 4I2XA 4XPTL 4U1KA 3GBMH 4N8PA 2VIRB 4U1JA 5D7SH 5HDOA 2FBJH 2QSTA 3D9AL 1WTGT 1AGDB 1FO0L 4AT6B 4PJHA 3VXSE 4G6ML 3G9VA 2HJKA 3IS1X 3VXNB 4UQ2A 4LGSB 5D6CA 1JWSA 4G43B 2VSDA 2R1XB 4MA3A 3QEQB 3U30B 1SYVA 2GUOB 3QB7C 3BQUB 3V52H 5DVLA 2ED7A 1K6QH 3TT1L 3OJVC 2YHGA 1NMCC 4R7NA 2NW3A 3D39E 4QXUL 4HJGA 3GNMH 3BJLA 5TPWL 3WXVL 9CGTA 1FZJA 2NYYC 3LEXA 1VA9A 4ONOA 5IK3B 2ZUTA 3WXWL 1TTGA 5C0BB 1BAFL 3L9RA 4HBQA 1G7QA 4UTBL 3X12A 1YJDL 4H88H 1BD2A 3UTQB 4Q0XH 3RIFK 3FHQA 4NCC1 4RFOH 4HZLB 1BFVH 1WCBA 2Z31A 1PVHA 3GMMB 3VFNB 5IR1B 2MQCA 3BH9B 4K71C 4PD4J 5FA3A 3LRSB 5T3XD 2HLAA 2QR0B 4OCLC 4OIIH 4RDQF 1H15B 2XKSA 3BEWA 5DWUH 4Y5XB 3PL6C 4PP1D 5CCKH 1CBVL 1A9BA 1CIUA 4MX7A 3GUTA 4YBLB 3VGAC 1RZKH 5EU6D 5GJSL 1R3LA 2FHBA 5DURD 4S1RH 4LNRB 4WDIB 2HT3D 5CILL 5CMAA 2DQTH 2ARWA 2YBRA 5L9DH 3TN0C 2EDTA 2XZQL 5HHOE 4X6BB 1MRDL 1VB9A 2VZSA 4R6UA 2R29H 1I8KB 2WQRA 3WFBH 2BNUB 5DHVA 3O9WC 4ZPVA 3L3KA 15C8H 4M8VA 5IB5A 2Z8WC 4PRDB 3TO4C 4DOHE 5MENA 3PGDB 3GMPB 2VKXA 2YPLD 1A7OL 3LKNA 5DQ9A 1U8IB 2H9GB 4Z7QF 3GSWB 3JVGA 4IRJB 5F7LB 5IIEA 5KSUB 1ONQB 3N1GC 4MXWH 1QFWM 1RZIB 4PY8I 4MGXA 3QEGH 4G8GB 5HXMA 3NTCL 1B9ZA 3MRPA 4N0CD 5E2UH 3TO4A 4FQXD 4MDIA 3QFJA 1KEML 1DANT 5ALCH 4G9DB 4QXWA 3FB5B 3A0OA 2D3VA 3UTPD 1W72L 4R4BB 4QOKB 3LIZL 5CJQH 4JM2C 4QYOB 4OCYL 3S4SB 5J12C 5FKAA 1I1YA 2BOCB 5TDPB 3CUPA 3IDJA 3EOAB 2CDEB 2HVJB 3O3UN 5C08D 3PWLB 1YEFL 4AEHH 1OSZA 2Z91B 4JHWL 1U0QA 2DLFL 3G6DL 3ABZA 1FL5A 3GBLA 3MRIB 1AGCA 1L7TH 2IANB 4PLKD 5BMFH 2EYRA 3IXTA 4HCRH 4U1SB 1SVZA 1KCRH 1GGBH 2W1NA 4R26L 4JCLA 4CN1A 4LPUA 4JRYA 3BH8B 3TPKA 5F6IB 1T80A 4NC1E 3JV6B 1U8PA 4UDTB 1BQLH 3TBTB 2NY1C 4J3VA 5E2TH 1F3JB 4LAJH 3HAEA 1UM6H 1K4DB 2P5EB 2DM7A 2EDHA 2Y9RT 1XGPB 5F9DC 4ZUVB 3D5OF 3DMMA 3UTSB 3Q5OA 5JLZB 4H1LH 4PRHE 3V5DB 5FIEA 3CFJA 4OUOA 4YDLB 2DMKA 4ZD3L 4YHIA 4CMMA 4M5YL 4N8VB 4MNQB 1FV1B 1LEIB 1HSBA 1VACA 1AXIB 2OJEA 4H0GA 3I6GA 5IM7B 3ULVC 1NCCH 5BQ7A 5JDJA 3TVMB 2VTFA 3IS0X 3NCFB 4G8FB 5DJ0A 3TCLA 4ZUTB 1WITA 1PFCA 3QA3B 1QLEL 1T4KB 1NAML 5DVOA 1OAUH 5FYKU 1V5JA 1I3RB 1AR1D 4C83B 3GKWH 2J12B 1G9MH 1NUGA 1YY9D 3GGWA 1CVSC 2Y7QB 3O3DB 4JFOB 4RGND 1BVLA 3L7FA 3VWKD 4NGHL 3BHBA 4J7RA 4NKOA 5HHMB 5GS0H 2VKWA 1LO0L 4KKBC 3EJYC 1WZ1L 5SWSE 1F5WA 3MBED 3ALWA 3SOBL 3L95B 4YDKL 3TBWB 3QYCA 2AAVA 2DQUH 4XVJH 4NUJA 1I1AD 3FFCD 4IJ3B 3HPLB 2EDEA 4JPWH 1JNLL 1K8IB 3GSXB 5D1ZD 4MHHI 3GIVA 5DQJB 1ZLVH 3ZKQD 2EDXA 3MCLL 2ZNXA 5HYQA 3Q48A 1CGSH 1RIHL 2W9EL 3TNNB 5DMGD 5EU6B 3WLWD 5F6HI 3ARBB 3QNXB 4M7LT 2DIAA 5DURB 3CZFA 5FK9B 4C4KT 4HWBL 2I25N 5I1HL 4DTGH 3UBXB 1VFBA 1DE4B 4MA8H 2HH0L 2P7TB 3FQRB 2UZXB 2V2TB 1KT2A 5F1NB 3HRZB 3DLQR 4LLMA 3HNVH 4FTVD 5ADOH 3VRLE 1ES0A 1YDPA 1S7XB 2PXYD 3HZYA 4PTUA 1T7WA 5DK3A 5I75B 5DEFB 2V6HA 3ZKMD 1HH6B 3H3PL 4X4ME 5KVDH 3B43A 1F00I 4GSDL 1DUZB 1DBJH 2YPLB 1T2XA 2VDPH 1YMHA 3EYSH 3WIHH 5HHXL 4P4KB 2R56H 3VH8A 1AQKH 1WUNT 4LK4A 3WHXA 4B41A 1YY8A 4LSQH 1Z5LB 4XPAL 5ITFA 4FQXB 2DQCH 1I75A 2ZOLB 3CZJA 2DQGL 3MRFA 4PJBF 1NJ9A 5ISZD 3V0VA 1TZHA 4ZQKB 1LO5B 3I3EA 1YYML 4HIHB 5CIPH 2F5BL 4U1NB 4UQ3B 3D3VD 1QVOA 2YWZA 4YHZL 4QRSA 3SPVB 5IMOA 4K3EH 2QSCL 5TDOA 2RJMA 3WS6C 3N0PB 2H26B 1NBZB 2DI8A 3D18B 4JHBA 3Q6GL 2FYYA 5DD1H 1GZQB 5A2LH 2DQJH 3B2VH 4HWZA 1OB1B 1SMAA 2J88L 5EC2B 2CDGB 3RJDA 4MJIB 5JORA 4HGWA 1I9JH 4R2GC 3ZYJA 3GSVB 1GOGA 3MRDB 1NLDH 5DJZB 1GGCH 3DNKA 5E5MB 3VFWB 3WS6A 3N85L 4X5XA 4MD0B 5MI0C 4ZUSB 4TVPL 5CBEB 5E99H 3E6HA 2VLRE 4YC2C 2APVA 1LNUB 2V9RA 3WLBA 1I3GL 1ZE3C 1IGCL 3MACH 1N59A 1A7NH 2NY6B 5D70H 3QIWD 4CN6A 4XHJD 2G60L 3DSNA 5CINL 3W0WE 1CU4H 1QSFE 1NDGA 1T03H 3RGVC 2R1YB 3PQYE 4J1UA 1S7TB 4P2RD 3F7YB 3VFTA 5L0QB 1HHJB 2EDKA 2J7LA 1ZHKA 5MEOA 3ZHDA 3WFCH 1TZGL 2N7AA 5GZOD 3P9MB 2DM2A 2AJZA 5ILTL 2DKMA 4TOYH 4ORZC 1Q9OB 3LV3A 4V2CB 4OUUA 5CS7A 1CVRA 2HTLC 5T1DL 3QDJA 1U9KA 2Z35B 2OJZH 1JF6A 3LS4H 1UZ6F 4G9FA 1VEOA 3QQNA 4PV9B 4C59B 1M7XA 3GJEA 4LSRH 1ITBB 3MO1A 4FQQA 3H8NA 5JW4R 1ULVA 2GK2A 2I24N 3QDMA 3QZWG 4TPRH 4PJBB 1OAZH 4DGVH 3MOBL 5DZOA 5D1QA 4RGNB 2JCCE 3BPLB 1IZKA 3LHPL 1MLCA 3OF6A 1TJHL 2K9UA 3C6SB 4E42A 1EFXD 5IHZA 4U6VH 4EQ3A 4DW2H 4U31A 4RFEA 4MVBC 4OLUH 3ZDYE 2OL3B 4FFZH 3QUKB 3ARXA 3T0BA 3HC3L 2V2WA 5F9AC 5JZ7C 4YHOL 3QH3A 3BP6A 4PYHA 3REWB 2OBGA 3JV0A 1I1AB 1IM3B 1DLFL 