1JGLH

Crystal structure of immunoglobulin fab fragment complexed with 17-beta-estradiol
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
216
structure length
206
Chain Sequence
b'QIQLVQSGPELKKPGETVRISCKASDYMTSGMQWVQQMPGKGLKWIGWLNTQSGVPEYAEDFKGRFAFSLETTAYLQINNLKNEDTATYFCATWGGNSAYWGQGTTLTVSSAKTTPPSVYPLAPGNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig kappa-chain
publication title Crystal structure of a recombinant anti-estradiol Fab fragment in complex with 17beta -estradiol.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 36
structure length 206
sequence length 216
ec nomenclature
pdb deposition date 2001-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jglH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jglH02
4NO2B 4PD4J 2YA0A 1IM3B 5BS0E 1M71A 1T6WA 3GMLB 4L8DB 2X7LB 3OKEA 5IT2L 3QDAA 4WFGE 2CIIB 3U9UA 4U05A 3OJDB 3TCLB 3MODH 3RVVD 4M4PA 5C09D 2XRAH 2XTJD 4PV8A 2WBJD 3MJ8A 3HZYB 2D03L 5BOPA 1H3GA 4YBQD 1HYSD 3T0EA 3QUMH 2C3GA 1MFAL 5D70L 3ZL4L 4Z78B 3PABB 3SDAA 5DF0A 2FYYB 2QSVA 4NSKA 1PZ5A 2LVEA 4XP1H 1NC4D 3ZE0E 5JW3L 1ZA3A 2Q3ZA 2FJHB 3HA0A 1AKJA 1AD9A 3NFPA 5F96L 4L1HA 3FB7B 3VH8G 2VDLH 5E8NB 4UT9H 5DMKA 4IRSD 1DSFH 2FHFA 2DLGA 5TDNB 4G9FD 4ZUUA 3GSNB 1MPAH 3PGCB 4BH7A 5JTWA 1NUNB 2Q6WB 1GGCH 3ARZA 3UTSE 4G42B 1P7HL 2V5TA 2I26N 4YUEH 4YBLB 1C1EH 1PAMA 1RUQL 4F7CA 4RGNC 3VD3A 5A3IC 3QI9C 4HIEA 4I3SL 2UWEF 1X6LA 3N1GC 2HLAA 2W0FB 4MSWB 1EZVX 4WU5B 4PY8J 1BMGA 2BVPB 4HX1A 4KDTC 1AP2A 1U58A 1IAOB 1T4KA 2XICA 1F4XL 5KTEH 3WYRA 4YGVA 1BVKA 4U7KA 1FNAA 2EEAA 3FO1A 4P2OD 4X7CC 5EOCL 2NXYD 4FTVB 1VEPA 5KG9A 4D9LH 2LAAA 4K71B 3O41B 5DUMH 4X7SH 2XA8L 5IQ9A 4MJID 5DJ6B 4BYHA 2E9BA 1IEBA 5DMIL 2WLYA 3WUWB 2V2TA 1MJ8L 1G7LA 3RY6A 3KLHC 4ZFOL 1P4IL 3MRQA 1BD2D 2X1QA 4GKOA 3TLRA 3IRPX 4FQQA 1IL1A 1RUAL 4TSCH 1I9IL 5IWLA 2E8ZA 5AG8A 2Y4SA 4Z9KB 3RI5K 3B6SB 3QXAA 5HGDB 1B88A 3ME0A 2P42B 5MEOB 5EO0B 3FO0H 4HSQA 1NANI 1MUJB 5EC2A 4M7JL 1G7JB 4HFUL 5CBAB 4OM0H 3R06B 1KJ2H 2EYRB 3D39D 4ELKA 1BHGA 5F7NC 5HI5C 3ULVE 5EU7E 3RWHA 2UV3A 2CRYA 1BVLB 2ZCHH 3LS5H 5HPMB 2P48B 3RZCC 4GBXB 4J3VA 4NQSA 4FQ1H 4W70A 4U33A 1WWBX 2ZUQB 1F13A 1R0AH 4TTDD 3MBEB 2WQ8A 1R5IA 4JHWH 3TFKD 5HYQB 3W11C 4AL8L 5HHQB 3CUPA 4Q6IC 2Z8WC 5TPWH 1LEIB 3KJ6L 5T1DL 4RMRA 2KKQA 3RVXC 4TUKH 3C6LB 3C6SB 4O2CB 1WCBB 4XP4H 3OPZL 1YYLL 2DM2A 1PKQE 1YPZF 3VFPB 1J0YA 5KSBB 4NQCA 3T4YA 5ERWB 1GOGA 1BQLL 4WHYH 1CT8A 5FF6A 4G6KH 4NHCL 1L4IA 5KN5B 1C16B 3S9DB 4K3EH 3BE1L 4M8QB 5E2TL 4AEFA 2WZPD 1DN0A 4YHPB 1OT2A 2VDRH 4OLXH 2Q7YB 3MOQA 3MRLA 2HYMA 1KCRL 3O9WD 1TZGH 4GLRH 4I48B 4RFNC 4FTVE 4LPXA 5I17B 1UFUA 4WV1A 5B8CC 4K2UL 1G6RB 1S7UB 4LCIH 3R0MA 2M8XA 3ZSSA 4UQ3A 3W81A 2VITA 4WFEE 5AEAA 1MREL 3O4LA 2FB4L 1NAMA 3PUCA 1R3IL 4NNXB 1ROWA 1FSKB 5DD3L 1ZT1B 4TSBH 3WNNA 5KAQF 3L7FA 4PJ8C 4TQEL 2XQYK 2H2PC 3KPSD 1XIWB 4H1LG 4X99B 2W38A 2R2EB 2DMCA 3MLUH 3BJ91 5GGUA 2DQJH 3BGMB 1HSAA 3QQ3A 3BZ4A 4H88L 1JZ5A 4HUKB 3EFFA 1JN6A 1MVUB 4XHJC 3HE7A 3SCMC 1YEHH 1TZIB 4XVJH 4YBHA 5C0DB 3LKNB 4PTTB 3C8KA 2BNRD 5IVOA 1HWGB 3TO4A 4JPKL 4ZAKC 5IHZA 5D1QA 1MLCB 5T5NG 1DBML 3JWOH 5GGRA 4EDXB 1Z2KA 5JOFB 4QXGH 4PJ5B 4RGND 3K4AA 5A3ID 3I75B 1YA5A 3NMEA 4M03A 3EUUA 2A6IB 2NY1C 1KJ3H 3HFMH 2HRPH 4IEFB 3VXTB 4F9PC 4I9WD 4FMFA 3K3QA 4HF5H 1LD9A 3LN5A 4LCCA 1JRHH 4YX2H 1FN4A 2MCPH 3KPMB 1IEAB 5TQ0H 2EC8A 2WSKA 3VA6A 3VW3L 1UCTA 2CJUL 2VJXA 3HZVB 3QULB 4C56A 2EEBA 3HC0A 5E9DE 3RTQC 5KSBE 4NKOB 3U0WL 1PX4A 1T20B 1RZ8B 3DGGB 3KLHD 5CUSL 3VD4A 3DX6B 1T1WA 5C6PB 2QL1A 1MQKL 4M1DH 2OZ4A 1FNLA 1MJUH 4W6YB 1IARB 4Y4KA 3VFUA 2F74A 3ET9F 5MHSE 4JM4H 1JTOA 2BC4B 4OLUL 2FBOJ 2BDNH 3DUUA 3NFSL 1KTKE 1UCBL 4H20L 1GOHA 4HUVB 4WENB 2ENYA 3G5XB 3CSBA 5F1IB 3O8XB 2VH5H 2QSTA 4P2QD 4N1CA 2B1HL 3P4LA 1QFUL 3BO8A 3EO0B 2E7CA 5GS2D 3MLZH 3CJJA 3QUZA 1FBIH 1ZA6A 5SWSD 3ROLB 3L3JB 3RZCD 1AGCA 4Y5YA 5TF1H 2V9RA 5HHXL 2PYEB 1Q72H 3K46A 5GRWA 4K8RL 2RBLA 1I1AC 3UJIL 4R2GB 4ZFOA 1LEKB 4ZS7L 5BV7H 4JQIL 3W11D 1D5XA 5E7BA 1KIUA 4POZD 3RVXD 4R90L 3UEZA 4YHNA 4LSUH 4M1CC 1M05B 5GQBA 4OF3A 4MQ7B 1H3VA 4L3AA 5F7DB 3VFSA 3TV3L 4YFLF 3MCKB 3R8QA 4PJ5E 3QQNA 4F7TA 4C4KT 2D9CA 1J87A 5HDLA 3QDGA 5I1AA 3SKUD 1IGYB 4P2YA 3KJ4B 4J4PA 3BH9B 3FONA 4KAQL 4IRZL 3QH3A 1KLGA 2XZAL 3B2UC 2X89D 3QCTL 1Q38A 3GMRB 4G7YH 3UBXB 4PGEA 2F5AL 1Z5LA 4IS6A 1YY8A 2ADIB 2BY1A 5DZNA 3W9EA 1U8IB 5ISZB 5FV1L 2R0KL 2Y07L 2MCG1 3EYSH 3G6DL 1BQSA 1ED3A 2IH1B 2XWJA 1FC1A 4EUPH 4PJ8D 5BQ7B 1G7QA 4QOKE 4YXHH 5EU3B 3V5DA 1CCZA 1YEKH 5C9JA 5GGSY 4Y88A 3SGDH 3VGDA 3GUTA 1A7OH 2KQNA 