3OZ9L

Crystal structure of anti-gp41 fab nc-1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
211
structure length
211
Chain Sequence
QIVLTQSPVIMSASLGEEITLTCSASSSVSYMHWYQQKSGTSPKLLIYSTSNLASGVPSRFSGSGSGTFYSLTISSVEAEDAADYYCHQWSGFYTFGGGTKLEIQRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab NC-1 kappa light chain
publication title Crystal Structure of anti-gp41 Fab NC-1
rcsb
total genus 52
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2010-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oz9L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oz9L01
1FJ1B 5CD5C 2MHAA 1BQUA 1H0DA 3D39D 4NQTA 3UMTA 2F5AH 5LCVH 3E8UH 5KJRH 3NBNA 1TXKA 4KHXH 1PD6A 5AYUH 4PD4J 1CFVH 1U8IB 3DIFB 3QQ3A 2ZJSH 3ZO0A 1W0VB 4JDVB 3VXTB 4Y4FA 1QBBA 4LOUD 3TBYA 2YUXA 5DEFA 3VXSD 3HG1B 4WU7A 5IGXH 2ERJB 1IJ9A 3QT2A 3ZTJH 5ERWA 2R39A 2NW3B 4H1LB 4U7SA 3ULVH 4YNYA 3MA7B 3BIKA 1OARL 2F53A 3HZKA 3RNQB 5EUOF 1KPUA 5KSBB 3ZSTA 3SGJA 2IH3B 2Y6SD 5C07B 5E8DL 2Q8BH 4D3CL 1P7QB 2D9CA 3NZ8A 5IVXB 3ARBD 2X4SB 5ANMA 4L3AA 2BSED 4L8DA 5DGRA 3RKDC 5DRZB 2Z35A 5HYJE 2FR4A 3MXVL 4PJDF 3H9HB 4FQJH 3VGAB 3FOLB 1FH5H 4NO3B 4G8EA 5IR1A 1G6RB 4PREB 5DGQA 3NCFB 2Z93B 3JWOL 3S4SA 4EDXA 4KGJA 1BZQK 1WIUA 5FA4B 1E4JA 1RV6X 3EYFB 2W9DH 4MSWB 4WWKA 4LLMA 5C0AB 4ZXBC 1I75A 1JHLL 4X4ZA 4YHIB 4DN3L 3SKOA 4J12A 1TZIA 5EU6B 3WLBB 1MFAL 4DOHB 3OAYK 4TTDC 4W68A 3BN9C 4G8FB 2FHFA 4MS8D 3DYOA 3VXME 3VFSA 5F1IB 3QDMB 3MGOA 3A6BH 1ORQA 1JFQL 5F3BB 3MRNA 2C3GA 4RZCA 5E4EB 3V4UL 3EOAB 2HA1A 4YPGB 3KPSE 5DUMH 4JZOB 3T2PA 2ZG1A 1RI8A 5MERA 4PRID 3QSKB 1WIOA 1SEQH 2VWEE 3U2SB 5D7JA 5TE6H 2EYRB 1PKOA 2VH5H 1YYML 3JWNC 1N26A 1FZOB 1X5YA 4NWTL 4S1QH 5IM7B 1YEKL 5CCKH 5KOMC 3UO1H 5EU5A 1A1OB 1AQKH 5C0BA 2AXJA 1BMGA 3IJYB 3C5ZC 2I9LB 3O0RL 3ZKSD 1WF5A 3EJYD 1R3IH 5BS0B 2A0LC 3U9UB 4GUPB 1BD2E 5F9AC 5DMYA 4XTRC 1WQVT 3SKNB 4E41A 2A73B 3HMXL 4RGNE 3UPRB 1A1MB 2AK4E 1J8KA 4MXVE 1Y6MR 1CDYA 1K4DA 2NYYD 4X98A 2ZNXA 3P4OA 3O3AB 3ZT7A 1YY9C 3NTCL 2IFFL 3STLA 4PGZA 1HHKA 3WD5H 1BFOA 5E03A 3FTGB 3KPOB 4DVBA 1OGAA 4UUJA 4NRXB 4AJ0A 4OLUL 4I0PB 4U1SB 1AXIB 3K80A 2PTUA 3T0EE 1AR2A 3B5TA 2XZQH 4X6FA 5DJZB 1UACH 4GKOA 4O5LL 5JXAH 5L2KB 4HBCH 2A6JA 3IFOA 4IOSD 3VD5A 2DIBA 4JO3H 4JB9L 4WFFD 1UG9A 4RCAA 1I7RA 1DE4A 1Q94A 4LVOC 5TF0A 2LFGA 1BQHA 25C8H 3PG2A 3QHFL 1AY1H 3MUGB 4HX1A 1HIML 3L3IA 2VZVA 4O2FB 4XCNA 3ZYJA 2CLRB 2GHWB 5IESH 4NQVB 3PNWB 5I0DA 2NY0D 5J11C 3FQUA 1G7HB 2PO6A 4HHAA 3ILQD 3PWVB 2DDQL 3IFPA 4JPWH 1QFHA 5CZXD 4G8GD 2VL5B 1C5BH 3TIEB 1ES0A 1AXSB 1NGZA 2RAMA 2H9GA 3AM8C 4LAJH 3UJTL 5ADPL 4DTGL 4NQEB 2ADJB 4FMKA 1KTDA 4ODHL 2F8OA 2VQ1B 1GCFA 1U91A 2FBJH 3X3FL 1SM3L 3QUXD 4GAJH 3WL9A 2DD8H 3IDMA 3VFRB 4WFED 1KB9J 3M8OH 2VLKA 3PUCA 2DBLH 3U48A 3W5NA 4Q9RL 3HA0A 1JUFB 1A6ZB 3WFHB 4ODTL 2WANA 4JKWA 2BXYA 2Y5TB 1AP2B 3FL7A 5GGRA 3O4LD 2E7LA 4HUUA 4DKEL 5FAAA 3CX2A 4UTBH 3OKLB 3W9DA 4BZYA 1EH9A 3VI4F 1IGJA 3L5XH 3ZSSA 4ZSOA 1J18A 2DQGL 5MEND 1SJHB 1W8OA 3NVQA 5KZCD 4K3EH 2NY3B 3TYGL 1XGTB 5K9OA 2VDML 1QO3B 2Z31C 1A9EB 1V7ML 4BQCA 3B2VL 4PJ7F 3MXWH 2DQUH 2ADFL 1N8ZB 1JIBA 1S9WA 1U36A 4E5XA 2HN7B 1F45A 1MFDH 4EI6B 3ZT5A 3U7WL 1JZ7A 1N2RA 3MYZA 2GT9A 2X1PA 3MO1A 3GKWH 2VDRH 5IBTL 2VN4A 4XVTL 2V6HA 3KR3H 3CSYA 4XRCB 3NPSC 3MCKB 3IJHB 3GDBA 2NY1B 4MJ2A 4FA8A 4PJ5E 1NUFA 3IDGB 1WAAA 4OLZH 4OTXH 3AS3A 3GO1L 4QHLB 4XXCA 5F97E 5EIIB 2FH6A 1HOCB 4LQFL 4AIZB 2YRPA 4Z6AT 4M6OH 2J8UA 1CBVH 3LEVH 2UWEF 4JQIL 4P2QB 1JPSL 4YDLC 5DQDH 3VGHA 1T7VA 5LJYH 5EBMB 2NXZB 4D0DB 1A6VL 1K6QL 4O58H 3PJSB 1U3HB 1UM4H 1BBJA 2EH7H 4YHOL 3UAJD 3G6JF 1AI1L 1PG7X 2VYRE 4U6HB 4EJ1C 3LSOB 4H25B 4U3HA 1A3LH 3X11A 4YIQB 3CUPB 1KF9B 3TYFB 1T21A 3MLSH 2LE9A 3BZFB 3OKMB 4P2OB 5DMIH 1MCLA 4HF5L 4XP9L 4H8WL 4XI5C 1CFTA 4WW2A 4R4ND 5J9PB 1TZGL 2EIZA 4YHPB 1UXSB 1L0XA 2BDNL 5C0RL 4JM2B 1ZA6A 5GGSA 4KH2A 2DJSA 4WHCA 4JFHE 2AJZB 3QNXA 2WQRA 4FQ1L 5HVHB 4JGMA 1K3IA 5TQ2H 5GRVL 5D2LB 1GC1L 2PCPB 2X4OA 4OKVB 5E2UL 4Y4HB 4FABL 3AGVA 2ATKA 4I8DA 4H26B 5E00A 4UT6L 4K3JH 3Q3GB 4FHBD 1S9KC 4WO4C 4PB0H 4TPRL 1Y18A 1UYWL 3RY6A 4HSQA 5C0CA 1YEFH 3SDDB 4ODXB 5EOCJ 4M1CD 2LU4A 3SE3C 1EFXA 3LDBC 1RFDL 3MRBB 4RFOL 4OZIA 3CU7A 3LB6C 2F15A 4OGZA 4Y16A 3HC3H 1KJ3H 1WFOA 4HUNB 4WTZG 4YBHA 3U82B 3V6FA 4Z7NF 1W72H 2FIKB 5H8DA 2V2XA 3QEGH 1OM3H 4MCZA 4P5TC 2HLFC 2IAMA 3VD9A 3QG7L 1CXEA 2IWGA 3W11C 2R8SL 4FQIH 1N64H 1XR9B 1ZHLB 4HIEA 4QTHB 3TM6A 3VDAA 5FUOL 2I27N 4ZG1A 1MJ7L 2R23B 3D39E 2B1AH 2ZP0T 1DQLL 4Y4KB 3V6OE 4EI5D 4XGZB 5GGRY 2P48B 3NOIA 4NWUH 4MWFA 2WIMA 2R0WH 4NC0B 1T0MB 2RR3A 3KDMA 2HP4A 3P30L 3BE1H 4RAVB 1L7TL 1BQLH 3ZDZE 2AEQL 2DI8A 1MFCH 3QIBD 2AGJH 4R0LC 3VXSE 2BVPA 4F37F 1FV1A 4AYFA 1K5NB 4N8VA 5ID1A 3MRJA 4QOKD 2CR3A 4K8RD 3DRQB 4J1UA 2VWEC 5HHOA 5J1AA 1E4KC 1MCDA 2VMFA 3PDDA 1Q38A 1EUTA 5DJAA 1AE6L 3U30B 3E6FA 2HT2C 1FN4B 3B9DA 3UCRA 4DCQB 2X1QA 4F2MA 4R7NA 4YWGL 1EZVX 1F6LL 3KPMB 3RWFB 4EXKA 5GGTH 4QYOA 4Q6IC 5TPWL 2V7NA 1NFDA 1A3QA 2Q1EA 4NQDB 4RGNC 3V4VH 3VGEA 3X3GL 5C3LD 5F44A 5F6HJ 1AR1C 3X17A 3LAFA 1P9MA 4HH8A 4JZNB 2H26B 3HE6D 1GGCL 1HQ4B 1ETZA 