2NTFB

Crystal structure of a quorum-quenching antibody in complex with an n-acyl-l-homoserine lactone analog
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
222
Chain Sequence
QVQLQQSGSELVRPGASVKLSCKASGYTFTTYWIHWVKQRPGQGLEWIGTIYPGSDNTYYDEKFKNKATLTVDTSSSTAFMQLSSLTSEDSAVYFCTRGSLYYNNYGWFGYWGQGTLVTVSAAKTTPPSVYPLAPGSNAASQSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Murine Antibody Fab RS2-1G9 Lambda Light Chain
publication title Crystal Structures of a Quorum-quenching Antibody.
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 222
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ntfB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ntfB02
4YX2L 4G6JH 2FHCA 2FB4L 4U6VL 1DLHA 1A9BA 1DVFB 1FFOA 3ULVF 5C0BE 5E2JA 2P47B 3HNTL 5C0AB 3D0LB 4NQTA 4YBLC 3SGKA 4OFIA 3D18B 4FFZL 1A6WL 4LPCA 4PS4L 3N06B 3CJJA 1LEKA 1QO3A 4OCWL 3ZT5A 1IGCH 1UH4A 3STZB 3V6FB 3KDMA 1IGMH 4FFWC 1TZGL 4HXBL 1JGDA 1ZT1A 2OBGA 4FQJH 4G3YL 1BQLL 2Y5TB 3MOQA 2N56A 4FHBD 3FFCE 5EO1A 5DJ8A 3TO4A 2N7AA 1NSNL 1I1AC 3T0EE 1L6XA 3UBXG 4O58H 5DHVA 5I1DA 1AE6L 3QXWA 4XP1L 1S7RB 3N9GH 1S7TB 5SX5K 4XVJL 1BWWA 4P2OB 2G5RA 2MCPL 3O6MH 5HVGB 1IE5A 3IJHB 3FRPG 2VSCA 1MRDH 5I0DA 3EOAB 2CRZA 5DK2B 3WKNA 1RZKH 2JIXA 4XTRC 5DRZB 4GQ9H 3MACL 2EDTA 3SKNA 4ALAH 2DRUA 5DEZA 1GGYA 3D5OF 4U1IB 1I7RB 1T1ZA 5IK3A 2X4RA 1RZFH 3WE6A 4HUXA 4UT9H 2P8MB 4PJ9B 5FGBC 3WDHA 2FX7H 4JFDD 5H35A 5KJRH 2ZSVB 4OLZH 3GJFA 3QCVL 1MLBB 3EIFA 4I77L 1MSPA 1RFDL 2C3VB 4GRLD 4Y7MA 4KK5D 3V4PH 3QEUB 4M7ZC 2FGWL 1F90L 4U1MB 4PJDB 1FL3B 2QSQA 3IJYB 3MV8E 4HBQA 4JFZH 4RGND 4Y5VC 5F7MC 4JPKL 3WO4C 4LBEB 4NUGL 4ONGH 5IQ7L 4JHWH 3JTSB 3PP3K 3LD8C 3GIZH 4PRHB 5EZLA 3DMMA 2Z91A 3OG6B 1PFCA 4L4TE 1B4JL 3VWKB 5IHUH 4APQA 1DBMH 5EORL 2LU7A 1KB9J 2FO4B 4UU9B 1ZA3A 4GRWH 2ZZUT 4GUPB 1JGUL 1ZLWK 4ZSOB 2QSCL 3BWUC 4M8QA 3LS4H 4NO0D 2V17L 5F93C 4LFHG 2PO6D 5HDBF 2HTLD 1OGAB 4ZUUB 3UTTA 1X5GA 4QTIH 1CVSC 1ONQA 2H8PB 5L7XH 3QZWG 4IRZL 5IFHL 4CNIA 4PRAB 4BFEA 5TDPA 4F2MA 2NTSP 1MLCA 4YFEA 5LAXB 4XBEH 3SQOH 4LSRH 2VZUA 4M5YH 1AP2B 3B9KC 1FG2A 1J1PL 1FO0L 4KI5F 4YBLB 5C09A 3RZWA 3X14B 4DFHA 5HHQA 2XOTA 4NQVB 4OF3A 3VXQB 2ICWI 3BSZL 3P0YL 5IJVA 1BFVL 1SBSL 4K2UL 1KN2H 3CPLB 2DQCL 1A4JA 3HAEA 4I5BB 2DDQH 4DN3L 3KPRA 1I4FA 1CLZL 3T4AA 5D7KD 5CCKL 1QHPA 3FHAA 3L7FB 1S78D 3OF6A 4PGDB 1B9ZA 2WWKT 1RJZB 5JA9A 4XNMA 2NXZC 1I1AB 1SYVB 2NY7H 1OAYH 4OQ1A 3QUMH 1RUAL 1I8IA 5D7JC 2ZUSA 3EYFA 2COQA 5IMOA 4R4FL 2EIZB 1ZHKA 4IBLT 3V0AC 4F37F 1FH5L 5I1EL 1YMHA 4D3CL 5DJ2A 1W0VB 5C08A 5HTSA 2ZOKA 1GOFA 2ORBL 3ORJA 4G9DB 4O2FA 1MCFA 3VFRA 5M94B 4FXGB 3S7GA 4PRIA 1GGCL 2DI7A 4EUPB 1OD7A 3KPLB 3TV3H 2BJML 1IEBB 3X3GL 5J7CC 5E8OB 1UG9A 1XGQB 3C8DA 4AM0A 1H8NA 5FM5O 1NAML 5J3HC 2G9HA 3VFTA 3MROB 2X05A 5EIQA 3ZYZA 3LSOB 4OI8A 1WEJH 2BVTA 1HWGB 4N8VG 4Y89A 5L9DL 1KB5L 3PWNB 3UMTA 4JRXA 4PJHA 1VGEH 4JQIH 3BUYB 4NPYB 4JFFD 2F54B 4LEXH 4ZO8A 1ZHNB 4P2RD 2NLJA 4B53A 5GRZA 1C5DA 3V6OE 4XP4H 5DUPL 3O41B 1DBAH 3UP1A 1YEEL 3TYFA 4Y5VB 1QLEH 5CD5C 3DV4B 1XGTB 5EULV 3WO4B 4JB9H 3ALXA 1PX3A 2XPGA 5IR1B 5KSBB 4G6AD 4KKLC 4DKFH 2FJGB 4XAKD 1AGBA 3LD8B 5JOFA 3ZZ1A 3RU8L 5A40E 4XVUD 5EUKB 4IOFD 2VXVL 4JJ5A 5EU4B 2Y72A 5FV2A 2GCYA 4OZIE 2VIRB 2MFNA 5ETUA 4X7SH 1YNKH 4L4VB 2FIKB 3I6KB 1KIPB 2P44B 2YC1A 3H9SE 3L9RB 1DN0B 3AY4A 1PKQA 4F7PA 4YAQA 2GJ6E 1G6RL 3T09A 5E6IA 5I1GH 1HOCB 2HRPH 4UINH 1MI5A 4LDOB 1RU9H 3EW3B 4OZHA 2JJSA 4OZFA 4XZUA 2FDBP 1J8KA 4JO3L 5CINH 3K8LA 1QSED 3R0NA 4LCWE 4JRYE 4NWTH 4G8FA 3B9KB 4HPYH 3MLZH 1K6QH 3G08A 5GS3A 1NGYB 4DCQA 2AP2A 1DBJH 3ARYA 1G84A 4O02L 3T04D 2ID5A 1Z2KA 2ZSWB 5LGHH 2YPVL 4K7PH 3S3SA 4FQCL 5D2LA 4HCRL 1FORL 3CDGB 3QWOA 5DD0L 3V7AG 1J05A 5EOCJ 3ULUL 2ADGA 3QQ3A 3T3MF 2HWZH 4ISVB 1JYVA 2RR3A 2ZCHL 5HVHB 1N26A 1AIFA 2NXZB 3SDDA 5KVDH 4FTVB 3HZYA 1UYWL 3KPOB 2EDBA 5D7JB 1I8LC 1PKOA 5FECA 1L6ZA 2EEBA 1P9MA 5D93C 4LSQL 1P1ZB 2D7PA 4DKAA 2F5AH 4FQPA 1FGVL 1YJDH 1A6UL 3BEVB 4GW5A 2BNQB 1OTSD 4NRXA 4NQDE 2HKFL 5JPNB 1NLBH 2VAAB 1A7PH 1KCSH 2AXGB 3BD4A 3HZMB 4R8WL 4RMWA 4S1QL 2E9WA 5DMGC 5HGDA 1DUYB 2VL5B 4H5SA 4ORGB 3NCJH 4S1SH 1O7VA 4MCYB 1YYLL 4A6YB 5TF1L 2R23A 5IW1A 5I76B 1AC0A 3H2WA 3FRUA 2J8UE 3P4MA 2PTUA 1Q9KB 1EJOH 2ICEB 1G7LB 5HI5C 1IM9D 4XP9H 1G7MB 1P2CB 2IG2L 5D71L 4M6OL 3HC0B 2W92A 3DX6B 3OKMA 4BFIB 3V0WH 4EUPH 2DLEA 5C07E 6CGTA 2W07A 4I4WA 4HX1B 4BH7B 1B3JA 4OKVA 5GJSL 1QSFE 4XAWH 3DSNA 2VH5L 4DTGL 5JA8B 1PW3A 3QA3A 5HI3C 1KJ2L 5E03A 3JV4A 1F4XH 3ARBD 3OHXB 3IKCB 2IH1A 4UDUB 4U1LB 1BD2D 4LCUB 1LDPL 4XNQB 4WHYG 4K3EL 2OL3A 1YN7A 1RUQH 2X4PA 4G9FE 4NZRH 3H3PL 1RZ8B 2CD0A 4MJ2A 1IEHA 3RWJB 3ARQA 1UJTA 3ZDXE 3QCTH 2XN9B 1KPVB 4GLRI 5HYJB 3KPPA 4DGIL 3O9WA 3SE8L 4KJQC 4TTDC 5TE7H 5CBAA 1T2QH 1GAFL 3O6LL 3GI9H 1L0XA 1TQBC 4P5TA 4HMEA 1SVZA 3D2UB 2CLRA 4MS8D 1NCBL 4OD3L 4NP4H 3HZKA 4PB0H 1DQDL 5SWSA 2P48B 1G9NH 5BCAA 3AS3A 2DQUH 4MAYD 4NNYB 1BPVA 1LE9B 5ISZA 2AQ1A 2QKIB 1T04B 1N0XH 4MQ7A 3GMQA 2R0WL 3SDXB 3ZL4L 3BKJL 4R3SA 1MF2L 3U0PA 4GRLC 4CN4A 3TFKD 4L29B 4EI6B 2RQ8A 4KK5C 3FOMB 5D4QA 5D93B 3U7WH 1ED3A 4LPTA 3UROR 3MLVL 