2NTFB

Crystal structure of a quorum-quenching antibody in complex with an n-acyl-l-homoserine lactone analog
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
222
Chain Sequence
QVQLQQSGSELVRPGASVKLSCKASGYTFTTYWIHWVKQRPGQGLEWIGTIYPGSDNTYYDEKFKNKATLTVDTSSSTAFMQLSSLTSEDSAVYFCTRGSLYYNNYGWFGYWGQGTLVTVSAAKTTPPSVYPLAPGSNAASQSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Murine Antibody Fab RS2-1G9 Lambda Light Chain
publication title Crystal Structures of a Quorum-quenching Antibody.
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 222
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ntfB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ntfB02
4GBXA 5IESL 1FRGL 1D5BA 4NQDB 2QEJA 1AXSA 2GSIA 4OSUH 1AGEA 4MAYA 4O02L 3BZDA 4F33A 3D85A 1F4AA 4PTUA 5E8PB 1SY6L 4PGCB 3MBEA 1N5AA 4W70A 3V7AE 1EZVY 4QRSA 4MZ2A 1QR4A 5CP7B 5D1XB 4AT6A 3VFPB 1DL7H 4HFUL 3QPQD 4E41B 1G6VK 5DA0B 1FIEA 5JXED 3VFSA 2QSVA 3ROLB 1KCKA 1TJIH 3NIDE 4QRTB 2V7HB 4JREB 5HHOA 1R3KA 3QCUH 1NSNL 5SX4I 3EUUA 2YWZA 3KNBA 3KYAA 1MFAH 5I1KH 5JHDD 1XAUA 3GM8A 2NTFB 2HH0H 3L6FB 3U9PH 1F97A 2HFGH 2ORBL 3DV6A 4DAGL 4LHUG 1KB9K 4KKAC 5I17B 1LEGA 3O6FD 4R3SA 1JPST 3PWPD 5IR1B 4M5ZH 3OKMB 4R6UA 1HHKB 2CDEA 1U8PA 2PF6A 3H9HA 4M1CC 5GGSY 3UO1L 5IMLB 4KGLA 4AH2A 3UMTA 1RJYA 1GPOH 2WANA 2WV3A 3L3KB 2VDPL 1FNSL 1WLHA 5I8OL 4WI5A 3R4DA 4NQTA 5C0RL 1EPFA 3MZTA 4KHXL 1U3HC 2CH8A 4QHUB 5IKCB 4YBHA 1IZJA 5DD0H 1E4KC 4DVRL 4N9GA 4HS8H 1MCOL 5JA9A 5DC4B 1Q72L 2PYEA 2YPLD 2FO4A 1ND0A 5DZNA 4YX2H 1NANH 1AO7E 1RHFA 2HLAA 3QDME 4FNLH 4LAQL 1NUGA 2XWJB 3KJ6H 3RWFA 4BK5A 3GJEA 1WBZA 2FGZA 3BE1L 3FO0L 3LQMA 3PJSB 4ZOEA 1VSCA 8CGTA 1B2WH 2E5EA 5JOPD 4PGZA 3VXRD 1FVEA 5C07B 3SY0B 3A6BH 4C57C 7FABL 3LQAL 4WCYH 4P5KA 4D0CA 2NY7L 5HY9A 1OP3K 5DJYB 5EOTB 5T33L 3B2VL 2F54B 4MZ3A 2BSSA 3F12A 4HLZG 1RK1B 1NBYA 1E4KA 5E00A 3ZE0E 1OAUL 5C08A 1PKOA 3PABB 3HNSH 2LQRA 4G7VH 1RURH 1G9ML 1WWBX 2Q7YB 1GGUA 4Z7WE 2HJFA 3UPRB 7CGTA 2VXUH 3E8UL 1DUYA 4P3DA 1DLHA 2GSGB 1PAMA 1SQ2N 3D39E 1B90A 2OP4L 5I16A 4BQ6A 1MQKL 4V1DA 1S3KH 5E5UB 1MCOH 3O9WD 5D1ZD 5IB3B 1A7RH 3TJHC 2R0ZL 1FZKA 5M7QA 2X4RA 3ZKND 2UZYB 5EU7C 4TTDC 4CDHA 2A83B 2EYTB 2EE2A 1FNHA 3SDCD 2AXJA 3WIFA 3W0WD 5SWZE 4KJQC 4PJEB 2OJZL 3CUPB 4U3XA 1JL8A 3UTQA 3SKMB 1MREH 1IEAA 3IS1X 4GRWF 3MGOA 1QHPA 2DLEA 1RK0B 4FZ8L 1YMHA 1N8ZB 4KUZL 3P4NB 3B2VH 3C60C 4BFEA 1T1YB 2X4SB 3N1FC 1KIQA 1TPXB 2DJSA 3HC3H 2Z31B 2FD6L 4UAOB 1YPZE 4OF0A 1F6FB 2YD7A 1I9JH 43CAA 2B20A 1ZT1A 4F7MB 2VDLL 4NKIH 2V2TA 1UWXH 4OZFB 4Y4HD 2I60L 3FHQA 1QPPA 5FUOH 5FCUL 1U3YA 2DQDH 1OVZA 3MSPA 4TVPD 2B4CC 4WDIB 3N9GH 5KN5A 5DT1L 3M07A 1AFVL 1H3VA 3WXWL 4PJFB 3S6CA 3UYRH 3MXVH 2W0PA 3MRGB 4E0RB 4NUGL 5F3BA 1G7QA 5K59E 3F6LA 3REWA 4KK6D 5L0QC 4BZ2H 4HULB 5K93A 1RUKH 4U1JB 4E9LA 4K7PH 4OGZA 1I8MB 5F9JA 3J8F7 4MQ7B 4KUZH 4KK8C 3C5JB 4YBLC 1BZQK 1EO5A 1UWEH 2EDLA 1NKOA 3MLUH 2VR9A 2XQYG 5BOZG 4DZBA 5DZLA 4MDIB 2VITB 1R5WB 4X99A 3S97C 4EOWH 1M1SA 4MB4A 4PJHE 5JZ7D 3FFDA 5C70A 4ZUWB 4YDLC 3TWCH 3PWUB 1CDCA 4YHZL 4H0HB 3X12B 5AAMA 1NGPH 1WBXA 1XZ0A 4HS3A 3DI3B 3MRDB 5I1JH 3T0AA 1F4YL 5JTWA 1NQBA 4MSWB 3ZDZF 3SDXE 3CZFA 4WTXA 1A6TA 2XKUA 3CX2A 1RFDH 2F74A 1OT1A 2KPNA 3BWAB 2O61B 3G6DL 4JVUA 3QULA 3ES6A 2XI9A 3GI8L 3OKLA 2Q8AH 5EZLB 2EZ0C 3Q6GH 4ZFFB 1ZSDA 4YGVB 5GGTH 1YEHL 2BNQD 3B6SA 3SOBH 4Q0XH 6CGTA 4JZOA 5IF0B 3G9VA 3H3PL 4KH2A 5A43C 4CMMA 1YEDB 3U48A 2NW3B 3S5LA 5JHDB 1TVHB 3KYNA 2P5EA 5MERB 3LIZH 4ZQKA 1FORL 1AHWA 5HYQA 1WF5A 3RFZC 1WZ1H 1P4IL 5DR5H 5HVFB 1T21B 1AD9B 2I25N 1JCKA 2O5XL 3H7LA 3VRJB 5FF6A 2IQ9H 1OM3L 3OKEB 3B9VA 5HGAA 3PWPB 3BRGC 2C9AA 4R4BB 5FM5O 2BVOA 1QSEA 1K2DA 1ERNA 5FKAA 2VZUA 4OCNC 5FYLL 3RKPA 2VQUA 1DBMH 2ESVA 2RAMA 1E4WL 2X40A 5BVPL 1BEYH 1TMCB 4QTIL 5C6WH 2CMRL 4JZJB 4HS6A 2Y9RT 2P42B 5IVNA 5CZXD 1H3TA 4C56A 4ONHB 2MSPA 1SMOA 3WCYA 4GRLD 4UTAL 2FH6A 3RVXD 4HIEB 1AGFA 3GGWA 2YPLB 4G8GD 3WBDA 4RAUA 1JPTL 3JWOH 1BAFH 2E6PA 2Z8RA 3I3EA 5FUZH 4AMKH 4Q9QH 4Y1AD 3EOTH 2YD1A 2BDNH 5E8DL 1I75A 5HGHA 3VXRB 1EAPB 1MJ7H 3KPQB 1HXYA 5C0BA 1HWGB 2V6HA 4XI5D 1U92B 2WQRA 1FFNA 1XIWB 2VIRB 4PJDB 3L1OL 4KY1L 2P5WE 1DQDH 1CDIA 4FQJL 4KI5F 1SJHB 4Y4FC 2NY2C 4X80L 4YUEH 2W0LA 1YN6B 4NC0B 3T0XA 3OGCB 2B39A 4GFTB 4JFEE 4H1LA 4EIGB 2K7QA 4X7TA 3RVWD 5F7EL 3LS4H 3CH1B 3ETBF 5INCB 2OL3H 4PV8A 1AIFB 2CD0A 1RZ7L 1UT9A 4NO3B 3O9WB 5D1ZB 2H8PB 4JFXA 2HKFH 3THMH 3Q5YA 3UX9B 1Q1JL 4X9BA 3S9DB 3QSKB 3QDJD 5IB5A 5HDLA 3QNZA 4IRSD 3SDCB 2ZCKH 2AEPH 4XPTH 2Z35A 3PGCB 4Y4FA 3B9KC 4XP9L 5DWUL 3HAEA 2R4SH 3GMOA 3MUJA 2UWEB 1LD9B 4YH6A 2AVGA 5GZOC 2GK2A 1X3DA 3PHOB 4TULL 1FHGA 1YNLH 5D2LE 5E6ZA 4OZIF 1HEZA 2XG5A 1J1PL 3QCVH 1UJTA 5IB1B 1VADB 4HG4K 3IDIB 3MOBL 5HVWA 1XH3A 4LVHB 1S5HB 2BVQA 3O4OC 2PTTA 2KKQA 3IAGC 4I0CC 4TQEL 4IRJD 2AQ2A 1BZ9A 1NAKL 4U1KB 5I73B 4FMFA 4EDXB 5IB2A 2B5IB 4P46D 5JPMA 3B9KA 4M6OH 5CD5C 2ENSA 4AM0A 1AGCA 5I8CA 4WEBL 4TUOA 5ADPL 5I9QC 3EOBA 2DKUA 2ZUXA 1QHOA 3C9NA 5I0DA 5SWSE 4MJ6B 1IM9D 3MJ7B 4G6ML 3HNTL 3WNPA 1LILA 3IXAA 3QEQA 4M7LT 4XBPA 1G1YA 4Q9CA 5ITBH 1MFCL 3JTTA 5IT2H 3QHFH 