3OZ9L

Crystal structure of anti-gp41 fab nc-1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
211
structure length
211
Chain Sequence
QIVLTQSPVIMSASLGEEITLTCSASSSVSYMHWYQQKSGTSPKLLIYSTSNLASGVPSRFSGSGSGTFYSLTISSVEAEDAADYYCHQWSGFYTFGGGTKLEIQRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab NC-1 kappa light chain
publication title Crystal Structure of anti-gp41 Fab NC-1
rcsb
molecule tags Immune system
total genus 52
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2010-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oz9L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oz9L01
4QOKA 4LU5L 4U3XA 5B38B 1TTFA 1J1XH 3UROR 2VO5A 3E3QE 4P2CG 5ENWB 4R7DA 3CZFB 4X7FC 5IB4A 3WLBA 2ZKHH 3UZQA 5MP6H 4WWKC 5I1EH 4N9GA 2C1PA 4Z7VE 4P3WA 1UC6A 4F33A 2YD1A 4ZSOE 3GMQA 1Z5LA 3OAUL 3SGDI 2PCPB 4OZGF 4P5KA 2PTTB 3NH7L 2R56L 4OCSL 5EH1A 3KPLB 4Q0XL 1JNHB 5JA9A 4JRXB 2CMRL 3HMWH 5DRWB 1BOGB 5JPNB 1GZPB 2WBJD 2D9CA 1A6WH 2X4NA 4Y5XA 3NCYP 1C1EH 5E2TL 3MA9L 2AV1A 3TV3H 5F9JB 2ZNWA 1IEBB 3TC9A 4M6OL 5JHDB 2ZPKL 1IKFL 1KEGH 2Q8AL 3VW3L 3K80A 2Q76A 4UT7H 5BRZA 3U9PL 5EUOA 4XP4L 4MD4A 3SGEH 4X4YB 3VXOB 4KUCF 3ULVC 1TPXB 1UH2A 1MREH 4BQ8A 4POZD 3MJ7B 5EPMA 2Q6WA 4XVSH 1NGXA 1CGYA 4HIJB 1FZKA 1DQDH 2RFXA 1AP2A 4M1GL 3BPLC 3S36L 5F72S 2HLFC 1NLDH 1JI2A 4NT6B 1GSMA 2HN7A 1RURH 3WJJA 4OI7A 2ICWJ 4LDEB 2BY3A 4YAQA 1GOGA 1YY9C 1I8IA 1O5DT 1NANI 3X14B 2EYRB 4TVPD 4OGXH 4E5XA 1MLCA 4PRID 4FZEH 4GXUN 4AMKL 4DGYL 1WIOA 3UP1A 5DK2B 2LABA 4JANB 4ZQKA 3DROA 1J8HE 4Q6IC 5E99H 3KPMA 3UXFA 3QXDA 1INEL 3TCXA 4K7PY 1TVDA 5GRZA 2M26A 5I73B 3CPLA 2HT2D 2W9DL 1FSKC 4Z6AT 1A6AA 4NZJA 1JV5A 2DQGL 4X4XA 3GSWA 4YHNB 4O4YH 3PV6B 1G6RB 5EZIH 2V5TA 3VCLA 1VGKA 2CJUH 3NTCL 2WUBL 4NJAL 2FX8L 3LS5L 4OLEA 5C08E 1MCOH 2DBLL 5FO7B 1FG2A 3NPZB 4KC3B 1CDCA 1MEXH 1U95A 5I9QC 1UZ6E 5B39B 2EC9U 5E03A 1N0LA 3ILPA 3WJLA 4AM0A 2GQHA 4M93C 4Y16D 1DQML 4M8VA 4JRYA 5IVNA 3GB7B 4U1MA 4CN1A 4X5LA 5TE4H 2NX5A 2UWEB 3KPNA 2Z91A 1B4JH 1VFMA 2IH1A 2H2PD 2Y6SD 5EU5A 4FQCH 5AYUH 1KIUA 2R1XA 2FJHB 2AI0H 4XBEH 5D71L 1BVLB 4LKCB 5IFHL 4IOSD 4WO4D 4JFXB 3T65A 4Y19E 3CLFL 5HI5D 4X6CE 43C9B 4YPJA 3T0DA 4AEEA 2HVJA 1ZTXL 2RB8A 1RK0B 4PRBA 5F9OH 5T3ZE 4K71B 4B50A 1CK0L 2E7HA 1R3KA 4WENB 1MJ8H 2IQ9H 4GT7A 1ZANH 3CFDB 3LB6D 1YC8A 5C0RL 1UM5L 3O9WA 2IQAB 1AXIB 3RGVB 3NIFF 2VLRD 4WWID 4PJ5E 3TT1L 4U05A 3U82B 1XF3A 3UZVB 4JZJB 4R4ND 3NA9H 4HLZG 2BJML 3EOBB 2DWEA 3QNYA 4DKAA 2BC4A 1P4BH 2H8PA 3STLB 4YDIL 4G6FD 4LFHG 5IHZB 5K9JL 2C7UB 3V2AR 5MHSD 2JB5H 4U4BA 2AEPL 4Q2ZB 1EH9A 4O2FB 4FQXD 5ITBH 1TJHH 2P47B 3WNMA 3TZVD 3FOMB 4IMLA 5IUSA 3MRFA 4DUWA 5B21A 2ESVB 2VR4A 1FGVH 3L5WA 4H1LB 3RIAK 4M6MH 4ZNCD 3MJ8B 3W81A 3Q3GB 2LU3A 4RZCA 5IJVA 5DJ2A 3OX8A 4LLMB 4F7MB 3EZJB 1UVQA 2VABA 3GI8H 1WFOA 4F7CB 1LNUB 5D2NC 3ARDA 2VLJE 3ZHKA 1I7RB 3PQYB 3OGCB 1F4YL 3IFLL 3NPSB 1KG0B 1M71A 4JN1L 2OTWA 4JDTH 1QPXA 2YC1B 2VZSA 1LD9A 4K3DH 4Q9RL 1HILA 4C59B 5I1CL 2GTZA 5J12C 3ZT5A 4IRSA 3F8UB 3BKYH 5KZCD 4FFWC 3TBSA 1JTOA 3QQ4A 5F96H 3MNZA 3PGFH 1NL0H 3JWNC 2XKUA 5IMKB 4HX1A 4OLVL 4JHBA 4NOBA 1EZVY 4DGIL 5IWLC 5DSCA 3RWHA 3ZDZF 5C7XH 1MHCA 4MA3A 5HHMD 1OAZL 3IT8D 4Z7NF 5IBLD 2NZ9D 2YSSB 3BW9B 2GSIB 3V0AC 3RWJA 3U4EB 1GGCH 3NACH 4OFYA 5HDOA 3KPOB 3B9DA 3OKMA 3KDMB 5L9DL 3KPSB 4TSAH 2APXA 1GGIH 3IFOB 1RHHA 4CW1B 1C5DA 4P2QB 1LO2H 1I3RA 3LCYA 3FT2A 5ICZB 1HXYA 2R9HC 1A3LH 3QFJD 5BJTA 5EZOH 4ZTOL 5GZND 5KVDL 3MPCA 5TQ2H 3R8QA 2IALB 2JCCF 3BP7A 3F65A 1E27B 2WSKA 2AJUL 4RGOL 3PL6B 4NZTH 4YQXL 1JJUA 2QADC 1TZHB 2E6QA 4PJDB 2YUXA 4MWFA 1W0VB 3LRSB 2WAHA 1HDMA 1MCPL 2NY4D 1YYMH 2PCPA 4I0CC 5D5MA 3HMXL 2PTTA 1YN7A 4TVSa 3EOAA 5E2WL 4LVHC 4D0DA 1A22B 4NRXB 5DZNA 5DRWA 3RVXC 1G7PA 4KAQL 1FVCB 2VXSH 3EYQC 2FATH 3BH9B 2OP4L 4ETQA 1NDGA 3DMMC 2E6JA 3B5GA 4I2XE 1A64A 3MACH 1A7BA 4OGAD 5JHDA 3IGAB 4LEOA 1U8OA 1FO0L 2EDTA 5F1OB 1FNSH 4MQSB 4QY8A 1UM6L 1C12B 2A1WH 4IM8A 4ODUB 1PLGL 2IADA 1HHIA 2RQ8A 3BZFB 4XP9H 4FXLA 3GMNA 4QRPB 5JOEA 3EJJX 3QCVL 4UZGA 4DK3A 1MHPH 3MLZL 4G9FA 3CX5J 1A2YA 2X42A 2BSSB 4G8FA 2GCYB 5B38G 1QEWB 1ZS8B 1LEIA 4NT6A 2BVQB 2APBA 5IIEB 3SDXE 5C0FA 5JR1L 4F58L 1IC4H 5KSBA 4NO2B 1T0MA 5CSBA 3EUUA 1S7XA 1GIGL 3RBGA 5DK0B 1FPTH 2EYRA 3O6KL 2JJSA 3K46A 4U6VH 1Y0LA 1HHJA 5E8OB 1J05A 3U36A 4LKXB 1OTSC 3OKYA 4JANA 2XZQL 1G1YA 2NQCA 5K93A 4XZUB 3WO4C 3SKJL 1ZLVH 4HJJH 3QT2A 1N64H 3LKOB 1EAJA 4XMKH 5KOVC 5IMMB 4QHLA 3T0EE 3RFZC 1ND0A 1C8PA 1IMHC 3S35H 3K4AA 5HGDB 3ZKMD 5EOTB 4HMEA 3S37L 4KRNA 5IFJA 5T1DH 3X3FL 3PV6A 5DHVH 1AI1L 1NBZA 3V7AE 3VRJB 3U30B 1Q38A 3EYSH 1BFVH 5GJTL 3OB0H 3SCMC 4ZODA 3O3EB 4M61A 3MBEA 3MLUL 4PJBA 2Q1EA 5ALBH 5I75B 1JYXA 3DTXB 1OVZA 1EDQA 1A1MA 5TE7L 4Y4KB 3HTLX 1A7OL 2E6PA 3KNBB 3QIUB 4Y2DB 5KAQG 1V5JA 2JELL 3JTSB 3HCVB 5DT1L 3QWRA 3SE4C 3KPRB 1CL7H 3EJYD 1F13A 2FEEL 1I1FB 4KV5F 1LO5B 2JF1A 4ZXBA 4JFDA 1TVBB 4YDJB 3RWFB 1BM3H 1GHFL 3PWPD 1OAKL 4NYLA 3JV0A 2P7TB 3NCFB 3OKOA 4NCDA 1ED3B 1J0HA 3TYGL 1Q9KA 2AQ1A 4RGMB 3G5ZB 3K74B 4NO0B 1MF2L 3RI5F 4OBRA 1JFQL 1G0XA 1AGEA 2NY6D 2DI9A 4LCYB 2YKLL 4P23D 3VRIB 5C0BA 4PRPE 