3CDFA 4OBRA 4MA7H 5D1ZB 1E4JA 3WBDA 1PQZA 4PPTA 2Y25A 3Q1SH 6FABL 3W9DB 3MSPA 1L0QA 4RCAA 5DZNA 1NGZB 1U8HA 2NY3D 3LY6A 1FL6B 1CLZH 3VFPB 3O4OB 3I75A 4KJWC 2QBWA 4BK4A 5DA4A 5KSVB 3W81A 4TSBH 4P59L 5FO8B 4JR9H 1CD0A 1T1ZA 5D2NA 4FTVB 3TPUA 2VLKE 3V6ZA 4QWWD 3O41A 2PXYB 4PJ9C 3BE1L 4RNRB 2FH6A 5FYLH 1HQ4A 1P4IH 2LQRA 4WU5A 1S9XB 4X6EA 3TGXA 5I74C 5DUML 3HB3C 1W0WA 1QSEA 4EI5A 1JUFB 1RIUL 1KNOB 1PEWA 1CFVL 3BUYB 4PJCE 3PE9A 3RIFF 4FG6C 4TSCH 1A64A 4L4TB 4XAWH 5F9OL 4P46C 2FGWL 4JO3L 1D5MB 5ERWA 1S7RA 3HS0A 3E0GA 4LU5H 3KYMB 1J88A 5FO9B 2XN9E 3IU4L 3D0VB 2FBOJ 3MV9E 1P4BL 1FYTD 2DICA 2Z93A 4QHKI 3SDAC 1C5CL 4B0MM 3EYQD 2JKXA 3EO9H 4X4YA 3TWCL 4P46A 4Z77B 1OVZA 1ZGLA 4Y5VC 5CJOH 5TF0A 1R0AL 2BX5A 3E2HC 4N0FA 4HPYH 3H9SD 5AZ2L 4XAKD 5F8RC 3FCTA 3FQUB 1DQML 5T1KA 5F9WC 5J9PB 3B9VA 1JYNA 3NCBB 4XCNA 5KAQF 3NVQA 3IFLH 2EDNA 1T04B 4BH7A 2EYSA 2PTTB 1EPFA 1YYLL 5ENWB 2VZ1A 4ZNEE 1NUNB 4NKMA 4ONFL 4X83A 4OTXL 2RCSH 4PJFE 4ZYKB 5I8EA 3KPRA 2BC4A 2G5BA 4PJDF 3ZSSA 1FJ1B 2ITCB 4HIXL 4F7CA 2DD8H 2QTEA 4XX1E 4JFQA 1GPOL 2AVGA 4JVWA 4Y4HD 4EN3C 3RNKB 1U58B 4P5TA 3MJ8B 3MOAL 4XRCA 3J8F7 4RZCA 1RZ8B 1PX3A 4NJ9L 2G5RA 2HWZL 3MV01 2YRZA 1BFOB 2AKRB 4J3TA 3KPQB 2ESVB 1RHFA 3L3JB 3S4SG 4OJFH 2YMXH 5B39B 5LBSL 1CGUA 4P2RB 3SDDA 3UJJH 4YIQA 3TZVD 3TBYA 4ZFGL 1BECA 1A2YB 2DKSA 3F12A 3F7PC 1T20B 3H0TA 8FABA 4QRQA 1A1MA 4PV8B 3SDCC 3DV6B 4JFYA 3BUTA 4OZ4A 4Z78B 1KTLB 1QBML 1Y6NR 2ICES 4LAQH 3FOLB 2VWEE 3QWOA 5DD5H 4KXZI 5BVPH 3T1WA 5C0RH 3VXRE 3OV6A 1FGVL 2P45B 5KVFL 3BWUC 4M6ML 1TIUA 2VDNH 4K7PL 4RMQA 3ARDC 1OOAA 2R23A 3SDCA 5BO1H 1CXLA 5FOBA 1B4JL 1UYWL 3UO1H 3GB7B 3MREA 4V1DE 1IAII 3HI1B 1AO7A 4K3DL 1GGUA 3EFFA 3OR7A 3K0WA 5C6WH 3O0RL 4ZUWB 3PABB 1B2WL 3RU8L 5K9OA 3EJZD 2Y07L 1L6XA 3MRRB 5ESVB 3NIGF 2IPKB 3RWJA 2EIZA 2ZZUT 1JNNH 3EYVB 4N8VG 2GY5A 3W9EB 5KW9H 1TDQA 4QRUA 3EDEA 3K2UH 4RA0C 3O4LD 2CIKB 4PJDB 4ZFOB 5F7EH 4A6YA 2AJVH 2PN5A 3KYNB 1GC1H 2B1AL 4JVPA 2Q87A 2IH3B 2A6DA 1Q9LA 5C0NC 1JHLL 3MRGA 5C07A 4M7LH 3HZMA 1DVFB 3KPSD 4JB9H 2NY3B 3DHMA 1BVKA 1MCIA 2P5WE 5DGRA 5H37H 4X9GA 4HAGA 5ETUB 1PKOA 4LF3A 2HFTA 2IGFH 2C1OB 1A22B 5KN5A 1MI5A 4YHNA 1R5IA 1N0LA 2CLZB 3B9DA 4XCCL 2FL5B 1ED3B 4XWOC 4LIQH 5LKNA 1FFOB 1MCWM 5D1XC 2NY2C 1A6VL 5I18H 1WIOA 4Z5RA 5C09D 2VLJA 1OQOA 5DD3H 1OTUD 1P6FA 3MRKB 4JANB 4X99B 5DLML 5KJRH 5EUOE 3QXAB 1F2QA 2AXJA 2OSLB 4ODVH 1CDIA 1S7VB 5JOFB 3FAWA 1NGPH 2WUCH 4NKIH 4HKXA 4GRMB 1NL0H 2M1KA 4M5ZL 3AU1A 3RL2B 4YHPB 1F90H 4P23D 5J13C 3MV8A 3DOSA 2PYFA 3DIFA 1RMFH 1FZKA 4K7PY 3UYRL 3RUGE 2DQIL 1LE9A 5B3JE 3IDGA 1BREA 4PUBL 5FYLE 1N6UA 3H9SB 1OGAE 1QR4A 3MODL 1I7UA 3WE6A 1KF9B 1BFTA 5DMIL 3BKJH 2A83B 1NUFA 1CK0H 1K3IA 4O2EA 2Q1EA 3SCMD 1XIWC 3KXFE 4M7JH 1S3KH 4J6RH 4PRPD 3WS3A 1YEGL 4YR6A 3P4NB 5E00B 4ODTL 2X1PA 3KPLB 3S3JA 5FA4A 3K1KC 2BFVL 1DZBA 1FVDA 12E8L 3R8BB 4XNZB 3BIBX 3RZCB 5J6HA 2FRGP 1ZKAA 5I1AA 1FORL 3JUYA 3C08H 5I0ZA 4PJAE 5TQ2H 1HHIB 3KJ6H 4PGEB 1CICD 1YZZA 2F54D 1DEEB 1EIBA 1RHHB 4WRLA 3PWPD 1QFWH 3KHOA 1UA6H 3MR9A 4ZS6D 4JRXE 3TZVB 1CDCA 5D5ME 4C56E 4Q6IA 2C7UA 5IHUL 1DBMH 1R3JA 5E6IC 2B4CC 5HDLA 4LPTA 5D2LA 1A5FL 2OR9L 3C5JA 2W60B 2Y06L 5E2WL 4U1GB 1UQSB 2MPAH 5H8DA 1JFQH 3B9EA 5GISH 4Z7VA 4NZTH 5FECA 2BNRA 2ADJB 2DBLL 1NMAH 4M1CD 3SKOB 2XWBA 2MQ0A 3G6JB 2E9WA 3GZKA 3RI5K 3O6ML 3OTTA 4XXCC 1MCLA 5HYJD 4HULB 3BN9D 2VH5H 4BELD 4OV5A 2CQVA 3DV4B 4Y2OA 5EOCH 3DTXB 4L3AA 3Q3GB 1I8IB 2DQDL 1KTKE 2X89A 2BSTB 5T1MA 1GL4B 5BXFA 4H25B 2WSKA 1C1EH 1WICA 2J8UA 5CSBA 4WFGE 3QUXD 4ODXA 5J06A 4XXCA 4XBGB 3PWUA 1FL3B 1YQVL 1MFDL 1BJMA 4Z76B 3VFVB 3QCVL 4OKDA 4LGRB 3AREA 1N5AA 3G6AB 5KSAD 2OR7A 3L5XH 5BVJB 1V7ML 5I8CA 2DB8A 5T3ZD 4JHAH 4CJ0A 2PTUA 5IOPA 1JF1B 3D0LB 5KS9A 5IB4B 2Z4QA 1MWAB 4OKVB 4FN0A 4X4XB 5CJBA 5E2VH 4O58H 2P1YA 4NM4H 3V6FB 3RY6A 1X5YA 5E7BA 2XZCL 4XPTH 5D7IE 2FEDD 5L2KA 3OGCA 2NPLX 4IRZL 4L8DB 2GJZA 2I07A 3GHBL 4OZGE 2ED8A 3D9AH 4GBXB 2A74B 3AUVA 5JHDD 3TJEL 4AIOA 1FO0H 2E7HA 3OKNA 1M4KA 4I9WE 1YN7B 3C60B 3CVHL 4G6MH 2X09A 1RUAL 5C09B 2GJ6A 3T1FB 1MREL 1FVCA 2UY6A 1HILA 3PWNB 5GS1A 3QG6A 1J0ZA 5A43C 3TT1H 5TH2A 3CC5A 1AD9A 4QXUH 5HYIA 1AJ7L 2XOTA 4PTTA 5BV7C 5TPWH 4FQ1L 3WXVH 4R4ND 25C8L 4QTHA 3VI4F 3BT2L 1EO5A 3QQ9C 3S7GA 4FA8A 1T5WB 2D0FA 4PRNA 3G08A 1CN4A 3IRZA 3WXWH 