1FE8H 1GAFL 3HCVB 3WO4B 4XXCA 3SGJA 2SEBA 4OAWA 4FNLH 3ZTJG 4GXVL 1JYXA 1RHFA 1I9JH 3S4SA 2XWTB 1DQDH 4XHJD 2NY3B 2VL5A 1H9VA 3LQZA 4LSPL 3LHPH 3NIGE 4NQVA 4JKWA 4JFQB 1KUMA 2RB8A 2APVA 2DQCH 1J12A 1CE6A 3H6JA 4ZAKD 4C83A 3WHE0 3BKJH 1BVZA 4Q0XL 4UUJB 4DEPB 3L6FB 1QSEA 1NDGB 1QSEE 2NY1D 3DXAA 4UT7H 3W0WB 1JTPA 4NZJA 1F45A 4X6CB 2Q86A 1KG0A 3KS0J 3WFZA 3VXPA 4P46A 2MOVA 4L3ED 3TBTA 1ZSDA 1I1RA 1UYWL 5CWSB 3JTSA 2VLJB 5IVXF 2DD8L 4W81A 1H3TA 3BXNA 4L8BA 5C0BB 1RJLB 2Q20A 4OLWH 25C8L 3FN0H 3L5WB 3RTQD 3QO0A 4WUUB 5FO9A 1ZT4B 5HGBA 2OL3L 3MV9E 3SBWA 1J1OL 5FHBL 5I75B 2OYPA 4D0DA 3KPPB 3L95A 1P1ZB 3FKUS 1RIUL 2V6HA 4N8CH 4OD3H 4JO2L 4YR6A 4POYA 1ERNA 3X11B 3JVGC 3CZFB 1RUMH 4ODXA 2PTTB 4KY1L 5F1NB 4XNMA 1EPFA 3HC3L 3G08B 1HHKB 1JPGA 1W72B 4NKIH 1I7RA 3VE0A 3C60B 4WEBL 3QPXL 3Q1SL 1IGMH 2PCPA 1NSNH 1JUFA 1G0YR 3HNVH 2J6EH 5E00A 3MLVL 5IEHA 1YEJH 2PR4L 5FA3A 1I1AD 1T3FB 2IG2H 2DBLH 2PETA 3UROR 5F7EH 1U8PA 1F3DJ 1HILB 3D3VE 2UVEA 4WI2A 1FNFA 4EI6A 1V3JA 3OSKA 1N5YH 5I8CA 5I6XC 5BRZB 4CVUA 1IQDB 2M1KA 3FL7A 2R4SH 3QO1B 3WIIH 1NUGA 5IFJA 5EWIH 1J5OL 2C4XA 1RZIB 2CDFA 3MR9B 4KTDH 4FFZL 3RWCB 4RBPK 5CZXC 5LG1A 3W0WE 2E3VA 3BRGC 1FL6B 1LO2H 2BVOB 5E5RB 4MHHG 1KB9J 3MGOA 5KOVC 2HJFB 2VOTA 1NLBH 3WFDL 3MODL 3MV8D 3RGVB 2VLJE 2HFEA 2VQUA 1ND0B 1IILE 4PTUA 4MAYC 4UDUB 4A6YB 3QUML 4OCXH 1B6UA 5I8OH 2HMIC 1WQVT 3UZQA 4CVZB 4MJ6A 3ZKXC 2A6KB 5FECB 4ZYKA 1CLYH 1G9NC 4XP1L 1PLGL 2YEZB 4NQEE 4OBSA 2VR4A 4JZJA 2VDLL 3KXFE 5KANG 5I1HH 3DV4A 4UT9L 4HUWA 3GSRB 1DSFL 3OX8B 4JO1H 3PGFH 4HT1H 1PG7H 2CLVB 5MENA 1MPAL 5MENE 4M6NH 4FABL 2A6JA 4J1UB 4NIKB 5JMRA 3QNYA 4YUEL 1DTUA 2WINB 4H8WH 3ARFB 3TCXA 1C1EL 2P8PA 3FZUC 3BDBA 4M00A 3K7UA 3O3EB 2OQJB 3NA9H 5CP7B 5DHVA 1W0VA 5D1ZC 1K2DA 3WL9A 5D7KE 3STZA 5KTEL 1XCTB 2D7TH 5GRVL 1FJ1A 1UM4H 2PUQT 4M8VA 4X6EB 1FVEB 3MUHL 1DE4B 4D9LL 5FA4B 1FHGA 4G8EA 4Y4FA 5DUML 5AYQA 5K9QG 4X7SL 5CSZB 4HG4J 2A9MH 2YC1A 4JQVC 1X4XA 2CLZB 2R23B 1AIFB 3Q0HA 4LPVA 5DXWA 1ONQB 3T08A 2ERJB 3IU4H 3TBYA 2V5RA 1P4LA 3Q6FB 1GZPA 3DETC 4QCIB 5GXBB 1IGTA 4X9BA 4Q9BA 1JPFB 1E4XI 1G1YA 4DOHB 3RWJA 3TBSB 3QHFH 5IG7B 1A9EB 2BXYA 1Q9WB 3MNZA 4NFCA 5HDBF 1NGWB 1VGEH 4Z0BH 3ULVC 5EU7C 1S9WA 4XGZA 3UBXG 1FPTH 4TSCL 1DLHB 3QJFB 5D96B 5DJDB 5DRXB 4G8GB 3GSUA 3QJHA 4QKXB 3EAKA 3FO0L 2IBBA 4RNRA 3QIBB 2Y5TB 2B20A 4NKDA 1T22A 3GB7A 1QVOA 2W60B 4OM0L 3DPBA 1T0NA 1ZT7B 2FO1A 1KJ2L 1Y18A 5IB5B 3RUGA 4EQ3A 3LS5L 2R39A 1P9MA 4QF1B 4E0RA 2VLRD 4FQ1L 2ZG3A 1REIA 5FKPB 5IESH 3SPVB 5DRWB 4YBLC 5FIEA 4PPTA 4JHWL 3WBDA 4NUJA 3HKFA 5A2JH 2MPAH 5TPWL 5ETUB 4YNYB 2OL3A 3UZEA 2E7LC 5FK9A 4TUKL 2UY7A 3OKYA 4XP4L 2YSSA 4LVNC 4IOSD 5FAAA 4K71C 3SE3C 3BISA 4NRYB 4XNQA 4OT1H 1AH1A 1KN4H 3MA9H 1XAUA 3KYNB 4G6KL 3ZDYF 3D6GA 3DVNA 4Q7DA 3JXAA 5F7WC 4K3EL 3GJFH 2X44D 2VDRL 3GGWB 4OLXL 5GSRB 3CX5K 5DEFB 5FYJD 4MA7H 4GUPA 4ZOAA 1ZOXA 3BIKB 5EZJA 1E6JL 4U6XA 5CD5C 5CZXD 2GT9B 2K7PA 1KB9K 2C1OA 4LCIL 1XCQA 1DUZB 4S1RH 1J18A 5ICXA 4PRDA 4WI8A 1EDQA 2AQ2A 2H32B 1LDSA 2HWZH 1CDBA 1BFTA 3PDOA 4JZOB 4LOUC 1CICA 4TSBL 2ESVA 2UWEA 3FFCB 4MDJA 2UWEE 2YBRA 3EIFA 1J8HD 3H3PH 1UB6B 4GBXC 4XH2A 3NZHH 3DRTA 4G8GE 3WS6C 2DQJL 4JFHD 1XF4B 4G6JH 3RX8A 3GMOB 2ZUQC 3CD4A 5J1AA 5EO1A 1DEEB 1NLDL 4OUUA 4PG2A 1YEHL 3B9EA 4PB0H 4AENA 2XWBA 4HK0B 4JPIB 1A6ZA 4BELD 5B39B 4KKBC 4ISVB 3JWOL 2NY0B 5ITFA 3ARTA 2NLJA 4HCRA 3FZUD 4QXGL 1Q9OA 3S96A 3V5HB 3F6IA 5DI8B 4GRLB 3L3OB 4U1GB 1ZLWK 1KJ3L 3IYLW 4TUJB 4NQDE 5J9PB 4NBYB 3HFML 4NZTH 1QRNB 2A73B 3OL2A 2F53D 4HF5L 2NX5A 1JRHL 3P9WB 5JORA 4YX2L 4OQ1A 5DVOA 2YD1A 5TQ0L 2MCPL 4X7FC 1ZHLA 4RMVA 5TFSH 4LSSH 2HFFB 1KJMB 1RSFA 1SYSA 4J3OC 5I1LB 5IVZA 2QJDA 5EZLA 1I3GH 1CTNA 4CADB 3DETD 4OSUH 4KKLC 2VB5A 1S7RA 3VCLA 4H0GA 1CXFA 1Z3GH 4H0HB 3RNKB 1YC7A 4M1DL 2IEPA 2B4CC 3GBNH 3H3KA 1HDMB 5T3XH 4JM4L 1R24B 5ACMA 1JZ8A 4Y8AA 3MRHB 4OJFH 1XIWC 1GC1C 4X4MA 1MI5B 5CS7A 4PRNA 1TJGH 5EIQA 3VXMA 4U1NA 4KI5F 1DQJA 4JZNA 2VH5L 4V1DA 4CN6A 2VDPH 3PHSA 3GMNB 4U1KA 1KCUH 3KYAA 4DGIH 1YPZA 3MLZL 3V6OA 4PLNC 5T1MB 3BH8B 4PGDA 5E4IA 5HI4C 3AM8C 3MRBA 1MCKA 5TF1L 1CLOH 1Q8MA 4MMXC 5HHOB 2FEDC 1Q72L 4WHDA 3KGRA 3KWWA 3IFLH 1WFTA 4MD0B 1F11B 3N9GH 5HHPA 1TZHA 1W0WA 3ZYZA 5BV7L 5KS9E 4I5BB 4P3DA 4OLVH 4ACPA 4OF6A 3FJTA 5C08A 1G7PB 5C08E 3BEWB 3ARGA 1B4JL 1N59B 1V7MH 4JRYB 2ZSVA 5DHYB 4XRCA 4WGVB 4FTVD 2GUOB 4QHLB 2E6JA 3T1FA 1AXTH 3TIEB 4MX7A 3MYZA 3PHOA 5GS0H 3TA3B 3AMKA 1RUKH 1T7XA 3H9SA 3H9SE 1QRNE 3ZHLA 1P7QD 2M2DA 3W39B 5I30H 4R4BB 2YR3A 5EU5B 2GEEA 4LCUB 2FIKB 5CMAB 2A1WH 4UQ2B 2BSTB 2BVQA 3P4OB 5CD5D 