1MFCH 3ZTJH 5C9JB 1FYTE 4RGNC 3GFUA 4M93C 4N1EA 1I9IL 5HGAB 1BQHA 4C57C 2IBZX 4PJFE 1T66C 4F37K 4MJ6B 3Q3GB 5JLZB 3SE3A 1WITA 4XC3L 1NBYA 3HRPA 1ZEAL 2DKMA 3EO9L 1UEMA 5IB1B 4K9EH 2GJJA 3HE7D 3UPRA 4ETQA 4PGBA 4WUUA 3L6FA 3TNNA 4HIXH 4F58H 2G75B 2MHAB 4NM8H 4Z5RB 3Q5YA 3FT4A 5IVOA 5D8JL 2OI9B 4Q2ZA 2XZCH 5A2LH 1RY7B 2J8OA 5E0QA 2PO6C 3GMLA 3QR2A 5ESAA 5IBUG 1L9NA 1PQZA 3TEUA 3KPQB 1OL0A 3EOTL 2LAGB 4EVNA 4Q74A 3W9EB 1HIMH 3PWPE 3TBWB 1UB5A 2KL6A 1IGJB 4DQOL 4F7CB 4XCEB 1HILB 2QHRH 1JHKH 4DVBB 1P4IL 3RNQA 2B4CC 4OJFH 5J13B 4M6MH 5CJOH 4HKJB 1JPST 3EYUH 3U6RA 1K4CA 4MJ4A 4GQPH 4U3HA 2JE8A 1JGVH 3OXRA 4X9HA 5ADPH 2GITA 3LKOA 5GRVK 2WUCL 2IPTL 2YBRB 3F7YB 2IBBA 3A6OA 1JGLL 2JJWA 3HE6A 3IGAA 5F9WC 2V7HB 3LZFH 5JHDE 2XY2A 2IQAB 3UTOA 5HD8C 1JBJA 1PY9A 4G6FB 4GW4A 1SQ2N 3GMRA 5ANMB 5FYKH 3BT2H 4L3ED 3UC0H 2HFFB 5I1LB 1HYSD 2C1PB 2UZXB 1EMTH 4JFXB 3H8NA 1AH1A 5DVKA 4JFQA 1IEAB 4MNQA 1JPFB 4HFUL 5EFIB 4R0LC 2HT2C 4P5MB 4Q6IC 1NCWL 3P9LB 5E94A 4RIRB 5I0ZA 5J4MA 1SYSB 4GAGH 1X5HA 1NL0H 1CTOA 3AXLA 4K07A 3CDYA 3WSQH 3FO1A 3MCLL 4D9RD 4JO4H 3O3EA 1INQB 5DA0B 1T03L 4QRSB 2AJZA 4GBXC 3TBYA 3UTPD 2EH8H 4FQIH 4JFDB 5KW9L 3PE9A 3H42L 1KPUB 3VGFA 4GRLB 1R6VA 2J3SA 3VE0B 2LABA 1I3RA 5BZWA 4V2CB 1CICD 2EEDA 5LXGH 4GOSA 2OR8A 1ZGLM 4L8CB 1QNZH 3QIWA 3VD3A 3QRGL 4RGNB 1D6EB 2D0FA 4M93B 5EBMA 3KHQA 4YHYC 4FZEL 5IQ9B 5CMAB 4WI5A 4UILL 2E6QA 3T2NL 2IADA 1JPSL 4H0GA 3V5DB 1EO8L 5EU3A 1WISA 1LD9A 4GAYA 2APBA 2JB5L 1LP9A 3WMSA 2BP3A 1EHLH 3PWJA 1EK3A 4XVUC 4PLKD 1Y18A 4IOFC 4G6JL 5CIPH 1NBZB 5GJTL 4XNZC 2VQ1B 3OJDB 3QEHA 5B21A 4PRBB 3VGDA 1CD0A 4HC1H 5HI4D 1FBIH 4GH7B 4X4ME 2R4RH 3R1GH 4PJXA 3VFPB 1R3KB 3AMKA 4HUWA 5HGBA 4U1JB 1NFIA 1IGCL 1W8NA 2FBOJ 2VMFA 3NFSH 4NO0B 5FUOH 3O4LE 1IGML 5CEZL 5I1AA 4FQJL 1ZWIB 2PO6B 2OS7A 4BH8B 3FTGB 5HHOE 4ZUTA 1FC1A 5EZIH 3QIBA 3IDIB 3JTTA 2D7NA 4JVWA 1LEIB 1SJXA 4YNYB 4MLIA 3I6GB 2FWOB 3MRLB 4MX7A 2H45A 3T4YB 4P4KD 1ES0B 2GKIA 4X5XA 4NCC2 3SO3C 1MRDL 5D7IE 2DJUA 1RZKL 3GSOA 5L2KB 3QT2A 1YYMH 2X09A 4G43A 4GQ9L 3BH9A 4ALAL 3HUJA 3C8KB 4XRCB 2DLTA 4KUCD 5BS0E 2D2OA 4JY6B 2YSSB 3CLFH 1MQKH 4JLRB 2FEDC 2BSSB 3QFJE 1UZ6F 4ZDHA 3GDBA 1UH3A 2FX7L 1OOAA 2H1PH 5KJRL 4OLZL 4UUJA 1OP5H 2YD6A 3Q6GL 4WO4D 4X7TA 4ZODA 5F9WB 3RY4A 2GTWA 4JE4B 5TF0A 1GZQB 2AV7A 3LQAH 4R2GC 3UTZB 1R0AH 1ZKAA 1RV6X 4GRWE 2BY1A 4LF3B 1LQSR 3V52H 1KCVH 1JMZA 1WQVT 3OR6B 4PJBB 4JFYA 4R0LB 5IIEA 3V9FA 4Q97A 4Q6IB 3B2UD 5EC1A 4ONGL 4JHWL 8FABB 1OF2B 1EEQA 3GIZL 3RA7H 4Y2DA 2HVKA 1G7HA 3ARRA 5IHUL 1UM6H 4GBXB 4G5ZH 1YECL 5IOPB 5JIKA 5HHME 2CK0H 1AXTH 1B0GB 2UUDH 5JZ7D 1X6NA 3LS4L 2Y07L 1UXWA 3MNWB 4GKSA 1KJMA 5E2TL 2XV6B 1K5NB 4Q6YA 3RVWD 3OMZA 4KRPD 3O6FD 4PGJA 1I8MA 1A4KA 1EERB 1S7VA 3SCMD 1EAPB 3QNXA 3W5MA 5L7XL 5L88H 4Q0XH 1UWXH 1ADQH 5D1XD 3BIKB 4ODBD 3BHBB 5MP6L 1FNLA 3UDWC 4PJGB 3MXWH 1SEBA 3MUHL 3FB5B 3ARBC 4LSRL 4XNZB 4FQXA 1NEZG 5E8PB 4GAFB 1ZA6B 2X4UB 5FYJU 2XT1B 3B9DA 3BRDA 5DJCB 5MEPA 5IEKB 2V5RA 5CEYB 5EN2A 2BFVH 1YNTA 4LLDB 4TNVK 4HS6B 1KN2L 1ZAGA 4KKAD 2DDQL 3FHQA 4OIAA 5E1AA 1TJGH 3T77B 4M7LH 2BVYA 1OW0A 1P7KA 1MHEB 5D1QC 5FM4A 3BZFA 2EDDA 3UTSD 1IM3B 3BX7C 4OUOA 4GKZB 1OAYL 3P9MB 3LKNB 4HGWB 1K4DA 3GSRA 1EEUA 3D3VA 3MMEB 4M03A 4FQ1L 2DIBA 4KVCH 2PKDA 3SO3B 1FVCB 4P9HC 3WCYA 4MS8C 2X89D 4W4OA 2HVJA 2I07A 3TV3L 5DK0A 4ZUVB 2ICWJ 43CAB 4I9WD 1UQSA 5IVZB 3Q6FA 2BSTA 2C26A 4C83B 4XH2B 5C7XL 1WSST 2FLBT 4M3JA 1UZ8B 5I8OH 5GZOC 2VISA 4OCRH 1XIWC 4PJCA 1VGEL 4JQIL 3WNKA 2NTFA 4BJLA 3MRBB 4QGYA 3WUWG 5K9QI 3MGTB 3TFKC 3U0WL 3TN0D 2WWMC 3BISA 4O9HH 2F19H 1G7PB 4R2GB 1S8DB 2M26A 3I84A 4KK9D 5HYEA 1DBAL 4RMVA 4HS8H 3PWUA 1G7QA 3FO0H 3MV9B 1E4XH 3BO8B 3UEZA 1QLEL 5EBLB 2AK1L 3GMNB 4JB9L 3WFZA 1CF8H 5MENE 4N0YH 2I9LB 3ZDYE 4MD0B 1NGXA 3O3BA 4X4YA 1N6QH 3GSXB 3UTQB 4G8GE 1P7QA 4X6BB 3W11D 1EPFA 2BVUA 2A2QT 2CIKA 1U8JB 4MZ3A 3HE7C 1MUJA 1NJ9B 4PJAA 1S9WB 4IRSA 2WIIB 1T5XA 4J2XA 1VA9A 4LP5A 4R7NA 4QY8A 4KJPD 2EE9A 1HHJB 3ARDD 1LO0H 3FQUA 3RWEB 2VN4A 5IHLB 4RFEA 2EDJA 3S35H 5BVPL 2X1XR 5DHYA 4LCYA 1S3KL 3BE1H 4Z77B 2Z0BA 2FZ3A 3P40A 3B4NA 1T1XB 2BCKB 5BRZD 2YA0A 3BW9A 4PRNA 2AQ2A 5I1GL 1ZT7A 2WBJC 3D85A 3AUVA 2VE6B 2AABH 3HC4H 4NJ9L 5A2IH 4R26H 1R5VB 1F3DH 3BOVA 2UWEA 5B3JE 5HYSB 5CINL 5FA3B 5CZXD 4NWTL 3ARBB 2G5BB 4LLVB 5EBGA 3MOAH 1JGEA 3MLZL 1K6QL 1BD2B 5I9QB 3CFDB 3ARFD 1PZUB 2QQQA 3WIFB 1C12A 2AJXH 4LNRB 2XZQH 1BFOB 5LGHL 3QDHA 1G9MC 4WU7A 2LVCA 4XHJD 5LGJA 3RY6C 3LN5A 3S5LG 5D1QB 2CKBH 2HWZL 4J1UB 2NX5A 1M7DB 1OTUC 3MRKB 1ZVSB 5IJKA 3NACL 2XZZA 3QDJD 1HSAA 1IAKA 3BGFB 4LHUD 3VMOA 1OWRM 4ENEC 4PG2C 4QLRA 4NKDB 2A38A 4WNQB 3VFOA 1HYSC 4YDIL 1IGFH 3VXUE 4AIZA 2X4OA 2W65B 5IHZA 2F5AL 1IFHL 1INEL 1YJDL 3TJHD 3NPZB 3AAZA 1BAFL 1NDMB 3QFDB 4JR9L 2EDHA 5AEAA 5I17B 3DV6B 3P4LA 3D25B 3DRQA 1NLBL 5ID0A 3GIVA 2ESVB 4LLUA 2UYLA 1HQ4B 4K3DH 5DRNB 4MAYB 1A6VH 1QFUH 3JZ7A 1ND0B 4LRIC 4Y16D 2DWEB 5DJDA 4U1KA 1MVFA 2A9NH 2I60H 2VXTH 4NM4H 1XIWB 1A6TA 1EJOL 1MAMH 4XP9L 3LRHA 3GJEB 3D0VA 2R0ZH 1C16B 1MHPH 4X7CC 3FQRB 1VACB 5HHNB 1NPUA 4YEFA 3OKDA 3BPCB 5IG7B 2OK0H 4JKMA 2FSEB 1E4XI 