4QHLA 3CIQA 1FG2A 1BAFH 1GAFL 4ZFZB 4R9HA 2XA8L 1ZT7A 2DL2A 4OFPA 4L9LC 1IAOB 3QEHA 4XCEA 1N2RB 1YJDH 5TE6L 1AI1L 4PRAB 5E8EB 1NGWB 1LILA 1WZKA 5AWNL 4D8PA 4LIQE 2VAAB 5D7KD 1IGJA 1NGXB 3H7LA 5FM8A 1PSKL 1T1YB 1A9EB 3MJ6A 1KB5L 3BP7A 2VQTA 4OBSA 2PR4L 4MA1B 4W6YB 5E95B 1INQB 1X3DA 3VCLA 3C5ZC 5IMLA 5JTWA 3GMOA 1CBVH 1T2JA 3OL2A 4QRPB 2N56A 5GJSH 5DJAB 2R0ZL 2VE6B 5FUZL 5JHLL 5DJDA 1WC7A 5K59F 3O3EB 3K8KA 1U8NA 1D3CA 3DURA 5CILH 3TFKD 2NR6C 2Z8VC 3MV7A 3CGTA 2WW8A 3KNBA 2XZQH 3KG5A 2O5ZL 1MRDH 1ZA6A 3C5ZA 1UXWB 5CJ5A 1CICB 3CSYA 1QBAA 2F54B 3F8UB 2UVFA 3QZWA 3BIAX 1U3ZA 4PYGA 5IWLA 4RQQB 4APQD 1KJMB 4HIEB 5BS0A 5FB8B 3C8KA 4JFDE 3QDGB 4XH2B 4QHMB 5FUOL 1YN6B 3GI8L 3ROLB 1A7OH 1QUNA 5HHPA 3BAEL 4P3DB 3TP4A 1HI6A 4OD2A 3T0EC 2WINB 3NTCH 1AGDA 1CWVA 4HUVB 3LMJL 1KEMH 4AT6A 1IC1A 2KQMA 4PJ7E 3X11B 2WNGA 2UYLB 3FO2B 4P48A 5HYJB 3LIZH 4NN5C 3VXNA 1OTTC 4LFHD 4OCYH 4DKFL 3RVUD 5IEHB 2COQA 2R1XA 3T0EA 3DVGA 3GJFA 4NRZA 2X41A 2GUOA 4P2QB 5SX4H 4HUWB 4X98B 3FN3A 1EH9A 1YEFH 4LVOC 4KGLA 2OR8A 2BMKB 4JHWH 2DLFH 2NZIA 1C16B 3G6DH 5C6TL 1J87A 1HSAA 2NY0B 4Z7WE 5F1SA 2R0WL 3RWFB 2KUTA 2XWTB 4NQCE 2W9LA 5BW7C 3BZDA 5KSAB 5I15L 2JJSA 4EI6B 5AYUL 4WUUB 5C0BA 1L9NA 2IJ0C 2VDKL 4R26H 5GHWL 3SKMB 3TO2B 2XTJB 3UTQA 4PRIE 3IJYB 1LD9A 3GMMA 3OB8A 2H32B 3VRIB 5E03A 1EVTC 3BH9A 3LRSA 3RVTC 1NUDA 4R97B 1QSVA 3NCCB 1H15A 4LHUD 4POUB 1T3FB 5JHDB 4P2YA 3SDXE 3TA3B 4LBEA 1JZ5A 2R2HB 4N8CL 4R4FL 4ZD3H 3ISWA 4M5YH 4H8WH 4ERSL 4O2CA 5ICZB 1Y18B 1KB9J 5HJ3A 4S1SH 5EU3B 4WDIA 2NX5D 5GIRA 4LEXL 4WTWA 4HK0A 4KKLC 4GW5A 4DWHA 1QLEH 3FB7A 4HLZH 4X6BA 3RHWK 1J9CT 1NAMH 4Q9BA 3ZKNC 3QI9B 2HTKC 1OAQL 5F88A 2BNUA 1RUKL 3BVNB 2IBZX 4BKLB 1QKZH 3BP5A 4B50A 3TBSA 4NFCA 3QEQE 4CDGC 4FQLL 2UZYB 2Q8BL 4NGHH 43CAB 4X6CA 3PGDA 4OZHA 2DRUA 1TQCB 3H42L 1LO0H 1V8HA 4N1EA 1KCUL 1U8IA 4IRJA 2E6JA 1ONQA 5KSUA 5JOPD 4KRPD 2KDGA 1CGWA 4E41A 4I1NB 4YDKH 1PKQE 1AKJD 3RX7A 3G9AB 4ELME 2OI9C 2RHEA 5JW4Q 1UENA 1OD7A 5CP3H 1JNLH 1YEHL 2EYTB 4WFFD 5CEZD 4QOKA 3MCLH 4UILL 5EWIL 2W9EH 1RIHH 2C3VA 4QYOA 2DTMH 1DR9A 3L7EB 2YD5A 3G5VA 3KAAA 3IDYC 5GRVK 5TDPA 4EBQL 2WK2A 1HHGB 2CDEA 2HVJA 5I1HH 5I16A 3L1OL 2OQJB 1NMBL 3PWLA 2PW1B 2HH0H 3FO9B 2C4XA 4XHQA 1SBBA 4OF7A 1G7MB 3NIFE 2NY5H 1CFNB 5IVOA 3DGGB 2H1PL 3MRIA 4OM1L 2IANA 1R3HB 3HE7C 3DPBA 1VKXB 3S36L 1Z0MA 5E9DD 3H3PH 5DTFB 5SWZA 5BRZB 3IF1B 4XMLH 4LSPL 4NQDB 4GSDH 3QUYC 2FH8A 3I50L 4JFFD 4UDTA 3TBTA 3UJIL 3CMOL 1F3JA 3WIFB 4KTDL 3VXUD 1ZT4A 5HHXH 4RRPG 1DJSA 1XGPA 5E1HB 3UTSA 1FNEA 4PP2B 1MCPL 5IVNA 4UTAH 4WTXA 4S1DC 3V5DA 4F9PA 5C71A 3GHEL 5GGTL 3T4AB 4Z7NE 1G9NL 3WUWA 1H3PL 2DQGH 3QUYA 2P44B 5SV4A 4PJ8D 4MNQA 1FV1A 3QIBB 4W81A 4E9LA 3UZEA 1XF3B 5ICYB 4B53A 4IRSD 1YYMH 2F5BH 2MCG1 4NC0B 2Q76B 4LLQB 1SEQL 3TVMA 4G8FA 4OD1L 4YHZH 2XY1A 5IFJA 5E4IA 4G8GE 4JN2B 2QSCH 1AXSA 2K1MA 3QA3A 2J5LC 2FECL 3Q6GH 5GZND 5H35B 3QCTL 1ZHLB 1JGLL 3RKPA 1TCRA 2J88H 1H3XA 1HOCB 1WK0A 1KCSL 1QO3B 2Y7QA 3O3DA 4JFOA 1U3YA 4L8SC 5INCA 3MLXH 5EOCJ 5EIIB 2IQAB 1TVDA 5D7LA 3R06B 3N85H 4GFTB 4MLSA 4RMTA 4LCCB 4TVPH 1DBAL 3S6CA 1A6WH 4GOSA 5GGSB 1I3GH 3IDUA 1IGCH 1TVBA 2V17L 4GAYB 4MJ6B 3TBWA 2VZUA 2G60H 5CINH 5C0CE 2EKSB 4HS6A 5HI3C 1MCNA 2IC2A 1J0YA 1LWRA 3DROA 3UBXI 2YD9A 3HPLA 3FQTB 3MLWL 1K8IA 3GSXA 1FFPB 4MS8D 4X8JA 3RI5F 3I02A 1RZKC 5ILTH 3TNNA 2P5EE 2BSED 3ARBA 1F02I 1QFPA 4MXVF 5FHBL 5DK0B 5FK9A 3V8CA 1MVUA 1MCSA 3CCHB 4YAQB 5T1DH 4TNWK 1NPUA 3O6FC 1CDGA 3UBXA 1DE4A 1B6DA 2P7TA 1MEXL 2V2TA 4CDHA 3IDIB 5F1NA 3UTZB 3HG1D 3HRZA 1FZMA 3W5MA 3QULB 2AJSL 3U7YL 1FBIL 3BW9A 4KI5D 5DEFA 1MCBA 3IXAB 4Z7QE 3O6FA 4N5EC 4RX4D 2ZOKB 1G7JB 4YDVA 3X13B 4LEOA 1DUZA 3LHPH 2YPLA 4PR5A 1TJHH 4K8RD 5I8KL 3NFSL 1CDYA 1YEDB 4M6OH 4GW1A 4P4KA 4ORGA 4Y5YB 1JPTL 2MTPA 4L29A 4TUJB 5T1LB 3HC3H 3MYJB 2WWMC 3QJHB 2RIKA 3IVKA 1AKJB 2FX7H 3BPNB 1Z5LA 4FQXA 3DBXA 4Z7UF 2F8VA 2ZOLA 4QLRA 1DLFH 3UAJD 4ZQKA 5I6XB 1LO5A 3AC0A 1QPXA 2ICWJ 3W11D 1OW0A 3D69B 2GFBA 4DKAA 4OSUL 1XZ0A 4U1NA 1ORQB 3EDDA 6FABH 3DJ9A 5FUCE 1X5LA 5T3XE 3SPVA 5ID1B 1U95B 3I9GL 4UAOC 1OTSC 2H26A 4JGJA 3VA6A 5ANMA 1GZQA 4P59H 5C9JB 1MCEA 2BP3A 3OAZH 3S35X 2E9IA 3O8XD 5EC2A 2CDGA 1T83C 4JN1L 6CGTA 4MJIA 5EU6E 1NGYA 3OXSA 3BE1H 4HWEL 5CKGA 1X7QB 1N26A 3QQ4B 3GSVA 1H3UA 2OX5A 3MRDA 3LKQA 3ULUL 