5I71B 4HWZB 2YOCA 2FX9H 2DM3A 3ALXA 4PJCF 4D2NA 2XACC 4CDHA 2AK1H 4JFFA 2I9TB 4OCMC 1DVFB 4D9QE 3O8XC 3E1F1 4YAQB 5I1DA 2VZUA 2VABB 3EYSL 1QLFA 1Q94B 3FB5A 4N90D 3RNQB 4ZNEE 4S10A 3NCFB 5K59F 4HGMA 2HJKB 4YXHL 1YEKL 5CD3B 4ZPVB 2VERN 1FE8L 5BZDB 4YDLB 1MI5E 1G7HA 3RPKA 1G7MB 4P9MH 4ZOEA 1HKLH 4I4WB 3UZVB 1CIUA 4CNIA 1JWSB 1I9JL 3GMQB 1DQDL 1E0OB 4TULH 4HKBB 3QQ4A 4L9LB 4QHMB 3DIFA 3LHPL 3ARDC 4F7MB 4PJ9C 1JNHB 1V8HA 1X5FA 1R3JB 2DQCL 1T6VN 1QUNA 5ILTH 4KKBD 4XCYA 5I19H 4NFDA 4ZODA 2VO5A 3QHTC 5FYJH 3BKJL 1L7TL 3BJLA 3MJ9A 1ETZA 2UZYB 2EDEA 2D4DA 2PYFA 3DVGB 4UT7L 4BFIA 4OZHB 1TXKA 4KRNA 2C3VB 3NCCB 1CYGA 2JJSC 4JN2B 1VGKA 1WT5C 1T0PB 1QA9B 1YQVH 3BZFB 3CLEH 2HG5B 1NEUA 2DIBA 3KJ4C 3QCVH 3CU1A 3F7QA 4APQD 2VE6A 1U3HB 1KIQA 4G5ZH 4LHJB 4PJXB 5FOJA 4OLWL 3FN0L 2J8UF 4H1LH 4U1HB 2EDYA 3V6ZB 2FH6A 3MOAH 1LO5A 2JELH 1G9NH 3AU1A 4KKLD 4QRTB 5C07A 3I84A 7CGTA 3O6KL 1MY7A 4HJ0C 3T0AA 4RMTA 4WO4B 5GISL 1M71B 1A4KA 3E3QE 4MD5A 3QDMD 4QT5A 4MZ3A 3QNZA 4OD3L 5EUOB 3UAJC 1T83A 1XIWD 3U9UB 1HQRA 4X6FA 1ZANH 1RUML 3FMGH 4MNGB 1HOCA 4R96A 3BWAA 3LAFA 3WO4C 4M6OH 3MJ8B 4W4OA 4NKIL 3T0EB 1I8LA 1OLZA 3FT3A 2NY3C 1IGML 3T65A 1NSNL 1PZ5B 3QDJA 4NSKB 2EC9T 4PJAF 5EU6E 1DBJH 4OBRA 4S2SA 1SJHB 3Q6GL 5HI4D 2ORBH 3HNVL 3PWNB 5B39G 1D5BA 4MNHB 1DZBA 2AK4D 2C1PA 1AD9B 1WWAX 1YEJL 4BH8A 5FUOH 2GJZA 5JOEA 4DEPC 4S1DC 2DBLL 1VA9A 2Z8VC 5F7EL 3DO7A 4MB3A 5DMKB 4URTB 3P73A 4ZUUB 3HB3C 3WD5H 3N1MC 2YUXA 3L5JA 1EGJH 4YDVA 1N5YL 2AXFA 4F7CB 3D9AL 2R4SL 3WIIL 3D85D 1NGPH 4EZMA 5EWIL 2HLAB 3TVMB 4IMLA 1N7MH 4MD4A 1AP2B 1U58B 1KTDB 1T4KB 1MRDH 1M7IB 1SY6H 4KTDL 3GSXA 4YGVB 3ZT7A 1CGUA 5IKCA 4NYLA 2NTFA 1NDMA 5IHBA 3S35X 5HVFB 1DFBH 3GKZA 4U1LB 1ACYL 5EO9B 5I75C 4C58B 5DJ0B 1UGNA 1NLBL 5E4EB 5IQ9B 2AGJH 3OKNB 1KULA 1VFBB 1FLRH 1IEBB 5F72S 3RJDA 1PZUB 3BZEA 1VFAA 2V2TB 5C0NC 2E9WA 1G7LB 2JJWA 4OCXL 5I8OL 3TESA 5FUCC 3GMPA 3EZJB 4G43A 3O8XD 1AGEB 5F9OH 2O93L 1MFBH 4JFYA 1IL1B 4IOIA 4JY4A 3FHAA 4TVPE 1BPVA 4QHKJ 1SQ2N 2R0LH 2W0PA 3C60C 1J0IA 2WAHA 1Q9LA 1PGRB 3QXAB 5I1HL 1UH3A 3VFMA 4JO1L 3PGFL 4HT1L 3OF6A 1CL7I 5EUOE 2I07A 3NVQA 1A6AA 4M6NL 1J0KA 2PYED 3S6CA 4MNGE 3WXVH 4Z7WF 1UEYA 3UCRA 4H8WL 3GFUA 5IVXA 4ELKB 5GGSB 5IVXE 5ID1B 3NA9L 3ARDD 4M93B 3DWTA 4PJ9D 3ZYJA 4NC0B 1MVFA 1FZOA 1EXUA 1HXMB 2D7TL 3NAAH 4X6DB 1UXSA 2ZWLT 1F6AB 3O3BB 4DTGL 1FIGH 1R5IB 6CGTA 1EJOL 1IC5H 2HVJB 4Z7VF 3CUPB 1M7DA 5C9KA 5I66A 2A9ML 5DJCA 5IJVB 4OZIA 4FQLH 5L8LB 2JE8A 3T2NH 4LLAA 1S8DA 3IU4L 4KK9C 4QY8A 4DZBB 3FTGB 4Q9RH 4J2XA 1T1ZB 3LQAC 3GEWB 1B9ZA 5DYOA 3QHFL 3TBWB 4NQCB 3T4YB 3RGVC 5FF6B 3B3IA 3RX7A 2XY2A 4Z0BL 1CQYA 43CAA 5DFVC 4UTAH 1OP5H 1DN0B 3P9LB 3QFDB 3OKLB 3MRLB 3VRJB 1HHHA 1KCLA 4WV1B 3FOLA 3L7EB 5ISZD 3VWKA 4M4RA 2XTLA 4MXWL 5L2KA 2W9DH 3BSZH 3IU3A 1V05A 4MMZC 1E4WH 3RDTA 3UAJD 2J5LB 2RFXB 3SO3B 4UQ3B 2VITB 4Y5XA 1VFOA 4EDWH 4U6YB 3O4LB 3L3KB 5CJ5A 4DAGH 5IESL 2F54A 2FZ3A 3ARFC 1EHLH 3U79A 2NY3D 4GRWF 5IB2A 3LN9A 3BIAX 5GGUB 3VGHA 1T04A 2MPAL 4Z8FH 4EQ2A 3VFRA 1HSAB 3QQ3B 3BZ4B 3G5YA 1JN6B 3I6KB 1LEGB 1W8OA 4S1DD 2YD7A 5LGJA 4OGYL 1CXEA 5FXCH 3HB3D 3I6LD 4L4TA 3C8KB 3ORJA 3HTLX 3TO4B 3MA9L 4GG6F 3QYCA 2ERJC 5E2JA 3MLXL 1U8QA 4DJMA 1SMAA 2YMXH 4WHCA 4ELMB 2FHBA 3ARYA 4X6DE 2CKBA 4X4XA 4MA7L 1N4XH 2A74A 5C0BD 5KJRH 1MCNA 1KSRA 3BKCH 3VRLE 1XGPA 1I1FA 1BIHA 4WUUD 1CD1A 5D96C 1MHPL 3PIQB 3SKJL 2L7JA 4U3XA 3UTTD 4S1RL 1UQSA 4K7FA 5D1XD 3S88H 2IQAB 2J6EA 5KSAD 2ATPA 2HWZL 3QIBC 5EC1A 3DYPA 1EHXA 5CINL 3IDYB 2DWDB 1C5DA 2A83A 1GXEA 2EKSA 4GW1A 5FYLD 4CJ1A 1AFVH 4N9OB 1MLBA 1T21B 3EYUH 4M6MH 2FJGA 1T1WB 3NZHL 1CLZH 3GHBH 1JZ4A 1A14H 4G6JL 4Y4KB 2F74B 1YDPB 1NGYA 1II4E 3NN8B 4D8PA 3C60D 5DUBA 4DKDC 3DUUB 4XNYL 4PB0L 1FNGB 4XVTH 3CU7A 3UX9B 3L9RB 3QUXA 3T04D 3U7WH 1OAUH 3CDGA 3KHOA 3DYOA 3SKNB 5JZ7C 4LLQA 1ZA6B 2QSQA 1T2QH 2XKUA 5D2NA 4OCYH 4JCMA 2UZIH 1EERB 1EH9A 4NZTL 2P5WA 4R26H 4Y5YB 5D7IB 5BRZD 1CFBA 4ZFOB 4NOBA 3C5SA 3INUH 4IRJC 1S7QA 1A7PH 1FC2D 3LVEA 3S8WA 5TFSL 3QB7C 2EYTB 4LSSL 2DJUA 3PGDA 4Y4HA 3D69A 4FQIH 2NXZB 3HMXH 5T3ZD 5HVHB 4PJFB 3QIUA 2YRLA 1I3GL 2PW1B 3HAEH 4DUVA 2X6MA 4YHNB 1UEMA 3SO5A 1Z3GL 4GQ9L 2YHGA 4LMQI 3RGVD 4F7TB 3S36X 4ELME 1XR9A 5T3XL 5JLZA 2VIRA 5DFVD 1JF1A 4WHTB 1OW0C 3ZT6A 3MREA 4OJFL 2XG4A 5C71A 4WFHD 5I1JH 1CFQA 2IALA 5D4QA 3B5TA 4OTXH 2VDPL 1KCUL 4NZUH 3TBVB 1HH9A 3QXDA 4PGEB 5I73B 4DGIL 2EIDA 4IS6B 4NQXA 4O51B 5M94B 4Y1AA 4UOW0 5E1AB 1MAMH 3MLSH 4L9DA 3DV6A 1MAKA 3ZDYE 3GHEH 2P1YA 1CLOL 2XG5A 5IV2A 2NY0C 3ARFD 3IFLL 4F8TA 2MNUA 3N9GL 1G7QB 4GRLC 1NBQA 3P77A 1YUHA 3IVKB 4U1GC 