4U6XA 4G9FE 4XBEH 3IF1A 2FL5A 1F3JA 2M1KA 4JFPA 5DMYA 4WU7B 5EC2A 4ZAKD 4EN3A 2JJVA 4JAMB 1VEPA 2DLFH 4DZ8A 1FFOB 1HHHA 5CBEA 2E9WA 1KB5H 2H2PC 2R0LL 3UTSD 4LMQE 3VGDA 2UYLB 5KAQF 5ACZB 3PV7A 2WBJD 2IQAA 5I71C 5IVXA 1YDPB 3NA4A 4EXPX 2C3XA 4I2XB 1IKFL 1IGML 4KUCF 1CZ8H 1OPGL 2X09A 3CSBA 5J1SC 5C0JB 1CICB 4M1GH 4DGYH 4NRZA 2GUOB 4JPKL 4M5YH 4MXQC 5ISZB 3GMMB 3MFFB 5EBMA 4OZFG 5C92A 4JM4L 2VKXA 2XQYK 3MYZA 3ARQA 1MWAB 3EAKA 4FOMA 1QYGH 4OZGA 4RMVA 4TNVK 3WDHA 1MFCH 2BNQB 1RAMA 2EE3A 3GO1L 1RZJH 1OHQA 5JW5A 5F9WB 4L8SB 1RPQA 1ZAGA 4L4TA 4APQD 2ZWLT 4P59L 4JLRA 1FE8L 3EYQD 1BFVH 3BAEL 4JCLA 4QTHB 3AMLA 1Z5LB 4X8XA 4C83A 4ZFZA 4AIZA 2OI9B 1WGOA 3WLBB 5DSCB 1TTUA 1MH5A 4LGRB 4L4JA 1VFBA 2NXYD 3PP4L 1KEML 3MJ8B 3ULSA 4PY7B 1U0QA 1HDMB 3NFSL 4I18B 1QSVA 4RIRA 1FG2B 4MWFA 4KK9C 2VLLB 4G42A 3CCHB 4U49A 5IG7A 5I1HL 2GTWB 2X5PA 4J3TA 4GRLB 1GOFA 5ICXB 3V5DB 5DD6B 5I66A 4F7CB 5C0CD 1U41A 1UA6H 3X11B 3I02A 3ZE0F 3LH2L 3KPLB 1AE6L 2AJSL 4G8GB 3U1SH 4AL8L 1LO2L 1DEDA 4BSJA 5DJDA 4Z7WF 3STBA 1JUFB 4MA8L 4J4PC 1IZKA 2P8LB 5A2IH 1C1EL 4Y1AB 5IBLD 1NMBH 4Y5XB 1UQSB 1JGLL 5SV4A 4NHUB 4QRRE 1JRHH 2M26A 4HD9A 4OJFH 4TVPL 4HUXA 1IAIM 5TE4L 1G7JB 3V9FA 1C5DA 5LGKA 4OCWL 3LKNB 5FO7A 5TFSL 1EJOH 1JWUB 4JG0H 3PP4H 5CJXC 3MRMB 2EEDA 1JI1A 4NO0A 1I7ZA 4OLWL 5L7XH 4XVUC 1I1FB 3FFCE 3IDNA 4GH7B 1E4XI 4Z7VA 5EIIB 4KJWD 4K7PX 1CE1L 5DMKB 5GS0D 3MPCA 4GQ9L 3S34H 4J4PA 5GZNC 4PLNC 2EDJA 3VE0A 2NY4C 5E8OA 4BUGA 3LMJL 5FYJE 3RVVD 4N90E 3C2SA 5CEYA 1YNTA 1MJJA 5HI5D 1YPZF 3QDJB 3VGBA 5C86A 5FM5M 4PJ8C 3OBAA 4M1DL 4RISL 3EFDL 4IRSB 5DO2D 4KFZC 2FX7L 1K8DA 5CJXA 1ZHNA 3DUUA 5IFHH 3HG1E 4KRNA 1IQDB 2F5BH 3C8KB 3VMNA 2CDFA 2E6QA 1VGKB 5BJTB 4Y4KC 2C4FT 1N26A 4ZTPH 1FYTA 4KKBC 3BZFB 1FLRL 4HQQL 5GRXG 3RWEB 5JW4N 1IILE 3QUZD 3BZ4A 1HSBB 1Q0YL 3ARFD 1CK0L 2YK1H 3GSRB 3FO2B 2JK5A 1S7RB 2JCCE 1MCPH 2PR4L 5K59F 4HV8B 4NNPH 3CDFA 4JPVH 4AENB 1MWAL 1K8IA 5E99L 5HTSA 4I3GA 4PJ8A 3V0VB 2OSLB 4ZXBB 2ICES 2J8UA 3B83A 3DSNA 4PJ7B 1J1OL 3DX6B 4OGXL 3U4BH 1LO5A 4P46B 3RA7H 3NBNA 3ULUE 1JZ4A 4OV5A 2ADJB 4WWID 3JUZA 1PBYA 5DJ0A 2D7NA 4F7EA 5FA3A 1LO4H 5B8CB 4D0BA 5GQBA 3VFMA 2O5YH 4LQFH 2CKBB 4GMSL 1DFBH 2FECL 4Y4KA 4MA3B 4OLZL 4PJHF 3WNKA 5C6TH 1DN0B 1CIUA 1B0RA 4ODHH 1I7UB 1IM9B 5E03A 3DHJA 4YPGB 2ZOLB 1S9WA 1K85A 1MCLA 2QJDA 4KVCL 4L8BA 5D1QA 1BM3L 3AU1A 5HI4C 3AAZA 1INEL 1A8JH 4Z95H 1GGCL 3SDXF 1H3PH 4ZFOA 3D0VB 4OCRL 3OR7A 1MHEA 3ZT7A 2GTZB 1JNLH 5DVMA 4PGBA 5L2JA 1U91B 3KDMA 1OWWA 1FO0B 1Q9KB 4M8QB 3BJLA 1IBGL 1T7WA 2E6JA 4MMZC 4F57L 4ZUSB 5GGTA 1LO3H 5BQ7A 1CFQB 1CTNA 3UTSB 4YAQA 1MY7A 4K8RD 1HHJA 4X8JB 3MV8A 4XNUH 2FJFB 2E8YA 3K3QA 4YNYB 3NCYP 3OHXB 1YA5A 2WBJB 3EO1B 2DN7A 5KOMC 1PZ5B 4MA1C 3WEXA 3O6LH 4BSWA 4JRXB 3C5SA 3QEGH 3JWOC 4PRHE 3UC0H 4LPUA 3ZLQC 1ZT4A 3NH7H 1X5AA 2P48B 1KTDB 2IANB 3DGGA 4Z7UF 1ODAA 1UXSB 2Z4QA 5GGUA 5GRYA 4PRPA 5SV3A 4HPYH 4NM4L 1UM5L 3PHQA 5E8EB 1N7ML 4ZNCD 1BM3H 3O3AA 2YN5A 4URTB 4LLDB 1UZ8A 4XTRC 4OD2A 3T2OA 1MLCA 4X6FB 2IG2L 4XPFL 2NY1C 4IDLA 4NN7B 5D93C 1T0NA 1LP9A 3B9DA 1SJEB 3G04B 2AABH 2X1OA 3W39A 3GK8L 4APQB 4NO2B 4RMRA 3GSNA 1BJ1H 3H3BC 2VXQH 4RAVA 1A6WL 2F53D 4Y89A 4JO3H 1KENH 3CFKA 3TNNB 5J89A 4GW4A 4ZO7A 2VERN 5ADOH 3GHEH 2HYMA 2NXYB 3DX7A 3OAUL 4UOJA 3U46A 2JIXB 4YFLF 5D5MA 1UB6B 3IDJA 4BK4A 1YC8A 2ZOKA 4LK4A 4X7CC 1EFQA 1CLOH 3QUYD 4HEPG 2HMIC 4AEEA 3EYFA 1S7XB 4WJ5B 5C7XH 5I6XB 3BEWA 1J1XH 1BHGA 3GBML 4Y5VB 3DV4B 2ZUSA 3KWWA 3GMNB 4K3EL 5JIPA 4PJAA 1BJMA 3ARTA 3BH9A 2E7LA 3QHZL 1WFTA 4JANB 4WU5B 4K3DH 4ELMA 4KPHH 1E6JH 3MRCB 1KIPB 1DSFL 5C0CB 2X1QA 5C0NC 5D7LD 5GS1B 2E9IA 1BFOA 2OL3A 1U8NA 2XRAL 3STZA 5J9PA 3FRUB 4TPRL 4XNXL 1WEJL 1T1ZA 2VH5H 5C0FA 4JZNA 4M93B 4JN2B 5FOBB 4NZJA 1EV2E 1IRAY 2CKBL 1BD2E 4HIIB 3T1FA 2AK1L 4U1LA 43C9B 4UIMA 3ULVF 1XF2B 4YXLH 4Z8FL 2X4TA 5D72H 4M7JL 4NYLB 2CK0L 4DEPC 3BP6B 4IOFD 2QHLA 3FQWB 1XR8A 4QY8A 4NC1E 1PW3A 4LCWD 5J6HB 1AR1D 4ODUB 2V2XB 5D2LF 1OSPL 1MFBL 4I48B 2ARJB 1KGCE 1NANI 5DJCA 4CN4A 2YPKA 5B39A 1A14L 1EZVX 1FO0L 4MQXC 4V2BA 2BNRA 4KDWA 4YK4B 3D87B 3T65A 5I1CH 4GLRI 1RUML 1U8OA 5K33A 3NCFB 4GMTL 4OCSH 1KCVL 1MEXL 3TBTB 5HYJA 3MOAH 3MRRA 4YBQD 5F7KC 3TN0D 4KI5D 1T3FA 3I6LD 2AS5M 4PJ5A 4NFBA 3GMQA 2H32B 4K94C 4C4KT 4F80A 3JVGC 2Y5EA 4MS8C 1SBSL 3QUZB 1EUTA 3T0WA 2F5AL 3ARFB 4LIQL 4X7SL 3D25B 4JM2C 1JK8A 5IK3B 4JO4H 2WNGA 1CLYL 4JFYA 3RWGA 4L4VD 1AI1H 1WFOA 3C09C 4OF3A 4BH7A 3KR3H 1OD9A 1A7QH 5DJ6B 1AGBB 3RKDC 2DLTA 2Y72A 3HPLB 3CFDA 2XY2A 3L5HA 4HUWA 1A14H 2A0LD 2J6EL 4LHJB 1RZJC 1RHHB 4LAJH 4L5FL 1KB5A 1XR9B 3E3QC 4KJQD 3X3GH 4ELKA 5F6IC 3BVNA 3JVGA 35C8L 5CSZA 5D2NE 3O8XD 5FK9B 2FEEL 4UU9B 1JYXA 1PQZB 4NZTL 1S9VB 1YEGH 4JM2A 4LRNH 4OQTA 4GW5B 3MTRA 2BC4B 5C08E 4PJ9C 1MCDA 1HSAB 3ZKQD 4NT6A 1FPTH 2DWEA 4X6EB 1HCFX 2WWMC 1XGRB 3HI1B 4HC1A 4U1NA 3L7EB 3NN8A 5EU6D 5HSFA 5LGHH 2H6PA 1EEYB 4V1DE 3T4YB 3ZTJH 1T0MA 1TQCC 3FMGL 3RPKA 1S7WB 3UBXB 1BECA 2V2WA 2QBWA 4FQ1H 4QEGA 1TCRA 4DVBA 1KULA 4JDVB 3T0ED 4KROC 4ENEC 1QO3A 1UWGL 5DHVH 5EPMB 4OLXL 1QBAA 1CU4L 1OB1A 4WV1A 4U6HB 2EDOA 4O9HL 4H8WC 1DBKH 2HVKB 2VC2L 