4RFOL 1D5ZB 3LVEA 4XPBL 4O58H 1OAUL 1DBBH 3VI4E 1NAKH 5AZ2H 1X5AA 3MA7A 4KGJA 2K9UA 5J11C 3QCTL 1WC7B 3DECA 1RULL 3LY6A 4EQ2A 5KANI 2NY2C 4Q9BA 1FFPB 4BSVA 3BH8A 1YEHH 3VWJA 3CD4A 4KI5E 3QXVA 3E6HB 2IQAA 4ZUUB 1J88A 1OTTD 3B8YA 4JREB 3VXRD 5DMKA 4TTDC 3RHWF 3HR5B 4QXWA 4XX1E 1S7TA 3RAJL 3O3DB 1M7DB 3EOBA 5CEZL 32C2B 3FO9A 5JUEH 2I07B 2JIXB 3GSVB 1EGJH 2C7UA 3MRBB 2H3NA 4NHUB 1YUHA 2AK4D 4HKZA 1ZMYA 4ONHB 3MV7D 4P4RB 1IARB 3X11A 2FO1A 4GAJL 3RDTA 2A6IA 1R5VB 4XP5H 3I2CH 1MCQA 4NC1E 1A9EA 1U8NA 3OL2A 4KJPD 3C5JB 2FECI 1J7VR 1G9ML 4AEIL 1ZSDB 4I13B 5JIIA 4G42B 5FCUH 1WZMA 1IAIH 4R96A 3Q3GA 3CXHJ 3TA3B 4YHYB 3KYOA 5F7FA 3ZT6A 2DKUA 4KMTL 1OPGL 5E94B 1ES0B 3ARVA 4L4VA 3HG1B 9CGTA 3BUYB 4N90D 1I7RA 1NGPH 3GIVA 3WHXB 1EHLH 3QQNA 1LGVA 1T22B 3GIZH 2XRAH 3ARSA 5ISZA 1X7QB 4U1IA 2PXYB 5JO5A 4EDWH 1W8NA 4KFZC 2IC2A 1QBLH 2VLLB 3IRPX 1QA9A 2X4QB 1ONQB 3ROOB 2DM2A 1I9RL 1UWXK 4XVJL 3D69B 4EQ3A 5TPWH 3U0TB 3CU7A 3U0WH 3SOBH 3C5ZA 5F7WC 1DE4B 2MQ3A 1K8IA 2VDLL 1KSRA 2NR6C 3N06B 3N85H 3H0TA 2DQDH 1NMAL 1MCEA 2VZTA 1RZJL 4U1SB 5D4QA 3BW9A 3ECBB 2OXGA 4X9IA 4UNUA 3OTTA 1CE1H 2FJGB 4KK5C 4PV8B 3V8OA 2VISB 4YBLC 4MNQB 1ZHLB 3LZFH 3VGEA 2VDNL 1LP9F 1BQHB 3R1GH 4MYWB 1FL3A 3MBXL 4JKPH 4Z0BH 4ZTPL 4PREB 1RIHL 2CLRA 1TZIA 5LGHH 4M6NH 1L7IL 5LBSL 2XWJA 1ORSA 2EXYC 3TFKC 3Q2CA 4PUBL 5D7JD 5DGQA 3IF1A 4ZPTB 1A6PA 4RFNC 4TUKH 4OZFB 1CXFA 4HH9A 2HFFB 3UJTL 5DHVA 4NRYB 3NFSH 3WS3A 2AJSH 5E95B 2GTWA 3AM8C 4XNUH 4NKMA 1WK0A 5CJQH 1FVCA 4JFEE 1VACB 4UV7H 2IEPA 3MLRH 5I66B 3B43A 3HNVH 3GBLA 3AMLA 3N1QC 5D1QC 1PKQB 4L1HA 3PWNA 4F15B 4FQJH 4LP4A 4D3CL 4YPGA 4MDJB 4PJXE 1HINH 3AROA 4M5YH 5LWYH 2BVOB 3IFPB 3WNOA 3DHMA 1J86A 1DUZB 2GY5A 4OIAA 3ARGD 3SQOH 2AEIT 3HNTH 2WBWB 4MQXD 5L8JB 4G8GE 2QQKH 3HE7B 1KPVB 5I18L 1QR4A 1WCBB 3JV5A 3RZCC 3JWOL 4DVBB 5J1AB 3IU4H 4V1DD 4PRNB 1P1ZB 5ID0B 1TZGL 2GCYA 2A6DA 1ZAGA 5E8DL 1QEWA 4QHUB 2BSTA 2PW2B 4OAWB 2XXMB 1E4KA 2CIKB 4LNVA 5CGMA 3OKLA 1HE7A 1N6QL 1XGPA 4NHCH 4FZ8L 5DUMH 2VC2L 4OCMC 5JHLL 5DD5L 4LF3B 1FGNL 1V3KA 5C0DB 1VA9A 5C2BH 3P0YL 4R97C 3SDXF 2V6HA 3CVHH 4KQ3H 4X9HA 4LKXA 1D5MB 5D1ZB 2DM7A 3MUHL 4MDIB 4EN3A 1LE5A 4K9EC 4H8WL 1IT9L 4L8CB 1EGJA 4DZBB 4YGVA 2ORBL 2WP3T 1R3LB 1C08A 5J13C 3IS1X 2PN5A 5C09D 2CRIA 2BNQE 5CFHA 1LDSA 4LCCB 1FNAA 2WUCL 4OCWH 1NMBH 5C8JB 2IAMC 3H9SB 1XGYL 3TNMA 2O93L 3EO0B 4P4KC 3MZTA 3QXTA 3L9RA 3U1SH 1HIMH 3O3EA 3FHQA 4M62H 25C8H 2F5BH 4KI5C 1NGZA 1QFHA 3CVIL 4Y4KA 4OV5A 3MQIA 2NTFA 4Y2DA 3ZTNH 5IVXF 5E5UB 5EORH 2OBGA 1D9KA 4HK0A 4GRLB 5TQ0L 3HCVA 5EA0H 3KPRA 1NGWB 3IKKA 3FO0L 4OZHA 1YJDC 5H35A 3R8BB 3U7AA 5ECJE 5DJCB 1A6VH 2P7TA 4N0YL 4EI5D 3BP6B 3WKNA 3C2SA 1QZ1A 3CIQA 1X5IA 3FRPA 1UXSB 3WSQH 4R90H 4NC1C 3E2HC 5CZVH 4JM2B 1X6LA 4OLZL 4HDIB 3V7MA 2Z31B 4X6DE 3EDDA 3T4AA 2VLKA 3GK8L 3GNML 8FABA 2BMKB 2N4IA 4PY8J 1KUMA 1UQSB 1D5ZA 1VERA 3QUXC 2AEQH 4QT5A 4R2GC 3RX7A 3QEGH 1IE5A 1OB1B 3GO1H 4YHIA 4QLRA 5F7NC 5IMOA 1U36A 5GPRA 4ZFOL 4HFUL 4LDOB 3IJYB 1RIUH 1HOCB 4G5ZL 4C4KO 1XF5B 1T1WA 4G80A 1H0DB 2GK2A 3D1MC 1SY6H 2W0FA 1N4XL 2J7LA 3QHZH 1A6ZB 1BJMA 1KGCD 5JIHA 3MROB 3KYKL 2R29L 3CFCL 4YGAB 2EDFA 2HYMA 4BA8A 5GS1A 32C2A 3M07A 5DRNA 1AHWA 4HXBH 4K8RL 1GOFA 3MRBA 5FYKU 1MVUA 1X4XA 5ESAB 4U7MA 3RKPA 3TT3H 1TCRB 4HHAA 3VXME 4DAGH 5D7IB 4XBGB 3WHE0 4NSKB 4PJEB 1R5VA 4AG4H 2NNAA 5CP7B 3S9DB 4M7LL 4I4WB 3IDGB 5F7HA 3CFJB 4Y1AB 2VLMD 3ULUE 3EJZC 2ZCHL 2P5WE 3FRPG 1FH5L 4RQQA 1FLRH 1HQRB 3HC0B 1OLZA 1QBBA 2YPVH 2BNUA 3SGDH 1S5IL 3FO2A 4D0BA 1K5NA 5E94A 3FB6B 3B2VH 5C9JB 3OR6A 3BGMB 2WBKA 3MFFA 3I9GH 3FB7B 5FUZH 2VQTA 3WBDA 4KUCD 4K07A 4FQPA 2GIYA 1X7QA 3EYFB 1LK3L 2PXYA 3BSZL 3IXAB 3LRHA 4ONGH 2BNRE 3IXTB 2NYYD 1H5BA 5D72L 1RIVL 4JFOB 5DURD 2C4FU 5F8RC 2DJ4A 5C0EB 3S37X 1E28A 4XPTL 3UBXA 2D0HA 4N0RA 3LDBB 4CKVX 2HT4D 3ES6B 3Q1SL 4WUUD 2WBJB 2HRPH 1LO0H 1J1PH 3U7WH 1IBGH 4OZGA 3QH3A 3WN5B 3DRQA 5EOQL 3ARXA 1VESA 3K8LA 1XF2A 1KENL 3N1FC 4OJFH 2CO7B 4PV8A 1T1YA 3MRKA 4U6XB 1BQLL 4LPWA 3MLWL 3CVHA 5FOBA 1AFVL 3O6LH 2P46B 3QNXA 4ZD3L 5HTSA 2PYED 4OF8A 3X12B 5BS0E 4PGCA 1SYSA 3VGFA 3ARQA 1H3XA 4OIIH 3RPKA 1X44A 1NANH 4X6EB 1A7QH 2J8OA 3GMPA 3PXHA 2EDQA 4LIQH 3WE6B 1KIQB 2B7DT 2X1QA 5H94B 4J3UA 1DEEB 2IBZX 4D9LH 1JN6A 5TF1L 4LCWA 5IG7B 1I7TB 4XAWL 3AS0A 1KTDB 3T2QA 1JZ6A 1B88A 2M8XA 3L7EA 4NJ9H 5IB3B 4OF5A 4XRCA 2GUOB 3ULVD 3SKOB 1HXMA 3DO7B 3P30L 2R69H 4X4ZA 3W5MA 5T1KD 1MPAH 5CEZE 2XI9A 3MCLH 2FWOA 5CSZA 3H7BB 4PGBB 4PRIB 5IFAH 2Q3AA 1YEEL 1QUNA 2HLFD 3CC5B 4Z76B 3MRMA 1A7NL 3R06A 3UBXG 4FQ2H 1PKQA 4M43L 2UUDH 2XQYG 5CEYA 4RIRB 5H8DA 3ARBA 3T2NL 5HHVH 3HI6H 4RGNE 3KWWA 1YY9D 2HKHL 3JV6B 3V52L 1IEHA 4JVWA 2Y07L 4HH8A 2H1PH 5J1TC 3MMEB 4JKLA 4XCCH 2VDPL 4BH7B 3KXFD 2FGWH 2OTPA 4HUVA 4PJXF 2G75A 5ALCH 4OCXL 1EMTL 3B9KC 3MRRA 4LNRA 1CR9H 2XTJD 5TDNB 5IHUH 4AIOA 4XP1H 4XMPH 1RU9L 5FO9B 2R0LL 2XV6B 1S7RB 3T1WA 5KSUA 3C87A 2NY7H 1LK2B 3SEPA 2ERJC 1MI5E 1UYWH 5T1MB 5C0GA 3U2SB 4EKXA 4MB5A 4WU7A 1CXHA 1SY6A 2J8UB 1JGUH 3TBYB 1S7SA 1XR9A 1D5MA 2FHFA 3PHSA 3V6OE 2L4OA 1KELL 4HEME 3TN0C 1FNFA 4L8CA 3CMGA 4KMQA 5D7LA 1DQQA 3H2WA 