1JGLH

Crystal structure of immunoglobulin fab fragment complexed with 17-beta-estradiol
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
216
structure length
206
Chain Sequence
QIQLVQSGPELKKPGETVRISCKASDYMTSGMQWVQQMPGKGLKWIGWLNTQSGVPEYAEDFKGRFAFSLETTAYLQINNLKNEDTATYFCATWGGNSAYWGQGTTLTVSSAKTTPPSVYPLAPGNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig kappa-chain
publication title Crystal structure of a recombinant anti-estradiol Fab fragment in complex with 17beta -estradiol.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 36
structure length 206
sequence length 216
ec nomenclature
pdb deposition date 2001-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jglH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jglH02
3LAFA 3MZGB 5GZND 5T1LA 5FYJD 4Z76B 1H8SA 4XNMA 5SWSB 3CAFA 1A3RH 4WW2B 4QT5B 4L3AA 4L4TE 1MOEA 3W9DA 4HBCL 1U95A 3VI4F 4YFEA 3VXTA 5F6IC 1CGXA 3DSFL 3TO4A 5ALBL 5DJDA 4YX2L 1WC7A 2H32H 4JM2D 3MV7E 1JGUH 1MFNA 5A16B 2LABA 1NMBH 4JG0H 4LHJB 1VGEL 1S3KL 4OUOA 3ZMRA 4P2RA 2PYEB 4KRNA 1WBXB 5DJ0B 3BN3B 1P7QA 1J8HE 2G75B 1LDPH 4ZNEA 3FRPA 5KSAD 4O2EA 2CLRA 3FZUD 3E1F1 4WIQA 4MDIB 1H9VA 4I18C 2R4SH 4PBWD 2XACC 3VW3L 5EPMA 2R1YB 2DDQL 1CCZA 1L6ZA 1L0XA 4NFDA 2VDPH 4TNWK 3U7YL 5SX5H 3H9ZA 3KXFA 4OF3A 3VA2C 1FZKA 4LEXH 4NQCD 2GK2A 2EYTA 2EICA 4WHTA 1KPUA 1WCBA 3HS0A 4MD5A 3T04D 1CF8L 2HKFL 5L0QB 2VLJA 4R3SB 1ES0B 3BZ4B 3GMQA 3OKMB 3RVVC 1CLZH 2P5EA 2CKNA 2YUZA 2CDGA 4ONFH 5D5ME 3OX8B 2VUYA 2B7DT 3AXLB 2JIXB 2HFGL 1BBDL 1HILA 4PJXF 2C3VB 2ICEB 4HFWB 1UM5L 2X89A 4QRUB 4WU7B 3VXPB 3LEXA 4URTB 5HHXL 3A6CH 3BN9C 5DDHB 3T0WA 1QPPA 3FMGL 1KN4H 2C1OB 5BV7L 2E6QA 4G7VH 5GGRB 3VWJB 5ETUA 1M6OB 3O8XC 3QIUD 2CPCA 1FVCB 1EEYB 4P2OA 1WITA 4YBLB 3WUWB 1JN6A 1N2RA 1YNLH 3QB7C 2Z31B 4KPHH 1RUQL 2F8XC 4XC1L 4LCWA 3WNMA 3CNKA 1R3LA 4NHUB 1OP5K 4F3FB 1NPUA 7CGTA 3SDAB 4HXBL 4JRYE 2BFVL 2C7UB 3FOLB 1BM3H 5DHXB 2BDNL 1PFCA 2DM4A 1MHPL 2VRAA 4H25B 3REVA 3B2UC 2AJXH 5E2UL 5K9JL 1UH2A 2DQCL 3ARFC 3ZT7A 3RTQD 2NXYB 3GGWA 3MRMB 1T6WA 3MV11 5F9DC 4OT1L 3KPRE 1L9MA 3CDGA 1VA9A 2C3HA 3QSKB 2ICES 4PRPE 1ITBB 1YC8A 4U6TA 4NIKB 5GGVY 2VXUH 4C59B 5KSVA 3VFRB 5EUKA 4JRXE 5FA3B 2LAAA 3B9AA 2NY5L 3OKKA 4PJIA 5ID0A 2A0LC 1O7VA 3P30H 3QWQB 4GRMB 3VXUB 2EIEA 4GW1B 1S7RB 2YD3A 4C58B 2RR3A 3EHBC 1F8TH 1AGCA 3FJTA 1QKZL 3NVQA 4DN3L 2FEEL 2WINA 1OF2A 5DZOA 3AUVA 4YIQB 4WWKA 2I9TA 5JIKA 4JFOB 4ELKA 2X70A 3UTSB 2WP3O 5JA9A 3WN5C 3BDYH 5C0EA 5TDPA 3GSWA 5TQ0L 5DWUH 3IDYC 2Q20A 1PVHA 1F4YH 3SDCC 4BZ1L 3D0LB 4KRLB 1VERA 5T5FH 3UDWC 1UKSA 2GFBB 3KG5A 3OB8A 1FL3A 1FYTD 1I1FB 1J0YA 5GS1B 5EIQA 5GISL 4JGUA 1M05A 1TPXC 5HDLA 4CL7A 2F5BH 1KACB 2D03L 2YHGA 4U1LB 1C5CL 3WIFA 3W9EB 1ZWIB 3BKMH 3CLEL 4AEFA 3QEGH 3O6LH 1JI1A 3LPWA 4IOIA 4UAOC 3MYJB 1FFPB 5IFHL 1R5IB 1X4ZA 1U8OA 2ZNXA 1ZGLP 2W07A 5SWZA 3P40A 2W9DH 2OTWB 5IV2A 2G9HB 3PWLA 3QFJA 4U6YB 3QA3A 4EQ2A 4XCNA 4Y4KC 1WT5A 4P49A 1RAMA 1A2YA 3X14B 1HDMA 4BFBD 1PDKA 4GMSH 4YDJB 3D87B 2CQVA 3L9RB 2FYYB 5JPMB 5J8OA 4NQVA 2QSTA 1YJDC 3H9SA 4HXAL 4PJCF 4OB5L 3IFPA 2Y23A 1UKTA 5E94B 4K8RC 3SCMC 2ZSVA 1HKLL 2VZSA 4MHHG 4YNYB 4XXCC 1CG9B 4Q6IC 4X0KB 4NHCL 5D2NC 5DMKA 1PG7W 4WFGE 1QQDB 3K4ZA 1I9JH 2V17H 1KPVA 3NH7H 2B2XH 4KKAD 3BT2L 4F58L 1Z9MA 5AYQA 1AY1H 4WEMB 1NCWL 4OAWB 5FHBL 4YC2B 1IGFH 4MJIE 2GUOA 3MRDA 3MBED 3RNKB 3GHBL 2X9WA 4PJAB 4NO5A 5LQBL 2VAJA 4YXLL 3K2UL 1KB9K 5E24E 2D7PA 5DI8B 2P8MB 1JWSA 3BIBX 1N6QL 5IOPB 4NO0B 3B9KC 1VFMA 2EKSA 3C5SA 1TDQA 2HWZH 2BMKB 3IDGB 2F53E 3LKRA 1KELL 1NBZA 2WUBL 4KJQC 2KL6A 4JPVH 1BQUA 4QF1B 2EEAA 1HCFX 3CSGA 3IVKA 3HE7D 4EJ1C 5FA4A 1PD6A 4HT1H 1HHKA 1RUMH 3O6KH 2HFTA 1HQ4B 4GSDH 2X1WL 2BERA 5DEFA 3PE9A 1TCRA 4NN6B 1ZVSB 3RGVD 4BSVA 4N0UA 4NP4H 1XGRB 1K4DA 3QUXC 5FUZL 3IKCB 4KUCF 3HC4L 3SE3C 2O5YL 4OGYL 2BOBB 4N90D 4P5TA 1KCSL 1N0XL 1BQHA 4PREA 1SEQH 3BZEA 1D6EB 1UKQA 3DX6B 5IG7A 3VXSA 4F8TA 5DVLA 1JPFB 2L7UA 3VFTB 5D72H 3UTPE 5C71A 3MLUL 3QUML 1XR9B 2YSSB 5DO2D 4NRYA 4Z5RB 2JCCE 4M61B 4TNVF 4ZFOL 1GYAA 4A6YL 4L4TD 3CVHL 4KKCC 1EO7A 1JF1B 1CE6B 5CSZB 1WBYA 4FXGB 4OLVH 4OZFA 3MLWL 4RIRA 2IQ9L 2FLRT 2P42B 4MGXA 1BWWA 5KVDH 4OIIL 2BJML 4WY7H 4HIHB 3O45A 4Y2DD 4Y5VB 3FCTA 1KLGA 1B0RB 1JV5A 1I7UB 1BFOA 4HPOL 1HHGA 1U8LB 3ECBB 4U2ZA 4GQPH 4L5FH 4NQXA 4DTGH 1CFTB 2AERT 3B5TA 3PXHA 4S1QL 2JB5L 2MCG1 1S8DB 1YYML 1X5IA 1A14H 3DMMC 3TA3B 1NKRA 1LK2B 3C08L 4HMEA 1MQ8A 5C0IB 3MGOA 3OKOB 1UH4A 1I9EA 3PGDA 4E0RA 1NMCB 2AXFB 1T0NA 3O9WD 4P23C 3FFCB 3NCBB 2W92A 2B4CL 5ITBL 1OLLA 1YUHB 3PWVB 2H6PA 4OV6F 4FZ8L 2MHAA 4BZ2L 3MRCB 2F15A 3W0WD 3VH8B 5I1IL 3GKZA 3KDMB 3HPJB 1DUYA 4XP6L 5FM5M 2E8ZA 3P9MB 1BAFL 4FTVA 4EN3D 2OTUA 4Y4FA 3L7EB 2FNBA 1IC5L 1IM9B 4XP1H 3EIFA 3D1MC 1I1CA 2H3NB 4JPWH 2WWMD 2VLME 3I3BA 4WFEE 1RZJH 1FNEA 3DVIA 1AR1D 2YPLA 1SMOA 3GHEL 2CKBH 5F1SA 2EH8L 1M7IA 1JPTH 3IFOB 4NJ9L 5HGHA 1WVZA 4X6CA 2IH1A 3BMWA 3TO4C 2EZ0C 3JWOC 3X3FL 5HDQH 4NJAL 2ID5A 4PJEF 5EZJA 3BWAB 5DGQA 4NC2B 1DN2A 1H15A 4BELD 5CKAA 3VH8G 4ZTPL 1AFVH 4Z7NF 3BQUD 3O81A 5H37G 3VG9B 2YD1A 1WGOA 2BNRB 4Z76A 1CR9L 5JLZB 4H88L 1X5HA 1QRND 