2NTFB

Crystal structure of a quorum-quenching antibody in complex with an n-acyl-l-homoserine lactone analog
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
222
Chain Sequence
QVQLQQSGSELVRPGASVKLSCKASGYTFTTYWIHWVKQRPGQGLEWIGTIYPGSDNTYYDEKFKNKATLTVDTSSSTAFMQLSSLTSEDSAVYFCTRGSLYYNNYGWFGYWGQGTLVTVSAAKTTPPSVYPLAPGSNAASQSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Murine Antibody Fab RS2-1G9 Lambda Light Chain
publication title Crystal Structures of a Quorum-quenching Antibody.
pubmed doi rcsb
total genus 44
structure length 222
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ntfB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ntfB02
1K4DB 1YYLL 3PWPE 1ADQH 4FHBD 1P9MC 3NH7H 2RHEA 4LLUB 4TUKH 1LK2B 3OKEA 2D7NA 5LQBL 2EDHA 3F6IA 4HIHA 1EFXA 4RISH 1JUFB 1M05B 1DEEA 1IT9H 5MP6L 5GRWA 2V9TA 4OZHF 3C6LB 1MELA 4P23A 4RMUA 3VXMD 3D85B 1ZHBB 4PRNB 1AIFB 4G43A 3UTQA 2WP3O 4O2FB 3ARFC 2N4IA 5IVXB 4NRXA 3MV9E 1AGEB 4PJ8C 1OCWL 1BVKA 2QQKL 1C7SA 4M4PA 2YEZB 3LOWA 4OD3L 3ZKXC 1KJ3L 2X2YA 3BKCL 2E8YA 1KJMB 4K3JL 1LP9E 4PJIE 5F1NA 1KB5B 4G3YH 4GAGL 3LZFL 5I66A 1H8SA 5DJAB 5J9PB 4EDXB 1JVKA 2UYLB 1MJ8L 2AERT 4X4XA 3D1MC 3UZVB 5D7IE 2W38A 4JPVH 1MQKL 1ZTXL 2XZCL 5DJ8B 3OF6D 4FFVD 2AKRB 4HZAA 4ETQB 4Y2OA 3SCMC 1DQLL 1V7MH 1GVIA 4F7CA 3RX7A 1MFDL 3RL1B 4HUUB 5JO5A 5HJ3B 1IM9D 4MD0A 1DQTA 5HD8D 1FO0B 1QA9A 1KXTB 3V4PH 2C3GA 2E8ZA 3EYUL 1UVQA 1NMCC 1T7YA 3GSNB 2R1YA 3T0EC 3QDJB 4JQXA 4H26B 4QXGH 1XIWC 4ZS7L 4JPWH 1N2RB 1NPUA 1MCWW 3MNZB 1JE6A 4OFYA 4NKIL 4OFDA 3INUL 5BQ7B 4PV8A 3QEQB 3HUJE 5C07B 5DMGD 4NUJB 2AK4B 9CGTA 3BEVA 5TGBA 4HMEA 2F8VA 3RWCB 2XWBB 3IDJA 5FOBA 2ZKHL 4OJFH 1I8IA 1PAMA 4YHKL 3SQOH 2DQTL 5GGVL 3U0TB 1H9VA 3B2VH 3TBTA 4Y4HB 4RX4D 3WNPA 5I8KH 1I3GL 4U1MA 3SE8H 2UV3A 3NA4A 1J0JA 3R0MA 1JTPA 1EFQA 3KPSD 3IDNA 2CRYA 2F9BT 5CZVH 4N8PA 5MI0C 1J7VR 2B0SL 1KCSL 4JFXA 4PRAA 1EERB 5DJ2A 5EZLB 1TJHL 4MA8H 2DBLH 1Z6JT 2FO4B 2UWEE 2PN5A 3KPSE 4JZJC 4LIQE 3RGVB 5E94B 3DMMA 1DQMH 4OLVH 5FM4A 1A1OB 4OCSL 1I1AB 2ED9A 1NAML 2YZ1A 1BAFH 4OSUL 2XKUA 5D72L 5J1TC 1EMTH 5D5MF 5JHDB 4FQJH 3TP4A 1JHKH 3FJTA 1N6QL 4M6NH 3QUZB 1UJ3B 4W81A 4JPKH 3MV8A 5IGXL 1F58L 3KYAA 3V4VH 2IANB 1JHLH 2L0DA 3O2WH 5D71L 5ESQA 3KLHD 2BZDA 1QLEH 2GT9B 4NZTL 5DMIH 3Q5TA 3QFDA 5CZXD 1JPTH 2APXA 4P0DA 4Q6IC 4YHOL 4RIRA 4LSRL 5JQ6L 3DTXA 3HE7C 3IDGB 3CLEH 5F9WC 3MRIB 5KS9E 1F6FB 4TPRH 3WXWL 2NYYC 1A2YA 2P5EA 3HRPA 2C4FT 1GGBH 4M7JH 4GMTL 4QXUH 1KNOB 2CJUH 3GIVB 5L7XH 4GRLB 5E9DD 4G8EB 1FZMA 5IQ7H 3DXAA 4OCYL 2X5PA 3DETD 1CT8A 3FQUB 4NWTL 2Y6SC 2ATKB 4LCUB 4OLXL 2JF1A 4APQD 5DJXB 5JOEA 5E9DE 4UQ2A 3D25A 4XXCA 1S7VA 5ADPL 3UYRL 3WN5B 1YY9C 1QHPA 1JNJA 4IRSD 5HY9A 1QLRB 1KFAL 1TQCC 3GSVB 4CU7A 4Y4FD 1PKQB 2IFFH 3THMH 3S88L 3MLXL 4K7FB 5KVFL 1WZMA 4POZD 1FGNL 4OLYL 4AMKH 2HWZL 4HWEL 4FP8H 4YBQC 4NO2B 4YC2C 4CBPA 5IFHL 4AY0A 2A9NH 5GSVA 4QT5A 2AEIT 5C0NC 1BVLB 4NSKA 5HYJB 1DBAH 1WCBA 5BMFL 2ATPB 1P6FA 4LLYB 1IEHA 4ODVH 3OX8A 2VDNL 4L1DA 5T3XL 3U9PH 1KXVC 4G42A 1ORQB 1N7MH 4XTRC 4KK9D 3JV6A 4HAGA 3TV3H 1LQSR 3O9WC 5ISZD 1DVFD 5IB2A 1XR8A 2EDWA 2OL3L 3H9SE 3OXRA 3RP1A 3QZWB 1N5YH 1L0QA 3RWIA 3LIZH 2B1AL 4UAOB 3ARSA 1SEBB 4RSVA 3RX8A 1PYWB 2HVJB 4QF1A 2VXVL 3PGFH 1Q9WB 4IRJA 1I9JL 2H32H 3UZQA 4P2OA 3MGOA 4NN6B 2H32A 2V2WB 1C5BH 2DIAA 5E8EA 1U58A 4M93C 3Q5OA 4DJMA 1S7SB 4CNIB 4UI2A 5EO0A 3GHEL 1ZHNB 4M7LH 4CU6A 3HI5H 3IFLH 2FSEA 4GFTB 1AHWC 1OAYL 2X1WL 2Y4SA 5T1KD 4P3DA 4UT7H 1CLOL 2VDRL 4HXBH 4JFZH 4PRDA 1F3DJ 3JV5A 1KIRA 4GO6B 1ITBB 3TVMC 3UAJD 4R8WH 1T6VN 4DUWA 4Q97A 5LKNA 3LS4H 2BOCB 3TO4A 1W0WA 4JVWA 3S37X 3TBSB 1JZ4A 4PJDB 1Z0MA 3C5ZC 2G5BA 3WDHA 2Z4QA 4QRTB 2DI7A 4YEEA 3UTSE 5HGAB 5FGCE 1C1EH 2VISA 3REVA 1B0WA 4I3RH 1Q0XH 1F4XL 3ARWA 2F58L 4LQFH 4YO0A 2VQUA 5J11C 5E4EB 1NUGA 1TJGH 4R4BA 1IGML 2F15A 1ZANH 4YEFA 4K3DL 4W6WB 4FFWC 5DD1L 3PHOB 2CPCA 4KKLD 2L7JA 5T33H 5MEOB 1N59B 1HQ4B 3D5OF 3MXVL 5D1XB 5A16B 5IKCB 3BO8A 1CN4A 3RIAF 1B2WL 3SDCD 3I3BA 5E6IB 4KPHL 4KV5F 4WCYH 1AGBB 1KPRA 2ZUQC 1O5DT 1NBVL 1TPXB 4R96B 2BRRH 4B50A 1YY8B 5I0DA 1Z5LB 4JFOA 3DURA 4L4VA 5FO9B 4M8QA 5E8DH 3T0AA 4PRHA 2IALA 3QWRA 5BV7C 3OQ3B 4OZHA 1U6AH 4B5EA 2Z91B 4JZOA 2VXUL 4QGYA 3KPMA 1TQBB 4OD2B 4EQ2A 1UYWH 4OZIE 4JFHD 3ZSTA 3EJYD 3QHFL 3VFSA 1CFVH 1VACA 2H3NB 4G7VH 5DD3L 1GJIA 2DAVA 1XH3A 1GZPB 1YC7A 4PRBB 3BEWB 3LKRA 1RI8A 4HFWA 4X98A 4XMLH 2MQ3A 1KLUB 2FD6H 4TNVK 3VI3F 5IVXF 3WS6A 4TTGA 2I9TA 4P5KA 2R4SL 3BIBX 2VITB 3HPLB 4M1GH 1QSFB 3K2UH 4OF6A 1T22A 3VXTB 4UB0L 5EOTA 3DHJA 3B83A 5D2LB 4ODSL 5DK3A 3ZKMD 5JORB 3OGCB 2GTZA 4NBZB 1D6EA 5SWZD 4U7SA 3ES6B 5D7LB 3KLDA 3VGBA 1Y0LA 5B8CB 2CLZA 2VH5L 3O6KH 1IC4L 3RVXC 3Q6FA 3FT2B 1A0QL 3HZVA 4LSPH 3T04D 4OKDA 4U0QB 1F42A 5HI3D 4JR9L 2MOVA 1UM6L 1Z3GL 2HTKC 1LE5B 4MLSA 2I9LB 1MREL 4MS8C 5DEGA 5GS0C 4MNHB 4HIXH 1FG2A 4Z8FH 5EN2B 4DOHE 2DLFL 5E00A 3BN9D 1OPGL 4P9HC 5D1ZA 4P4KB 4LSSH 5A40E 5EOQH 2NY7H 8FABB 3QISA 2DQGH 1CDIA 3SGJC 4Y2DC 4O4YH 4X83A 2CK0H 2UUDK 3VFUB 5F7EL 1E27A 4QXTA 4DQOH 3JWDL 4X80H 1E6JL 3BWAB 3EOYG 5IK3A 1I85C 4JE4B 4XPHH 1Q9OB 