3IFNL 5E9DB 5E5MA 5I1DB 3ZKSD 2A77L 4HWNA 3T09A 4MD0A 4ZUSA 1ACZA 1RIUH 5CBEA 4GRWH 1U8MA 1CFVH 3VXMD 1DN0B 4JFFB 2WMPA 1LNUA 1FH5L 3VXUB 5F9OH 2FGWH 1UJTA 3UYOD 3PNWB 1HIML 5MEPB 1TJIL 4JFXA 2R1YA 1ZLWH 1LP9E 1UCTA 3IU4H 3F7YA 2JB6B 1LDPL 4OM0H 1P4BH 5D72L 4PJ8B 3P9MA 1C5CH 3ZLQC 1N7ML 4KI5F 4IDJL 4IRSB 5F71A 1KYOK 4P2OB 1Q9OA 4FQHB 4QRRB 3TWCH 3K4DA 3NN8B 1FGNL 2HRPH 4Y4KC 4FQCL 1R0AH 4QNPF 2Z35A 5AZ2H 2WP3T 4F37K 1DQMH 4PV9A 4E0RB 2F53D 3KYKL 3QBTB 3T2QA 1ZLSL 1V3MA 4PIRF 1X4ZA 3UTPE 1QZ1A 4JZOB 1G9MC 1YYLH 3NCYS 5CJ8A 3QDHA 1YNKL 4ONFH 1GZPB 1SJXA 4OTXH 2LTQB 1KTRL 1MCJA 4JPIA 5F7WC 2YKLL 1BLNA 2EDDA 5C08E 4HIXH 2HT2C 5GS0C 2X4NA 3AB0C 1GPOH 5IBUB 4HLJA 4MAYD 5L6YL 1D7FA 1YUHA 4EVNB 3RDTC 2XY2A 3QPQD 35C8H 2O93L 2OL3A 2A6JB 1P69B 3OAYH 1VSCA 1DQQB 3QUKA 4NJ9H 3L3HB 2HWZH 3QUMB 4F8TA 4X9FA 3LDBC 5IG7B 1IGML 1I1AA 3L3IA 1OF2B 1IM3A 5CEYB 5LBSH 2PUQT 5JR1L 2APXA 4YFLF 4ZFGH 2F74B 1R3KB 2MSPA 1NEZG 3OPZL 3W9DA 4Z18A 3M1BB 1VPOL 5D7JD 5K9JL 3EO1B 1FL6A 1QBMH 5DHYB 4CADA 5EULV 4K8RL 5DHXB 4FQJL 3KWWA 5FO8A 2D7TL 1FGVH 1YEIL 3UCRA 4M6MH 2VN4A 4K7FB 3ZO0A 3FOMB 4RNRA 1EDQA 2ATKB 4K7PH 3A6BH 1GVIA 5DC9B 4JDZB 2R2BB 2HJFA 1B4JH 1PG7W 1UYWH 1LK2B 2EICA 5A16B 2BVOB 4GRLB 2E8ZA 1KSRA 1JUFA 3JSSA 1KNOA 3ES6B 5IJKC 1BQUA 3O0RH 3BUYA 2GHWB 1B2WH 3RPKA 3RU8H 3HUJF 4PRBB 5IKCB 4L4TA 1H3GA 4PJBE 3ZL4H 1IEBB 2Y07H 1S9WB 1D5MA 4JPKL 5IW1A 1XR8A 5KSBF 1BZ7B 3OB0K 2WQ8A 2FJGB 3NAAL 4G6AD 4OGYL 2CKBL 1XF2B 1YPZF 3KYMA 3QEUA 3D0VA 3KJ4C 3JUZA 5GSVB 4L3EB 1F97A 1B0RB 5IBTL 3GMRA 1MELA 2B1AH 4WHCA 3L5JA 4X9BA 3OHXB 3HZVB 3BP4B 4KGJA 3L5WA 5IB3B 3FQUA 3HPJB 3FFCE 1BQHG 3FQXB 3RHWF 1JZ7A 1T04A 3O8XB 1BD2D 2EDBA 4XCCH 4XPHL 2XIDA 2VWEC 2J8HA 4BSVB 2Z92B 1A6VH 2ITCA 4IOFC 3STBA 4PJEF 4O00A 2O61A 3RNKA 4F7PB 3VXMB 3VXPB 2DLIA 4HC1L 5DLMH 3MJ8A 4FTVE 1NC4B 1WCQA 2GITB 2WWKT 4O9HL 1RZ8A 3RA7L 3U7WL 1KJ3L 4H20L 2D2OA 4WHYG 2ESVA 4D3CL 4M5ZH 3VG9B 3ZKXB 5B39A 1MJUL 2IMMA 1F6FB 5ITBL 3PL6D 1A2YA 1T20A 3UYRH 5GS2D 2DQIH 4BFGA 1QD0A 3MXWL 2VAJA 4PV8A 1HN1A 3DV6A 3QXUA 1YEJL 3HUJB 4Z78A 1CF8L 3U79A 4PUBH 4YHYC 1KTLA 2WANA 3EOYG 5GGRY 5KSBB 3FOLA 2IBBA 3MODH 2ZNWA 1YPZB 4LVHB 4LDEB 5MEND 2CK0L 3TN0D 4PGJA 5ISZE 3THML 2GQHA 2WM0A 3H9ZA 3QRFM 4OLYL 3V9FA 1TPXB 3GMQB 1YEGH 1SJHB 3AAZB 3D3VE 3D25B 1X5GA 4ODTH 3LD8B 4PG9B 4UNTA 4UOJA 5F3BA 4ETQB 3GB7A 4ODHL 3WO4B 2HG5B 4OGXL 4OIBA 1G84A 12E8H 1SJVA 1F6LL 3TO4D 5I1CL 1A6ZB 3PABA 2ITDB 1XGTA 3QFJD 3ILQC 2VNCA 1HCFX 3RWDA 4FMKA 1FORH 4NOBA 1ZTXL 5ESVA 2IPKA 1T21A 1Q1JL 2AJ3B 1U3JA 2VN7A 2YEZA 5IFAL 3B9AA 1XH3B 3P0VL 3EYVA 3W9EA 3G04B 3AS0A 4DCQB 5IVXA 3NFNB 3NIDE 4LFHG 3BYTA 4GXVL 1BBDL 4PJDA 3TYFA 4ZFOA 2FD6L 5C8JB 4J2XA 3KYNA 1CT8A 4PJEB 5IHUH 4D9RE 1OLLA 1IT9L 2IH3A 3LQAC 4G3YL 2NZ9D 1A5FH 5D7JB 2OR9H 4I3SL 2VXQL 1DVFA 2Y06H 4KDTC 5E2WH 1I85C 4N1CA 4M9OA 3EKCA 5JPNB 4U1MB 5ETUA 2FO4B 1K85A 4P2RE 1UWEL 2C1OA 1UXSB 2DBLH 4JRYD 4LOUC 1ED3A 5IVZA 1IEHA 3DARA 3MA9L 1TETH 3O6MH 3DVFA 3PJSB 1EAPB 1RK1A 1FFOA 4M61B 4I2XB 3DMMD 4U1KB 1L7IH 3W2DL 1ZGLP 1HKLL 4HW6A 3OZ9L 1KLFA 2PW2B 5C0IB 2QQKL 2DQDH 3RUGA 2BNQE 1J11A 2XXCB 3V5KA 2MCPL 4LHUG 2EZ0C 1S7VA 4HQQL 1P9MA 5JOFA 2NY1D 1D5IL 1MNUH 2HJKB 3QNYB 4OLWH 4GRMA 5D6CB 1K4CA 1YQVH 3MMEA 5FDYA 1CXFA 3QCVH 2V7NB 3RL2A 4HZAA 4LLDB 1SYVB 5MP6L 3CFCL 1V7MH 3S37L 3KPOB 4U3HA 5C6PB 5CZVL 2ERJC 3REVB 4HJGB 3EDKA 4GMTH 4DKDC 5JXAL 3I6KA 3LEYL 5EFIA 4XNUL 5E1AB 3H9SA 4BUHA 1MH5A 3BKML 4TNWF 2XZCH 4IRZH 1T66D 1E4XL 2YD4A 2A83A 3GHBH 3L9RB 1M05A 2XWJA 3F6IA 3NFPB 3WDHA 4RAHA 3TJEH 3X12B 4EDWL 1BD2B 1NMCB 4U6YA 4D0CB 4LARL 2RR3A 1DQLL 3CVHH 3JWOL 1KELL 3KPLA 5KVGL 3MLTA 2KQNA 4P57B 4JO2L 5FA3B 4X6DF 1RUAH 5HD8C 1MREH 3RZCA 4HUKB 3BEWB 1L0YA 1CI5A 2OLDA 4KKBD 4IIQC 3D87B 2VXVL 2W59A 4JM2F 4DGIL 5C0JB 3WHE0 5IV2A 1CLOL 1AJ7H 2HKFL 4PGEA 4TTGA 3LQZA 4FQ1H 1R3LB 25C8H 2Z9TA 4K71B 5I17A 4HFUL 3BT2H 1DEEA 5EZLB 1RHHA 4LLUB 4AK1A 4XTRC 3ZE1E 1MCRA 2EH8L 2DOCA 2D7OA 5J56B 2G9HB 3PL6B 1N4XL 4FFWC 4KK8C 1F3RB 1GAFH 4IIQA 2XA8H 2PYEB 1QLRA 1IL1A 5TE6H 1AI1H 3VGAB 1BBJB 5AWNH 2W60A 5DHVB 2XICA 1PSKH 1UQSA 5BZWA 4GKOA 3OKKB 3L3KB 2R2EB 5IQ9A 1IJ9A 2MNUA 4DN3L 1KB5H 2ADJA 5MENB 1J0IA 3TN0B 2EDWA 4UI2A 1FYTE 3LKOB 2PR4H 4R7DA 4P9HL 3RBGA 1JVKA 3G6JA 5DQ9B 1A3RL 4I48A 