2XKSA 1FL6B 4M9OA 5JHLH 4MS8C 4X83A 3ARSA 2ADFL 4RMTA 4YDLC 4AYFA 5I8CA 5FV2A 3ISWA 5L8KB 2DD8L 3MXWH 3QEQD 1KCVH 3DO7B 1WLHA 2YWYA 3MRLA 4F7MB 43CAB 4AK1A 1BREA 2YMXH 3OG4B 3TM6A 1C1EH 2DBJA 4I48B 3CFKA 5HYQA 1VCAA 1WWWX 4NUJB 4TVPE 4N1CA 3BJ91 4LIQL 2FLBT 4ONOA 2FHFA 5CILL 3ZKQD 1GOHA 1JNNH 1NANI 1U8NA 2G75A 2R0LL 3Q3GB 5C0CA 3DVFA 3BKCL 3F7QA 3KHOA 3WSQH 1RIUL 2NY4C 3D39A 3MLYH 4Z7UF 5MEND 1A22B 4X9BA 5HHQB 4OM0L 1IEAA 2RFXB 4PRHA 3T08A 2XG5A 3GBML 3AC0A 3LSOB 2EIDA 2D9CA 3DUSB 1RJCA 3FHQA 2CJUL 3O11A 4OTXL 4K3DH 3KJ6L 3SDDA 4U1NA 2A6DB 4TPRL 4LKXB 5D2LF 3WHE0 4HGKC 2H9GB 1IL1B 1AO7E 3BZ4A 2OLDA 4YR6A 3HI6L 4F7EA 5T3XE 1YPZA 4HH9B 4P2OC 4BH7A 3UX9B 1KJ2B 5DMGD 2DTMH 3OX8A 3ZTNL 2DDQH 3AXLA 2HKHL 3SJVE 2PW1B 4KV5F 4RWHA 4QRUA 1UJTA 4OM1L 25C8H 3VXPA 2NY2C 1F58L 1FVEB 2C4XA 4RISH 2UY7A 5GS0C 1U41A 1CF8H 2Z92A 2HKFH 1S7UA 1WUNT 3GEWB 1QLFB 2ENYA 3TO2B 1RY7B 3TH3T 3VWJA 5DJ6A 2HT3D 1OGAE 4YHLL 1ND0B 3CZFB 4L3CB 5F7FA 2W9LA 3WUWA 4MQXC 2J7LA 2OR9L 2Z31A 5LKNA 1KCRH 1UM5H 3UTQB 3S9DB 1QPXA 3MACL 2NNAB 5F96H 3ULUF 5A2KH 3MOBH 5K33A 1K4CB 4OZGF 1GAFL 4NHUA 4MLIA 3WKMH 2J2ZA 2C7UA 4OFKA 3BO8A 5I1AB 3ARGD 4XMLL 5MERA 3L5HA 1CXEA 2ICWB 2VLKE 3E6FB 5CJXA 4PJ7B 2R0WH 3JWDC 4WWKC 1UB5A 5EDXA 1MFCH 2IC2A 4WGWB 4MX7B 5DA4A 2UZIL 4EXPX 4CADB 2H41A 3W39A 4XC1H 1L7IH 3U6RB 3V52L 1ZANH 2BFVH 3QYCA 3NMEA 2Z93B 4TTDC 3VFRA 5CMAA 3OF6D 2O5ZL 2XXMB 4I4WB 4LHUB 2HJKA 1AHWC 1GXEA 3VXUA 3DXAB 4GW1A 5E8EB 1FCGA 3SKMB 1UG9A 2P45B 2Z0BA 4Y1AE 1RIVL 1U91A 1U8IB 4X7CC 4JY4B 5CP3H 3UTSA 4BQ9A 5DD6B 3IF1B 2R9HD 1G9ML 4UUJB 1BLNA 5EOCH 2YD7A 3N1MC 4GG8B 3V95A 1OWWA 1DQDL 3OMZA 3MRPB 1F5WA 1RSFA 4LCCA 4HKZB 4NPYB 3IDXL 1TETL 4JO1L 4EIGB 1RJYA 3I6LD 1I1FA 2NY5H 5I18H 4MXVE 2X6MA 4U0QB 3ZSSA 5KG9B 3MUHL 3L7FB 5GS1A 3K46A 5IEHB 5E5RB 1YQVL 4JO4H 3GI8H 2CDEA 2CKBA 3CUPA 2ZSWA 2F53D 1WT5C 5IGXH 2NX5D 3KJ4B 4LHUG 1SVCP 3IGAB 2HJFB 2Y07H 3SO5A 1SVZA 1ZWIA 4GG6E 4LL9A 4AL8H 3SGJA 4QHLA 2AJSL 5AZ2L 1DQQA 1FC2D 1OPGH 5IB1A 4UI2A 1R5IA 4DQOL 4DZBB 4PUBH 4IBLT 4PJDB 2N7AA 4DAGL 1DANU 1DJSA 5AG9A 4FQCL 5C8JB 3FB5A 3QCVH 3UPRB 2Y5EA 1V5JA 2XQBH 1LP9E 2B1HL 3RZCA 2HRLA 3BEVA 4LKCB 5DS8A 4CJ0A 3JV5A 1QSEB 1P4LA 4DEPB 5F1OB 4MXQC 1G7LB 2EXYD 3ARDA 4XVSH 2ZCKL 3F7VA 3UTPD 3GMRB 2WP3T 1F6AA 1FDLL 1KJVB 1MQKH 2YEZB 1KTLA 2OTPA 4PRNB 4YNYA 5L2KD 3N85H 3BGFC 4J3XA 5BZWB 1KIQB 2BXZA 4MMZC 1FFRA 1RPQA 4X0KA 2XWJB 4ODTH 3MCLL 1ZKAA 1QQDA 2GTZB 1RJLA 3M07A 4RGMB 5IVZB 3R0MA 3VXRE 3ZE1F 4EBQH 3IDIA 3T0VA 4YQXL 2YRPA 4I3GA 4XPBH 4OAWA 4PB0L 2ITDA 3A0OA 2X1OA 1E6JH 2AV7B 3BYTA 5H35A 4GKSA 5GZOD 5CZXD 3MV8A 1JZ6A 4JVUA 1JNLH 5E99H 3L3DA 2WK2A 1J87A 3IFLH 3LZFH 2IMMA 5FF6B 4EZMA 5DI8A 3WE6B 4DJMA 2P8MA 4ZO7A 1QLRB 5IOPA 2X4UA 2DLGA 5GIRB 1JGVL 1RZIA 3BT2H 2BMKA 3IDGA 4MDJB 4R90H 1HXMA 1XT5A 4YHIA 4LPYA 1KTDB 2DWDB 4GOSA 2GAZB 1KJ2H 4O02L 4RGNE 4UU9A 1XF3A 2VDOL 3TVMA 2HJLB 5GSRB 3LKOB 3C6LB 3GHBH 1MCOL 4X6DF 3MRQA 4PBXA 3U4AA 3DSNA 1HQ4A 3GMNB 4IS6B 3P2TA 1NGPL 3LN4A 2VLMD 3U83A 3RL1B 3OKEB 1B9ZA 4PS4L 3C8KA 5GS2H 1B6UA 1NSNL 3JV4B 5C0DA 1A6PA 1YC7A 4XC3L 1S9YA 2BOBA 4RBPH 4WNQB 3QI9A 1ODAA 1UH3A 4AIZA 1D6EA 5KSUB 2DLEA 3DX6A 4P4RA 4ONGH 5CJ8A 1NUFA 4NM8L 3MA7B 5J9PB 2OSLB 3MTRA 3NFSL 1AQDA 3QXVA 4DFHA 4IHOB 5TE7L 5FECB 5E7FA 2DN7A 4JN2A 4Z95L 4APQD 4KAQL 4JGMA 3P0VH 3PWUB 1S9VB 1LEGB 1UYWL 2DQGL 3LPFA 1U3JA 2F19H 2XTJC 3UAJD 1D9KC 4ALAH 1ZSDB 3TZVB 1E6OL 4Y88A 4R4ND 1EDQA 4PB9H 5DTFB 1UB6B 4ORZC 5L6YH 1MRDL 2N1KA 3BPCA 2Y7QB 5JNYA 3C5ZD 1J1OH 4HIHA 4Y5VA 1UQSA 1ZHBA 1B0RA 3BPOB 4LSPH 1ZVYA 3G5YB 4Y19A 5TE6L 1NCUA 4F57H 1QHPA 3EYSL 4MVBC 3DNKA 4HS8H 5A2JH 4XI5C 3TA3A 1LK2A 1X9QA 3H9HB 5ISZB 4GAGH 4UQ3A 2PXYA 5C0IA 3CVHH 5IMKB 1LEKA 3OKOA 4RMQA 4M7LL 4R4BA 5FYJL 5BVJB 5IB4B 4XBEL 3MLWH 4L4VA 3FFCA 1TNNA 3FO0L 4NN5C 1QSFD 4WFHE 5CP3A 1U8QA 5F3HB 3S4SB 2YKLL 2KPNA 1C5DA 3QNXB 3VH8A 1SJEA 2K7QA 1EK3A 2YA0A 3MRNB 3P9MA 1AD0A 1H3VA 2VLJE 35C8L 4EIZC 3RKPA 5KS9A 2NY0B 3T1WA 3PQYB 2P5EE 1IM9A 4PJBB 3BHBB 3DURB 5J1AB 5EU7C 4G8GA 4KQ3L 4PGBB 5BZDB 1CDHA 2R8SH 3TYGL 5D93B 5ANME 1HXYB 5MI0B 3RA7L 4O9HH 2FX8H 1N3NA 1LO3L 4WCYH 3SGDH 3GB7B 1QBLL 1Z9OA 3QHZL 5I1IH 3UZVB 2P47B 3S88L 1IKFH 4XP6H 1T0PB 3NA9L 4JQXA 3VFMA 4IRZL 4MCYA 4AZ8A 3VFPB 2ZUSA 3S4SG 3QDMA 1GGIH 5KTEH 1DUZA 4LSSL 4F7CA 1B0WA 4HUWB 2DB8A 4M00A 2PCPB 5L9DH 1U3HD 5CJOL 1FL6A 1X5LA 3C6SA 4LCWE 1RK1A 2MMXA 4OLUL 4Q9QH 3T0EB 3RAJH 5LWYH 1V05A 1CFVL 5C2UB 5DQDH 5KVFH 4I77L 2FB4H 1OD9A 4KI5C 1EGJH 1ZT1B 1MCBA 3LRSB 3D0VA 5EORH 5D7IA 3B6SA 3LHPL 4Z7WB 3S35L 2XZZA 4XMPH 2QEJA 4ZTPH 4YE4H 3K1KC 1JRHI 4UOJA 4H88H 4QRPB 4KFZC 1K8IB 2DQUH 4NO2A 2FCBA 5BO1H 3ESVF 5L0QC 4UIKL 1MRCH 2GQHA 2W0FB 4XPHH 3DROB 1R3KA 3CU1A 4LLYB 1V3KA 3L6FA 4L8BB 4PJIE 1BQLL 3IU3B 3I3DA 2B0SL 2MOVA 4HPYH 4P9HL 3PWPB 1JUFB 5D7LD 3TJHC 1EV2E 4FQPA 4X5XB 5GRWA 1N4XH 2DOCA 3ULVL 4JFHE 3SPVA 5D96B 4PJHB 4L9DA 4I8DA 12E8H 4NYLB 3MREB 5CILH 1E4KA 2A6DA 2XV6B 1NMAL 4XTRD 5J3HD 4LPWA 3G6AA 1RUKL 4KHTL 3VWJC 1QFWI 1QZ1A 4QRRB 4GRWE 1ZT4A 5HVHB 4YBLC 3MLZL 1LK3H 2BSTA 2DQFB 3V4UH 1TZGL 2Z31C 4DKDC 1NC2D 1Q0XH 