3ZDZF 4NN5B 1IE5A 1PBYA 4TSCH 3G04B 2OI9C 1YEHH 1A9EA 1RJZA 4IS6B 4QRPD 4U1IA 5CSBA 3BPLB 4K7PX 2AXFB 1HHGB 5CMAB 3AREA 2WIIA 2VLLA 1UA6H 3JTSB 4NKMA 3T65B 3U4BL 5IEKB 2MHAB 4ODXA 5TF0A 4QRPE 1MJJB 3SQBA 2ORBH 3NN8B 1VFBB 3UBXG 3B3IA 3CVHL 4HWBH 1KJ2L 4ISVB 5FKPB 4HWBA 2PW1B 3ZKNC 5D5MA 3PWJA 3OKNA 2BVTA 3IF1A 3FRUB 2NY1D 1RK1A 1W72H 2DMBA 1SVCP 3QUML 1ZGLP 2HYMA 1FDLH 1QNZL 4AK1A 1KEGL 4YHLL 2XZQH 3WHE0 4U1KA 4UT6H 1RZGB 2BSTB 2P8MB 1EVTC 4Y16A 2XA3A 1J0YA 4Z7QE 1MCNA 3TBYB 3H0TB 5HI5C 3BP4B 2BXZA 3C60A 5I19H 3O11A 5AEAA 1UWGH 1L0XA 1S5IL 3E1F1 4G6KL 5DLML 4OUUA 2WBJC 2CK2A 3UJTL 1JN6A 4R4ND 5TQ2L 4OCWL 1AQDB 1LNUA 2J3SA 1ROWA 1YEEH 4JFEB 4MA3B 3L3DB 3TZVB 3BKJL 4J1UB 1R5VB 3CFCL 3CFDB 1ZLWK 1AE6H 3OPZL 1GPOL 2BFVL 3H3KA 5ICZB 1S7WA 5TDNA 3NZHL 4KJWC 4KKCD 1BIIA 4PUBL 5BVJA 1IAIM 4PBXA 1PSKL 5KANG 43CAB 1D7FA 1Q0YH 3P2TA 3PNWB 1Q9LA 1D5IL 4H0IA 5ETUA 1U36A 4ALAH 2C3VA 1L6XA 4L29A 3MRDB 4G6AC 5GRJH 5J6GB 2R0WH 3QQ9C 2DIJA 3LEVH 4UT9H 3HB3C 3L95B 1RZKL 2GAZA 3RPIB 1RZIB 2CLRB 4HEME 4WUUA 5I2IB 3V6OC 3C09C 4LHUG 2Z9TA 3E2HB 4OIIL 1UXSB 3N06B 4N1EA 2OMNA 1FLRH 1NDMB 1LO0H 4ZPVA 5E95B 1WBZB 3W11C 1R3JB 2XN9B 5I16A 5BXFA 3RGHA 2D7OA 4JHWH 4U31A 5I1CH 3IFNH 3SKMB 3SKJL 3BAEL 4WO4D 4JJ5B 4X6DE 2RBLA 4C57C 5HHVL 3E0GA 4DGIL 4XGZB 3D0LA 4UU9A 3DECA 1JK8A 3DX9A 3MRJA 4XP6L 4GMSH 4P5TD 4NRYA 5IB3B 3HI6L 4KKAC 3F7YA 4PLJD 1CFSA 1JF6A 1F02I 4JGUA 1WGOA 4WUKH 4W4OC 4S1SH 3PQYB 1OLLA 1N4XH 2BSRA 3U4EA 5DRWA 1G7PA 4OB5H 3WJLC 4F15C 1NC2D 5FA4B 2V2TB 1UM4L 5I1LB 4XPAL 3K46A 1RZFH 3L5XH 5C09A 4LLDA 4HT1H 3FMGL 3TIDA 2ITCA 4IHOB 4UIMB 5E7BA 2GTWA 1ZA3B 4KKNA 2V5RA 5FF6B 4ZAKA 1JWSA 5EZOH 4XNXH 4ACPA 2HTLD 4LDEB 4R7NA 2Y9RT 1UC6A 4X7CC 2EDTA 2Q76B 1A6VL 1FYTA 3CMOH 4WHCA 5GRUH 3DUUB 4KK5C 4XXDA 1U8PB 1VGKB 4WVRA 4PJDF 3ULVF 1CFBA 2DBJA 2D7PA 4HUWB 2LAAA 1FBIL 2XQBL 5T3XD 4ZNEA 4UBDC 2FLRT 1S9KC 4RQQA 3VDBA 3CSYA 3HFML 4LLWB 3MGTB 3F7PC 3GJFB 5ICXA 1PX3A 4JFPB 3HI1A 5T3XE 3LY6A 1MCRA 5IFAH 5FB8A 2FRGP 4K7PY 1D9KC 3C6SA 1MH5B 15C8H 2KKQA 3AXLA 3MLPA 2R2BA 3OHXB 4FMKA 4U6HA 5E8PB 5HHOB 4EI5A 1YNLH 1OLZA 2PTVA 2R2HB 3E8UH 1MAKA 2R1WB 3PDGA 1ZV5A 5C0AA 4EVNB 1F3DH 3Q1SL 1I8KB 1SQ2N 1K4DA 1SY6H 2E7MA 4BYHA 1T1WA 1G7LB 4NZRL 2KZ1B 1WZKA 1LK2A 1KELH 1FN4B 3BH9B 4MXQD 3EYSL 4U2ZA 4OI7A 1II4E 3MODH 5F3HB 1Q72H 2E9JA 5KAQG 4M3JA 2NNAB 3C6LA 2PR4L 5F7UA 3D85A 5J4MA 4M4RA 4PRNA 3I6KB 1AIFA 4HH9A 1A14L 2X9WA 4KDWA 4O2FA 4FFYL 5IVXA 4WFHE 4YHZH 3BPOC 5D6DC 1AGEA 5IVZB 2Z31B 4Z7OF 3AM8A 4PJHE 2HFGL 2YEZA 5GGRY 3LN4B 3L3GB 4OF7A 4NNXB 4P23C 4KRPD 4HGMA 1RK0B 1KJMA 4ZYKB 5F1KC 3QBTB 3UTPD 5HYEA 1B9ZA 3P0YL 4JKPH 5DJAA 3P11L 5J9PA 4EDXA 5C7XL 5D2LF 3AS2A 4JGMA 1BJ1J 2EDBA 1L7TL 4WGVB 4OFPA 4RFNB 4GQPH 4TSBH 3UTPE 1OGAE 1FJ1B 4H25B 5GGQL 4XT1C 2AKRA 3D2UB 3SKNB 4KQ4L 1FL5B 3HC4H 1LO3H 4ETQA 3AAZB 3OSKA 1MCPL 4GG6B 1N3NA 4PV9A 1Y18B 2O61B 4HUUA 2C3WA 5HJ3A 2EYTB 3VDAA 1FO0A 4HQQH 3B9KD 3J8F7 4GKZA 3PXHA 1U3ZA 5JUEH 3QCVL 3I2CH 3IFOA 2QV2A 4P46B 4H26A 1N2RA 4DKAA 3MNZA 4AQ1B 1R5WB 4NM8H 3MJ8A 4JREB 1OT1A 3QEQA 2YHGA 3IDIB 4XPFL 1YEGL 5C07A 3VWKC 2QSTA 4OT1H 4NUJA 2E7LA 2AK4A 1NGWB 1FC2D 3RWCA 2XWBA 2UUDH 3MOBL 3SBWA 4I77L 1SJVA 4ZDHB 3QFJB 4RZCB 4WW2B 4YJZL 5C70A 1EZVX 4JQXC 1CTOA 3U0TA 5IMOA 4Y4HA 3QUXC 5I9QB 1EGJH 1GOGA 4LARH 3K1KC 4N0FA 3WNLA 2DLGA 1G7HA 3VXRB 1KOAA 1MCOH 5ID0B 1A47A 3QI9D 5EZLA 4X4MA 3BUTA 3RY5A 1YMME 2FO4A 1CR9H 2P42B 4EIGB 3I84A 3RGVA 1J8HE 5E94A 1UB5B 2WUCL 1A1OA 1A4JB 3W82A 1I1AA 1LHZA 5EIVA 5SWSB 3I75B 5JHDA 4LP5A 2JJWA 3UTTD 5K59F 3QRGH 2DJUA 5FYKD 1UJ3A 4DUVA 2YPVL 1BJ8A 4N5ED 3QIUB 1YEIH 5INCB 4KMQA 2IANA 4ORGB 5F7DB 5KOVC 4O02L 3SDAB 1ZGLB 3RTQA 2VN7A 5BS0A 4GKSB 2JCCE 1NCBL 4K3GA 5KJRL 1P4BL 2NLJB 2YKLH 4PR5A 4JDZB 1FH5H 3GO1H 4XVJL 4J8RB 5H94B 2AABH 4EOWL 1M7DB 1K85A 1R3IH 4NP4L 4HDIB 4WEBH 1RV6X 1U3YA 2DM3A 2LTQB 4ZFZB 3MRIA 3BGAA 4P2QA 3VA2C 4BQ9A 3T2PA 3MRRB 1OAXH 3VI4F 4JY5H 4JQVA 3PV6B 4JFYA 4YFLF 1PW3A 4NQDE 2BCKB 5ILTH 1S9YB 5DFWH 5DZLA 1MI5D 2EDRA 4JFDB 1EHAA 2ZUSA 2P24B 4GRLA 2YOCA 1ZLWH 4G8EA 4YDVA 5FDWB 2ATKA 1MFAL 1MI5E 4R26H 3MRQA 4FQLL 5DJXA 3VWJB 3FO0H 1AP2B 3EFDH 4GW4A 4M6OH 3UP1A 3WN5A 4BA8A 1CK0L 3C8DA 3PWNA 1R5IA 1QLRA 1IAKB 3STLB 3GSVA 3SJVD 1PKQA 3O8XD 1A64A 2AQ3A 4K7FA 4OLUH 1WWBX 3JXAA 2NY2C 5KSVB 1D5ZA 4DN4L 1MHCA 2ZUUA 3FL7A 4XXCC 1MJUL 2ZJSH 4HKXB 3U2SB 3HTLX 1QVOA 2NXYB 1BVLA 4D0CB 2E7BA 5HYJA 3FB8B 5B4MC 2YC1B 3PWPB 2ATPA 1JIBA 4LLYA 1I9IH 3HAEG 1JI2A 4ZFOL 5LGJA 4NNYB 2Z92B 2W60A 4ZFGH 3TESA 5I74B 1ORQA 4NHUB 3W9DA 4HKZB 4Z6AT 5LCVH 3QZWA 2AV1B 2Z8WC 3QG7L 1OAZH 4PS4L 3V79C 5GS1B 1BGXL 3O6LH 3ZTNL 1SEBA 5I75C 3QXVA 3VXMB 1PYWA 2HVJA 1CIDA 4FQCH 5C2BH 1Q9WA 3QIBB 1M6OB 1TZIB 1MNUH 2EC9T 5EH1A 3QSKB 3WFCH 2V2WA 4XBPB 1LP9B 4PJIB 2DN7A 2X4NB 3FB7A 5TDPA 3V0VB 2VZ1A 1BD2A 1S7SA 4J3WA 4CNIA 4DGYH 3BZEB 5K9JL 1HZHL 1ZHNA 3TH2T 2IBBA 5D7IB 4EEEA 4LKCB 5EOCJ 4LCYA 2NY0D 3OJDB 4UDUA 4P2OC 1QEWB 1BBDH 3MRKB 4TTDD 4PB0H 3D0VA 5FYJL 3TYFA 4CMMB 4KI5D 3G6DH 2BOCA 1TNNA 3DX6B 3IRZA 3TBSA 4PJXE 3EO9H 2AJSL 4PJDA 4Y8AA 4RMTA 4Z77A 