3BQUA 5E2UH 2DD8L 4XWOC 1BFOB 1LVEA 5LXGL 5J56B 3LH2H 5HYJA 2DKMA 1KB5H 4FTVA 4QXTB 1T03H 4GJTB 4WNQB 3B8SA 2DTSA 4HGKC 3AREC 3G9AB 3UTOA 4MNHB 3TO4D 3MODH 3QUML 5CILL 1U92A 3M1BB 5KS9E 2YN5A 1QPPA 4E41E 3ZLQC 3OHXB 2B20A 5D96B 3AY4A 4IRJC 3IDXL 4X80H 1SJHB 3N50A 3QYCA 4TNVF 2WQRA 1MQKH 1EEQA 1JHKH 5IKCA 1QFWL 2VLRB 1CU4H 4X5XA 5DMIH 1MUJB 1RZFH 4DTGH 4DFIA 4UT6L 5SWQB 4PR5A 1DANU 1Q8MA 1Y18A 2FL5A 3HAEH 5L2JA 3ZKXB 3Q6FB 4G6FB 1URLA 3V4VH 1IZKA 2EKSA 5FYJU 1XF4B 5BW7C 3V6FB 3L3KA 5EU6E 5IROC 1BGXH 1DP0A 4FQXB 5TDOB 5DEFB 2D31A 3TZVB 1WWAX 2A6KB 1ZT7B 4MXWL 3F12B 3NCYS 3QG7H 2YUVA 1QYGH 1IC5L 1F02I 2J6EH 2IANA 4KKBC 3ULUC 1OAQL 1QFPA 4NQDD 5CZKA 4OTXL 3VFOB 5H2BB 3MXWL 1UACH 4BUHA 1KIRB 1KTLA 1J18A 4XNXH 4BSJA 2F8XC 1T66D 4YDLB 1HZHL 2DYPD 5DJ6A 2A0LC 4K23H 4Z7UF 3MROA 2DI7A 3O3AA 4HIXL 1TNNA 3RTQD 3F7YA 5KZCB 1MY5A 1R5IA 3PDGA 2W91A 3DGGB 3F58H 4Q74A 1FNLA 4M48H 4HPOH 1AQDA 2DLIA 1NCDL 1BP3B 1BBJA 5ESAA 1XGTA 3IDIA 4DKFL 4KZDL 4BZ2L 4LP5A 3C09C 1MCFA 5DD0H 3T1FB 1Q9LB 2NY5C 3X3GL 3BI9X 2VQ1A 4JQVC 4ZS6C 1X5FA 2XWTB 4ZNEE 4EBQH 4YHPB 3P0GB 3MRDB 1KLGA 4K3EH 4LRNL 4ODBD 3V9FA 1K6QL 4BH8B 1Q9WB 1CGUA 4FFWD 1NGQH 4Z78A 1CXIA 2GYSA 2YEZB 3PGDB 2FYYA 3CX2A 3F7VA 2ILLA 2I60L 5F3HA 5ERWB 4O2EA 3QFJB 1DQTA 2ZP0T 3P77A 5DJ8B 3D48R 2ARJQ 3HI5L 2NLJA 4P59H 3W39A 5KTEH 3KR3L 3TIDA 1KCUH 2AJXH 4PPTA 4Y2OA 1U93B 4G9DA 3ARFD 2NY4B 4U1HA 4P9ML 2J88L 4HWEL 1Q94A 2FHCA 1U8JA 2JCCA 2R9HD 3NFPB 2HG5A 4YWGL 3HUJE 1QRNA 3LKSA 1HH6B 2EO9A 3ES6A 3DUUA 4KK9C 4J3VA 5T3XL 3T04D 1TLKA 3HHRB 4PRHE 1NLBH 3PV7A 4O02H 2QADD 2Z8WC 2AQ2A 2EDDA 3HPJB 5I6XC 1CE6B 4OCRH 2C3XA 5ESVA 4OT1H 1T1XB 1AE6L 2R4SH 2Y06H 4JB9L 3LD8B 4A6YL 3BKCH 4RGNC 2B39A 2CLVA 3C2AH 4FXKA 5I8KL 3BAEL 1BZ7B 3Q5OA 5CKAA 1MCHA 4PJ7F 1LDPH 1IQWH 3QXAB 5D2LF 3DMMD 1VCAA 3EFDL 4X6EA 5F88A 1EA9C 4N8CL 3WE6A 3GUTB 5DEGA 4GG8B 1I1YB 2GW5A 1RUAL 5GRWA 3UTQA 4NUJA 4NO5B 5DUBB 1J8HD 1KB5A 2GJ6E 1YECL 2C9AA 3DVIA 1KTDA 1BEYH 1T21A 5E00B 3LHPH 5F6IB 3SKOA 3DO7A 1LE9B 3FQTB 4N0UA 2X05A 4QTHB 4OLYH 4YHLH 3RGVC 3W2DH 5T5FL 1MJJB 3LRGA 5HYFA 3H7LA 4MNGE 4FA8A 5CAYB 4JZJC 4ODVL 4KUZL 5AD0B 2VDQL 4ZOBA 1YY8B 3LV3B 5K9OA 2OSLA 3HZYA 5C08D 3HAEA 2I25N 1KTKE 2J12B 4NFCA 4LPCA 4LLQB 2QQNH 2A9MH 3OKNB 1Z3GH 3VXSE 4POYA 2FB4H 3CCHA 1RZJC 4HUNB 5J9PA 4OLWL 2IGFH 3MV8E 1M1SA 2FHBA 2DQHH 3CSYB 5TGBB 4B41A 3PNWB 1NC4D 4JG1H 3CDGB 2QKIB 3KG5A 1OTSD 3WIFA 1BX2A 1J8KA 5EOCH 1P6FA 1XIWD 2J6EA 2XZAH 3REWA 1FYTE 1TQCB 3GMOA 3QRGL 1UWEL 4FP8L 5IW6A 1VB9A 3PGCA 3B83A 1LK2A 3DVFA 4UT9H 4Y19D 1B0WA 1CXLA 3U0PB 3UJJL 1KYOK 4ELKA 3LIZL 4QGYA 4LCUB 3P3YA 5BV7L 3I84A 1YEGH 4ZUVB 3PWPB 4BQ9A 5T3ZD 2B1HH 5D1XD 5DC0A 2EDKA 3SCMD 4C83B 1G7LB 3V0VA 3WFHB 5B8CC 2MPAL 2OR7A 4PJ5D 2NY6B 8CGTA 5FA3A 1INQA 2DTMH 5GGRY 4L3EE 1U8MB 4P23B 3L5JA 4QHMB 2EC8A 2X09A 3ME0A 4JFFA 4NQVB 4WNQA 1FFOB 4K7PL 1U8HB 5MERA 3H42H 3M1BA 3X17A 4IJ3B 1IEAB 3M45A 2APTA 1YEDB 1SJEB 1A8JH 1EX0A 1SJHA 2XNAB 5TE6L 2FBJL 3VXRB 4RMTA 4WFGE 3PHOB 4RFEB 5ILTH 4NN7C 3ULSB 4JY5H 1TETH 3GSXA 5FDWA 4LMQE 2FD6H 5DJDB 5KS9F 1IGML 4HSQA 1Q1JH 2J8HA 1J1XL 4C56A 5IQ7H 3QI9D 2AK4B 2ZKHL 3MV7B 4YHMH 5MP6L 5I1EL 2NY2D 1CIDA 2PW1A 3CDFA 2IG2H 4PJFF 2R0KH 2VLJD 3W82A 3QO1A 2V2XB 3L3JB 3SGJA 4TTDD 3SE3A 3MV9E 2I26N 3WMSA 3O4LE 3O4OB 3RKDC 1AGCA 5DVNA 2DMBA 3HMWL 4PBXA 1E6OH 1NBYA 2DLEA 3LQAH 1A6WL 1KEMH 3WKMH 1C1EL 1FCCA 3L3GB 3SDAC 3TV3L 5GGRA 3O41A 1KEGL 3TO2A 4UT7L 1UGNA 1RUPH 3DETC 2XKNA 2R1WA 5IT2H 3DXAA 1HEZB 5C07A 4GW1A 4HIIA 4F7TB 2ZNXA 2AJZA 1MREL 5IVOA 4V2BA 4Z7WF 2W38A 4XVSL 4PJHB 5IR1A 1DQDL 4JLRB 3UPRB 1ZVSA 2ZOLB 5IHBA 3IU3A 1S5HB 2DB8A 1KC5H 4OGYH 3W5NA 1NLDL 4F3FB 3Q5YA 3DRTB 3QUYB 1HI6B 1QNZH 1RURL 1CDBA 2HFGH 2MMXA 4L4JA 1I3GH 4Z0XB 1RPQA 2UUDK 1Q9WA 3JVGC 4U1JA 5J1SC 4OGXL 4S1DC 5DZOA 4FZEL 4I48A 5I1AA 4W6YB 3TPUB 5SWZA 5ERWA 4MS8C 5C6TH 3DI3B 4QRUA 3BWAA 5E99L 4U6HB 4AJ0A 4ZPVB 4PY7B 4OM1H 1RJYA 1D6VH 3WV0A 1MVFA 1S8DB 2WIMA 2E9JA 3BEVA 1SYVB 5D7JB 4P57A 2SEBB 1LP9A 2Y7QA 3KLSA 4P46C 1SM3H 3SJVA 3U30C 2YUZA 3QO0A 2X6MA 3QR2A 4O4YL 5EZIL 5JW4M 5E4EB 1MFCH 2CJUL 1CGSH 5J6HB 1MCOL 5F1NB 2ICWB 1A02N 4GRMB 4PJ8C 1G84A 2ATPB 4U6TA 3TBVB 3TFKD 2DWDA 1MEXL 3TIEA 4X98B 3CH1A 4R8WH 3C8DA 5EU4A 1XZ0B 1CFBA 5D9SA 3HE6A 2FIRT 4F80A 1OM3H 2W59A 2X4TB 4P2RE 3BGFB 2CDGB 2DL2A 4RGMC 5EBMA 2FDBP 3LN4B 5TE4L 3WL9A 1B4JL 4DN3H 3SDCC 3DX7A 4FQCL 3O2VH 5AYUL 3ARGB 2Q7NA 4XBEL 2AI0L 1UENA 3QA3A 3C60A 4V1DB 1UJ3C 3L7FA 4HIHB 1AKJD 4UB0H 2P45B 5CWSB 3T0ED 4J8RB 1IAMA 3A6CH 4PJGF 5F9OL 1F2XK 3HRPA 1MRFH 3M17A 3OAYK 5MEPA 1ZT1B 1MJ8L 2IQ9L 1ZANL 3BDBA 1PQZA 4MAYC 1RJLB 1MHEB 5ELIA 5AD0A 1YMMA 1K2DB 1YY8A 3LV3A 4HMCA 4Y0GA 1DBMH 1L9MA 2VN7A 5IB2B 1NBVH 3NA9L 2NY0C 4LLQA 1FFRA 1P2CA 1P4BL 1W72B 5I74B 3OG6B 5F1KC 5BCAA 1T3FB 1XR8A 2JJTA 1XFPA 5C09B 2JB5L 1QSFE 5ITBL 5C0IB 1TJHL 1LHZA 3QIWA 4X5WA 1NDMA 1DDHA 3C6LA 3MV11 3QSKB 4IHOB 5SX4I 2EKJA 1WBZB 4Q58C 1TENA 1KIPA 1DVFC 1FGVL 4PG2C 3VXTA 4YHYC 1BZ9B 3KYNB 4N9OB 4QOKE 4XCYA 5TDPA 3MJ6A 4TTGA 4HUWB 4UIKH 4OZIB 4M6ML 4APQD 1YC7A 2XQBH 1I8LC 5KSAA 1B6DA 3MRCA 