5DJ8B 5F1NA 1A6VH 2PW1A 2NXZB 4KK5D 3SDAC 2YZ8A 2VL4A 1A02N 4OGZA 1FVEA 2F54A 4Y16D 3RWJA 2YPKB 2XN9D 4IDJL 1I8MA 4GO6B 5DK0A 3ARBB 3GI9H 3PF2A 1QLFA 5CJXC 3TO2A 2XWTA 5BVPH 1I9RH 3K4AA 2EDOA 4O58L 4EI5A 1C7SA 3CZFA 5C0BB 3IDJB 2ZUWA 2NXYC 4HWZA 3HZVA 2VOTA 2PNDA 4NKIH 4W81A 1KGCE 4NGHL 2BNQB 4H26B 5F9OL 2NNAA 1R3IH 4M6MH 4CKVX 1FGNL 3EGSB 4LOUC 2GCYB 3QDGA 4X6EB 3RVXD 1CN4A 5MEOA 3IXAB 3DUUA 1B88A 3HFMH 2AXJA 2ICWA 3H9SE 4ZO8A 3AREA 4EI6B 2NZ9C 4PJ7A 4HFUH 3SDYH 5C08B 5EOCJ 4MD4B 4PJGE 3FB8B 4LNVA 4HIXL 1SY6L 3WS6A 3MRBB 4GXUM 4MX7A 4PYHA 2ED9A 1PSKH 2XWBB 4QXWA 4CADA 1CGSL 3TC9A 1NGQL 3QUMA 3GMPB 4JFPA 3NZHH 2JKXA 5EOTA 1ZA3A 1RHFA 3INUH 1GHFL 3BE1H 1BX2B 5IESH 3QG6B 3SHSA 4ZFOA 1MF2L 4A6YA 3CVHA 5E00B 5GS1C 1PY4A 4I4WA 1WFOA 1U6AL 3U2SB 1RZJC 2AABH 5EZOH 5CINL 4ZOAA 1G6RL 5GGVH 1NBYB 2HTKC 1U8IA 3GK8L 4NO3A 4JY4A 4NOFA 5EA0L 1PEZA 3QJHA 3SGJC 2H1PH 1LD9B 4NQED 3VXMB 3V5KB 4MXVF 2J4WL 4CNIA 1ZA6A 4P2QA 4F15B 4GG8A 4QY8B 3J7HA 2ZUTA 4LQ1A 5AAWA 2FR4B 4R4FL 3VGAC 5H94B 1IAOA 1MWAB 2FL5B 3UJIH 5DJYA 2AJVH 4H20L 1K8DB 1K5NB 1BD2A 4YXKL 1TQBB 3U7WL 3KPPB 1EHLL 5C7XH 4KRMB 5GJTH 1LO2L 4OCSH 1CDBA 5GRUL 5JW4M 3TT1H 1PLGL 1Q9OB 3WFDL 1D5IH 2FD6H 5I1LB 3ARDC 1T1ZB 2J88L 4PJFF 4N0UE 4JFED 2GSGB 5F44A 3QQ4A 1U8HB 4N9OB 4OFYA 1FZOA 1DQDH 1H3WM 3NPSB 5ILTL 3EYFB 4DZBA 4GRLD 2R0ZH 2G5BB 4PJDA 3ZKMD 1NAKL 3RUGF 3O3AB 3HPLA 4WI7A 1DTUA 5INDB 5C8JA 1NBVH 3V6ZA 3S3PA 3IRPX 3B5HA 5FIEA 1SYSB 4IRJB 1WJ3A 4K3JH 4X7TB 6CGTA 2HFEB 4EXKA 4WUUD 1CICB 4N9GA 2HYMA 3ARTA 2V5RA 3IU4L 4KK8C 4PJ8A 5JUEL 3LD8B 2LAGB 1EGJA 4LVOB 1FH5L 1DQTA 1I8IB 2QQNL 1CE1H 3NIGE 1KJVA 1HI6B 3OKLA 4QGYA 1EH9A 3QEUB 4K9EL 4JB9H 1FNGB 1FG2A 1KIQA 1BOGB 1AQKH 2ITCB 1NUDA 1A3LL 2XWJA 5I1HL 2G2RB 2ZCLH 1MAML 5IVZA 2VZ3A 4XBGB 4MAYA 4QOKA 5MEQA 3FFDB 3MCKA 5BS0D 1EEZB 2OL3L 1G7PB 5EC2B 1P9MA 1DBKL 3WS3A 4POZD 1TNMA 1MUJA 2AV7A 5HXMA 1T1XB 5DZLA 2XTJE 3RWDA 3T0AA 1IILE 2MWCA 1YMHB 1DL7H 3BEWB 1J8KA 4NN6C 4X5WB 4OZIF 2OI9B 5DHYA 1BFVL 3WE6A 2FZ3B 2YBRB 4YHKL 3RVUC 3VDCA 2VSDA 4NQDA 4M1GL 4FTVE 4DUVA 1IMHC 4MDJA 1RFDL 1PKQA 5E1HB 2VAAA 1YEHL 5DVMA 5C07D 1DFBL 3MJ7A 5T1DL 2C3GA 1NC4D 3DTXA 4D9RE 3C6LA 1PBYA 2H2PD 4GBXB 1H5BB 1MFAH 4ZODA 3Q1SH 2ICWJ 3BKJL 3BJLA 5DLMH 5DQ9A 4X6CE 3OKEA 3QXDA 5DD1H 5ADPH 5HGGS 4OSUH 2BSRB 4L8CB 1FBIH 1JHTB 4WNQA 4LPVA 4I3RH 5FHAL 4Y5VC 4HZLB 3KAAA 3SE8H 3DV4B 1ZLUH 4AQ1B 2WIIB 1P7HL 3OJVC 2R69L 5JW3L 3MA7A 3S98A 5J9PA 2CDFB 2OSLA 4PRID 4QRTA 1WV7T 1C8PA 4WI8A 4YHOH 2BVOA 1KIRA 3TA3C 2R2EB 3I6GA 5HHMB 1HKFA 4P46B 1F00I 2F58L 5IVXA 4ODBD 2P49B 1UACH 1X6LA 2KQMA 3T3ME 3NFPA 3EDDA 4ZSOB 4NZDA 2D4DA 1HIMH 1UB6A 5EO1A 5HHOB 1UJ3B 1BEYL 2XZQL 5I2IB 2NPLX 3P11L 4J1UB 1A4JB 3VD7A 1KOAA 4XHJC 3G5YA 5JIHA 5KSBA 3DX7A 4KKLD 2XNAB 1ED3A 5TFSL 5LG1A 2BVEA 4LDOB 5C0CE 3CC5B 4PY8I 2Q86A 2SEBA 5I30L 1HOCB 2HVKA 1B0GB 2BOCB 2IPUK 2VDML 1PKOA 3I9GH 2EDFA 3AMLA 5I1CH 1YEJL 2IANB 3WNOA 1S9WB 5DFVC 1UYWH 2R23A 3D39E 1KB5B 1MCSA 4I2XE 5A40E 5BVJA 5L7XL 4U1JA 4QTIL 1A7QH 4PRHE 1Q72L 5E6IB 4KJPD 2FATL 4JKPH 1G0XA 1G7QB 4LPCA 4LVHC 1UM6H 1AD9B 2NYYC 5F3HA 3NFNB 3U36B 4TSAL 3SY0B 1OTTC 3MLRL 4OBRA 4TUOB 2IQAB 4JQXC 1VFOA 1HNFA 5B4MD 5EBMB 2ZKHL 4JQVC 3KPSD 4HUKB 4O4YL 1NGYB 2NY7L 4JFHD 3BSZH 1JWMB 1MJJA 3PQYA 1YPZE 2P44B 1BVLA 4FP8H 1MWAH 3VG9C 4XCEB 3EYQD 5FYJH 4ODWA 3MV9A 2BVUA 2BC4A 4Z78B 4QKXB 2GJ6E 3VI3E 1YN6B 4FQXB 1DBBL 3C09B 4Z8FH 1HXYA 2N56A 4R2GD 2FO4A 5D7JD 5DD5H 3I2CL 3K4DA 2KDGA 4G8EB 1RU9L 1C12A 1MCFA 3RQ3A 5T3ZD 1U8MB 2IADA 4HKJA 4PGDA 1TVHA 4WU5A 1NAML 1A6TA 3TBVA 3WEXA 5T1KA 3MRFA 1YMMB 4G6AC 4XWOD 1D5MA 2W59A 1OARL 1JHKH 3HZKB 3C2SA 2J8UF 3ES6B 1FV1B 1LVEA 4J3WA 2PCPA 1HYSD 3TYGH 4D9LL 4GW5B 2Q1EA 2JK5A 1J0IA 4XT1C 4NQTA 4YBHA 3OQ3B 1U42A 4LLVB 4NKOB 1MNUL 3LQZA 3MRHB 4XAKD 3T0EA 3PGCB 4KY1H 1FPTL 4LCUB 1S9KC 5GRJL 5F3BB 3S7GA 4BSJA 4TOYH 1Q1JL 1AGEA 1S5HB 4E41E 3WNPA 4AIXA 4D0CA 1IC7H 3RIAF 2EDJA 3TBWB 1FJ1A 4G3YH 5ICYB 4MJ2A 5E2VH 3JZ7A 3KR3L 1ZEAL 3TESA 5KVGH 4D3CL 4HC1L 1MCQA 1K8IA 2FWOA 2DQDL 1Z9SA 1DVFD 3V4PH 4C54A 5JW5A 4LPTA 4PJIF 5MHSE 4PG2A 1MIEH 4XPTL 2W0FA 5DJAB 4I77H 2FBJH 1IC4H 4L8BA 1SBSL 3IU3A 3LHPH 1WSST 4OLYL 1J0HA 3AS3A 1F97A 3P4OA 1CDJA 1JUFA 3O6ML 3NZ8B 4C4KO 2ZOLB 4XP9H 3VG0L 4YDVA 1BBJB 1FFOB 3EO0B 4YDIL 4UV7L 3RGVB 3QUYB 2ENSA 2LVCA 4GRWF 4OFVA 4FZEL 2VXSH 3IAGC 4UIKH 1Y6MR 5HDBE 4JCLA 4N8VB 1FZJA 3HUJB 4OGAC 1KXQE 2EDRA 2GJZA 4KWUA 4WEBL 1F4HA 3TNNB 1A6UL 5D6CA 1V3LA 1G7JB 1T5WB 3WYRA 1SHMA 5EU6D 4LLQA 1IFHH 2B1AH 1TZIB 3T2OA 3O2WL 3G5VB 4L4TB 4PV8B 1L0YA 3RRQA 1AGDB 4U0RB 1KJMB 1FFNB 2YPKA 3DYMA 3AREC 4UBDC 4JHAL 4M43L 4U05A 3TF7C 1C16A 2DLFL 3LKQB 5HYJE 3IDJA 5I8EB 4XNQB 5D1QA 3M17B 4KK6C 8FABA 3MV7B 2BNQA 4P57A 3GSVA 4N8VG 5IW1A 1A7OL 2DYPB 3BUTA 4NT6B 4HK3J 2AGJH 3KLAB 4WO4D 3JXAA 2NW2A 4FQIL 1O0VA 2GCYA 4WGVB 1J8HB 3IXAA 5F7EL 2CXKA 5B3JF 3HMWL 5CLTA 5LGJB 1QNZL 4EI6A 2M2DA 1P4BH 3H9YA 1B4JL 4MD4A 2G5RA 3FB8A 1OT1A 4BFIB 1AR2A 2J5LB 4PPTA 5IB5B 1DQJB 1I1AA 3L1OL 5I1KL 3T3PF 2XZAH 3D25A 4DUXA 4JKLA 3UBXA 1S9XA 1BX2A 4K3GA 1IBGH 3ARRA 4ODSL 4U6HB 4PJ5E 4HKXB 