3AM8A 2H6PA 4D0BB 4M5ZH 3VRJB 2F9BT 1J87A 1CIDA 4JFED 4BZ1H 4XAWL 4N0FA 2KZ1B 3RWIB 3UPAA 3MA9H 2WBWB 3MREA 3C5JB 4PLKC 3RVUD 2H32A 1I85A 2OTWA 5J11C 1V7ML 3HE7B 2FNBA 3ULSB 1UXSA 5BVJA 3CFKB 3IXAA 5GRWA 1EGJL 5HI4C 3IFLL 2FBJL 5DGRA 2BOCB 4X6DE 1RUQL 4B7LA 4TQEH 1YN6B 3P73A 4BK5A 1DDHB 1D6VL 4M4PA 3GSVA 3S98A 1S9XB 1FSKC 5J1AB 1UM4L 2Z8VC 2B0SL 2XG4A 2F8VA 4DZBB 1QLFB 4X99B 2IBGA 5FYJD 1T2QL 1ULVA 3VFWB 1CFNA 3PV7A 3GI9L 1ITBB 4Y5YC 4R4NC 2W0PA 5EZJA 1U8MB 4RZCA 5IB4A 3QWQB 3ALPA 3D48R 3JBG7 1E0OB 3DYMA 1I1FB 4NP4L 3LKQA 5I18H 4F33B 4YXLL 1G9NL 1JIBA 3QUYC 4YPJA 1U2CA 3QDGE 4PUBH 2DQUL 3QI9C 1AHWA 3H9YA 1WZKA 3D9AL 3LN4A 3LDBC 4OAWB 4KQ4H 3NIFE 2ARWA 2FGZA 1EEZB 1N0XL 1E28A 3G6AA 4ZFZB 1P84K 3BGAA 1N59A 4UI2A 1BFTA 1JZ6A 1VADB 3VDCA 1I1YA 2X5PA 2OSLB 4LSVH 3U7WL 2B1HH 3CK0H 3M17B 3C6LD 1NGWA 4I2XB 4Y1AD 1MFCL 1QYGL 4KDTC 3V5HB 1AO7E 4RNRB 4AQOA 4LCCA 1DL7H 2IPKA 3CH1A 1Z9LA 4XMPH 2H3NB 4QRRB 3VXSA 5GS2H 4P5KA 3KVQA 3G5YA 4HWBH 1ZSDB 2FCBA 4HMCA 5EG6C 3QHFH 4U3XA 2C3GA 1UVQB 1Q9OB 4K9EL 3QULB 3U4EA 4FNLH 3G5XA 1UA6H 5DDHB 2IFFL 4NKOB 4NWUL 1TVDA 5C0EB 4HIXL 4F58L 2IF7A 4V1DE 4NZUH 1A47A 5E00B 3T0VA 1HHIA 2FYYB 2ZKHH 4LOUC 4MQXC 4NGHL 5JZ7C 3I02A 1X5AA 2P5ED 3BKCL 4LQ1A 4J7RA 4QRUB 5TDOB 5JTWA 3VXRA 1HHKB 4WV1C 3WFCH 3QUKA 3A6CH 4J6RL 4KRPC 4WW2F 1HNGA 3CVHA 1OAKH 4LAJH 3GZKA 4GRWF 1MFNA 4GS7C 1CFVL 4RMUA 2JIXD 3LMJH 2Y06L 5D1XC 4DJMA 1HIML 4FOMA 4KWUA 4PGEB 3KG5A 4M6NH 4RX4A 5EIVA 5IF0A 4WFFE 3CCHA 4EI5D 5I8CB 5J11B 3DO7A 5HY9B 1JHKL 5K93A 4XMKH 1HKFA 5HPOA 2R1XB 5FYKE 1BIHA 4J3TA 1CBVH 4M6ML 5CP3H 3EYUL 3MLTB 4ZD3H 4JPIB 4EN3C 3ARUA 3QXDB 2XKSA 2HG5A 4KKAC 2DQFA 3VXMD 1C1EH 1FSKB 4MJIA 5MERB 4I0PC 3ZKND 1AKJA 1GGBH 1ORSA 4DOHE 3FB6B 4U49A 4DAGH 2YR3A 3T1FA 5KSUB 5DMIH 5FYKL 3NN8B 3BT2L 3UAJC 3UC0L 3O81A 4Y5YB 3ARGD 3D1MC 3QZWA 1Y0LB 4OGAD 3PV6B 5GGQH 1XCTA 3PIQA 5T1DH 3O8XA 5D72H 3U4BL 3P11H 1NL0L 3QUYB 1S5HA 3QI9B 1ZS8A 1EA9C 1NFDB 4GRMB 3IS1X 4JO4L 3LDBB 1M7XA 4PY7B 4DGYH 4PP2B 1DN2A 4JJHA 5K9KB 2EH8L 3QNYA 2R69L 2AVGA 4D94A 1RSFA 3MJ8B 4QYOA 5BJTA 3MR9B 3SN6N 4C56B 1DP0A 4WEUD 3T0BA 2WSKA 2YN3A 4ZAKD 4G7YH 4K3HA 5LXGL 4KK9C 3VD9A 3GMPB 4AJ0A 4Z7WE 4K3GA 1QNZL 4X9BA 4BZ2H 3CFEA 1QRNE 4YDJB 3WD5H 2SEBB 4GFTB 3CXHJ 1S7XA 5E2UL 3W2DH 1C5BH 4Q58C 4XX1G 5F7NC 5EOTB 1IT9H 4LCIL 5C09D 1ZGLP 1QA9B 4GJTB 2BNRA 4PJEE 1A7QH 3PUCA 3CFBA 1EHLL 2VR5A 3E6HB 5FUCE 4K7FB 1KF9B 1Z6JT 5LQBH 5E9DE 3O6KL 2R2HB 3HS0B 5IBTH 4H1LB 3ROOB 2YD4A 2PYEE 3OR7A 1FZKB 1FBIL 3GSNB 3R1GL 4KJPC 3S35X 1K8IA 5J56B 2Q6WA 3NFSL 4WV1B 4P23C 4LPYA 3IJSB 4KRPB 3WLBA 5FHAH 4C59B 1YEIL 1OSZB 3O6FB 1U95A 1FE8H 4GS7B 4MNGB 2VZSA 2VERN 4OT1L 4LLQA 4E41E 5FIEA 1HH9A 5D1XB 3O0RH 4FFVD 1B6UA 3O4OC 3MFFB 1QG3A 3CNKA 3HI1A 2O5YH 5F89B 3ZDYF 5CZXC 3BP7A 3O45A 3BUTA 1EDQA 4TPRL 1UWGL 1W72B 3D6GA 4H0HB 4MD5A 3TH3T 3RWDA 4P57A 2OJZH 3RP1A 4RA0C 4EN3B 3OKOA 2OMNA 1LGVA 4IS6A 2NY5H 2J88L 3QH3A 4L8DA 1FAKT 4EOWH 4KRNA 1N7ML 1MQKL 3CLFL 4LASL 3RKDC 2CUHA 4JPWH 4I0PB 4F8TA 3KPMB 3WJLA 2H1PL 2GSGA 2WAHA 4WWKA 1E6OL 2WANA 5DTFB 5HHPA 1MCOH 5MI0C 4TUOA 5EBWB 4QOKD 1R0AL 1WC7A 2UVEA 4M7LT 1QVOB 4MXQD 2MQ0A 3V52L 1KCVL 3QUXD 2DOCA 4BZYA 2HJKA 4P59H 2J5LC 5B3JF 4ZTOL 1UENA 5E4IA 4O4YH 2VLKA 2QQNH 4MNHB 4EUPG 2JF1A 4C54A 3RA7L 5ACZA 4OZ4B 4Y16C 1UM6L 5ICYB 3L5XL 3T3PE 3WIHA 2YUZA 5K9OB 1AXTL 5GSVA 3EOBA 1KUMA 3VFGH 2DTSA 1ZHLB 5J0BA 2DM2A 4OZGB 3TN0B 4XPBH 4YE4H 4M7KH 5FO7B 1IC7H 5ESVB 2EE2A 3KLAB 3FQXA 1MCLA 2M2DA 4YIQB 5GGTH 2EDYA 2CDEB 5C0DB 4PJ5A 2IANB 4KK6D 5CILH 1PEWA 4RGMC 2Q8BH 4UV7L 4QHNB 4XCFL 5L88L 1ADQL 1X5FA 2DQIH 2GSIB 1DBKH 4MCZB 1SJHB 2GK2A 3RVUC 1Y6MR 3MXWL 3G6JB 4U7SA 2EXYD 5H94B 1TETL 1DANT 3FN3A 2HH0L 3VXOB 1I3VA 1M05A 4HK3J 1YQVH 4I18A 1UKTA 1L4IA 4P23B 2CRIA 1P7HL 3PP4H 3FCTA 3U36B 2PETA 1TJGL 3QG6B 4M7LL 2CLVB 2EYTB 3L5IA 3RWGB 1M71B 5BRZB 4HUVA 2XWBB 4JANA 4WFEE 2WQ8A 3ZYOA 5SWZA 1QUNA 3C5SA 3EBAA 2AXJA 5FB8B 3O4OB 5GHWH 2BVPB 3OKNA 2BXZA 3KYNA 4ZOCA 4KVCL 5DEGA 4OCLC 3WNLA 1XAUA 4ZYKA 1WT5A 3Q1SH 4F7EB 5DD3H 3SJVE 4Y19D 4UIKL 5C0BA 3QPXH 4FRWA 3HRZB 4X6DF 1QR1A 1DEEA 5DJAA 4PB9H 5F3HA 4KDVA 1KYOJ 2MWCA 4NRZA 3QDJB 3KXFB 4LHUB 2FRGP 4UT6H 4KAQH 5MI0B 1FZJB 2B4CL 3ECBA 4QHMB 2F19L 4QXTB 3FFCA 1CFTA 2PW2B 1Q0YH 3C6LC 5BV7H 3ME0A 3T0EA 3FO0L 3F65A 3OX8B 1E4XL 3K7UA 4Y88A 1BECA 3B9EA 1J0HA 1PG7X 1CF8L 2DTMH 1KXTB 2ADIB 2F58L 3SGKC 2DF3A 4NHUB 2NW2A 5TQ0H 5C0CE 3MRIB 5FM8A 4PTTA 3S6CA 1I7ZB 3I75A 3CLEL 1D5IH 4Y16B 3NFPB 3CXDH 2GIYA 4NIKB 1JI2A 4Z8FH 3CAFA 4X8JA 4LEOB 3W5NA 2DLGA 3TO2B 5IB2B 3EDJA 4NZTH 1BIIA 3P4OB 3TO4C 4JFFE 3NIFF 4P2RE 1LO0L 5DSCA 3S35L 2JCCE 3WXWH 4N9GA 2ADFH 4H88H 2E7MA 4R96B 3BE1L 3MFGB 5IM7B 4OV5B 5DQ9A 5F9JB 4QF1A 3BD3A 3RZCD 1F4YH 4J3OC 3IT8D 4Z7VB 3TIDA 4WTWA 4JFEB 5T1LA 1A0QH 3PP3H 3QJFA 2P8PB 3L3HA 2Q20A 3HC4L 3DYPA 3MV8A 4R26L 4XAKE 5DR5L 4OGYH 1MWAB 3DXAE 5GRJL 3BAEH 1MCPH 4LPWA 4YHPB 4HIIB 1CDGA 4UT7L 4JHAL 3MOAL 1ZLWH 2C3WA 1DLFH 1TCMA 4GXUN 4HUNB 1XZ0B 4FXKB 4KTEH 2QV2A 4LAQH 4CMHC 5EO0A 2AJXL 4PGCB 2GUOB 1A6AA 1BHGA 4HKBB 3SKOA 2R56H 1IAMA 1X5ZA 