1JGLH 5FGRA 3FOLB 3GI8L 3G6JB 2W0KA 3U0PA 4WI7A 3VGAC 3BO8B 5GS0C 4PRPD 2IAMD 3OXSA 3RVVD 4P4KD 2LTQC 4JDTL 1YEFH 5D6DA 3FT3B 5IVXA 1JGDB 4K3DL 4L3CB 4EI5B 2MWCA 3HI1B 3HC3H 2HA1A 1XH3B 4KI5D 3BKYL 5T3XE 2XA8H 3RY6C 4WW2B 4O9HH 1WEJH 2MQCA 5ID1A 2EDBA 5F96L 3PGFL 5CJ8A 1NL0L 2EDEA 1UB5A 1PX4A 2V7HB 5BO1H 4IBLT 5C7XL 5L7XH 5BRZE 5EUOE 1O7SA 2A2QT 3UPAA 1HSAB 3WDHA 5GQBA 1GGCL 3NACL 4OSUH 1KJVA 3BPNC 4L9DA 3MRGB 4LK4A 5FYKH 3WXVH 3HZMB 4TSAL 4U1LA 1X4ZA 3RHWK 1I85C 5EUKA 1GGIL 4RFEA 2OM5A 4U1GB 1LO2L 2KPNA 4GW4B 4ODHH 3BXNB 1A3LL 3TJEH 5EZOL 1XCQA 5DMGD 5KVFH 2MTPA 3LKPA 2VAJA 1RZ8B 2VSCA 2AXFB 5TQ2L 3HRZA 4UUJA 5E08H 2V7NB 2AV7B 5HGAA 4HS6A 3U4BH 4HAFA 4NZTL 2F74B 5HGHA 2EIZB 2WNGA 4UQ3A 4S2SB 4XGZB 3CFEA 3PWUA 3HPLB 4U0QB 1YYML 4W4OC 1X5YA 3QULA 4YH6A 2M2DA 4HPYH 1V05A 3P4OB 2HMID 1MCNA 4L8BA 3SBWC 3T8XA 5DJYB 1ORQA 2VXSL 1MFDH 4UINH 2FATL 2HKFH 1I1AA 3MGOB 5LCVH 5IW3A 2FBOJ 4PJ9A 3L3GA 2EE9A 3DX6A 3MACL 4HMDA 2HWZH 3EZ8A 1FFQA 2OCFD 1FNSL 5CEXA 3RL1B 1XGQB 2HVKB 4Y89A 3RWDB 3D87B 1DN0B 2AKRA 1N8ZB 5T1LD 1TIUA 1R24A 3EJZD 2A1WL 2ZCKH 4LAJH 4GAGH 5E7FA 1QLRA 3HE7C 4LHQB 4QWWD 4XP9L 2VITB 2D0FA 5DUPH 4PJHA 3NFNA 5DURB 5DHYB 5KVMC 4QRRA 3WIHH 2BHUA 1S5HA 3VI3F 1MHPL 2EYTA 4M7LT 4O5LH 3QUYA 5F70A 4R3SA 4WUUB 4WEBH 2E8ZA 5E6YA 5MEOB 1T20B 1IC4L 1BREA 1FQ9C 4JCLA 1SEQH 1V7MH 4JRYE 3P0VH 5EBLB 1F6FB 4JPIA 1T04A 2NX5E 5EU3B 5DYOA 5BZDA 1FPTL 3RPIB 5D1ZC 2F5AH 2UY6A 5EN2B 4U6VL 4XHJD 5IV2B 1PSKH 2O5YH 2X4SB 4OKVA 4DKDC 2PYEB 5BXFB 4GLRH 4K55A 4JFED 2ATKB 4HJJL 3S3JA 1KJ2H 1N64L 3MLPA 5HYSB 4XMKL 4O00A 3CMOH 4LCCC 1TJGH 2A73A 4QYOA 2SEBA 1K4CB 2O5XH 1MHHA 2BXYA 4PLJC 4BKLA 3S35L 4TOYH 1BOYA 1MCJA 5JTWA 1KXTB 3QJFB 4GBXD 2PO6C 3VFNB 1JPSH 3P9MB 3FFDA 5T1DL 1ZA6A 1HQ4B 4NQXB 2X4OA 1DN2A 2XWBA 3EYSL 1BFVL 5EWIH 5LVEA 5T1KB 4WHYG 4DK6A 1B4RA 3W0WB 4IS6B 4FOMA 4FS0A 4QHKJ 5CUSH 3BPLB 5ALBL 2P8PB 1B2WH 4G8GD 4KKAC 1KACB 4GRLC 3DX9A 5IW1A 4M7JH 2Y72A 4FHBD 1G7MB 3WS6A 5DQJB 1J0YA 1AD0A 3MJ9H 1OWWA 1NFDF 2HTKC 4XCEB 1CL7L 2X4TA 1OAYH 4PFEA 5EBWA 4XTRD 1BM3L 1VKXB 1JCKA 2CKBB 3T0BA 4YX2H 2ADIB 4N5EC 3P4NA 4LASH 2YD8A 3D3VE 5GGUA 3KXFB 3QRFM 1U91B 3GSRA 3EYVB 4Q6IB 2XTJB 5E6IC 2C3VB 3DV4B 4V1DA 3MR9A 1ITBB 2BSRA 4TUOB 4J2XA 1T0NB 4O58L 5JXEA 1DQLH 1CF8H 1DBBL 5HJ3A 1FSKB 4EI6A 1NAKL 1JWUB 5AZ2L 1R5WB 3GM8A 4M4PA 2BNQD 4UTAH 2YBRB 3BFOA 4LBEB 2P8MB 4L9LA 1QFUH 3T0VA 1YEHL 2YA2A 1RJLA 3B9KD 2Y4SA 3NN8B 5E8EB 5JOFB 5JNYB 4WTWA 3CSBA 4UDTB 5SWSA 5FGCE 5I9QB 5JUEL 1ETZB 5CINH 1GZQA 1CWVA 4KHTH 1EGJL 4Y5XC 3WNKA 4QRTA 2ICEB 5DA0B 4PP2A 2H32H 4KTDH 4BSWA 2W1NA 3ZYZA 5BMFH 4OCYH 4XP5L 3I2CL 3O6FA 4EVNA 4F57H 4M93B 1N5YH 1S7QB 3GGWB 3G6AB 4F2MB 3ARZA 4OZ4A 4DKEH 2Z4QA 4NN5B 3TO4B 4EXKA 3TN0D 4JZNB 5F3BB 1NCNA 5FYJH 5FCUL 3FB5B 4H25A 1IAIL 1FE8H 1AGDB 4ODXB 4RMWA 4PJIF 4X8XA 5IEHA 1VGEH 1HHGB 1RZKC 4JFYA 3G5VB 3FOLA 3G6JA 1U42A 2V17H 5DRZA 1A4JA 1FZJA 4ZUSA 1QSEB 3BHBA 1NGPL 3WJJC 1EHLL 2Z35B 5D5ME 1AD9B 1QKZH 3GIZL 2XRAL 4OF3A 3FT3A 2GFBA 1JGDA 4JFQB 4IRJD 1QTYT 3IJHB 2CKBH 4EDWL 4Y5YA 1PFCA 1QBLL 2F54A 1OCWH 1YNTB 2EICA 4KHXH 3HNSH 3WIHA 3AAZB 5K59E 4NO3B 3QHTC 1YPZF 3BMVA 5A2IH 3DURA 5TPWL 1P7KA 3VMNA 5FKAB 4A2LA 3U0WL 3SOBL 4NQDB 3V79C 5HYIA 4R7NB 3N85L 1FN4B 2DQDL 2V5SA 5HHOA 2ADJB 3GMLA 2GAZA 4HT1H 3VXMD 4G8EA 4JFPB 1CE1L 1PD6A 2R8SH 3K4DA 5MEQB 1L6XA 1VFOA 3MRGA 4DZ8A 1RD6A 1A1NA 2IPKB 2P8LB 4D2NA 3LZFL 2DYPB 5C0AA 1M7XA 3QDAA 2BX5A 4G9FE 3ULUD 3LN5A 1D5BB 3R1GL 3DLQR 5CSGA 4JKPL 3KPPB 4Z0BL 2P5WD 2EXWC 3RTQB 1KJ2A 3G04B 3PDOB 5LGHL 1FO0A 4M6NL 3IVKB 1RUQH 1JNNH 3U83A 3J7HA 1ZOXA 3QEQB 3UTZB 3P2TA 3P4LA 4OD1H 1TFHA 3H3PH 2V7NA 4D0CA 5KSBE 5D2NB 3U9UA 5ESQB 2W60B 3RU8H 4TUKL 4S2SA 1FORH 1OGAB 1A4KB 1UZ8B 3WJLC 2WLZA 3DGCR 3JWDH 3NFSL 2ITCB 3AGVA 2AJSL 5F89A 4ZOAA 4XNUL 4RMUA 4Z7VB 5J12B 3MRPA 5CJQL 3BZ4B 2XN9E 4WW1A 2BNRD 5FIEA 4ZSOB 5I15H 1KB9K 4Y4HD 2D4FA 4UV7L 5A16A 3MGOA 1U8PB 3MLRL 5T33H 2P1YA 2QSCH 4TRPH 5I1DB 2QJDA 2FO4A 1TTUA 3MJ9A 1A6TB 3PWLA 5LJYH 5FCSH 3HNVL 5DRXA 3LSOB 5JDSA 4FQJL 4Z7OF 4ZS6D 3EKCA 2IBZY 1B0RB 3VFVA 2ZCLH 2ZUXA 1HINL 1MFEH 1DN0A 5HVFB 2HRLA 4M5YL 5LWYL 4JO3H 2ZSWB 5DS8B 2VAAA 4MCZB 5JW5A 4PJBE 1IFHH 5B22A 4GRWB 3ARFB 1JI1A 3SQOL 2ARJB 3HNTL 3L95A 5ACLA 2QQKL 1JK8B 3OKEA 5DHYA 4MLIA 5FHBH 1ZK9A 3SGKC 3R4DA 3IU4L 5I8EB 5BS0D 4EUPH 2Q7YB 2EYSB 2CUIA 3B4NA 4O51B 1RSFA 4J12A 5KBNC 3GKWH 4I0PD 4WWKA 4JFDE 2QADB 4HUUA 3RNQA 5I8CA 5EBLA 4NHCL 4Y16C 5EU7E 5DUML 1L7TH 3NIDF 1UKSA 3ARYA 3INUH 4GKNB 4PJCF 3RWEB 4HEPG 2H2PC 3ZE2E 4LVHB 5C2BL 1U0QA 4XVTH 3CVHL 4KQ3L 5DJZB 3DVGB 4BQCA 4LL9A 3GM0A 3U6RB 5CEZD 5BXFA 4KK9D 4I77H 5C0BE 3DMMB 4WO4C 4FABH 5FOJA 5HHNB 1HHKB 4OKDA 3TH4T 3H3KA 1K4CA 2H32A 1E4XI 4N1HB 1J8HB 4PLKC 5IJKA 4QF1A 2OL3H 5FM5O 1IQDA 2DQEH 4OCWL 3GI9H 5D2LA 1NMBL 2DQIH 5D96C 4FQLH 1ZA3B 3PJSA 3LB6C 4RGND 4RCAA 5CKGA 3U1SL 3QUZA 1UB6B 1HIML 5T1KA 1KCVH 2X44D 3HLAA 4HS3A 4JJ5B 4M62L 3W0WA 25C8L 4IRSC 2NXYD 2F5BL 4ZUTA 1YNLH 3ZTNL 5EORL 5DFWH 1A3QA 3UX9B 5EA0L 4XPGH 1P4LA 3B6SB 4D8PB 1MI5D 1A6VL 3TZVC 2Y5TA 3BP5B 2MFNA 2ADIA 2R2EA 