3B2VH 4X7DC 5IT2L 2QTEA 2XI9A 3QUZB 1NEZB 1KB5H 2JLLA 3EYUL 4ZUWA 2V5SA 5D2LB 2C1PB 3VFVB 3TNMB 2HLAB 3KJ4C 3MV8E 3QNZA 5D5MB 4HIXH 3V5HB 1UT9A 5DEZA 1OP3K 4F7TB 4LCYB 1Y0LB 3OAZH 5D70L 1N0LA 5EWIH 1GHFH 1NCNA 1KIPB 1MHCA 1WZ1H 1A6AB 1I3GH 1DN0B 4NNYA 3VGEA 2FL5A 5JTWA 2FGZA 2DMCA 1BF8A 3BP4B 3TT3L 1K5NA 3F5WB 3PJSB 4M5ZH 5E2JA 2E6PA 1FAIL 4X99B 1TZHA 1R24A 2XIDA 1QG3A 5KOMC 5E2TL 4DEPC 5I1LA 3U4EA 1NEZG 1T1ZA 2HLFD 1U8HA 4I9WE 3EDJA 4JY6B 4KTYA 4JM2A 3LIZH 1V7NH 4B7IA 3DBXB 5CIPB 5EULV 4JRYB 4GUPB 1BFSA 1T5XB 3HNSH 3EYFA 1INQA 2BY0A 3UYPA 4F2MB 4LCIH 3V9FA 15C8H 2UUDK 3MLXH 1A6WH 4YO0A 3EJJX 5SWQB 1ACZA 5CHNB 1TVBB 3HCVA 3G5XB 4EUPB 1LO2H 1SYSA 2Q76B 2XXCB 4YH6A 2HFEA 4RGMC 2K1MA 4KROB 1EFQA 5KSAA 3VD9A 3WFDH 1QA9B 4H8WL 3BKYH 3CSYB 3KPRB 1VFAB 4F37F 4LSTH 1NGXA 5ALCH 5GGTL 3QBTB 5GPRA 4PRPB 4Y5YB 1I8IA 5I1DA 2O61B 4OKVB 3KNBA 1M7DB 2VABA 3G6DH 4OZHA 4EDWL 4JRXB 4CW1B 3OB0K 4D8PA 4TQEL 3B8SA 3EYVB 4NQCA 2QLVB 5FYLL 3L3IB 1BOGA 2ITCA 3HC0B 2VN7A 4ZUVA 2GSIA 4NUGL 1LO0H 1MCWW 1OT2A 4L4JA 5DHVB 5DEGB 3RDTB 3LMJL 2BK8A 1B3JA 5KAQF 1AJ7H 2BVQA 3VGDA 2YC1A 4EUPG 1G7PA 2W38A 4P3DB 1LE9B 2QSCH 3HB3C 2IG2L 3EO9L 5JHDD 3GSNH 1XCTB 1T1XA 4WTWA 1WFTA 3C6LC 2B20A 1XIWD 4L4VE 4ZAKB 2Q8AH 3MODL 4U3HA 2MCPH 2HTLC 4G7YH 5DURB 4B0MM 2X4SB 1KFAL 4LDEB 4R26H 2YBRA 3QPXH 3VU2A 3F6LA 4MYWB 1F3DH 5C0FA 3QIUA 5KS9E 3R1GH 3BP6B 5K9OB 3D69A 2VUOA 3EJYD 5I66B 1A7RH 3FAWA 4G8GE 3SDXF 1T0MA 4HUNB 4X6CF 4K7PL 4NZJA 3U0PA 2OJZH 5E4IA 1H5BA 4XPAL 2EDBA 2W1NA 5GGSY 4HJ0D 5D1XD 4I3SH 2GJ6D 3SKJL 1EZVY 2BRQA 4YHKH 2V6HA 2JELH 3RHWF 5FM8A 4H0IA 3DX8B 3TZVC 3QDME 2BSRA 4XH2B 2UY6A 5ENWA 1JHTA 3WLWD 3RTQA 3FQUB 3DECA 2ZCHH 3RIFK 4AY0A 1BVKB 2ZPKH 1WTGT 2W9EH 1CFNB 4HZLA 5JR1L 5J6GA 3WO3B 3EO1A 2WIIA 5I17B 1Y6NR 3GKWH 3OG6B 5F72S 4J6RH 3S96B 2Y5TB 2D7TL 3BH8B 4LAQH 2F8VA 3EOAB 2APTA 3O4LD 4Z7QE 5GGUB 2AI0L 5I15H 1MCCA 1T1YA 3PP4H 3G04B 5D7IE 3JTTA 4BZYA 4HWBL 4U7SA 3HC3L 2VERN 1D5BB 1J86A 5LGKA 1J10A 2HN7B 3MXVL 2IAMD 5FYKD 2C9AA 3W81A 1QUNA 1NDMA 4MJIB 4E41D 5JW3H 1WBZB 5ICXB 2CGRL 3GSOA 4NQUA 4KUZH 5JA8B 2ATKA 4KI5F 5ITFB 1Z9LA 2NY0C 1FYTA 1B0GA 4JFQB 1A47A 5ACZA 3KWWB 2AK1L 4ODHH 4RX4D 2QBWA 5JXAL 1BZ7A 1KB5A 2DIAA 3QQ3A 5C2BL 3P9LA 1MAJA 3ZE0F 2F53B 1G0DA 3KYOB 4I0PB 5MI0C 1I1RA 5F9JB 3PL6D 2FO1A 3T2PA 3NFNA 3U36A 4OCYL 2VR9A 4QWWD 4XP5H 1GOFA 1OSPH 4TUOA 4LSVL 1YPZF 3TLRA 5BCAA 4NKDB 5C0GA 5I74B 1F4XL 1WZMA 1G9EA 3MR9A 1JK8B 3VI3F 1NGYA 5CEYA 3V0WH 3G08B 4ONHA 4W4OA 3SQOL 4TYUA 5D71H 4KTDL 1TLKA 4HUXA 5EFIB 3V4VH 1O5DT 1GC1L 2E7HA 4LLWB 5AUMA 1G6RA 1T4KB 3P4NA 2E9WA 4M7KH 2EDTA 4HUVB 2QQQA 3T0EC 1YEFH 4HF5L 5DK2A 2EYSB 3ESUF 1QSVA 1T04B 2F74B 4JKMA 4XBPA 4NZUL 1H3PL 4OD3H 4M7JL 2F54E 4MSWA 3HAEA 4XCFL 3CDFA 1K3ZA 2KBGA 2HRPL 2ZUYA 2JCCB 3IJYB 1PX4A 2VXQL 5CIPH 4MA7L 3H8NA 3ZZ1A 3FQRB 3HZKA 3P73B 4RQQB 3ES6A 4HK0A 3TCXA 1MAKA 4JFDD 5T5NG 3LB6D 1FZMB 4EUPH 2EEBA 3QO1B 4ODXB 4IOSD 1KJ3H 4N0RA 4KMQA 4M6AA 5IHZA 4LLVA 4YHPA 4CMMA 3PGCA 2A2QT 3HI1B 1LO4L 1F3JB 5F1IB 3D2UD 3QDGE 1FSKB 4Y8DC 1UCTA 5HVWA 1FP5A 3BWUC 4FFZL 2J12B 2BHZA 1PX3A 5E8PB 1W0YT 5FCUL 3MBEA 5F7WC 4F9LA 2E6JA 4GKNA 3WD5H 2ADGB 1DBAH 5F6IB 5ICYA 3BUYA 4LBEA 4GAJH 2WQ8A 3LS5H 3VD5A 5C6PB 5F9AC 1JGLL 5J6HA 3GIZH 1MCPH 2EIZA 1VADA 3LKNB 2ZUVA 4ENEC 5IW6B 4L3ED 4PP1C 3AY4A 3GZKA 1WIUA 2ATPB 5DHVH 1KLUA 2JTDA 5HVHC 3CFIC 4NRXB 1AGBB 4NSKB 1VENA 1MJUH 3GSNA 3RBGA 1TTUA 5CJQL 2PW2A 3HE7A 3DV6B 3LKSB 3NZ8A 4OUUB 4MA8H 3BW9B 3HZMB 1FFOA 1ZEAH 4MNHA 4GXVH 3RGVA 1ZGLB 4G9DA 2EDHA 2PTUA 6FABL 4CDGC 1VGKA 1WFNA 5FO9A 4P2QE 43C9A 3ARBC 2OL3A 4G42A 3MFFA 3BN9D 3C9NA 3H42L 4N8VA 2GKIA 3HUJA 2RCSL 4MJ6B 5HY9B 1IGCL 2VXTH 3ETBF 4LQFL 4OLYH 2B5IC 1BD2E 4UT7H 1DLHA 2VDRL 4KKBC 4TUJB 4NRZB 1A1NB 1TZIA 3NCJL 4UV7H 4HIEB 4JN1H 3ZHDA 2H8PB 4ZPVA 3T8XB 1KENL 2V5MA 3FT3B 3IJHB 4L4TA 3U30B 2P7TA 4PJ9B 5LBSH 2WSKA 3BRDA 4AH2B 1P1ZA 4FFWC 4Y2DA 1LO5A 2FEDC 1SJHB 4YHMH 3M17A 3PWJA 5ESQB 2HH0L 1I1AC 1AE6H 4QYOA 2X2YA 4N1HB 3L3GA 1UGNA 1JMXA 2VDKL 3O8XB 2CMRH 4M1DL 2EYRA 3QAZB 4C4KT 1YECH 2EE9A 5GHWH 3KLAA 4NWUH 1NUGA 1T21A 4JRWA 4C56D 5CEZD 4JPIA 1A4KA 4J4PD 3O9WA 1JTTA 4ZS6C 5DJXA 4OCRH 1IEBA 3U0WH 2NTSP 4LP4A 4ZFFB 4EVNA 4YHZL 5DRXA 4LVEA 2VDQL 4M43H 3REWB 2VC2H 5FGBA 4DVRL 4YLQT 2BSED 1OB1B 3W0WA 2DQTL 3EHBD 1KT2B 3L3HB 4BFIA 2R56H 2CD0A 4EOWL 3OXRB 4F15C 3F7YB 4ZPTA 4EN3A 1CL7L 2QADC 3FHAA 2NTFA 1T7XA 4ZFZA 4QOKE 3BP7B 4WTZA 4DKFL 3PHOB 4U6HA 4UDTB 4HKXA 5FOBA 4RWYH 4D0DB 4Q0XH 1ZLVK 3OPZH 3SDCD 4WTXA 3EOBB 4JPKH 1TQBC 2APBA 1AO7B 4PJAF 5E4EC 5C70A 5CSGA 2A6IA 2IEPA 3WLBB 3MMEB 1U2HA 2VH5L 3VMNA 5I1JL 3V5HA 1EMTH 4LIQE 1IARB 3X12A 3CFCH 3KLDA 3N9GL 4QTHA 5DUBA 2UYLA 3SJVB 4NKQB 4HS3A 2C26A 3BYYA 1W72H 4LPUA 2BHUA 4K2UL 1WAAA 3NAAH 2R1XB 4K94L 3NPSC 4NQDE 5KJRH 1DCLA 1A6AA 1BMGA 5ID1B 1GIGH 2PYFA 3BQUA 4HD9A 3DPBA 3TV3L 3G6JA 3O3DB 4NZTL 4LASL 4TULH 1G7MB 4FQQB 2BY3A 3BP4A 3F5WA 3PJSA 3IDYB 2IBBA 5KZCB 4ZUUB 1FC1A 1DP0A 1OGAB 3GJEB 4KVCH 3P9WB 4V2CB 4IEFB 3PG2A 1ZVHA 5D1ZB 3WXWL 1EO8H 1T2QL 3ILQC 1ZHNB 3LD8C 1HHJB 3QEQA 1HWHB 3UBXI 5BRZD 3WFHA 1A5FH 