1X6NA 4DZ8A 1BIIB 5C3LD 1RJZA 3NIGE 4XB7A 5E70A 3O9WB 1NDMB 2R0ZH 5K9KA 4XAKE 5FUZH 5JHLH 3VJ6B 1J1XL 2D03L 3E3QE 2UWEF 3TO4B 4H0HB 4MDIB 1MCOL 3QFJB 1JPGB 5IF0B 2FNBA 5KG9B 3Q2CA 5F7DB 4XCYB 4OCXL 2O5ZH 2HT4C 5F96H 3ULVF 4P49A 5I73C 4AM0A 2X4SB 4XBGA 5FKAB 1I9EA 1I1YB 4V2BA 4CMHC 3VFVA 3VI3F 1SM3L 5HVWA 3CUPB 4MWFB 3G6AA 3PWJB 4OQTA 5BVJA 4X6DB 1H9VA 3U9UB 4KAQL 3EGSB 1GC1C 1EEUA 3MFGB 1JF1A 3D0LA 5IB4A 5J1AA 1MWAA 3VWJC 5FUOH 1P1ZB 4X4XA 3HC4L 3GI8H 1FNGA 4JM2B 3GEWB 5J12B 3BAEH 1AGCB 2W91A 2VDLL 1HYSD 1PZ5A 4MMXC 2EYRB 3M45A 4PB9L 3IXTB 4F37F 2V5RA 4GG6A 3TCXA 2Q8AL 2R69L 1NLBL 1X5KA 4GBXA 4HIJB 3B9KC 5IB1B 1UB6B 3LMJH 1U8PB 2DQFB 4Z8FL 2ENYA 3C60A 5HY9A 3MGAA 4XPBH 5IBUG 4HPOL 5CGMA 3HAEB 4DKFH 4NN7C 2DJSA 4NN6C 3FRPA 3CFJB 3MUHL 1RV6X 1Y6KR 1NFDE 3B9KA 4CMMB 2NY1B 1VACB 2B7DT 5C6TH 4ZODA 1F13A 3I6GB 4LLYA 5BQ7B 2R0WH 4UV4H 4UB0L 5DJ0B 3QDJD 1AGEA 2CR3A 2MKLC 3EFDH 1CFBA 5I15H 5AYUH 4HG4K 1U8JB 4ZFZA 3EBAA 3ZT7A 2UWEB 3BX7C 2VDKH 5GHWH 3QDMD 3EZJB 1LO2L 4PRAA 5E8EA 4WWKC 1L4IA 2PCPA 2GT9A 2VAAA 2H45A 4JZNB 3MNZA 3CH8A 2V9TA 2HTLD 5D1QD 2QADC 1A9EA 5GRUL 1BVLB 4X7EC 3O4LE 4FZ8L 4NKOB 1HYRC 1OAKL 1JMZA 1JMXA 1UJ3C 3ARZA 3GDBA 5E8OB 1INQA 4PJIA 4N8CH 4R4FH 4MZ3A 5FV1L 4QRPA 4GXUN 1NBVL 4X7SL 5DJAA 2VE6A 3KPSE 5FYJL 3QWRA 1QRNA 3PHQA 4CJ1A 3MNVB 3VMNA 1KEGL 4ALAL 5B38B 1JYWA 4WENB 4LQFL 4LEXH 2VDQL 4XVUC 5ALCL 4OZIF 2W92A 3GIVB 3D2UB 4H5SB 2GJJA 4LRIC 3P4MA 1FNSL 1JI1A 4MVBD 2FZ3A 1OAQH 4JY6A 4NYLB 1CICA 2I9TB 3MNWB 3F58L 1RUKH 3CZFB 5C09E 5JZ7D 2HKHL 2A0LC 3INUL 4NKDB 3RNQB 4FQLH 4HKJB 3G5ZA 4RQQA 1KJMA 4HIEA 2Q8BH 5HPMB 5J57B 1KT2B 3QDGA 3H42H 3P30L 4XH2A 5C3TA 4OGZA 4WHYH 1TTFA 3EUUA 4OFYA 4X9HA 4PTUB 1VFAB 1KCUH 4P3DA 1MJ8L 1I8LC 1KV3A 3MLSL 3QSKB 5D93C 3L3GA 1U91A 2EDLA 1QSED 1P7KA 2WINA 4EI5D 3TH2T 1VGEL 1BFSA 1DP0A 2J6EA 3CSBA 1YMHB 4ELKA 3X11A 3DSFL 3FO2A 4PJ9D 4PGDB 4UILH 5EWIH 3VH8B 5HYJA 1I8LA 3O11A 1C8PA 2WBJC 5CLWA 2IF7A 4EBQH 1T7YA 1WAAA 4P2QA 3ZYZA 4HUWA 3CJJA 4X98A 3L1OH 1NMBH 3MRFB 1NJ9B 4BUGA 2BMKA 4PRPE 4RIRA 4P46D 2CJUL 5JO5B 3M8OL 2H1PH 2WBJA 4OM1H 3RWFA 5AZEL 1SY6A 4QRSB 5LWYL 3ZDXF 5A40E 3S36H 5TDOB 4EI6A 1QOKA 4U05A 4WUUA 1JIBA 4MJ2A 4HBCL 5CD3A 1A0QH 5LG1A 4JHZA 1V3LA 2CDFA 2ADIB 3SKMA 4LSPH 3O3BA 3SDAD 1XCQB 1RK0B 3I50H 3IJYA 1MHCA 4U49A 3UJIH 3CMOH 5HVFB 4OZIB 5E4EC 1SVCP 5JORB 1RURL 4KTDH 4M4RA 4R96A 4P3CL 2GSIA 1UH4A 2F54E 1HDMB 2C3WA 3QHFL 3KPRD 2JE8A 3PWPE 4U3XA 1G6VK 3C2SA 4X7TB 2Y72A 4UU9A 5F1KC 1T3FA 4X5XB 1N5YL 3GHEH 4NQSB 1H5BC 4QXTB 3B5GA 2JK5A 5GGTH 3TA3A 1G9NH 1H3PH 2R2HA 4P5TD 2KZWA 1T7VA 3SE8L 3WLBB 1UM5L 3CK0L 1OSPH 2UZIL 4YO0A 2MHAA 5ICZA 1N59B 4DAGL 4R2GB 3MJGX 1SEQH 3OBAA 4NBZB 4KRNA 5EU3A 4BQCA 4OD1H 3VI4E 1WF5A 4J1UB 2DMCA 3SDDD 1H5BA 4JPWL 5MI0B 3O3AB 1FO0A 2G75B 2VO5A 4EN3D 5MEOB 3QCTH 4YC2B 1JGLH 2A73A 1JTOA 2AJZB 3QI9A 2I5YL 3SN6N 2X5PA 3ZE0F 5EOTA 4Y4FC 3LV3B 1EVUA 3BVNA 1EHLL 4OZFB 3C6LB 1KCSH 3QDJB 3RGVB 3P9WB 3VGHA 4Z0BL 4HJJL 1P5VA 3GJEB 3MO1B 1JHTB 4XC1L 1K2DB 2ZUSA 1YJDC 3PDOA 3HNVL 3BZEA 3QDMB 1DBAH 2EEAA 3WSQL 3I2CL 3SDCD 1SMOA 4YUEL 2WUBL 2V17H 1AGFB 1EJ6A 2V5SA 1QHPA 8CGTA 1EHNA 2A1WL 1AO7D 3IDNA 5IQ7L 1MLCB 2ICWA 3P73B 3MUJA 3MLWH 2EYTA 2GI7A 3R0MA 2VSCA 3ARDD 3SDYL 4W70A 1U8KB 3L7EA 5D71H 4GUPA 1A6AB 5DC4B 4LSQL 1HHGA 1DBBL 1AD0B 2OQJA 5JHDE 2PW1A 1L0XA 4I4WB 3KLDA 1MEXH 3BPCA 4U6XB 1PQZB 1U93A 2VLME 3ARFC 1A6PA 1KJ2B 2VDRL 4HX1A 2APTA 1CFNA 3DGGA 3CFIC 1ZSDA 2AJSH 4YHKL 1HH9A 1R3HA 5ESQB 3U7YH 5F9JB 3GJFK 2AXGB 5C07D 1FBIH 1U8HB 4U1HB 4WVRA 4K3EL 4NNYB 2A6IB 1RPQA 3IFOA 3TH4T 5JNYA 3I75B 3NH7L 4OFIA 1H8OA 5BRZA 3TBVB 3LKRA 3IF1A 4NQDA 5CEZH 3A67L 1MI5D 4JFEA 1UT9A 3ZYIA 1T1ZB 3J7HA 4D0DA 1RU9L 3ARFA 3BISA 5I8KH 2ATPB 3NFSH 3WIFA 1ZVSB 3JBG7 4N0UB 5C0ND 1JPTH 2P43B 1RQ5A 4WU5B 4X6EB 3IU3A 1WISA 3LRHA 2VLJD 3TYGL 5MERA 1P53A 2ZCKL 4WTZA 3T4AA 5IBLC 5J4MA 4X4ZA 5E99L 2DWEA 2DWDA 1FG9C 4RGMC 5ACMA 4ZS7L 3QIBA 3TM6A 4AZ8A 1XF3A 3SE3C 4PJ9B 3VD7A 4OSUH 5ERWB 2AV1B 5D7KE 1G7HB 2Q76A 2DIBA 3IETA 4LLQA 3DXAD 5D1XD 3QHZL 5I74B 1HHHB 3I9GH 1MCCA 3NA9L 5E5RB 4XGZB 3IDMB 3SQBA 3TLRA 2Z93B 3VFOB 2P8MB 4NO0B 1W72A 4NUGL 1DTUA 4TOYL 4WGWB 4AQOA 1R5WB 4JN1H 4P46B 2FECI 1HOCA 1PGRB 1ZGLB 1BM3L 4F80A 4HWEH 4N0FB 1QO3A 1S7QA 3ULUH 3V95A 3IFNH 