3FN0H 2Q87A 3WSQL 4GRWH 4R90L 1NC4B 1W0WB 4M7KH 3RA7H 5BZWB 3G5YB 5CZVL 5JORA 1RHFA 4L29A 3WO4B 3DV4A 5E6ZA 5DTFB 4EEEA 4L4VE 3IDYC 1PY9A 2E7LC 1Q9OB 1T1ZA 2AEQL 3HZVB 3QEGL 1CICD 1JWUA 1QSZA 1NCBH 4WHDA 4NKDA 1MJUH 4YDLC 3WDIA 3GO1L 5ISZE 3KHQA 3VFWA 4Z7QE 2HH0H 4X6CB 3UTSA 3ESUF 1RIUL 3PABB 5IB1B 4UNTA 1AO7A 1SY6L 2YD9A 1T4KA 3QHZL 4QHNA 3RVUD 3SCMB 3MUY1 4E41D 5GGSY 4OQ1A 5JNYA 4RAUA 5CBEB 5A1AA 5F7UA 1RUMH 4HXBL 4PJ5B 5F7EH 1IC1A 3O8XA 1NFIA 3TT3L 4AEFA 2HLAA 3FB8B 4U6YA 5IBLC 4DAGL 1S3KH 3REVA 4AG4L 3GGWA 2GJZA 3N1GC 1IGYA 3STBA 1NGYA 5EU6D 3NMEA 2F53A 5F44A 2DOCA 1T7WA 4M7ZB 4TNVK 5ACZB 4H5SB 5HDLA 3BEWB 3V4PH 1FLRL 2COQA 4PIRF 4MVBD 2YPVL 3VD3A 5E5MB 5E2JA 4X99A 5GZNC 3IETB 3OR7A 4P5TD 1KPUB 2QR0A 3B2VL 5HHPA 1CD0A 1QSEA 3QI9B 3I9GL 4PGDB 1U8IA 5CJ5A 5FUZL 3GJEB 5J11B 4JE4B 4B5EA 3E8UH 2NY2B 2NY4C 4XWGH 5B3NA 3JBG7 2VLJB 2XACC 4ONGL 2JB6B 4NCC2 3BKJH 3BZEA 1BBDH 4KI1A 2JJSC 1RK1A 4RDQG 4MB4A 3VFMB 5GGSA 3MRJB 4EUPA 4PJFA 1AC6A 4ORGA 3VXNB 4OGAC 4ZAKD 3ZKNC 1F6AB 1RZGB 2HRPL 2ZOKB 5B3JE 2AP2A 1JYNA 1LO0L 4H88H 4U1KA 1J1PL 3U7WL 1IBGL 2ZSVB 4I5BA 1EFXA 4JAMB 4UQ2A 2CUMA 4WFEE 4PJAB 5IEKA 4OJFL 4GH7B 4WU5B 5IHLB 3VDCA 2IPKA 5JXAH 3MO1A 3RKDD 4Z5RB 1ZLSH 5F21B 3O6LL 4LLYB 4YO0A 2WP3O 1G7HB 3IFNH 3MBEC 1PGRB 4XNMB 4OIIL 1A7QL 3GRWH 3SDAD 3QEQA 4LIQL 5HHXH 3TNNB 2DMKA 4N8PA 4D9LL 2OL3A 3KYMB 5F6IC 1VFUA 2WIIB 3DETD 1OGAA 4Z7WA 4DN4H 2NXZD 5DD6B 2BP3A 4NJ9L 3PWJA 1TQBC 5A3IC 1CFNA 1M6OB 4KY1H 4ZXBC 5F9WC 3BYTA 4KDTA 5FGSA 1BLNB 2R69L 5KSBF 1MPAL 1QBMH 4HAGA 5EU7C 1SBSH 3MCLL 4LPTA 1IKNA 1MWAB 3P9WB 3WUWA 5HHQB 1CBVH 5IFAL 4LCIH 5I1DA 1HSBA 2YD2A 5IWLA 4RBPK 3BZDA 4FQ2L 5AZEH 3Q5TA 4EUPG 2FCBA 5F1IB 1YEIH 1WVZA 5I2IB 3ZKMC 3QJHB 4PRHD 4I2XB 1AGFA 5HHVL 3HI6L 5FUOH 1KJMA 4YBLB 3SO3C 4IOIA 3ISWA 2H1PL 2P5EB 4R4FH 4LLWB 1XCTA 4S1DD 4WHCA 5CP3H 1L6ZA 3VWJC 4XCCL 1S7UA 2OR9H 4P9HC 7CGTA 2FGWL 4MS8D 5ALCL 1DL7H 5D8JH 1CR9L 2EE2A 4YZFE 3VGDA 1S9WB 4YXKH 1QLEH 4XNZC 2BVUA 3KPRE 2Q7YA 4PJBF 5IHUL 4AH2B 2G60H 4XP1L 2D3VA 4XMPL 1IGFH 4OZHE 1IGJB 3NGBC 4U2YA 4P46D 3MYJB 5HPMB 2NY7L 4KQ4H 3V5HB 3EJYC 4RFNB 3DVNB 2GJ6D 3HB3C 4UV4H 1UYWL 2OZ4H 2DRUA 3MOAH 3FQNB 1GYAA 3SDXB 1JP5A 4Z95H 1A7PH 3FFCA 1JGUL 1K3ZA 4R0LA 5CZXD 3D85D 2VLKE 3U6RA 4PJ8D 1FV1A 5F6HJ 2UWEF 1YQ2A 1D6EA 1EJOH 4K8RD 4HLJA 2JK5A 2CD0A 5EIQA 5HHNA 3T0AA 5FYLH 3WUWG 4BUGA 4P23C 4LPXA 4QXGH 5E2UL 4X6BB 4RMVA 4G6AD 1J8HA 3LH2L 2EEDA 5HVGB 3RWGA 4OLXH 1AKJB 4DEPC 1KB5L 3KVQA 1T03L 2A6JB 1EHXA 3VXPA 4NN6C 3T0EB 4IJ3C 1R3JA 3VXSD 2AABL 4YFLI 1K4DA 3MODL 3DIFB 2V5MA 3D18B 3UDWA 4KRLB 3MV8D 1OTTC 3SDCD 4HJ0C 3K81A 4CVZA 4X80L 1EAPA 1U3HD 4WFFE 1A9BA 1OD9A 1OF2A 1R3IH 1CFQA 3MRIB 1MQKL 1FJ1B 3RZCB 1JHKL 3SY0B 1PVHA 1CU4L 4U31A 5DMIL 3RUGA 1RZFL 4DTGL 4PJGA 1MAMH 1I8KA 2BOCB 5DJAB 2PTUA 2DJSA 4TNWF 4BJLA 43CAB 4ZFOA 2X4UB 1FYTD 2V9TA 3GMRB 2KBGA 2PNDA 1F3DJ 3AU1B 5FKPB 2OK0H 3V4VL 2AJYH 2HJLB 2BFVH 2CDFA 4HWUA 4JY4A 4D8PA 1V3LA 1BGXL 2GKIA 4KJPC 1IAKA 5KG9A 2N7BA 5CHNA 1NEZB 4R97B 1W0WA 4OI9A 5CGYC 3LKNB 2ZG3A 4LARH 4WV1A 1PBYA 4LSSH 4ZFFB 2NY0D 3QG7L 2IMMA 1QYGL 4BFBD 2APVA 2J6EL 5DTFA 1U2HA 4APQB 5HY9B 1F11A 1Q9OA 1UACL 2CR3A 4KJWD 5J13B 4WHTB 1CZ8H 1MRCH 3BKMH 4LSPH 5CCKH 4L3ED 3T77A 5M94B 4XNXL 4PRPB 1RZIB 4OM0H 4RX4D 2IAMB 5IB1A 1JUFB 4HKBB 4XC1H 4P4KB 2FSEB 5L0QB 5INCB 1DJSA 1FLTX 1LEGB 1H3PH 4K23L 5L8KB 3FQRA 5ETUA 1H3UA 4MJ5A 3S3PA 3D5OF 3GRWA 5C92A 1HWHB 5IB5B 4WFGD 1IM9D 2XFXB 3F58L 4XP6H 4M48L 4OZGE 4HPOL 1U8KB 3OF6A 1QLFB 5C0JB 1DFBH 3SE4A 4BFIA 2V2TB 2JJVA 2A74B 4X9BA 4XXDB 5MI0B 1EHAA 5DD0L 4JEGB 1HYRC 1B9ZA 1G9NC 4EBQL 1EEUA 4HJGB 4K3EL 2O61B 4AENA 3E6FB 5I76A 3E2HB 5IGXH 1IAOA 1NGQL 3G08A 3MUGB 4XH2B 4IOFC 4NUGH 1FVEA 3MV9D 5E5MA 1EEZB 4F8QA 3IETA 3O4LD 3EW3B 4AYFA 1AGBA 1K8DB 2VDMH 4LCWE 5FF6B 2QSVA 5D7JC 4LLDB 3BIKB 4UIMB 2EDNA 4ZFZB 2X4RA 1U41A 1R6VA 3GBNH 4P59L 3S4SA 5KTEL 5CD5D 1KCUL 2AJXL 5INDB 5CP3A 2OR8A 5EO0B 4PJDF 3P9LA 4JN2A 4HUKB 4PTTA 3ROLA 3EIFA 5LGKA 2X70B 1UH3A 4K9EH 1JNLH 5FGBC 1UKTA 3O3BB 3QB7C 2BVPA 1BJ1H 4YFLF 5D6CB 2ZSVA 1NLBL 3DWTA 3FQUB 1W8OA 4O02L 4Z77A 4PJAA 3Q6GH 1UXWB 4ODWA 2OZ4A 1KPRA 4OCRL 4YUEH 1DZBA 4OT1L 5CIPB 2R4SL 2Y06L 5B3JF 2YR3A 5T1LB 3WFEH 4Q6YA 2BERA 3C6SA 3ARGC 3BKCL 4JO1H 3CFIC 4B0MM 4A2MA 3C2AL 4J3XA 1S9YA 1G7HA 4LDLB 1LDPL 5GGVH 4U0RB 1KT2B 1IQWL 3L3OA 4XNMA 2VUOA 4I8DA 4MMZC 3MLXH 1V7NH 2Y36H 1G7IB 2XXCB 4NFDA 4G43B 5CD3B 1D9KC 3P73B 1YJDH 1BEYL 5IQ9B 5DD6A 3F7RA 3QDGA 5HVHC 4HUMB 3LHPL 3S4SG 3K7UA 4YHLL 4OLYL 1CDGA 4X7TB 3W2DL 4RWHA 5LG1A 3D2UD 4BELD 4HZLA 1DQJA 3MNWB 3ARWA 3BVNB 4MD0B 5D7LE 1QVOA 3CSGA 2QSQA 1F4WH 1V3MA 1MAKA 2BY0A 1ZGLB 3QDJA 4I9WE 2C1OA 4O2CA 1MFAH 2W9EH 4ODTH 1JRHH 4RA0C 5HYJE 4GKOA 3BPCB 3V5DA 4OFVA 4JFEB 1BWWA 4FTVE 1FAKT 2EZ0C 1Q72H 2QQNL 2A9ML 2Q86A 3QJHA 1Z3GL 2FB4L 5DO2C 1JMXA 3FQWA 4YBQC 2IGFL 2P5EA 4XMLH 2DQHL 4GBXB 4LHUA 4P2RD 1ZHNB 2A9NH 4PJXB 1AJ7H 4JG1L 1GC1C 4J3TA 3SKNA 2FR4A 3DX8A 4G6KH 4LVOC 2IBGA 5EOCL 1LQSR 3UCRA 1U8LB 3RY5A 4HIEB 2XZAL 1M7IA 3B9VA 1XGRA 4G8GB 4ISVA 4PLJD 4IIQA 3V5HA 4UT9L 1BFSA 4YIQA 