1RZGA 4JY6A 3HNTL 4XNXH 1YN7B 5CIPA 4OD1L 4XMKH 4F2MA 1C5BL 5EO9A 3T0BA 1Q8MA 2BNUB 3P77A 4YXHH 4JVWA 5E8DH 3PDGA 3KPQB 1M71B 3TCLB 1EXUB 4ERSH 2VLKB 2R4RH 3I50H 4EUPA 3F12B 1IGMH 4BFGA 5E2TH 2Q3ZA 1IAIM 5C0JB 3D9AH 3UC0H 1VFAA 1HNGA 3JV0A 4HX1B 3GIVB 3AAZA 5CGMA 1NAMA 1QTYT 3SKNA 5MENA 2AK4B 2FJFB 3CCHA 3QP3A 2NY1D 1X7QB 3GMOB 1QACA 4KQ4H 4Y4KB 4Y5YA 5IVXE 3S97C 4DN4H 2XZCL 3QH3B 4MZ3A 1MREH 5B8CB 3DIFB 3QDJB 1K2DB 4JRXA 3L3JB 3Q5TA 5AZEL 1T83A 4JANB 1CT8A 2AJ3A 3SGKA 1F3DJ 5B39A 1T1WA 3BD5A 4P3CH 1JPSH 3T77A 3OKDA 4Y1AB 3SCMB 3U9PH 5KSBE 2A83A 4ZD3H 1UWGH 4NC1C 1GL4B 5DHVA 2V5TA 5I8OL 3RDTA 3N1PC 3SKOA 1E27A 4XAWL 5EUOA 1ACYL 1LE9A 2VLRD 1U3ZA 1FO0L 1QR1B 2X1XR 4ZFGL 4AG4L 5JXEC 1XCTA 5FK9B 4XZUA 4HQQH 4GBXC 1H5BC 4JO2L 3IAQA 4Y16B 3QEHB 5D6DA 3B9EA 2Q6WB 4U6XB 5IKCA 1X5AA 5KS9F 5CD5D 3LMJH 1RI8A 3F58L 2IH3B 1YYLH 3QUXD 4GG6B 4YDKL 3RTQC 4Z7OF 4NDMB 1OGTA 4M48L 1JVKA 2R2BA 3MV9E 3LH2L 2X4TB 2AV1A 1GJIA 3PWNA 1K9TA 4NBZB 4Y4HD 3MODH 2AXGA 2LQRA 1FORL 2YK1L 1W8OA 2GT9A 1XR8B 3D85B 3K8KA 1LP9B 4P46C 3ARGA 4FFVC 1OM3L 4GW4B 3E8UL 1CDUA 4P4KB 1J1PH 5EU5B 2XG4A 3TYFB 5DMJB 2IPKB 2XYCA 1QEWB 4X6FA 3VFOB 4KKCD 5DD0L 1PZ5B 3FQUA 1HN1A 4OF8A 5FEBA 1UJ3C 1NJ9B 1BFTA 1CFNA 4OD2B 5FGRA 3QUKB 3LS4H 5IJKA 2ESVD 4HG4K 3VFWB 3ZL4H 1MY7A 3LQMA 1AXIB 4NKMB 4D9QD 5D7IF 4TVPH 3SGEI 1HK6A 4G6KH 4PTUB 5KANI 4S1SL 1XZ0B 3OF6A 3EZJB 4PRBB 5LGHH 3I84A 3PIQB 2E9IA 2GY7B 3VXRB 3DMMD 4X9FA 1ZTXH 3NCYS 4UILH 5E6IC 3LKPB 4X6BA 5FUCE 1D5BA 5IP4A 2E27H 3LEVH 1MFBL 5JR1H 1WK0A 3EOTL 1G7HB 4L9LA 3WXVL 1CD0A 5IMOB 1N59B 4JFZL 5ICXA 3DI3B 5CGYC 1DQML 5E9DD 1IZKA 3V6OC 5E7BA 2R1WA 1NLBH 5CP7A 3HNVL 4N68A 4LLAA 3HE6D 3KWWA 4AEHL 1TJGL 1XEDA 3X13A 3QIWB 4FQXC 4D0BA 3C09C 3O6FB 1MSPA 2V9TA 1C7TA 5T1LD 2F53A 3M1BB 2OMNA 3KYOA 3RWEA 2NX5A 2VTFA 3MXVH 4NQSA 1D5ZA 4G8FA 4RGNB 4O2CB 5BW7C 5E1AB 5CCKH 1W72A 3GO1H 3KPTA 3LV3B 1S7XB 4P23B 1U8KB 4WI3A 4C57C 4NKDA 4RAHA 2OXGA 4QCIA 5DMIL 3OXSA 5B22A 1JK8A 2BVPA 3TO4D 2V9RA 3ZDYE 4M62H 3BAEH 2KQNA 2P8LB 3BFOA 3WNNA 3TWCL 5ERWB 5EFIA 3DX9A 2EE2A 1D5XB 3RVTC 4HJJH 3MJ9L 2HA1A 2RJMA 4ISVB 4HUVA 1CFSB 4G9FD 3WFEH 4KKAC 4WVRA 2EYSA 4XNMB 2W0PA 4HKBA 4GMTL 4V1DE 4RGOL 1T04A 1JPGA 4JEGB 3WMSA 2P48B 1JNHA 1NCBH 1KCKA 5DVOA 3ZKND 3W9DB 1G9NL 1U95B 1YEGL 1E4WH 5LCVL 3L3KA 3VXTB 5TGBA 2JCCA 3DWTA 5L2KA 3OAUL 5DJDB 5J57B 1WC7B 4OJFH 4AMKH 1FLTX 5I9QB 1VFBB 2VQ1A 4DGYH 3KXFD 1FNSL 4TSBL 1CGYA 1FZMA 3AY4C 3RWGA 5I1EL 1KLFA 1MRFH 3IS1X 1XH3B 4NZUH 3K2MC 3S36L 3O3UN 1F3JA 4PJ7F 5CBEA 1P7QB 1GZQA 2MTPA 4RMWA 1RZFL 4X7SH 4Y2OA 2CLRB 4NZRL 2NY4D 3IRZA 5JORA 4TUKL 1T22A 2OP4H 1YEKH 4KDTA 3RGVC 3QUYC 1F6FB 5EPMB 3HN3A 2I9LB 3RNQA 3OGCA 5IW6A 3BIAX 3DJ9A 3WBDA 3PDOB 2EYTB 4WHTB 3WJLA 1RK0A 5JO5A 1KPUB 1RZKL 3HS0B 4MD5B 3GBNL 2VLJB 4E9LA 3LRHA 3O2DH 3CXDL 1NC4B 1LMKA 2EECA 5FKPA 2P5EB 5ICZA 1MHEB 4GFTB 3MCG1 1G7IA 2DJUA 3RWCA 3HZMA 1D6VL 1UXWA 1E4XL 4KRPD 1CDYA 1ZGLA 4XVJH 4ZS7L 3FRPG 5EU3B 5ANMB 1VACB 4U0RC 1Y6KR 2FX9L 2CRZA 3EFDL 3N1QC 2NY2D 2E7BA 1A1MA 3LEXB 4YUEH 4UDUA 3F6IA 4J7RA 3NABH 1Q9WB 4Y2DC 4TN9A 2VLLA 5FYJE 2EE3A 5C0AE 3L3OA 3IETB 1W0WA 5DR5H 5ETUB 4TUJA 4YWGL 1A1NA 1UM4L 2NR6D 4MQXD 1JBJA 1N2RB 1CZ8H 3FQXB 3T8XA 3FT3A 5BOZG 4LCWB 4PJDF 2LE9A 1R3LB 2V7HA 1LQSR 5FGBC 5GGSB 1XMWA 4OLWL 5K9QI 3C5ZA 1J5OL 5HTSA 1QLEL 2ZJSH 5ESQA 1GH7A 3REVB 3C2AH 2Y06H 5JZ7D 3ULUL 1KCUH 4JY5L 1CFQA 3MLTA 3GGWB 5DUPL 1OAXH 3CDGB 4LRIA 4OZ4A 4EDXA 3L5WB 5CEXA 2WWMC 4BQ8A 5AD0A 2J8OA 2CR3A 2WUCH 5E2WL 2DQHH 4OZHE 1QSFA 5KSVB 1KN2L 2DS4A 3IAPA 5DA0B 3OKKB 4PJIB 5IB2A 2CIKA 5ID0B 4CVZA 4NQCE 5F89A 5TH2A 1VKXB 1LILA 4R7NB 3CFDB 1HHIB 1AGCB 4X80L 3RP1A 5IBTH 1OF2B 4S1DD 3F7YA 3QXAB 4WI9A 4WWKB 4M1DH 2X70B 2X10A 1CQKA 5FGSA 5IFAL 4UDTA 4LEOA 1CI5A 3NN8A 2ORBL 4D0DA 5C0EB 1EBPA 5TDPB 2AW2A 3GSWB 4G6FD 3EOBA 1AKJD 2WM0A 3WNKA 1DE4A 1T3FB 4ZTOH 1CLOL 4DVRH 1FVDB 1FL3B 4GRWB 3WLBA 2V5YA 3MMEA 4NCC2 1VEOA 2UV3A 1CVSC 1INDL 2F5AL 3QCUH 1P84J 3LRGA 5GSVA 1M05B 4PR5A 5AYUH 2R1XA 3FB7A 3LEYH 1C08A 1CU4L 4NNPH 4XWGH 3WIFB 3WDIA 4XB7A 3MNWA 4UT6H 3K81A 1NANH 4IOIB 4PLJC 5EH1A 3QRGL 3LQAL 4OLZH 1G7MA 4DGVL 1U3HA 4RNRA 3BX7C 3QRFM 1OGAA 3GJEA 5IV2B 4KROC 3TIEA 5I1JH 3PWLB 1MCNA 4ZOBA 5IJVA 2AEPH 4ORGB 2VIRB 5IHUH 4M8VA 1GGCL 3QA3B 5FYJU 4Y5YC 3BI9X 2V2XA 2XKNA 4U3XA 4M6NL 2MNUA 4MXQD 1A2YB 2WNGA 1F90L 1T83C 3CH1A 3RWHA 2N7BA 3F62A 4NZTH 2BNUA 1S7QA 3UO1L 4NQVB 4TRPL 3H9SB 3SGKC 3VCLB 1M71A 3ZDXF 1DVFB 3IFPB 2Q7YA 1HINH 2ZSVB 5I6XC 4PJGB 4IRSB 2BVYA 3RDTC 3GNML 1G84A 4KHXH 3P0GB 2DLIA 1UZ6E 4S0SD 1J9CT 3NACL 1G1CA 1KPVB 1HZHL 1X7QA 3GMOA 5D7LA 2A9NH 2H2SC 5IIEA 4KMTL 2X4QA 5B8CA 4ZAKC 3DIFA 4C83A 3MRKA 1WISA 4FQLL 2PR4L 4JANA 4MQTB 4QRSA 1L7TH 3FO9A 2XRAL 1J0ZA 2GUOB 3MRDB 3QNYA 4Y1AA 3DETD 5DMYA 4NO5B 4L8SA 3SEPA 1YNKL 3ET9F 2CXGA 3RWFA 1FYTE 1JWSB 2VDLH 3O2DA 1NC2A 3QG7L 3C5SB 4Z18A 3JVGA 4CGTA 5FK9A 3SQBA 3NTCL 5AZEH 3VXSD 1KEGL 1NBZB 1LNUB 1BZ9A 1FLRH 3F7RA 5TQ2H 3BDBA 3IDNA 5EZLA 1NL0H 5I19L 2XA8H 3ARGC 4JDZA 3A67H 4Y16A 3QEHA 3T2QA 1CDCA 3M8OH 4V2BA 5TE4H 4U6XA 3IVKB 2XN9A 3O0RH 4PJBF 1F42A 