3GUTB 4OLVL 1RY7B 5I76A 3PWPA 2YWYA 2JKXA 2SEBB 4OAWB 1V7ML 1MCBA 4GOSA 3S4SB 2VL5B 1AXTL 3CMOH 4FQCH 5IB4A 3OHXA 4ZOCA 4YEEA 2CRMA 3P11H 2Q76B 5GS0L 1CE6B 2KQMA 4ZFGH 4JDZA 4WW1A 5KVGH 4LK4A 4C83B 1RUKL 1J05A 5DK2A 5IFAH 5D7IE 1JF5A 2BRRL 4NM4H 5I30L 1MHEA 1TVHA 3DXAB 5HHVH 1AQDB 1QSZA 4PV9B 4XPTL 3H9HA 3VD7A 3VXPB 1Q9KB 4XCNA 2P7TA 3TBTB 3PE9A 1ZSDB 4PJFE 3JTSB 2AK1L 3QUKA 4TSAH 1H3XA 4JQXA 1E28A 3BXNB 1KB5H 1F6FB 3M17A 1OT1A 1MCPH 3HRZA 3DBXA 5FO9B 1TVDA 5M95B 4X5LA 4L4VE 2RCSH 3ALWA 4D0DB 1M4KA 3MA7A 1JPST 2W59A 2NY7L 2Y7QA 2AKRA 4EI5A 1VB9A 4P9ML 1HKLL 4YR6B 4JGMA 2BNQA 3BPCA 1KENH 4H26A 4HLZG 2IH3B 4JG0L 5JIPA 1YQ2A 4P5TA 4XNMB 1XF5A 5F8QC 5ILTL 1FIEA 1JPGB 3A67H 5TGBA 1QEWA 5I19L 2Z31B 1X5KA 3G9VA 5JZ7D 5FYJL 5IMLA 2LE9A 2PCPB 2FO4A 4JLRA 4ODHH 4Q2ZA 1JNLH 5C3TA 4YC2B 5IF0B 3QEQD 3TA3C 5E00B 1N2RB 1NMBH 3ULUH 1KN2H 1GGBH 4X9GA 3RVTD 4DK3A 1YQVL 3CLEL 4XP6H 4PRPA 4IRJD 2GY7B 3BGFB 2EICA 5IFHH 5ANME 3QCVL 4WW2F 5CZKA 3SY0B 1A6WL 3E3QC 4EI6B 2W9EH 3B9DA 4KI5E 4DVBA 3DSFH 4NCC2 1QSFB 4G5ZL 1SBSH 4POUB 2ADGA 5FYLH 2DI7A 5I71C 3JSSA 3FO9A 3MOAL 5IFJB 2JELL 1G9NL 2B39A 1RFDH 3FO2A 3F65A 1DVFC 3SQOL 3TN0A 2CDFB 5E7FA 1Y6KR 2WP3T 2AJUH 4GXUN 3FFCD 4JB9H 4O2FA 5I2IA 4J3TA 1ZANL 3NACH 2GW5A 2JJUA 3L3GB 4PBXA 4BA8A 4D3CH 4YDLC 2HFEB 4M6OL 4DFHA 3MRFB 3N1PC 1ZHNA 4MJ6B 2ZOKB 4L9LC 3VXUE 2I9LB 1DBJL 4Y5VA 2Q87A 2JJTC 2WUBH 3X13A 4RMUA 2ORBL 3GSWA 3VGGA 2NY0D 5FUOL 4QHNA 5GS1B 4X0KA 4QRPA 4HUWB 4JHAL 4GRLD 4OZ4A 5T3ZH 1XZ0B 2XPGA 3WD5L 4L4JA 2LV4A 1EGJL 5DMYA 4PJCA 2YKLH 3QNYB 1FYTE 2P8PB 3Q48A 3ILQC 4XBGA 3HS0B 1NGPL 1W0VB 2DJSA 1NCCH 2VLMD 1K2DB 5ACLA 1I8MA 5F6HI 1U3HC 4PUBH 5DJ8B 3V7MA 1D9KA 1MRDL 3KLAA 1UJ3B 4A6YH 4AM0B 1FJ1B 1I3UA 1MRFH 2R0WH 2JIXA 2I27N 1G0DA 2I60H 2LU7A 3JWDH 3MJ7A 4P5MA 1DFBL 4F15B 1VACA 3MRJA 1TTGA 4G8EB 4Y4FB 4FZ8H 4AMKH 2JF1A 2AGJL 2PO6A 2Z0BA 3ARPA 4WO4C 1NANH 1YNLH 1FLRL 5HDOA 1QSFE 3LCYA 1CG9A 2HH0H 2D4FA 2EH8H 1F3JA 5JOPE 2VZVA 2PW2B 5F9OL 1MFBL 3UTPD 2IBZY 1LK3H 1S9WB 4G8IA 1J1XH 2R0LL 3HRPA 3T0EC 1JBJA 1LHZA 1A4JA 3GSUB 4LPCA 5CBEA 4N0UE 3WFEH 3OB8A 1N0XH 1AO7E 2H6PB 4RNRB 4YHIB 4N9GA 4AQOA 3F58L 4NKDB 1T22B 3GB7B 1QVOB 3AC0A 5HHOD 3WXVL 5F7KC 5DJ2A 3UPAA 1T0NB 4PJDA 1QYGH 3JV4A 1IMHC 3H7BB 1Y18B 3OWEA 3RUGB 3S3JA 3BW9B 1P2CA 1D3CA 3BDYH 4CJ0A 1CGYA 4E0RB 3E6HB 1JZ6A 3IFOA 2J8UA 2FCBA 4YHMH 5DJXA 1EAPB 4JRYD 4UU9B 3NAAL 3S4SG 4MLIA 4Y8DC 2Z8SA 2OX5A 3BD3A 1IC5L 4GRMA 4ZDHA 1UM6H 2JK5B 2G75B 4FQLL 3T2NL 5KVEH 5EU4A 5A2LH 2OL3B 3MLPA 5FK9B 1JMZA 3MRCA 4F37F 1OOAA 2YSSB 4UILH 2X4QB 3L5HA 4HS3B 2R1YA 5E4EC 2Y9RT 4GW4A 3SGDI 2XFXB 3V4VH 3H42H 2XT1B 3FAXA 4PJAA 4UTAL 3RY6C 4AEHH 4MWFA 5EPMA 1QFWI 3QNXB 4GUPB 3D18B 4IDJH 4LVHC 4XPFH 5EB9A 3VG9B 1A6VL 4U6XB 3QXVA 3BSZL 2XN9A 5IWLC 1XCQB 1ITBB 1E4WL 5ICXB 3BP4A 3ARBA 3BOVA 2GAZA 3ECBA 4U1JA 4EDWL 4MQTB 5EORH 5KSVB 1EUUA 1FG9C 3PDOB 4KPHH 4DAGL 5I1KH 4WEUD 5GIRA 5GHWL 2ESVB 4XTRD 1EHLL 1IBGH 1OPGH 5C0AD 4FFWC 4M93C 1J0ZA 1M6OA 3QIWB 3KLSA 1I9EA 1INDH 4QRRA 3EDDA 1XF1A 4Z8FL 1WAAF 1ZHKA 5EO1B 4ZQKA 1ZGLM 4UIMB 4OUUB 2MFNA 5F9AC 3VFGH 1MHCA 1EO7A 4U49A 1MFDH 2DN7A 1A6ZB 4HK3N 2BMKA 2DMBA 2X9XA 3BKYH 3QCUH 5ITFB 2NLJB 3BP7A 4DQOH 1Q9OB 3S96B 4NKMA 5DT1L 5EFIA 1TNNA 4H0IA 3CZJA 3ILQD 3OTTA 4N0FA 4GKZB 1CXHA 1U3HD 1N4XL 1UWXH 4OZGB 5KJRL 5DD6B 1EEUA 3ZDZF 3BKCL 2NX5B 3HG1B 5JORB 4HKJA 1HHJA 5LQBH 1ZHLB 1J11A 3S88L 4E9LA 4WV1C 2ZOLA 4WO4D 5CLWA 1V7NH 1SYSB 1GH7A 3LOWA 4HUXB 4Z7WE 5DO2C 5IVZB 4M02A 5T5FH 1I75A 2C9AA 5EZLB 1B0GA 4XI5D 4FXGA 3TNNA 3W5MA 3TWCH 3VFOB 4PJHB 1AFVL 2J5LC 3C87A 3SO3C 1S7RB 4LSRH 3VCLB 1X5GA 1OGAE 4M6ML 1OM3H 1I7ZB 1LILA 3IETA 4N8VA 4QTHB 1CLZL 3GHBL 4FZEH 5DJAB 3RWEB 1A14L 1BBDH 3T0XA 4HDIA 1IZKA 1RV6X 5IK3A 3T0ED 4Z7VA 4ZNCD 4B7LA 4Z7VE 2V9TA 1FZJA 3TIDA 4PRNB 4OGZA 4M5YH 1SY6A 1QG3A 4XVTL 4PGBB 4U1NB 5FO7A 1AY1H 2MMXA 4V1DB 4YK4B 4E5XA 1QR1B 4ZXBA 2R29H 4U1KB 3SGEH 1AKJD 4J8RA 1BREA 3U1SH 3U7WL 1OAUL 4N0RA 1DUYB 1NBZA 4GQPH 4EOWH 2Y36H 3WLWC 1T2QL 1A8JH 2AJYH 3THMH 4OCYL 3T0VA 2IAMA 5GRVK 1YJDH 1D5MA 4PGDB 1Q1JL 2UZIL 1F4WH 3MRBB 4R26L 3TO4C 2HN7B 1KIPA 4WJ5A 1QFPA 4QHUA 5J6GA 3HNTH 4Y2DA 2MHAB 4BFGA 1W0WB 4PP1C 4P3DB 2NW2B 5LAXA 3U82B 3CSYA 3WE6A 1A7NH 1UM5H 4FQIL 5CEXA 1WZKA 2BSED 5C0EA 3P30H 1MFNA 3C09B 4K7PL 1RMFH 3RKDC 5SWZA 2VISA 3CC5B 2DYPA 1MIMH 4D9RE 3T1FB 5HYEA 4MX7B 4F57H 1GYAA 3QWOA 3F7RA 4F9LA 5ECJE 3B9KA 1U93A 3PHOB 5GGVH 1A6TA 1HQ4A 5CZVH 3ISWA 5IW6A 2D0HA 3KHQA 1HYRC 4OZGE 2A0LC 5F6HJ 1NGQL 1M1SA 1FVCA 1YMHB 3HG1E 1JNJA 4J3UA 5I1JL 5D6CA 3NCBB 4CMMA 