3QWRA 4J4PA 5D7LE 5CP7B 4ZXBD 4YXHH 1NMCC 2GFBA 5FCUL 1C7TA 5LVEA 3OGCA 3R06B 4GSDH 1FO0A 2A6DA 2BVQB 4AENA 5ESQA 1SJEA 1DE4A 3GKWH 1VFAA 1YEFH 3LPGA 3DMMC 1QSEE 4FQLH 5I6XC 2ED9A 3GGWB 4OGAC 1TITA 3OKLA 2ZUVA 1JWSA 4APQC 1MCQA 5L0QC 4C55A 1JN6B 1MCBA 2AJ3B 3S4SA 4HD9A 2QBWA 2NXYD 2W91A 1GZPA 4K3DL 4YHOH 1A6VL 1DUZA 7FABH 1OPGL 1QFUL 4OLUL 5F9OH 1T7XA 1MFEH 5T3ZD 4PJ7B 1TVHB 4NNPH 5GRYA 2A9NL 3LEVH 2B2XH 4NM4L 5D2LE 1R5IB 2BSRA 3KYAA 1TZIA 1Q94B 3K80A 1MAML 5CGTA 3F12A 3LKSB 5MEOB 2O5ZH 3Q2CA 4XWGH 3BP6B 1TNNA 3TA3A 1MHPL 5FO9A 3PGDA 1IC5H 1NAMA 1YEDB 2OK0L 3C6LB 4UTBL 2VLRA 4ODSH 4Y1AB 4X98A 3MRPA 1DLHB 1A9BB 2Y36L 4M5ZL 1KSRA 2JK5A 3EAKA 1FFOB 4AQ1B 3X13A 2ENYA 3V95A 4BZ1L 1T21A 2AEQH 1GXEA 5I16A 3RTQA 1LEKB 1QO3B 3J8F7 4XXDA 3MA9L 3KDMB 5IT2H 2Z93A 4WCYH 1ZT1B 5E7BA 4FQHA 4K3JH 2JKXA 3GM8A 5EO1B 5DJ8B 3RVXC 4DKEH 3TO4B 1FZOA 2VNCA 3INUH 5ACMA 5J1TC 4N90E 5DHVB 5FDWA 5I1DB 5FCSH 4TQEL 4HUUA 1J9CT 3B3IB 1SM3H 2CPCA 2APWA 1RURH 4U2YA 5IMLB 2YS4A 3V6OA 1Y6KR 2CK2A 5LBSH 3CMGA 4Z7WF 1U8PA 2JIXB 2NR6C 3OAYH 4LDLB 5DMYA 4JAMA 4FFVC 1P6AB 3SKNB 1QLRA 1AGCA 5AYUH 3MNVA 3JXAA 1T1ZB 5IK3B 2X4RB 4Z7OE 3WE6B 4HUXB 2CSPA 3L5WA 4PJEF 5AZ2H 1G6RA 5K9QG 1WICA 5H35B 3GJFB 4CMHB 3VA2C 1YUHA 2W0FA 3RHWK 4PUBL 5FA4A 3WIIH 3WDJA 3VFUB 2X9YA 1NMCB 2W9LA 4KQ4L 2XRAH 4PD4J 3LIZL 3C60D 3BD5A 4YHKL 1FIGH 4U6YA 2X2YA 1MWAH 5HHVH 4N1CA 4OBRA 1S7SA 4ZS6D 3H9SA 1IZKA 4CADA 2BHUA 4AT6A 1F3DJ 2J1KA 4LSTH 3ARGB 4U7MA 2GJ6A 2VJXA 5EZLB 1VFMA 2B1HL 2H32H 2Z91B 4RRPA 4KMTH 5I6XB 1VEOA 4J8RA 4MXQC 3V2AR 4APQB 4RISH 1DL7L 5I1KH 5L0QB 4GMSH 1NH6A 2J7LA 1ZA3B 4XMPL 4HWEH 1FPTH 4LL9A 4HWBL 1PG7L 4HIHA 4JRYA 1OARH 3EYQD 4M8QB 3QHFL 1RHHA 1TPXC 3B8YA 4LGSB 4IHOA 1HZHH 1VSCA 5TPWL 5FYJH 1UA6L 4OM1H 3AY4C 3RDTA 5T3XD 2FJHA 3UTTB 5E6IC 3A6BH 1ONQB 2ZKHL 3IRPX 2Z92A 3ZE0E 1FNFA 3PNWA 2X4TA 1KEMH 2IBZY 1ZT4A 4CNIB 4PRPD 2DQTH 2JJSC 3WFCL 5TDPB 4F2MB 4K71C 4H0IA 1OAKL 1FLTX 3N85L 2HTKD 5CLWA 3NA9L 1RJYA 4KK6C 1FG2B 4P2YA 1Z5LB 3FQTA 5FUZL 3QIUA 5C09B 2B1AH 1YDPA 3LMJL 5HHQB 1KTLA 1MVUA 2JELH 1NLDH 2R39A 1CLCA 4QO1A 5JMOC 4Q9BA 3E3QE 2E7CA 4M6NL 5IJVB 2VABA 1X7QA 3PABA 4HJJH 4NQDA 1A4JB 3KYMA 4HSQA 4WDIA 3HAEB 2EXYC 3RL2B 5F8RC 1QSVA 1FNEA 3AS2A 3KPRB 3WNMA 1I4FB 3T4AB 5B38A 1JMXA 3EUUA 3O2WH 2AK4D 4XNMB 4ZD3L 3SDDC 3Q5TA 3VGHA 2WNGA 2Y25A 1I1RA 1HDMA 3T3PF 1I8IB 5GS0D 3N50A 2P49B 1KJ2A 1P9MC 1ZVYA 3EYFB 3QSKB 2YXFA 5CGYD 5B4MD 5IMOB 1ZHKB 3HI5H 3MOBH 2EXWD 2VDRL 1YMHB 1QFHA 5DJ2B 3LHPH 3PG2A 3TBTA 3QG7H 5FYLD 1NCAL 2ZOKB 4DAGL 4O2FB 3VFRB 3DVIA 4PRIB 4WY7H 3B8SA 5C07A 4PJIE 4M61A 5DMIL 2EDLA 1T7YA 1CCZA 2CRYA 4AM0B 3VXNA 5GGSY 3G6DL 2G9HB 3VFTB 1QSFA 3FO2B 5E2VL 4P99A 5GGQL 3CSYA 4JRXB 2PR4H 4PJHB 3G5VA 3P11L 2DB8A 1I3UA 1NEZA 5F71A 1CVRA 5JO5A 1V3MA 2NLJB 1RZJH 1C5DB 5F1NA 2M8XA 2VDLH 1DFBH 3PJSA 5DYOA 4XVSH 3TYFB 1CGXA 3BKML 1A7RH 1AR1D 4G9FA 4JM2F 1T89A 2V5SA 4M4RA 4NZJA 2XPGB 3PDOA 4LGPB 4NKQB 5FM5M 1GGIH 4L9LA 4L3EE 4G7YL 4QOKB 1AGBB 5JOFB 2OM5A 1TQCC 4RMSA 4JJ5B 3RJQB 1WGOA 2GCYB 1C08A 4O5LL 1G9ML 3KPNA 2P5WE 2MKWA 5K59E 3NCBB 3NFNA 1OAZH 1IT9L 1I8KA 2CUIA 5T33H 1A7QL 3HB3C 1TPXB 1A6PA 2YC1B 2A1WH 4Z7NE 4NQCE 1YEHH 1PKQB 4F7PB 2JJVA 4YAQB 4PJ8A 3FN0H 4Q9QH 3O9WC 1I9JH 1MI5B 4UZGA 4RDQF 4OZHB 1H0DA 4OZFB 4XZUB 2DMCA 1MCNA 2BY0A 4K71B 5FHAL 5E70A 3VFVA 4P5TC 3CDFA 4G8FB 1IAIH 2DQGL 3G08B 4JZJA 3MCKA 2VOTA 4M1GH 1MELA 4NDMB 1UM5H 4NUJA 4WI9A 2HT3D 2NW3A 4DCQB 4PJBF 4QHLA 3OV6A 1FYTA 1NC2A 2G60H 3QWOB 2O5YL 3DSFH 1J05B 5A1AA 4B7IA 2ADGB 1T5WA 5MEQA 3QQ3B 2MKLC 5HJ3A 4HXAH 3BXNA 1E4JA 1QEWA 1AIFB 3SDDB 2OJZL 1UJ3A 3HZYB 1QPPA 4BUGA 3FJTA 5FECB 3IXTA 3NVQA 3UBXI 2XTJD 4YBQC 4EOWL 1ZGLA 4PJXE 2MMXA 4J3UA 4JPWL 1U9KA 1KN4L 1X5KA 1OSPL 3OKKB 4GW5B 2BZDA 1EAJA 1KFAH 2JCCF 4NRXB 3FT3A 5EO9A 3GI8H 3RPIA 4GG6E 2EIDA 1ACZA 1MCOL 1H3PH 3FQNA 2CO6B 2PF6A 4H5SB 4UTAL 3SE3C 1JYWA 3RJDA 1P7QD 4F3FA 1YMMD 2KBGA 2R23B 4I0CC 1D9KA 3O3AA 5IW1B 3U48A 3FRUB 3HMWL 4IRSD 1VKXA 3C5ZA 3PWPA 3P4MB 4IDLA 3TZVD 5KN5A 3OKYA 2V9QA 4ZOEA 4WW1A 4O4YL 4YHLL 4XPHH 1CR9H 3C09C 5LCVH 3OKMB 1F2XK 1MIMH 4ACPA 4PG9A 1KIUA 4I4WB 3TBSA 4FP8H 3ZHKA 4JFPA 2AS5M 1CZ8L 4OKVB 3D85D 4XPBL 4JY5L 3DX9A 3QA3B 5D7SL 2VZVA 1AQKH 1TQCB 2LQRA 2KZWA 1AXSB 4OD2A 3JV4B 1LO5A 2IH1B 2FEEI 3IDNA 2IAMD 5CILL 3Q0HA 2Q8BL 5T5NG 1CGVA 3VGAC 3OKEA 2OL3B 2VDMH 4NHCH 1YN7B 3ZKMD 2X4PB 1OP5K 1DBKL 3O2VL 1RUMH 3EYVA 2OQJA 1YZZA 3KPPB 4N0UA 4HJ0D 2NX5D 3MUY1 2EDKA 3HE6C 2YMXH 5CBAB 3BPOC 4RWHA 1JZ2A 5B8CA 3PP4L 3EDFA 4PY8I 1CXLA 4P5TB 3FL7A 3ET9F 1IAII 1CG9A 5C71A 2CLRB 3HZKB 3MC0A 5SWSB 3HI6H 3L3JA 2ICWA 2EYRA 2Q87A 4WWID 3I85A 5J57B 5GHWL 2UUDK 4HLJA 1R3IH 4ZOBA 3W0WD 5ISZB 4JREC 3BPNC 4J23A 2HJFA 5HYSG 1TNMA 3QUZA 1KOAA 2B39A 4MQ7B 3GMQB 3L3IA 5F7EL 3P4NA 4OGXH 4Z7UE 4G42A 4R3SB 3Q1SL 3U0PB 3DURA 3HTLX 3AREA 3QDME 2A74A 2NY5C 1QKZH 1MEXH 1ODAA 5E5MA 1Y6NR 1IGIL 4X4MA 1ED3B 3QIWC 5FFLA 3UTSE 5C70A 3BDXA 1BQHB 4U2ZA 4ZS6C 3F7RA 4UT6L 1EHXA 4KAQL 2H26A 2Q7NA 2BY2A 1NBYB 5HHOA 4U6HA 2AERT 1V7NH 3VI3F 4YHIA 3JWNC 3UPRB 4X80L 4ETQB 4PGBB 4WUUB 3L6FB 