3IXTA 1HHKB 2YPVL 5DEFB 3PNWA 5LAXA 4UB0H 4JCMA 2A9ML 4GH7B 1TCRB 2IH3A 3DVNB 4BSVB 4N0UB 3S37H 3S5LA 2C3XA 1N64H 1GOGA 4HGWA 3ZYIA 5IJKC 5D7KD 4HAGA 1HSBA 2I5YH 3UYRH 1IT9H 3OR6A 4P5TB 3K8LA 4FN0A 1ORSB 2YWZA 2VISB 2HAZA 1BQHB 4PREB 4JREB 3T2NL 4QXTA 5IG7B 4WI2A 1AGFA 3HI5H 2YA2A 1LP9A 3LN5B 2UZXB 2VZVA 3EJZC 3PHQB 4NRYB 2GW5A 1F2QA 4XCCL 4V1DD 1NKOA 4ZQKB 4G6JL 2VXVH 1PZ5A 4JDTL 1QRKA 1D9KD 3P0YH 3ZDZF 1NJ9A 2BZDA 2R9HC 4MB3A 4K71C 3JBG7 1WBYB 4OZFB 5FGCE 1YNTA 3LH2H 2BHYA 4RIRB 3VFWA 5JOEA 4PJXA 3S34L 3STZA 5K59E 1FGVL 5HPMA 2PETA 4LFHD 5LXGH 4NKMA 2LU3A 3FCTB 1KLGB 1AXTH 1JV5B 2CUIA 3SN6N 1BFOB 4Z7WF 4DUWA 1HHGB 2Y6SD 3E8UH 4PRBA 4OF5A 4RAVB 2GJJA 1BQHG 4XI5D 4TNVK 1AXSB 1G1YA 5BMFH 4I0PC 4FFYL 4XVUD 4JFFD 2D4FA 3MGOB 5HI5C 3FTGB 2VZ1A 1T0NB 4W6YB 4KJWD 2XTJB 2YPLD 1H3XA 4NQEA 3CX5J 5I8KL 2R0KL 3HTLX 5I74C 5FO7B 2MHAB 5EOQL 1NCAL 4OZFG 1DUYB 3VFGL 1NCDH 1BZQK 5GJSH 4FTVB 2QQKL 4XXDA 4M3KB 4Y4FB 5JQ6L 4PJHF 5SWSD 2DM7A 4CRPA 1MFBH 4HIIA 4MQSB 3HMXL 2A74A 2ZUQC 4NCDA 4JFEA 3U79A 5T3ZH 1FNEB 3FT2A 4P59L 4CVUA 3Q6FA 1XCQB 3E6HB 5EU4B 3Q2CA 1JTOA 4YJZL 3AB0C 4Z0BH 1DZBA 3VRLF 1M7IB 4GRLA 4FQ2L 4N90E 5KAQG 4X6CB 4DW2L 3GUTA 3MUZ1 1UVQA 1OAQH 4F80A 1CGWA 5EZJB 2DMBA 1TVDA 1WZKA 3VGBA 4WUUA 4MA3A 1UCBL 5TJWK 2JJUA 3KYNA 2CLZA 2PYED 2V2WA 4G8IA 4DGIL 5C0AD 1UA6L 1FSKC 4R0LA 3J8F7 5EBWA 2MQ3A 5GZOC 4WHDA 5I8CB 5CZXC 3WJJA 1OAYL 4KI5D 2XA3A 2WQRA 2G60L 3ARXA 4PGZA 5KVEL 1FRGH 3MRLB 5EBGA 5DUMH 5AWNL 1LDSA 4LSDA 1VFBA 1MJ7L 1P6FA 3CFKB 3P4MA 5DC0A 3CVIH 1R3JA 5HYQB 4R97C 5C09E 1TXKA 1T7YA 4XGZA 5C6TH 1XH3A 3QDAA 3OV6A 5E08L 2P8PA 4JVPA 4KMLB 4OLXH 1U8NB 2DAVA 5C0CB 4L1DA 5DXWA 5D8JH 3SOBH 4ODUA 2JIXD 4U2YA 3D39B 4WRLA 1YY9D 3W0WE 4I2XB 4HV8A 3TJHD 1IEAB 4PRHB 1VSCA 4L8DA 5HVGB 1MEXL 4XPGH 4Q2ZB 3R4DA 3KVQA 2I9LA 1JZ2A 1EAPB 3H0TA 3VXQB 5I1EH 3PDOA 4BYHA 1MY5A 2B39A 4LRNL 3O11B 4WUKL 3SDDB 4U1NB 5HHVL 1P69B 3C8HA 4O5LH 5C07A 3ROLA 4PJCA 1NC4A 4YR6B 3CFJA 4F7EB 1BIHA 1AI1L 1YPZB 5DRWA 1MHEA 1UZ8A 2OZ4H 4BH7B 2DBLH 5ABDE 4HWNA 3U30C 2XT1B 4PJ9C 5EU3A 5ANMA 1VACA 1KV3A 3IJSA 5CEZL 3SDAD 4BK5A 5T3XL 1P2CB 1WAAE 1PYWA 4M6OH 4R4NC 2XOTA 4LU5L 2Q87A 1JYNA 1DSFH 1IM3B 1IGIL 1Q9WA 2Z92B 5I1GL 3G6JE 2CRMA 3AMKA 1S5IL 1S7UB 2WIMA 3IETA 1QRNE 1TTFA 2DJSA 3U4BL 4PRIA 4GQ9H 5DJ6B 3ALPA 4B5EA 3WFCL 1CXHA 1WF5A 2X4OB 3QAZC 2J6EL 3FQXA 1OAUL 4LRIC 3AM8A 5HPOA 3QEQE 5IWLA 1FIGL 3EFDH 2WAHA 4LOUD 5IK3A 1NGZA 3ULVD 3GJFK 4FQ1H 1QR4A 1K6QH 5GGSA 4MWFA 4H1LH 3BO8B 1ZMYA 1XGTA 1GPOH 5MERB 4GKZA 3CFEA 1HH9A 1RUPL 1GGBL 2FGWH 2NZ9D 5J11B 3PP3K 1CBVL 4OZFH 1PG7X 3SE4A 4Q97A 4F8QA 3O3EA 3UTSD 1UB5B 1T7ZA 4FMFA 5E6ZA 4HCRL 1HSAA 1MPAL 2WW8A 3W39B 2DQIL 3L5WA 3OAYK 2JJTA 1QYGH 5MENE 3MNZA 1OP5H 5MEPA 3LCYA 2FECL 1P7KA 3WUWG 1A7PL 1JF6A 4KZDH 1P4IH 1QBML 4LLDA 1ZT7B 5CMAB 2HJKB 1J5OH 2A1WH 1VKXA 4R7NA 3CFDA 3S8WA 1HHIA 3I3EA 3U0TA 2HTKD 1JFQH 3KPSA 1UEYA 2RB8A 3QXAA 3S37X 1T20A 1U91B 2DI7A 2M26A 3FN0L 3OZ9H 1I8LA 2AVGA 1N6UA 1BLNB 4G5ZL 4XPFL 1ROWA 4O51A 2DL2A 1YJDL 5AG8A 5EUOE 1U3HC 3GSQB 2O5XL 4LCCB 4K8RL 1T3FA 1B6DA 4XVTL 1JHLH 1RJYB 1ZHLA 1FVDA 5T33H 4PYGA 5D7JA 4UT9L 4S1RH 1JYXA 5D1ZC 3ZKSD 3DARA 2ERJB 2Y72A 3FO1A 4PRAA 2CDEB 3O2VL 2BCKB 2YRLA 2CKBB 3CUPB 2ZSWB 1EHNA 1Z3GL 1JRHH 4Y89A 3W82A 2DQEL 5T1MA 2IFFL 4MB4A 3QJFA 2PO6D 4FG6C 2ARWA 3EBAA 4QHLB 4UMGA 1DQQB 4FHBD 5IB1B 4P5KA 4YAQA 3MO1A 3VGAB 2QHRH 4Y5XA 5HYJB 4HDIA 4KTEH 1NFDE 1HHHB 3IFNH 1N7ML 4ORGA 1Q0YL 2VIRA 1QFUL 4UINH 4B7LA 2AQ1A 3FB5B 4AEIL 3FRUA 3RZCB 1TIUA 1ZOXA 3VMOA 1T03H 2EDLA 3BEVB 1DLFH 5DS8B 5B8CC 1P4LB 4NNXB 3NIDF 3ME0A 2L0DA 3ARDB 4QXUL 4K7FA 3F7VB 4RMVA 5IQ7H 2LU7A 4K3EL 2A77H 1F6AB 1QFWH 3VCLA 1DVFA 3Q5OA 1KTLB 4XTRC 5J3HC 4X4XB 3C60B 1N5AA 5E5UB 1IAMA 4I1NB 5ESAA 4PJGA 4IRSA 1MJ8L 3CXHJ 1OY3B 1ZLSL 1RZ7L 1GGCH 1S7VA 4NO0D 5IROC 3SBWA 2FH6A 1RJLB 8CGTA 5D7SL 3MA9H 3JVGC 2ADJB 3TBYB 2CK0L 3IDIB 2AJUH 5K93A 5J12B 1TJHL 4N0CC 3BH9B 4KK5C 4PJ5B 3H3BC 2VE6B 1NLDL 2DIBA 1OAZH 3MBXL 2ITDB 3CH8A 4JDVA 4Y16C 5DQJB 5H35B 3NGBB 4GKSB 2FJGA 3MV8B 3LOWA 4RSVA 4XP4L 3L3DB 1B90A 3I6LE 3CFBA 3KYKH 1D3CA 3RVUD 5DRZA 4K23L 3MRJA 3UJTL 2QKIA 2X4UB 2LU4A 2MKLC 1SM3H 4CDHA 4M03A 1RZIB 5EU6A 2OZ4A 4EEEA 1HXMB 3MOAL 2NX5E 3QO0A 3TBTA 1LNUA 5HI4D 4YHIB 1R5WB 2ILLA 5CWSB 4UU9B 3ULSA 2NY6B 1XF3B 1BECA 2X05A 3TVMB 3VXOA 4ELME 4UV4H 5TF1H 2EE6A 1QP1A 3PGFL 4H0GA 4P4KC 1N8ZA 5MP6H 3MRQB 2VQUA 2R29H 4G6ML 1KPRA 4CMHC 3DVNA 3LN4B 4AENB 3EW3B 2AJYL 4OQTL 3C8KB 2I60L 4HH8A 1OHQA 3QG7H 2UWEE 3OKYA 4HWEH 5C0DB 4Z7UA 4RDQG 2E5EA 1NCCL 1J0JA 1S9YB 3NTCH 3QULA 1S78C 3TPUA 1ORSA 3QI9B 2VISA 4AIZB 3EOYG 1RIHL 4M4RA 1IQWL 5I19H 3MLSH 2P24A 2XPGB 4P4RB 5F71A 3RKDC 3KGRA 4QXGL 4LLUA 3LN5A 1R0AL 4ESKA 1AQDB 1CS6A 2LTQC 3WDJA 4C55A 2N4IA 3TA3D 3TP4A 3PHQA 1P53A 4JN2B 5IMLA 3X3GH 3PHSA 4JHBA 4H1LA 2MPAL 4PGJA 5F6HI 4M8QA 2KH2B 5C1MB 4M5YL 4ZQKA 3S3JA 5L2KE 3CMOH 3OR7A 3FFCD 5FYKH 4CN6A 2NZIA 5INCA 1OAKL 1B2WL 1DQLL 2AEQH 3BPCB 5JNYB 4R8WL 1MFEL 1UQSB 1ZHBB 3WIHH 4JO3L 4XHJD 1EO5A 1Q38A 3W2DL 1VESA 3JWOL 1YEIH 2K3TA 3GJFA 4Y19B 1EEQA 3K8MA 1A6ZA 4WW1B 4RAVA 