3IGAA 1K6QL 4OTXL 4Y4KC 4MA3A 4X7TA 4LKXA 2UY6A 3HI1B 4FA8A 2R2BA 3MLSL 4GG6A 3RIFF 4ENEC 1C7SA 4CU6A 2GHWB 3QUYB 4PJHE 2K3TA 1QLFB 4LCWE 5FKAA 3TC9A 2B5IB 5D7LA 2V5MA 1R5VA 5IOPA 1H15A 4FFWD 1UJTA 2VR5A 4PRHE 3V6BR 4Y5YC 3ARSA 1G7HB 2X4RB 4U2ZA 2YZ8A 3MUZ1 4LQFH 1NUDA 4WI4A 1OHQA 2ILLA 4O58H 1FFNA 2EDOA 1CGXA 3MPCA 5DQJB 3SE4A 1F2XK 1PG7X 4W6XB 3QQ4B 3LEXA 4FQCL 5C70A 4F33A 3HMWH 2NXZC 4WFFE 4I77H 4ZFGL 3SEPA 4LSDA 4BFBD 5IFAL 1FLTX 1OL0A 4NM4L 1ZGLP 1ETZB 4JFEA 4JDVA 2PYFB 2O61B 5CEZD 1V3MA 4NQCD 1TJHL 4U31A 5HHVL 1VGKB 3U4EB 4X8JA 1A2YA 1CFTB 1PY4A 5ENWA 1MOEA 2GJ6E 5JPNA 4TSAL 2VE6B 3AS2A 1KIQB 3K81A 1E6OH 4MB4A 5JQHC 1KB5L 3LQMA 5DO2D 4J23A 5EBLA 5LXGH 1ZK9A 4K94H 4KROB 5I73C 3WIHA 5DA4A 1MCFA 2RCSL 5HHNA 5C07B 1A6UH 1H3WM 3CFKA 3LIZH 3KPRA 5KZCB 3O4LD 4HFWA 1TIUA 3X3GH 1UXWA 4KVNH 2GFBB 4QT5B 3GBMH 5EUKA 1OSZA 1MCEA 4X6FB 1KENL 4RGMB 4LPYA 4PRIE 3SGJC 2DL2A 3A67L 4Z5RA 2YD9A 3SJVA 4TOYH 2C4FU 2APTA 2XTJB 3FT3B 2VLKA 3EGSA 3WLWD 3T65B 3QDJB 4ZTOH 4ODHL 1JNLL 4FQ2L 4S1QL 1JYWA 1YEEH 3UPCA 1KACB 1ZLSH 2V2XA 1D5BB 3RAJH 3QEHB 3TO4D 1R3HB 5JPMA 5D1QD 4P2RA 1NMBL 3ULUL 1KN2L 1GGBL 4N5EC 4F58H 2ZNXA 3IS1X 1NC4B 4XP6L 2GSGB 2R1WA 3QFJA 5IFHL 3P73B 2L0DA 4PP1D 2G60H 4PLJC 4KJWC 2W9EL 3DSFL 4FMKA 1IAKA 1M7XA 1S9YA 4X98A 4X4ZA 1SBSL 2PXYA 1WZ1H 5FYLL 1NFIB 2AXFB 4MXVF 3RKDD 5EBMA 1KPVA 2RIKA 4DGVH 4LLVA 1I9RH 1RFDL 4ZUWB 4RQQA 1FH5L 2CDEB 1KLUB 2M26A 1S9XB 2Z91B 4C56D 1L9NA 2MQ0A 3DJ9A 3TGXA 4NYLB 5IKCB 1YMMA 2NTFB 4G3YH 3SBWC 2A0LD 4JB9L 4YPJA 3BVNA 4JKLA 5E6IA 3KYMB 1A3QA 3NACL 1NCTA 1J86A 5F71A 4D3CL 3CMGA 1XGUA 4Y4KD 3UC0H 5BV7B 4J6RH 1KIRA 4BSVA 3GMPB 4KMLB 4PYHA 3HMXA 2WUBL 4ENED 4JFYB 2DWEA 4JY4B 4WI9A 1BD2B 3K8MA 4I18B 3AUVA 5DEGA 3EDFA 4OIAA 2GTWA 1BP3B 3A6OA 1YC8A 5T3ZL 1D5ZA 3QWRA 5D5MF 2VAAB 3IB4A 4YC2C 3V0VA 5DQDH 1A6AB 4EN3A 1ORSA 1H8NA 4JRWA 1INQA 2YKLL 3LQAL 3PXHA 1FRGH 1DEDA 1NCCL 3UMTA 5C09E 2XTJE 4UINL 1C5BH 1E4XH 5F9DC 4PUBL 1TETH 2NXZD 4A6YL 4K55A 1FZOB 1EXUB 5CJQH 2DQTH 1CR9H 1MRFL 1UXSB 4RMSA 3PWVA 2R0WL 1ZVSB 2I60L 4CMHB 2X5PA 3B43A 4D94A 1IZJA 4AMKL 5I66B 1U8OB 5DJCB 4OZIB 3OGOE 3LS4H 1YYML 1YNLL 2AJZA 2D7QA 3QDGD 4QY8B 4KQ4H 1A1NB 1KC5H 2HH0L 4G9FA 4J4PD 3ZE2F 5DYOB 1LO0H 2EH8L 1BM3H 2AJXH 4Y0GA 4K8RC 1PKOA 3JUYA 2DTSA 1MCWW 3DRQA 4ONHA 3U0PB 1LK3L 1J1XL 1J88A 4X8XA 4PR5A 1YY9C 3CXDH 3SDXB 5CJXA 2OR9H 5JW5A 1U8JB 1HHHB 3OR6B 4TNWF 3WFEL 4AH2A 3FFDA 2VXUH 4X9IA 3T3MF 3VWKB 3SGKC 1JHKL 2XZZA 2VQ1A 2BX5A 2OCFD 4NZRH 5L2KB 1NJ9B 2EIZA 3IU3B 4XVSH 1BJ1J 1QYGL 4WW2A 3JV6A 5GS1C 1X5IA 2WWMC 3IDIB 4ZO8A 1HCVA 4MJIA 4MJIE 3KPQA 4WHYG 3PJSA 4HXAH 3BDYL 2APXA 4YHML 5K9JH 1DQQA 2LVCA 5I1IH 3LKOA 1TVBA 2F54B 2KH2B 5CEZH 1WC7A 3T0BA 5F97E 5IB2B 1BD2E 1WISA 5E8EA 1K8DA 3WKMH 1KB5A 3N06B 1UM6L 3KDMB 3IKCA 1UJ3C 5EULV 2D31A 1CZ8H 1A7RH 3G5YB 3LMJH 5KVEL 1WEJL 4N5ED 5LGJB 2YPLA 4DKFH 4F15C 4UILL 5CSGA 4N1HB 3CX2A 4PLJD 3DXAD 4KJWD 1WTLA 2VC2H 4L4TB 1F8TH 4Y4FC 5H8DA 4HPOH 4XZUB 2WNGA 1YN6A 2IWGA 5FOBA 3V4VL 4HUMB 1HH6A 1MWAH 3H42L 3D39E 1EEZA 1NAMH 5EOTA 2CKBB 2VZ1A 2A74B 3QAZB 4IDJL 4XPFL 1GZQA 2DM4A 2X4SA 3ULVF 1I1FB 1CD1B 1KXVC 1U91B 4LLWA 1UQSB 1NCWH 1SVZA 4DN4H 3IXAA 1F90H 2ATPB 3T77A 5EORL 1OCWH 4YE4H 5TE4L 3X17A 4KPHL 1KXTB 1CFNB 2P44B 1C5DB 3DVFA 2EKSB 4GW1B 4MGXA 5DLMH 3WHXA 4P57A 2YXMA 1IBGL 1MLBB 1OPGL 4F37K 2NZIA 4UT6L 2FJGB 2PF6A 3SDXE 1INDL 1NGYB 3GIVA 5DWUL 4D8PB 3V6FA 2QEJA 3CNKA 3VFGL 2NW3A 3MLRH 4GO6B 4PGJA 3FQRA 5IVNA 3QUXB 3RWGA 1Q0XH 5BOZG 5DUPH 3BKYL 1RZFH 3QCUL 3UTQB 4P2QB 4LLQB 4DQOL 5D2NB 2HTLC 1TNMA 3OAZH 4IIQA 1U8MA 2P5WB 5SWSB 2KUTA 4FXLA 1LP9E 2JJVA 1EFXA 1FAIH 3KPSE 4F80A 2OZ4H 3RI5F 4ZD3H 2IANA 5LQBL 1J1PH 1NBVH 1O7SA 5C0FA 4Y4HB 1A6PA 3VG9C 1V7NL 1S7VA 5T5FL 4UZGA 3C5ZB 4Q6IB 1MNUH 3EOTH 2BNRA 4U2YA 2BNRE 2EDTA 4LSRL 3BMWA 5HY9A 3VWJB 3MLYH 1OM3L 4K8RD 4FZEL 1LO3H 1C8PA 3RU8H 1BBDL 5H35A 3H0TA 1XR9B 1G9EA 5JW4Q 1UWGH 3QI9A 4RGNE 5JLZB 2VIRB 1YY9D 1JF1B 2X4PA 4OD2B 4KDTA 5J06A 4HBQA 3TO2B 4M5YL 3QIWC 4LDLB 4HK3J 1T2JA 5FGBA 4I9WE 4WTZA 1CFQB 2IALB 1FCGA 1AY1L 1XGYH 2FR4A 2R29L 4U0RB 3U1SL 3G6AA 1MFCH 3OJVC 4EOWL 1A9BB 2Y36L 3CFJA 1WVZA 1U0QA 4Y1AB 2WWMD 2AJYL 5EBWA 4LEOA 3THML 2WBWB 3IJYB 1KYOJ 3DV6B 3IFNH 3EFDH 3OG6B 1F4WL 4DWHA 5IV2B 1NCNA 5ESAA 3RWDB 1P7KA 3ES6B 5E8PB 1KPRB 1RZKH 1YUHB 5GRUH 5BMFH 4RWYH 4JFDA 5GPRA 5KSBF 4LSQH 1FDLH 5I76B 3PWPB 1A7NL 1UM5L 5KSUA 3P30L 3T2PA 1S9VA 3OJMB 1RMFL 4CW1A 5AD0A 1B90A 3B9VA 1C12A 4JKPH 3B5HA 4N5UA 3PV6A 4Y4FD 4F57L 5IB4B 3PV7A 4P2QE 3DX8A 3QXUA 4WEMB 1QRKA 5GGVL 4WW1B 4U1IA 