2HKFL 4KJQD 1CE1L 5AUMB 2XACC 4QRTA 3CMGA 3V7AE 5CHNA 3PJSB 5I1EL 3BQUB 1EHLL 1MJ7L 4PY8I 5FHAH 2FEDD 3OKOB 2MMXA 3REWB 4PGBB 3TO4C 1BVZA 1IGCH 5HDBE 3WSQH 3KS0J 1EZVY 3HUJB 2HLFD 1CLZH 1BPVA 3PHOA 1JPSH 2X4UB 5MEOA 3U48A 2MJWA 1N59A 5D8JL 2MQ0A 5D1XA 5IKCA 3TFKC 2EDNA 4L3EE 1CXKA 4NFBA 4Z0BL 3NAAL 4JQIH 1PEWA 4XNMB 3ROLB 4LMQI 4NRZB 5E6IA 1KCLA 4NBXB 2IJ0C 1I8MB 3WBDA 4I2XA 5F3BB 4NNPH 1AGBA 3SGEH 4TVSa 1U8NB 4Z7UE 4X7FC 2X7LB 4FQ1L 4WWID 3MFFB 4R96A 5CD5C 3H7BB 2UWEB 1YY8A 1CBVH 1CGYA 3KPSB 5F96H 3OG6B 5FO9A 5JNYB 1EHNA 4H1LG 3B5HA 4PGEB 1YN7B 1WC7B 3HA0A 4G9DB 4HPOH 1T1ZB 2Z91A 1QFWH 5GPRA 1QYGL 5DO2C 1T1YB 5L2KD 4RCAA 1B90A 2H3NA 2NY3C 1GZPA 4PRBA 3BEWA 5JHLH 3O6FD 2HFFA 2VITA 4DAGL 4JB9L 3QXAB 1QSFA 1IL1B 5JMOC 2Q8AL 3VXTA 5D2LA 2G5RA 3ARBB 2E27L 5JORA 1KV3A 5CD3B 1QSVA 2NY6C 4U2YA 1ETZB 3VGAC 5KS9B 2KQMA 2RCSL 4P2RD 1REIA 5D7LA 2X4TB 1VFUA 4XBEL 5B8CA 2FHFA 4ZXBD 4P2RE 2AS5M 5SV3A 1KCKA 4GG6F 4QRSB 3FFCE 2I9LA 32C2B 2VDOH 4HXAH 5EN2A 2A6KA 5E9DB 2VN4A 1P7KB 4LLMB 4DZBB 2EEDA 5DRNB 4MXVF 1YEDB 4P4KA 1C12B 8FABA 1KIPA 2DIBA 2DQJH 1CZ8H 3VFGH 1ZKAA 4F7MB 3V52H 1EPFA 2YXMA 3WHXB 3UROR 3BWAA 4KWUA 2B5IB 3KDMB 2V5YA 1Q9OA 1ZMYA 5D1ZC 1IAMA 4WW2F 3W81A 1WCQA 2QBWA 3G04A 1NCWH 1MCLA 3V4UH 1BJ1H 5CJ5A 3GMOB 4JO4H 5A3ID 5CAYB 1IFHL 4IS6A 3MJ9A 3B9VA 4Z7NF 2AXFA 1HHGA 5CMAA 3R0NA 4R3SB 2XQYK 5B22A 5LBSL 3JTSA 1CD1B 2HH0L 4OV6F 3VXUD 3DGGB 1MCDA 1F3RB 4Y19D 5IEKA 1BOGB 3S37L 8CGTA 2HT4C 4KKBC 3VRLE 1WLHA 3NN8A 2B1HL 4JPIB 1VFBA 1UACH 4I3SL 4M5YL 3H9SB 1K6QH 4Q0XL 3TWCH 4JRYD 2HLAB 4ISVA 5FKPA 2PW1A 3GMNB 2UVEA 3MUZ1 3K74B 1DVFB 3ZMRA 1NQBA 4S1DD 4W6XB 5CIPH 2WUBL 3FRUA 2RFXB 1JZ2A 3VA6A 1EA9C 4JRYE 4BH8B 4XC1H 25C8H 4IOIB 5F93C 1V7NH 2Y7QB 3RAJH 1OTUC 2M26A 2P8MA 5KSBE 4KZEH 4N0CD 1RQ5A 3TBYA 3HKFA 3H0TA 3V6FB 4U3XA 4WFED 5BO1L 2FHCA 3EYFB 1S78C 4JANB 4JHAH 3O2DH 5F1IB 4EDWL 3JWOH 2H1PL 3S9DB 4DVRL 1N0XH 5TE4H 3O4OB 4WFEE 1ZT4B 1QG3A 4BFEA 1AQDA 4Y16C 4JFEA 1TITA 3BKMH 4MA3A 4HW6A 5T1KB 3L3DA 3TZVA 4J1UA 3UTZB 3ARGD 4CW1B 5IT2H 4OV5B 3C60C 4OI8A 4L9LB 2DQEH 3CFDA 2GCYA 4JDVB 2AXGB 2PO6B 3MCLH 3UTSB 5IHZB 5FGCB 5ICZA 1AJ7L 3BOVA 2Q7NA 5DRXB 4S11A 3LRSB 1H3PL 3T0BA 5F6IB 2LVCA 3P0GB 43CAA 1DUZB 4U1HB 2W9EL 3PNWA 5HHXL 1IEBB 3SDYH 4QRQB 5AYQA 3MRDA 4K55A 5J6GA 1HEZA 1IJ9A 4L3AA 3MNVB 3L95A 3RPIA 4UV7L 1ND0B 1RZIA 1ZWIB 2VTFA 2CLRA 4HK3N 5I2IA 2R0KH 1UXSA 1PG7H 4HMCA 2VXSL 5SWQB 4LOUD 2APTA 1VERA 3B5TA 2CIKB 4ODWB 1WBZA 4F57H 1R3JA 2XN9A 2YMXL 3CD4A 3SKMA 3RVWC 5IEHB 2XA8L 3UMTA 4JJ5A 4DCQB 4DWHA 5IVOA 4MB3A 4QWWD 4L8DB 2R39A 4RGND 5EU6E 1MRDH 1WZ1H 3L5IA 3F5WB 4XGZA 2MKWA 5AZ2H 1PG7W 1G0YR 2LQRA 2B2XL 4OBRA 5IB3A 3UTOA 4B0MM 2DL9A 5TE7H 4IMKA 4RGNE 1J87A 4GSDH 4DKEH 1XGUB 3HZMB 4OZIB 3BD3A 4KDTA 5DUMH 3EJJX 3PQYA 4YHML 5D7JB 1I1FB 1NMAH 3LS5L 5ALCH 1YPZE 5FA4A 1ZOXA 3B8YA 2W9DL 1GAFL 3B9EA 5GGSB 2V2TA 3DMMD 3VFWB 5I1LA 1EUTA 1KUMA 1XF4B 4UTAL 3BRFA 1HYSC 1K3ZA 2D7QA 5AYUH 5F7WC 1GZQA 2G75B 1LP9F 5JPNA 5GGTA 4U1JB 4UIMA 4FQXA 1NCCH 4IHOA 5E56A 2FX9L 3LPWA 4FZEL 1ZA3A 4BH7B 1NEZB 5SX5K 4K7PL 3NIGE 1IGFL 5D7IF 1RUML 4EXKA 4QO1A 5I1JL 2YD3A 1HYRC 2Q76A 5HDQH 4LAQH 1OW0A 2AJYL 3L1OL 3DV6B 3DUUA 3V5HA 1U8PA 2XY1A 2OK0L 1VGKA 5E4IA 2HA1A 1S7UB 1E4KA 2W65A 3GB7B 4K07A 4DOHB 3EJZD 4P2YA 4HUWA 4AENB 4OM1H 2Z93B 3DYMA 4OQTL 4LLWA 3MGTA 3ROOA 2MNUA 4PJ9A 5H37H 2VC2L 3GJFA 4F80A 2Z35A 2A6IB 3WD5L 4OCXH 3E6FB 3HUJF 1CXHA 3I6GB 2P46B 4TSAH 2Q7YB 3LEYH 1MH5A 2VDQH 1NL0L 2FH6A 2YXFA 3OHXA 4MJIE 4U4BA 5E8PA 3U0WH 5HHOA 1BIHA 4RMRA 4TQEL 4U0RC 2Y23A 2R2HA 5C0EB 3QH3B 2R1WA 3ZL4H 2XFXA 1N64L 4EVNA 1A6ZB 1I8KA 4I18B 4QRPB 3L5JA 3S36H 1TVHB 1WZLA 4NQXB 5HYQB 1A3RL 4X4ZA 4BUGA 5MERB 4LU5H 1G7LA 1NGQL 2UWEF 1F90H 3VD4A 2OP4L 4PLKC 5FAAA 1FN4A 4BSJA 5D7SH 1LDPL 1U8OB 5F3HA 1MCIA 5FYJD 3P4OB 3GMRB 3MUY1 4UZGA 5FGBC 2AJVH 4MVBC 4XCYB 1UWEL 1CS6A 4F7TB 4MLIA 3I6KA 3KS0H 3ZZ1A 1IKNC 1TLKA 4O00A 5FYJE 3PWUB 4MD5B 5CINL 5EORL 3FO1B 4WV1B 2Z31A 4KJYB 5IG7B 1X5JA 2X6MA 4XB7A 3LN4A 3L3GA 3BIAX 5LG1A 4NNXA 4ZYKA 1RK0A 2FX7H 2YD2A 1HXYB 3E6HB 4EUPB 3S34L 3F6LA 3D9AL 1FFOB 2EIBA 3CX2A 3V5DB 1PZ5A 1D6VL 4ZOAA 5JZ7C 1FJ1A 4H25A 5DA0B 5KS9F 4XPTL 3SKNA 1FL5A 5F9OL 3AAZA 4GG6A 2ENSA 3T2QA 3T2NH 2O61A 3MBXH 3CFKB 2CIIB 4BSVB 3LN9A 5DEFB 1LO4H 1KPUB 3IXTB 1NLDL 1VSCA 4NC1E 1UM5H 3IAGC 1RJCA 4P46A 1I3RB 3LB6D 3SDDC 2GY5A 4KROB 3O0RH 1AC6A 3LQMA 1R5WA 5IESH 1MEXH 5CP3H 3WO4B 3BKYL 1NGWA 4Z7WE 1NAMB 4R0LB 4I9WE 3FQXB 2ENYA 4ZDHA 3QFJA 4RZCA 4WW2A 1KN4H 1CGSL 2HMID 2DLEA 3IVKB 3MV7D 4F58L 3ECBB 2CDGB 5CBEB 3MRMB 4LBEB 3CX5J 3U1SH 1VHPA 1AR1D 1GYAA 4X6DB 3VXRA 3DRTB 3MV7E 5ID0A 5BV7L 1U8MB 4J2XA 4NCC1 3TT1L 1QFUH 2NZ9D 3MRNA 4YZFE 5DS8B 5IQ9B 4U3HA 5FHBH 3BMVA 5ID1B 3BN3B 1AD0B 3U7YL 1UB5A 3HR6A 1A4JA 4GAJL 4M9PA 4P5TB 1OD9A 4M6MH 5D1QB 1FCCA 1I7RB 3LMJL 1G7IB 2G60L 5SWSA 4RAVA 3I75A 5LAXB 1HI6B 3ARQA 4WW1A 4HLZH 2AEPL 3MBEC 3QIUA 2APBA 2VOTA 4M7KH 4HIJB 2VZOA 3QDAA 3U36B 5I8OL 4ZUWB 5EFIB 5KTEH 1NC2B 3GMLB 1ZGLA 1YQ2A 3KPRD 3MLVH 4CN1A 4YDIL 3M8OL 2ZWLT 2NLJA 1G6RL 1JNLH 2R23B 3RVUC 4JDZA 3CLFL 