2XFXA 1KYOK 3QIWC 1WEJL 5KW9H 3O6FC 1XF2A 1BF2A 4XCCH 1AXSA 5C09D 1EEUA 3HRZB 2WBWB 2VWEE 1I9IL 4UQ3B 2PXYB 4JFXA 5DT1L 1LEKB 2IGFL 3FTGA 4RGNC 5C9JA 4R4BB 1MIML 1A0QL 1TJIH 2A6KA 4L4VB 7FABH 4P9MH 2CO7B 2NYYD 1DBMH 5FO7A 1U8QB 4FQJH 1CXKA 4OZGA 1JCKA 3F65A 1C5DB 2E9JA 1NDGA 4JLRA 3HRPA 1EHXA 3VFNA 1SJEB 2BRRL 3MPCA 4RFOH 1F4WL 1AD0B 3MV01 5GXBB 4DKEL 1PG7L 2FJHA 5KS9B 3JWNC 1RVFH 2BNRD 5FYLE 4UOW1 4LSRH 4JAMB 3WHXA 4G8GB 1CXIA 3ZLQC 4LNRB 1FCCA 1KBGH 3HUJF 2FHCA 1IAKA 1XCQA 3E6HA 5EU4A 1N3NB 2AEWA 2ZG2A 3B9VA 4LVHB 3WJJC 5EOQH 3UEZA 1E28A 1EVTC 2F8OA 4ZOCA 3U1SL 5ADOL 5I9QC 1UWXK 3VFMB 3FB6B 4MCYB 1BGXH 4LSQH 3QDMB 4KVNH 3MQIA 1X5XA 3WFBH 3QCTH 1DUZB 4YZFE 3V2AR 2D9QB 3OWEA 5F9WC 4IIQA 5ISZE 4F7CB 2Y36L 4JG1L 1NEUA 4BUHA 1N5YL 3FAXA 4POZC 3C6SB 5TPWH 4M7ZB 1RK1B 4JM4L 1UWEH 3GM0A 1DBJL 1OQXA 3DGGA 4LARL 1OTUD 3UJJL 4CN1A 3KPLA 3ZYZA 1IEHA 3D0VB 5D7IB 3B6SB 3VD3A 4FABL 3H3PH 4LGPB 5C86A 1KC5L 2BSSA 4X4YB 3HKFA 5EO0A 3WKNA 2Z35A 4Z7VA 1CL7I 1U3YA 1NGWB 3ROOB 5GS0L 4NO2B 4M1CC 5JHDA 4U6VL 4HBCH 1QD0A 4POUB 4OCXL 1XIWA 1R3KB 1OAYH 2IBGA 3HLAA 3RY6A 3RL2A 3DSFH 1QSFE 2HVJA 3L6FB 2G60H 1V7ML 5ALBH 5AWNH 4YX2H 3HZYA 4I2XA 2NY3B 2RGSA 4Q2ZA 1KG0A 1VGEH 2XY1A 1EAPA 3VXQA 1S3KH 3SPVB 4GLRI 4OCWL 2ZOKA 4JZJA 4ODVL 1JTPA 4MAUL 5I16B 5D5MF 4M9PA 4RAUB 3G6AB 3T09A 4Y4HB 3JWDL 1ADQL 4UNTA 4R9HA 1ZLWK 1ZT4B 5FKAA 2BSTB 5D1XA 3VW3H 3AM8C 1WAAF 2GJ6A 3CLFL 1MEXH 5IWLC 5F1NB 3RWIB 3TJEL 3U7YH 1HH6B 5H8DA 3N50A 1P2CA 4XNUL 2VR5A 1RMFL 4WUKH 3MROA 4HIJA 1IM3A 2F54B 4P2CG 3RWJB 4BQBA 3WIIL 1I8MB 1M1SA 1MCWM 5GGQL 5DK0B 1YY8B 3HG1E 2XWTB 3SE4C 2OK0L 1I8KA 4EI5B 2HMIC 4KK6D 3AU1B 2AKRA 2X4OA 3QDHA 4HWZB 4CAGA 3HZVB 4N0YL 2HFGH 1BBDH 1BJ1H 3O4LA 5IM7B 5LJYH 2KZWA 2JJVA 3C5JA 2JJTC 2DMKA 1IAIL 4XCYA 4W70A 1JNJA 1OP9A 4AQOA 5FO8A 3UTOA 5DVNA 4LHUD 4EKXA 5HHXH 2ARJA 1A3RL 3QDGB 5MEOB 3DXAD 2IAMA 5I1GH 1X44A 3DUUB 4QO1A 3FMGH 4E41A 5BV7H 3BGMB 2LVEA 3AREB 2VB5A 3ORJA 1RZ8A 1KXVC 3WIHA 1I8LC 1AC6A 2JB6A 1RUQH 3G5ZB 4RX4A 3QUMB 1JGUL 3FT4A 4JFPB 4OF7A 5EOTB 1ZA3B 4JG0L 5D7LE 4P48A 3WL9B 4HXBH 4ZFOB 3PL6A 3NPZB 4A6YB 3CVHB 1ZT7A 2BDNH 1MHPH 2KZ1B 3FOMB 1LDPL 5E2UH 5K9JH 2RIKA 3W11D 2DQCH 5EUOF 4XX1E 2R4SL 4NO3B 4OT1H 1ONQA 3VI4E 2D2OA 3QJHB 2J1KA 4OIAA 5JMRA 4CNIB 1J1XL 1HYSC 1ZA6B 2VDPL 4P2QB 3GSQA 1I75A 4LEXL 1IAOB 5DJYB 1YEDA 1U92A 5F7HA 1A9BA 1BD2B 2FHBA 4Z0XA 1QKZH 2BCKA 4DN3H 1CLZL 1KEML 1QSED 2HG5A 2XN9E 4ONFL 3X11A 1F13A 4U1GC 2X41A 2CK2A 3GSRA 5DSCA 3QQ4B 2D0FA 3FONB 1FZOB 5TQ0H 4JFDA 1DVFC 1A1OA 4BZ1H 4MZ2A 2B8OT 5E6YA 4XVTH 4L29B 4UNVA 1V3JA 4IRSC 1I85A 5HYJA 3HPLB 3A6CL 1HHHA 1IGTA 5GISH 3V6ZB 5EIVA 4E5XB 3SBWC 4DK3A 1KN4L 3D2UA 5F97E 3V6FA 5AAMA 3AS1A 4N9GB 4RZCA 3S6CA 2D03H 3H3KA 1C5CH 3NCMA 1MCJA 4NCC1 4NNXA 4PJ8B 3RVWC 3CLEH 3QXWA 2KKQA 2VR4A 3DHMA 4KPHL 5JDSB 5IFHH 2W0LA 3L5XL 4X4XA 4PJXE 3C60A 4L3EA 4NBXB 5GRVL 2VN4A 1BM3L 2PF6A 1GCFA 3OKLB 1X4XA 1FG2B 2Y4SA 5IBUB 3V0AC 3ARVA 3QQ9C 2ADJA 4MAYB 4QOKB 1KXTB 3TBYA 5MEQB 1DDHA 3MCKB 4DOHE 4WJ5A 3BH9A 4PJ5A 4QHNA 1ZS8A 3HB3D 3WS3B 2VE6A 3B8YA 4HXAH 2X4PA 1KB9J 1ETZB 4OB5H 1MUJB 4WI6A 3DRTB 5DQJA 1T7WA 4NQEE 3IKKA 3RWDB 2VXUL 1HKLH 2I07A 4PLOB 4HHAA 2VL5B 4ZMAT 2P4AB 5D9SA 3P30L 1J11A 4NHCH 5DHYB 2PTVA 1F8TL 3FQTA 1JWUB 4NQDB 2CK0H 3F8UB 2APWA 4P5TC 2CLVB 2FDBP 1A7NL 4F58H 5IBUG 1PKQB 2X7LB 4JREC 1NCWH 4MNGA 3UZEA 1R5WA 5FHBH 3BDYL 2VAAB 4GT7A 5CWSA 3MJ7B 5DWUL 1R6VA 5T5NF 4JFEE 1F4YL 3DTXB 5T5FL 5FYLD 2WBKA 5LQBH 4YXLH 3K2UH 1S7TA 3LY6A 5HSFA 5DQ9B 5L8JB 4AENA 2EC8A 2HP4A 1N6QH 3QXDB 3TZVD 2F5BL 5HJ3B 1MHHA 3BKML 1MI5E 4WUUE 1KELH 3MOAH 3QEGL 2WUBH 2E7CA 2BX5A 3EYOA 3O6LL 3VE0A 5CZVL 2XPGA 5HDOA 4C56A 5F8QC 5HGBA 3VRIA 4J4PA 1MLBB 2JCCF 1Z0NA 4QRTB 5BQ7A 2W9DL 4DCQA 2BVOB 4G6MH 5K9KA 1KIRB 5ISZD 2VMFA 3CSBA 3I6GB 4U1MB 5FUZH 4BKLA 5IVXB 1U8PA 4HJGA 3HC4H 2DIJA 4J12A 2O5YH 4OGYH 3NFPB 1FAKT 5F88A 1KCSH 1N0XH 5EO1B 1RHHB 4GMSL 4HZAA 3WN5A 1I7TA 5BS0E 2XQYK 3UP1A 1R0AH 3SDCA 5KSBB 3VWKB 4FMKA 3DX7B 3MLUH 3UDWA 3QUMH 1ED3B 4WW1A 2NY0D 4Y4FC 2SEBB 2Q86B 3QR2A 2HVKB 3HRZA 2DL9A 5A2IH 4A6YH 1H8NA 2R23B 4RFNB 1E4XI 1I9JL 4U1JB 3NH7L 2IQ9H 3UPAA 1FYHB 4HCRA 2B2XL 3O41A 4OIIH 2BJMH 4M7LT 4R8WH 5CJBA 1AY1L 3AGVA 5IF0B 2X5PA 2W65A 4RMUA 4HPOH 3ZYJA 1SYVB 1OSZB 1IGFL 2OYPA 4N8CL 2PTTA 3K0WA 3I85A 5C07E 4S1QH 2JB5H 4ACPA 1YYMH 4ZOEA 4PJCE 3T1FA 4FXKB 1MJJB 3C08H 5DT1H 1BVLB 3IDUA 1XF4A 3JUYA 4JAMA 1SJXA 4ODWB 3MV9B 2BC4B 5E95B 5BRZA 4LNRA 1QO3A 1IQDA 2B4CH 3T0ED 1MLCA 4DVBA 5ITBH 1W0VA 2FO4B 4KXZI 4FZ8H 4BZ2H 3FQNB 4JPVL 3KYMB 4Q7DA 1RJZB 1C12B 3RJDA 5J06A 2BRRH 2UZYB 2IADB 4HKJB 5ELIA 3HR6A 1I4FB 1F4WH 1TVHB 4PGDB 4YZFF 2OM5A 1BAFH 4WU5B 3GSXB 3FB6A 3QXUA 4HT1L 1A6TB 3TBVB 1RUML 4GSDL 3WEXB 3WV0A 5T1KB 1IC5H 3MRFB 3WNLA 4PRIE 1D5MB 4Q6IA 4NP4L 4QRPD 4J3TA 3HG1D 2JK5B 3O3BA 3GHEH 2DTSA 1XIWC 3LQZB 3A6BL 2X44D 2EH8H 4NJ9H 1SEQL 3RY6C 2QL1A 5DGRA 4ZXBD 3X3FH 3PWPD 1AGEB 5D72L 3MGTB 3SKUD 4NJAH 4D0CB 3H2WA 4R6UA 1FJ1B 4QRQA 4X9GA 3THML 4X4YA 3RU8L 1CR9H 3OHXB 1NGWA 4JG1H 3SDDC 2FWOB 3ROOA 3EJYC 4K55A 4OLVL 4ENED 5HYEA 4PP1D 2NQCA 1FN4A 