4WTWA 5CZVL 1BZ9A 2FJFB 4LKCA 1Z9OA 2GSIB 3D0VB 1XF3A 5SWSE 1AGFA 3FRUA 3RZCA 1MHEB 2VR9A 4OD1H 3TT1H 2AQ1A 4NUGH 5FUZH 1WAAA 4PS4H 5DZLA 3BUYA 2FL5A 1DBBL 3H9HB 2IMMA 4LF3B 2P7TB 4PJBE 4ZUSA 2FGWH 1U36A 1N6VA 5DJYA 4IHOA 2VLLA 4L3EB 1E28B 4PY7A 1S7SA 1PYWA 2GKIA 4RSVA 3WDHA 1CDJA 1JGLH 3V6OC 3U30B 5I15H 5IJKA 4KJYA 5KW9H 3MA7B 2XKNB 5K9KB 4UNTA 3ZDZE 2Y7QB 2AKRB 1FQ9C 4EI5B 3GJFB 5T1KA 1QQDA 4LQFL 4O58L 4UIKL 1J0HA 1U8LA 5BJTA 3MRGA 4KI1A 4O9HH 2PN5A 5JR1L 2BK8A 1QFOA 2ZUSA 2Z8RA 1NFDA 4MNQA 2ZG1A 5D2LB 3RPIB 3ARQA 3HMWL 3GJFK 4L29A 3ARGC 4I77L 4ONGH 4U1MB 3C09C 3K74B 5C86A 5TGBB 5L2JA 4PGCB 1BFVH 4I0KA 1QBMH 3MYJA 1FYHB 2HTLD 4Q2ZB 1HK6A 3IF1A 2C7UB 1NKOA 35C8H 4P5KA 3RIFK 4XPBH 3QEUA 1X7QB 3D2UA 2DQHH 2EO9A 1A1MA 3EJYC 4NJAL 4DVBB 1E6OL 4YPGA 4OF5A 3VXRA 1HXYA 3S35H 2C3HA 4K94L 3SCMA 5GZNC 3CK0H 3FO9B 4QXTA 1HHGB 3RA7H 3AAZB 2G2RA 3FO2B 4ALAH 1XGQA 2FWOB 1A6UL 3LIZL 4H25A 3DMMB 4ZAKA 4X7EC 3QUYC 1KGCD 3X3GL 4KVNL 2B5IC 3NIGF 3GBML 5ABDE 2ESVD 4DUWA 1GOFA 4O2FB 5I2IB 3PHQA 3DYMA 5E03A 1RK1A 4LRNH 1QTYT 3VXQA 4L3EE 4TOYL 1KYOK 1ZHNB 2P8MB 5E1HB 4Y5VB 5JW4R 5SX5H 1IGJA 3X13B 1YEEL 3GSWB 3CDCA 1ZLSL 5IB3A 3RAJL 2AAVA 1YEGL 4MZ2A 4F58L 4PJIA 1ZV5A 4JR9H 1OTUC 4X0KB 2P24B 5AZEH 5C0CA 4E41A 1OB1B 1JVKA 2G60L 3VFNA 2DRUA 1K4CB 4GT7A 5FCUH 1WZLA 1U8HA 2R56H 5INDA 4AEEA 3KYOA 1WZ1L 2NX5D 4JN1H 3T8XA 4NHUA 1UVQB 4DGVL 4XBGB 3AGVA 3LB6D 3VGBA 1I9RL 1ZTXH 1I8MB 3AVEA 1NKRA 2AW2A 1D9KB 5CAYB 3MXVH 4KROC 1RHHB 4G3YL 4MLSA 3PQYA 2XI9A 3QG6B 1VACB 3MRJB 5C8JA 1G7IB 1F5WA 2OLDA 3WLBA 2PO6B 1OP9A 3JWOC 2VSDA 2DMKA 3VDBA 1CL7H 3VI3E 3UC0L 5TDOA 2GY5A 1Z0NA 2COQA 4P9HH 4J6RL 3X12A 3L3HB 5L7XH 1F3JB 2CR6A 1IM9B 1KNOA 4V1DD 5GRYA 3KPLB 4ZG1A 2HT4C 2ICES 3NCYS 4I13B 4W4OC 1FG2B 5DHVH 1I8LC 1A4JB 2XTJC 4R3SB 5CBEB 4HHAA 3TP4A 5DQDL 4NN7B 4Y19A 3WDJA 3MV11 5DJ2B 4PJDB 3WNPA 1FRGL 3RY4A 4NO3B 3MV8E 5DFWH 3P4NA 1K4DA 1C5BL 1E4XL 3IFOB 4NN6B 3ARGD 4U6HB 1P84J 5DJXB 2WUCH 2ZPKH 3L5XH 4RBPH 2DQTL 1JK8A 1CR9L 1DBAH 5E95B 1IC7H 2V7NA 3M8OH 4Z7UB 3MROA 2BY3A 4BQ9A 1WBZB 2J8HA 4ZDHB 1BLNB 3PP3H 4LAQH 3LS4L 3QSKB 3MGAA 4HBCL 1FO0H 4KQ4L 1DQLH 3MRCB 3EJYD 1KC5L 4OLZH 3JUZA 1F3RB 1LO0L 1ZVHA 1BM3L 2AJXL 4GW4B 2P5EA 4KK8C 2R2HA 4OFPA 1AHWA 2A6DA 3C9NA 5GZND 1BJMA 2HA1A 5DS8A 4OKVA 5BV7C 2DQEH 3CXDL 2OR9L 5EPMB 4JFFD 3MRPB 4K3JH 5JHDA 2CUIA 2G5BA 2N56A 3OAYK 1I3RA 3QUYD 4NZRL 3QXTA 3NZ8B 4XVSL 2XN9B 4I18C 2EIEA 3BP4B 3QZWA 1BWWA 5AWNH 3PL6A 5D72H 3S98A 3WJJA 2GAZB 5HYFA 4HXAL 4X6BA 4Y89A 5K9JL 3U0TA 3MV7A 2ITCB 4PLKC 1SJVA 4A2MA 1S7WB 5CEZL 2QQNL 4KHXH 5LJYH 3GMMB 1XR8A 3U4BH 5JO5B 2IQ9H 1JI2A 3WKML 3W9DB 1UH4A 1U8NA 4QRRB 3T4AA 1DL7H 2YUZA 4JFXA 4H1LB 1A7RL 3DURA 3LMJL 1ZHKB 3EKCA 1OTUD 4DKFL 3IDMA 4CMHC 1WBYB 1MAJA 1MHCB 1H5BA 4CRPA 2VC2L 3IJSA 1F8TL 2P45B 4HPOL 3MLWH 4JFPA 2QHLA 4TUOA 4JHZA 5K93A 1JNNH 1MWAL 1PX3A 4NKMB 4LRIA 2ADJB 4N0CC 1NAML 1AC6A 4N0FB 2FBJL 2VLRE 3O2VH 4V2CB 1J7VR 5J12B 1CS6A 4JRXA 4Z7UE 1BEYH 1DR9A 3CCHA 4BSWA 1CWVA 4KROD 5ESVB 1YEFH 3BN9C 2DOCA 5D5ME 4Z0XB 1NCWL 4IOFC 5C07D 1F90L 2ZOLB 1ZS8A 3VWKC 2YPKA 1OCWL 2CSPA 1E4JA 4OQTH 2ENSA 2E9JA 3U9PH 1B0GB 4CU8A 3TNNB 5BS0A 2KDGA 4BZ2H 4LEXH 1XH3A 5EDXA 3V8OA 1JZ3A 2APBA 4QWWC 4RCAA 4N8VB 1P6FA 3IETB 4HCRH 4QXUH 1VENA 4BKLA 3D0LA 3E6FB 2HT4D 3S5LA 4HDIB 1IFHH 4WNQA 5IK3B 1YN7B 3EDEA 5HJ3A 2E9IA 1XEDA 1WTGT 2BCKA 2GCYB 5FYJE 4CAGA 3QDJD 3TIDB 2YA2A 2IPUK 3MLRL 4M43H 5FO7B 2XZCL 4BZ1H 4J8RB 1NBZB 5DUPL 1RZFL 4XP9H 2W9LA 3ZE2E 5H94B 4M1GH 2HRLA 2DS4A 2IAMB 1JYVA 1D5MB 1P84K 4JVUA 4WI6A 1CVRA 3O6FA 4Z95H 2DIJA 1NCAL 3AXLA 3KNBA 4MAYA 2MJWA 4QHUB 5J6GB 4Y2DB 3BEVB 4OCRH 1FAIL 3UTSA 3BHBA 1N64H 1J8HE 2AXHA 3ESUF 3EYOA 2OZ4L 4ZD3L 3MX0A 3T3ME 1NBVL 5LAXB 1GGIH 1RD6A 4JFHE 3O11A 3AROA 3WE6B 3QAZC 4AK1A 2V2WA 5C0EB 2X1PA 4XWOC 5E2UH 2R0ZL 5HGGS 2CKNA 1MNUL 3EOTL 3QEGH 3I3DA 3QWOB 4PIRF 5TH2A 2D7MA 3P4MA 2BERA 4U1SA 3MLYL 4BJLA 1PBYA 4PRBA 1HQ4B 1LO3L 4LVNB 4KK8D 3QRFM 3RU8L 5LGKA 2B2XH 4NO5A 1UWGL 4DUXA 5D1ZA 2FX8H 3EO9L 3UJTH 1CXIA 4WVRA 4HJGB 1FVCB 5C0IA 3AS3A 4KZDH 1R5WA 4MCZA 2F53E 4LHUB 5M7QA 1P7QB 5D6CB 3IGAB 2N7BA 2YRPA 1XGYL 1R3LB 2VXQH 4MA3B 4X7TB 2JCCB 4GKSA 3MC0A 4LBEA 4HC1H 3K8LA 4ODUA 4AT6B 1MFCL 1WSST 4NO2A 4ZFZA 4LKXB 1JGDB 2EE3A 4HUUB 4XB7A 5SX4H 2R2BB 3OF6D 1KELH 4GG6B 3EFDL 4V2BA 5FYJU 5GGVY 3QUXC 4R4FH 5FKAB 5J0BA 1RIVH 1PQZA 2HKHH 5D7LB 4PLKD 1N5AA 5L88H 5D2NC 1R5VB 1RZKL 3TCLA 3P9MB 5IOPB 1HZHH 5GRUL 1H15B 1L7IH 1RIHH 3DECA 4F7PA 1EK3A 1XMWA 4LSQL 1FDLL 3HZYA 2ED8A 4XAKD 1I85A 1PW3A 2EYSA 1TCRB 4RMWA 