5EIIA 2O5XL 5KVEL 4ODBD 4IDLA 2A77H 2N7BA 4NC2B 4YFEA 3N1QC 3D85B 3VD4A 4TPRL 3SDAB 5DO2C 1AHWC 5FGSA 1WIPA 5HGBB 1FH5H 5GGSA 1EGJA 1QYGL 4Y5VB 3LSOA 3MLVL 5J7CC 1LO3L 4J3SA 4MJ6A 3PV6B 1HIMH 5I8EB 2HFFB 2BC4B 1MPAL 2EKSA 1TJIH 5F9WB 5A3IC 2ARJQ 4JFQB 4G7VL 1CLCA 1T7XA 1FFPA 1LDPH 4GQ9L 4LP5A 5D72H 5AD0A 4NHUB 3O45A 1C5BH 4RZCB 4IDJH 5DFWH 2CRIA 1KCLA 4MJ4A 5DK0A 1FGNH 4BFIB 3CCHA 3P4OB 4FQCH 4KK6D 3FTGB 4PGBB 1MUJB 1MLBB 3NZ8A 5LQBL 5DUPL 4YIQB 3TESA 4EN3B 5DZLA 1ZLSH 3F12B 5E8DL 2WBWB 3QULA 3S8WA 4PG2C 4Y5YC 4XMPL 3P0YL 1J0HA 2YXMA 3QPXL 2VZTA 1CLZL 1YNKH 1R3IH 3CPLB 4YQXL 4Z7OF 4WI6A 3QWOB 2YKLH 4TSBL 5E8PB 1NAMA 5L6YH 4G8IA 5GRJL 5F8QC 2HN7B 1IAIL 2R23B 4Y5YA 1MCKA 4JG1L 3SDCB 3N06B 4D0BB 5FOBB 5T1LA 2YZ8A 3MYJA 5J89A 3QJHA 1ITCA 3HAEG 4FFVD 5FCSH 1IGMH 4A6YL 1VENA 2X89D 4O2FA 5EBWB 5JR1H 1B88A 2X7LB 5IROA 3ZDZF 4WW2C 2AGJL 2EEDA 3OPZH 4JZJC 3ARDB 3RWJB 3VG0L 1ORQA 5D6DC 4DK6A 4HMDA 1KOAA 2IFGA 5ID1A 5K9JH 3FQNB 1U95A 2P8PB 2UV3A 2V9QA 1UFUA 3ARED 2FB4L 4F7TA 4MAUL 4YWGL 4WI2A 3CLFL 2X4PA 1G0DA 5CP3A 4K8RH 2C5DC 4FQJH 3AROA 1C7TA 2D7TH 3EO9L 4S0TD 1YEIH 2A6DB 3GMNB 3AXLB 5CJOL 1IGTB 1X7QA 2A38A 5D6DA 5C07B 4JQXA 5I1EL 4N0CC 4HWBA 4ZOAA 1BVKB 4UUJA 5I1DA 2NX5E 3VGFA 5IESL 1TCMA 4PJXA 5KN5B 3S3SA 4YHNB 1DN0A 1R5IB 1HXMB 4JFFA 5DD0L 2NW2B 1CIDA 4P2OC 1S5IL 5SV3A 1QQDB 3NAAH 5JW4M 4UOW0 5MEPA 4OGYH 1U2CA 2CKBH 1G0YR 4Z5RB 3P2TA 3CFKB 5IGXL 3NCYP 5CZXC 1JL8A 4M6NL 2JJVA 3FB8B 5E0QA 5D2LF 4PJ8A 5IBTH 3MA7A 1SJEA 4P2OA 2YZ1A 4FQHA 5GJTL 4HKXB 3U4EB 4QRRA 4Q74A 3DXAB 4YH6A 5D1XB 3AS2A 5JOPE 3IJSB 2NY2B 1IGYB 3HR6A 2YMXL 4E0RA 2HP4A 4F9LA 5HHVL 4OF6A 3DYOA 1INDL 4KK9C 1FZKB 4Y2DC 4WFFE 3U46A 5CEZE 3WEXA 4JZOA 4OLVH 1MFCL 1OT2A 4XPHH 3IDGB 2FR4B 5C0GB 3QQ9D 1KACB 4NHCL 5HI4C 3QIUC 3WNPA 1RJLA 1BWMA 3BZ4B 2E7BA 5J13B 1RIVH 2NMSA 4Y19B 3MRNB 4EVNA 4HS8L 3SQOL 4O2EB 4Y2DA 4HC1H 5EPMB 5DMKA 1X4YA 4YR6B 2A6JA 4EUPA 4O9HH 2NXZC 3WFHB 3HR5A 3GSRB 3RA7H 3U7WH 3QUMA 4H20H 4NSKB 1N6QL 2YUWA 2GSGB 3OX8A 3QIUA 1FVDB 5E9DE 4D3CH 3VH8G 4DN4L 4AYFA 5CEYA 5KS9F 1E27B 4LPCA 3MV7D 5K93A 1MJUH 1RFDL 4U1IB 2F74A 2E7CA 1R3KA 3ZMRA 5I1AB 1XIWB 5ITBH 1A21A 2X1WL 4PLJC 3C5ZD 5EZOH 3VXUE 5DJ8A 1YY9C 5L8JB 3MXWH 1YEJH 2JJTC 1CF8H 2EC9T 4XNXL 4KVNL 4ZTOL 1UGNA 5T5FH 3K2UL 5DHYA 1C12B 4JG0L 4WV1C 5C0DA 3ULUE 3MR9B 2NR6D 5DJ6A 2XNAB 5BS0D 2DS4A 5IEKB 2CK0H 3VXSD 4PJGE 2C7UB 3MBEC 3SBWC 4K7FA 2HYMA 4OLYH 1LMKA 3FOMA 5D2LB 4CW1B 2JELL 4JDZA 4M7LL 2JJTA 4S0SD 2BVOA 4ODHH 4GRLA 4OGXH 3B8SA 4WV1A 5FECB 4NQEB 5KVMC 1WWWX 5I1CH 1OARL 3D39D 5DMGC 4GQPH 1EEQA 4PRBA 4Z7UE 4UDUA 5IKCA 1Q72L 5E6IB 1IEBA 1SHMA 1ZTXH 2X4TB 4PS4L 1PX4A 2VR9A 1BZ7A 5IFAH 2FJGA 3P0VH 2BY1A 5D9SA 1XF2A 4AL8H 2UUDK 4OV5B 3T0ED 2X4OB 3C2AL 1O0VA 3NA4A 5EU4B 4GXVH 1BBDH 4ACPA 3FN0L 5GSVA 3KYOB 3KLAB 5T1MB 4L3EA 2FD6H 1B0RA 4C55A 1NGPL 2VC2L 4NKIL 1IT9H 1FRGL 1NL0L 4MB4A 5SWQB 4G3YH 4Z95L 4YFLI 1OTTD 1MHPL 3PWUB 4IMKC 3HZVA 3BP4A 5HBBA 2VXQH 1J0KA 2HVKA 5IB3A 2EIBA 4G42B 3BPOC 5GGVL 3FQXA 4M93C 5IOPB 1YMMA 5KS9B 2ZCHL 3Q6FB 1NCTA 3MA9H 5F44A 2CLVA 2GIYA 3BIKA 4JY5L 3W2DH 3OGCB 3BKJL 4JO4L 1HKLH 4QT5B 3OZ9H 4W4OA 2CO7B 3HG1E 3VXMA 3VXPA 3LPWA 1S7SA 2MCPH 1NC4A 4HEPG 2GITA 3I85A 4HQQH 1D5IH 1L9MA 3FJTA 1J8KA 1F4YL 2EEBA 4KI5E 5C0AE 2LU3A 2EC8A 3RVTD 1D5XA 4U6TA 4F57L 3OKLB 1FVCB 5FDWA 1EO7A 5GGRB 5LVEA 1CE1L 4QNPE 2NQCA 5MP6H 3CFCH 1MHHB 1TNNA 3S37H 3CLEL 2XT1B 5F7KC 1A1NA 5CZVH 5TQ2L 3T4YB 3CC5B 5JXAH 2OTUB 4PTTB 3HUJA 3LEYH 4F3FB 4QTHB 4XNUH 1JPSL 4MNHA 5KSBA 3BKMH 2X2YA 1YPZA 2AJXL 4QHLB 1E4XH 1FG2B 4LSUL 3GBNH 3QEHB 4XCEB 4N68A 2APFA 4EDWH 2E27L 4LARH 5FV2A 3QIWC 1SJHA 4D8PB 3AAZA 5BOPA 5BV7B 5TQ0L 1DQLH 1UB5B 4XB8A 1KELH 1ZMYA 4IRJD 5KVGH 2IAMC 4E41D 4JO2H 5GISL 2HG5A 4G80A 4NZTL 3AMLA 1ZLVK 3B4NA 3BP7B 4CAGA 1GHFH 1EERB 1EBAA 4MNGE 5GS2H 4L9LB 5IB2A 2VXVH 2B20A 1RZ7L 5GRZA 4DGIH 1WT5C 2AJ3A 2VRAA 3BWAA 3WNNA 3WN5C 2HKFH 5E6ZA 5E08L 2IAMA 2X9XA 5DJDB 5I66B 3G04A 4HFUH 1QFUL 3NFNA 3DURB 5IHBA 4FXLA 2EH8H 3KNBB 2NY7L 5C8JA 3GRWA 1N4XH 1J8HB 1ZA6B 3C5ZB 4EOWL 4AEFA 3HZKB 3H9HA 2FJHB 3CSYB 3PP4L 2IAND 4OF0A 2XZZA 2EE2A 4HXAH 1RZJL 2FIRT 4U1MA 2FO4A 2FSEB 4KUCD 43C9A 3JZ7A 4RAVB 4PJ5A 4ISVB 5SWZD 1UXSA 3C8KB 3VXSB 3UTTA 4P9HH 5FOJA 4PLOB 4QEGA 3RQ3A 3LKPB 3DI3B 1MCWW 