2AAVA 3HC0B 4J8RA 1M7DA 1A7BA 3T1FB 4HDIA 5GJTH 3KPRE 2NPLX 4KMTL 1BBJB 1IAOB 4ZFZA 1C5DB 2YRZA 2P49B 2ITDA 5CJ8A 1F4AA 1D5BB 3GBNL 3PV6A 4Y4KB 3RTQC 5GS0L 4WI9A 5KG9B 5FUZH 4NUGL 4JFDA 1EDQA 2P24A 1GGIH 1FZKB 1UB6B 5EO9B 3O45B 4HWZB 1QBMH 3WIHL 5FDWA 4GBXC 1ZXQA 5E2UL 3GSOB 4JQVC 4XP5L 3RWHA 4DW2H 1AP2A 2F53D 2DQCH 1LEKB 3MSPA 5E8NB 4N8VB 3JVGA 4XMPL 4UV4H 1BZQK 1IAKA 2GIYA 3STLA 3ARFD 5ACZB 2F53E 4L8BB 1U42A 4CVXB 4X9GA 1RUKL 1MAML 1ZE3C 2R0LL 2E7HA 2W0FB 4HKXA 4ZOCA 3U2SA 4C54A 5E99H 3K4DA 5IWLC 4G8IB 4D0CA 1C5CL 4F7EB 5EDXA 3BT2L 1KC5H 1J0ZA 2XG4A 2YC1A 1T5WA 3PWPA 4DN3H 1PQZA 4X6EB 4NNYA 2Z92A 1UKQA 1U2HA 1X9QA 5FEBA 5K9KB 3EOBA 3SCMD 4FFZL 1DP0A 4F3FB 4M03A 4DTGL 3ARED 3DO7B 5I6XC 4RNRB 5FCUH 1MWAL 4ONFL 5GS1A 1NGZB 3MRFB 5C6PB 4JLRA 4RWYL 3S8WA 4IIQB 3VXMA 4ZTPH 5AZEH 4J3UA 3DPBA 4PB9L 3BJ91 4PJHB 3QIBA 3OAUL 5M94B 2XTJC 2CO7B 1M6OA 3A67H 1TZIA 4XBPA 4L8SA 1LP9A 4L5FH 2CGRH 3TYGL 3BZEA 1WWAX 1UQSB 3SGEI 5D7IA 4KRPB 4LKCA 4MD4B 4RGMC 5DUBB 2NW2B 3OJDA 4PG2C 3TA3B 3DNKA 5SX5H 1QEWA 4LPVA 1G6VK 2WQRA 4J3OC 4YQXH 3MRKA 5DTFB 3N1MC 2H45A 5B3NA 4EN3C 3RNQA 4CMMA 4S0SD 3OF6A 5F7KC 2OM5A 2YD1A 1A8JH 2YPLD 4ZTOL 2Y36H 2ZP0T 1INQB 5AUMA 1QFWI 3NFPA 1S5HB 3PJSA 1T2XA 3SE9H 2I07A 3QA3B 5CJXA 3QG6B 3B9KB 2QHLA 3REWA 4PGBA 3ET9F 1DQJA 1F8TH 4IRZL 3ULVC 2AP2A 2WMPA 3MV11 2X4UA 4Z5RB 2BNRE 3F65A 1W2KT 3QDMD 2EXWC 3UJIH 3FRPG 2DMKA 5TFSL 4KTDL 4XNMA 7CGTA 3I85A 3ROLA 4NRZA 5ANMA 1I8MA 4J7RA 3WNNA 3KHOA 5F3BA 3HMWH 4HCRA 4JO3H 1U8NA 3AMKA 1Z0NA 4RX4A 1CXFA 1CD9B 3MFFA 5EBGA 1CU4L 1YMMB 3X3GL 3H7BA 3R4DA 3HPJB 3MLUL 4R97C 2NYYD 3GSRB 3KPSA 4BKLB 1J8HB 4WGWB 2AI0H 4POUB 4L8CB 4OGYH 3RU8L 3L6FB 3QI9B 3IKCB 2K3TA 4PGEA 1YN7A 1DE4B 1WC7A 4RFEA 4PYGA 1T1ZA 5CGMA 5C86A 1NLBH 3BYTA 4HFUH 4XVUC 5FK9B 2YWYA 3LDBC 4I4WB 1B0GB 3MACL 1EK3A 2Y6SD 1SJHB 5T5FH 1T1YA 3P9MB 2ZG3A 1PJ9A 4YHNA 3SOBL 1PKOA 2XTLA 3EOTL 1YY9D 4J23A 4Z7QF 4NM4L 2JCCB 3WL9A 4NO3B 1MRFH 3QXAA 1IL1A 1BMGA 4JCLA 4X99A 1FIGH 3ARBA 1NUFA 5L0QC 5CD3A 4YBQD 2IAMD 4BZ1L 5KS9A 2X4TA 4RWHA 3FQRA 3HMXH 5EG6C 1U8HB 4UINL 4CRPA 1AXSB 2CKBL 1S9WB 4QRSA 4NQUA 3DIFB 5F9AC 32C2A 4ZAKD 3MX0A 1UGNA 2RB8A 1MI5B 1TCRB 3V6BR 1RZJH 3O9WD 5CCKL 4XVSH 4MA7H 1A6AB 5E9DA 1YA5A 1INEH 1H5BB 1P7KA 4LLMA 4DZBA 3KWWB 3TBVB 2VL5B 1CVRA 5DRNA 1YEDA 5C9JB 1C12A 3P3YA 5I1GH 3ARUA 3DOSA 2AW2A 3ZTJG 2MQCA 1XMWA 2EO1A 2W9LA 1IZKA 3CVHB 4GH7B 4MYWB 4LEXL 2FNBA 1KJ2B 3FQWB 1M1SA 1G9ML 7FABL 4F7MA 4IRSA 2GJZB 2Q20A 1T7XA 5JLZA 2OXHA 5B38G 2P45B 3KDMA 4P4KC 1KPVB 1T4KB 3QUMB 3KYKH 4URTB 1HHIB 5ELIA 5IJVB 3KYOB 4R3SA 3U7WH 4YWGH 1CD1A 4MA1B 5CJOL 3VDCA 3ULUL 1YEFH 1Z9LA 1BOGA 4O2EB 2VABB 3TVMD 5K9QI 4JPIA 3PDOB 4NN5C 4NQCD 4AL8L 3G5ZB 5J12B 3G9AB 4F37K 3C5ZD 3BPLC 1X4ZA 2Z0BA 3GMNA 1M71B 1ADQL 1AQKH 4HWUA 5ISZA 4YHPB 1DVFA 3NH7L 2C7UB 4NQCE 2RFXA 3B6SB 4TUKL 3MOQA 1MVUB 4S1QH 1IC1A 4RISL 4IOIA 2E6PA 4O58H 1VENA 1IT9L 2DKUA 2Y7QA 3BDBA 1UFUA 3V6FA 1G9NC 3CFBB 1NCDH 1DSFH 4KZDH 1YEKH 3C6LD 3EYFA 1BFSA 3D85D 2MWCA 5F1IA 1QKZH 4LSTH 5CUSH 3MUHL 4GG8B 3RY6A 4HWNA 1ZT4A 4OF5A 1K4CB 1JV5B 3QQ4B 1NCAH 3FT4A 1JI1A 4Y5YB 2NY0B 3P9WB 4G3YL 5DZOA 5T1KA 4MWFB 4PJXB 3TF7C 1NEUA 3UTZA 4HGKC 4OV5A 2XWTB 1BREA 4L9LA 2ICWI 4JDVA 2AXGA 2KH2B 4JPVL 1MPAH 3JWOC 5IVNA 5IHZA 1NFKA 1PLGH 3FCTB 2WAHA 5FECB 3LRSA 4W70A 3H8NA 3KYMB 2R1XB 1V7ML 1DUZA 2HJLB 4U1HA 1OTTC 5E1AB 2J7LA 5IHBA 3TZVC 4LLQB 2A83B 2MTPA 5HHMD 2IG2H 3V4PL 5FYKU 3MUJA 4JRWA 3MNVA 1VPOH 1EEUA 4L3EB 1ND0A 1DLHB 1X5IA 5HHME 3CK0H 3BP6B 4QXGL 1D5XB 2IGFH 4JPWL 2HT3D 2KQNA 1CXLA 3GJEB 3QDJD 5GIRB 2CR3A 3PHQB 5SWQA 2CQVA 4RGOL 5C08D 5KSAB 4Z7UB 3L3OB 3OXSB 2CIKA 4ODWA 1YUHA 3EFFB 4OJFL 1T20A 2DD8H 3SQOL 5C08E 5IEHA 1EXUB 2ESVD 4DCQA 3B2VL 4MQXD 1S9XB 5I8KL 4MQSB 3SE8L 1WITA 2CUIA 3KXFE 3F5WA 3G5XB 5I17B 4Y4HD 4BK4A 4M3KB 2ESVE 4M1DH 3QCTH 2ADIA 5GS0D 1XGUA 4MA8L 2DBLL 1R3KA 4LASH 3TGXA 3KJ4B 1K8DB 2F74B 2JK5B 1MLBA 1VGEH 4WFFE 1DQML 4OLVL 1H3GA 5D7JA 1I1FA 1HSBA 1YC8A 4CL7A 2EC9U 1BAFL 5GGSA 3VFWA 1EMTL 1XF4A 4PJHF 3G6AB 4FQJL 4IOFC 4JG0H 1JHKL 3KG5A 5DHVB 4M6NL 2K7QA 2G75A 4KDTC 2QADB 3DARA 1LD9B 3GBML 3WLBB 1UJTA 2FDBP 1FE8H 4XZUA 3QUZD 4NJAL 4Q7DA 1NEZA 3V4VL 1JHLL 3O2WL 5H35B 1QLEL 4HJ0D 2XZAH 5DMIL 5SWZA 1JPTL 3ABZA 4NC2B 4P2RB 5I1KH 4A6YH 4FQXC 4QTIH 3FFCB 5JIPA 3CLEL 4ZXBB 1S7UA 4DGVH 4TPRL 1TCMA 3QRFM 4PY7A 1GGBL 4LSQH 4M7JL 2O5XH 2YBRA 4QXUL 4AENA 2F19H 3C2AH 2UZIH 1P4IH 1HDMB 2CJUL 3M1BB 1OW0C 5L7XL 2Z93A 1T83C 3FAWA 4YDJB 5CEXA 3P0VH 5LQBH 5I30H 4GRLD 2A6IA 1E4KC 3D48R 3E6FA 3WE6B 3I6GA 3LAFA 3K8KA 5MP6H 2Q7YA 3P4MB 4R2GC 2C3HA 3VFTB 2J5LC 4LHQB 4PJ9C 4N8CH 1DQQB 1HINH 5M95B 1YJDH 3THML 5C0EA 3QH3A 3WNKA 3OJMB 5DF0A 2WBJD 3EBAA 1A6ZA 3PHSA 4I18A 4FP8L 4QRPA 5L88H 1TVHA 2DQIH 2A9NL 4NQXA 5HYQA 3PIQB 4GAGH 5MERA 4MMZC 1ZT7A 1J0KA 1DBAL 4PLOB 1AD9B 5C3TA 1UKTA 5J6HB 2DJ4A 3A6BH 3P4OA 3GMRA 3QDGD 1FVCB 3U9PL 4JRYB 1HHKB 1K5NB 4XCYA 3TV3L 4F7TA 4Q9QH 4LCWD 4JJHA 1MCBA 4PP1D 3PWUA 1N5YL 4MD5A 2Y07H 3QDGE 5KSBB 3FO1A 4WV1A 5JDJA 3LIZL 4KJYA 2A74B 4LCWE 3ZDXE 2JCCF 2VR4A 3WFZA 1HXYA 3PGFL 