2PTVA 3MZGB 4CN6A 2PO6D 5I17A 4NWTH 5FV1L 4PV9A 5ITFA 3QG6A 4EI5C 3AM8A 35C8H 3ZO0A 1YEGL 4MAUH 3LEXA 5IVZA 2B1HL 3JV4A 1PZ5B 2VXVH 1G7QB 2IANE 3VE0B 1NFDA 3MLTB 1VFBA 1OSZB 4KKAD 4Q9CA 4RWYH 5JW4Q 4Y7MA 3FN3A 4GG6B 1EBPA 3FN9A 4AIXA 3UTTA 5D1QA 2DTML 2HTKD 1RFDH 4KH2A 2A6JA 4ZS7H 4KJYB 2KUTA 5E8NB 5DZLA 4MLSA 5FA4B 3H42L 2BNQB 2VOTA 3DUSA 2VDOH 5DC9B 4N5ED 1QSFD 1NCAH 4ZO8A 3MCKA 3LN9A 3DV6A 4LHUG 3RRQA 2ZUSA 4U1GC 4ZFGH 5KVEH 3RNKB 4HCRH 3B9KB 4LIQE 3RZCA 3D0LB 4M1DH 4PG9B 5ILTL 5E6ID 2BOCA 1N0XH 4JY5L 2FECL 1TETL 1QP1A 2FD6L 2A83A 1I8MB 2W0LA 4QOKD 4WTZA 1Q1JL 3K2UH 3AU1A 5IQ7L 2VDKH 3EO1A 4MQ7A 1P9MC 3NA4A 5DDHA 3HS0A 2ERJB 4JRWA 5GS2D 2YPLA 4YHML 5KW9H 5KSVA 2R0WH 3BISA 2IG2L 2V2WB 3NOIA 1F3JA 2R0KL 3QEHB 1JHTA 3D0VB 4DCQA 2PYFB 1UM4H 5EZLA 4Z7NE 5ANMA 1HNFA 3TN0B 4J4PC 5DI8B 2I9LB 4JZOA 4XI5C 4M03A 1E6OL 1MCKA 5T3XD 3BD5A 3IDNA 2VZUA 3LQAL 3UJIH 4LLVB 1U3JA 1KEML 3GJFB 3WKML 4X6DB 4TQEH 4N0CD 5EO9A 1RJZA 4FRWA 4J3WA 2WINB 4HKBA 4XCNA 5BRZD 4V2CB 4P4KA 1RUPL 4QRSB 2FSEA 5IT2L 2F58H 2EE6A 4PJIA 2JCCE 3BD3A 2NYYC 4IRJB 3QDMA 3F5WA 1FZOB 4DGVH 4AZ8A 1QRNE 3I50H 1D5IH 1PYWA 4UDUB 3QPXH 1T7ZA 5HGBB 5DFTA 1CD1B 2B4CC 2HT4C 1U3ZA 2XFXA 4HBQA 1QLFA 1J1OH 4MX7B 1KC5L 1OP5H 4OGYL 1I1RA 1L4IA 2X7LB 4LSUH 4WTZG 1QNZL 2A74A 1H15B 2E5EA 4XXDA 2Z92B 4UU9B 2HFGL 5GSVB 1YPZA 1I3GL 3VXMB 1I9JH 2O61A 3SDYH 1DSFH 2FX7H 1VADB 3PHQB 3VD4A 2UYLB 4JGUA 2BCKB 4NFBA 3QZWA 1NJ9B 2DLFH 3GSOB 5C6TL 1FFNB 1K8DA 2P5WB 3QIBA 4Z9KB 3QUXA 4MXQC 4KTYA 1BMGA 2CLZB 4OM1L 2MHAB 4FXGA 1D6VL 3ILQC 5A40E 4A6YA 4HKXA 4N0UE 3CUPB 1CD8A 3D39A 1SM3L 4L1DA 3MRLB 1I3UA 3L5IA 1QHPA 3KPTA 3I75B 1NC2A 1WBXA 5F9DC 1LEKB 4BFEA 1MFCL 2ADGB 5J06A 4JDZA 2EXWD 5B4MD 1CGSL 2G5BA 1UT9A 2BNRB 1FC1A 4YR6B 4Y4HB 3IDJA 5J4MA 4KK6D 4FQQB 1JPTH 3BQUC 4R8WL 3LPWA 2DQFB 3C09B 5JLZA 2NW3B 1OM3L 4H26A 1H9VA 3I3EA 1D7FA 3MRQA 2AXJA 2I9TB 3CSPA 4JRYD 5I30H 1X5HA 2NX5D 4M9PA 1JE6A 4OI8A 4EDXA 4DN3L 2O5ZH 4MSWB 3AY4C 3O2VL 4X0KA 5FV2A 2XTJC 2EEBA 2I24N 3QZWG 3TBWA 3WIIH 3P4MA 4RISH 4CNIA 4F7PB 3D6GA 5BS0B 5CD3A 4UB0L 5FFLA 2IPUG 3P73A 4K3JH 4QCIB 1EXUB 3C9NB 4I0PB 1GGYA 3A6CL 4XNQB 1UADC 2DLHA 4OBSA 4G8IB 1MRFL 4X7TA 1E4XH 2VXQH 3PWVA 5E70A 2IH3A 3MNWA 4HCRA 2Z93B 2R2CA 3O9WD 5I1LB 3FMGH 1YMHA 2XPGB 4KV5E 4AEHH 1TDQA 2B2XH 3VGHA 3V0WH 1DBML 3STZB 3ULUH 1NBVL 5ICXB 1NCTA 5DD3H 3IDMB 5ADOH 1I9EA 3VU2A 2C26A 4JFFE 2W92A 1NUDA 4PJCA 5HVWA 3NCMA 1NKRA 3MGTA 4KZEH 5I6XB 4N0FA 4NN5C 3GFUA 4L8DA 4S0SD 3TO4C 5C3LD 1AXSA 5DVLA 5E9DA 4QKXB 4YHOH 4DW2H 4RGNB 4NPYA 1Z9LA 4HG4K 1CLOH 1N59A 4FQIH 4NIKB 3NAAH 4WIQA 1EK3A 1JZ5A 3D3VD 4UIKL 4C56E 2NXYB 2XQBL 1P7HL 3N9GH 2OXHA 3RX8A 4LAQH 1WIUA 5EIIA 3UPCA 4PLKD 1JGLL 4NKOB 3ARDD 3C8HA 4CADA 2NY5H 1PDKA 1KLFA 1R3HB 4XXCC 5K9QI 3VD5A 3VXUA 1YEFL 4JFHE 3GSQA 1MI5B 4NC0B 1TVHA 1HK6A 1G7QA 3HC3L 1ZHKA 3L6FA 4IRSD 2P24A 1FHGA 2XA8L 3MV01 1CDYA 4GG6A 4E42A 1ZWIA 4WY7H 4O9HL 1WEJL 4JHWH 4JM2F 1QFOA 2VRAA 4N1CA 4HWZA 4F7EA 4NQSA 5C0CB 3VRLF 5BO1L 3R0NA 4KROD 1I9IH 3FTGB 3V5KB 1MELA 5E8NA 5L7XL 2BDNH 3VJ6B 2HFEB 2RIKA 1CICB 2R1YB 3DXAE 1T66C 4P2OA 5C07E 2GT9A 4OFYD 1G6RH 4OSUL 4GMTH 2D7PA 5FYKL 3WXVL 5CBAA 3PIQA 3RTQC 4PG9A 4MA8H 5KS9B 1AY1H 3K8MA 4E41B 2CH8A 5GHWH 2AJ3A 3MLSH 4ODHL 3NZ8B 3TJEL 5TJWK 3AXLB 5KVFL 5TH2A 2CDEA 3MNVA 5JW4N 5E08L 1I7ZA 3E3QC 3T0WA 5L2KA 1AXTH 1TJIH 4IRZH 3U4BL 1T6VN 2DDQH 1BD2A 3WEXA 3QXUA 1FIEA 2HJFA 5D7IF 5A2KH 4PGEB 1KF9B 3LKQA 2H6PB 1Y6NR 1CDHA 5EU6B 5SWZE 1P5VA 4HPYL 3V6ZB 5DI8A 4NNYB 2ENSA 2VMFA 3VFPB 4CVWA 5L88H 5LKNA 3I6GB 4JQXC 5DVKA 1QSVA 1MFDL 3WFDH 4MD5A 4UINL 3TVMA 2HKFL 3VWKC 5B8CB 5LCVL 5DLMH 4NQCA 5MENA 2BHYA 4CU6A 2VDRH 4YDVB 1WT5A 4P5TB 5F6HI 3VFRA 1HHHA 3HA0A 1LP9E 3DYOA 3SJVE 2FIKB 2HWZL 1B0GA 1JIBA 5I1IH 2AGJH 1FZMB 3AREA 4QRSA 3O45B 3QISA 2FJFA 4XNYH 3T2PA 3ARFC 5HYQA 2ZCKL 3P40A 4ZMAT 4GAGL 4LPVA 3BOVA 3IS0X 3CH8A 5DUPL 5B38A 4NN7B 5ENWA 1FDLH 1OQXA 4HFWB 4G9FD 3CZFA 3WIHL 1YEKH 4JDVB 5EC2B 4PRAB 4O5LL 1VEOA 4ALAH 4HV8B 4WEBL 4ZAKB 5IOPB 1H3WM 4GO6B 2LU4A 2L0DA 4FFZH 2Y1VA 2D4DA 1SEQL 1V7ML 3I6KB 4CAGA 3P0VL 3KPLA 1JNHA 2IPUK 2FLBT 4JRXA 5DQ9B 1J0IA 5E24E 2B5IC 1BOGA 2F5AL 2JJWA 4H1LH 5JPNA 4HWBH 3O2DH 5L6YH 4Q7DA 1GZPA 3VD7A 2HT3C 1JZ3A 3NZHH 1PSKL 2O5YL 2XN9D 5F9JA 1IEBA 3ZKND 1KJ2L 2CLZA 1U8QB 3SDAB 1MCIA 1WZ1H 2AQ3A 3CMOL 1TJGL 2O5XL 4NBYB 4X4YA 3VXOA 4TOYL 1XT5A 3FONB 2NXZB 3X13B 7FABH 3MJ7A 1JPSL 3MLYH 4HIJA 1S9VB 4FG6D 1YMME 1CFTB 4E0RB 4XT1C 2LU7A 5EWIL 3MBED 1N5AB 5CUSL 3CDCA 1B2WL 4K2UH 5BOPA 4M7JL 2Q8BH 1AR1C 4FQQA 4L5FH 4TYUA 5JQ6H 3HUJB 4Y4FC 3MJ9L 4UOW1 1T89C 4WEMB 3QWRD 5EO1B 3BDYH 3RJDA 2A38A 5BOZG 1WQVT 1OAYL 5A3ID 4PRHB 3X14A 4ZXBD 3AS3A 4JFDD 1KYOJ 2R2BB 4OUUB 1EEYB 5DK2A 4YX2L 1IJ9A 4LASL 1XIWC 4WI3A 5C9KA 2AK1H 2RHEA 2D7QA 2R2HB 2K1MA 2UV3A 5BS0A 3TYFB 5C0BD 4AIZB 4GW5B 2W65B 3HC4H 1DQLL 4WUKH 3W9DB 1CF8L 3K1KC 3WCYA 4P46B 4YHNA 4XNQA 4ZOCA 1G6RA 3F6IA 2GJ6B 2V9QA 5IVXE 4UTAL 2LVEA 4G8IA 4K7FB 1QFUL 5D1XC 3VWJD 5FO7A 3GSUB 1U58B 1FNEB 4LLUB 1U6AH 2X1OA 2XPGA 3WD5H 3SGJC 5J89A 4X7SH 3D85B 1I1CA 2J8UF 4CVXB 3STZA 