1VERA 1HI6B 4L3CA 4HXBL 4M61A 4Y1AA 3HE7D 4BSWA 4OD2B 3T2NL 1P84J 1J1XH 1FNHA 3S98A 2PW2A 2W0PA 2D03H 2VXSL 5C0IA 1B0WA 2F53E 5DMJB 1MCOH 3D39B 3SGJA 3QUYD 1OWWA 4MNQD 3LN4A 4OCXH 3QNYA 2FO1A 1MQKH 3WDIA 2AK4A 3TVMD 2X44D 3T0EB 3DVGB 4X6CF 2V7NA 4OZHF 3GJFB 1SM3H 1HZHL 4NRZB 4LLDA 4TN9A 4S1DD 4IHOA 5CJXC 3KPOA 5B4MD 4KAQH 2H3NB 4QWWC 3JTTA 4WI9A 3S37X 4TUOA 1CG9A 1NFIA 3REVA 3HAEH 1HSAB 1VADA 4NN5B 3HC4H 4P5KB 5E1AA 3DX8B 2VDLH 2QEJA 5F1OB 4XP5L 3DRQB 3QQ3B 4PB9H 3VDBA 5D7LD 5HHMD 2Q8AH 2R69H 1NLBH 1NCBL 4KY1L 3NFPA 4LVOB 4RWYL 4PJEE 4NPYB 5I76A 4D0CA 1E4XI 3K80A 4ONGL 4Z8FH 1LD9B 2YRPA 4HPOH 3VGDA 4P57A 3BD5A 3OMZA 3F6LA 4FXKB 4YJZL 3QFDB 4QCIB 1TZIB 2VXTH 4LBEB 4I5BA 2YD2A 1I3VA 5C0JA 2R0LL 2Y5TB 1NCAL 1NANI 1Z9SA 4O2CB 3ARBD 4KUCF 4I2XE 1JE6A 1FIGL 4KH2A 4KMQA 5EZLA 4LLUA 5HJ3B 1ZA3A 4UB0H 2E3VA 1AQDA 2CSPA 5GIRB 3DX7A 5I8OL 4HK0B 2G9HA 3PL6A 4GW5B 3FB7B 3IGAB 3K4AA 2PYEA 4PJHE 1U42A 5K9QG 1BBJA 1LO2H 4NWTL 5F88B 3Q5YA 5DUBB 5JMRA 3BP5B 1FNAA 5HDQL 3WNLA 4POZC 3OKKA 3TBSB 2R2EA 4L4VA 3O6FD 4Y4HC 5GRUH 5FFLA 3ZSTA 4FZ8H 4X6CB 3TN0A 4OZHB 5CGYC 1T7ZA 5DDHB 3LKOA 3DYMA 3G5XB 4F33A 1OAKH 3MCKA 1XF4B 3RVWD 2WBKA 1LK3L 3H3KA 4UNVA 4P4KD 5ADPL 1BIIA 1NBVH 4X7SH 3O9WA 1NDMA 5FYJH 4E41B 1ZWIB 3VJ6A 5I71C 4N5ED 4NNPL 1JGDB 1KEGH 1YNTA 4ALAH 5IF0A 1F58L 1JPGA 4LQFH 4P4RB 4KMLB 2VDQH 5KG9A 4JGMA 4WGVB 1BD2E 5F7DA 1HWHB 4XCYA 3SGKC 5J0BA 1FNSH 1BP3B 2X4SA 2C3VB 2BVEA 5FYKD 4GJTB 7FABH 3G5VB 3F58H 2P49B 5EH1A 4L5FL 3T08A 4MWFA 4QXGH 1D5ZA 2HKHH 3PWJA 4ZSOA 3INUH 4H26B 4J3XA 4X6DA 5I16B 5JIKA 3U9UA 5BOZG 3EGSA 3WCYA 2OI9B 1WBXA 1CFSB 4ONHB 3P30H 4OLZL 1P1ZA 4MJID 5JQ6L 5E7FA 4JM2A 2WAHA 1JZ6A 4KZDL 1MJ8H 4CVZA 1C7SA 3IDYB 4PRHB 4NZJA 3MLSH 3PQYD 5DXWA 2R0KL 3VRLF 4HIJA 3EJZC 2D31B 5SWZB 2SEBA 1VGEH 4K94L 5IB1A 1UB6A 2OK0L 2DQFA 1BJ8A 5CD5C 3DSFH 1ZT4B 5I30L 1JWMB 1FNEB 1X44A 3HE7B 2NY6D 3HMXA 1BPVA 3M17A 5MENE 1QP1A 2X4UA 3WUWB 5C0EA 3ARRA 3SKJH 5GGUA 3QUYB 2C4FT 4XNQB 2IBZY 4H8WL 4IEFB 3U0PB 2YWYA 2HMIC 3UPRB 2CJUH 3M8OH 4NCC2 4S1SL 5AZEH 5LWYH 1BWWA 4CVUA 3PGCA 5IFJB 4TQEL 1MAKA 5T33L 1AXSB 4HBCH 5A2KH 2B5IC 3QFJE 4JFZL 1U8JA 2UWEA 4RWHA 5F1IB 3WFEL 3C09C 3FT3B 2BVUA 1TCRB 2V7HA 5T3XL 5DI8A 3D1MC 1RURH 1QKZL 1RUML 4JZNA 4KHXL 1NKRA 4P3CH 3QHFH 5B3NA 1NFKA 5INCB 5DQDL 3ET9F 1E4WL 5D7LB 2BZDA 3BXNB 4CU8A 1N5YH 2J5LB 4GT7A 4HK3J 3BDBA 5E8OA 3VFSB 2ORBL 3SE8H 1EUTA 1UM5H 3CK0H 2UZIH 1MCQA 1TVBB 3MJ7A 2IEPA 3TNMA 4DAGH 4MB3A 1JGEA 4P23C 3MNVA 1XF5B 4L8SB 4HS6B 2BVQB 4EDXB 5B38A 3KS0H 5GS0D 2HT2D 3DROB 1VDGA 4GAGL 4JRYE 3RDTD 3D2UA 1XGQA 1MCDA 4H5SA 4X8JB 3I02B 1QLFB 2DTML 2I5YH 4KRLB 4NYLA 2I9TA 1I1FA 2VQUA 3MNWA 2G2RA 2VB5A 1PAMA 1EHLH 1MVUB 1AGBB 1WJ3A 4ENED 4PB0L 4NKDA 2EXWC 3RNQA 1CDUA 2I60L 4ZMAT 4HKJA 4LHQB 3SCMC 4Z0BH 4HJJH 5HPMA 2VISB 4URTB 2Q86A 4XC1H 1FZMB 4AIZA 3CFDA 2XYCA 2VXUL 5EIQA 1ZXQA 2NY5L 3LVEA 3WSQH 3I2CH 4WU7B 1VFAA 1NBYB 4U1LB 1A7QL 5B21A 3BW9B 3DO3A 4YUEH 4DEPC 1WGOA 2WUBH 4OFVA 2XN9D 2XG4A 3O6FB 1CD9B 2A1WH 2V2XB 1GGYA 1MOEA 4XMLL 4YDVB 5IQ7H 4LEOB 3F7VA 4PR5B 2RBLA 2DQEL 4L4TD 2BHZA 5FYKL 1GOFA 4GW1B 4PGDA 4ORGB 2JCCF 3SDYH 3MC0A 4L29B 4UTAL 4ZS6C 3IVKB 3VXQA 1KB5A 3ZDYF 1DBBH 3DBXB 4AH2B 4BFBD 1KB9K 3UTOA 3FFDA 2GFBB 4X80L 2NTFA 4KDWA 5JO5A 2VDRH 1XZ0B 4JKLA 1PG7L 1F4AA 4YHKH 2LV4A 2O5YL 3RWCB 1DN2A 2A2QT 1FPTH 2IADB 3NH7H 2VLRB 3S35L 3LB6C 5ANMB 2ADIA 1MFNA 4HGKC 3A67H 1XCQA 1RK0A 3DUHA 2A6KB 1RU9H 4OZIA 1NGYB 3OXSB 3WD5H 4J4PC 3W0WB 1KIPA 3BD4A 3PQYB 1HDMA 2BY2A 4PREA 5FYJE 1G7LB 3LKQB 3IJHA 3MLXL 4UAOB 4X7TA 1FN4B 3MZGB 3HI5L 3TYGH 5JW5A 1BJ1H 2ZCKH 3QUZC 4QXTA 4NQSA 1JYVA 1H3WM 1S7UB 1U8MB 2DLGA 1A6WL 3QUXC 4O51B 3EDJA 4OB5L 1MSPA 4ZS7H 1XR9A 2IH1B 3EOTL 5CFHA 4J4PA 5L8LB 3C6LC 1FFRA 1JPST 4PJCF 2ESVD 3QHZH 4JFXB 2FGZA 4IOFD 3VXRD 1S78C 3KPNB 3NA9H 3QUZA 4DKEL 3O3AA 2X70B 2G75A 1G6RA 3HHRB 1U8LB 1MHEA 4NUGH 4QY8A 5JDSA 1BM3H 4OZFA 4PBVC 4PY8J 3BESR 3C6LA 2CK2A 3BJ91 2JCCB 4H1LB 4LCIL 3RGVA 4LLAA 3NMEA 1J10A 3AVEA 2O5XH 1JHTA 5KVEH 1K2DA 2DDQL 2H2SC 4JPVL 1EO8L 2OL3L 5HHNA 1F8TL 1DBKL 4DGYL 1OAXL 4JKPL 4FFYL 1Q0XL 5TF1L 4HEME 1QYGH 3MLVH 1UACL 1AGFA 3EO0A 4RMUA 1LO3H 4Y4KB 1T89C 1IKFL 4JPIB 3GMLA 1BLNB 1MPAH 5LAXB 4BZ2L 1HXYB 2X4NB 4KZEL 4G7VH 3P73A 1YUHB 1LDSA 4M6OL 1CE6B 