2NY2D 5TE4L 1AKJD 3RA7L 2VNCA 1TVDA 1NCCL 4MHHI 5FHAL 2BVQB 3MRGB 2FEDD 4IRJD 5JOFB 1T1ZB 1RHFA 4MJ6A 3VFNB 3QI9B 3KYAA 4L1DA 4L3EA 3CSPA 4QWWD 3T0EC 1RJCA 1ND0B 2QSVA 5F88A 3B2UD 3RU8H 3T77B 3QRFM 1BWWA 4OZFA 2E27L 1T83C 2DYPA 3UZVB 3RL2B 3WFEL 4PRIE 1RQ5A 3OB8A 2R1WA 3WFCH 5IB4B 1BVKB 2ORBL 1EAJA 1QBLL 2A83B 3RGVA 1JL8A 1JGUL 1Z0NA 1BZ7B 4JN2A 2CGRL 4M03A 2IMNA 3BW9A 1MIMH 5FEBA 1WWCA 1J8HA 1ONQB 3C8KB 4GRLD 5BO1L 1QEWB 3B43A 1MI5B 4POYA 1ZGLM 3MV7B 3LEYH 5D9SA 4D0CA 1NCWL 3ILPB 4KK5D 4LSQH 4FFVC 1MLBB 3F7RA 2CO6B 4L4VB 3C5ZA 1CFSB 3IDXL 1F90L 5C0GA 1PZ5B 4MD5B 2BFVH 2H2PC 2OL3B 4UBDC 4JDTH 1YEEH 1KCUL 3Q6FB 4KKAD 4ELMF 3VXUD 4D9RD 4WV1B 2K9UA 4V2CB 3VRLF 1HI6A 4M61A 3BD4A 3EJZC 2GJZB 2J6EH 4WHTA 1JNLL 4X5WB 1XGRB 4NUJB 2Y72A 3PF2A 1XCTA 3BPOB 2HH0L 4F7CA 5T3ZH 3ZDXF 3PWLA 4WFFE 1KTKE 5FGCE 4ZFZB 1JGLL 1W72B 2V5SA 4M7ZB 5IV2A 3BGFC 2YA1A 1IEBA 5EORH 1F3DH 3EYSL 4OCSH 3QQ9C 4OIAA 2ED7A 3PP3K 4LGPB 4G43B 3GMPA 1A3RH 2X89D 5CEZD 2D0HA 2YMXL 4PRHB 5J56B 4HK3J 3X14B 3GBNH 4OM1H 5DJ6B 1ZHNA 3BP4B 3DX6A 4G8GE 4OLVL 4YEFA 3TBTA 4CVZB 4LRNL 5DJ0B 4PJHB 1T1WA 4JFDA 1FZKA 4NO5B 1LE5A 2VC2L 5C0DB 3CFBB 3MRQA 5L88L 5C07D 4ZO6A 1P7QD 5HPOA 1EBPA 4MNGE 4WFEE 4UV4H 1C5DA 4I3GA 4JHWL 3VXPA 1I3RB 2QHLA 4QHUA 1TJHL 2DJUA 3NABH 3RX8A 4YHNB 3MRCB 4E0RA 1R5IA 1NGYB 3ARGC 1T1XA 4DUWA 4JPVH 5JPMA 3O4LE 2CLVB 5BRZB 3TA3A 3BESR 4KJPD 3DURB 2JELH 3GMOB 1YEHH 4HZLB 3WXWL 4GAGH 3U36B 1BEYL 4KKBC 5C0AD 5K9KB 4WNQB 4GAYB 1KOAA 2PYEB 5CJXC 5EU6D 1P7HL 5IMOB 1BGXL 4WY7L 3CH8A 3WJLC 4XBGB 1W0WB 3QDMD 4XBEH 5BQ7B 2RFXA 3MBEB 4EXPX 4GAFB 1P2CB 3WFDH 1U8HA 4IOIB 3RWGA 3UTSB 1FO0H 5C0IB 3QH3B 1TQCB 4PGBB 5E2WL 1GPOH 7CGTA 2HVJA 1YEGL 1MNUH 1MCEA 4Y8AA 1GL4B 1EO7A 2E5EA 3ET9F 3V52H 1MFEH 4JHBA 3MOBH 5FDWB 2IC2A 3F6IA 2E8ZA 4I4WA 3QNZB 5B8CC 2E7MA 4JY6B 1X5IA 1UJ3A 1U8QB 4PPTA 1MAKA 5BS0D 5FKAA 3BRGC 1MHHB 2EKJA 1I1AC 2W92A 3SKMB 1S7UB 2OR8A 1B0WA 1QLRA 2EZ0C 5DF0A 1OTTC 5DUBA 1MF2H 3KPPB 4MGXA 5JDSB 1A14L 5DHVA 2V17L 2FO4A 4IOFD 1CICC 2G5RA 2R0LL 4M7LL 3V4PH 2EE3A 1FVDA 4KJQD 2PKDA 1YEIH 1PX3A 3NACH 1FVCB 2A9ML 3HI5L 5K59E 1MCWW 2OTWB 4TNVF 3O41B 3C6LA 2HFEB 3W39B 1H3XA 3V6OC 2MQ3A 1RZJH 2DTML 1RUQL 1FZJB 4IHOB 5F1SA 2NR6C 3S3SA 4BSJA 3WJJA 4I0PD 1UH3A 5C09B 1BVLA 5HYSG 5IHBA 4HS8H 4MAYA 4PJFB 1QA9B 4ZOCA 3DUSB 4M3JA 4EQ3A 4PJXE 2PXYA 2YWYA 4UT7H 1AGFA 1I1RA 3AXLA 1SEBB 2AJXL 1BIIA 1CVSC 2YSSB 3KPTA 4I77H 4LOUC 4X6DE 3RTQB 3P4MB 2XOTA 2X1XR 4YXKL 15C8L 4OV5A 1R3KB 4L4JA 4KKLD 4PGDA 3BP7A 2IMMA 1WWAX 2X4UB 4CDHA 2R4SH 3NFNA 2Q20A 3U9PH 1B2WH 3QXAA 2CUMA 2XWTA 1CGVA 4LGSB 3WIIL 1JF6A 3KPNA 1C08A 2Y6SC 3O3DB 5IMKA 3ZE1F 4NKMB 1CDIA 4U2YA 2Z91B 4ZDHB 2XTJD 4RMVA 5IVZB 4NCDA 5D7IF 1NBZB 1QSEE 3VWJA 3KXFA 3IFNL 1F3JB 3ARZA 3HAEH 3L5JA 4NQED 4YX2H 1X44A 4NO2A 3BD3A 3HPJA 3K3QA 3FMGL 5J57B 3TP4A 2YD8A 5KSVA 4AQOA 5KS9A 4WEBH 1HKLH 5J13B 3HRZB 5DI8A 5ID0A 1GSMA 4M7KL 5FYKU 1DJSA 2O5XH 4K07A 3RAJH 3ZKXC 2NPLX 3F5WB 3L3DB 4CVXB 5DVLA 3NCCB 5GGQL 5DRNB 3NA4A 3ULVD 3VA2C 2NY6D 2ATPB 4DGYL 1M05A 1J0YA 2F58H 1A9BA 2C4FT 4NN6C 1TJIL 3KYMA 4WI9A 3FN3A 4MS8C 1M7DB 2DLGA 3VD3A 1VHPA 2CMRH 5GRWA 1MFBH 5D71H 3SO3B 2HJKB 5D1XA 2NY3D 2D0FA 4YHZL 5C6TL 4YQXL 1XR8B 4QOKE 1I3UA 4XVJL 4CADA 4KJYB 2KH2B 3F7YB 4BSVA 3MX0A 4NT6A 3ZLQC 4ZYKB 3SDAA 4DZBB 3DVFA 1EVTC 3PWPA 4P3DB 3TNMB 3JBG7 4NKIL 4P5KB 1NGXA 5EOTA 3D69A 2IADB 3EJYC 3NPZB 2VZ1A 1X5AA 2GY5A 3V0VB 2NY1D 2WIIB 3LKNB 4GG8B 5C0FB 4XVSL 4WW2F 1A22B 4LQ1A 4ONFL 4HWBA 2ITCA 3RHWK 3S96A 3H9SD 2H2SD 4YEEA 2NYYC 3I75B 2PETA 3O9WA 1UKSA 1G0YR 1KNOA 4OUOA 3TO4D 1NGPL 4P2QD 4PBVC 1N6VA 1OARH 5J6GB 4UI2A 5E8DH 2FZ3A 3BN3B 4MQ7B 1U3HD 2EYSB 1ED3B 5HY9A 5GIRB 4F15B 3RVTD 2XKNB 1IAIL 4XNQA 3ARFB 4U6TA 2R4RL 2DL9A 5FF6B 1CL7I 1EAPA 5AD0B 3MXVH 3CFDB 4HD9A 5EOCH 1LK3L 1UB5A 2HTKD 3JV4A 4P2OD 3I3DA 4B50A 5BW7A 4GXUM 5JLZB 3BP6A 4XMLL 3SDXE 4PJAE 5ESQB 5CEYB 1FVEA 4JM2D 5C70A 1EERB 3WYRA 1JHLH 2NTFA 2NY0C 4DN3H 4IIQC 3ILQC 3MNVB 1MFAH 5K9JL 3HE7D 3IKCA 5AAWA 4JFXB 3BOVA 3O45B 5CZXC 2CSPA 4MNQA 4LU5L 4Y4HD 4LLDB 1CQYA 1JFQH 3V4UH 1K2DB 1QRNB 3VXRA 2FJHA 5CWSB 1JYXA 3IGAA 1QSFB 2GW5A 3QFJB 3SDDD 3WKNA 2W0KA 3OAZH 2GTZB 4W6XB 3QUXC 1Z3GL 1YYMH 2EC9T 2YPLA 1HH6B 3BI9X 1JTOA 4LRIC 3VXUE 3MJ9A 4D9RE 1YEKH 2R2HB 3PWUB 3SCMB 1ZHBA 3C9NB 4XH2A 3NA9L 1X7QA 3MRHB 3O3BA 3DSFL 3O0RH 4BZ1L 4CNIA 3KPLA 4C56A 1R3JA 3VG9C 3BEVB 1SYVB 2VLRB 4WUUA 2P7TA 2NW2A 5FYJE 5D1QA 1Q9KA 3HMXH 4Y4KD 3O6KL 4QRSA 4F3FB 4ODUA 3V9FA 5F89B 1IGFL 1WC7B 3VFGL 1I3GH 4NC1C 1PYWA 1RIUL 4JE4B 5B22A 3NTCH 1RJLA 2BHZA 2IFFH 3WNPA 1N59A 2P44B 5CEZE 3JTSB 4OLUH 4JKKA 3DJ9A 1HHHB 5EU3B 1BLNA 1DQJB 1YPZA 5D5MA 1NLDL 1LEGA 3L3HA 2DOCA 2F19L 3G5YA 1MEXL 4O5LH 4NC2B 2MOVA 4JKPL 5I75B 3KJ4C 2HWZL 4NFCA 3OX8B 2DKSA 3JZ7A 4PBWD 2X1WL 3GUTB 4X6CE 5KSBE 4KI5F 1ZVSA 4KWUA 4KRMB 3T8XA 4JB9H 4JZJA 4Q2ZA 5C07E 1LD9A 3FO0L 1CE1L 2ED9A 3BQUB 3DGGA 3K8LA 2BY1A 2PF6A 5IVXE 5F96L 1JRHL 3DX7A 2SEBB 1EHNA 4OAWA 3A67L 43C9B 4R97C 1FFPB 5CJOL 1A7PL 3UAJC 1R5VB 1OSPL 4NYLA 3BVNB 4LLVA 4QXTB 4JHAL 1C16A 1GGUA 4BQBA 3G9AB 1K8DA 