2DTML 3TNNB 4U31A 3PL6A 4Z7OF 1AFVH 4WUKL 5D2NE 2NXYB 5TQ0L 3WNNA 5F7WC 5D7IA 3FT4B 1D5IL 2ZPKH 3CXDL 3MLSL 4Q2ZB 4Y4FA 4YX2H 3HKFA 4F9PA 5FDYA 4WTXA 3GMLB 5ESAB 1J5OL 2V9RA 3GRWH 1EVUA 5BS0A 2DI8A 1PQZB 3L3KA 1F58H 3HNTH 3QIBC 1MCHA 4HULB 5FHBH 4FFZH 4BSWA 4EVNB 4PS4H 3QFJA 2Z8WC 3WXWL 4RBPH 5GISL 4H88L 1UB5B 1NGQH 4G3YH 4WW2A 1F4YL 3RNQB 2HTKC 3QXTA 1U91A 1A0QL 5EZOH 3BZ4A 1B0RA 3VGAB 4AEFA 4NO2A 3U6RB 4P46A 1K4CB 3LAFA 2X1WL 4OGYL 3OXRB 1ZANH 3CFCL 4XP1H 1MCPL 2GITB 3LKOB 4XVJH 4WEMB 2MCPH 2CIIB 1X5JA 3S88L 2HRLA 1DLFL 2PTVA 3HE6B 3IGAB 4KTEL 4LAQL 1QFWH 3SDAA 1H8SA 3TWCH 3BPOB 5EA0L 3EO0A 4GW4B 3GMRB 4BQBA 2R56L 4XHQA 3EHBD 1T83A 1Z9SA 5B4MC 1S9YA 3RX7A 4JFQB 3JV0A 1RJLA 4HIJA 4MNQB 2D0HA 1MCWM 2KPNA 5F88A 4GSDL 3QCVH 4XC1H 5ECJE 2PXYA 3AXLB 1XMWA 4DZ8A 2VLJD 3NCFB 1T0NA 3FO1B 3SO5A 2FGWH 1YEFL 4Y2DC 4YGAB 4JREB 5C9KA 1XF2A 3BPNB 5C6PB 2AJZB 2KQMA 1X5YA 1WK0A 5H37G 4E5XB 3IU3A 1GC1C 4NUGH 5IQ7H 2QQKL 3QUMA 1MQ8A 5FAAA 4YHOL 1I3RB 1BVLB 3U9UA 7FABL 5F9OL 5BZWB 3VMPA 3LRSA 4PLNC 3VGEA 3DOSA 4WFHD 3VXTA 2Q3ZA 3D18A 3QIWB 1TMCB 2EE6A 3IAQA 3LEVL 4CUCA 3HHRB 5HYQA 1JTPA 5EBMB 5CUSH 3QCUL 3TBVA 1ZVHA 3DPBA 1JGUH 1N4XL 3MJ7A 1HI6A 2IADB 5BMFL 3LN9A 1BBDH 3C87A 5EU3B 1LD9B 3ARVA 1LP9B 1KELL 1ZXQA 5IKCA 4UQ3A 3AROA 2DLFH 1A7NH 1Y18B 2XKNB 4PJIF 3D87B 3QEHB 4FQXC 4NC1E 1S7RA 3LEXA 2CRMA 1UKQA 2AEQL 2YRZA 4D9QD 4P2OA 4L1HA 4HUWB 5HGBB 4IRZH 1NFIB 1YNLH 5IFHH 3KAAA 5DO2D 5IT2L 5I1AB 4WCYL 4K3JL 3OZ9L 1OW0C 5DJZA 4DKEL 1XF3A 4ZUTB 3QIBB 1J1PH 1L7TL 3MPCA 3ZKSD 2X1QA 5LG1A 1TZHB 5IEHB 5C0RH 3DVFA 3JTTB 4K8RC 1QZ1A 3BSZH 4LVOC 1SBSH 4K2UH 1SM3L 2DQCH 1W0WA 2ZSVA 3OG4B 4XBGB 1NBVH 4MX7B 1MRFH 1I9RL 1XGRA 4EQ3A 4OQTH 4X5XB 2IMMA 5LBSL 3O8XD 5T3ZH 4W4OC 4J3WA 3UO1H 5CJQH 4G43B 4NRYA 3BH9B 3HUJB 2VWEE 1AGDA 4CL7A 1MFBH 5MENA 2HJLA 4JKLA 3JTSA 3VU2A 1G0YR 5FOJA 5AZ2L 2VKWA 3IDGA 4G8GA 2ORBH 4N1HB 1QFWI 3MRNA 1GGCH 4Z7NF 3VWKA 3JWDC 2GTWB 4X5WA 2BJMH 5TE6H 3X3GH 3WIIL 2AV7B 2XTJC 1NAMH 4PRHD 1A3RH 1U93B 2AEPL 2XRAL 5SV3A 1NAKL 1MJUL 5HXMA 1FIGL 4JFYB 5IIEB 1MWAL 1KB5H 2E27H 5EC1B 5HHVL 4OF0A 2XA3A 4CJ0A 1IC4L 5FYJE 3TCLA 1VGKA 4KK8D 3X12B 1S5IL 1BM3H 2F74B 4Y2DB 5DUPH 2HVKB 4KMTL 4PTUA 5DZOA 3K2MC 4ELME 4RISL 4IRSC 4OUUA 5I1KL 5D9SA 1FPTL 3DUHA 4MWFA 4R4BB 4WIQA 3O3UN 4Y8DC 3K74B 3OJ2C 1HHGA 1UXWB 1XR9A 1QBAA 1XR8A 4GKSB 1AXIB 1KJMB 1HZHL 2ICES 4KVNH 4H8WC 2QJDA 3X14A 5FYJL 1FNGA 4OM1L 1XH3A 3VXQA 1I8MB 1A4KB 1JNNH 5D5ME 3FO9A 2P46B 1CE6B 1S7VB 3SGEI 5C0IA 4MLSA 3RUGE 1JJUA 3QNXB 4HV8A 4X9GA 1B2WH 4JZNA 5ADOL 1J0YA 1PEZA 4GG6F 3VI4F 1JHTA 1NFKA 1SEBB 1MHCA 1GVIA 4FQXB 4M62H 1D3CA 4KGLA 3VXUA 1I1AD 2B1AL 1WWBX 5MEPB 2E7BA 1NLDL 5EN2B 4HKXA 1YNTB 2DQHH 4E0RA 1W0VA 1S9VA 1HINL 4PYHA 1VPOL 4HJJL 4NBXB 1YPZE 4JO3H 4EUPA 5E1AB 2R0LH 4HGKC 3U4AA 5EU6E 4KUCF 1P7KB 2IWGA 5IJKC 2YZ1A 1PX4A 2P5EE 4XTRD 1GYAA 4BELD 2MPAL 1K4DB 4AG4H 4LVOB 5I1CL 3JV6A 3GSRB 2HFEA 4HCRH 3D3VB 1FORH 5DD0H 3CSGA 3BUYA 2UY7A 3ULUH 3MOBL 5L8JB 1MNUL 3TP4A 3QG7L 4BQ9A 2ZCHH 1IVLA 1EGJA 4L9DA 3GBNH 1J12A 4WY7L 4MA3A 4QRPE 1UYWH 2I07B 1IC1A 5DK0B 4GG8A 1UQSB 3FFDA 2VLKD 3Q6FB 2BSTB 1JTTA 5HDBE 1XGTA 1CYGA 5E2WH 3HC3L 2IFGA 3OXSA 3DTXA 2VISB 2PR4L 4PJCB 2NTFB 2JJTA 4X7EC 4ZFOB 4S1QH 5A2KH 3SE9H 2XTJB 4R6UA 1S7WA 1YYLH 3VXME 4R97C 4LVEA 1U42A 3PWUB 5TF1H 1G7QB 3BN9C 3AM8C 4U6XA 4X6DA 4ZNCD 4MGXA 3ZSTA 4P3DA 1KXQE 4PJ5D 1BMGA 4Y5XA 2GY5A 2W9DH 5KSVA 1GGIL 1NGXB 3O3BB 4X4YB 3TH4T 4L4VD 3BH8A 3RWFA 4NQEE 1P7QB 1I85C 2Z31A 5TH2A 1VERA 4PJAB 1MUJB 1SMAA 4IRSB 4TSCH 3BYTA 1T5XB 2UZIH 2FEEL 2EIEA 7CGTA 3ULVC 4QY8B 3NCEB 2CKNA 1AJ7H 4JFOA 2XNAA 1I7TA 4RFEB 5FYLH 3ZMRA 3BKYL 4YK4C 4Z7UF 1NGYA 4LCYB 5DHYB 3DRTA 3I3EA 2A1WL 4JO1H 5IESH 3QDGA 2ZSWA 3B9KD 4ZPTA 3QO1A 2Y23A 4Q9QL 2WWKO 3BW9B 1I9JL 4X9FA 4K3EH 3D85B 1EH9A 1Z3GH 3WHXA 2VLLA 3WNOA 1P69B 2UWEB 3DVNA 2R4SH 4IRJA 5ALCH 1JGEB 1IAIL 4RAVA 4M1GL 1UM5L 3EYSH 2BX5A 4FTVD 1C12B 1G1CA 2Z8SA 1GAFH 4WU7B 3O6LH 1AO7A 1CDHA 3PHOB 1AHWC 2G60L 2Q3AA 5JPNA 1GCFA 5LGJB 3LN5B 4E42A 3RIAF 4HXAL 4AEIH 2NX5B 1NCBH 3QNZA 4OD3H 5KS9E 1DQDH 1L0QA 1XGPA 4WI7A 4X7DC 4V1DA 3EOYG 4AIZB 5IHZB 3OAUH 1E27A 5FGCE 4OZGF 3VG9C 4F80A 3AAZB 5GGVY 4XPAL 3FONA 1FAIL 1KFAL 1JWMA 4NBYB 4LCCC 3DETC 3DRQB 2H2PC 3BKJH 1WWAX 1MF2H 3GI8L 5DUMH 3ES6B 3GIVB 1H3PL 4LLUB 4OFPA 2JB6B 2GI7A 3PQYE 3W0WB 3FB7A 5DJDB 4U1KB 5DI8A 5J12C 3B5TA 3U0TB 5CD5D 1A6TB 3G6JF 4Y8AA 3HZVB 3O11A 3LKRA 4XPHL 3IKCA 3D0VB 1CR9L 4XC3H 2DS4A 3OKDB 4R97B 2D4FA 1FDLL 3SKMA 3UYRH 2H6PB 4FP8L 4XNXL 3IDJA 4IIQA 1YA5A 1D5MA 2FH6A 4ODXB 2XN9A 4OLYH 3EO1A 2YOCA 4LKCB 4N0FB 1URLA 4LHUG 5JIIA 1NGZB 5JW5B 5D8JH 2MTPA 2OTWB 2K7PA 4FA8A 1U3HA 4MB5A 1UXSB 4MMXC 5BVJB 2CDFA 3IXAB 2EKSA 1T2JA 2C9AA 4KI5C 1V5JA 3EOTH 4NHCL 4L4TD 4XPFL 4Z9KB 3WJJA 3P73B 3CSPA 2VZ1A 1GPOH 4YK4B 2Y7QB 3QWRD 1RUML 5KZCD 5E8NA 4B50A 3SKJL 4EZMA 2V2XA 1P4IH 3GSVB 2DWDA 4R7DA 3D2UD 2YK1H 5EWIH 5IHBA 2A6JA 2YMXL 2APXA 4CVXA 1U41A 3KJ4C 3V7AE 2MOVA 3BI9X 1SHMA 1CFNB 1CLOH 3FOLA 4MAUH 4JO2L 2WUCH 2QLVB 4N8CH 5CIPA 5EZJB 3REVA 4RZCB 1IARB 5IB4B 2E7LA 4JN2A 