4PJ9A 3BEVB 1CR9H 2HT4C 3QO1B 3O3DB 3TBYB 4QOKA 3QNXB 1N3NB 4J8RA 5E9DA 1FNEA 1NCWL 4YJZL 1A9EB 1T20B 3EHBD 3MLZL 5TE6H 3DECA 5DQJA 4N8VA 2JELH 3KXFA 1KEGL 3L3JB 2IADA 1IJ9A 4BFBD 3P4OA 4XNQA 4CNIB 5IM7A 4YHOH 4RGMC 1MHPL 3EBAA 3D0LA 2ZSWA 5ANME 5EU7E 1HH6A 3K80A 1BP3B 1BVKA 1KBGL 5GS0L 5FHBL 3VXMD 2D0HA 2WW8A 4N0YH 4KUCD 5TDNA 1J18A 1XFPA 3MRQA 1IL1A 5EH1A 3EO9H 2F53B 1CGTA 3E6FA 4MD0B 4G43B 3T09A 5C0DB 1BX2A 3HI6L 3K1KC 3NIGF 4LVOB 1ZVSB 1DP0A 2ZG2A 2VLMD 1KCSL 5DMGC 3PWNA 2BOCB 1JHTA 3QUYB 2EIZB 2G75B 2VLRD 3KYKL 2DWDA 1HKLH 1PKQA 3QPXL 3SGKA 4U2YA 5CZKA 2BSRA 5FDWB 4D0DB 3PXHA 4TYUA 2AEWA 4O2EB 2DL9A 1ETZB 3WFCL 5C8JA 2NY5H 1LE5A 3ZKMD 5D7LB 1F58H 2VXVL 4HF5L 4HLZH 4FTVA 2MHAB 3IDMA 3VJ6A 4PS4H 4Z7OE 4XH2B 2K9UA 1T04A 3KPSD 3P9WB 3VGEA 5HHME 3QISA 4O5LH 4BJLA 4KJYB 4LSVH 3FOMB 3PIQA 4PV9B 1C5CL 2ZJSL 2CDGB 2VR5A 3P11L 3BDYH 2J4WH 1A1MA 4IDJH 4A6YA 1F6AB 1A6ZA 12E8H 4IOSD 1CYGA 4H0IA 3WNOA 4EVNB 1J10A 1P7QB 3LV3B 4P2RD 5IW1B 5JMOC 2LABA 4FQCL 5L9DL 3K8MA 3U0PA 1UJ3B 5L6YH 4YHML 4LCWB 3MLXL 3VXNA 1QNZL 1NLDL 1J9CT 2DQGL 3O2DA 2Q3ZA 3B5GA 3GJFH 1F4WH 1BVLA 1A9BA 4NKDA 3V6FB 1EVUA 4G8FA 3VWKC 2P5EE 3TT3H 3BPOB 3JV4A 5T3XH 3QEHB 2ITCA 5DRNA 3WFCH 1JN6A 4NDMB 4OD3L 4X4XA 32C2B 1QBML 5ESQA 2AJYL 1U8MA 4K8RL 5EDXA 4HT1H 4TSCH 3TN0B 4JRYA 2R0WL 2OX5A 1QSEE 2VDQH 3BKYL 3ULUF 4JHAL 4LPWA 1KELH 2VDKH 4JFHE 4LLQB 1XGPB 4UUJA 5J11B 4GRWH 4QRQB 3HE6A 1QKZH 5BZWA 3DUHA 3ZKXC 4HWZA 4FQQB 1Y6MR 4NQXB 4C56E 4WI7A 5DTFB 3MNZB 1J0JA 3VWKA 4PGEB 3HZKA 3D2UD 3IU4L 3IGAB 3QWOA 3WD5H 3MRLB 1T1WA 5CCKL 5E08L 1KC5L 1DEEA 4DQOL 5LXGL 3VXTB 3GUTA 3QXDB 2YOCA 3HR5A 3FT4B 4G8IB 1NEZG 4HIXL 1MRDL 5BRZA 1AQDA 1P53A 1U8JB 4JB9L 1NAMH 1GZQB 5C0BE 4EQ3A 4RRPA 4HH9B 3O8XB 1NDMB 4OGAC 5D8JH 4O2FB 4P4KC 3LKRB 4QXUH 1TLKA 4S11A 1KNOA 1G9NC 3VD9A 2GCYA 3U7WH 2HTLC 3FCTA 3MO1B 3WL9B 1BFTA 1I9IH 3MLRH 1RZKL 1P9MC 2HA1A 5EU6B 4LASL 4ZG1A 1I3GH 2A9MH 5I0ZA 1DQQA 3OF6A 4R2GC 5MENA 4NQVB 3FQUB 3UTTA 5CD3A 1ZLVH 3MJGX 1EHLH 4UNTA 3HCVB 5ICZA 1HIMH 2E7HA 2FNBA 3RZCD 3VI3E 3QA3A 3C6LC 4ZPVA 5TDPA 3T0EB 1ZGLP 1I7TB 5J6GA 4PJIA 4P4KA 4UMGA 1KTKE 3MRFA 4POZC 2P49B 3DTXA 5C0AA 2W60A 1V5JA 4AIXA 1IMHC 3S36H 3KVQA 3BPNB 1MRDH 4DKFL 2DBJA 1IM3A 4M48H 4I4WA 3WUWA 4Y19A 4KTDL 1P9MA 2XIDA 3ARDD 3PGDA 2Z91A 3EIFA 3CLFL 3CFCL 1LQSR 1NGQL 3IDUA 4TVSa 5MP6L 1FZMA 4H26B 4ODTL 1MCKA 3VXOA 1VDGA 4NKQB 1LMKA 1YMME 5DXWA 1S8DA 1M6OA 2B2XL 4OIIH 6FABH 3F5WB 3EO0A 3C6LA 3HPJB 4UILH 2EXWD 3VMOA 4KMLB 3RIFK 3O41B 3TIEB 2BNUA 4IMLB 1F4XL 1F90L 3O3BA 2AJXH 1SYVA 1RJLB 3I6KB 1C7TA 1NGYB 1RSFA 1HN1A 1WCBA 3GNML 3ZTNL 2WUBL 5CGYD 4MJIA 4JDTL 3L3HB 4XP1H 2E27L 4L29B 4HXAH 4WRLA 3NCYS 5DFVD 1WTLA 3IETA 1OCWH 1B4JH 3QEQE 1OAXH 4BFIA 2C26A 1IAOB 1MCNA 3UBXG 3WNNA 4KTDH 4XP5H 5C0IB 2VDML 2W1NA 5JORB 4XNZB 5J1AA 3HUJE 3V4PH 4I1NB 3BDXA 2HJLA 4JGMA 3CIQA 4M61A 4QRPA 1CLZH 1O5DT 4PJBA 4JFFA 2JJWA 1XF4B 2VZVA 2JB6B 3LEVH 4HZLB 4P2QD 4UDTB 1R24A 3WN5B 3KLAB 1AO7B 2P8PB 4HMDA 4QCIA 3QDMB 1I1AA 2QKIB 3E2HB 4OLUL 1ROWA 3WLWD 3VXQA 2V9QA 1BBJB 1MAKA 5F96H 2DJ4A 4RNRA 2A6IB 2W9EH 4WO4C 3E1F1 4JDTH 5JQHC 5HJ3B 4ZYKA 2JE8A 4F15B 1OARL 3OX8A 4WFFE 3DETC 2DLIA 4FFZH 1VFOA 3S88H 1PSKL 3IDGB 4OGYH 4PP1C 1AQKH 1IT9H 4UTBL 3GIVB 3GRWL 2VDOL 4Z7WB 5IGXL 4G3YL 2DQUL 3FB8B 3CGTA 1Q9WB 3W82A 4Y2DB 5E2UL 2MQCA 1HQ4B 2HLFC 3BRFA 5FFLA 4G80A 2GAZA 3I6GB 4TTGA 2FBJL 5LAXA 1WVZA 1A2YB 4GAYB 1HI6B 3ET9F 1MNUH 3MUGB 1JRHI 4NKOA 4WO4A 2NY6B 5T1LA 3FTGA 3QJHB 1U58B 3BPLC 4XCCL 1ACYL 5SWZB 3V4VL 2EYSA 5BVJB 3NCJH 5SX5H 2ID5A 1RZFL 4AG4L 2QSQA 4LBEA 1DUZB 5D70L 2X4NA 4LPTA 2G60H 1K6QH 3VFUA 2Z92B 1IAKB 3I9GL 3LQZB 5A1AA 4XC1L 4ODSH 4XAWH 1A4KB 1EGJL 1KCUL 3G6JA 5K9KA 4M7LL 1XGTB 4XAKE 2C1OB 3KPPB 5T5FH 2QSCH 2HKHL 1YPZB 1AY1L 2NY4D 3V4UL 2KDGA 3MNWA 1SJVA 2HTKC 1X4ZA 4XCYA 1QQDA 3S35H 2ADFL 5EOCH 4OQ1A 1MQ8A 2GK0A 5FOJA 5JO5B 3DVGA 3SKNB 2EDBA 3P4MB 5DEGB 4P57B 5DHVA 3BO8A 4J3OC 5I1EH 4UQ3B 5JDSA 4HUKB 3VRLE 5HGBA 1IGIL 1JBJA 5SWSD 4EDWL 2Y7QB 3LB6D 3I3DA 3P77A 4JR9H 4K3GA 5E1HB 5ABDE 1FC2D 1MHHB 2V9TA 3I50L 4D9QE 1YYLH 2MPAH 3EYOA 3D3VA 3CC5B 1YYMH 2MMXA 1Q94A 5F88A 4YHYB 3LN4B 3KG5A 3BP4A 3QIWD 4P5TD 1CFTA 1CIDA 3IJYB 4XC1H 5HHVH 4XZUB 3KPNB 2AQ1A 1F8TL 1Q9LA 3FOLA 3H9SE 4M7ZC 3VCLB 5FA4B 2OTUB 3RZCB 2QADB 1N0XL 4FQXC 4K71C 4WHYH 4PJHB 3CK0H 1L0QA 3FB7B 3BFOA 3QQ9C 2ADIA 5FHAL 2AK4E 3PXJA 1E28A 1GRWA 2NX5D 2C3GA 1ZLWH 1DQMH 1WFUA 3JTSA 4ALAH 3NA9L 3VXSA 5I75B 1C16B 3U2SA 1QLRB 4HCRH 3CPLB 1FNGA 1E0OB 2UY6A 1FV1A 3P40A 4NRYA 2FGWH 3TJEL 5E2WL 3SDXB 3ARDB 3OKKA 3T1WA 4LSSH 1XGUA 2IPTL 4Q6IC 2Y6SD 4K9EL 5D71L 4XCFL 4S2SA 2EDRA 1Z9MA 5I1IL 4Y5YB 3FQTB 3TBWB 4XMPL 3WFBH 4N0CD 2R2HA 4FQXA 2EC9U 2FJGA 4XNMB 3O2VH 4JFOA 5EORH 3OKYA 3Q6FB 3QNYA 4KK5D 2VQ1A 2PW1A 2EXYC 3LKSA 2YA0A 1DANU 1FFPA 1H9VA 4O51B 5LCVL 3UAJC 5AZEL 1MIEH 5DJ2B 1X6NA 2P7TB 3HE7B 4R4FL 4UINH 1JNJA 1S9KC 1GXEA 2AJ3B 2O5ZH 4MNGA 4X5XB 4Q6IA 4HPOH 4AEIL 1RUPL 3HNVL 4NWUL 5DK3A 4Z7OF 1P4BL 1P84J 4MCYA 2XTJE 1E27B 3MRBB 3ZZ1A 3VXUE 3IFOA 1LWRA 4P2OC 2FH8A 3KPRD 2JJTC 3HZMA 4XWOD 3CFEA 