1H0DB 1LQSR 3UJTH 2Q76A 5ADPH 4DTGH 3C5SA 5IFAL 2FRGP 3BPNB 3RIAF 5A1AA 4NPYB 5C0AE 3QQ3B 1C7TA 5EU6E 2EDHA 3X3FH 4PG2A 4NBZB 1SM3H 4LLYA 4PP1D 4R4NC 4U7MA 1WITA 3QI9D 5F7HA 5IOPA 2GTWA 3QDME 1TCMA 4Y4FB 4KXZH 1QP1A 1T7WA 3TBYB 4Q9RH 1YMMA 4ZPVA 5FOJA 4WU7B 1TIUA 4ODTH 5MEOA 4WUKL 5ERWB 3GMQA 1YQVL 4Q9CA 4DKEH 4YNYB 1BZ9A 1D9KA 4CMMA 4K3DL 3BIKB 2DQGH 2F53B 3HZKB 3WKML 1KPUB 2M2DA 2ICWI 4HFUL 4RAHA 3CFEA 3UJIL 4KFZC 3TYGH 2P49B 2VDMH 4UQ3B 1V7MH 3NZ8B 5CBAA 4IJ3C 4M1CC 3B2VH 3MMEA 5ANMB 2ADFH 1XGQA 4L5FL 5BS0E 3TBSB 4L8DB 2FR4B 2Z35B 3QIUA 4X7CC 3U7WH 1OP5H 3S9DB 4KV5F 4O4YH 5IF0B 3ARRA 1MI5D 3ZHDA 3MV7D 3P11L 4D9LL 2Y07L 4XVTH 4X9BA 2EIEA 1D5ZA 3EFFA 3MJ7A 4EDXB 4L4VD 2WWKT 2E9BA 3GJEA 2B39A 3GRWA 5HI4D 1HEZA 4WWKB 4LLMB 2X4QA 4EI5C 4JJ5B 1V3KA 1NDMA 4FQLL 3OQ3B 1KCLA 3GO1H 3SKOB 1TZIB 4MD0B 4G9FD 5TQ0L 1AHWB 4N5ED 4LQFH 4KTDL 3GRWL 5T1MA 1OY3B 2H8PB 1JPSH 1QRKA 1KFAH 2J8HA 3GBLA 1VERA 3L95A 4OD3L 4Y89A 3MGOB 3W82A 5E5UB 1ORQB 1YNTA 4RZCB 1I1YA 1T0NB 1A6VH 1K6QH 3QIWA 3QIBC 4BFIA 4HS6A 3D9AL 4QY8A 1AI1H 4D9QD 4G3YL 1T2QH 4XPTL 1CLYL 5D7JB 5TJWK 1E6JL 4K8RC 4FXGA 5BZDA 3A6CL 3NMEA 1CR9L 4GW1B 3JV6A 3QO1B 4HIHA 4OF6A 2CK2A 5EU7E 5EU5B 5C0BB 1ZTXL 1CD1A 4PRHD 3R1GL 4HF5H 1PJ9A 4XP9H 4H8WH 5E8NB 3TH2T 1QNZL 4CJ0A 1TZGH 1TITA 2XTJE 5HDBF 2BDNH 4K94L 5C0RH 5EDXA 5I1AB 1MWAA 1KXTB 4E41B 1GVIA 4OZHA 4RFEA 5I30L 1OW0C 2ENSA 4JANB 2C3HA 4FFZL 2JJWA 1OAKL 3O3EA 4FQ1H 5C1MB 2CRMA 3IAGC 4OGAD 4X98B 4F9LC 1GC1H 3HAEG 3KS0J 1MWAL 1FP5A 5E2UH 3LVEA 4FABH 2BY2A 5CAYB 1IMHC 1YUHA 3HE6C 1T7ZA 4UT6H 3STLB 2NY2C 1HHKB 1EEUA 4A2LA 2PYFA 5ABDE 1BFOB 4TPRH 1E6OH 4UUJB 3ULVE 1UYWH 2IJ0C 1X5LA 5IIEA 3K7UA 2FEDC 3I3EA 5E2VL 4IRJC 1RFDH 4S0SD 1P84K 2MSPA 3MLUL 4RFOH 4AK1A 2APVA 4X6FB 1KXVC 1T2XA 3KYNB 3LQAL 3R06B 2BOBB 4PJCE 4QWWC 4U1MB 3QB7C 2A6JB 5JQHC 3IFOB 3MREA 3B2UC 2WSKA 5GGVL 1UH4A 1BECA 4RDQF 1U93A 1OT1A 5EPMA 3MLTA 5JXEC 1DE4B 1Q94B 3QG7H 2FSEB 1CCZA 1W0YT 2R8SH 2PYED 1NKOA 1BQHB 1NFIA 4I18C 1CXKA 4CU8A 4HX1B 1U8KA 5FUOH 3L3IB 3ARXA 3QA3B 4HUXA 5E24E 5DVMA 5J6HB 1E4WL 5JTWA 3FQUB 1IM3B 2PO6B 4HHAB 4BELD 3C09C 3IFPB 3MBED 4ZTPL 1B4JL 5M95B 4JFPA 3P30H 1ES0B 1NGZB 1L7TH 5E7BA 3RVUD 3F65A 4NNYB 4OIBA 2AEQH 1AGCA 3BKYL 1XF3A 3UJJL 4GRLC 1KTDB 4KK5C 1U91B 1WISA 3H9SE 3ESUF 4ORGA 3RX5A 3WL9B 1G9NL 1TZHA 3IDMB 4DEPB 1QBAA 5D72L 3BYTA 4P2QE 4U0QB 4LPVA 5EZJA 5I66A 4Y5YC 1AO7B 1LK2A 4Y5XB 1AE6H 4PJEB 1RJYA 4XCEA 5J12C 3I2CL 32C2A 5GGRB 4HUUB 2Y5EA 3EYVA 3K74B 2DB8A 3W9DB 4YWGH 4JPIA 1IGJB 1AGEA 1K3ZA 1KN2L 2WP3O 4ZSOB 3RRQA 5TPWH 3X3GH 1QR4A 5K9OB 5KN5A 4IM8A 4MLSA 3K8KA 1MVUA 2BY3A 4LKXA 4POZD 3A6OA 4PJFF 1GGCH 1S9WB 5B39G 4MJIB 5C09D 3LN4A 5TE4H 1U92B 4YBQD 4E5XB 4YBLB 2VABA 3RA7H 3MROA 1NCCH 1H5BB 3DI3B 5FHAH 3GMMA 3MO1B 1IAOA 3OBAA 3SOBL 5HPMB 2YN3A 4WHYG 4UOJA 2ERJC 1U3JA 4NZUL 1JZ6A 3U83A 3S98A 3TV3L 4JR9H 4YGAB 3S4SG 2GEEA 3DROA 4QHMB 1VGKA 4PUBL 1B4RA 2V5YA 4JDZB 3OJDA 4EQ2A 2E27H 2AAVA 4V2BA 3WNNA 4XAKD 3WFEH 5T3ZD 2J8UB 2OR7A 3L3GB 1OSZA 5BVPL 4OZFH 4C83A 2ORBH 1U0QA 1R3LB 4Z7UF 2X4TA 1QBLH 3O8XA 5IWLC 1JGUH 4MA1B 1BBJB 4NZTL 2CGRH 2Y23A 3VGAC 2WINA 4Z8FL 3DHMA 2W1NA 4DQOL 5I15L 2XIDA 5IB2A 5GGVY 3X11B 3B9EA 12E8L 1T21B 3G6AA 5BO1H 3GJFA 4KJPC 4ODWA 5C71A 4R3SA 1NCWH 3DTXA 4JVWA 3O6FB 3FB8A 1FQ9C 1A7BA 4JO2L 5HGBB 1CFTB 3IDXH 1F90H 1F8TL 1P5UA 2YBRA 3JWDC 1JBJA 3PGCA 1KCUH 2O5YL 5GGSB 5J1SC 4JCLA 3DXAD 1GJIA 5E4EC 1N5AA 1UADC 5EO0B 1RZGA 3NGBB 3KYOA 5FO7A 4DWHA 4XHQA 2ATKB 1PKQA 4IRSA 3VH8G 3QZWB 5E00B 1JNLH 1Q1JL 4LFHD 3S5LA 1IGIL 2HH0H 1LGVA 5I18L 1Y18B 3MZTA 1FNLA 1QVOB 1JGLH 1EFXB 4KDTA 1PLGL 4OZIB 4LHUG 3EYSH 5LBSL 3KJ6L 4Y16B 2H3NA 3U6RA 3H42L 3V6FB 2VO5A 4XP1L 3CLFL 3UTZA 2YMXH 2BRRL 4YH6A 5C08B 1XF4A 2V2XB 4MCZB 2P4AB 2IAMB 1U8JB 1CDHA 4PP2B 4HIEB 4IOFC 3QUZA 1RVFL 4KJQC 4GMSL 2Y06L 3I50L 2VC2H 3MCLL 4NCC2 3K46A 4MWFB 5L88H 1QUNA 4RGMB 3MNZA 2DKMA 3KDMB 5JIIA 1A6AA 1NANI 5JZ7D 2BVOA 3VXQA 5DQJB 5HHVL 4JHWH 1UEMA 1S7WA 1TJHH 3MV8A 3OGOE 4NN5B 5CKAA 1FV1B 5CS7A 3U4BL 4RMRA 1WT5C 3V8OA 4N8VB 5ID1B 3MRJB 4JRXA 2BNRA 4KKLC 3B9AA 5IFHL 1UENA 2CDGA 4J1UB 1PZUB 5HHOB 5J1AB 5IW1A 3LOWA 5LGKA 4HJ0D 3KLDA 1P4LA 3WXWH 4BSWA 1BEYH 5EU7C 3E6FB 1NCAL 2JKXA 1BGXH 4WY7H 2BZDA 4F2MB 3EOBA 1TVHA 2XTJC 4MDJA 2NX5A 4QYOB 5CBEA 1NFDB 2WWMD 4HJJL 1QRND 3MV7E 4TUJA 1HN1A 4UIKL 3LKPA 3GSWA 1QSFD 2BK8A 5E2WH 3QFJD 2COQA 4L4VE 1KLGA 1ETZB 2VLLA 1CD0A 1YEGH 2BSSA 2VAAB 1QSEA 1YPZF 1AIFB 5D5MF 2R2EA 3DV4A 4G9FE 3ULVC 2NY6C 1H9VA 4MJ6B 4HKXB 3S7GA 2DMBA 4P0DA 5FXCH 4PJGA 3NCYS 3DX9A 4OF3A 1FZMA 3M1BA 5F88B 2HJFA 2VLRD 1YDPA 3FQTA 4OZFB 3QO0A 3QFDA 4ZXBB 4XNUL 2DRUA 3WIHA 1X6LA 4I48A 3NFSL 1A14H 3DOSA 4J4PD 2EDJA 2V17H 4PJDE 4FXLA 4M7LH 2FWOA 2FGWL 4AZ8A 4KZEL 1LO2L 4HUVA 1JI1A 2A9MH 2BVTA 3HI5H 5A43C 5KAQF 3WIHL 2W0FA 3RGVB 1CFQA 2WBKA 2DTMH 1RUQH 4JN2B 3HLAA 1LP9A 5GJSL 1DQTA 3W0WA 3BW9B 2LTQC 1F58L 4PJHE 2MPAL 2AJXH 5D9SB 4IEFB 4D0CB 1EJOL 4CJ1A 3SE4C 3QPQD 2X9WA 1OQOA 4YXKH 15C8H 4K71C 3C5ZB 4U3XA 2ZUUA 5C0GB 2H2SC 3EDFA 1RJZA 3P3YA 1DBKL 3UYPA 4JY4A 3ZDYE 3KNBA 3E1F1 