4PJ8B 4NNXB 1FL5B 4L4TB 4MNGB 5B39A 4R6UA 1YDPB 3BIAX 5CINL 4KHTL 4ENEC 3HB3D 1M4KA 3RDTD 4ESKA 3MCG1 3GB7A 2GITB 4KTDL 2UWEA 5BMFL 3DSFH 4OCYL 3O11B 1N5YL 4F57L 3VXSB 4M7ZC 4DKEL 2FJHA 2DJUA 1BVLA 1DUYB 1PZUB 4LKCA 3MV8B 3SDCB 1T83C 4JFXA 1U3HB 3H9ZA 4DQOH 5FYJL 1WBYB 5FB8B 3OXRB 4WGVB 3ZDXE 1FE8L 43C9A 3MRNB 1VGEL 1UJ3B 4P5MB 3QI9C 1RK0A 2V17L 3EYOB 4WI8A 4L4VD 3QQ9C 1J0KA 3CFDA 2CRMA 4GUPB 5JW3H 4Y5VB 3RGVA 1QKZL 1YEJH 4HJ0D 5ISZD 5J3HD 4S1QH 4CUCA 4MAYB 1ITCA 2OJZH 4UOW0 2CKBL 4JZJA 3B2UC 3G6DH 2BOBB 4XBPB 1OCWL 3HFMH 4FQHB 4J3SA 4KHXL 3HNSL 3STLA 3L3HB 5IHZA 3LQZB 2NY0B 5CLTA 2MCG1 3C5ZD 5C0CA 5B39G 4Q2ZA 3V5KA 2ARWA 4O2FA 3VJ6A 3S3SA 2VTFA 4JJHA 1KBGH 5EFIB 3FOMA 4L3EB 3UO1H 3MREB 4HT1L 5HPOA 2G2RB 2ESVA 2R8SL 1L0XA 4H1LA 2OJEB 5CGYD 4HWBA 3O2DA 4PJHE 3MJ8A 3KHOA 5DJXB 2DQUH 2QTEA 4QRRE 1DVFB 2GSGB 2OTUB 3C5SB 4LGPB 4LLMA 1ZT4B 4F7MA 2X4PB 2IJ0C 1ZGLM 1UCBH 3AXLA 1NCWH 3RWCB 4F7CA 1LNUA 1RUQL 4PLOB 1JNNL 1U9KA 1IM9B 2VWEE 4OLUH 3PQYA 3OGCA 1D5XB 4JKKA 3H3PL 4OD1L 3JSSA 1BF8A 3VGAB 1KG0A 4ZUWB 5KVGH 2YC1A 3EGSB 3RU8L 1IL1B 1BVKB 1FORL 5CLWA 1WIPA 2LTQB 2ED7A 1UA6H 3JWDL 4LGSB 1YN6B 4RRPA 5IMKA 5I15L 2H9GB 3RIFF 5FO8B 4LHJB 3MV9B 5T33L 2QSCL 4TRPL 5JMRA 3O4LB 2EH8H 5I1GH 2XY2A 3C60C 2YSSA 4WDIB 2GSIA 4U7KA 2VIRB 5IMLB 3U4EA 1Z6JT 3PP4H 2YWZA 4JVUA 3KPOA 1AIFB 4K94H 4D9RE 5F93C 1OP3H 3NCBB 1VFAB 3KDMA 1CIUA 2ZCLL 2RBLA 1MFEL 3K2MC 3KPSA 3O6MH 4JO3L 4WFED 3IFOA 3BPNB 1FP5A 4CW1A 5ICZA 4P2QA 3S97C 1T2QH 1IFHL 4M8QB 4H1LG 4IOFD 1FNGB 3BRGC 5FHBL 2IALA 2FH8A 3CZJA 1E27A 4DVRH 3PL6A 1TZHA 5DXWA 3WO3B 4PJDA 3MRHB 5IOPA 1W0VA 1ZEAH 3LRSA 1LMKA 3GKWL 1X5XA 3KS0H 2VR9A 2VZ3A 3PE9A 1II4E 4NRXA 1L7TL 3QWOB 3C8KB 3INUL 3QIWC 4D94A 3VH8B 2AVGA 3BH9A 4XVTL 5DWUH 2CXKA 1P5UA 2FLRT 4EN3D 5H37H 4RRPG 1OTUC 4I77L 2EO1A 4NRZB 3IGAA 4FABL 5IM7B 3UYOD 2JKXA 4KWUA 3DARA 5KSAC 3D25B 1JZ4A 3FO1B 1C12A 4JFZH 3T0EC 5HXMA 5GS0H 4ODUA 5FYKE 2OL3L 4L8SB 2DQEL 3BZFA 3GI9L 2E27H 3QUMB 3ESVF 2DQIL 4FQLL 4QRPA 1S9VA 2NZIA 3D2UB 5FECB 1KCVL 1ZVHA 2ZG2A 4EXPX 5SWSE 2BSSA 1ZS8A 1CT8B 2BVQA 1C16B 4Y4KD 5TF0A 5IIEA 4AT6B 4RAHA 1YNLL 1CD9B 1JF1B 1D9KD 2CIIB 4BZYA 4NO2A 3KPRD 5I1JH 2N1KA 4XPGL 4XVUD 5DK0A 2VJXA 4YLQT 3VFUB 1T2JA 2XYCA 1KNOB 5GIRB 5E8OA 5I16B 1T5WB 4HGWB 1K3IA 3QFDB 5IK3B 3FN0L 4M3JA 4P2RB 3WHE1 4XZUA 3RA7L 2MCPH 4M7KL 3WXWH 3NABH 3LKOA 2AXGB 1ZHBB 3HZKB 1I7UB 5IMMA 2YD4A 3I02B 4APQC 2VLKD 2X89A 5F7DB 5DK3A 2DF3A 3VFTB 5DR5H 3SPVB 4OFKA 2EZ0D 1LO4H 5HGDA 4RMSA 1NKOA 3LS4H 4CN4A 5EOTA 2W65A 4OZFH 5DO2D 2R23B 2OI9C 1HKFA 4YBQD 3TCLB 1NCBL 1MJUL 3L3DB 3RVVC 3VRJA 4CU7A 5I19H 1DLHB 3CLEH 3OJDB 2HH0L 3RL2B 4ELMB 5L0QC 2PO6B 2I5YH 1DR9A 12E8H 4NM8H 2X2YA 4WJ5B 3J8F7 1JPFB 2F54E 4TN9A 1G7JB 2UZIH 3DTXA 2NMSA 4IMKA 4I3GA 2YMXH 3QQ3B 2DMCA 4J3OC 3QIUA 1P7QB 3KNBA 4PJ8A 2FZ3B 4L4TA 4ZO7A 4WFFD 3JTSA 2DQCH 3GMMB 1RUML 3HR6A 4W81A 5F7EL 1I1FA 4NZDA 5HHOE 1LO5A 4PJ9C 5MI0C 4YDJA 1TVBA 3RWFA 1ZLUH 1JGEB 4HUXB 1ADQH 4PTUB 1S3KL 1ED3A 4YNYB 2ICWI 3O11A 2OS7A 3G5ZA 3O81A 4NO0A 3TJHD 3U4AA 4P48A 1H8SA 2XA3A 5C0AE 2F9BT 2C3WA 3SDCA 1QSFB 1PG7H 3TF7C 4LCYA 4M00A 5FK9B 4I18B 3OXRA 5E1AB 1QO3B 2G9HB 3V4PL 3VRIA 5DMGC 1Q0YH 2MKWA 5E6IB 3VA6A 1UJ3A 4TNWK 4Z8FH 1A6UH 3N1PC 4Z7UE 4QOKB 1WC7A 3ZKSD 1RV6X 4R7DB 1FFPA 2RAMA 5IB4B 5FUCE 3ZDXF 4WVRA 3WLBB 3E6HA 1MCDA 15C8H 4ZUUA 3E8UL 4N9GB 2C1PB 4XWGL 2NY3C 3VFGH 3HR5A 4NDMB 4G7YH 2O26U 4MAYA 4F33B 3GMQB 4NQEE 1Z5LB 4X83A 5C0ND 2HMIC 3O3DA 1M7DA 4P5KB 3BKJL 1BBDL 2I07A 2JIXA 3GSVA 5EB9A 3LQZA 3QHFH 4NHUA 4HK3J 1XAUA 1EPFA 4ONHA 4GOSA 4P4RA 3NCJH 2X4NB 4YC2B 4Y5XB 2QHRH 3KYAA 4H88L 2AV1B 2YPKB 1NUNB 3QPQD 3MXVH 3C5JA 1A5FH 1ZSDA 2P42B 4G42A 5BRZB 5EUOB 1CG9B 4QWWC 1J10A 5AG9A 4MD4B 5JXAL 4J4PD 4U0RC 1DVFA 4PG2A 3TA3A 1ZLSL 1HCFX 4XI5D 1ZT4A 3RGHA 4I1NB 5F71A 2Q6WB 4RNRB 3IFNL 3VDBA 1NGXB 1I8LA 1FZKB 3RWCA 1ES0A 1AP2B 3HG1A 2VKWA 3GRWL 3BUYA 3BT2H 4PJHF 3TEUA 5A43C 3WHXA 5HHXL 3ET9F 1T22A 1EVUA 3BMWA 1BWMA 4LCWD 3EGSA 2HN7B 4DN4L 4YAQB 1GPOH 2VLLA 2X4QA 1ONQA 4KY1L 4GAFB 3ROOA 1YN6A 3LKRB 4KKLC 3WFBH 1I8IB 4XHJC 4M5ZH 4MJ4A 3D69A 4KDVA 1QBML 3VXQB 3U0TA 1SBSL 3RY6A 4YXHH 4E5XB 1DE4A 1CBVL 4NNPH 3MV9A 4LCIL 1F45A 4QTIH 3QEUB 1RY7B 4ZQKB 3DROB 4U1SA 1ZLVK 3ECBA 4YXLH 3KPMB 3QXDB 5AZEL 4PJ7E 2FJGA 1EO5A 3D9AH 5GRYA 2VISA 1YEIL 5D2LE 1CGWA 3ARBD 4MNQA 3CPLB 4GBXC 3SN6N 5E5RB 1ZHLA 4YHZH 3NCEB 1A6AB 1H8OA 5FUOL 3EOYG 1BQHA 5FYJE 1JV5B 4R4FL 1BIHA 4L9LC 4X4XB 2X1XR 3W0WE 3GSWB 4PREA 4LOUC 2OR9L 3VCLB 1VGKB 1GGTA 1HKLH 4LLAA 3I6LE 5H37G 1DL7L 3OB0K 5D8JL 4MXQD 4YXKL 1FG2B 1QLEL 4F37F 4ZPTA 2G60L 3ILQD 4OZFA 1IGFL 1U95B 2HFFA 4NRYA 2VL5B 4KQ4L 3ZSSA 1MY7A 1GAFH 1JWMB 4UV4L 4XTRC 2H45A 2K3TA 2OZ4L 5BV7B 3ILPB 4GLRI 3MOAL 4AM0B 4NKQB 3EAKA 1OT2A 3O6FC 1VACA 4WI9A 3HKFA 2IWGA 4QXUH 4JRYB 3SBWA 4Z95L 1A7PL 4U1MB 5I66A 2IFFH 2IH1B 2IF7A 2YA0A 1EJOL 1MOEA 2R1XB 4HGMA 1ZXQA 4MGXA 5D7LD 5FYLL 5CJXC 5HD8D 4I9WD 4HWNA 4KRPC 1RZKH 3BQUD 4MDJA 4QXGL 2CRZA 3T4YB 3T65B 1VDGA 5HYJD 1ADQA 2BVOA 1V8HA 3IFPA 3DUHA 4WI2A 4OLXL 4FTVD 5DC4B 3UTSE 1DUZA 3DO3A 2HVJB 