3NTCL 1I1YA 4ZSOA 2BOBA 2HWZH 2YA1A 5ESAA 3HMWH 5CS7A 3SJVA 2BERA 4K9EH 5D6CA 5BOPA 3HRZA 4D9RE 1QBBA 5F7YC 5I15L 3B3IA 1C5BL 4AJ0A 2R2BB 4QYOB 4ODWA 5IEHB 2HN7B 1IGTB 1KPRB 3AS2A 5DJZB 4TNWF 3GJFA 5EC1A 3BT2H 5IMMB 3KS0H 3MV8E 5CMAB 4JGUA 5AYUL 3PL6C 4NFDA 4O4YH 4PUBH 1NCBH 5KVFL 3EFFA 3LN5A 1V3KA 3NFPA 4R4FH 5HHPB 1TITA 4P2OA 2ICWB 3PDOB 4I3SL 3FN0H 4P23C 4QRRD 3W11D 5B3NA 2VZSA 2JJTA 4R90H 4LKXA 2XFXA 1F45A 3MLYH 4UI2A 1S5IL 3JV6A 4G9DB 1KLGB 2Y5TB 2Z9TA 5FGSA 4JDZA 5A40E 4PRPE 1U8LA 5KAQG 1VA9A 3GSVA 4OF7A 2P5WB 5CILL 1E6OH 1WIUA 1DBAL 4RSVA 2CLZA 5JNYB 5HXMA 4LCYA 1A6UH 1XCTA 3QDGE 5DK0B 4H25A 1IC4H 2H26B 4LEOA 4I0PB 3FQXB 4AY0A 2BY3A 4AEHH 2BRQA 4JFEB 3C5ZD 5T3ZL 1K4CA 2N7BA 1LP9E 2B7DT 1RJZB 2DMKA 4LSPH 4XWGH 3MRHB 3CMOL 5J0BA 1FL6B 4J1UA 2DQJL 5A16B 1ZLVK 3U83A 2HJKB 4M3JA 1G7PB 2IALB 5FYJD 4LSRH 4N90D 1NPUA 5HVGB 3RWDB 4LSQH 4P23A 1RUAH 2BZDA 3IFPA 1NUFA 2R1WA 2DLGA 4NKMB 5LJYH 2AERT 3TYGH 3WSQH 4FFVC 1NGZB 4NZRH 5D5ME 1YEKL 5HPOA 4ZUVB 3HG1D 5C09E 5TJWK 4Y16C 2ADGA 4HBCL 2R4RL 2YSSB 3S36X 3RZWA 1KG0B 1NAMA 4NQCD 5JOFB 1OGTA 4KKLD 3OJVC 5D2LB 1A7NL 1Y18A 4FFYH 4P9ML 4PJAE 5IQ9B 1M71A 1QOKA 3BW9A 3BH8B 5TQ2L 4NM8L 3LQAC 2DQEH 4FQLH 3EJYC 3S96B 5T3ZH 2DYPA 4Z77B 2B1HL 3PNWA 5ERWA 2Q76B 3KYMA 4S0TD 2VABB 3OAZH 1UH3A 2F8OA 1BPVA 1Q9OA 1ZVYA 1G9MC 1Q8MA 4KDVA 4NBXB 4Y16A 2EICA 1XGQB 3IDXH 3BP7A 3EYUL 5E8NB 5LGJB 2OK0H 3BKJH 3BPCB 4LSTL 4HKXA 2Q1EA 15C8L 4OI8A 3TCLB 1ZA6A 2DRUA 4P0DA 1PG7H 2P47B 5SWSB 1KPUA 3MJ9L 3ORJA 4MGXA 1MAJA 2IAMA 4WUKL 3RVTC 1L7IL 1UEMA 3QFJA 4WWKD 3OG6B 3GBNL 3P2TA 4JFDE 4G9FB 5EU3A 3RDTC 1X5JA 1W2KT 4XC3H 4CN6A 5JR1H 1UXWB 4U4BA 4LLVB 4TSBL 3RKDD 3SO3C 1QRNA 4ZD3L 1TJHL 2P8MA 5K9QI 1G0YR 4NOBA 4GKSB 5D1XC 3RPIB 4YHPA 5FO8B 1KT2A 1KXTB 1U3ZA 1RZIB 5IBUG 4IIQB 5IMOA 4M3KB 5CWSA 5HYJE 1IGCL 5DRXB 4WUUA 5GGRA 1R5VA 3MLSH 4JREC 5F7DA 4EEEA 4PJXE 1KB9J 5GHWH 5CAYB 4O2CB 4NQDA 3FN3A 4PLOB 4PRHD 2QQKH 1TDQA 3CVIL 2EDXA 1YQ2A 3RDTA 3SDAD 1BOYA 1M7IB 4UOW1 5HYEA 1WWAX 5E8PA 4L3EA 4PGCA 2AXFB 2FATL 3BIAX 2D7MA 4UOW0 5T1DL 1HNGA 4XBGA 1X5GA 1RJCA 5D1XA 1DLFL 1WWWX 2APVA 5C1MB 5F3HB 4EUPH 3KLSA 4E41A 1FH5H 1REIA 3BUTA 4P9HL 3ARBB 1T2QH 3RUGA 4ZPTA 3ROLA 5E94B 4Z0XB 1UM6L 1FVCB 2VDRH 4KROD 4JKLA 3TIDB 1JPFB 2X4PB 4LU5L 1KJVA 2BJML 5CJOH 1OAQH 1L7TL 3IJHB 1DQLH 2AV1B 5GSVB 4G7YL 2HT4D 2NTFA 3L6FA 2BVEA 5IVXF 2XZCL 4YHKL 5CZVL 4L1DA 1NBVL 5T5NG 4UQ2B 5I17A 3MRJB 2OYPA 2AI0L 1TVBB 4RDQG 1JV5A 3G5XB 1OTSC 5L8JB 2AJZA 3LRHA 1Y6NR 3ZSTA 4L3AA 5IMLA 3S3SA 3QIBD 1G6RH 1CXKA 1DLFH 3L3KA 1V7MH 4OZGF 2I9LB 3G5YB 3E3QE 4JKKA 2AV7A 4QHUA 1CDJA 1U8IB 2PETA 4ZOAA 1NC2D 3VFWB 4YLQT 3S35X 4W4OC 1I8KA 4LCIL 3P3YA 4QRRB 1ZLSH 3MBED 1CI5A 1L7TH 4H0GA 4RMUA 1BD2D 5F7NC 3DJ9A 3MLWH 3PJSA 3ULVH 2G9HA 2VAAA 5DQDL 2XZCH 4NNYB 3KXFE 2OR9L 3GSXB 3WS6C 5C07A 3FFCB 2X4UA 2DJUA 3KAAA 1UACH 3UJTL 2PW2B 1N59B 3D18B 4LVNC 5DJYA 1CTOA 3TH4T 3C5ZB 5EOTA 2F54A 4NSKB 1RK1A 3GKWH 4OCYH 1S7VB 4ERSL 2DD8H 3PABA 3FKUS 5A3ID 2F58L 2Q7YA 1GH7A 3OTTA 5H8DA 1FBIL 4KJPC 3UPRA 4W4OA 1JTTA 1WIPA 4W4NA 4IMKC 3SGEH 4PG9B 3WDIA 4BSVB 4HIHB 5FGRA 1QFWL 3RX7A 2Z31C 1OAYH 3HG1B 4Y8AA 2D4DA 4XPAH 1J12A 3WS6A 2J5LC 1VKXA 5HVHB 2A83A 2EYTA 3QYCA 5DLML 3GSUA 5MEOB 5I18L 2XZQL 4X6CA 4YDJB 4MVBC 3SKMA 5SWQB 5MEQB 2EYRA 2FIRT 2JCCB 4UT6L 3UTZB 2GITB 1QR1A 3CVHB 1RK0A 3MV7A 3ZHLA 1JNNL 3QUML 4IMKA 4JQIH 3P4NA 3UDWA 3N06B 4X4YB 2X4SA 4Q9RH 2HRPL 1MPAL 5FUCC 4NUJB 2Z31A 1Z9LA 5J3HC 2QQLL 3F7VB 3ARYA 1T66D 1AC0A 4B0MM 5TPWH 4F7MA 1AR2A 1ADQH 3L3GA 5JMRA 4NQUA 1NH6A 5DVNA 2D9CA 3DROB 3EZ8A 3SKOB 5JQ6H 2VLJE 1F4HA 3K74B 2YKLL 3QBTB 2J88H 4WDIA 4UDUB 1YN7A 2VLKA 4MYWB 5INDB 1KN4H 4WWKB 3UJJL 2OLDA 3CH8A 5DLMH 3WHXB 5CEXB 3TV3H 4E0RA 1X6LA 1IVLA 4LDEB 4HLJA 3VFOA 3IRZA 1I8MA 1X5LA 3QDAA 3CDGB 4KV5F 4MQ7A 2Y06L 3C08L 4ZO6A 5CEZD 4JPIB 3V79C 3QPQC 3QUMH 5IQ7H 3C5JA 5JXEC 2FIKB 5KSAD 3L5XH 3NABH 2X7LB 4RGOL 2V17H 2VITA 2J8UF 3O4LD 1R5WA 1YNKL 5KSBE 4JRYE 1A3RL 1S7SA 1K4DA 1MAML 4ZUWA 2O26U 2ICCA 2DQIL 3MBXH 1JZ8A 3SDYL 5L88H 1G7IB 2GW5A 4PRHB 3WKML 3X12A 3SDAB 3PE9A 3KPMB 3MUZ1 3MRDA 1GYAA 5D9SB 4OLYL 2IFFH 4MSWA 3GZKA 5C2BH 3X13A 3DUSB 1MIML 2AW2A 2O61A 2HT3D 2AJVL 3O6FC 4PD4K 3BQUD 1VFMA 5EZLA 3PGFH 5J56B 5JXEA 1DBJH 2P24B 1M7DB 1IQWL 1QFUH 1J0YA 4ZFFA 4YGVA 5IW6B 2R2EB 4G6FD 1FIGH 1QP1A 1RZ8B 4I9WE 4CVXB 4XMLL 1W8OA 4FFWD 1R3JB 4LCCB 4W81A 1OP5K 5FYJL 3Q48A 2CRYA 5AG8A 3BZEB 5JHDA 1RVFL 5J13B 4QRUA 3U30B 5H2BB 4U7SA 5DRWB 1F02I 1J86A 5MERA 4L8DA 4YEEA 4JO2H 5E6ID 2UUDH 4WEMB 5I8KH 4OFPA 3L95A 2X41A 1ZEAH 3O0RL 2Y36H 4JFZH 3GSQB 3WFEH 4CKVX 3VRJA 2FX9L 2F15A 3O6FA 2R69H 5DRZA 1AJ7L 4R4BA 4X9HA 1ZGLM 1EH9A 4XVJL 5FO9A 2XPGA 3JWDL 4LSUL 5MENE 2ICEB 3OKNB 5DUPH 1UVQB 5MI0B 1DBBL 2Q86A 3GHBL 3O45B 5IB4B 5E1AB 4ONHA 4LCUA 3VG0H 1ACZA 1RU9L 1MOEA 3NAAL 1QBLH 1D5MB 4HIEA 2BVYA 1LP9F 3LHPL 2L0DA 1AXSB 2DTMH 2GSIB 5BXFA 1AGEB 4MAYB 2YPLA 4Q7DA 3D85B 5TGBB 3ULUL 1A3LL 5I19H 1NCCH 1MRCH 3MBEB 2YPVL 2R8SL 1BD2B 1FGNL 2VR4A 1OAZL 4AT6B 5KW9H 3O9WC 3G5ZA 5D1ZC 1U6AL 3VXRA 3VFSB 1PG7X 5D5MF 2I26N 2UZIH 