1FG2A 3TO4C 1FYTB 1MFNA 2XWBB 2R29L 2QL1A 5C3TA 3WIIH 2KKQA 5DRXA 3IVKA 1HI6B 1JZ2A 1U3HC 4M61B 5EN2B 5AZEL 4WHTB 3MV11 3IFNH 5AAMA 2NY4C 2BP3A 3LKRA 2HTKC 4GXVL 4GW4B 5SWSE 3TVMC 4P2OC 4M48L 3D2UA 4L9LA 4P46A 5EC1A 2PYEE 3WFZA 5JMOC 5J8OA 4P23A 2BCKA 5D7LA 4M7KH 3RFZC 2LABA 5D6CB 3GMPB 3QJHB 3KWWB 4YK4B 4AENA 5GGQH 4JM2C 3I6GA 4Y4FD 1VACA 5IVNA 3MLRL 4LGRB 3VD4A 4DGYH 1S9YA 3PHSA 1ZHNB 3DX6B 1TJIH 3WIFA 3HE7C 4LVOB 5HVHC 4ODSL 3NCBB 3ROOA 2CRIA 3SDXA 1IQDA 4Y4HC 1T1WB 2Q7NA 5CD3A 4JFDB 1FZKB 1LE5B 4LCWA 2LQRA 2F53D 1CZ8L 4ZUTA 4XCCL 1MJJA 5CP3A 2E9WA 2YPVL 4YXHL 4YHZH 5C6TH 4YQXH 2NY7L 3SDDC 4XVJH 2QR0A 1T5XA 3NIFE 1C5DB 5H94B 1NDGA 1ZT1A 3VXPB 1OWWA 4WDIB 4QHUB 4XMPL 1D6VL 4YDIL 4NKIH 4DGIL 3ZYIA 1R5IB 1T1XB 5MEQB 5JPMB 3TA3B 3TN0A 5LXGL 4NP4H 3G9VA 1K4CA 3O2WL 2D31A 5EIQA 4XVSH 5AWNL 5F6IB 4WWKD 4ONFH 4Y4KC 3F62A 1HHGA 1R5WA 4LMQI 2Q87A 4PV9A 3H9YA 2R1XA 4HWZA 5DMJB 5C09E 1NGPH 4OKDA 3QEQA 2OYPA 1XZ0A 2CH8A 4JKLA 1PY9A 4K3HA 3MLXL 2RHEA 4PLNC 1ZA3A 2RFXB 3SKJL 2YN5A 1U8OB 3KS0H 3RWGB 2A9NL 2X4PA 1T89C 2Z31B 2PW2A 1CDCA 3UZEA 5DTFA 1C12A 1KLUA 1IAIH 2HVJB 4I5BB 2R4RH 5D7JD 4WFHD 3MLPA 2FATL 5H2BA 1LK3H 4JG1L 5L0QB 4I4WB 2D3VA 5C0BD 1MY7A 4OZGE 4KY1L 4XAKE 4XMLH 5T3ZE 3RQ3A 3RDTA 1UJ3B 3NPSB 2KPNA 5FKAB 4JLRA 2ADGA 2R9HD 4LPYA 1QLRB 2W60A 1QFOA 4E41D 1XGPA 5DUBB 5T5NF 3LZFL 1X5JA 2CIIA 3DI2B 1L6XA 3CFKA 4RMUA 1EUUA 3CDGA 4F37K 5K9JH 4X6CA 4PB9L 2FO4B 5DHVB 3BMVA 1FVDB 5ENWB 4LU5H 5SX4H 1QBML 5J7CC 3C6LB 4MXWL 4TYUA 1S8DA 1GHFL 3OAUL 3MRFB 4IS6A 3TT3L 5I1HL 4PJIF 1OGAD 3QISA 4HS3B 4QTIL 4Z7WB 3BT2L 3V5KA 1BVLB 3EDDA 1B0RB 4MAYB 1VEPA 1AGDB 1LO5B 3JSSA 1Z3GH 4PP1C 3QI9C 3X13A 1OQXA 2PXYB 3OJMB 5L6YH 1AGFB 3AXLB 1BIIB 3DXAE 3VRJB 5GS2H 2YEZA 3NA9H 2UWEE 3OKDA 1F00I 3DSFH 4BZ1H 1EHLH 4OV5B 3ARUA 4PGDB 3BP7B 3DYPA 2X09A 3GMLB 2FX7L 1NAMA 3G6JE 3QXAB 3OKKA 4KKCD 1DANT 3BIAX 3HUJF 3BDBA 4QO1A 3O6KH 5IMKB 3KPNB 1C08B 2R69L 2PO6D 3EAKA 1IGFH 4UZGA 1I9IH 5SWZA 4PGEA 3EYQC 2I5YL 3VFGH 1RIUH 1F97A 2JCCF 1NAML 3MC0A 3BSZL 3KXFB 5CP7A 5F72S 4ONGL 2YD2A 3QQ4A 4TUOA 2CO7B 1TENA 1TLKA 2UZIL 4AIOA 4WW1A 4XPFL 1I9JL 1G7LB 5I8EA 2VUYA 5KSVB 2FNBA 4CU6A 5KS9B 1NLDH 4MB3A 4Z0XB 3LDBB 5HDQL 5DI8B 5DMGD 1DN0A 1MEXH 4U6XA 2RBLA 4JKPH 4NQCA 3I84A 2HWZH 4PY7B 5HI4C 5F8QC 4LLWA 1JWSA 2VLKD 2EXYD 5HYJB 4PJEF 3QXUA 3QAZB 3VE0A 2G9HB 3FO0H 1A9BB 4WV1C 4P5TB 1CE1H 4N5EC 3U4EA 1SVCP 2D7QA 4ETQB 5F96H 1LNUA 1P4IL 2R0ZL 4KDWA 3RJQB 3HC0B 1JRHH 1KCSL 3A67H 2HFFA 2V2TA 5CJOH 3BPOC 5D1XB 1A7PH 1OSPH 1Z9MA 2Y7QA 1E0OB 4JHAH 3GHBL 2PTTA 1WTLA 4FQXA 3UDWA 1IC5L 5CILL 4BSVB 3MZGB 4FZEL 5IFAH 3SDAB 3IKKA 2XQBL 1TPXC 1CS6A 3PXHA 1NGXB 2C3XA 3FO2B 3RWJA 4X7DC 3RY4A 4WI3A 5FYLL 5CINL 1WZKA 5F7KC 2CKBA 5BJTA 5I71B 3TPKA 2VDNH 2XKSA 3WLWD 2I07B 1QRNE 4HIIA 5GS1A 1MAML 3VFVA 4OB5L 2E6PA 2EICA 4WUKH 3S96B 1ZGLP 1QSFE 3QFJE 1MQ8A 3OB0H 2CKBL 1AXTL 1HHIB 1YQVH 2OI9C 3O9WB 3T3PE 1KNOB 5FKPB 1PEZA 3T08A 4K3DH 1N5YL 3WKMH 2XA3A 3GMRA 4Z7QE 4HFUH 1CXLA 5EIVA 2DM4A 4QGTA 3H2WA 4GS7B 2P45B 2H1PL 4NRZA 5HY9B 3VFOA 1KYOK 4L5FH 3BGMA 3RI5F 4XNQB 2CIKA 1JCKA 5EBLA 2VLRE 2NNAA 2Z8VC 4EVNA 1UB5B 5DK2B 5TE7L 5AG8A 3BHBA 3JV4B 4OFYA 5B21A 3P11H 4NCC1 4D9LH 2Y07H 3BP6B 1DBBL 3EDJA 1IILE 3OAZK 3MRIA 2HKFL 4LEXL 2GUOA 3T0EB 4RDQG 3VFMA 1KTLB 1SJVA 4PJCA 4DKAA 4M6AA 2NTFB 4FQLH 5TQ0H 4CGTA 35C8L 5DZNA 3MBEC 2VUOA 3R0NA 4Z18A 4UAOB 4MYWB 4KTDH 3GRWH 2R1YA 4PJ8A 4W6WB 4OD3H 2FJGB 1MRFL 1TQCC 4PRAA 3I6LD 3RVUC 5DJCA 3VXRB 3CJJA 5DS8A 1RZIA 3D9AH 1T3FB 3IGAB 4U1IB 4UDUB 4G3YH 3WUWB 5GS3A 5C0CD 1KULA 2Z0BA 3BIBX 1CLYH 4JPKL 4XPTH 4AT6A 1EFXD 1E6JH 3A6CH 1CR9H 3ZKMD 3OR7A 5EC2A 4Y16D 5FM5M 5HHPB 3TBVA 1ZHBB 4N0RA 5MP6L 4PGJA 1JWUA 1UA6L 1ZTXH 1RULL 43CAB 5D70L 1X7QB 3N1FC 4ZAKA 3R1GH 4P2RE 1MCHA 3CSGA 4P2CG 4CNIB 4ONOA 4Y5VA 1KCVL 1QNZH 2IAMD 1FYHB 4C56B 2UY6A 2GSIB 3W9EB 4K94H 4PJ9A 2P7TB 2EIBA 1DL7L 2PR4L 3JVGA 1EZVY 5D1QB 3D0VA 5I30H 1Q9KB 2OP4L 4FFZH 4BUGA 1OAKH 4QRSB 1HWGB 4DVRL 2Q3ZA 3T3ME 4ODUB 3UYOD 5B4MD 1ZEAL 2VL4A 3V8CA 1MWAH 1PYWB 5I0ZA 5C6PB 2XFXA 4POZC 3FQXA 4RGOL 4YBQC 2JK5A 5IHUL 1NGWA 4LARL 4BZ2L 4XX1E 3LV3A 4K7FA 3FO9B 1XCQA 1BLNB 5E2VH 4CMHB 2YD7A 1LEGB 3MLUH 3L3HB 3G5YB 2P5WA 5KSAA 6FABL 1Y0LA 4XP5L 4LKCB 4D0BA 5HHOD 5GGVH 3U0WL 2IPTL 2F53E 4GW5B 4PJGF 1AJ7L 3T8XB 1IC4L 2MFNA 4Y7MA 1LD9B 3IYLW 2F8XC 3DGGB 1EV2E 1HHJB 3HPLA 2JB6A 3WS3A 5ANME 3ZDXE 4HC1A 4LPUA 4GG6A 3DX7B 5D96B 1E4WH 2GJ6A 4OAWB 4PJ5B 9CGTA 4ZTPH 1PBYA 4L1HA 2EDDA 2D2OA 3GHEL 4HC1L 3CH1B 3FQWA 4J8RB 5FCUL 1K8DB 2ARWA 2GK0A 3BKYH 3C5SB 5J13C 3T2OA 3UJJH 2YD6A 4NM8L 4HXAL 3QUMB 4BYHA 5J0BA 4DFIA 4CVUA 4OT1L 3IF1B 1SJEB 1YMHA 1IL1A 4OM0L 3JTTA 3D48R 2DM3A 4NZRL 3BZDA 3ARGB 4ZUSB 3FT3A 5DURB 4L3ED 5D72H 4HKJA 1WBZA 4WU5A 5KVDL 4U7KA 5E6YA 5C8JA 3FB5A 5IMLA 1OP5K 3UYRL 5IW3A 3NN8A 1SYSB 1DQDL 1YMMB 4ZPVB 4MA7L 5J1TC 1RMFL 3TJEL 4S10A 5JOPD 5MEOB 1I8LA 3D3VE 2B1HL 3I2CH 4UTAL 3GMQB 5DFWH 5ADOL 1QFWM 3QHTC 1UWEH 1BZ9B 1D9KB 1KN2H 1OAYH 4WFHE 1QTYT 4Z5RB 4WFGD 3CFEB 3QUKA 4Y19A 3RGVD 5E08L 4CRPA 5C0BE 4RAUA 5EB9A 4ZPTA 1RAMA 5CBAB 