2DQHH 3QIWB 4XPGH 2WLZA 1FFOA 1C5BL 2V5MA 3V5DA 4M62H 5M7QA 5HHPB 1I75A 3KAAA 4YGVB 3ZO0A 4M7LL 2Q1EA 5C0DB 2WANA 3HI5L 2VLMD 3GRWL 1YZZA 3IFLL 5C0IB 2LABA 5FA3B 4ZODA 3S97C 4ODTH 2DM4A 4UT7L 4HXBL 2C1PB 1HWHB 2CIIA 3CFKA 1CF8L 4JFZL 4BSVA 5DEFA 1CE6A 4KAQH 4ERSH 1KPUA 4R8WL 4GRWF 4Q9RH 1G7QB 3IXTA 3LS4L 3SHSA 1JMXA 1IC7H 2P8LA 5T1DH 4ENED 4D2NA 4HF5H 3QZWG 4ODUB 1C1EL 3FO2B 4I3RL 1Q0XL 4LQFL 4OZFB 1RHHA 1XF5B 4DFHA 1J5OH 1EEZA 1NAMA 1TJGL 1HOCA 4XB8A 3FQXA 3QUKB 2YSSB 1ZANL 1JYWA 2Y5TB 3IVKA 5T33L 2BX5A 3ECBA 2XXMB 2CDGA 5CBEA 5IGXH 1F58H 2A6DA 2F5BH 3MRMA 4FTVD 5B3JE 2O5YH 1RAMA 5D71H 2GITB 2FJHB 3DRTA 5EU6B 2IWGA 3KJ6H 4FTVE 1AXTH 4WCYL 5DS8A 3PL6B 3G5YB 5BCAA 1BECA 4M7ZC 4WO4A 5E6ID 5ID1A 5EZIH 2LAGB 4KK5D 4NWUH 4LSRH 2BRRL 4HGWB 4RGNB 2XZZA 1IM3A 4P5TA 4RFOH 5D1QA 1DN0A 1I7RA 1G7IA 5ESVB 5E8DL 5LWYH 5LAXA 1HI6A 4ZUUB 1YPZB 1AY1L 4TNWK 3OJVC 2YUZA 5E08H 1SHMA 1XGYH 3L3KB 1KCUH 3U36A 4ZUWA 5I8EB 1UYWL 2E5EA 5EFIA 3ZYZA 1NC2A 1BWMA 5JIHA 1CFVL 4G7VL 3MA7B 5ADPH 3GM0A 1OM3H 2R23A 4MDJB 4XMLL 4X4YB 2FD6L 3HC0A 1YNKH 3T1FA 4YBHA 1CGTA 1UH4A 1A7NL 4M1GL 1BBJA 5TPWH 1CGUA 1C5DA 5CGYC 1D5BA 1PG7X 4LPWA 1MFCH 4X5XA 5KG9A 3WYRA 4ODHH 1BF8A 4PJXF 4RMSA 3DHMA 3ARVA 3H2WA 4J4PC 1FZKA 3FOMB 1UB6A 2WINB 4KK6D 3LD8C 3O6KL 5EO9A 4KI5F 3ULUD 4HWZA 3WXVH 4LSPL 1B4JH 1SYVB 4YNYA 1Q9KB 2GY7B 4HBCH 3GSOA 1NFDA 1WUNT 4ZFOB 1RVFH 5HDBF 3ULUE 3GK8H 4HIXL 5GZOC 4WI6A 4Z8FL 1IAII 2I60H 5JQHC 2OL3H 4WWKC 4D8PB 5ACZA 1XFPA 4L8BA 2OL3A 4LCIH 4CVXA 5C0JB 4LSSL 4OTXH 1IBGH 4MJIB 2NY7L 4Q58C 5EOQL 2DQGL 1NGXA 4HJJH 4O4YL 3X13B 2CK0L 3RI5F 4L3CB 4OD1H 1I9JH 5DRZA 4DQOL 5DMKB 2ZSWB 1JMZA 4Z7UF 3W9EB 4F7EA 4X80L 1JHTB 2QQQA 4X6EA 2OZ4H 4XPHL 4TSCL 2A77H 2QKIA 5J1AB 1YEHL 3GHEH 3WFEH 5K9KA 3B9DA 2F5AL 2ZSVB 2CR6A 2WSKA 1UA6L 3H3PH 4F3FA 1GOFA 5D93C 2ORBL 3DO7A 4KMLB 1NGZA 3MRFA 4HWBL 4IIQA 3PP4H 5JOPD 3GUTB 5BW7A 1ZSDA 4OM0H 3VFRB 4Y5XB 5JOPE 1W72L 4U6VH 1TVBB 4HULB 1QFOA 4KRNA 2XZQL 1UQSA 1A5FH 3EZJB 4UT6L 4YFEA 1SJEB 1CLYH 4MD4A 1FLTX 1BJMA 5DUBA 2HJKA 2NW2A 1A7QL 3TA3A 3S35H 1NMBH 3MXVH 5I19L 1MSPA 2JJUA 4L8SC 2W92A 4QY8A 5DTFA 3S5LB 3FQNB 1UWGL 3QEGL 4B53A 3ARRA 4UOW0 5JW4N 4C83B 5E5MA 4G9FD 4KPHH 1INQA 1NSNH 4BZ2H 1HN1A 4HX1A 3PABB 1YEEL 1S5HA 1AH1A 2BVPB 3AROA 1FNSH 4G9FE 1KLGB 2EYSB 2DQFA 3K8LA 1DFBL 3B9KA 3NIDF 1ORSB 5KW9H 4FFVC 2B20A 2YD7A 1CFNB 2P7TB 5EU4B 1I1RA 1X5ZA 4IBLT 2A2QT 4Z7WB 3BGFB 5H2BB 4Z5RA 1Q0YL 2IQ9H 3RUGE 1D3CA 2V7HB 2IPTH 4ALAL 5HD8C 5GGUB 2YN3A 5HBBA 1HHJB 5EULV 5GRJL 2R0WL 3PV7A 3V0AC 3LEVL 4UT9L 2J12B 2VDMH 3QCUH 1DBJL 4ZSOE 2DDQH 2D03H 3MV7B 4YHYC 1CICB 1BQHG 5DMGC 1FLRL 3GSRA 4BKLA 4ODSH 1J8HA 3VRLF 3L6FA 3QI9A 3IKCA 3MV8E 2VO5A 4JHWL 5I1CL 3IFNL 1DE4A 3OB0K 4I3GA 1EO5A 2APWA 4CJ1A 2XN9D 5FK9A 3RL2B 2VNCA 4I4WA 4YXHH 4HK3J 1SJHA 2BVQA 1WSST 4JR9H 1A7PH 3P9MA 1UM6H 4UNVA 1X4XA 1D5MB 5E5RB 3S96B 1MREH 5FYKH 1AFVH 4WUKL 4S1SL 2QTEA 1H0DB 5KSBF 1FPTH 4NO3A 1OAQL 4XX1G 2J6EH 1N4XL 3ARDC 3MQIA 4MZ3A 4QNPE 3VH8B 5MEQB 3ZT5A 3KPRB 1ZVHA 3IXAB 2X40A 1RZFL 3L5XL 4V1DE 1UCTA 4K71C 4HT1L 5IMLB 3TPKA 1MFBH 4WNQB 4QEGA 4POYA 5ICYA 4Y5VB 1U8HA 3KLHC 5CLWA 5DFVD 5EZOL 4XNXL 1GXEA 1AXSA 4GRWH 1MHPL 3OR7B 1S9WA 3DIFA 2DJSA 5KBNC 5ITFA 3BUYB 4LFHD 3HAEH 5CZXC 1MI5A 1OWRM 3HAEA 3LCYA 5FYJU 1A6AA 2BHYA 5GRUL 3TCLB 4XP1H 1H5BA 5LGHH 3KWWA 2VL5A 4LSVL 5C9JA 1RUQH 4P9HH 1Z9MA 4XNUH 2F53B 2G2RB 4N90E 1KJ2A 3FQWA 3X12A 2GJZA 1JGUH 4Y8DC 3VD3A 3DETC 3ARFB 3R8QA 1IGYB 3O8XA 3QUMH 5HDOA 3PDDA 1KPVA 5IFAL 4APQC 3QUMA 5IOPB 4N5UA 5ERWB 2C4XA 3O3EA 5T3ZD 3MV01 3ZKXB 15C8L 1HHIA 3HLAB 5IJVA 3KYOA 3BDXA 4IRSC 1OARH 3ZHKA 1QUNA 5J13C 5EO1B 4O2EA 5D6CB 4CN4A 1YNLL 2VABA 4NIKB 4Y4FC 4M1CD 5JMRA 4E0RA 3E8UL 3PDOA 1HQRA 5HHOD 4K94L 2ED8A 2XWJB 1K8IA 4OLEA 1R3LB 1QLFB 3SCMB 3TBWB 1F45A 4MCYB 1M71A 1SY6L 3TNMB 4YHPA 1YQVH 4LNRB 4KJPC 2C7UA 1J10A 4I48B 3B6SA 4X5LA 1KELL 1MVUA 3LKNB 1INDH 1G1CA 3MODL 1Q72L 1TMCB 5EBWB 1NMCB 1YPZF 1NC4D 3KHQA 5DJYA 4KK9C 4MB4A 1VEOA 2DTSA 1XIWB 4XNQB 3CFBA 1DVFC 2O93L 1OGTB 3BGMB 2DWDB 1K2DB 4YHZL 3TFKD 3VFNB 4PG9B 1H3VA 5I1HH 3LKQA 5IBLD 2V6HA 3NIGF 4X8XA 1K4CA 1JV5A 1ZEAH 1F97A 3QQ4A 3MPCA 5TE6H 5DGQA 2Z31D 3GMPB 4Y5YA 3GGWA 2D7MA 3NIFF 2FIKB 1XGQB 4MWFA 4PJXA 5IBUB 4JKPL 1EAJA 1LO5B 2FZ3B 3DX8B 3VFMB 1T21B 2XRAH 2VDLL 4TSBL 3JBG7 4HHAB 1WJ3A 1JGDB 3FCTA 1P7HL 5FECA 4MXWH 5MI0B 1LO3L 3KYMA 2HJLA 2DF3A 5E1AA 3D2UD 4M7LT 4H1LH 1GIGH 4JZJB 5E2WH 4LLQA 1YECH 2A83A 1B6DA 4HQQL 3UAJC 1MOEA 1KCRH 2BNRB 1FAKT 4HC1H 4CADB 4MAYD 1UZ8B 1FNFA 1A7RL 5JUEL 2NY3D 5I73C 3I2CL 1OAUL 1DLHA 1N0LA 3CUPB 1D5XA 2BERA 3GJEA 4NM8L 4P46D 4PTUB 5GIRA 3ARXA 3IJYB 3PHQA 3R06B 3GSQA 1DANU 2R0ZH 4Z7UA 4N0YH 3L3OA 4P9MH 3OXSA 1JZ3A 4WI2A 1H3UA 3CDGB 3BP7A 3EFFA 1I8LA 2OSLA 4DK3A 2JB6B 1W8NA 1S9VB 3LKPB 5DD6A 2JJTC 1HKFA 1A3LH 3HE7B 1EGJL 5JR1H 3G5XA 3ZT6A 3RIFF 4DUXA 5I17A 5FO8B 5JOFB 4PJAE 1DR9A 1UT9A 4LARL 1MIMH 2XIDA 3SDCC 5HVFB 1MCOL 3UBXI 5L2JB 5FV1L 4ZUVB 3VXQB 1CLCA 3RWDB 1K8DA 1CR9L 2F74A 4U1NB 2YD9A 3T2OA 3DSFH 3SKUD 4LMQE 3SY0B 3HE6D 3HG1D 5L2KA 4C59B 3MLZH 4X9BA 