2VLRA 3V5DA 5JW5B 4QRRD 4JM4H 2ADFH 5KVDL 3UTTE 4WY7L 1XGQA 2DD8H 4HJ0C 3RIAK 4L5FL 4DTGL 3U82B 4FABH 2BXYA 3P4OB 2NXZD 4MJ5B 1A14L 1EX0A 2OBGA 4YDVB 3TIDA 1YMME 4KJYA 3KPSE 4PY8J 3QUXA 5ECJE 4XRCA 3QIBB 4LIQH 2GK0A 4H5SB 3SE3A 1ULVA 3ARBD 4KZEL 2R0LH 1MVUA 5I16A 2GITB 3BKCH 3LDBB 4RAUA 1BJ1J 5FCSH 5C0BD 1BOYA 1FZJB 4Y4HA 4ZO9A 5HHNA 3TFKC 1RIUH 2BNQD 2GJZB 3E3QE 3X17A 4KKBD 5D6CB 4OM0H 3B3IA 5FV1L 2VO5A 5T3ZE 4X8JB 3RWIA 4LLQB 3GBMH 1HH6A 3UMTA 4XP1L 4IJ3C 2CJUH 4OTXH 1RURL 3KJ6H 1JF5A 4JPWL 4TPRH 1X5KA 5JOFB 4JGJA 1EFXD 1RZJL 2ESVA 2XKUA 3GRWL 5J11C 2CKBL 1YY8A 5C08D 3HI6H 5IHLB 1C16B 3CMGA 4LGRB 4MNQE 4XAKE 3AU1A 4P99A 5D1QB 3ZTNH 5HDQL 8FABB 2EDNA 1WICA 2B5IB 2HKHH 4P57B 3GSVB 5CS7A 5IM7A 5IW1B 3H6JA 3DMMA 4OM1H 3DLQR 1RUAL 1AFVL 4QHUA 4O2FA 4OQTA 1F58H 5FAAA 2NW2B 2Y25A 4YGVB 4QWWC 5J13B 4U1KA 3T65B 5JHLL 3QFDA 3V8OA 3BGMA 3OKNB 5HYFA 1J7VR 5E9DA 4YHLH 3MXWL 3CU7A 2JF1A 3MRRA 1MCHA 3OJ2C 1FQ9C 1KCVL 1U93B 2OR9H 3VXMD 1I1AB 3HE6A 2YMXL 3G5ZA 3MACH 2Z4QA 3D25B 1GAFH 4LCCC 3UBXB 1S9XB 3AROA 3WL9A 4KK9D 4PJEE 5DFTA 4U31A 2HT2D 1B4RA 3ALWA 2PUQT 4XMLH 1H0DA 5FFLA 4Z7NE 3EZ8A 2ERJC 5DJZA 1JNNL 3FOMA 4ZUWB 4J8RA 3QNZB 3WSQL 4G43A 2UZIH 3MLYL 4PG9A 3LB6C 3BXNA 3V52H 5SX5K 1MHCB 2QADB 5EU6E 4G9FA 1I85C 4NNYB 2O5ZH 4K3DL 2VZUA 1UXSB 5C0AB 4IRJD 1I3RB 3UBXG 1CICD 5E4EB 3RZCC 4GG6F 1BVZA 1CD1B 1TZHB 1R24B 1RIVH 3ILQD 5DRNA 1R3HB 5HD8D 2R2HA 2EXWD 2Z9TA 1JL8A 2DTML 3ARPA 4WI4A 3U4EB 2FX7L 1G9MH 3D5OF 5FM5O 2VZOA 1J1XH 2E7MA 3FONA 4WENB 4JM2B 1WWBX 3MNVA 4Z7UE 25C8L 3IDXH 1TETH 4JO1H 3C60C 1INQB 2EH7L 4L29A 1LP9F 3BP5B 3KPNB 4UIMB 4YO0B 3R8QA 3QZWA 4RISL 5EB9A 2IBZY 3BDXA 1J05A 2IPUG 1YQVH 3HCVB 4E5XA 2P5WE 5B38A 3U46B 1KEMH 1JGEA 1SJVA 1MI5D 4YBQD 5D2LE 1ZHKA 5KSAB 4PV9A 3MLVL 5J12C 5B3NA 1NGXB 1F45A 1FNLA 2AJSH 3KPOA 4MD0B 5AZ2H 1KCRL 3RPIA 5F96L 1T7VA 2OCFD 3MOBL 5JDSA 4PRDB 3TPKA 5I1DB 1J12A 5IB3B 4LPXA 3KNBB 2VABB 4DQOH 3NGBC 4OZHB 2H45A 2X4RA 3WKML 4U33A 4DAGH 4D8PB 4NQCB 4FQCH 4KV5E 5GRVK 1RULL 1OLZA 4NFCA 2B1HH 4ZUVB 2GSIB 4F37K 2R0WL 1UC6A 1IRAY 1MFCL 4TSCL 2BVQB 3TN0D 2YC1B 1MH5A 1TFHA 2ZCKH 3VFSA 2Q3AA 5JXED 2J8UA 1L7IL 1HE7A 2NY6C 1FDLH 2YD4A 5IR1A 3TVMC 1ETZA 3L5XH 4GBXD 3DRTA 5BXFA 1ZANL 3ULUE 2VL5A 2V7NB 2OJEB 4OZGE 1FE8L 2I27N 1GGYA 1R5VA 2QQLL 3MCLH 3VRJA 4UQ2A 3FN3A 4BFEA 2MFNA 1JWUA 5JIPA 5C0FB 3QIUB 4YQXH 2CLVA 3QI9C 4YHNB 5IBLC 3D69B 1U58A 2X7LA 4PB0H 5EOCL 2HFFA 1T0MB 4J4PC 3NIFE 2L4OA 3CX2A 4NC0B 5E8OB 4HGMA 3U0PB 1L0QA 1MVFA 1JP5A 5HHMD 5I18L 1PQZA 2YRZA 3UPCA 4P46D 4FFVD 2EDYA 2FRGP 4GAYA 5BV7C 4JO4L 3GI8L 1QOKA 5HI3C 5HJ3A 4K7PY 1ADQA 5JOPD 2X4NB 4R96A 5IGXL 5J1SC 3V79C 1JGVH 4LLMA 5HHOD 2Y07L 1A7NH 5ENWB 4YPGA 3RTQB 5CBAA 4AL8L 2JE8A 3V8CA 5KANG 5J6GB 4O02H 2GHWB 3EO1B 2VDOH 1OPGL 1MLBA 4PUBL 3VGHA 4X98A 1MCOH 3BOVA 1KIUA 3QWRD 4E42A 2MSPA 1AHWA 2IAND 1NGPH 3RHWK 2PXYC 3QCVL 4PS4H 4Q9CA 2XQBL 4U1MA 1T1YB 2Q7NA 2IMNA 1NSNH 5E6ID 3JTTB 3ARZA 4XC3H 1EVUA 1TQCB 2MKWA 2ED7A 5CZVH 1M4KA 1RHHA 4XVSL 3MX0A 1OTSC 1NDMB 4Z7VE 5CGYD 4CJ1A 4FS0A 1KTRL 4NM8H 1MQKL 3GSOB 3NFSH 3VWKA 2DKMA 5TE7H 1AKJA 1LE5A 3JSSA 2ATKB 4WFFD 5CZKA 4Z95H 5JHDE 4KAQH 2NY5C 1FYTB 3N85L 1HEZB 3EDFA 3K1DA 5ACZB 4ODTL 1WIPA 3AS0A 4FQXD 2DQGH 1BZ7B 1WIOA 3QQ3B 3UTTD 3P9LB 4KUCD 1QFHA 1E6OH 1T6VN 2WZPD 4EBQL 1MRDH 3FQWA 5HHPA 4U1SA 5CFHA 2PO6B 1Q9LA 2H32A 5IF0A 4XPBL 5E70A 1E6JL 1SYVA 1OSZA 5CD3A 5TE6H 4PGCA 5ESVA 5C0GB 1YMMD 3MR9B 1JNLL 3EYSH 5E99L 3QWOB 5CEYB 4FXKA 4ONHB 3P4LA 2IF7A 3IFLL 3LZFL 1KF9B 4JR9L 4WDIA 4HUXB 2MQCA 4M7LH 3RVTD 4XBEH 5AUMB 1G6RB 3P4NB 1F11A 2NY1C 5SV3A 3FO0H 4Z6AT 4M7ZC 4H0HB 4R90L 4B41A 2H26A 5DK2B 1HYRC 2YKLH 1I7RA 1LGVA 3FQNA 3KYMA 1WQVT 4XBPB 1RJZA 3ZE1E 1KJ2L 1K3IA 2OS7A 4N8CH 5IMMB 2CIIB 4MSWB 1I4FA 3HAEB 3VMPA 4F33A 3GSXA 35C8H 5DJ2A 4FRWA 5J89A 3QXTA 5M95B 4KQ3H 4HK0B 3DVGA 3IDMA 4QHMA 4LHQB 5FGCB 3QPQC 3O4LE 2APVA 1IVLA 3FO2A 3D18B 3RA7H 1LO3H 5IHZB 4MNQD 4YHPB 4CMMB 1QBLH 3QHZH 2FECI 3BISA 4DKAA 3OJDA 4ONGL 5IQ9B 3S88H 4A2MA 3NA9H 5FYKE 4J23A 3MGTA 4IRZH 1RD6A 2QSVA 5J0BA 2NY3C 4OBSA 3MBEB 4GKNB 5CD5C 2ZG1A 4Z9KB 5SX4I 3QUYD 3P0VL 1A9EA 3BUYB 4LBEB 2WMPA 3ZYOA 3HAEG 3LPGA 4LSSH 4X6DE 2A38A 3OHXA 2F19L 5J6HB 1CK0L 5E8NA 1E4KC 1QBBA 5CJOH 4ALAL 4LSUL 2EIZB 1VADB 5IUSA 1A7BA 4Y7MA 4OLUH 4PB9L 4XHQA 5L6YL 3A6BH 3DYOA 4HEME 4Y4HC 1CFVH 1KLUB 1J1OL 4N0FB 3FN9A 4OLEA 4LSPL 5C92A 3D3VE 3MC0A 3MFGB 3GSNB 4I5BB 3ARWA 4F57L 2PW2B 2IFGA 1CIDA 3S35H 3HE7B 3L5IA 4MJ5A 3THMH 5TDNA 1WCQA 4HS8L 3MJ8A 3DRQA 4MNHB 4GAGL 3RU8H 4G9DB 3QIBA 4H5SA 1VGKB 5FO9B 3V0VB 43C9B 4FNLL 3SGEH 2GITA 1RQ5A 2OL3B 4G42B 1XGUB 3MFFB 3C9NB 4EI5C 5ACLA 5IEKA 3MV7D 1BQLH 2B0SH 4P9HH 4PTTB 2DYPD 1DLHB 4JZOA 3CPLA 4X8JA 3BIKB 3BD4A 3ULVH 3N06B 3MRIB 4ZPVB 2R2CA 4V1DA 2P1YA 1J8HD 1GZPA 5K9QG 1CXLA 1D9KA 2V2TA 2P7TB 2YUVA 4KZEH 5JOFA 2R8SL 1NMAH 1QFOA 1S7SB 1ZGLM 4JFDE 1GSMA 1RUKH 2FX8L 4KHTH 4O9HL 4OFPA 4WCYL 5GRZA 5DYOA 1P1ZB 1XGYL 2EDWA 4Y2DB 4BH8B 1LO5B 3MLZH 3MOQA 1IKFL 1TZGH 3I75A 3WS6C 3PWJB 3HE6C 3RBSA 3U9UA 2D31A 4QYOB 1GGIL 3L3GB 5KTEL 1JJUA 3TEUA 4RMSA 5C09B 2EYRB 4JFFA