5IROA 5FGSA 3MMEB 4GRWH 2HFGL 3RUGA 1XGQB 2KL6A 3OL2A 4NGHH 5DZOA 1KPVA 1X4XA 3QIUB 4ZUVA 4Q74A 2YKLH 4E41E 2Q7YB 5JNYA 2AEPL 2EYTA 2DQFA 1NBYA 1OCWL 3SOBH 2WLYA 3I02A 1D5ZB 5B8CB 1F3RB 2W59A 3MJ7B 4NZUH 3C5ZD 5T1LA 3TV3H 3GJEB 3UP1A 2FIRT 2UVEA 4MNHA 1DTUA 2Q3AA 1I1AB 3TZVA 1JPTL 3TO2A 4F7EA 1NDMB 1Z2KA 2YK1L 3HNVL 5H35A 5JDJA 1OGAE 3WFBL 4Z76A 4CL7A 4AIXA 2GY7B 5IEKA 5D6DC 3L95B 1CICB 5EBWA 4MQXD 5BVPH 1YNTB 5DJ8A 4N8CL 4F15C 5JZ7C 1DFBL 2OJZL 5T1DL 1I1YB 3UX9B 4BFIB 3HN3A 4HS6B 4NZTH 5K93A 1UWGL 4ONHA 4QY8B 5IFJB 5GRVK 1DEDA 4M1DL 4Z8FH 1J1XL 4DQOH 5I15H 4FXGB 1O5DT 5BZDB 3FZUD 12E8H 1RZ7L 4PJBF 3OTTA 1JRHI 4HJ0C 3FRUA 3FN0L 2EH8L 1CD1B 4IMKA 5A3IC 1JP5A 2O26U 3GGWA 4JO2H 4NQXA 3VXSB 4C4KT 3EYOA 3G6DL 5ETUA 2OS7A 1F8TH 2H45A 3GJFH 1XGYL 1RZJC 2FCBA 2O5YH 4JO4L 1F4HA 4RFEB 1L7IL 2UZYB 4UQ2A 1JYNA 4JCMA 2WWMC 1WIPA 4JFDD 1F6AB 4Z78A 3I85A 4KU1A 5F3HB 4X5XA 4QRTA 4N0UA 3OKOA 2IQ9L 1YUHB 1Q1JH 1IGIH 2PYFB 3HTLX 1ZHKA 4MCYA 4HWEL 2X7LA 2X6MA 2VLKE 1UEYA 4LBEA 5I18H 2BHUA 3NFPA 3D25A 4LVNB 1PLGH 3N06B 1I85C 2P8PA 5LBSH 2ICCA 3KJ6H 3TA3D 5FGBA 2XWJB 3H42H 3MREB 3N9GL 4M8QA 4XP1H 3CLFH 4ZSOE 5KVMC 2BRRH 3TF7C 3NCYP 1WFNA 1U93B 5EPMB 3MLTB 4TSBL 3QG6A 3G5XA 3CXDL 4J4PC 4OGXH 4NN6B 1NFIB 3OJ2C 3P0YL 1RVFH 1TFHA 4ZNCD 5EUOA 2DWEA 4GMSH 3CSBA 4H20L 3ARBA 3OKEA 2Y06H 3I50H 3UC0L 3CIQA 2D0GA 5KAQG 5I1JL 4PJDA 2MCPL 4PRIB 3GI8L 5HHVH 1FNHA 4X5LA 3V5DA 4B53A 4OV6F 3IDNA 3EBAA 1XEDA 4X9GA 5I1EL 2V2WA 5I75C 1WAAE 5DJXA 5E8OA 3U4BH 3ZYZA 3QPQC 4Z7VF 5I16A 1UT9A 4ORGB 4YHLL 1OTUC 5IFHH 1M71A 5DC9B 3AB0B 1FL5B 3ABZA 2ID5A 2QLVB 4X8JA 5EZJB 5I66B 1FPTL 1LK2B 3NCEB 3RNKA 3R0MA 1RJYB 3WO3B 1OT2A 3WNLA 3TWCL 1NCAH 1NL0L 1JZ4A 5IKCA 1FC2D 2HVKA 4JPIB 1Q0YL 1AGEB 4GRWB 3ZMRA 4XPBL 5GZOD 5C7XL 3FAWA 3C6LD 4X9FA 1U58A 3QEUA 1H8NA 4HJJH 3BPNC 5KN5B 1S7XB 1IBGL 1YEDA 1IGML 5DJDA 2OBGA 4LKXB 2EDLA 1G7IA 4MAYD 4F7PB 4GSDL 4U6VL 4Z7OE 2O61A 3MROB 3QXDB 5EWIL 2PXYD 3GMMB 4Y4FC 4XC1L 2VLJA 4LAQL 1A7RL 2BSTA 1EA9C 4RISL 4AM0A 4FZ8L 4XI5D 3ES6A 3I6LE 3CFJA 3DROB 1XF2B 4YR6A 1VGKB 4GQPH 3OJDB 3SDYH 5A2JH 2F74A 4XNUH 4P4RB 2NY0B 4IIQB 3AS2A 2AKRB 3NFSH 5C0CE 3SGJC 5HHXH 1VEMA 3Q6GL 4NJAL 2FGWH 5JW4R 4KZEH 1OSZB 1LO2H 4OZIE 2QJDA 4NZDA 4F7TA 4BH7B 4X6BA 3VWJD 4KVNL 3BWAA 3KXFD 3WIHH 5FO8B 2X4TB 3BZ4A 1VFAA 3O8XB 1O7SA 4O9HL 1DQML 3AU1A 4CDGC 4TVSa 2NLJA 3MRLA 3L9RA 2WINB 5GJSH 3LEXA 4C59B 2QTEA 5IB2B 4L29A 1BIHA 4KGLA 1IKNA 3G6AB 5D7SL 1G9EA 1F58H 4ODWB 3OKNB 2MPAH 4R3SB 3VFSB 1EJOH 3C60A 2MWCA 4GKZA 4WWKC 4F80A 3FB8B 3IDIA 5F6HI 4MJ5A 3GI9L 1BBDL 2YBRB 3KG5A 4JG0L 5HGHA 2DQEL 3PGCB 3RZWA 2W9EL 1DBKH 2IG2L 2P42B 2FDBP 3T65A 3PIQB 4AEEA 2XV6B 5E1HB 4EN3A 2R29H 5IHZA 5KZCB 1N5AB 4NQSA 4MQSB 2EDQA 1I7ZA 5D1XD 5FECA 2DQHL 5FO7B 3KYOB 4FFYL 3GM0A 1L9MA 4YFDB 5AZEH 4IRSB 2P1YA 5ALCL 3G08A 3T0DA 1MJ8L 5HYIA 3ALPA 5HHOE 1CIDA 5D7JC 1X5KA 3RWDA 5CSBA 3SDAD 4GXVH 2VITA 2WBJA 3PWPD 4HLZG 4M48H 1KPRB 5EZIL 2H3NB 5DO2D 3U6RB 2ZUQB 2VTFA 3KJ4B 1CL7L 3UTZB 3K4AA 2ESVE 1XF4B 3IT8D 3MLRH 5IQ9A 4LL9A 1NFDE 3GFUA 4XVUD 4G6JL 2G75A 5MENA 1MCBA 2X9YA 4ODSH 2VIRA 3QUZB 3WE6A 5T5NG 3EO0A 1GOHA 3O9WD 1N6QL 3O2DA 1U8MA 4W70A 5JR1L 1CZ8H 1OAZL 4G6ML 4XCCH 3BISA 2BNUA 4NZJA 3MNZB 4MXVF 2YPVH 4M4PA 4YXHH 4PJ7A 5T1KA 2OQJA 1JV5A 2NY7H 4NKQB 3O2DL 1A6PA 3LN5A 3VXQB 4L3EE 1IE5A 4W6YB 3QBTB 2X4RA 4UINL 5CP3H 5CJ8A 1S7WB 3MV8B 4XMPH 5F1NA 1D6VH 4YDIH 4DGIH 2FLRT 5T5FL 4F8QA 5IBLD 4GH7B 5JOPE 4AL8L 4TULL 4JRXB 2BNRB 4LMQE 4QHNA 2M1KA 3ARQA 5LXGH 5IW1B 3O2WH 1EMTL 1H3WM 2OM5A 4YDKL 5AWNH 3T0ED 4KKCC 1P4LB 2ZCLL 4PJXB 4BSWB 2HT3D 1TTFA 2PO6C 2P8MA 3RWEB 2VQTA 4I1NB 4LEOB 3SJVA 3R4DA 3H9ZA 4LPTA 4M3KB 4MNQD 5CBEB 3ULUL 5IHLB 1J8HE 3MLXH 3SKJH 4NBXB 3CVHA 3O81A 1YZZA 3VXRD 2A9NH 1WCBA 3LKPB 5F7DA 2IANA 4IJ3B 4L3CA 5GS2D 3TPUB 2VLLB 3CVHL 5DMGC 1I8MA 2BSSB 2FATH 4DEPC 1QSEB 1LEKA 1YY8A 4O2EA 3BPLB 1QFPA 2R2EB 2XY1A 5C0NC 4JG1H 5DQ9B 2EXYC 3LRSB 4KY1H 2DQDL 3DUHA 2C7UA 4FFVD 3B9VA 3DX9B 3TNNA 4C56D 1FZMB 2E7LC 2HJFB 2R2BA 2XY2A 1G7QA 2MJWA 4WUUD 1YDPB 3QO0B 5D1QD 3LZFH 4C54A 1CTOA 3PV6B 1KB5A 4I48B 1Z5LA 1FDLL 4GG6F 4M5ZL 4PB9H 4XPAL 3K1DA 2FWOB 2GKIA 3EHBD 4OLXL 4KV5E 1CG9A 1QBMH 4HUVB 1HXMB 5J06A 1JF1A 4KROD 4MXWH 4J3WA 1KB5L 4X0KA 2W0FB 1GHFH 3OAUH 2DN7A 1CFQB 4RMSA 1K85A 1MIEL 5DSCA 5HHNB 5DA4A 5BOPA 3TT3H 2CRZA 4G80A 5LKNA 1OAXL 4QTIH 4XAWL 3BT2H 4Q97A 3W0WB 2B4CL 2FEEI 3KVQA 2ARJA 4G6KL 1RUML 1F11A 4I9WD 3RJDA 3QHZL 1ZLSL 3O6LL 2ZNWA 3OF6A 1T7XA 1ZWIA 4L4TA 2EE6A 1S7RA 4JFDE 3RBSA 3WLWC 1EFQA 2AEWA 4IMLA 3AAZA 3FOMA 3KLAA 4XXCC 3BJLA 1RJZB 5ESVB 2IFGA 1X9QA 5IEHA 3LQZA 2FX7H 4JY4B 3KNBB 1FG2B 2XTLA 4LHQB 5DA0B 1JPGA 5DLML 2R69H 5DRXB 3SBWC 3IVKB 4JREB 2H32A 4MA1C 5E6IA 2ARJQ 2ICWA 2YOCA 5GXBB 5IB3A 1NAMH 1HNGA 2ZZUT 1EEQA 3BSZH 5F9JA 3MRMA 3TH4T 4ONGH 5E1AA 2NY2B 4H8WC 2YD5A 3MFFA 1D5XA 3LKRB 3S5LG 1Q9LA 1JGDA 2UZIH 1BJ8A 4UDTA 4X4XA 1WICA 5HDBE 4XPFH 2BC4A 3B6SA 1I9JH 4GBXA 2RIKA 4L9LB 1S78C 2FJFA 5HDQH 5LAXA 1D6EB 1H15A 1NCUA 4LSUL 4WW2C 5DURD 3VXOB 1LHZA 4G6AD 5B3NA 3L3OB 3MA9H 1GC1C 1VACB 1R3HA 1YNKL 