4Z78A 3PABA 1RZ7H 1FFNB 4XMPH 4R4NC 1JFQH 4JKPL 3VXOA 4ORZC 2DQIH 1FGVH 2PTVA 4TTGA 2FJHA 4Y4HC 4F33B 2BSRA 1OP5K 3FB7A 3STLA 3QRGH 4R0LB 3C5ZC 5TDNA 6FABH 3GSNA 3PGCA 4N0CD 3NGBB 3U7AA 1R3KA 4POZC 1JGUH 4OD1L 3TT1L 2Q6WA 3OKMB 3VWJC 4IDLA 2EDKA 2XIDA 4NUGL 4MS8C 5FUZL 2E27H 1PKQA 4PS4L 3VI4F 4H8WC 3SKMB 3BP6B 1A2YB 4DCQB 1CDUA 3BN9D 4PJEB 2FGWL 4WU5A 2EDNA 2F58H 2W0FA 5ENWB 2EDRA 2X05A 4IOFD 5HGHA 1TITA 1IAOA 1LE5A 3ZO0A 4PD4K 3VWKD 1B0RA 3LEYL 3V95A 3ZHKA 5L2KD 3K4DA 4APQB 4U0RC 3HNSH 3BQUA 4FTVA 4S1SL 2YD8A 5KS9F 1CDGA 4P3WA 1JGLL 5I15L 3RDTD 1NMCC 3WFHA 5HHNB 3IAQA 1VADA 5KW9L 4QWWD 5DJ6A 4XAWH 3KPRB 4J7RA 4HFWB 5IR1B 3WUWA 1MWAA 1UXWB 3MJ9H 3FCTA 4P99A 2F54D 5EUKB 1A22B 3D25A 5MEPB 4JVPA 1S7TB 1X3DA 2JCCE 4P4RB 7FABH 4O9HL 4WU7B 5HSFA 3QDMB 5EOQH 5ID0A 1ZE3C 3PDDA 2J12B 4XNUH 4ONGL 2FECI 1T66C 5GJSH 3SJVB 1BFVL 5EO0A 2FSEA 1QBML 2VDNH 4HQQH 1MJ7H 4L4TD 4QNPE 4YHKH 5CBAA 2VAJA 4NWTH 3GSOA 4N90E 5HHMD 5D7JA 3WNKA 5JPMB 1S3KH 4HKZB 35C8L 2ICCA 2YWZA 2EYRA 4XPBL 1DBKH 2DQHL 2FEEI 2VDKH 2AK4B 3QFJB 5HPMA 3VXSB 4GBXA 2ED9A 1EO8H 2DTMH 5A40E 4X98B 2IC2A 2IPTH 2PXYB 2O5ZH 4CVWA 4XWOD 3S35L 5EBMB 3CK0L 3MBEA 3RA7L 4Q74A 3PG2A 5HHQA 3MRIB 4ALAL 1T5XB 2NNAA 4JQXC 5AUMA 4RGOH 1LEIA 1U3YA 4WI3A 1CDHA 3D85B 2PTUA 3C6LA 1WCBA 1YMMB 2HFGH 3CAFA 3HI5H 3U30C 5DURB 5E9DA 4XCEA 5E6IB 5KSBA 5ERWA 1ZGLA 1ZAGA 2YD3A 4N8VG 4PJEE 2IPUG 4MA1B 5KN5A 1XGUB 4LRNL 4M8QA 4EI5C 2W07A 4AJ0A 1BZ7A 1L0QA 4DN3H 4BSVB 5TJWK 4RDQG 4P5TC 3LSOA 1JHLH 1F00I 1WK0A 3QUXD 5MI0B 5I18H 1JWMB 3HAEB 2Q8BH 4EIGB 4Z18A 2FRGP 4JR9L 2Z93A 5AZEL 3S34L 4C59B 1D5ZB 5DSCB 1JF6A 5HYJB 1WLHA 2P5WD 1ORSB 2H9GA 2W92A 4OF8A 3ARRA 3QDME 1INQB 4ZS6D 1KCKA 5MEQB 3GRWA 4JM2A 4X99A 2YK1H 4CN1A 4R4ND 2R2EA 1ZTXL 3NIFF 3BGMA 3AY4A 3B5GA 3KR3H 4Y4HD 1OQOA 4OLYH 3MXVL 3ARDB 3WNOA 2XNAA 4PJ9B 4H5SA 3SGEI 3PWVB 2B1AH 3C5ZD 3RHWK 4XBEH 5DVLA 3GI9H 5F3BA 4JO3H 4TVPH 1DLFH 2V5YA 3VWJD 3HC4H 2RHEA 3TN0C 3DMMC 3QT2A 4MS8D 2AK4E 1MLCA 4P49A 3VXSE 4EDXA 2HKFH 1CXKA 1CL7L 1I8KA 3SE9H 4PJ5A 1BX2B 2A6IA 3V0WH 3Q3GA 4ZO6A 2F19H 4RAUA 2HFTA 2ZUVA 2WIMA 5L7XL 5L0QB 4LHUG 2ATKA 1BGXH 3PWJA 4ONHB 3KPMA 5F1SA 1S78C 4AZ8A 1UA6L 3L3IA 1K85A 1D6EB 4Y1AD 3F7VA 3BAEH 3HZVA 3LKQA 2DLFH 4QO1A 1IKNC 3QULA 5E99H 4Y5VC 3FFDB 1Y0LB 1T1YA 4UNVA 2ARJA 1QO3B 2EIZB 1T20A 1MCRA 3DGGA 3JV6B 3DX6A 1OSPH 4MB5A 4DZ8B 3KPQB 1X5HA 4QOKA 4OCWH 4OZHF 1ODAA 3PWPD 4RFOH 3QA3A 4NCC1 1DQQB 5I1GL 1ZWIB 3LKOB 2ZPKL 1T66D 1TVBB 4GS7C 1DBAL 2VN7A 1IC7L 3M8OL 3G5XA 1X4YA 1K8DB 1KB5B 1QFWH 1D9KC 4PJXF 4LNVA 3EO0A 2D31B 3ZDXE 4FQJH 4TVSa 4OCSH 1A7QL 5HYJE 3ZSTA 1EMTH 2LU4A 4B41A 1FO0L 2GIYA 2YPLB 3ROLA 3BPLB 1DQLL 4OLZL 2E6PA 4J12A 3RWFA 2VZOA 4EVNA 1GGYA 2PO6C 2PYEE 1YN6B 3PWLA 1LEKA 5E2VH 5FOBB 1HH6B 1WV7T 1ZKAA 4LU5H 5I9QB 3P0VH 2DQEL 2MWCA 1EEZB 5EUOF 4FOMA 5EOTB 1QBAA 1TLKA 4K3JL 3CSGA 1GZQB 2DQFA 2AI0H 2X9WA 1RI8A 1NAKH 2AV7A 4OFYA 1M05A 4MQ7A 2UZXB 5F7DA 5AWNL 5D72L 1LGVA 2CUMA 3IXAB 5GS0C 4LCYB 3MV9A 3CVHH 3OXSA 1UG9A 3UTTB 1Z9SA 4NN7C 1WT5A 4AYFA 5D1XB 4R7DA 4EI5D 4RAHA 1IGYA 5KSAB 1S5HA 4PGZA 2BNQD 3WHXB 4GJTB 4KHXL 2K9UA 3EYVA 3LKSB 2Q7NA 3U4BL 4FS0A 5EA0H 3KPTA 4M7KH 3ZT5A 3GMRA 4P5TD 1DL7L 4NN6C 4NDMA 5HTSA 1RULH 2DQGH 3GIVB 1Y6MR 3V6FB 1YZZA 2CKBH 1QKZH 2BXZA 2B0SH 3A6BH 2ADIA 5F1OB 1U8IA 4K9EH 3BRFA 4NPYB 5ISZE 5FDWA 2IFFH 3MLWL 2IGFH 2OTUB 3RWGB 4PJGB 4PRPD 5EU3A 4HIXL 4I2XB 4OIBA 5JMOC 3HCVA 4IIQB 4F2MB 3O2VL 5GGRY 3LN4B 3D3VA 4J3WA 4JEGB 4W4NA 1EFXB 1YEFL 2V9QA 3UPRA 3UJJH 3H9YA 2IANB 3S36L 5C0FB 3HZMA 5DJZA 3TN0D 3DMMD 4NT6A 3C5JB 2H26B 1RURH 4OQTL 4UUJA 1J9CT 3U9PL 4GG8A 1RAMA 5DDHA 2Z4QB 3B4NA 3MRRA 4BZ2L 4LEXL 3I6LE 3W0WA 3ARBC 4QRUB 4X6CE 2YD6A 43C9A 4XT1C 4YHZH 4KXZH 4HCRL 1FFPA 4QXUL 4IMKC 5H35B 3O2WH 1EAJA 4QYOB 1IFHL 4TPRH 5ELIA 2VLJA 1S78D 3P3YA 2XRAL 2X4PB 1EEYA 2VDOH 1RJLA 5C0BE 4FQHB 4QRQA 2OTPA 1ZT4A 4BZ1L 4CKVX 2AV1A 1ES0A 4WUUE 3G04A 3HAEG 4XP5H 2FR4B 5FHAH 4X6DF 4YFEA 3UTTE 4QRPD 4M1GL 4C54A 4NQEA 5EBWB 4LEOB 5DHXB 4NFBA 5KBNC 3VRLF 5F7LB 3KXFA 2EECA 4Z95L 1P1ZA 4ODBD 4LIQE 5T3XD 5ESAB 5CP3H 3NIDE 3X11A 1IAIM 5FYLE 4OCRL 1P7KB 5FUCE 4XMKH 1N64L 1GGCL 1OAKH 3WMSA 1SM3H 4FQXA 5F1NA 1BJ1H 4JFDB 3M45A 5J12C 1GGIL 4HWUA 2D03H 1D9KD 5FYKD 4ZSOB 5BZWB 5EN2B 3IAGC 3ZL4H 5E2UL 5IW1A 3LRGA 2Y06H 2MKWA 3QEGL 5JW3H 3TPKA 1CF8H 4O00A 3GSQA 1L0XA 3DX8B 2PO6D 5F6IC 3BKMH 4I2XE 4U1IB 3TJEH 1T3FA 1OD9A 2HTKC 4UDTB 2B2XL 1HSBB 2NY2B 1XF3B 2IADA 2YXFA 2UYLB 3H2WA 5DTFA 1AGFB 3FRUB 2FX8L 4U6VH 1H3UA 3OG4B 1HINH 1WGOA 3UJTL 4KZDL 1IM9D 2B7DT 5BRZE 3BUYB 