3QNYB 5CSZB 1VFAB 5DHVA 5C1MB 1J05B 3O6FA 3QRGL 4I0PD 3HG1E 1LD9A 2R15A 4MJ2A 3WLBA 1TQCB 5F1OB 1YEIL 3GDBA 2XYCA 1SM3L 3MLRL 4V2CB 5H35A 2OR7A 2DI8A 4QKXB 1RU9L 2E6JA 4AJ0A 2ADJB 4F9PA 4EQ3A 4Y89A 2C1OB 4YC2B 2IAMB 5FUCC 2YKLL 1FH5L 3GO1L 4P2RA 3SDAD 1P84J 2BNQE 2AABL 4EBQH 1R3IL 3IAQA 3OAYK 3FFCA 4WEBL 1KBGH 1JWUA 2BVOA 1BZ9B 1WTLA 1T89A 4ZXBA 1A1MA 4KKBD 4IDLA 3F7QA 1OAXL 3RFZC 5JW3H 5GGRB 1MFEH 2VE6B 2XG5A 4JY5L 4OCNC 2OBGA 4YDLC 5ILTL 1HDMA 3IDYB 3M1BA 3O9WB 5BRZD 5KANI 4YDJA 3IRPX 1T6WA 5FM5M 4MNQD 2PXYC 4KGLA 3ZKQD 4R26L 3WE6A 1QR1A 5BRZE 3P4MA 4Z7WF 2WBKA 5EU5B 3FO0L 3EFDL 4M6OL 4WY7H 2VDPH 3L5HA 3VFTA 4MNQE 2JJSC 3JV4A 3VWJD 4NFDA 1DQQA 3BN9C 4FQ2H 1IKFH 2VXQH 3KR3L 4OLUL 1CCZA 1JNNH 3GNMH 4CDHA 2P43B 3I50H 2ZJSL 5F7YC 3CAFA 3HNVH 1AHWB 4HS3A 4PGCB 4YZFF 3PIQA 4H8WH 3VXUA 3QEUB 4Y19A 2CKNA 3TVMB 1U8QB 1AD9A 5J6HA 1I9IL 3GI8L 1YJDC 4NQCB 4ZFGL 1FVCA 1FVEB 3PWPD 4JRYA 4I18C 3C5ZB 1HHKA 3CH1B 4J12A 3UPAA 1DTUA 5LCVL 3OL2A 5KSBA 3GBLA 1OAZL 1TNMA 2YN5A 2A74A 3S98A 5DD0H 5J11B 3RWFA 3QXUA 4HJGB 5ACMA 3TJHD 2OJEB 3O6LL 3QUYC 4N0UE 3FT3B 4FQCL 1J18A 2YPKB 5C2BL 4OF3A 3MV9D 1MNUL 2NY1C 3WFCL 3QIBD 1RIHH 5HHPA 1JNHA 4DGYL 4YGVA 2ZG2A 3P77B 4LVNB 5C0IA 4YXKH 2W0PA 2ZUQB 1KXQE 2HJFB 5FA3A 3W39B 1Y6KR 5CEYB 2C1PA 1U8KB 3ARGA 5DWUH 2XOTA 1BBDL 4PB0L 4QHUB 1P7QB 3LHPH 3CC5B 1G7QA 5IW6B 4WUUE 3G6DL 3PGDB 3EO9L 3M17B 4R4NC 2QSCH 5BV7B 3PWVB 1MCFA 1MCHA 3GHBH 3BI9X 5JW4M 3EAKA 3K0WA 2M2DA 4FQIH 3FO2A 3U4AA 5HHMB 1LEIB 1P4LB 4OZFA 3WKML 5FHAL 1XF5A 4GW5B 5J3HC 3BQUD 1IGCL 1OB1B 3WSQL 4KKCC 5JDSB 2YSSA 3V6ZB 2Y5TA 1CLZL 3RWEB 3AUVA 1JPSL 5EC1A 4M9OA 3MUGA 1F00I 3BPNC 3Q48A 3HNSH 1ED3B 4LVOC 1KTKE 5C08B 3WO4C 4C56D 5HGDB 2ZOKA 1P53A 2FJHA 2AJ3B 3KXFB 4YXLH 5E0QA 4NNPL 4D0DB 3G5YA 1U2CA 4C56E 2ESVB 3O3AB 1G6RB 4O2CB 5FGRA 3OAZK 4HGWA 1T3FB 2NW3A 1T66D 2K7PA 1CBVL 1SYSB 4WJ5B 2PYED 1VFMA 3J7HA 5ESVA 3F58H 4NZUL 2ZCKH 3P30L 4ZUUA 35C8H 2GUOA 1YPZA 4WO4C 3SGDH 4HPOL 3V5KB 4CJ0A 2PYEE 3L3KA 1QFWL 2HT2D 4GXUN 3C08L 3K4ZA 4G7YH 5I8EA 4P5TC 1F4WH 1B6UA 3MA7A 4Y2DB 1NKRA 4PLJC 1RPQA 3NBNA 1DEDA 2PNDA 3R8BB 5JHLL 4X4YA 3UPCA 5A2JH 1CK0H 3L9RB 4TYUA 5IF0B 1MRCH 5HYIA 4ZNEE 4W6YB 2OTWA 2QL1A 2OI9B 4GXVH 1QBLH 2EE6A 2XNAB 3BZFB 2IBGA 3ARBD 4XPBH 3I6LD 3MJ7A 3TC9A 2WZPD 1BQUA 3ALPA 3FOMA 2GJ6E 3RKPA 3NGBC 3FN0H 1JFQH 5F9DC 1SYVA 3I6LE 1Q9KA 4J3SA 1PY9A 4YR6B 1NDGB 2HTLC 1OT2A 2VKWA 4ZFOA 2VDOL 4MVBD 4HXAL 3P73B 3VJ6A 4WDIB 5IP4A 4M5ZH 3EZ8A 3MR9A 3OWEA 3QG7H 1QTYT 4PS4H 5C0JA 1T0MB 4MJIA 4JDTH 1YEJH 1MWAB 2DQJL 3ZTNH 2VR5A 1CZ8L 1KCVH 3VFGL 5FUOH 3V52L 5DI8A 2ZSWA 2R2CA 3CZJA 3W9EA 4OCRH 1U3HC 1JHTA 2P5WE 2X70B 2NCMA 3V4UL 1NCWL 2WBJB 4Q2ZB 5J1AA 1JGEB 4JO4L 2ZSVA 4HLJA 4LSDA 4YIQB 3U9UA 1ONQB 1XR9A 3VRIA 4M43H 1RZ8A 4PJGE 4YUEH 2H2SD 3OKLB 1RMFH 1F11B 1OSZB 1KIUA 2IPKB 1UACL 5BOPA 1L0YA 2BY0A 3TNNA 2HVKB 3QDGB 3TWCL 4S2SB 2V17H 3GUTA 3H9SD 5E2VH 4LCWB 3VFRA 1U93B 4Y5XA 5I1EH 4MXQC 4XC1L 25C8L 2GSIB 4JAMB 3V2AR 1V7NL 5DQ9B 1FIEA 5DVMA 4IIQC 1SJEA 4JKWA 5LXGH 3RAJL 5DGRA 1A6PA 4KZEL 3WIIH 3D3VD 2VUOA 3C09B 5IW1B 3W0WD 1KIQB 4JHAL 3O2DL 2VQ1A 3JWOL 4LRIA 1OTSC 1N0XL 2NXZC 3FQNA 4E42B 3MO1B 5TE4L 2SEBA 3D3VE 4RMQA 3X14B 4C83A 2D0GA 2ADFH 4PFEA 3W0WE 4HZLB 3CVIH 3OAYH 3PABA 3I3EA 3BKML 2FR4B 4BM7A 2BVPA 2AK1L 5IT2L 1N5AB 1T1XA 3FN3A 4XC3H 1KLGA 1C7TA 1ORSA 1U8LB 1CFNA 2P7TA 2PO6D 5FYLH 4G6MH 5EU4A 3UTSD 4Z7WA 5H2BA 3GFUA 5DC0A 2V7HA 4XH2B 1RZ7H 3MBED 3SDYL 5GGUA 5AAWA 1HHJA 4X4ME 1RUAH 3B9KC 5DJDB 4F15B 5J56B 1RIVH 3QWQB 1JGVH 2BOBB 3RZCD 5GRXG 2R2EB 3RVUD 1H15B 2B8OT 2NX5D 3MV7A 2R0KL 3RBSA 4XRCB 1PG7L 5D70H 3VFOB 4FTVB 3RIAK 1CTNA 1BOYA 3RKDC 1LVEA 2NX5E 1JWMB 4F57L 2N7AA 3JUZA 3HRZB 3SE4A 3RVTD 4F9LC 4QRRD 4PJ5D 1AGCB 1E28B 1SMOA 3RL2A 2FYYB 5BS0E 1MRDL 1WZ1L 3WHE1 5AZ2L 1SEQH 4GBXD 4NO5B 4Q74A 4PJBE 4QRRE 4UQ3A 4PJ5E 5BVPH 1EO8H 4ELME 3IDMB 3S96A 2HN7B 2CKBB 4GSDL 4DKEL 4P2QE 3TN0D 1GSMA 1P5VA 4CU8A 4XHJD 5DUML 2JE8A 1T03H 3IJSA 4TOYH 1ACZA 5F89A 3LH2L 1WTGT 1NMAL 5ALCL 1TZGH 3VH8A 1URLA 5MEQA 3KPRA 3MLSH 1D9KB 1E4WH 1TENA 5D7JD 4R90H 5AYUL 5IMLA 1KYOJ 3LKSB 4WNQA 4N5EC 1NCCL 5DQJB 4ZNCD 1WV7T 1ZK9A 3IU4H 3MRLB 1J1OH 3H9YA 1GL4B 3T8XB 5SX4H 4AEIH 4MQ7B 3BUYA 4C55A 4AZ8A 5HDQL 3KPNA 4GUPB 1LMKA 3BP5B 1DCLA 3AU1B 2ZG1A 1P9MA 3T4YA 4P59H 1AXIB 4FXGA 5AAMA 3X11B 5L8JB 3ILPB 3O6MH 2ZNWA 3BW9B 2CUHA 4MB5A 2F53A 2G2RA 2ZNXA 4Z0XA 4OM1L 5GSRB 1KTLB 2X4PB 3V95A 4K8RL 3RHWF 3OKEB 2BDNH 3ARFA 3RWGA 1IGYA 4GAYB 4ONGH 1J1XL 1IGTA 4HIHB 1ZGLM 2LE9A 4K3EH 4CVWA 3ZYJA 1DEEB 1KYOK 2X9XA 2XTJE 3BJLA 4TSAL 2VUYA 4F33B 5IOPA 3LEYL 3HLAA 4YAQB 1MCQA 3G08B 3BX7C 1XGRB 3UTQB 1DDHB 3U0WL 5EO1A 1NEZG 3IT8D 3MCG1 3O8XC 3ZL4L 4EN3D 2QLVB 2P4AB 1CXIA 2XWJA 4RAUB 3S36L 1QLFA 4ZOEA 3SCMA 3TBWA 4MCYA 3OAZH 5GJSL 5I66B 4MA1C 4LNRA 1QD0A 4LU5L 1BD2E 4I48A 4CVUA 1F90L 5EIQA 4HH8A 5TF1H 1GCFA 2HG5B 3IGAB 3LKNA 5DR5H 2PCPB 3RDTC 5EBWA 4JZNB 1PD6A 1UEMA 1HNFA 2A1WH 4NN7C 2AJVL 2A73B 3L7EB 3WDJA 5CILH 4XNQA 2W9EH 3WUZA 4XI5D 1J1PH 3PG2A 4YPGB 1OGTA 3BGMA 1HCFX 2DWDA 4HIIB 4FQQA 1K2DA 1QA9B 2DB8A 