1YMMD 1S9YB 1GOFA 4HW6A 4ZS7L 4FNLL 1CXFA 3BUYA 3SQOL 3HAEA 5IW6A 1P4IH 3SDXB 4PJAB 2R0ZH 3NGBC 1X3DA 4LCUB 5CD3B 1KCSH 1D9KD 4LCWB 1CGWA 3SGDI 3E2HB 1ZSDA 1R24B 2C1OB 4CAGA 5FYKL 5F7EL 1KJ2L 3RY6C 4PRNA 1HSAA 3L5WA 2QR0B 3GHBH 5LG1A 1T5XB 1A02N 1IC5H 5CILH 4N9GA 4PV8B 4FZEH 4WI6A 1NDGB 1ZT1B 3ZKMC 2AQ2A 3GSXA 2XQBH 3QIUD 4OD1L 4Y16C 4YHYB 3QEHA 4BQ8A 2I9TA 1JVKA 4I2XA 4UV7H 4MXQD 4O51A 5E56A 1VPOL 2IAMC 3QP3A 5FYLH 3L3JA 5CINH 3TN0B 2DMCA 5LGHL 1B6UA 1JNHB 1X5GA 3P2TA 1K4CB 4Q58C 4XWOD 1XGUB 3ARPA 2VE6A 5LGJB 4ZFOL 2XPGA 1EEYB 3ARDA 1CDUA 1T04A 5ICZB 4Y5YB 5AZ2L 1OHQA 1MAMH 1NMBL 4OB5H 4OGYL 3LHPL 4PGCA 4U1KA 3KLSA 5B4MC 1SBSL 4FQHA 2CKBH 1RURL 5L2JB 1VFOA 3QUYA 2VXVL 1N5YH 3QEQB 1XZ0B 3N0PB 2IPUK 4IDJL 5GHWL 1KBGL 5A2FA 3WHXA 3Q48A 3QIWD 3UPCA 2X4PB 2H1PH 5ACZA 4OUUA 5ICXA 5TDNA 2PW2B 4NN5C 3SE8L 2RJMA 1TNMA 1C12B 1KLUB 2NR6D 5HGAA 5EO1A 3BMWA 3QWRA 5L7XL 4UU9B 1MCKA 5H2BB 2YR3A 5TE7H 3VRIA 6CGTA 1YEJL 1UH2A 1DBBH 4HUKB 4NKDA 4L9DA 5FA3B 4B7LA 2HKFH 5A2IH 3LIZL 4JLRB 2ADGB 3S97C 2WW8A 4ELMA 1F2XK 3KHQA 3KXFE 3U0TA 4ZUWA 1XGPB 2BERA 2CIIB 35C8H 1WZ1H 3V7MA 3CDGB 4PRBA 4X6CB 1CE6A 1WLHA 1NC2A 3A0OA 4NRYB 5KS9E 1P9MC 1MRFH 4J3UA 5B39A 1Q9WA 4AH2A 3DIFA 4Y2OA 4HCRL 4KK8D 3WMSA 2EEBA 4GMTL 2AQ3A 1CF8L 1F3DJ 5F7WC 2QQKL 4M93C 5SV3A 4JPKH 2QQLL 2CXGA 3BKML 1MCNA 2HT4D 2N7BA 3T4YA 3LKOB 3HG1A 4NNPL 2JLLA 4QRRA 1OD9A 5MP6H 3JUZA 1UA6H 2YEZB 1RULH 4LCYB 5D70H 3OKDB 5E9DA 1ERNA 4H1LA 3C5JA 4LLUA 4H5SA 2GJJA 3VGGA 1UM5L 1KCVH 2AJUL 2B20A 3LPGA 4B41A 1DL7H 2PR4H 1NAMB 3P9MA 3BZEA 3OKKB 2OP4H 3AMKA 4DVRH 4HKBB 2X4SA 3PWPE 4WI4A 1MHCA 5SWZB 3RGVC 1CDJA 1FIGL 3PL6A 1ZEAH 3PWNA 2ZUTA 3D3VA 1PAMA 5TGBA 3LD8B 5CP7B 4RGOH 5IHUH 3OXRA 3QQ4B 4LARH 1PG7W 4BZ2H 3ZHKA 3L7EA 3MSPA 2Z93A 4WW1B 2YD4A 2QSCL 5I8EB 3SDCA 2AJ3B 5FA4A 2YUVA 3NZHL 3EYFA 2C1PB 4MSWA 1DN0B 3HMXA 4U6XB 1A6TA 6FABH 4XP5H 1I1FA 2VXUL 4LLWB 3O2VL 3U0WH 2IPTH 4Q7DA 1YNLL 3VE0B 1HH9B 3RL1B 1IC4H 1VA9A 5TF1L 1YA5A 2AP2A 4AEHH 3U4EB 3CC5B 1ZK9A 4RIRA 3EOAA 4MQXC 3VH8A 2ZSVB 4YPGA 3DVGA 4XWGL 4PS4L 2V2TB 1V7NL 1S7TA 3NIDF 3NAAL 4NKOA 4OCNC 2EYRA 3GHEH 4HC1H 3OB0K 4CW1A 3RIFK 4ELKA 1FZOA 3V7AE 4FQXB 5FCUH 2CPCA 3ZHLA 4LHUA 4NNXA 3BFOA 3FZUC 3GSQA 5IJKA 4F33B 4NM8H 4WGVB 2I9LA 4HXAH 3RWCA 5I1DB 1EVUA 3U9UA 4YK4C 3SE9L 4OT1H 4GUPA 4QF1B 4JAMA 4OM0H 4TNWK 3RWJB 2AEIT 4NZRH 4ALAL 3E6HA 4Z77A 4MNQE 5KVDH 2CKBB 3FJTA 5BJTB 1CWVA 4Z0BL 3UYRH 2RGSA 1BX2B 2NXYB 1DQDH 3VXRE 4HIIB 3O3AA 1RMFH 1GGTA 4OQTA 3TJEH 3VFVB 2B1HH 4UTAH 2ZWLT 5ADOH 4JRYA 3FTGA 1ITBB 3KPOA 3H7BB 2V9TA 1T03L 2XTJB 1X5HA 2I25N 2MQCA 4OQTL 4I0PA 4U1SA 2YPLE 4ZFGL 2VXSL 4FMFA 1B88A 1S9XA 3O8XD 5E08H 1REIA 4QRUA 3I9GL 4NRZB 3KHOA 5IP4A 1KC5L 1BAFH 2HFGH 3VFOB 5L2KA 2ICWJ 3IAQA 3V95A 4C56E 2CIKB 1XIWA 3TA3C 4WUUE 4EVNB 1JE6A 1FNSL 5FK9A 2CRYA 2XACC 2AEPH 3BHBB 3IRZA 5INCB 1INEL 1OCWH 3MUGA 4KMLB 5F6IC 4MMZC 2NY6B 2CLRA 3MRIB 3H3BC 4JFQA 3PNWA 5HVGB 4DFHA 3ZKQD 2GUOB 5CHNA 5EFIA 3VFMB 5J3HD 4PJCB 4P4KA 1JPTH 3V6ZA 5EU4A 4QRPA 5DJ2B 2YK1H 3HNVH 2J5LB 3HR6A 3WFBH 3TIEA 5AYQA 4PJ8B 5D7IA 1YPZE 1QQDB 4YDJB 5D5ME 3ELAT 2NTSP 4I9WE 1UXWB 4N8CH 4O2CB 2OJZH 1DFBH 1S7SB 4IRSD 2L4OA 5DJCB 5T1DH 3ROLA 4GXUN 2BJML 1AH1A 4D8PA 4RNRB 1RZIB 2QV2A 1UWGH 5FHBL 1UVQA 4M1DH 2J4WH 4HQQL 1J1XH 3IXTA 5L0QC 4AT6B 1WUNT 4U2ZA 2QKIA 1Y6KR 5I1IL 3OR7B 1UJ3C 2H6PA 5HDOA 1JUFA 1GZQB 1TCRA 3INUL 2LTQB 3WFHA 5DHXB 3FN0H 2EH8H 2Y5TA 5FUCE 4YPJA 1AP2A 5DD3L 3P0VL 1C8PA 3G6DH 2APWA 5INDA 4P9HL 3IS0X 4K71B 4GQ9L 1XGYH 3V5HB 3H9SB 4X8XA 3RZCA 3ULUF 4PJ9B 3QUZD 1GOGA 3D0VB 4JO4H 1GH7A 4YLQT 2W38A 4LDEB 3TO4B 3AFLA 1A9EA 1U95A 5GZOC 3CDYA 3C6LC 1N8ZA 2D4DA 4X7FC 3L7FA 2ITDB 3SBWA 4LIQL 1U8LB 2HN7A 2IQ9H 2XFXB 3OXSB 4RA0C 3U7AA 3WJJC 2XZAL 3FQXB 5DD6A 2JK5B 4K7PL 4MAYC 4HWEH 2NY4B 4C55A 3QDJA 3LV3B 4YO0B 2PXYC 3T1WA 3MCKA 4K7FB 5C6WH 3MV8D 4PY8I 3IJHA 1YMME 3TVMB 3BEWA 1MLCA 1NJ9B 5HDLA 4NSKB 3FO1A 4M8VA 2FH8A 1KENL 2P5WB 4JRXD 4L8SA 1Y0LB 2BNRD 2HTLD 3MLYL 2P8LA 5EIIA 5FIEA 4D0BB 1HZHL 1DLHB 3N9GH 4PJXF 4XCYA 5KVFL 3UTQB 4AIZA 5I8CB 4X6DF 4TSBH 4G5ZL 1B9ZA 3CXDH 4U6YB 2JB6B 3P0YH 2E7HA 5BV7L 3HE7B 3WS3B 5ITFA 3MRPA 3TCLB 4H20H 5JIPA 4UILL 2GJ6B 2NX5D 1OTSD 3VWJC 1SQ2N 3DHJA 5TFSL 3UC0H 3AY4A 3LSOA 1ZLUH 4H25A 2XN9E 4WI5A 2VJXA 3FQWB 3CUPA 1JGEB 4NUGL 3DO7A 1DQQA 5I1JH 4W81A 3GI8H 2GK0B 5HHMB 4KVCL 5I1EH 3ETBF 1QSED 3HZYA 1A7NL 4YHPA 2WAHA 1AC6A 1YMHB 1IL1B 3CPLA 3JTTB 3QAZC 3QDGE 4YHLH 2DQCL 1TETH 2ZKHL 5D93C 3P9WB 3S36H 4HKJB 3C6SB 1WBZB 1JZ5A 4WU5B 5C8JB 3TCXA 1EGJL 4ERSL 5IMLB 1FPTH 3NN8B 5D2LA 3T0VA 1G0DA 4OKVA 2Q6WA 3EKCA 5KANI 1KYOJ 3TWCH 1NL0H 2J3SA 5D1XC 2BRQA 3HHRB 4LLQB 2UVFA 3OSKA 1Q0YH 4XPBH 3BRDA 5C7XH 2JJSA 4X7TA 3QUKB 4Y19B 2ADIB 3SDAC 3DBXA 1IBGH 4RAUB 1PDKA 1ZGLA 4ZPTB 1IGMH 3Q5TA 3VFPA 1UB6B 1G9ML 2APXA 3FN9A 3RUGB 5CIPA 5A16A 4KRNA 5F70A 3W0WD 1KPVB 4GSDH 4U6VH 3VJ6A 3VMPA 4ZUVB 4HJGB 5DO2C 5EWIH 3PDGA 1IVLA 2FYYA 3FRPG 4OZHE 5JNYB 2HG5A 1MY5A 5F9OL 4C57C 2EYTB 1MCPL 4XC1H 4J2XA 1XR9A 1NBYB 2AJYL 4JKMA 3WCYA 1UQSB 4LAQH 5I71C 3I02B 5HI3D 4JQXA 1A7RH 5SX5H 