5C70A 1AO7E 4PRBB 5IBUB 4XCFH 3HE7A 2CO6B 4CGTA 1KPVA 4MJ2A 1R3KB 1WCBA 4OD3H 1BQHG 4DVBA 4OQTH 5J1AA 1OGTB 5ID0A 1E4WH 1P1ZA 4PRNA 1R3IL 3O9WB 4Y5YC 4QHUA 1S7VB 2KH2B 2PW2A 2YD6A 4OAWA 1MAML 2CIKA 4Q9QH 2X40A 2CIIA 5BVPH 3C08H 2DWEB 3QNYB 2H8PB 4OZFG 2OK0L 1VENA 2AJYL 3E1F1 4LF3A 5C0DA 2BFVL 4Y16B 1GH7A 2F53E 5D1ZA 4HGWA 4MDIA 4JGMA 4IMLB 4LARL 3MRFB 1NH6A 4DZBA 4LSSL 3QCUH 3L5WB 3CAFA 3BYYA 1R3LA 2IAND 2MNUA 4WO4B 3VFTA 3WNLA 3DHJA 3SPVA 3D3VB 1QSEE 4G3YH 2UVFA 4RZCB 4LCCA 4OZIF 2J2ZA 5IJVB 5DJ2B 3OX8B 2R23A 5E56A 1F00I 1CZ8L 5C8JA 1J12A 3H9SA 1MRCL 1UVQB 3EO0A 2AABH 2P49B 2VABB 3BKML 2VZVA 4LSPL 5CCKL 1DLHA 4ELMA 3ARDB 3G6JF 3BP4B 4BK5A 4OM0L 5GZOD 1JPFA 4XC1L 1FG9C 1M71B 4JR9H 2OTWB 4TVPH 4YE4H 4KPHH 5FUCC 1LD9B 1H3PL 1HILB 3QQ3A 3U48A 1ZE3C 1P7QA 2GTZB 5DD1H 4IRSB 4PJFE 3TBSB 4GRLA 4CMMB 5I0DA 4HKJB 1NGWA 4JO4H 1UEMA 4XP6L 4BYHA 3MNZB 4WW2F 3BESR 1DFBL 4HX1B 5DJCA 4I3SH 3RWHB 5DSCB 4KROB 5FGCB 3BN9D 4EJ1C 3BP6A 4MA3B 3QNZB 4LQFH 1UXSA 1KN2H 4JM2A 5C6PB 3RWJB 4JY6B 4HDIA 3AB0C 2Z31A 1OP3K 1CI5A 3OKMB 5IGXL 4Y88A 2BMKA 3RBSA 4NUGL 3QEQE 1UQSA 1RHHB 1C5DB 1KB9J 1A21A 1I3RB 3FT2B 1HXYB 3UAJC 5BJTB 1OB1A 1PEZA 3IDYB 2VDML 4FFVC 2Y25A 3KAAA 1OGAE 4Z7WE 3IJYA 1HOCA 3BP7B 1XF5A 1H0DA 4BQBA 2F19H 3GBNL 2H41A 5DGRA 1A6ZA 4NDMA 4MWFB 3VD9A 1HDMB 4R9HA 1RMFH 1IC7H 3BPOC 4UTBH 5D5MB 1YN7B 3EOAB 4Y4HC 4D0DB 1MJ7H 1G7PB 1QRND 1NBQA 4K9EL 1JNLL 1TCRA 4ETQB 4LRIA 5D7IA 1NDGB 4XBGA 4NSKA 4PJEA 5CP7A 4I4WA 3IDGA 2YPKA 4QNPF 4PBWD 2FRGP 3CFJA 5HHMB 4Y1AA 2OQJB 2NCMA 4MJIE 4X9GA 4LEOB 3Q6GL 1U8OB 1UFUA 5IJKC 2WM0A 4GRWE 4YUEL 2D0GA 4QY8B 3KLAB 1RUKH 1CG9A 2YA1A 3CU1A 1C7SA 1HQRA 3HC0A 4JPKH 3WFEL 5D7SH 4TSBH 1D3CA 4JO1L 2IADB 1HHIB 2KKQA 1F3DH 3QUZC 3FB6A 4RNRA 1RZ7H 3VWKD 3GMNB 1VPOH 5GGVL 5AG8A 5C9JA 4HW6A 5JMOC 3BGMA 2XY1A 5IP4A 1F42A 1HH9B 3MLXL 4HBCH 1V7NL 3TBTB 2Y36L 2EIBA 3FB7A 3OPZH 4G9FB 4M6AA 3H3BC 1A2YB 4WGWB 4LQ1A 4G8FB 4I0PC 4XPFH 4P49A 1LEIB 2Y5EA 3EYFA 3IXAA 1VHPA 1YJDL 4IEFB 5C0FB 3IXTA 2XQYK 5KSBB 3FFCE 4JFOA 1BECA 2OMNA 1T0MB 3LKRA 1S7XB 1UWXH 4OQTA 4QO1A 5C0EA 4F9LA 3VXQA 1DBAH 1IGIH 1Y0LB 1HHJB 3PXJA 1F4WL 2WBJA 1J05B 4CL7A 3U36B 3QEUA 1MFAL 2W9EL 4ODTL 1JRHL 2XN9B 3WN5A 2C4FT 1PKOA 2B8OT 1Q72L 4QHLB 1F3RB 4U6XA 1ND0B 3VG0H 3RVTD 1G9MC 4CDGC 2BZDA 4M3KB 4XMLL 2APWA 5IFJB 3X12A 2A9NL 3CJJA 1NBZB 1AJ7L 2HT3D 4WCYH 1MSPA 1P84K 4HQQH 3RUGE 4G6KL 3ULVF 4PJGE 3G5XB 2NXYC 4KTEH 1CFSB 4M61B 3MBEB 4PJBB 1KIQA 5H94A 1F4HA 3WFCH 1DEEA 5IG7A 1I7TA 1A1MB 5IESH 1WAAF 4JHAH 5IB3A 2VL5A 2GUOA 4G6MH 1JWMA 3O8XC 1DBKH 1NCCH 4DUVA 1JWSB 5A2JH 4W70A 4NWTL 1TQBB 4ZXBB 4J1UB 35C8L 3JWDC 4JFDB 5F9WB 1ZLUK 3H7BA 4PGBA 3AS1A 4MAUL 4PRIA 4NYLB 1EFQA 3OKOB 2XZCH 3VG9C 4JPVH 3CC5A 2VXVL 2X9YA 4Z76A 1Q9KB 5HGGS 5FEBA 1SJXA 1YA5A 3V6OC 3PDDA 3ELAT 4RWYL 4MA1B 1AR1D 5L8LB 1AGEB 3JUZA 4H20H 4Y4FD 3T4YA 4RIRA 4JQIH 4CJ1A 3LMJH 2DQJH 4NCC1 3JV6A 1HCVA 1CICC 1JPST 1KCRH 5C0BB 1RFDL 1L0QA 4JFFD 4ZS7L 3MMEA 3AMKA 2DM3A 4BH7A 3MA7B 3SO3B 2VDOL 3DPBA 4BSVB 1NCAL 3BH8B 3EDJA 3VWJB 3RVUC 5TFSH 1SBBA 1OGTA 1YZZA 2N56A 4ZFGL 2Q3ZA 5TDNA 4AQ1B 1KXVC 3SGKA 5K9QG 4HCRL 5KVEL 5DMKB 1GOHA 1S7VA 3UEZA 4M1DL 5FO9A 1S7TB 1S7RA 1N0XL 4XNZB 4RDQF 3FO9B 3NGBB 5T1MA 4C56D 4JGJA 3K2UL 1X9QA 1C5BH 2VDKL 2IBBA 3U2SA 2H3NB 1YUHB 2VR5A 4HKZB 1DLFH 4Y16A 4TPRH 3X11B 5KW9L 3RDTB 2J8UA 2R0WL 3TBYA 2A6IB 4MB3A 1PG7W 2CUHA 2X1PA 1A9EB 1U8NB 5HI3C 3A6BH 4OF0A 4X7CC 4WRLA 1UM4L 1MCRA 3WLWC 4JFHD 4MVBC 2DIAA 2EIDA 1BFOA 4WO4A 1OP9A 4P5TC 3K4ZA 4KJQC 4LSVH 3D3VA 4R96B 4KVNH 4ENED 4QXTA 3UJIL 3KYOB 1WISA 4TQEL 2HJKB 3DSNA 4MNHA 4BZ1H 4DEPB 3DOSA 4L4VB 3BP4A 4NN6B 1F4XH 3OHXA 4OF6A 3GIVB 4LPUA 3U79A 3DXAD 2F58L 5F8QC 2FNBA 5C07D 5IBUG 5ISZB 2VLRA 3V6BR 1UWGH 1MUJA 4U1IB 3RVWD 5JO5B 4KDTC 3BD4A 3JWOC 4DGVL 5SWQA 3I50L 1D5IL 1QA9B 4CMMA 3QPXL 2YD3A 1IKNC 4HKJA 1CTOA 3Q6FA 1N2RB 5F7KC 4ZAKC 1J1OL 1XF4A 2CR6A 3V6FA 3C5ZB 4PJAE 4BFGA 3QQ9D 1K8IB 4LSUL 3WDJA 4FQXA 5TDOA 1DANT 3QNZA 3H0TB 5DEFA 4GQPH 1A0QH 3KJ4C 3TZVA 2A6KA 4LVNB 1ZT7A 3WYRA 4JY6A 1RVFH 3UTPE 1I9JL 3B2UD 1JBJA 3SDYL 1DSFL 2FX7L 3F12A 2W07A 1WTGT 1PY4A 5FYLE 4P9HH 4H8WC 1F5WA 3VFOA 4MCYB 5H2BA 5HI4C 2DLFL 5SWZD 4NZUH 1I4FB 1FL3B 1QFWM 1KIRA 2CLRB 1TZIB 2E7LA 2XWJB 1ORSB 3QDGE 4S1RH 2NXZC 4CJ0A 5E1HB 3VI3E 3SJVD 3IF1B 4PB0H 1KXQE 1KJ3H 2L7UA 4TULH 1B3JA 2D03H 3UYRH 4HH9B 5DHVB 3WS3B 4XB8A 2GTWB 3FAXA 4NKMB 3QDJE 1EV2E 3DGGA 2GJJA 1S9KC 4R0LC 3SDDC 4Z7VF 2J4WH 4J23A 3FKUS 2R0ZH 4UAOC 1O0VA 3T1FA 1Q9LA 2I27N 2WQ8A 2OQJA 1JPTL 2XWTA 3TP4A 3HE6D 3PWNB 4YHPA 4B7IA 3MRDA 2P5EE 4YPGB 4BH8A 4OD2B 1GGUA 3KLAA 2G5RA 1M05B 4GQ9H 3BE1H 2YEZA 3PGDA 3SE9H 5I30L 3L3IB 3UDWC 2MKLC 2O5ZL 3QFJA 5LAXB 4GRWF 4KMLB 5DJ8A 2J3SA 1HH9A 3TBTA 3C60D 3WIIL 3U7YH 4RISL 3L5XH 4PY8I 2A6DB 2EDWA 2BSTB 4K3JL 4JPWH 2Y9RT 1U93A 1HYSC 3OB8A 4TSCH 5JOPE 3OKLB 1BVZA 1XGPB 4XPAH 3KLDA 3NFPA 1E4XL 1NFDE 2VXQL 5CZXC 3MJGX 1WZKA 1HH6A 4PD4K 4U2ZA 1N7MH 2X10A 4S1SH 3FMGL 1YMMD 3S8WA 2BSED 4B7LA 4AEHL 1C5CH 4K8RC 4WV1C 1NUGA 2B2XL 3UTTE 4EN3B 2QQQA 3V0WL 1LE5B 1CDUA 2VXUH 2XN9A 3ULUL 4MZ2A