2IMMA 3KPQA 3LVEA 4YZFE 3ZKNC 1FSKC 4YDIH 1U92A 3SDCC 4HW6A 5C6PB 2DOCA 3VW3L 4HG4J 1A5FL 1JGUH 5F1NB 3WIHH 4HKBB 3SE4A 4QHMB 4PJAF 1T03H 3ARSA 3IU3B 4LPVA 5CINH 1YN6A 2P1YA 4QHKI 3OGCA 3OPZH 4ELMF 4MB3A 1UM4L 1SEBA 1CWVA 3DV6B 4HWBL 2KZWA 3CH1A 5INCA 3TM6A 1YUHB 1LEGB 3S98A 1CDUA 4MJIE 4NO3A 3O9WA 4PRAB 5D1ZA 2H8PA 3T77B 3U6RB 4R3SB 2LFGA 4MHHI 1QSED 1OQOA 2VJXA 1QSFD 3WO3B 3P0YH 2CSPA 4CW1B 2CDEB 3SE9L 5C0EB 3H9HB 2YPVH 5I73C 4R26H 2FJHB 4JFHD 4RWYH 4GKZB 3W0WA 1CLCA 1JPSH 4Y4HC 4AH2B 2I9TA 4JHBA 1RJYB 25C8L 2D03L 2UZXB 2DLHA 4GG6A 4QRPE 4J23A 4YO0B 1D5IL 1CGSL 3PHOA 4OM0H 4N9GB 3OZ9L 3WV0A 2A74A 4JQVC 1EEQA 2HLFD 5A2KH 5EOQL 1VADA 5IB1A 1U93B 1KJMB 2FO4B 4YE4L 4EI5D 4NO5B 2E7CA 5B38B 1U42A 4KK6C 1S5HA 2HLAB 3ISWA 1JGDA 4OZHA 2R56H 3ECBB 4WHCA 3QQ3A 1I9RL 4L9LA 4U0QB 3RWFB 3LRSA 1A0QH 5KG9B 3WMSA 1FYHB 1TZGH 2ZUQB 4N5ED 4EDXA 1FVEB 3H42H 5GRUH 4Y4HA 5CJQL 1BQLH 2W65B 4Z76B 1MF2L 5D2NB 1GL4B 4D0CB 3K4AA 4G6JH 1NMAH 3WJLA 2NXZD 4OB5H 2QQNL 2BSSB 3F12B 3RNQB 5JZ7C 1NBYB 1MI5A 3TPKA 4OFVA 5C08B 3OB0H 1KFAL 3DMMA 1OSZA 1N6QH 4JQVA 5FEBA 1BGXL 4Q74A 1A7PH 5HDQH 2P43B 2VXTL 3IAQA 3MJ7A 1DUYB 4P3DB 3WJJC 1DLHB 5LVEA 2WUCL 5I16B 4V1DB 2R0KH 3OZ9H 4EUPA 4MAUH 4F58H 2AEQL 4LHUD 1R0AH 5KSAB 4WU7A 2AXHA 1MLBB 2X4RB 1JHLL 4WI9A 3WIFB 4FHBD 1FFOA 3QXVA 2D7TL 3A6CH 4FXKB 3UTQB 5F9WC 2UYLA 1RMFL 4L8SC 4OT1L 5AWNL 4H88H 1CT8B 3MGOB 5CGTA 5GISL 5CBAB 1YEFH 4I2XA 5CP3A 1YMHB 1MUJB 4QKXB 3WJJA 4JM2F 3CXHK 3G6JE 4UV4L 1YMMD 1BQHG 1J5OH 2OI9C 2Q8BL 2PO6D 1F13A 2G5BB 3HFMH 3QIUD 3AB0B 3MFFA 43CAB 1F2QA 1ZT1B 5ANMB 3U82B 4RBPH 2V2TB 2KH2B 3MV11 3QEUB 1MWAA 4G6FB 2BNQA 1IGYB 3BKCH 4JG1H 4I18C 4PRID 2GT9B 1XGYH 4L8SA 1MHCA 4G6AD 5CZXC 1M4KA 2VO5A 1IC7L 5KN5B 4XHQA 4K3HA 4GRLC 5AZ2L 5A2LH 3RVXC 3JWNC 4UV7L 4OKVA 5E6IB 2J8OA 3ALPA 3REWB 1A64A 1ZXQA 5L8KB 1Z5LA 1KN2L 3CJJA 2DS4A 3WLBA 4UIKH 3D3VE 4M00A 5F9JB 1BZ7A 4HBQA 5DJXB 1Z3GH 3MJ8A 2BXYA 3T0DA 4Y5XC 1NDGB 1HDMA 4TOYL 4PREA 1EO8H 2C4XA 3WE6A 1FG2A 4XI5C 4GXUM 4X99B 4NJAH 4X7FC 4NHCH 4TRPH 3FFDB 4DJMA 2GTWA 5GGQL 4GRLA 5E4IA 5ICXA 5DD6A 1LNUA 3VXSE 3KHQA 2E7BA 5JUEL 3KPLA 1Z6JT 1S9XB 1WBXB 1H15B 4G8GA 1XZ0B 3B5HA 3RVWC 4PLJD 4BQCA 1H0DB 1JF1B 3PQYD 4M6ML 1ZANH 1A6TB 4X6BB 1T1XA 5AZ2H 4P3CH 4RQQB 4XMKL 3KJ4B 3LS5L 4Y5XA 3ES6B 4UV7H 1UQSA 3BOVA 3OKLB 4NHUA 2R29H 4WFFD 1OAKL 3DVIA 3KGRA 5DDHA 4Z78A 1G7JA 5K9JH 1KN2H 4GO6B 3SGJC 1YJDH 4IRSC 1JWUA 3UYPA 2D7QA 3B6SB 5EBWA 1PEWA 3MRMA 1QFPA 4K3JL 2I5YH 4CMMB 1I1FA 3S5LB 5L2KD 4TOYH 3LZFL 4R9HA 2XN9A 2P5EB 4JKPH 4ZOCA 1UCBL 2RCSL 4ZQKB 1H8NA 5EIIA 1AHWB 1M7XA 3PL6D 3RAJH 5BO1H 5DMKA 5ID1A 1N64L 4CL7A 4KKCD 1CFBA 1ULVA 3BKML 1HH9B 1GC1L 4KQ3L 3AC0A 4ZNEA 4PGDA 2G2RA 4IRJC 3C2AL 1UKQA 4KZEH 3ARWA 3TVMD 1QSEB 3QDJA 5FYKH 2W0FA 5FKAB 3HKFA 5D7KE 1ADQA 3FO1A 3SGJA 4IRSA 1JFQH 2RIKA 4M6MH 1PX4A 4ZSOE 4P46C 1FJ1A 2ATKB 5E7BA 3RWHA 4JHWL 2NTSP 1WT5C 3SJVE 3ILPB 4OM1H 5B8CC 1ONQB 4C56B 5BJTA 5DD5H 1T6WA 2HG5B 1HSBA 3MMEB 4EI5B 4RAUB 3FO2A 1S7RA 3TBSB 1UGNA 4HV8A 2CJUH 4P2YA 4IRJA 1CDYA 4AENA 4AZ8A 3WS3B 5HHNB 5T3XE 5C2UB 2RCSH 1A1NB 4LARH 2IBZY 4M7KL 2YRZA 2BMKB 1RIUL 4CMHC 2OSLA 5DFWH 4LLAA 4OCLC 5CHNA 4ZAKC 1BJ8A 4P46A 1HXYB 5C0BB 5JPNB 3V52H 4XVTH 4DTGL 4CRPA 4K23H 4K7FA 2NXZB 1GGIL 4MA3A 5EOCJ 4GRWE 5D96C 1YEIH 2EE6A 3AFLA 4D9QD 2WBJC 5FYKU 3NZ8B 1G9EA 4H1LB 3LDBB 5DMIL 4PV8B 4MNQE 3DLQR 3SQOH 3H9SD 3DVFA 1CVSC 4JFXB 3SQBA 2GTZA 4XNYH 1U91A 3R06A 1FO0A 4DK3A 1Q9KA 5EFIB 4ZAKA 4PJCA 4BQ8A 2DM7A 2B4CL 5IB5B 1EK3A 3VFRA 3VRIB 2AK4D 1FGVL 2XACC 4I77H 2B8OT 2LVEA 5IBTH 1O7SA 4TN9A 5F8RC 3NCCB 4Y4FB 3UTSA 2NY2B 4WW1B 4KAQH 1JWSB 4LEXH 3GM0A 3HAEB 4NN7C 4FABH 3GMOB 4LLYA 2FJFA 4PRNB 2Z93A 4YNYA 3OHXA 2WBJA 4IBLT 3QQNA 1SJXA 2DBLL 1UH4A 4DGIH 1HEZB 4APQC 1FG9C 5B38G 3B8YA 3BN3B 3BXNB 3EYQC 3VD7A 1GGIH 2XA8L 2PTTB 1YMMB 1KTDA 5F7FA 1UXSA 4B41A 2BVPA 2NXYC 1C8PA 1BZ9B 5E8EA 3S37H 1CXHA 3NMEA 1YC7A 2QR0A 3MACL 4LLDA 5IB2B 4X98A 4J2XA 1Q0XH 5I6XC 4Y5VC 4L9DA 1D6EB 2GFBA 2J6EA 5BMFH 1AGCB 5I8CB 3G04A 3QG6A 4D3CL 5IVOA 4PJIF 2ZCLH 3PWJB 4NZUH 4APQA 5F1IA 3C9NB 4LGPB 2DQHH 1NFDB 3DX8B 4NP4H 1NLBL 1TETH 2XTJD 3TNNA 5D1QD 5GS1C 3QEQB 4YWGH 3VXUD 5HYIA 2BRRL 3JTTB 2X9WA 3WIIH 4MD4B 4U6XB 4L8CA 4YR6A 3IF1B 1UB6A 1A21A 4PB9L 5IBLC 5IHBA 4P99A 2FL5B 3HUJB 3I75A 2J1KA 4M93C 2H9GB 5GJTL 4MA7L 4EN3B 1QRNE 1S7XA 4D2NA 4WJ5A 3OWEA 4YZFF 2YZ1A 2XNAB 4JJHA 4KXZH 4LLWB 1PY9A 4OF8A 2WQ8A 1WAAE 4JANA 4WU5A 5F70A 3FQNB 3D9AH 3MRCA 1KIPA 5C0CA 1E4JA 4F8QA 1RIVL 4FQIH 3REVB 4K2UH 4Q58C 3OKDA 2H2SD 1N2RA 2B1AH 1E4XH 4WUUE 3T3PE 1DJSA 2E7MA 3UZEA 4KJWC 5GS1A 3KPOB 5GS0C 3CXDL 2OM5A 3DXAE 2WK2A 3FRUA 1NMCB 4LSDA 4NRZB 4XPGH 4BZ1H 4YK4C 5I1LB 2DQCH 3RVVC 3EW3B 4PB0L 3CFBA 4L3EE 2CK2A 3V8CA 3GMRA 3P4LA 5HI5C 5D7SL 3NPSC 3VFNB 1PLGL 3VFVA 5F9AC 1L9MA 4J6RH 1MFDH 1T80A 1S7TA 2BRRH 1C08A 4QLRA 3AS3A 3LKPB 5DO2C 2QL1A 1RV6X 1X5FA 3QDGD 4HZAA 5JW5B 1NEZA 3RUGE 4NYLA 3BP6A 1A22B 2XQBL 5I71B 4XVSH 4PJBF 4S1RL 1SM3L 3QUZC 2MQ0A 4C58B 3ARFC 4I48A 5ITFA 1N5YH 2AJUH 2ARJA 3TGXA 4C83B 4AIZB 1EMTL 1MH5B 1VFBB 5FXCH 1IKNC 