3D69B 4PG9A 3VWKB 3ULVE 1S7TA 1UVQB 4GLRH 1TZHA 1A7OH 3FRPA 1YN6B 3GMPA 5KOMC 2FX7L 3MROB 1FSKC 1XGQA 2R29H 5GZND 1JBJA 1MFNA 4KU1A 2GKIA 3QUXB 5EBLB 5GS2D 2VXSH 2ICES 3DX8A 3VFMA 5KVDH 1T21A 5TGBB 3CDCA 4HHAA 4HUXB 5DZNA 2DTMH 4LDLB 1JGDA 2YPLA 1BQHB 4G9FB 4JN2A 5DD5H 4Y5YC 2YMXH 1TTGA 4JM2D 5D2NE 3TBTB 1CI5A 5HGHB 1F6AB 3T2NL 4XVUD 3MBXL 2GHWB 1JL8A 1LO4L 4TTDC 4I2XE 1A3QA 5IMKA 1BP3B 1OQOA 2R69H 2FJFB 3RUGB 1EX0A 4KI5C 4U6TA 4CADA 3DV4A 5DC9B 2DLIA 4KJQC 3CUPA 2ARJQ 2EEBA 3UPRA 3O0RL 1U91B 3QDMA 3IDUA 5IESL 5JXED 2D4DA 4PTUA 4ZSOB 3IJYA 3R06A 1WWWX 3RJDA 4KROD 5IROA 2D4FA 2FEDC 3MRBA 2BSSA 3EYVB 3UXFA 3CDGA 3EUUA 4H88H 4YBLC 2HLFC 1KN4L 4EUPG 2JB6A 3LKPA 3NFSH 3BMWA 1S9VA 5IV2B 1RJLB 2FX9H 3MV8B 5DT1H 3U1SL 1JPST 5FO8A 5JOFA 3M07A 1MCSA 5L2JA 1I8LC 3VXSD 5LVEA 4WHDA 1QFUL 2D0HA 4GAFB 4ZUVA 3VXQA 3RWDA 5FHBL 2ZUTA 3L1OH 4U1NA 6FABL 3PXJA 3VMPA 5E24E 1WBYB 3ILQC 3VXSE 3CZFA 2HRPH 3NVQA 4M6ML 3SY0A 2V5SA 1A2YB 4PREB 1ZVSB 3AB0B 3QNYA 2OXGA 1VB9A 5CSZA 1G7JB 1VFAA 3ZDXF 1J05A 3G6JE 2VRAA 1WICA 5D1QD 5F8QC 3ZTJH 5DDHB 3NCFB 4KHTH 3RNKB 3DWTA 4OQTA 2MFNA 4V1DB 1I7TB 1CT8B 4M7KL 2LU4A 1XGPB 5KTEL 5C0FA 4BFBD 2NY2B 1YYMH 3Q6GH 3MLVL 2ADJA 3NCYP 3SKOB 4BELD 2CRMA 1JNLL 2IAMA 5B38A 3O6FC 1L6ZA 3DO3A 1OSPH 3ZSSA 5HY9B 3L3IB 5GJTL 2NZIA 1EHXA 1BZ9A 4NHCH 1SJXA 5GGRA 2VE6A 2IMMA 1MVFA 2M8XA 1N6UA 5FUZL 1HK6A 4U7MA 2EZ0C 3O9WA 4Y4KD 5C6WH 1GGIL 5I8CB 4NSKB 5IHLB 2AJXH 1QBML 1IZJA 4ZXBC 1I7ZB 4XP4H 3LPFA 3LRHA 3OX8B 4KY1H 5IBTH 5EU5A 4DW2L 5I75B 1UWEH 2DQCL 4NOFA 3JV6B 4UV4L 1CDUA 3EDJA 2OJZH 3OXRB 4YLQT 4LRNH 4HV8B 2QHRL 3RWIB 3B5GA 5EU3B 5B3JF 2VMFA 1HE7A 1FP5A 2WP3T 3EGSB 1R0AH 4GKNA 1AHWA 1B4RA 4PGCA 2J8HA 4PRID 5E99L 5IR1B 5KVEH 5GHWH 2VLJE 4WRLA 3QEUA 4BJLA 2H32B 1HNGA 3IFPB 2IC2A 1TTFA 3D9AH 3TVMA 4NC0B 3MXWH 2I5YH 5JIKA 4PRIE 1D6VH 1ZT1B 4IMLB 4NQCA 2VB5A 2NTFB 2X89A 1FVEA 5A3IC 1A6WH 3C5ZA 1EV2E 2PTTB 5IJKC 4QRUB 3CH1A 1KSRA 1OTTD 43C9A 4P3DB 1Z2KA 4PRDB 2R56H 4WHYG 1GHFH 4H8WC 4KHXH 4H20H 1CWVA 3ARYA 4ORZC 4JRXD 4GQ9H 4LLUA 5FCUL 3PP3K 1N26A 4DK6A 4NO0D 1NC4B 1W0WB 4MAUH 1AO7E 2OJEA 4U1LB 2BK8A 1JUFA 1M05A 2H9GB 4N8VG 5AZEL 1H3TA 1M4KA 4JRXE 4WFHD 3A67L 1NH6A 12E8H 1EO7A 1ZHBA 1IAIL 1RY7B 4YO0B 4L5FL 3CPLB 2CGRL 2GQHA 2V7NB 5TDOB 3TCXA 3P77A 4PYHA 4ETYA 5EA0H 3WIFB 2X10A 4N0CC 2IF7A 3IYLW 5I18H 4UDTB 3EIFA 4K23H 5CEYA 1KB5H 1U8KA 1KB5A 3BO8B 1DBMH 1OGAD 2A6JB 4QHUA 3TA3D 3CC5A 1T0NB 2UYLA 4NJ9H 4ZD3H 4JM4H 1FVDB 2UY6A 3M17A 2Y36L 3SGDI 4FZ8H 3PWVA 5DJ8A 5DVOA 4TRPH 3ULUF 1F6LL 4BFIB 2L7UA 4GS7C 3ARGC 3SE9L 3QNZB 1ZLSH 1LEIA 1P4LA 2YZ8A 2X1PA 2I24N 5IHUH 1FO0H 3RL1A 4GW5A 3KNBB 2PW2B 2FEEI 4MAYB 2HKHH 1PX4A 1OB1A 1F8TL 2B4CH 2AJUH 2NY3B 3MRPB 5JDSA 4IOFD 4JY4B 3W2DH 3V6ZA 4KFZC 3GSNH 3RWEA 3QHZL 3GSNA 3CSPA 1ED3A 3QDJA 4G5ZL 1JPFB 5C08A 4AQOA 4D3CH 5HGDA 5KN5B 4X6FB 5BQ7A 5A2KH 1FZJB 2AJ3A 1VACB 5C0RH 3T3ME 1JP5A 4YDIH 3PQYE 2NY6B 1HH6B 3HMWL 4PJAB 3LKRB 3VGAB 4D0DA 3CLFH 1DL7H 2ESVA 3BPCB 3EDFA 1G6RA 3O3AA 4JN1H 4O2CA 3ARZA 3ZDYE 4P5KB 3QJHB 2UZXB 1T3FA 1OF2B 1SYSA 3DYOA 1MUJB 3Q0HA 2AI0L 1X5GA 4OGYL 1YMMD 1D6EB 5A2LH 5DURD 3RQ3A 4NUGH 2HFEB 1J8HD 4U1GC 3V5KA 1NLBL 4HFUL 4XNYL 3RWJB 3V0WH 5I0ZA 1QO3B 3HZVB 5T5FL 3WIHA 3HE6B 3HG1B 3K4AA 4I8DA 3SGJA 2PYFB 4Y2DA 4RDQF 4X7TB 4KTYA 3EW3B 4LP4A 4I0PB 3L9RA 5IF0A 4ZS6D 3CFEB 1MRFL 5IFJB 4K8RD 5CBAB 3QUZA 2H26B 1I85A 3B2UD 2R8SH 2BNQB 5CWSB 5I15H 1FIGL 4A2LA 1MAMH 3DMMC 2R0LH 2XNAA 3BZFA 2GT9A 3V9FA 3QXWA 3HMXL 5BOZG 4NQDD 3IDGA 4YR6A 3QT2A 1NDGA 1ACYH 4U1IB 1RZJL 5BRZB 4WDIA 4FABH 5E5UB 4DKFH 1KNOA 4XVSL 4MA7L 4NQED 1INEL 2DM2A 3GIVA 5L6YH 3RUGF 2OR8A 4ODXB 1FNLA 4MNQB 1LO2H 4G6JH 3HZYB 5CEZH 1T0MA 5EPMB 5E2JA 1FL6B 3CDFA 5CKGA 5I1GL 3EJZC 4NQEE 1MWAA 3FQUA 1Q94B 4XWOD 4LCUA 3ZT7A 3A6CH 4OIAA 2EDQA 5DXWA 5ACLA 3ARPA 3EYOB 4G8FB 1KENH 1W72B 4PRPE 2C26A 4Q2ZA 2WBJA 2FB4H 2B39A 5F8RC 3KYKL 3IB4A 4Y16B 4NZDA 3FZUD 3O2VH 3U7WL 4YWGL 3O4LD 4NO2A 1YEFL 3OKLA 2NY4C 1F11A 1OSZA 3WO3B 4NQSB 2IPKA 3VE0B 4K2UH 3O4LE 3QDGA 3SO3C 1IQWH 3NABH 4S2SA 3RVVD 1LK3H 3NMEA 4YX2H 1AQKL 4BQ8A 4LCWA 4FXLA 3PWLB 1U93A 4N0UB 1XF3B 1QFPA 3RBGA 3UCRA 4HG4J 4S1QL 3QO1B 2KDGA 3H9ZA 4O58L 2GSIA 2DRUA 1KF9B 3NPSC 4QNPF 4EIZC 4AT6B 5C9KA 3RRQA 1NCDL 1Q9LB 5IW1A 4KZDL 1YEKL 3MV9B 3BFOA 2Y72A 1KIQA 4Y5XC 2A0LD 2AVGA 5INDB 4L29B 1QKZL 4E42A 4LSTL 2YUWA 1BZ7B 3X14A 1PY4A 1NCAL 4OI9A 2GAZB 3D87B 4QTHB 4WUUB 2FR4A 2W0KA 4Z76B 1HKLH 1N5AA 4LVHC 3CSBA 3UZEA 1CDJA 1KGCD 4IRJC 4LRIC 3WFDL 1MPAL 3TJEH 1PLGL 5C2UB 3EDEA 1G0DA 1U8LA 1DBBH 3TO2B 4QOKD 1KGCE 3ULVH 5GQBA 1FNEB 4NOBA 2CUMA 3VFVB 4XH2A 1NGPH 2DYPD 3P4NB 1H3WM 3RA7H 2IG2L 4QOKE 5HGAA 5DJDA 1A9BB 4J3VA 3WJLA 4UILH 2EDDA 4NRYB 1NBZB 2VSCA 3L3JB 1H8OA 4TUJB 5TH2B 2BOBA 2DQUH 1VPOL 2R2EA 3GJFK 4R4FH 3VRJB 2D7TH 3LB6C 3CK0L 1H15A 2IGFL 3BIKB 4XRCA 5IB4B 4L3ED 3VFOA 2EYRB 4FTVA 3H9HB 5SX4I 3U4EB 4C56B 5DRWB 4AEEA 5CGYD 1HQ4A 4OQ1A 5A16A 3LQZB 4MGXA 4L9DA 4UUJB 5KSAD 2HMIC 4MJ6B 4M00A 1AGCA 1FZOB 2EDOA 3EOAB 5HHNB 2EH8L 5ITBH 4J4PD 4D9QE 2FYYA 2D9QB 2EDLA 2YUVA 4I5BB 4NBYB 3V7AG 3MGAA 