1JGLH 4HC1A 3LKQB 3O8XC 4F57H 5DVLA 5GPRA 4HHAA 4FMKA 4Z7WA 1EV2E 1OLLA 3BIAX 1AHWB 3LN4B 3TC9A 5A43C 4QHKI 3Q3GA 3RWHA 1E28B 3G6AB 4HFUH 3AGVA 4PJEA 1N59B 4OGXL 2PUQT 4U3CA 2WBKA 3PWVA 4O51A 1KV3A 1T20A 5E9DA 5D1ZA 1I1YB 4PPTA 3MCLH 4Z95L 2PYEA 1SVCP 1MEXL 1DBBL 4PY8J 3VG9B 1BJ1H 2G75A 2MHAA 4Z5RA 5T1KA 2NY2D 4LCCB 5M7QA 2IPKB 3CH1B 3VXSB 5A2JH 4P5KB 1Q0XL 3P9WB 2D7MA 1FZMA 3RTQD 1V7NL 2P42B 4WRLA 3U4EB 4E41A 5T1MA 1KJVA 3QRGH 3X3FH 2AI0H 5J12B 3W9EA 2RIKA 5JW3L 4FZEH 5EU7E 1AFVL 1HHIB 1HILA 4UILH 4DVBA 4NCC1 3I02B 4J3SA 4CU6A 1MCSA 4Y19E 1CE1L 3VXRB 5HI3D 1Z9MA 3QUKB 3GSQA 1U3YA 4HKJA 3RKPA 3CX2A 3CVHB 5GJTH 4P3CH 3GRWL 4JN1L 1F58L 5ALBH 3VJ6A 5FHBL 1A7BA 3RFZC 2WP3O 4MQTB 2V7NA 5IF0B 5CEZH 2GTZA 2X1OA 5DJ0A 3HCVA 1NGQL 3DO7B 1IGTA 1PYWA 4QHUA 3CC5A 4KJYA 5ANMA 4QNPF 2MQCA 3MYJA 2J8HA 5EZOL 3RGHA 1JZ4A 32C2A 4KJQD 4TTDD 4ELMF 1GIGH 4I3RH 4G6FD 3I6LE 3RBGA 5J9PB 1ZANL 2VR4A 2HG5B 1X44A 3N1MC 1JCKA 2DQFB 4IM8A 4P5MA 2LV4A 4MSWA 2ARJQ 3NCMA 1A14L 1WLHA 5EC2B 3G5ZA 4MJIB 1AKJB 1ORSB 3WJLC 3NOIA 4DW2H 3T1FB 1QFWL 1ETZA 3TWCL 3KJ4B 3H9SD 4WWKC 1EUUA 1ADQA 5D5MF 5IB3A 3HLAA 4OKDA 3DGGA 5DC4B 3RUGF 1LO3H 1D5ZA 1XCTB 3PIQB 5HPMA 2Z8RA 5CZKA 1CDUA 3DUUA 1CGTA 3O8XB 3Q6GH 4XC1L 2J6EL 4U4BA 5FKAA 5C8JA 2YPLE 3R8QA 1S5HB 4LCWD 3E2HC 4JRYD 3VRIB 3OJVC 5CMAA 5E8DL 2VYRE 3MRGA 1R3HA 3RDTD 3WS3A 3QNYB 1YC8A 1NCTA 4Z78A 1YPZF 1TTFA 1T66D 4QYOB 5BJTB 4QXGL 5CHNB 4JFHD 2WINA 3RIAK 4U1NA 4KZDH 4OLVL 1J86A 1N2RA 2A6KB 2EE3A 4Y4HA 4I3SL 3STLB 1T0MB 5DWUL 4EKXA 3NAAH 3M8OL 1N8ZA 3MRQB 3CFEB 1YECH 2Q76A 4NYLA 5MHSE 5CUSL 1S7XB 1UCTA 4JM2A 1F3RB 4JM4H 1BX2A 1T22A 1KIQA 2DL9A 1BBDL 2BNRB 4CU7A 3QEQE 1TVBA 2Y07H 3CFBB 2FX8H 5E2TH 4NQDD 4YO0A 2DLFL 1A7NL 3L5HA 3I9GH 4S1DC 2HLFC 5CZVL 3OR7B 3I6GA 2YD1A 1H3WM 1BQSA 5ID1A 1ITCA 3IFOB 1K85A 1FGNL 1K8IB 1QFWM 5EPMA 1ES0A 4I18C 1TTUA 1YNLL 2Q6WB 2YRPA 5MP6H 4MD4A 1IAOA 5T3ZE 4OV6F 1QP1A 3WLBB 1Q9WA 3WEXA 5F97E 2D03L 3BQUA 1U95B 3TYGH 3HNSL 3SJVA 2Z4QA 4H25B 4JY6A 3QXUA 5C0RL 5L2KD 2ZOLB 5C07D 1HH9B 2R0KL 2EYSA 1U36A 4DK3A 3HI1B 1NBVL 2AJUH 1MRFL 1J11A 3BP7B 4OQTL 2VDOH 3O45B 2XQYK 1GZQA 5C92A 4MD5B 5T3ZL 2VLRE 3RWDB 4P57B 5F7YC 5HD8D 3UO1L 1WT5C 5CJQL 2FX9H 3OKOB 4IS6B 3WFHA 1VFBA 3QH3B 4P2QE 5F9AC 4L8DB 2DIJA 1MFBL 4FQ1H 5B39B 1OF2A 1XF4A 3HAEG 3TT3H 5C0CA 4LARL 5DVNA 2HT2D 4G9FD 2GSGB 5GZNC 2H9GA 3F62A 4V2BA 2VQTA 5HHPB 5TE6L 3S3PA 4TUOB 4ZNEE 2YUXA 1RIVH 4JFFA 4K94C 1A3RL 1B0GA 1T1YA 5C7XH 4P2RA 3T0EC 4GBXD 4ZQKA 3WHE0 2E27L 2HJKB 2JCCA 1P4LA 4KZEH 2D31B 5BZDA 3U0WH 1SY6H 3E2HB 3SDYL 2VLKB 3S36H 1IILE 4M7ZB 1BM3L 3U2SA 5ACZB 2Q8AH 1FL6A 4LHQB 4ZO9A 2PYFA 1FHGA 1MCIA 2CKBA 1CGUA 2VITB 1RIHH 2AK1H 1NMBL 5GSVB 3DXAA 3EOBB 2J12B 2L0DA 1F4AA 3O2DH 5C0JA 3FB5A 3HPJB 2D7OA 3MRJA 3KPTA 4GKOA 4X6EA 4FN0A 5KS9F 3NTCH 4KGJA 3OAYK 3FQXB 4KVNL 2F53E 3MV7E 3EFFA 3EYOA 1JNNL 4HS6A 3HN3A 4PJ5B 3PDDA 5D7LA 5DRXA 3T77A 5DT1H 1UZ6E 1MHEA 1B2WL 3NIDE 5BVPH 1FYTD 5FO8A 3MNZA 1S3KH 2E9IA 4G6MH 1JNLH 1PAMA 3P9MA 3M1BA 4GLRH 4M62L 4POYA 3NCYP 2GQHA 5DD5H 3ULUE 1BZQK 1HXYA 1QSEA 2DBLH 5K33A 4I18B 4NJ9H 2DQHL 3BVNA 4DUWA 3KPSE 4J4PC 3FCTB 3IB4A 2R0LL 4LSUL 1G7JA 43CAA 4HUVB 1WTLA 4JANB 4K7PY 4C83A 25C8L 2NY0C 5SWZB 1H9VA 3C5SB 1P4BL 4AG4L 4PRPE 4U0QB 3CVIL 5FGSA 2RHEA 4KPHH 3OKNB 1MHHA 3MRBA 1J8HE 1N5AA 2FEDD 5DEGB 2C4FU 1KTRL 1CFBA 5J6HA 1KC5L 3DGCR 1GGTA 4XWOD 3GBNL 3NACH 3PWPD 1YY9D 2M1KA 5DEFB 3AU1A 4XXCA 4ZYKB 1LK3L 3RL1A 2BNUA 5EBLA 3NABH 4R2GD 4YDIH 5E2WL 5C0BB 1IFHH 1CD8A 1INEH 2VC2L 3C9NB 1WUNT 1QR1B 3IS0X 1BAFH 2C3XA 1DEEB 3MV9D 3MUGA 5I8EA 4JR9H 1M4KA 2AK4E 5F3HB 1FFPA 3VXPA 4NRZB 4EDXA 3B43A 3ECBB 3VH8A 3SE9L 3FFCB 3TA3C 3ETBF 1CFTB 8CGTA 1IM9A 3JSSA 5C86A 5BOZG 3T0EB 4IOIA 4NKMB 3QBTB 5JHDD 2NY2C 3D39E 3LKPA 4NN7C 5FYLE 1W0YT 5E4EC 3IDMB 4EBQH 1B88A 2W9DL 2NW2B 1S7UA 1UADC 3RTQC 4PTTB 3I75B 1ZLVH 4RA3A 1HSBA 3DROB 3DYOA 3W39A 4TSCL 5GS0L 4ZFGL 3C08L 4X8JB 4PV9A 4A2LA 2UZIL 1BIIB 3QQ4A 1AGEB 4IMKA 5KVGH 2P45B 1AJ7L 5DSCB 5D70H 4LLVA 3QRFM 1NCCL 5FYLL 1BD2A 4N9GB 2DYPA 1PZ5A 4JO1L 1V7MH 5DQ9B 4QF1B 3CFIC 5IESL 3TIDB 1EGJH 3V6OC 1K8DA 3G04A 2FLRT 5T1LB 1QOKA 2NY3C 5IBLD 3QJFB 1TLKA 3IFLH 3L3HB 2FBJH 1BJ8A 4HWBA 5A3IC 1KLGA 1FRGL 3MV8B 1Z3GL 5JMRA 5F1IB 3TJEH 4LGRB 4HGMA 1D6VH 4XMLL 2X70A 2R4SL 3BJLA 5ALCL 5D1QD 3MYZA 1UM4H 3KNBA 3EYSL 1MPAH 2B0SH 5DURB 5EO0B 4L4TB 3W9DA 4JDTL 3K4AA 3ARED 1A6AB 1C7SA 4BQCA 5I17A 4NQXA 3SKOB 1AD9A 3D25A 5KZCB 1L9MA 3VD4A 5IVXE 3MO1A 2BC4A 2GFBB 4JZOA 5INDA 4MAYA 4AEIL 3GJFK 3ZO0A 1M7IA 3GO1H 2NY0B 3O4LD 1FO0B 1U8HA 2IALA 4LNVA 2A6DB 4O2EA 4YXLH 4AENB 3VMNA 3KS0H 1WZ1L 2ESVD 4XB8A 5ESQB 1SJEB 1DE4B 4FQ2H 1XF5A 3OAUL 3D9AH 3OTTA 5HHOD 1VFAB 3LEYL 1A1NB 1JWSB 1FN4A 2R15A 2OZ4L 5GZOD 3FQRA 5CP3A 1XIWD 4Y2OA 3V4UH 3NA4A 5DUML 3QYCA 3EDEA 3S4SB 2WWMD 1GZPB 4HLZG 1DUZB 3JWOC 1HKLH 1F42A 4YQXL 1QYGH 4JVPA 4Y4FD 3RDTC 1IGYA 2BSRB 4BFGA 1TZIB 5BS0D 3F12B 1LDSA 1HQRA 3CGTA 3TA3B 2W0KA 4G7VL 3QFJD 3PGDB 1RUPH 2VR9A 3EJZD 3C8HA 3MRFA 4EIGB 1BF2A 1J1XH 3UYRL 4X98B 3MRPB 1U8OA 1MFDL 2NY2B 4NN7B 4TNVF 5E4EB 2JK5B 