3TVMB 1MRFH 1TIUA 5C09D 1H5BA 4W6WB 2BCKB 3OQ3B 3TBTA 4ZTOH 1VACA 4RIRB 4RA0C 4MWFB 4JPWH 5B21A 2MJWA 4G42B 1KXVC 4QT5B 4N8CL 4BZYA 5I1AA 1AP2B 3ARFA 1TENA 3RY5A 3OB8A 1EBPA 2UVFA 5DJDB 1A6PA 3SGEI 5JLZA 1QEWB 3MFGB 3LN9A 1IKNA 5DJ6A 4RFNB 5KZCD 4Q6YA 1AGBA 1VGEH 2J2ZA 4QO1A 5GGVL 4OD1L 4G5ZH 4HUXB 1J88A 1PVHA 4HX1A 2DM2A 4KRPD 4WTZA 3DURB 4X6DA 3FB6A 5HHXH 4OSUL 3S5LG 1I7ZB 5EA0H 4K8RC 1D5ZB 5FK9A 1PQZA 1S9VA 4JFDD 2IF7A 3S3JA 4OZIE 5ECJE 5FECA 3EJZC 1DL7L 1NCAH 1HCVA 3M8OH 2V5RA 1HSAA 5EUKA 2ZPKH 4N8CH 3H9SB 5KSVB 5H94B 1XGRA 4DGVH 3G6JF 5AG9A 3HI1A 3L7EA 1TJIL 1MJJB 2A2QT 5J3HD 5IROC 5ICYB 1EEYA 3T4YA 2AK4B 5AUMA 2A6KA 2NY3D 1S7WA 5DS8B 3V6OA 3MV9A 4C54A 5I1KL 1K8DB 1AXTH 1MFAL 1ZHNB 3UBXA 2FWOA 1QLFB 3MODH 4GRMB 2HH0L 3U9PL 3B2UD 2HFGL 4CUCA 1B3JA 2CR6A 1RZGB 4BUHA 4U6HA 2BSTB 4X6CE 2Q87A 3BP5B 5I30H 3RBSA 3QJFA 3O3DA 3QO1A 4M5ZL 1T89C 3MV7E 1F42A 2XZAH 4PIRF 5TE7H 3A6OA 1K8IB 1A9EA 1T20A 4H20H 5IROA 4RX4D 1GPOL 3I2CH 4PJ8B 4ODVH 4BQ9A 3QUYC 3M17A 1RZKC 4CNIA 1PFCA 3W5NA 3TF7C 5DD0L 5DJ0B 1YJDC 3BYTA 4F9PC 4HS8L 4D0BB 4GS7C 3FB5B 3JUYA 4RGNE 5FDYA 2V5SA 3W81A 4YX2L 3TBVA 1K5NB 3IDYB 5CUSH 4H1LG 1ZOXA 1WZKA 4FNLL 1B0RB 3EJJX 3VD4A 1DQJB 3EGSB 3KJ6L 2F53A 4LLMB 2VLKE 2XTJB 4G43A 4Y2OA 4L8BB 5D1QB 5KVMC 1A6VH 4I3RH 1T89A 3AU1B 3VXUB 4EJ1C 5DEFB 1B2WL 4JCMA 2DDQH 3ZYOA 2PCPA 4B50A 3U0WL 3CSYB 1HYRC 3KLHD 1A4JA 1MHEB 3A6BL 4PGBB 2BOCA 3KDMB 4WCYL 5MHSE 3IJSA 4YIQB 4MCZA 2Y25A 1HYSD 4F9PA 3HNSL 4G7VL 3FHAA 1RURL 4OUUA 1JYVA 5KVDH 3I85A 1JJUA 5FDWA 2C4FU 2VXUL 3DYMA 4O2EA 3MV8B 3LEXB 4IOFC 4YQXL 1ETZA 1U8QB 3IFLL 1CGUA 3K2MC 1EFXD 4L3CA 1INQB 1S3KL 1AR1C 4RCAA 4NN5B 3WEXB 1A7RL 3C5SB 4OFDA 4D9LH 2CIKB 3ZL4H 1HOCB 1P4LB 2MHAA 3OL2A 4XH2A 2IBGA 1ZT4B 1LEKB 3BPOC 1GVIA 5GGUB 1JGVH 4NCC1 4PRPB 3PWVB 2CDGA 3PHQB 2NY0D 4HUNB 4HGWB 5E5MA 3O3AB 1MREL 4GLRH 1F6AA 1UZ8B 2IGFH 3N1MC 2GJZB 3QDGB 4GXVH 4OD2B 4CVZA 5F1KC 4EI6B 3U0WH 4EVNA 4YBQC 3TN0C 2KQMA 4KI5C 5IW1A 1XIWD 3BGMA 1LP9B 5F7HA 1U3HA 4LCWA 2RHEA 3W39B 2DQTH 4M6AA 3HC3L 3S3PA 3BIKB 3VWJD 1YY9D 3GSOA 3KPTA 1I9JL 1KJ2H 3V6FA 1T83C 4GW4B 4I0KA 4XXCC 3CU1A 1JYNA 5I1GH 3TFKD 1BBDH 4NKIL 4YQXH 3MCG1 3IFLH 1NBZB 3DX7B 4W6XB 3U46B 1DE4A 5D5MB 3IDJB 3UYOD 5C09B 5C9KA 5KSUB 32C2A 5FUOL 2DQDL 1MCJA 2NLJB 2A0LC 3N9GL 1EUUA 3RQ3A 3BEWB 3TN0A 1ES0A 1ZKAA 3UYRL 3KWWB 3MXVL 4PJAB 4HH8A 5D93B 5JIHA 4UNVA 4N0FB 5HPMA 5B3JF 4LLQA 4OF6A 4QRQA 2XXMB 3VG9B 3H9YA 4BZ2L 3O8XC 1RUKL 5EZIH 4Z7NF 4K7PL 3ME0A 4NQXA 3MRNA 5DTFA 3MNZA 1T83A 4PGEA 5E0QA 1BFOB 3H2WA 1JTOA 3HHRB 4L4VA 3NCBB 4KRLB 2VXSL 1UWEL 3S37X 3MLUL 5KZCB 4FQHA 4XXDA 2D31B 5C0FB 3VXTA 4JZNB 1JHKH 4EOWL 1TZHB 2KBGA 3VGAB 3VH8G 2B0SH 3TWCL 3NCEB 4KRPB 3P30H 4U1LB 2VTFA 2VLJD 4CGTA 1NGPL 3VA6A 2X4TB 3P73B 2LU3A 1U8JA 5F7WC 3T0EC 1FCCA 1P69B 1GZQA 5I1JL 1IFHH 1NDMA 1XR8B 4GAGH 1TNNA 4JFDB 1RFDL 4DUXA 1YEJH 4ZFOL 3WL9A 2X1WL 2YD8A 2Q8AL 5B39B 3RX8A 3PWLA 4LP5A 3C60A 2WSKA 3GRWA 3Q6GL 2FB4H 5J12B 3DRQA 2ARWA 3ZT5A 5EU6A 5GGTL 5T3ZE 1M05A 1HE7A 2J8HA 3SOBL 3EHBC 4Q0XL 4QXGH 2JLLA 1CF8H 1U8OB 5F7UA 3UTOA 4TNWK 2NY3B 1CBVH 2ILLA 3INUH 4OTXH 2VXSH 5HYJB 3MREB 1YEEH 2APWA 4JRYD 1T3FB 3LIZL 4DEPB 3T0EA 1AKJD 1I7TA 1CFNB 3U36B 4PJXB 3MA9H 2D9QB 3T4AB 4JKWA 1WZ1L 5DR5L 4KKNA 3W0WE 5BV7H 2IQ9L 2N7AA 5F1SA 4GG6E 4PGJA 3UJIH 4JFYB 3VDBA 3RWGB 1A7OH 1FFQA 5DD3H 4POUB 1T22B 1CICD 1DBML 4BH7B 4H26A 1IAIH 5D7IA 1EGJA 1BEYL 3STLB 4FP8H 4NQSA 4OZHE 4HUWB 5ISZD 3ARGD 3F5WA 4I9WD 3Q3GA 4OV6F 2I07A 3QRGH 1GHFH 1OTUD 3ZDYF 4XNZC 1KB5B 1KIRB 4ELKB 3BVNB 3O41A 5CSZB 4EBQH 2NCMA 3JWOL 1WAAF 3TIEA 3VXMA 1BAFL 4IMLA 1J8HD 4YGAB 1RJLA 5FUZL 4AMKL 1NGYA 3ZKMC 4UBDD 4Q9QL 3EOTL 1MI5E 3BGFC 3T3PF 3WN5C 1SEQH 4FZEH 2BDNL 5EU5B 3L3HA 4PYGA 2DWEB 3E2HC 4L29A 4DFHA 4K55A 1MJ7L 2RFXA 4Z7UE 4U1NB 3NN8B 3GBLA 3K7UA 2H6PB 2BVUA 1IGJB 4QXTB 1DQDL 2VLRA 2N1KA 2BHUA 5IHZB 1CS6A 1J05A 1L0XA 3DRTB 4S1QH 4E5XA 4YUEL 3AY4C 5JORA 3UBXI 4IS6B 1BOGB 4DVBB 1TCRB 5F6IB 4YDKH 3QWRD 5GGSB 3RUGF 5ESVB 3LS4L 5D7JD 2OL3L 2JB6A 4HZLA 4EQ2A 4WV1B 1EFXB 3SKJH 3WN5A 2N56A 2HKFL 3THML 4PJ9B 3GSNH 2ITDB 1UH2A 2BFVL 2RR3A 2APXA 1CL7H 4Y2DC 2FZ3B 3KPSA 5FCSH 4J8RB 1H3WM 4F3FA 1QA9A 3OXSA 4TUKH 2ZCKL 2AEPL 4XPTL 3TO4D 1BBJA 3NACH 4WHTB 2NY0B 4N8VB 2EECA 3DVNA 5DQJB 3KXFB 2IADB 1JMZA 2CQVA 4XNQB 4Z7QF 5IM7B 1BIHA 2R4SL 3AY4A 4IEFB 5HJ3A 2LTQB 1WTGT 1RUQH 4XGZA 3D0LB 1YNLL 2PTUA 2ZSWB 3QCVL 4P2RA 1HH6B 3JV0A 1DCLA 1EA9C 4A2LA 1PX3A 4N5UA 3O3EB 3GIVA 1X4YA 3L3IA 3E6HB 4MX7A 3MRQB 1T5XB 3VWJB 5JIIA 3J7HA 3E6FB 3FONB 1W72H 2OJEB 4KC3B 1HQ4A 3GI9H 1BX2B 2FCBA 3I6GA 1EXUA 4GAYA 4KTEH 2BSED 1VPOH 1T5WA 2DMCA 3PWNB 4M9PA 1NC4D 4M6OL 4PJGB 3QJHA 1U58A 2BFVH 3V0AC 3R8QA 1ORSB 3ULVE 2C7UB 4O58H 1DZBA 3RWJA 5BVJA 2YWYA 3K0WA 3V8OA 2WAHA 5C9JB 5ITBL 5IT2L 5C8JB 1MFEH 3QHFL 3EDEA 3LQZA 5E5RB 1A4KA 4XBEL 3D2UA 1ZGLB 1XGTA 3KPPA 2C1OA 2ZUVA 1I1AD 4JJ5B 2IPUK 3SDDD 2O93L 3V0WH 2YZ8A 4JHZA 5DQ9A 2DLFL 2DKMA 3BHBA 3PIQB 1ZTXH 1R3HA 3U0TA 1XF1A 3FZUD 1NGXA 1KB5L 5GIRB 1MCWW 2VDNH 4ZXBD 2HFFB 1A6ZB 2OS7A 5DGQA 5GS2D 4Z9KB 4HUUA 2VLJB 1GAFH 