5F70A 1FFNB 4NO5A 3AFLA 2PYEB 4M1DL 3QCTL 5C92A 3IDMA 4R7NB 4O5LH 2Y06L 2HN7A 2CKBA 1Z5LA 2NQCA 4LASL 4J3TA 1QPPA 4NKQB 1VGEL 4WWKD 5CS7A 2FO1A 3PP3H 1LGVA 2H8PB 3BESR 4XNZC 2NR6D 4JG0L 4OD2A 3NCBB 4R7DB 4LEXH 1OY3B 3LKSA 1KULA 4RQQB 2IPUK 5DQJA 5F7LB 1FE8L 1KLUA 4PY8J 3MRLA 4U0RB 3TM6A 5IIEB 2H6PB 2QADD 3T8XA 3HPLA 1S3KH 2W0LA 2GJ6B 3O3BB 2XZAL 4MQ7A 3ZYOA 5KVMC 2YWZA 3QPQD 2GK2A 4GUPA 5I1KL 3OGCA 4OLWH 3BP5A 3AU1A 2R2BB 5JXAL 4A6YL 5CJOH 1BLNB 4QTIL 4WI4A 3AMLA 3ES6A 4CGTA 3WS6C 4TVPH 3X11A 1V3JA 3BSZH 3FFCD 3ILPA 4LSQL 2O5XL 2PF6A 3FT2A 4AL8H 2F19L 2BSED 3C2AL 2UZIL 4NYLB 1P4IL 4XVTH 4M8VA 3RZWA 5GSRA 1KTLA 2X4PA 4M02A 1LE5A 1T1WB 1ADQA 3S4SB 1LE9B 3P0VL 4MNHA 4N9OB 5D6DA 1MLCB 5I30L 4GAYA 3BH8B 4GLRI 3C8KB 5FV2A 4F33A 5T1MB 5B21A 4IM8A 3KPTA 2P5WB 1MCEA 4YAQA 1SBSH 3G08A 3WNMA 4PJFE 4O9HL 1XGRA 1DDHA 4HH9B 4PP2B 3VFUA 4N8CL 1HINL 4MDIB 1YJDL 4KK8C 1GGTA 3VXME 4HS6B 1MF2H 5L8KB 4AEHH 4X5WB 4PJAF 2EE2A 2DI9A 4RAUA 3KPQB 4PJGB 3N9GH 3FFDB 5L88L 1UG9A 2DQIL 4LSUL 3MJ9H 1UKSA 4GKOA 4M61B 4J6RH 2HG5A 3IGAA 5C6TH 3T65A 2PCPA 3IS1X 3A6BL 2MHAA 4JZNA 5TQ0L 1MJJA 4GOSA 1HILB 1T7WA 2A73A 3L7EA 3O81A 2JIXD 3SDDB 4HKJB 1N3NB 4PV9B 2J88H 4Q9QL 1EEYB 1F5WA 4YPGA 1G9NH 2Y07L 4HIIA 3HHRB 3D69A 3VWKA 3AREC 2VDKH 3IKKA 2CMRH 2H2PD 1BF2A 2FX8L 1KTDB 3N50A 4GKZB 4XAWH 4FQPA 2WW8A 3SDXE 1YN6A 3HC3H 3IFOB 4LPXA 4WHTB 3MROA 5DUPH 3VGGA 2GFBB 3D3VB 3VGHA 2DQHL 3BRGC 1JZ5A 3W0WB 1RZGA 2BSTA 3QUXA 4XPGL 5EBLA 3MJ8B 5HYSG 3GKWH 4Q9CA 2AV7B 4RGOH 3QIWD 3JWNC 3BP4A 4M62L 3Q2CA 1RHFA 4HUXA 3HCVB 3GSUB 4OAWB 1BQHA 3UC0H 4G9FA 4UNTA 3ESUF 4HBQA 3H3BC 3N85H 3E3QC 5IMOB 4ODTL 5HGHA 1F6AA 2EECA 4KAQL 5ANME 4ERSL 2C4FU 1TETH 4Q9RL 1Q38A 3VD7A 2FJFA 1R5VA 4N0FB 3RUGA 1G7HB 2C3XA 3K3QA 3T77B 1IC7L 1RULH 1ZLVK 5T1DL 5JTWA 3WNOA 3B8SA 1DBKH 4HF5L 1U91A 3WDIA 4ONOA 3MBEB 3ARDD 1U8IB 4ZSOA 2XY2A 2Q3ZA 2VAAB 1E4JA 4BQ6A 1J5OL 3EYVA 4C58B 4QLRA 3RZCB 3BVNB 2J4WH 4NKDB 5EWIH 5IV2A 2NX5B 2JTDA 1RJLA 3GBMH 1U3JA 5CJQH 5DMYA 2E9WA 4YK4C 2F5BL 2O5YL 4NJAH 1XZ0B 5IROC 2GYSA 3HN3A 1GGUA 4Z95H 3RTQB 5BS0B 3KJ6L 1AXTL 1G7MB 4PR5B 1NDMA 4PJBB 4QRRB 4PJ5B 5EU6D 5EZIL 4ELMB 4NWUL 3MREB 3X17A 2P47B 1WBYA 3PL6D 5EB9A 4P2QB 3LSOB 4GBXB 4RFOL 4LVEA 4PREA 1ZVSA 2ID5A 1ITCA 4JFYB 4H5SB 4HS8H 5LWYL 3X3FH 1JF5A 1G7JA 5E6YA 3TN0B 5E08L 5D96C 5DDHA 1NAKH 2ARJB 3RNKA 1Q1JH 1XGYL 4OLZH 2FECI 3DYPA 1ES0B 1KCUL 4OZFG 4V1DA 1I7TA 4YDVB 1XGPA 3SEPA 3MRQB 3SKOA 1EJOH 4GW4B 1OM3L 5I71C 4Y88A 1YNKL 1X5YA 3PWNB 1R5IB 3L3IA 2WV3A 5TPWL 5GGTH 2QQLH 4PJIF 1U95B 1D5ZB 1MHCB 3MRGB 1MFCL 4HK0B 4LL9A 5FF6A 5FO7B 4ODHL 1BQLH 2IAMC 2OYPA 1X5LA 4P3CH 4N0RA 1QVOB 5I8CA 4KJPD 2WWKT 3MA9H 4XHQA 2A9MH 2IH3B 1UWXK 3WXVL 1I7ZA 3FO9B 1B4JL 5I6XB 4ZOBA 3CXHJ 5C0CD 4DEPC 4HBCL 5LGJB 2W60B 1RVFL 4ZAKC 3OG4B 3GK8L 3IDYC 3W9DB 4ZUTB 1E4XH 2XTJB 5HGBB 5C0CE 2I60L 3WLWC 3WEXB 1R3HB 1ZAGA 4HV8A 4LCIL 5EU3A 5T1LB 3GJFH 4OTXL 1IBGL 5HI4C 5HVWA 5T3ZH 5ISZE 4MHHG 1EAPB 4HJJL 3EGSA 4JFPA 3NTCH 1UXWB 2JELH 4RGMB 4MJID 5IR1A 1TTUA 2FGWH 4OD1L 1WVZA 2IADB 3UYPA 5E8OB 3IFPA 1KACB 5TDPB 3FB7B 3LPGA 2OZ4L 4EN3B 1ZT1A 1BD2B 5EOCH 4IMLA 2A77L 1J11A 1O0VA 2NTFA 3NCCB 5AD0B 3WFEL 2PTTA 3GRWH 5ADOH 4LCYB 4QRUA 3BD4A 3GRWA 2CRZA 2EICA 4UDUB 2QQNH 3H3PL 3CXHK 3DVGB 1MHEB 1CF8H 3D0VB 4FA8A 3TYFB 3NA9H 4EI5C 4U6YB 1NC4A 1OVZA 4AIOA 5JA8B 3BH9A 3PP4L 4U1LA 4AM0B 4Z77B 2H9GA 4MNGE 3K81A 2Y5EA 2OLDA 4OM0L 2NNAA 3KPLB 5CHNB 1X5XA 4NQVB 1RIUL 1JTOA 1C16B 4U6VL 3CPLA 3MLTB 2V7NA 1A5FL 4U49A 4HPYH 5TDOA 4JFQB 5IVZA 1CLYL 3WIFA 5GRVK 3DUHA 3S35L 1AKJD 4UDTA 5KZCB 3C6LC 3SN6N 1NMBL 2EDYA 1V8HA 2A6JA 3DI3B 5D2NB 5I1IL 4R97B 5K93A 1T0NA 2GK0B 2ZCHH 1JPGB 1FVDA 4LVNC 1NSNL 3UDWA 4I2XB 1NBQA 4D0BB 4BZ2L 3AM8C 4G8GD 4Q9BA 4JM2B 4UMGA 3D2UA 4BFIA 3LDBB 4OGXH 3QNZA 1FNSL 4ZMAT 1Y18A 1XF1A 4HSQA 4G8GE 1KT2B 2X4OB 1X44A 3KNBA 2PW2A 4MAYA 2EYTA 1NCTA 5KW9L 4AG4H 4FNLL 3MRPA 4JY4A 1OP5K 4OUOA 3UYOD 1AY1H 2IQ9L 5SV4A 2IPTL 1WIPA 3K7UA 3NACH 3GSWB 2ED7A 2FIRT 1JPFA 2ILLA 3WFBL 2P48B 5I76B 2YK1H 1DQDH 4I9WD 5KN5A 1U92B 4X6FA 2BY3A 3I9GH 4M48L 4C4KT 3KPPB 1FZJA 2VDML 1BFVH 3IDIA 3QCUL 5L0QB 3WUWB 2B4CC 1HH6A 3DROB 4PJAA 3CFJB 4OZGE 3BPCA 2DDQL 2D03L 2HFFB 2HT3C 4JFHE 3BE1H 3QJHA 3TT3H 5FFLA 1I7UB 3S5LG 1A7NH 3OZ9H 3DRQB 3MJ6A 2VAJA 5FUCE 4PJGF 1OF2A 1CD0A 1MUJA 1CICD 4TNVF 3K2MC 2R4RH 2E7LC 3VXSB 4FG6D 1JYXA 2HFEA 1FORH 3ALWA 3SBWC 4MQXC 2EDXA 5T5NF 3RWJA 4XP9H 4IJ3B 3G6JB 5SWZE 2PXYD 1QO3A 2Z8RA 4Y4HC 5B39B 3ZE0E 4YXHL 2XPGB 3HE6A 3HG1A 2PYFA 3HZKB 1A7PL 1UENA 4G80B 5LJYH 4X7TA 4PD4J 1MCJA 5FYKL 1AFVL 1T2QH 4S1RL 3BDYH 4I0PA 1KJVB 1FPTL 2FJGB 2A6KB 2WWMD 3CFEA 1GC1H 2J6EL 5IFJA 1CL7H 5CBAA 3QWOB 4OBSA 1CIUA 2H26A 2BNQA 5E7FA 2FWOB 5CWSA 3RGVC 5INCA 1KTRL 3EHBD 4ORGA 1KIPB 4WTZG 1I1AC 5F7DA 3SDAA 1WAAE 1MFBL 1CDHA 2ZUYA 4GKSA 1FYHB 1NGYB 1UEYA 4WU7B 3CX5K 3QUZC 4TN9A 5FDYA 5H94A 1UJ3C 1A1NB 2F8OA 4HJ0C 4OGAD 4XWGH 3MLYH 2MCPL 4RMVA 3MRRA 2F5AH 2JB5L 3QR2A 2NY5H 5BRZA 1FGVH 2EKSB 3HR5B 1J86A 2BCKA 1S9YA 4XP1L 3AC0A 1IGJB 5DQDH 3STZB 1OAKH 5LGHL 4MNQA 3OGOE 3R1GH 3HZYA 3WJJA