4GQ9H 3T3ME 4HD9A 3C87A 1U8KA 4ZPTB 1I9RL 2YPVL 2M2DA 2P5WD 1A6AA 2FX7L 1ACYL 3D6GA 3L3IB 1AD0A 3MRLB 1W0VB 3AB0B 4I4WA 4POYA 5LQBH 2BSRB 1ZANL 2AQ2A 4TVSa 5DUPH 2VLKB 3ILQD 3RDTB 4U6XA 1Q38A 2ZJSL 3H3BC 4O5LL 1KJ2A 4Y8AA 5E8DH 3RL1A 2P42B 5ACZB 2VZOA 4M7KL 1IBGL 5F9JA 5ESQA 4XMPH 1HNGA 5M94B 3MGOA 2AXGA 4U1HA 3MCG1 4NZRL 4NNYA 1DVFD 3P0YH 3QPXH 4KXZH 4M8QB 5ID0A 2A6IA 3LDBB 2ICEB 1DLHB 1KLGB 4YQXH 5E94A 4CADB 4XVSL 4PJCB 3TBVA 4RISL 2Q7YB 2EIEA 1SYSB 3KWWB 1UH2A 2X4QB 4FP8L 1R5VB 4ETYA 3E8UH 3UP1A 2ATPA 3NPSB 5GRJH 1GXEA 1ZVSA 4NP4L 3RBSA 3OJ2C 1IAIH 4N0UA 4WEMB 4JG1H 1C08B 2HJFB 3TFKC 2F9BT 3QDJE 3JV4A 4KI1A 2XN9B 1MFBL 2HLFD 3S34L 1JCKA 4G9FE 3VXOB 5LCVL 4A6YH 5I0DA 4DVRH 2I26N 4TRPL 3VGGA 5FKPA 3QDME 4LOUD 1PZUB 2AGJH 4DK3A 4PJ9A 5HYSB 2AV1A 5IW1B 4NQVB 4UT9H 1G7HA 4PGZA 5GPRA 3VG0H 1XR8B 3TH3T 5HGHA 4APQC 1HHHA 1TJGL 1T0NB 2FB4H 4XGZA 3IDMA 4M62L 3QEUB 2GCYA 4MAUH 3ZDXE 4YWGH 3LAFA 3KXFD 4XC3L 3CLFH 1BMGA 3GMRB 3VFOA 2P8MA 4NO0A 2EZ0D 3V6OC 1R5WA 1XCTB 2VDOL 2HRPL 5E6YA 1RAMA 3L5WB 5I1EH 4CRPA 3RTQC 1Z9OA 3ZHLA 4YLQT 4ZO8A 2ED9A 3KJ4B 2XA3A 3GSNA 5IESH 3G5YB 4MQXD 3D85A 3X14A 3SDAA 5CAYB 5CIPB 5DD0H 3LQMA 5F6HJ 3V6OA 1O5DT 5HGBA 4Y5VA 5IVXF 2EE9A 1S5IH 1S5HB 3PV6A 2HFFA 2X1XR 4ZUUB 3RTQA 4JRXD 1J0JA 3IFPB 3RZCD 5IGXH 2O61B 1AC0A 4M6NH 2YC1B 5D2NE 35C8L 4NHUA 3UYPA 3TF7C 1WWAX 2BVPA 5GJTH 2E8YA 4BFIA 4GKNA 3P4OA 4CNIB 3C5SA 1QSEE 3VXRB 1L6ZA 3LEVL 2A9MH 3FTGA 1S7WB 4PGBA 1MUJA 1MLBA 4IOSD 4BQ8A 4K9EL 4EN3A 4KC3B 5HHVH 5CHNB 5FO7B 1FLTX 4F2MB 1INDH 3WNMA 3ZTJG 5GSRB 5FXCH 4RDQG 2CRMA 1JNHB 1MFCH 4CU6A 4HT1L 3BGFC 3KDMB 2AV7B 2R2CA 1H0DB 1P2CB 4BH8B 4LPWA 3CPLA 5DFVC 4G6FB 3RUGF 4NHCH 1DFBL 1TQBC 4KUZL 3MRCA 5E8PA 5B3JF 1NAKL 1T1WA 2LABA 1UKTA 4FFWD 4ZNCD 4HS8H 3SQOH 1ORSB 2HN7A 3A6BL 2YA1A 2D7QA 2BCKA 4QHUB 1KIUA 4D0BA 2P8LB 1EEZA 1FNFA 3UEZA 3LCYA 4YHYB 5F3BB 4K3GA 1DANU 2E9BA 1N6QH 3HMWL 4LVNC 4ZFOL 4DN4H 4K2UH 3HNTL 1XGTB 4XI5C 1FE8L 5EBWA 5K9QI 2X7LA 1I7RA 2L0DA 3RWDB 1RFDH 1ZEAL 3ZL4L 2J4WL 1T21B 3ARDA 2YEZB 3OKEB 3WUWG 3WYRA 4GS7C 2P5WB 2Y4SA 3KPRE 2K7PA 4W4NA 1Q0YL 4M02A 3FQNA 4KVNH 2P8PA 4XNXH 4ZTOH 5SX5H 5IVXB 2FX8H 4JG0H 2RB8A 4PJAF 3TYFB 3VDAA 2NCMA 1CT8B 3TIEB 3B5HA 4KPHL 3MJ9A 2KH2B 3EYFB 2EE3A 3GMNA 3AXLA 1IGTA 4KRPC 4P5MA 2JELH 3V5HB 5D5MF 3GKZA 2D0HA 4JFHD 2YD1A 5A2FA 4FABL 5M7QA 3ZE2E 3KS0J 3QJFA 4GBXD 3NBNA 5FGBC 1HXMA 2EH7L 1OARH 2NW2A 4FXGA 5IVZB 2APBA 1Q72H 3C60D 1KENL 4PS4H 1RK1B 1OD9A 1QQDA 2DYPA 3BSZL 3C2AH 3CFKA 5LGJA 1OCWL 3RUGB 3R0NA 3FB8A 3V5KB 3FN0H 1INEL 2JJWA 3B9KD 4M3JA 2VC2H 3U4EA 2EDRA 4LCWA 2J8OA 1FRGH 1OGAB 3V0WH 3DXAA 4Z95H 5D1XA 1JTTA 1K4CB 3IJSA 1MHPH 3S88L 1N64L 3MMEB 1IGYA 3CXDL 3SJVA 5KZCD 1AO7E 2OZ4A 3QDAA 1P4LA 2JIXA 5EU7E 4KQ3L 3G6JF 3KXFB 1BX2B 5GGVH 1NCUA 3K4ZA 5EO9A 1G7IB 4U7KA 3UBXG 4LKXA 2ZCHH 3I6KB 5EFIB 4LVEA 2FR4A 5C0GA 1IMHC 2IALA 2V5MA 1MH5B 3ULUC 2I27N 5CWSB 4JY5H 3O2DA 3V4UL 1CGVA 4R3SB 3BZ4A 4JO4H 1M05B 2XWJB 4Y19A 3X3GL 3MRNA 3K8LA 3MRJB 3N1FC 4PJAB 5EPMA 4U6YB 2ERJB 4WWKD 4BA8A 4QRPD 4OZGF 3WFHA 3GSRA 3MLTB 5C07E 4J3WA 1F4YH 3QWRD 4NSKA 3NZHL 2GSGA 1QRND 3B2UD 3LPGA 4WNQA 4JRXB 4F57H 2ZUVA 5D5MB 4C56B 1E27A 1CE1H 4TTDC 4B7IA 1CTNA 4JQIL 1MI5E 1DL7L 4U1IA 5L7XL 1XIWA 4HUMB 3JWNC 3CLEH 2HJLB 5EO1A 5IV2B 4LSVL 3LQZB 4GG6F 5I17B 3STZB 1JPSH 3VFMA 2VLJE 1C12A 3I6LE 1X5XA 2XNAA 3U36B 2AJXH 2AJUL 1BJ1J 5IEKA 3DX6B 4TYUA 2YUVA 1OPGH 3QDGD 4IIQB 3U1SL 2NY4C 4QGYA 4LSUH 4NRXB 1QLRB 1IL1B 3SEPA 2E27H 4OFYD 4CW1A 5TQ0H 1ZLUH 3PUCA 4U6HB 3KPPB 1I1RA 5BZWB 5IQ9B 4MS8C 3MV8E 4NQEA 4QHKJ 4NQXA 1XGUB 4R7DB 2AEQL 5E6IA 1TETL 2BSSB 2X4TA 1RZ7H 1DDHA 4I48B 1CTOA 3FQWA 4DZ8B 3OKMA 1RJZB 1L7IL 5I9QC 1OGTB 1UKQA 4HDIB 5K9KB 5F21B 5E08H 4OQTL 2X4OA 5F97E 1QFUH 3ARVA 4P2QD 4C4KO 4UBDC 5EU4A 4U0QB 1MWAL 2NY7H 3KLAA 3KYOA 4AY0A 3CNKA 1IGFL 2ZP0T 2ZUXA 2L7UA 1MNUL 4OLWL 2NY0D 3V6BR 4AM0B 4EOWH 5JMOC 5SWQA 1FZOA 1JZ4A 2XACC 1A47A 2PTVA 2WBJD 3PP4H 3DHJA 2C9AA 3FZUC 4OZGB 4UT7H 2Z8SA 3PHOB 2QJDA 4G42A 4WUUD 1RZJH 3CVIL 4K8RC 4PJIF 1A4JA 3MBXL 2XTJD 5J1AB 5EBGA 4AENA 2AXFB 4GMTL 4WO4C 3Q6FA 3P0GB 1HHKA 2HFGL 3AM8C 5I73B 1FNLA 1FNGB 1PZ5B 4CMHB 4HXBH 3DETC 3GJFH 1DEDA 1MY5A 3T2NH 4GG6B 4QT5A 4HUUA 3OG4B 3U4AA 2VXSH 3TA3D 3W11C 1ADQA 4ZOCA 3VWJB 3H7BB 4WO4<