3RZCC 2JTDA 2EC9T 5B22A 3GMLB 2E3VA 5JO5A 3F7QA 3SKNA 1CZ8L 3HS0A 1GZPB 3V7MA 5EO0B 1T4KA 1V8HA 1DANT 4ZFGH 5I75C 1HINH 4M1GL 2YEZB 5ILTH 3VXNB 4DGYL 5FB8B 4LFHD 1BVLB 4M5YL 1A9BB 2Y07L 4NKDB 4X6CF 4G8FB 2XN9E 2A77H 1JP5A 1DVFD 4OIBA 3OXRB 3ARDC 3BD4A 4Z5RA 1WC7B 3CC5A 2XY1A 1QYGL 4DN4L 1O7VA 1X9QA 5DRNB 1JN6B 1RZJL 3VFGH 4KHTH 4HWEH 1NBQA 4ZNEE 3UROR 3VCLA 2SEBB 5FA4A 5EO1B 5KSBB 3RZCA 1II4E 5EUOB 4JRYB 3MCLH 1WK0A 4Z0BH 3JXAA 1AKJB 3FB7A 4ZS6D 1BFVL 2EXWC 1C16A 1QLRA 4K94H 3CPLA 4NNXB 4XRCA 3HE6B 5BZWB 1JPGA 1HHIB 2CXGA 1HZHH 4FMKA 2P44B 4HXBH 3ARDA 4DOHE 3HZKB 3GEWB 1VESA 4JRXD 4OQTH 5CGYC 5D6DC 4BYHA 3QWOB 5CIPH 1FAKT 1T1WB 4GQPH 5I76B 5KOVC 5DFVC 1P7HL 1KPVA 2IAND 4HC1H 2Y07H 1BIIB 4UB0H 3TO2A 5E2VH 3FQTA 3GSWA 3ARGB 5ID0B 1AC6A 4P2CG 4R96B 1TVDA 4XNMA 1LO0H 1UA6L 3Q6FA 4DN4H 1FN4A 5JW3H 4HJGA 5DHYA 3U1SL 4O51A 1VB9A 4YC2B 3ROOA 2JB5H 2X6MA 1J8HB 5DJ2A 3ZYIA 1NJ9B 3TYFA 1D6VH 1S7UB 2AJ3A 3O11B 1NMBL 2GCYB 4F7TA 4X5XA 5D6DA 1JRHL 1V7NH 1UG9A 4OJFL 4G8EA 3MJ9A 2EIEA 3AXLA 4U1HB 5KS9A 1BF2A 2BHZA 1EJOL 1E27A 2WIIB 3WLWC 2IBZX 1DQQB 2YXFA 4JG0L 4X7EC 5MENB 1KLFA 2DIAA 2JIXD 3CFJB 2W59A 5CD3B 2ZCHH 5L7XL 1N6UA 5ICZB 2FR4A 4KVNH 4IRZH 1UZ6E 4Q2ZA 4NGHL 1D3CA 3QA3B 4HEME 3W5MA 1TJGH 3CAFA 4ZPVB 5TDPB 1P1ZB 2YRPA 4PJCE 4NPYB 4HKZB 3I84A 4MD5B 5D7JB 3MRFB 3S34L 2R2BA 4QYOA 2W60B 4WGVB 1KPRA 4P2QA 3NFNA 3MLVH 1IM3B 4KGJA 4H8WH 3IKCB 1KJ2A 3L5WB 5BZDB 3O6KH 4I4WB 3PGDB 3NIGE 2X10A 5DUBB 1ZHBB 5FIEA 3TO4B 1FZMB 1ZHKB 3VXOB 1UWXK 1D9KD 3D69B 5IFHL 3PDOA 2F5BL 1UYWH 4IOIB 4BQBA 5ALBH 1M6OB 4ETYA 4MXWH 1A1OB 3FL7A 3EO0B 4G9DA 1KLGA 5DGRA 4ZTPL 3C6LB 4DK6A 4KXZI 3K8KA 3QXAA 1LDSA 5F9OH 4I5BA 5JNYA 2YK1L 4HJJH 5DK0A 3EYSH 1MCPL 2BNUB 3FQXA 2OTWA 3AS0A 3NPZB 4NNPL 4WFEE 4JPVL 1SYVB 4NGHH 3T04D 1QFWM 3MROB 3MRHA 3QR2A 1FL6A 1WCBB 2J12B 4MJIB 2P45B 1G7LB 1Z0MA 5EZOH 2IALA 5DK2B 3U4BL 4HK3N 3RA7L 3D6GA 3HZVA 4WHDA 4U1SB 1LO4L 1NC4B 4NKMA 5D4QA 4HK0A 5CFHA 2O5YL 4LQFL 3TZVD 1H3XA 1DFBL 2EDHA 1DR9A 5C6TL 5J1AB 3SJVD 2YBRB 5EBLB 1GOGA 4A6YH 4ODHL 2HJLB 2YSSA 3B4NA 4ONFH 1KG0A 4QRPB 3WFDL 1XT5A 5H35A 3HMXH 4CVUA 1I3RB 5IQ9A 4Z95L 4FN0A 5BV7C 3BH8A 1H3PL 4F2MB 3LB6C 4LKCB 1JNLL 3O2DH 4WW2B 5C0CE 1I1AB 1NCDH 5TDOB 3SDDB 1PGRB 4JKMA 3RHWF 4Z77A 4YXHH 1LO3L 4YXKH 2LU7A 3QIWC 4P5TC 4UT7H 2VABA 3HC4H 2JJUA 4NQEE 2DQFA 3BYYA 1CFVH 1L9NA 1U8HB 1AH1A 1W0WB 2YUXA 4XNUL 5E8NA 1KCRH 5LGJA 3EOAB 3OX8B 4DUVA 3BPCA 3CX5J 3O6LL 3TCLA 2OQJA 3QEGL 4IIQC 5HGGS 5SWSA 3UC0L 3V5KB 2EH7H 3ARUA 3NH7L 1FLTX 4HPYL 4PR5B 1C7SA 4EZMA 5LBSL 4M62H 3WFDH 4GG6F 1DVFB 1LK3H 4U0RB 4MNQD 1F11A 2H1PH 1G1CA 3QIWA 4P5TA 2Y6SC 4LLVA 3QCTH 4NKOB 4OFYA 5IUSA 3FTGB 4ISVB 1N4XH 4OZHF 4N0CC 2AABL 2A6JB 5I8EB 2OZ4H 4FG6D 4KK5C 4OI7A 4OI9A 2VXQL 2NX5A 1RZIA 4X4ZA 4IIQA 4LBEB 4JO3L 1KENL 5F71A 2X4NB 2YMXH 4S1SH 5ADOL 4U33A 3GHEL 3F58H 4YFEA 4XP6H 3PV6A 3DX9B 4O2CA 3EJZD 3OJ2C 1CLOL 3G6JB 1R3IH 2G5RA 1EEZB 5C7XL 1J1XL 4RZCA 2AXFA 3MNWB 3CFIC 3RTQD 3QZWB 4XCYB 5LBSH 4K3DL 1QQDB 4XWOC 5F3HA 3K2UH 4KPHL 1E6JL 3VGHA 5CEZH 4ONGH 3NZHH 3G08B 1NKRA 3L3DA 3U9UB 3DVGB 3HC0B 4G6KL 5BW7C 5E94A 4Z0XA 5DHVB 4POYA 5BS0E 1BLNB 4MQTB 5JDSB 1JPFA 4X6DE 3HI5H 4HFWA 5HGBB 2VH5L 5H37H 4MJ5A 1YECH 1MVUB 1G9NH 3IJHA 2AV1A 5GSVA 5FKPB 3FRPA 3QT2A 1OP3H 4OLVH 5K9OA 3D3VB 1QLEH 5ENWB 1G7HB 1Q94B 2A6DA 4DKEH 1FVDA 4NIKB 2MCPH 4YXLL 3W11C 3KPRA 5D72L 5DMJB 4DN3H 1S9YB 1Q9LB 3FOLB 1EO7A 1TVBA 5DF0A 3G5XA 4NC2B 3BSZH 4XPBL 5BW7A 3ARPA 2AEIT 3NOIA 4YHLH 1E28B 3DI2B 1JNHA 5KTEH 3WDJA 5GGRY 3V6OE 3MV9E 3VXSB 1FNGB 2I9LA 4R97C 3N85H 5GRJH 3C5ZC 1FV1B 4UT9H 2DM4A 3ESVF 4NRYB 1T2XA 1W72A 5I1CL 3QH3A 1G0XA 1U8IA 2VSDA 3DXAD 4G6KH 2GJJA 1C12B 2ZZUT 3IVKA 3QXWA 5EG6C 2X42A 4GSDH 4FQ2H 3VFWA 4ETQA 4OCSL 4X5WA 2WWKO 3L7FA 3MOAL 1D9KB 4L3ED 2FLBT 4QRRA 1SVZA 3MLTB 1MCEA 4NRXB 4HMEA 1G7MA 4RMSA 3TA3D 2CRZA 4NNYA 3QNYB 4HSQA 4JO4L 5HVHC 2AXGA 1P7QD 2PW2A 4KKLC 3T3ME 5F6HJ 3PDDA 5EZJB 3ILQD 1AI1L 1INDH 1Y0LB 1I4FB 4M02A 3C87A 3KR3L 4XPBH 5HHOE 1A7QL 2QHRH 1MSPA 2DAVA 4MDJA 1ORQA 2GHWB 1U36A 2PUQT 1U2HA 4MCYB 5T1KD 4BELD 1U95B 2AGJH 2D0FA 3SGDI 4TSAH 1FDLH 3T2NH 5IJKC 1D5XA 3TZVB 4ZS7H 3X3GL 3HZMB 3CFEB 4HIJB 3T2PA 1I1YB 3LEYL 4ZSOB 3SE8H 5LQBH 3F65A 3SJVB 2VN7A 1FL5A 1YEGL 3EOYG 4LRNL 5D6CB 5ETUB 4NQCA 2LAGB 2HFEB 1XCQA 4KZDH 4KDTC 5MEOA 2DL2A 3A67H 5IHUL 4ODWB 3RU8H 4YDJA 5LG1A 1FPTL 3H9ZA 5SWQA 5MEQA 3GJFB 2NMSA 5EC1B 2JCCA 5LGHL 2EH8L 2GITA 4WWKC 3CVHA 5GJSH 3EFFB 3GIZH 1LGVA 1GGTA 1NL0H 2DTSA 5KJRH 5IJKA 1B6DA 4X4YA 2CKNA 2PYEE 4FQ1L 4CJ1A 1UKTA 1MJUH 1NCTA 4LKXB 4DW2H 2XFXB 3OJDB 3F7VA 1BQHA 3O2WL 1U8LB 1JZ2A 1P84K 5FYKE 3H3KA 5J06A 4KDTA 5LWYH 1DBKL 5JW4R 3CD4A 3LSOB 3R8BB 4RFOH 1CR9L 4GRWB 4XT1C 4Z18A 5ACMA 4H25B 3SKOA 2XKNB 3LEYH 3G5VB 2I27N 3CDCA 3DWTA 2IH3A 2YA2A 3QQ4B 4WWKA 3ZSSA 5TE6L 4J1UB 2JELL 4XPHL 5CEXA 4MNQB 3Q1SH 4PD4J 2YD6A 4R7DB 3FQRB 5DI8B 1RIHH 2IPKB 5CIPA 5IHUH 3SDAC 4YHOL 3AM8C 3NIFE 4GKNB 4GXUN 2R1WB 1W0VB 2EH8H 4XX1G 4HWBA 2VAJA 3W2DH 4JPIA 2WBWB 3L9RB 4M4PA 4N0YL 5TF1L 5KANI 2X7LA 2PYFB 3EO9L 4RMTA 3O6MH 3DO7B 1Y18B 3MNVB 