4XVUC 5AG9A 3CK0L 4RISH 4FZ8H 3M17A 4XGZA 2MCG1 2XXMB 2EDTA 3O9WC 4EKXA 3TZVB 3TO2B 2AJVH 2D7PA 1T0MA 4FRWA 4G9DB 3MODL 1GGBL 5DD5L 2ESVA 3D5OF 4RAVA 3VMNA 1KN4L 1FFQA 4EOWL 3GJFK 4GS7C 3Q6GH 5EBWB 4NJAH 5KANG 4K7PY 5DRWB 5HYEA 1UM6L 1ZV5A 3D85A 5DJ8B 2AQ1A 4KVNH 5GGUA 1JGVL 1K5NA 3F8UB 4HEPG 3U7YL 1FSKB 4O9HH 5MI0B 4X6EA 1DQMH 4LSVL 3PABA 5IBLC 2D7TL 2KZ1B 5BW7C 2Z8RA 4KMTL 3D2UD 1CK0L 4P46D 4OFKA 1J9CT 4LNRA 1MREL 4P23D 2WUCL 5D7SH 5D7LD 5HGDA 4BUHA 3N50A 4YDVA 3FRUB 4DCQA 5M7QA 1U9KA 3GGWB 2HT3C 3EYOB 3VW3L 3GI9H 1BBDH 4PJAF 5JPNB 4HV8B 4JG0H 5JXED 2DQEH 1CGTA 2W9EH 4UAOC 3RI5K 4K55A 2IG2H 4NQDA 4JEGB 1CI5A 1YJDL 4LCWD 2JJUA 3HNTL 4QLRA 2NMSA 4Z78B 1AD9B 1HQ4A 7FABL 2ZG3A 2DQHH 3OKOB 4OFIA 3EW3B 4FFYH 3SPVA 2MNUA 1HE7A 2ZUXA 5ALCH 4HAFA 5HYSB 1RUPL 3MRGA 1MJ8H 1ZHKB 5KSUB 2X7LB 3ARWA 1FNFA 4LBEB 3NFPB 3VFNA 2YS4A 2YD9A 4UB0L 3D25B 4IRZL 4P9ML 3K2UL 3HUJE 2P8PB 2KZWA 2FD6L 4MHHG 1TQBB 5EZIH 5IBUG 4HWNA 4M8QB 3TN0D 4MA3A 3JV0A 4GRWE 1CL7H 3FT2B 5I1KL 4GKSA 3RL2A 3VWKA 3GM8A 1ZANL 5D1QC 3DPBA 4XNXL 1Z9LA 3OPZL 3IJSA 1SY6A 4G6JH 4G9FB 4GFTB 2DQJL 4U1LB 1F6FB 1XF1A 3VA6A 2VDKL 2NZ9D 3EHBC 1N6QH 4KRLB 4R2GB 2DWEB 2XQYK 1BZ7A 1FCCA 5DK3A 1NMCB 5EUOB 4KROC 3OKEB 2N7AA 5GSRA 5JR1H 3QEQD 1OPGL 1OAZH 4G6MH 1SY6L 3OZ9L 1KIRA 3BPCB 8CGTA 5FYJD 4FFWD 5D2NA 2HJLA 3O2DH 1MI5A 4K23L 4CMHC 4PJDB 3DWTA 1A6UL 4UINH 1P4BL 4OCYL 1KEGL 1ZT4B 2NY5L 1CFSA 1TPXB 5T5FH 3VFTB 1PZ5A 5E8OB 4AL8H 1V3MA 2OL3A 4RMTA 4UNVA 4TULH 5I16B 1YN6A 2G2RA 2CJUL 4JZJC 4D2NA 3DO3A 2PW1A 1EMTH 4YDKH 1BP3B 2OL3L 2ZCLH 5D96C 2ZOLB 3RNKB 3QXVA 5KSBF 5FUCC 4C58B 1A5FH 3BRFA 4LPCA 2HVKB 5IVXF 2OI9B 3ULUH 5KG9A 1AQDB 3EO9L 4Y88A 2GCYA 1M7IB 1U58B 4KK9D 3QEUB 4NDMB 1VADA 3HCVA 1L4IA 4X83A 5I74B 1YEDB 4OF8A 1I8KA 4AMKL 2KQNA 4MJ4A 4WHDA 3CVHH 1G7IB 4PRHA 4PG2C 1J1OL 2OX5A 2X4NB 1OM3L 3HB3D 4G6AC 5DJ6A 1CD8A 3BP4A 1MRDL 3MJ6A 2VLJB 4PYGA 2YRLA 4RFNC 2DQDH 5SWSB 2BSTB 2WV3A 4AM0B 2BVYA 3ES6B 1KT2A 3BP5A 5C0DA 1PKQE 2XG4A 3CFJB 1K8IB 1S9VA 4YR6B 1D9KC 4JFEA 2EDOA 2F74B 4BQ9A 3QRGL 1TVBA 1FDLH 4M5ZH 4TVPL 3K4DA 5AEAA 5SWZD 4XPAH 4OLXH 2WUBL 1NFKA 1B0GB 4TOYL 4F7TB 2APBA 1KJVB 3BWAB 1KB5H 3MRCA 3T09A 3BZ4B 5GS0L 1NGYA 1VFAB 1UZ8A 5HXMA 1MIEH 2AERT 3ZYOA 3QIUC 1IC7L 1GRWA 1QKZL 5EA0L 4Q9QH 2CLVA 3AU1B 5ISZA 3QDHA 5BRZA 2NLJB 1OAXH 4XAWH 3VU2A 4BA8A 2B4CH 2CKNA 4MXQC 4G6KH 1RUMH 4JVPA 1RIHL 1MCIA 4L29B 1GYAA 3QHZH 4HFWA 4DW2L 1ZLSH 3U36A 1AD0B 1HQRA 1VCAA 4XWOC 4NQCD 3WNMA 2GK2A 3AREA 5IMOA 4GKZB 1NUDA 1T5WA 5B3JE 4P57B 4XBGA 1NUGA 1W0WA 2WBWB 2E7BA 3CNKA 4G7VL 1PW3A 5HGHB 4KRPB 2P43B 4WVRA 2BVUA 1EXUB 4MDIA 3UTSA 3U79A 5DLMH 4EN3B 4LNVA 5IHZB 2GFBA 3MV8E 4NQSB 3QIWC 4DN4L 1NMAL 5FECB 1FLRL 1OB1A 5LWYL 4ZUUA 3IDUA 4JRXE 2BNRE 3G08B 1IRAY 4ZODA 1FNAA 4FQXD 1MCRA 5JW4N 1A47A 4TSAL 3GSVA 3QNZA 1DN2A 2H32H 4BFEA 1Z9SA 5FYLD 2VITB 4WTWA 3TFKD 3H7LA 4PG9B 1U8QA 1A0QL 4K94C 1U6AL 1WEJL 1CLOL 4G6FD 3SKMA 1S7UA 4KUZH 3S34L 4OSUL 3IFLL 4LSUH 5ACLA 1DVFA 1RZ8B 2NX5E 3FB6B 1DANU 3NH7H 4LVHC 5F7UA 5IQ9B 4ZOBA 1ORSB 1YNKH 1CT8A 2NXYD 4ZS7H 3VFWB 2G75B 4KK6D 3GSUA 4FNLH 3KAAA 4OZGB 5C92A 2VIRB 3SQOH 3W39A 1DUZA 1LEIA 3WE6B 4QCIA 3EO0B 4XPGL 1OLLA 5C9JB 1U8MB 4IHOA 4HKZB 1F4YL 4KK8C 5FYKH 4PJ7B 3MYJB 4PJFA 5F7EH 2Y36L 1KJ2H 5T1KB 1JV5B 3UBXI 4R9HA 3LN5B 3ARVA 4DUVA 1NQBA 4Z95L 4LVNC 4PJGE 1RIVL 2X4RB 2YSSA 2WZPD 2HT4C 3RTQA 3P4MA 2A6IA 3FT4A 4OD1H 1WZMA 4GLRI 3ULVF 2LU3A 3C8HA 4OFYD 2X4UA 3GNML 3WHE1 4WI2A 3MRKA 3SQBA 5LGHH 2BX5A 3GK8L 3W2DL 3CCHB 4K9EH 5CEXA 1X5XA 4NKMA 4NOFA 1NBQA 2Z91A 5KVGL 4ODVL 5I17A 2EIDA 1LO0L 5AZ2H 5B38G 4BQ6A 4OGYH 3DXAB 3LHPH 1I8IA 1NBZA 2UWEB 3F7VA 1SBSH 5E6ZA 1WFUA 1RURH 1LP9E 4ZS6D 1A2YA 3NIGF 4PJ8D 3W0WE 3OKYA 3G5VA 2VXVH 4Z7UA 1KGCD 2IBZX 1U3ZA 1A4JA 2XRAH 2ZUVA 4IDJH 5GHWH 3CVHB 5JW3L 3EFDL 4OCRL 1KBGH 2J1KA 1UGNA 3G6JB 4HK3N 3SY0A 1EBAA 4EUPG 1NLBL 3HRZA 5FB8B 5KW9L 5F7DB 4C4KO 3SE8H 2JF1A 5HJ3B 3UBXG 1JHTA 1IT9L 3E3QE 3R8BB 5GPRA 5L7XH 1LEKB 1CYGA 1YY8B 2ATPA 2LAAA 5TDPA 4HXBL 1F4AA 3S88L 2DQIL 3AB0C 1YEJH 4S1SL 4APQA 1FBIL 4ZO9A 4ZAKD 4CKVX 5FOBA 2EO9A 3ECBA 2QSTA 4N0FA 3LIZH 5E2TL 4LSRL 3MV9A 4PJ9D 4M00A 1FO0B 4N0YL 5MEPB 2OXGA 1NBVL 5F9DC 3WDHA 3LMJL 1KB5B 5IUSA 2XYCA 1BJ1J 5T3XL 1NCBL 2DLIA 4UIMB 1OGTB 4D3CH 1IEAB 1CG9B 3GZKA 4LP4A 1O0VA 3TNMA 1JF1B 4MZ2A 4OF0A 3AS0A 5D7LE 3R8QA 5F7NC 4X0KB 2ILLA 1ODAA 2NY4D 4I13B 1DDHB 4GMTH 4QRQB 1P6AB 2IADA 4G80B 2X41A 3GSNA 1CF8H 2AXFB 4TRPL 2QQKH 3V0VA 2PNDA 3LKNA 3OHXA 3TVMD 2ARJB 3BKMH 1F11B 3GMNA 4Q0XL 4JFFA 4N68A 3ZT6A 2P5WD 1ZWIB 1UKQA 4NNPH 5KSAD 5TDOA 3JWOH 1DEEA 1L0QA 4JM2F 3GSNL 1S7RB 4LCWE 3I75A 4IMLB 1KIQB 3AAZB 4WHYH 3FOMB 3KLAB 1S5IL 1UM5H 4HK0B 1ZKAA 3QCVL 2AJUH 3TIDA 5D1ZA 5GSVA 5IB5B 1JN6A 5D2LF 3LQZB 5J6GA 3WFDL 4K2UL 2ZSWA 2CR6A 4H1LH 2GJ6D 5DEZA 4W4OA 3O8XC 1FIGH 2H32B 3ARFA 2EDKA 2EKSA 3ARSA 2ICWB 3HI1A 4R8WL 5IB3B 3CFDA 4HDIA 1BF2A 1KELL 4NO0A 4V1DA 4X4MA 2A77L 1D5XB 2VSDA 5HHMD 4UDTB 1WBYA 2BC4B 3B6SB 3QNYA 4NWTH 2QSCH 2IPKA 5CEYA 3NZHH 4RWYL 1KIPA 2FJFB 5LAXB 1H15B 1BF8A 3RWHB 2VXUH 1N6UA 2UUDH 3O2VH 4MLIA 