2IFFH 4NWUH 3SGJA 3X13B 1T21B 4A2MA 1CGSL 4NGHH 1GL4B 3QIUC 4OLYL 4I13B 3BKCH 1BQHG 4XT1C 5I16B 4P46D 3RTQB 4XXDB 1NDGB 2YD5A 1YMME 2FECI 3BRFA 4J6RH 2Z93B 3JWDL 3P30H 1JRHI 2BY3A 4FQHB 4PJIA 3SQBA 4ZFOL 3VFWA 5I1IH 1PLGL 2P24A 3MGOA 1J0ZA 3UJTH 3THML 1FZOB 1CFVH 2A77H 2WBJD 4MVBD 4A6YH 2Y06H 5FDWB 5DJYB 1G7IA 1GPOL 1CGWA 5DC0A 1NC4D 1MCJA 1EHNA 5K9JL 3CMOH 4ZUSA 2X4QB 2YK1L 5EWIL 3IDXH 2F5BH 3EGSA 1RZGA 4H26B 2NY3B 5BW7A 3MRDA 1U8PB 4XBPB 4MHHG 2WIMA 1FCGA 4JAMB 1CLOL 4YZFE 2WV3A 1O7SA 2VXUL 4MAUL 1QLRB 1AGCB 4OLWH 4LPXA 3MNVB 3AC0A 4N8CL 4HAFA 2EICA 4POZD 3SKUD 5GS1A 1R3JA 4S2SB 3L5WB 4L3EA 2R2BA 1OB1A 1LO2H 1OTUD 1G6RB 2HFGH 4F57L 3BFOA 2IJ0C 4QTHB 4PP1D 4GXVL 3V6ZA 1YUHB 2W0FB 1A1MA 3TVMA 2H2SC 4ENED 4OZIB 1P84J 2P5WA 4RNRA 1UEYA 5FA4B 1TQBB 1CT8A 4L3CA 2FD6L 2A9MH 5I19L 1CFQA 5C6WH 3DX8A 4DGVH 1ZSDA 2LVEA 4XNUL 1DQQA 2P8LA 2R1WA 4F7MA 2PNDA 3KLDA 4U6YB 4OM0L 1UB6A 2DMBA 4S1RL 1T89C 4KC3B 1S7SB 5E8EA 4QRRD 3H9SB 3U4BH 4CADB 4AT6B 4NQCA 5EOCH 4L9LC 4N0UE 4JHBA 2GJ6B 4NOFA 4CW1A 4J8RB 4N8PA 1N3NA 3IETA 1CICA 3T0WA 2R69H 3S36X 1H8OA 4HIHB 4LCWB 4JRYB 4ZO7A 2EDFA 1RHHB 1N5YL 3W0WE 4IHOB 1AQDA 4X4XB 4QHKJ 3X3FL 2AI0L 3RDTB 1XEDA 2RFXA 3ZTNL 2FJHB 5CEZE 1RIUH 4PJ8C 4HAGA 5E2UH 2WMPA 5HVFB 2Z92B 4LCIH 4WJ5A 1A7OL 3PNWB 4X6CE 4RGOH 1ZT4B 1B90A 3ARSA 4TULL 4GMTH 1DJSA 3O6KH 4ZPVA 4P3CL 3HG1E 3SBWA 3IYLW 35C8H 1RJYB 4JZJC 3FQTB 5ALBL 3A67H 3L3OB 3QIUB 1YDPB 3ROLA 1KTLB 1MVUB 5JDSA 3MJ9H 3PABB 3FB6A 4NQDB 4WDIB 1BGXH 1CXKA 3KYMB 1LNUA 1YEIH 4GG6A 2ZUXA 5MEND 5E7FA 2OR9H 2R2CA 5EUOE 5B38B 4UB0H 4OLXH 1AY1H 5GIRA 1JF1A 1T3FA 4G8GD 4OT1H 4P4KA 1IKFL 1UJ3C 1GIGL 4I3RL 1HDMB 2J8UB 1KJ2B 1U8LA 1I9EA 2I27N 3S34H 2X9WA 5GGTA 1E6JL 4R4ND 2CQVA 4KHTH 2I9TA 3TBTB 4TPRH 4GRMA 3TESA 1UWGH 4DW2L 1X4YA 3TNMA 4OIBA 5C07B 2F8XC 1F00I 3QUYD 4M61B 4PP2A 2K7QA 2O61A 2DM4A 2NY1D 3QI9D 2FO1A 2J88H 3VXNB 1T1WA 2EDRA 4WO4A 1N7MH 4LASH 3GM0A 1NGPH 1LO3L 4M1CC 2XY1A 1QSFB 3H9ZA 1D9KC 3NIDF 1ZTXL 4CVZB 4XWOC 2FJFA 3CSYB 3C5ZC 4L4JA 3F7PC 3G5VB 1YY9C 3GBLA 5DQJA 3RRQA 4C56D 1E6OH 2HLAA 5JO5B 2R2EA 5F1NB 4M9OA 2EH7L 3ULUF 3M07A 2GK0A 3PJSB 5DYOB 2XWJB 4MDJA 4RBPK 3G9VA 5DVMA 3CU1A 4G9FB 4ZTOH 2R9HC 3PDOB 4OLEA 1ZLSL 4KZDL 5FK9A 1TXKA 3VA6A 1FZKA 3KJ6L 2BDNH 3NAAL 2ATPA 1JP5A 3L5XH 1C08B 3KPNB 3NFNB 1UGNA 3MBXL 4JM4L 5DD1L 4LOUD 3VXUD 4MQXD 4YPGA 3O6FA 2VLJE 1I8KB 4Q9CA 5FF6A 3SCMA 2FX8L 4HFWA 1BJMA 1WWCA 3I9GL 4BKLA 1KG0A 2NZ9C 5L8KB 4FMFA 4YHYB 4PJ8B 4TOYH 1WJ3A 1YEJH 5ILTL 2FATL 5J6GA 3EDKA 5HHXL 4UV7H 5F70A 4XCFH 1FQ9C 2AXFA 3NCYS 1H0DB 5B8CC 4WFHE 4Z7UA 1TETH 3CZFA 3VFVB 4KRMB 3QDMA 2HH0H 2GAZA 1W2KT 3TYGL 2EC8A 4JZJB 3MCKB 1OT2A 5IBLC 3V7MA 1T6VN 5C0AE 4NUJB 2NW3B 4GAJH 4ODVL 2NYYD 4EN3D 1FYTB 1NC2B 3UTSA 1WCQA 2RJMA 4MA8H 2NCMA 2AJUL 4PJFB 2V6HA 3NIGE 1T5WB 5MEQB 2VDOL 1GOHA 1EEYB 5HJ3B 5AUMA 2WW8A 3QUZC 4I0PD 3BXNB 3GBML 1QEWB 4YHMH 4D9QE 1PVHA 3IVKA 5I1JL 1UJ3B 2FX9L 1R5WA 3AREC 1U3ZA 2X4NA 3UAJD 3IXTB 2X89A 4NNXA 1ZGLB 5J8OA 3T0XA 3ZYJA 5D2NA 4KU1A 3TT3L 2B5IC 1LEGA 2C1OA 2V2TA 4CU8A 3VDBA 3FT3B 3MA7B 5EO9B 4NBZB 1RZKC 4JEGB 3E6FA 4WI4A 3FQNB 5FEBA 1JZ8A 3GMMA 1RIVL 4UIKH 4OZGA 3HR6A 3TN0A 2Z31D 1D9KB 3O3AB 4UQ2A 5HGGS 5LGKA 1VKXB 4KUZH 2HFTA 3PWPB 2ZCKL 4XPTL 3PL6C 5KN5B 2X6MA 4KZEL 1SY6L 2B4CH 4WW1B 3S36L 5C0DA 2Q8AL 4F7TA 4PJDE 3TIEA 4XP6L 4I1NB 5D6CA 4PG9B 4Z7QE 3RAJL 4Y4FC 3TBSB 5E6YA 4DN4L 4F9PC 5F1KC 1IQDA 4XX1E 1RIHL 5CWSB 5IVXF 2F58H 2IAND 3PGCA 4JFPB 4U0RC 5IMKA 3ILPA 3O2DL 4KTYA 1UCBH 3DX9B 3CLEH 4AL8H 3EJZC 3NTCL 4G8IA 4OGZA 4PRHE 5C0FA 4AIXA 1YY8B 3HPLB 3ARDA 5JHDB 4OD2B 1A9EA 1LO5B 4WW2C 2OLDA 4IRJD 4RMTA 4BQ6A 1HK6A 3IDNB 1DCLA 4NKIL 1FNSL 3ILQC 2DQDL 2ZUWA 4ZSOE 3OKEB 3QG6A 5DT1L 4P46C 1OAQL 1E4KA 4P23D 1AO7D 2PW1A 2V5YA 4GXUM 4G6ML 3EYVB 1JNLL 4ZG1A 5I15H 5E56A 1KIRA 4FQQA 1BZ9A 1OAUL 2OQJB 2VB5A 9CGTA 3IFNH 1OGAE 5DC9B 5DD5L 2BVPA 1F97A 4MVBC 2R8SL 2DBLL 6FABH 4AY0A 3SDAC 5DR5H 3DVGA 5TDNA 5B8CB 5GRJH 3ARFA 1T83C 4V1DD 5SX4H 4UT7H 5GGVH 4JHAH 4AIOA 1WBZA 1CG9B 1KNOA 1LK2A 4XNYH 1WFOA 3VGBA 2VN7A 2PXYC 2EDNA 4D2NA 3L3JB 1J1OH 5F3BA 2ICWB 2EYRB 4KPHL 1TCRA 2ITDA 2IQ9L 4MMZC 4OCXL 3RKDD 4W6YB 2I26N 5KVFH 4POZC 2HJFB 1FZJA 2Q1EA 1BOGA 3QUZB 5FCUH 4HEPG 4JGMA 2EECA 3C6SA 5JOEA 3L3IB 3P4NB 4G42B 4PP1C 3KXFD 3DURB 3AREB 5CS7A 5SWQB 2XYCA 1MY5A 2A74B 3NABL 5FYKD 4L5FL 2XWTA 4FXLA 1LVEA 5E5MB 4X4ZA 1CK0L 1RK0B 3TCXA 2B5IB 2FL5B 3O4LB 3O3DA 3D69B 3RX8A 2H26B 2OMBA 2XA8L 4N0CC 5I2IA 1OPGH 4OLUH 4PRDB 1B4RA 5HHOB 4U6HB 3ESUF 1U3HD 4YHIB 4NT6A 4UBDC 5JXEA 1U8QA 2ZUYA 4YZFF 4W68A 3P3YA 4EBQL 3MJGX 4YUEH 1B0WA 2F54E 4P2OC 1FC2D 2PN5A 5D7IB 2APVA 4OSUH 1RI8A 2FECL 4UTBH 3GNMH 2RBLA 2EZ0C 3DUSA 4EIZC 4Y4FB 2Y36H 1JRHL 3L3DA 1MWAA 3LY6A 5BS0B 4U0RB 2P7TA 2DQEH 1A2YA 3L3KB 5KVGL 3IF1A 1MH5A 5I73C 5KSBE 5D70L 4BSWB 2EDEA 4HZLA 4JCMA 3QFJB 1I3GH 1MJ7H 2BVOB 4L8SA 4WW2B 1U91B 3NZHL 4NN6C 4GRWB 3BZ4B 1B0RB 4NO2B 4ORZC 4P46B 4L4VE 4CRPA 1QRND 3TJEL 5CSBA 5ACLA 5E08H 4OB5H 2ZCLH 4XCYA 4AYFA 3UJJL 3VCLA 1HN1A 5ITFA 1QTYT 1MPAL 2WBJB 1XT5A 3SDAB 3VWKC 4EXPX 3RGVA 15C8H 4ELMA 