3O2WH 1KJ3H 1OD7A 1L0YA 4GAJH 2ERJB 1LEIA 4KMTH 1G7IA 5GSRA 4PRHA 3U30C 4S1DD 2W92A 3SDAA 3DSFH 3MV7D 5IVZA 1EEUA 2ENYA 3AM8A 3HRPA 1HKLL 2DYPB 3DUSA 2HFTA 3KYMB 4L4VE 1Q9OB 1QRKA 3RTQB 1G0DA 3QFDA 2FX8L 4XPHH 3P0VH 4Y16B 3BP7B 4PLKD 3MR9A 5E2TH 1M7DA 4RGND 2NY5L 1UZ6F 5IW6A 1F58L 1GIGH 4PJCF 5ELIA 1RZ8A 1XF3B 3QIBC 1ZA6B 4M43H 1IEBB 4LFHG 4AEFA 4PS4L 1R3JA 1HXMA 5MI0C 4O5LL 3BZEA 2IAMB 2XOTA 4LSVL 5TF1H 5KVEH 5GXBB 4WI3A 3JV5A 1SVCP 3BDYL 2J4WL 5EWIH 2W9DL 4F37F 3ESUF 4IDJL 4NCDA 4XB8A 1RULH 12E8L 3U7YH 1IAII 2D4FA 3F8UB 3RL2B 5K9QG 5MHSD 4XP4H 3MGTB 3MBEC 1U2CA 4JO1H 1QRNB 1YZZA 1CE6B 2FLRT 1MJ8H 5I2IB 1HILA 5L6YL 2UVEA 1FZOB 3IFNH 1EERB 1KT2B 3C6SA 5EU4B 4R7NA 1ZT7B 4OBRA 3ARED 1F4WL 3QIBA 5IMOB 3OKNA 2FX8H 3TNMA 4FRWA 3TT3L 4WUUB 5IB4A 1NCNA 5E1AA 1R5VB 1B0WA 4P3WA 5F7DB 3T0EE 3TT1H 3QAZB 5T3XL 4JY4B 4U3HA 1X5KA 3DXAB 1D5MA 2HVJB 4NJ9H 5HDBF 3U4EB 1NC2A 5A3IC 1AGDA 5F1OB 1AO7D 3RDTB 3IB4A 5TGBA 5IFJB 2OTPA 3QDMD 2CIIB 4HT1L 4TSCL 3H0TB 4L3EB 1LK2B 3ZTJG 3QZWG 3SO3B 2VDQL 1I7RB 3LKOA 1BD2A 4PTTA 1KELL 4XBGB 5AYQA 5CLWA 2VDKL 5D7IE 2W9DH 3N0PB 4NFCA 3MXWH 3TA3B 3RUGB 4ZPTB 5E95B 1QKZL 2A73B 2RB8A 4ZDHA 3UZQA 1OP9A 2BHYA 3RWCA 3H7BB 3HMXA 1AD0B 5F1NA 4KQ4H 1FC1A 1CFSA 2ZKHH 4JN1H 4WY7H 4HKBA 3WD5L 4QHMA 1KJVB 1WJ3A 3N1PC 3RWIA 3PHSA 1LE9A 1EAJA 2ARJQ 3IU3A 2IJ0C 3QUXD 3VXME 1T7YA 1CL7I 3WXVL 1T0PB 3R1GH 4Y2DD 3D39D 1HQRB 5T1KB 5IOPA 5IESH 1NGWA 1YUHA 2BY1A 1FRGH 4PP2B 2VLME 4PRAA 3T77A 3U6RA 1NAML 2NY6D 1JV5B 4O02H 3RRQA 1BREA 5D8JL 1T66C 2AJZB 2VLRE 4QXUL 1SY6H 5SWZD 1WV7T 2H45A 4CW1A 5C0EA 2FJHA 2ZUQC 3U7WL 4GKZA 5AAWA 2VWEC 2ICWJ 1I9IL 5D2NC 3MLRL 4HFUH 2ESVE 5MEPA 2AV7B 1F3DJ 4WIQA 4YO0A 1I3GL 2A9ML 1QACA 1DQTA 2VZTA 4AIOA 1U93A 4CU6A 1KJMA 1EHLL 4PG2C 4NO5A 1HIML 5B38A 1NSNH 1I8KB 2X2YA 1B9ZA 3RNKB 1S7QB 3ECBA 3KPSE 1ZVHA 1FQ9C 3WXVH 1JGEA 3RL1B 2EC8A 5KG9A 2ORBH 2G9HB 4GAFB 2VAAB 1NCUA 4LPXA 2OZ4A 1GC1C 4DAGH 3S36L 2R9HD 5KSAC 5E2JA 3MCKA 4Z76A 2W65A 4M48L 2X4UB 5D2NA 5IV2A 3F7RA 4ZUTB 4OZIB 1EDQA 4P2RE 4LF3B 3RNQA 1MELA 5F7LB 3CXHJ 2L7JA 4D8PB 2XYCA 5DVKA 4QGYA 1MFNA 3UO1H 1OTTD 2KUTA 4OIIL 4PG2A 6FABL 2VDPH 1FNSH 5J4MA 1ZHLA 5T3ZD 5I8OH 5C0RH 3V6ZA 4KHXH 3OJMB 3HZYB 3IYLW 3N1QC 4DVRH 3HB3D 4UILL 4PRBB 5C3LD 1Q72H 1CGXA 2HT3C 2WINA 3QWQB 4U1MB 2XZZA 3VFTB 3AB0C 3BQUC 5KSAA 1MLBA 2AJXL 2QADD 1VKXB 4ODXA 3NGBB 3O4LA 4LAQH 3GSUB 4LVNB 1J7VR 2APFA 2P46B 4X6CB 3H8NA 4XP1L 3BE1H 3FO0H 4FFWC 4FXKA 2V7NA 4HXAL 2EYRB 4X6DF 2Q7NA 1CXFA 5GRZA 1OCWL 1B4JL 1CT8A 1OAXL 3SCMD 1QR1B 5CBAA 4LPCA 3MV7B 4U1GB 7FABH 1MUJA 3LQAH 4XP5L 2NY7H 5E6IC 5FAAA 1UB5A 3RVUC 5T33H 2NYYD 2VE6B 1R5IB 3T8XA 2AAVA 3V4PL 1OAUH 4LP4A 1J0IA 2QV2A 5F7MC 2G5BA 1CLZL 3DOSA 1G9MH 3BQUA 3LEVL 5ANMA 2J5LB 2R1XB 3OG4B 3E8UH 3CNKA 4RGNB 3L3GB 3D5OF 3QEUA 5DJ8A 2OP4H 1MQKH 3G6AB 1IGYA 4KRMB 4QHLA 2GT9A 1PZUB 1OF2A 2R0ZH 1YN7B 2VLKB 4DCQB 1ZS8B 1MI5D 4ZUUB 4OAWB 2IH1B 3HE7D 5F96L 3DMMD 4GW1B 1O0VA 2DIBA 5E6IA 2W9EL 3QP3A 2OJZH 1P7KB 1SYSB 3VFOB 3TPUB 2F9BT 4FFZL 3S88L 4OGYL 5JIKA 4FS0A 5DJXA 4FZ8H 3WUZA 1AQKL 2MWCA 3KJ4C 1IT9L 1J0HA 1NDGA 4WFGE 3WO4C 3AREB 1VFAA 1WZLA 1OLZA 2VUYA 4AK1A 2FD6H 4QF1A 1S7SB 1K4DB 4QWWD 4E42A 1XF5B 3T3MF 1P5UA 5DA4A 5IJVA 3TEUA 2VDLH 3N1GC 1MNUL 4B5EA 4FXGA 1S9XA 2I60H 1H15A 3CDYA 5FCUH 1AHWC 2YC1B 5IVXE 2RBLA 1HWHB 1H0DA 1JF1A 1X7QA 2XICA 3X13B 3TH2T 5DT1H 3QDHA 4C4KO 3NCJL 1AFVH 4X6BA 2EE9A 3WXWH 4RQQA 1KTRL 1U3JA 3QO0B 4NUGH 1FNFA 2G60L 1K6QL 5IMKA 2VSCA 4CN1A 2P5WD 1JWMA 2VZ1A 4ODSL 4XAWL 2EKSB 2X4QB 3Q0HA 4OZGE 5T5FL 1WBYB 3UZVB 2K7PA 2QSCL 4MNHB 1KACB 1I3VA 5F93C 4I0PD 4OZ4A 4JFED 4OLEA 4QRUB 2JF1A 1A02N 3QUXB 2ATPA 2VMFA 2VISB 4L8DB 3TH3T 3D39B 2ZNWA 3S35L 4L4TE 3L95B 4EI5C 5EOCL 5F89B 1HH9A 3O6FB 4YHZH 5DRZB 3FO9A 5KS9E 4RFEA 5EO9B 5I1EL 3ULVD 3V5HA 1OOAA 5FO9B 1QSFA 2ZSVA 2XPGB 4WI8A 4U1IB 4HHAB 1F4YH 3OKOB 4XCEB 4YHNB 4N5EC 4JR9L 2ATKA 3TCXA 4F8TA 3G6DH 3ZE2E 3ILPA 3GI8H 3L5JA 1YYLL 2MPAL 2Q86B 1ONQA 2NXZC 4RMWA 1CDHA 4LCUB 1YYML 1CDGA 3MYJB 3ALWA 5DJAB 1YEHH 5HHVL 5BXFB 2HG5A 4P2QE 4Z6AT 3MMEA 4EI5A 5EN2B 3TBSA 3LDBC 3H3PH 3CK0L 3NIFF 2FBOJ 4LNRA 3BUYA 5HHNA 3WS3A 2BY0A 1DQML 4PBVC 1A1NA 4ALAL 1FORH 3G5ZB 3SPVB 5T1MA 2BMKA 4HCRL 3H6JA 1P4IH 3KYOA 2O5XH 1OGAA 5JPNA 5AD0B 2FGWL 2FEDD 1OM3H 5CSBA 4LSSL 1QVOA 1NUDA 4HJ0D 2WIMA 1KUMA 1MCWM 5CJBA 3MGAA 5FYLH 2XN9D 1E4WH 5BVPH 4QTIH 3NZ8A 2CMRH 1B0GB 3WFBL 1SEBB 4Z7VE 3O2VL 2VL5B 1UCTA 4G9FD 5EORL 4UTAH 4MHHG 3GMPA 2NW2B 2K1MA 8FABA 2PO6C 3QIUC 1KTLB 3QI9D 4LHUA 2CLRB 4H5SA 2EDNA 5EFIA 1JPTH 1MIEL 4PRDA 2ZUWA 3WFHB 4UINL 3VRIA 1FSKB 2MKWA 2AKRA 2ZUTA 4RMQA 3N50A 3W0WB 2O5ZL 3EYVA 2I9TB 2WWKT 4OZFH 4HPOL 4WW1A 1J8KA 1JWSA 5JHLL 4GG6B 5E8DH 4G6AC 4PRNA 2VZOA 4IJ3B 5DURD 3SCMB 3X14A 4HGKC 4NCC2 2EIDA 2W38A 2A74B 2VN4A 1FYTE 2ZUYA 3L1OH 4KY1H 3BXNA 4FQJH 1CGYA 2HWZL 3HMWL 2X4OA 4X80H 1DDHB 1YMMA 1JGDB 2YUZA 4OZHB 1V3JA 2PO6A 3QIUA 3VDCA 3QQ3B 4L9LB 3FT2B 4HKJB 4KV5E 3L3OB 3LRSB 3HLAA 5KVGL 5F7EH 1WICA 3ARBD 2C1PB 4EN3C 1FL3B 1RZ7H 3BT2L 4Y4HB 2J8UE 3TP4A 4PRIA 1P2CB 3GJFK 4WGWB 1VEOA 5C0GA 5J1TC