5J3HC 5LVEA 3AUVA 3QEQE 2VRAA 1R3HB 5D8JL 5TF1H 2C5DC 1CVRA 3BUYB 3HAEB 1I9EA 3AROA 1KUMA 4IRSC 4FQCL 1ZSDB 4XWGH 4PS4H 4XP4L 3C2SA 4RQQA 1V7NH 4IBLT 4R26L 1P6FA 2DM7A 3NAAH 4Y19D 4PRNB 1J5OL 2WP3T 1HSAB 3DMMA 5ICYA 2A74A 4JFZL 2Z92B 4HUMB 3SCMA 4KDTC 4M6NL 3GSXB 3MRHA 1CXIA 2I9TB 2ZUQC 1JHKL 1MOEA 3DECA 3RX7A 4I2XB 3SE9H 3CZFA 1X6NA 1SYVA 4O51B 2Y4SA 4ALAH 4R4BA 4DZ8A 3L3JB 1MH5B 2F54E 5T1LD 4F3FA 1NSNL 4RX4A 2VE6B 3K2MC 3QUZC 3QHFH 4Z0BH 2XPGB 3TJHD 4WI8A 1HIMH 5AUMA 1T04B 3TZVD 5DWUL 2D9QB 4PGCB 4U1KB 4P2RB 1QZ1A 4FQHB 2DDQH 3QUYB 1T03H 4OQTH 1RZKL 2P47B 5E94A 4ZFGH 2VXSH 1BVZA 1DQJA 5I76A 2MHAB 3C08L 5ACZB 1FFRA 3I9GH 4OUUB 5ICXB 1HCFX 5TDNB 1KC5H 4MVBD 3WN5A 3S35X 1ZVYA 3PDOA 1CQKA 4ODHH 4WGWB 5EO1B 3S8WA 2HTLC 2VXQL 1FNSH 3VRIB 3BQUA 1KCKA 3UTTA 4XXDA 2VXTL 4NKDB 3BYYA 3ALWA 5SWZE 5DEFB 1V3LA 3HS0A 4OI9A 2B7DT 1PEWA 2DLTA 1FFPA 5SV4A 1BM3L 2YWZA 1OTSC 4F9PA 2C9AA 4Y8DC 2OK0L 3BVNA 2AABL 4PRBB 1CE6B 1JPFA 1II4E 1NC2B 1WBXA 4X4YA 3EYQD 4OZ4A 5B39B 1Q9WB 1LE9A 4AH2B 4NPYA 1ZS8A 3S37X 2BJMH 4NQCE 1SHMA 4B0MM 3F7QA 3BPLC 2YA0A 3N1GC 4S1DD 5FHBH 2XN9A 4HQQH 5IR1B 4G8EB 3VFUA 1NANH 5IBTH 3T4YB 5I1IH 3INUH 4QRRB 3S4SB 5LQBL 3HMWL 5JUEL 5DD3H 3P0VH 5E9DB 3C5JB 1RSFA 4LLUB 4H5SB 4JRWA 3SGKC 1IQWL 5SWQA 1FORL 4P9HH 4GQ9H 3FCTA 3QDGA 3P9MB 3BZEB 1FL6A 2JJTA 4JQIH 4R2GD 4UQ3A 4A6YA 4OBSA 5CZVL 5FYLE 3MRNB 1MHCB 3BH8A 1K9TA 3PL6B 3TBSA 2DI7A 4LIQH 3PWNB 4YHOH 3D3VB 5EOCL 5TGBB 4U1HA 4A6YL 2XZAH 4LSSL 2DF3A 5IF0A 3OXRB 4B7IA 4K7PH 1VDGA 5MERB 3LS4L 3L6FA 2H41A 5EZLA 3L7EB 2OCFD 4CN4A 1T4KA 4WWID 3SDCB 1A1NA 4PTUA 5HI3C 1KENH 4JJ5A 1A6TB 3LH2L 3MLYH 4PRPA 1I1FB 1HZHH 4MD0A 1AHWA 5KVFH 3E3QC 4PJHF 5A2KH 3FAXA 1EEZA 2AV7A 4QXWA 2H8PA 4G5ZH 1RK1A 1JMXA 1JNJA 1T6WA 2VDQL 2ZOKA 4KPHL 4M6ML 4RIRB 1QLEL 5BV7H 1T0NA 4JREC 1K4DB 3FQRA 5C2UB 3VH8B 4UILH 3DVGB 3ZDYF 3P4OB 3H6JA 4KQ4L 5TFSH 1S7TB 4NKOB 3KPQA 3NCJL 1YC7A 4DVBB 2OXHA 1OGAB 4OD2A 4CW1B 4ELKB 4M7JL 4GW1A 4KQ3L 3D0LA 4NUGH 3QO1A 1HYSD 4L9LC 4P46C 4LHUB 5DK0A 1CU4L 3O6ML 2D7MA 4NNXB 4P23C 3GSQB 1U42A 3V2AR 3RWCB 4KVCH 2YD3A 4Y2DA 1FGNL 5JORA 5E8NA 2A6KA 1A7NH 3ZKND 4JAMB 2VLJD 4NHUA 5I1AA 2DQCH 2ZKHH 4JANA 5SWSD 3E6HB 4Z77B 3RVXC 1I7RB 4JQVA 3FONA 2YUWA 1KGCE 1EGJH 4ERSH 4YFEA 4JVUA 1I3GL 4XCNB 1MJ7H 3WS6A 1DQLH 1JI2A 3E2HC 2QQQA 4U3CA 4DAGL 5DT1L 4YUEL 4LCCA 4JRYB 4LDOB 4TSCL 2H9GB 3O4OC 4PJIA 1S9XB 4QRUB 5FUZL 3S3PA 2IQAA 3KYNA 4YHYC 3R06A 2BOBA 1G9MH 2QQNL 4U1MA 1DBAL 3HNSL 4WEUD 3NIFF 1XIWB 5I73B 1RD6A 3QXTA 4JFOA 5FK9B 3TN0C 1J88A 1JWMA 2FSEA 5F9OH 1MCPH 1IFHL 5CIPH 2AJYH 2VLKB 3C60D 4LF3A 5E4IA 3QA3A 5GRZA 4XCFL 4LDLB 4JFQB 3CK0H 5J6HA 1OWRM 1U8PA 1Q0XL 1IM3A 4KRPD 3HUJA 5CHNB 5EFIB 2NZ9C 4P4KB 4AEIL 1FGVL 3V6ZB 5EU4B 1TMCB 4QRPB 2EXWC 5E99L 3IU3A 3MODH 1GGBH 4EN3D 5J89A 5DD5H 2JCCA 4FFWC 1KN4H 4NNYA 4EOWH 1FNGA 5JW4Q 5D7IB 3B83A 1EHAA 2FHBA 4MAUL 1UM6H 4XC3L 2HLAA 3O11A 3ROLB 1PY4A 3ZE2E 2P5WE 1JGVH 4D8PB 3IB4A 4ENED 3U7YH 4LSVH 1LO3L 1UVQB 2AXGA 2D7TH 3SGEI 1N2RB 2WBJD 2GT9B 3BAEL 2FHCA 3IXTB 1FG9C 4KMTH 3IU4L 1CK0H 1PSKL 4NFBA 1MREH 2QKIB 2WUCH 2VZOA 3RDTC 1AO7A 4Y5XA 2BNQA 2H6PB 2W0LA 3CSYB 4PJEA 1TCRB 4GG6E 4HWUA 3JUYA 2GJ6E 5C9KA 4YZFE 4OZGF 5INDB 3VW3H 4H1LG 1Y6NR 4UMGA 1SVZA 2BVEA 3RZCB 4BFBD 4P59L 4DK3A 3B9KA 4PLJD 1U95B 1YJDH 4ETYA 5HHME 2MQ0A 3HNTH 4KK9C 3L7FB 4OF5A 4MJIA 7FABH 1U92A 4R7DA 5T1KD 3CFIC 4LK4A 1H5BA 4LHJB 4O4YL 5DD6B 1RUPH 3CMGA 5DMKA 4MA8L 2WK2A 5M94B 3ZE0F 2EDWA 3QDJB 4J23A 5HPMA 1HNFA 3HB3C 1HYRC 4UB0H 1ZLUK 4U1JA 3BEWB 1MLCB 4XNZB 4IRZH 1TTUA 4P9MH 3K2UH 4QHMA 3FO1B 2FD6H 5HYQA 4L8SB 4JDZA 1W2KT 2APFA 2EEAA 1MCJA 2HRLA 2P8LB 4FN0A 4WW2B 5BVJA 4XCYB 5BV7B 1VFBA 2VZSA 2EIZB 4Y1AA 5I1KH 1NAKL 1ZANH 1NUNB 3U0PA 1ZA6B 2UZXB 4XNXH 1KFAL 3L3GA 3ULUD 4Y19E 3OPZH 4ISVA 3TBWA 1UCBL 2DQJH 2Z8SA 3QNXB 5ITFB 1R3LA 2CLZA 2VDKH 3RUGE 3SJVD 1A4KA 3MRPB 4EZMA 5DD0L 2X4OB 2HRPL 1BJ1H 1T2QL 1QSVA 1OPGH 3LD8C 3RGHA 1SY6H 3OZ9H 3B3IA 4BH8A 4LSTL 5C0CB 3TH3T 5C2BL 1HWHB 1DQQB 3DO7B 4K23H 2IAND 1A6UH 1P4BH 1J7VR 4OCYH 1ZMYA 1KEGH 3O6FA 5HGBA 2NY5H 2JB5L 4S11A 3HZYB 4PR5A 2YD1A 2KBGA 3CPLB 2CK0L 2CJUH 3KLHD 3MGAA 2FEEL 4UOW1 4OLVH 3PHOA 2KUTA 2OL3H 1CDGA 4LRNH 5EO0A 3Q0HA 2AI0L 2Q6WB 2R56L 2JIXA 4N5UA 3QZWA 1I4FA 2K3TA 5SX5K 3VDCA 3MV01 1AGBA 3IS1X 4P2YA 4FXKA 1E6OL 1RUKL 3P77A 2E6JA 3UROR 4FS0A 4FQXC 3UDWC 1QVOA 3EO9H 1DLFL 4X7TB 3DBXB 2F5BL 2ZG2A 1U3YA 1ZGLB 3TFKC 3VFPB 1G7JA 4AMKH 3ME0A 4GOSA 5CIPB 3VGDA 5A16B 2BVPB 3Q2CA 5CSZA 1L0YA 3VJ6B 5C08A 1J1OH 2FYYB 4OLWL 1U8JA 3OF6D 3GIVA 2HG5B 4FTVA 1MRDH 4L4TD 1H8SA 4PP2A 1INDL 3V0AC 4NHCL 5HHQA 5DC4B 2DM2A 2OTUA 2NXYC 1S7VA 3L5IA 5A3ID 5GS1C 1VB9A 4KK6C 4XZUA 5DJAB 4L8CA 4N0UE 3M17B 4N0CD 2QBWA 3QPXL 1KCRL 3WDJA 5E70A 1DUYA 1GXEA 4R7NB 3QRGH 2M8XA 1IGCL 4QGYA 2ESVB 4PTTA 4TVPH 2V7NB 5DQJA 2Y9RT 2Z4QA 5E6ID 3T3PF 2WNGA 2WUBH 3D85B 4TOYH 3OJVC 5DR5L 5GGUB 4OBRA 5GS0H 1IC7H 1ACYL 4Z7QF 1QKZH 2G5BA 4X6EB 5EA0H 5JHDA 1I7UA 3PABB 4GBXD 5L9DL 1GZPA 4M93B 3ZTJG 1RIHH 4LNRB 4DW2H 1F4XL 5HGDB 2EDRA 4L3EB 4RRPG 3ESVF 5EUOE 4YDVB 5DVNA 4HT1L 1QG3A</