3RBSA 5E9DD 1HH6A 1A8JH 1NC4B 4O00A 5HHMB 1V3KA 1QHOA 5SX4I 1S9YB 4X6CF 1RJLB 3N1FC 5T1KD 1MCEA 2GW5A 3GO1L 5F88B 4AEHL 1OY3B 2PXYB 2YEZA 4DZ8B 3KYOA 2NY1C 4FQ2L 5D5MA 5CJ5A 1T0NB 4BQ8A 1XF2B 1Q8MA 3RUGA 3LKSA 1KGCE 5DMJB 3LIZH 1X4ZA 4OFYD 3WN5A 1BLNA 3DBXA 4YHKH 3MGAA 3V4UL 3IU3B 4FTVE 2YWZA 2GT9A 3QXVA 3QUMB 4Y4KA 5EUOF 3U9UB 3LRSB 3UBXA 1HKLL 1OM3H 4K23L 4S0TD 1MJ8H 3VXTB 2VKXA 3GHBH 1YJDC 2BNQE 1WAAE 4YXKH 3WL9B 4ETYA 5HYQB 3QO0A 3ARXA 3SDCA 1YPZA 3FRPA 3TBVB 1A22B 1PG7H 3MJ7B 1HI6B 5EU6A 4NO5A 2GJZA 5IV2A 1RUPL 3EFDH 4ZTPH 5IKCB 4UQ3B 2ARJA 1J1XL 2P5EA 4R90H 5TPWH 1FFQA 1U8IB 2ITCA 4X0KA 3B3IA 3LEXB 3TO4D 3HFMH 2DI9A 3QPQD 4HIEA 5IMLA 4ZMAT 3E0GA 4P9HH 1J0JA 2QR0A 1F6AA 4D0DA 1TJHH 3GMOA 1H15A 5E1HB 1U58B 3P30L 4CMMA 4RAUA 1KLFA 4P0DA 4QRPA 4U33A 5I1IL 3F5WA 3N85H 1CN4A 4NO3A 2VDPL 5DJZB 1A3QA 3UJTL 1FJ1A 3NA9H 2RCSH 1XF3B 4K94L 4ODTH 4EI5A 2QL1A 2A77L 4A6YL 5JUEH 5FUZH 4HUKB 5I73B 4ERSH 3SPVA 2NY6D 3T0DA 1PJ9A 1W0WB 5JXAL 2OJEA 2BOBB 5E99H 1AD0A 3BZEA 1XGRB 3CMOL 3HR5A 3IDXL 2F5BL 3VFUA 1MCDA 4JY4A 4NN6B 2HT4C 4OCNC 4OF8A 4G80A 3VXMA 2X10A 4XI5D 1Q72H 2NYYC 5GGUA 5L2JA 5DJXA 4NRYB 4YWGH 1HWHB 3CX5K 4OLWL 2BHZA 3LV3A 1AGDB 1CXHA 3QHTC 5MENB 2XN9E 2HJLB 3H7LA 5HYJE 4GO6B 2VDRH 4XP5H 4FABH 4PV8A 3IU4H 1LO2L 2HFGL 3ARGA 1NCAH 3GSUA 3IDGB 4G8GB 4NQEA 3VFMA 3MRNB 1OTTD 2JJTC 4U1SA 1G1YA 4X5WB 4L8BA 2A9ML 4TSBH 3G6DH 3DMMD 4Y4HD 4DGVL 5E2VH 3V0VA 4APQD 4U05A 4HDIA 4UNTA 2OYPA 3CZJA 1LO4H 2APTA 4JM2D 4Y5XC 5EOCL 1G9NC 3TCLB 4JVUA 3KLSA 2NY1B 2Z35A 1VGKB 1QACA 4LMQI 1F8TL 4PTUB 4WFED 3ARWA 2Z31C 3BKMH 4ZAKA 5JPMA 1FNAA 2GYSA 4OUUB 4HKZB 4UIMA 5FOBA 1F6LL 3SDXE 3ZKQD 5D9SB 3UTTD 4YFLI 3NIGF 1KACB 1MAKA 4MWFB 5H37H 1CFSA 1X5IA 4O2CA 4WEBH 1HHGB 1XR9B 1HHHA 1XR8B 1Z5LA 3VW3H 5DQDH 1FNGB 1XH3B 4O5LH 1G9MH 3BQUD 4TRPL 1RIUL 2DQJL 3FO9B 5C0IB 1JHLL 1U92A 3SJVD 3P0VL 1X4XA 4KMLB 3UCRA 3KS0J 3RL2A 1JVKA 1CD1A 4HBCH 4HV8B 4Z76A 4RGOL 1JWUA 2VZOA 4ODWB 2EDWA 3ZHDA 4JZNB 1BEYH 3K3QA 5HVHC 1OAXL 4GMTL 5HGHA 5KS9A 1JHTB 4K9EC 2MQ3A 1MHCB 3KPRD 1YQ2A 3NGBC 3MLUH 4IRJC 35C8L 3RVXD 2FR4A 3OF6D 1K3IA 4D8PA 3VXUB 4NQSA 3A67L 3FT2A 4N8VA 4HKXB 4E0RB 1S9VB 3F8UB 1FCCA 3MJ9L 4RQQA 1BGXL 5JOPE 5JNYA 2OR9L 2KDGA 4UB0L 2DQGH 4OLXL 5C08D 5C0CD 1AY1L 3PQYA 4PJDF 2LU4A 4ONFL 3NZ8A 2NR6D 4Z7QF 4PRID 4TUJA 4CDGC 3FO2A 4TUKH 3OWEA 1DQJA 2OTUA 3JV6B 4TVPD 2HFEB 5F6HI 3FMGH 3S34L 1A21A 4KHTL 4AMKH 3BDYL 1F02I 1KCRL 5CJ8A 4HQQH 4JRXD 3H6JA 3WNPA 4MA3B 4XCCH 3KLHC 1JF6A 3LPWA 4GG8B 1Q1JH 4IMLA 3FFDB 1T0PB 4P4RA 4MJ5B 2YKLH 1NGPL 4R9HA 3FQWA 5IFAH 3DHJA 1KN4H 1OSPH 3BMWA 3WBDA 3OXSB 3DTXB 4OTXL 3U30C 4QOKA 3WYRA 2R1YB 3DXAD 2VXQH 5DVOA 4LLAA 3QUXA 3DHMA 4MXVE 4X5LA 5ANME 2A6IA 1JUFA 1J0IA 5I30L 4UTAH 1S7WB 4JDZA 1Z0MA 4WENB 4Y0GA 1RHFA 4U6XB 4X6DB 1WWWX 5B39G 4FZ8H 5INCA 3HMWH 4IIQC 3BESR 4D0CA 4P3DB 4Y5XB 5DZLA 5D7LD 5KSVB 3TGXA 2N4IA 5F8QC 4YHLH 3BH8B 3RWFB 2BDNL 3T8XA 2Z31B 1U3HC 3QEGL 5TH2B 5CEXB 2W1NA 4AEEA 2EC9T 4JFDE 4MYWB 2VRAA 1OQXA 1M6OA 1WVZA 5E6ID 1CZ8H 1JPTH 3I3DA 5E6ZA 1MI5D 1EIBA 1WBXA 2XNAB 4JFOB 4JY5H 3VGGA 1I7TB 3WJJC 5D7SH 2DL2A 4NDMA 4YHNA 3DRTB 5DUBA 3CU7A 4RGNE 3K1DA 1U2HA 2F8OA 3QDGB 1WZLA 3MXVH 4ZPTB 4TOYL 3RQ3A 3QO1B 1YEJL 5CBEA 4JFHE 1KTKE 5IB5A 3F7VA 4JKKA 4ELKA 3WHXB 4IDJH 2VLLB 1JPGA 3O2VH 1KULA 3DIFB 2HP4A 3DVNB 2W60A 3RHWF 1IZJA 2ZG3A 2ICCA 3NGBB 4IRJB 2AKRA 3JWOL 4RAVB 2E7LC 3GB7A 2AV1B 3GUTA 3SDDD 4GAJL 4NJAL 1TIUA 3OKKA 4U7KA 1AO7B 4MA8L 1FVEA 1HE7A 4QCIA 1A6ZA 1QBLH 4E42B 1JNHA 1N6UA 4PLJC 4KFZC 4HT1L 3GRWA 4YHML 3QNZB 5F96H 5FUCC 1XGPB 4H1LH 5D1ZC 4X7FC 4V1DB 3MV11 1JV5B 1DQML 3GSNH 1E27B 5IMMA 5KSBF 4LSDA 4XPGH 4JG1L 3FONB 4Y19A 4N90D 1JWMB 5F7EH 1BZ7A 4WU5B 3RWCA 2OI9C 5L2KE 2BXYA 3H0TA 1V3LA 2BK8A 5FKPA 1IGIH 5AZEH 3FB7B 3OJMB 5D7KE 3MCG1 4NC2B 5DI8B 5ICXA 5TJWK 3U30B 1BWMA 3LQZB 4KUZL 1CLYL 3MRRA 4HJGA 2BERA 4YGVA 3VWJA 4MDIA 1AXSA 2Q7YA 1FVDA 4CJ1A 3LKRB 3O11B 4LLMA 4CAGA 5JQ6H 2AW2A 2DJSA 1W72H 5J13C 3LQAC 2IH3A 3SKMB 2DYPD 4PJBE 3IDJB 4IIQB 4X80H 5DS8A 2XXCB 2J5LB 2APFA 1D5MB 1D7FA 1FFNA 2J6EA 4OFDA 4WUKH 3MLWH 3T08A 5GS2D 1MIEH 3EO1B 4YDLC 1UCBL 3HB3D 1T4KA 4DOHB 4AL8L 4HS3A 3DNKA 3MLSH 2G2RA 2LU3A 1U3HB 1IBGH 3S97C 1BVKA 4WFGD 2WP3T 2A83A 1QQDA 2CDFB 1J5OH 1HXMA 2EKSB 3O9WD 1ZHBA 3QPQC 4YDVA 1IKNA 3RZCA 3SY0A 4QRTA 4JGUA 4JCLA 5C0GA 4CDHA 4RFNC 3P2TA 5GISH 2UV3A 4M43L 4KHXL 4HPOH 3BYYA 1TTGA 1GSMA 5E8NB 5I15L 5GRUH 2YPLA 4P5TD 2V2XB 2DWDB 3IFNL 2YHGA 2YD9A 4R7DB 3TPUA 3VG0L 2A6JB 4RGMB 6FABL 1ZMYA 4CVXB 1WAAF 4HW6A 5SWSD 3DO3A 2NY6C 3FOLB 5H2BB 5LJYH 3BEWA 3CFCH 3WXVL 4PJGE 4QXUH 5ISZD 1CDJA 5CIPB 5GGVL 3REVB 5JR1L 1ZK9A 1NMAL 3S88H 1K2DA 1AGFA 5HDLA 4XNYL 4JN2B 2MCG1 4OI7A 4NSKA 1KPRA 4ZXBA 4HHAB 5C0ND 4XI5C 4Z7WB 1S7QA 4DUVA 3BP5A 5EA0H 3L7EA 3NCCB 1J1OL 3UYPA 1EO7A 1QRNB 2CDGA 1XFPA 4LLWA 4YBQD 5KVFL 5IROA 3LH2L 1E4WL 3RWHB 3QEQA 4PJEB 2HN7A 1QSZA 1WCBA 2WLYA 3PWVB 3F6LA 4O51B 1OTTC 1T20B 5E9DB 3E1F1 5D1ZB 2J4WH 2UVFA 5IWLA 2PYEB 1II4E 4Y4HC 5DD6A 1BREA 1AI1H 4OQTA 3K1KC 5T1KB 1RPQA 5KTEL 2D4DA 4WUUD 3BP4B 1KTDA 4JM2C 3VRLE