2EKJA 3TPUA 2VXQL 3QO1A 4JY6A 4HC1L 4I3SH 1IE5A 4ZUSB 3MRKB 3JV5A 4LSTH 1A02N 2VLLB 5GS0D 5T3ZE 1KELL 4HIIB 2AEQH 1S7SB 4R4FL 1FO0A 2DKMA 4RFEA 3S3PA 2BVOA 1GCFA 1RIVL 3WEXA 2VWEC 4KJYB 1HZHL 2IAMC 1L7IL 1RIHL 4NC1C 5E6ZA 3U36B 5DMIH 3F12B 5A16B 4DKEH 5T1KB 2JB5H 4UDUA 2ZCHL 2ZCKH 5EIIB 4Y2DC 4CVZA 1RZ7L 5FECA 4XMPL 1I8IB 1JFQL 3R0NA 4LLDB 4WFHE 4ELMF 1CIDA 2DQIL 1R0AL 1NFDB 4MNQB 5HGAB 2V7HA 1IGCH 1JGEA 4WDIB 2UUDH 3WSQH 1N6QH 3QRGL 1DQTA 4NRZA 5ICZA 1AJ7H 3GSRA 1FNHA 1KEGH 6FABL 4BQ6A 2CLVA 3K0WA 4W6WB 1JGUL 4HFUH 4F9LC 3WN5A 4J1UA 1URLA 2KZ1B 3IF1B 1OP3H 2E27L 3RWIB 4ESKA 3ALPA 1MCLA 3ARFA 3QEUB 3GZKA 4PBWD 3QEQB 2X1XR 3O3EA 5CP7A 1A1MB 2F58L 3JZ7A 3MCLH 1H8SA 4U0QB 4UOJA 4IRJB 1TPXB 3VXRB 1PVHA 2I5YH 1TZGL 1LK2A 3HNSL 4GMTH 2XN9D 1FV1B 4QXTB 1DP0A 1U92B 5FA4A 2Q8AH 3ARBD 1XGQB 3LY6A 1I7UB 1NEZA 1RZJH 2CLZA 2R23A 3KJ6H 3QPQC 1AIFA 4H25B 4XAWL 5T1DH 3U7YH 4YEFA 4KUCF 4R97B 1G9MH 3AS0A 3KPNB 3MJ9L 1FL5B 5F8RC 2QQKH 3OPZH 4PLOB 3T1WA 4DOHE 2LFGA 1BFOB 1Q9WA 2AS5M 1WITA 5EOQL 4NHCH 3OKKB 4K3GA 3MFFB 4QRRD 4YDKH 3U83A 1PDKA 1RK1B 3E8UH 3BE1H 1DLHA 5D7IF 4XNUL 3QJFA 3MMEB 5DJDA 3VXQB 3MLUL 4PP2A 4G8GA 5GJSL 3SE4C 3Q5OA 2CK2A 1UWXK 2VDNL 3QIBA 4HQQL 4OFIA 2Y5TA 4K2UH 3MUGA 1MJ7L 5E94B 1IGJB 5J7CC 4YHKL 2OXHA 1VPOH 1CGVA 2W60A 2FATH 4Q9CA 4OQTA 5C0RH 4XPGH 4XVJL 5IB3B 1ZT7A 1OF2B 2LTQB 4PJFF 4HLJA 1L9MA 5IB5A 4M9PA 2YD5A 1DBKL 4HS6A 4PJIB 4R0LC 1A5FH 5C0CB 4E42A 2VDKL 3OGCB 1WIUA 3NGBC 1A1OA 1T5WB 3VFNB 1EO8L 3V7AG 2DTML 1JV5A 5DD3H 5FKPA 3CXHJ 4U3HA 1HCFX 4XX1G 3SPVA 5INDB 5DRWA 2O5ZL 3KYOB 3BT2H 1OTTD 4NQDA 2YZ1A 3W5NA 4NHUB 1CK0H 5F9JB 2HRPL 4I0PA 2FX7H 1C5CH 3CH1B 3QXWA 1U8KA 2VYRE 1IRAY 3F6LA 4DK6A 4RGOL 3T09A 5ETUA 4YNYA 3FQTA 2DB8A 4HG4K 5DZOA 4NOFA 2HTKD 4APQC 4ORGA 2HFGL 3HI5L 5TQ2H 1PY9A 3PQYB 3AB0B 3NH7H 1BJ8A 4KRPB 1X5JA 1BF2A 5FGRA 3H8NA 5C8JB 3QEQE 4HH8A 2NY5H 3TF7C 4MJ5A 3WDIA 1OAYH 3DGCR 4I3GA 5TDOB 4U4BA 1SJXA 5GSRA 5GSVB 5DEFA 4DN3L 1MJUL 4HMCA 1PD6A 3OKDA 3MZGB 3X12B 2CXKA 3PDGA 4NZDA 4WTZG 1VCAA 4ZXBD 4X5XA 3OR7A 2BDNL 3UTZB 5I18L 5JXAH 1DUZA 1GVIA 1QBBA 1WFNA 2Q8BL 2X4NA 2YUVA 5K9OA 3K1DA 1WUNT 3VXNB 2GQHA 3HLAA 4PJ7B 2H32A 4P23A 3ULSB 5FYKH 4HZLB 1YNTA 2IAMD 4HHAB 3VI4E 4JZOA 1FBIL 5EIVA 2K7QA 4UMGA 4Y19B 3FFCA 4KZEH 1TTUA 3FFCE 5IMMA 4Y2DD 1Y6NR 3F62A 2YK1L 3ETBF 2IBGA 3CFEA 4X83A 3P4NB 1K4DB 4ODVH 2CDGB 1SJEA 2PXYC 1BBJA 5KS9A 2A2QT 4HC1A 1DEEA 4OLYL 3GSVB 4KUZH 5SWZD 4UAOB 1JK8B 4DW2H 3NBNA 2B1AL 3NFSH 2V7NB 2DYPD 4XBEL 1H3PH 3MROB 4HZAA 4JPIA 2HVKB 3GI9L 3FQXA 4JO3L 1DLFL 4TVPL 2DDQH 1ZLVK 3QHZH 4LSUL 4RX4A 1H0DA 1TENA 2N7AA 4OF7A 2HKFL 5CHNA 1FL3A 1SMOA 5DI8A 4GRLA 1WWCA 3V0WL 5C0JB 1XGTA 5E6IC 2F19L 2DLTA 1QRNA 2EC9U 2VDMH 2A73A 4LHUD 4MA1C 2JB6A 1BGXL 2OK0H 2R2HB 4ZTPH 4OKVB 3MRMA 4FXKA 5FM5M 2VLME 4KGJA 4HGWB 3BAEL 4G7YL 2H3NB 2DLFL 3WFBH 1KJMA 1KV3A 4ZUTA 5JHDB 1CE1H 3P2TA 3QPQD 2G5BB 1I3RB 2CRIA 5MI0C 4OGAC 4CADA 4YWGH 3EW3B 5D7LD 3WXWH 4DGYH 5JNYB 4M7ZB 3HUJB 1OSPL 3PL6B 2OSLB 4ZNEA 3F7PC 5JDSA 2Y25A 4FHBD 4X6BB 4RFOL 3TJHC 8FABA 1R24A 1T0MB 3MV7B 2HT2C 3IXTA 3BIBX 1A7OL 3MRHA 3GKWH 4YLQT 1MI5A 3VJ6A 4OF0A 1PSKH 1XR8B 1RK0A 4FNLL 3QCTH 3X3FH 2BY0A 3UTPE 4KH2A 4PJ7E 1QFWL 4JFXB 5C0AB 4FQJL 4OCSL 1EMTL 1TDQA 4PFEA 3IDMB 5I16A 1EBPA 4JFED 3BH8A 4L8SB 2EXWC 4AIZA 3IJSB 5F88B 4OKDA 5B38A 1ACZA 3REWB 1JGVH 5HHOE 4JFPB 4JREB 2A38A 1GSMA 5AG9A 4LU5L 1BQHA 32C2B 3G6JB 3P0VL 4I5BA 3L3DA 1KPUA 4UV7H 1PFCA 3BEWA 5L0QC 4JRYE 3CCHB 2EE2A 3OZ9H 4BSWB 2AI0L 5DHYA 5FCSH 3IDNA 3I2CH 1NAKL 2GUOA 2R8SH 3GIZH 4GAJH 3WCYA 5CJXC 4R9HA 4RAVA 3TA3A 3KPRD 1ZS8B 3CVHL 2YPKB 1CGWA 3JTTA 3I9GH 5BCAA 4Q0XH 2D0FA 5BS0B 4WW2C 2CD0A 3FQNA 3WIFA 4LCUA 2FIKA 3NIFE 1JCKA 3OKEB 5EA0L 4LP5A 4M7KL 2BSTA 4N8CL 4HWZA 4BKLB 3D0LB 2MQ3A 3S5LB 1RULL 2DQGL 1UYWH 5D93B 3SJVD 3S37X 2CKBL 4PV8B 1QKZL 2DD8H 2WMPA 2BCKB 2VLKD 2I9TA 2B0SL 3A6BL 1DVFA 2GTZA 3ILPA 3BPOB 2BNUA 4X4YA 3M1BA 3SDAB 2ICWA 2IFFL 3HUJE 2CIKA 5EU6A 2IGFL 1V5JA 4P2RD 1AC0A 4NRXA 1OGTA 1A3LH 2HJKA 2J6EL 2QTEA 3BPLC 3MLTA 1ZA3B 3QFJD 5CD3A 3MCG1 3VXSD 1AKJB 3NFPB 4ZPVA 5BZDA 2IG2L 3O6FB 2PXYD 3AXLB 3KNBB 3VFVA 4I4WA 3MACH 3QBTB 1JWSA 1ZHBA 4BH7B 4NGHH 4L9LA 3UTSB 5I9QC 5J57B 5C0AE 1B6DA 4RRPA 1N8ZA 2XQBH 4KY1H 1JNHA 3UJJL 1CVSC 2EDWA 3O11B 2BJMH 2V2WB 4HIEB 4WEBH 1RURL 1YMMD 4HX1B 3IDJA 3FOMA 5DURD 1BVKB 5E6ID 3FO1B 5DEZA 4OZHA 1CGSH 3P4MB 4OZHE 3MLVH 1E4KA 5KG9B 3G6JE 4YHZL 4JN2A 1LO2L 2PR4H 4PRBB 3ULUC 1QHOA 4JGUA 5D1XC 1QA9A 3BZFA 3O2WL 1I1CA 3SDDA 4NM8H 5KSAC 3P40A 4TPRL 1P69B 1MH5A 3RUGF 4XCCH 2VDOL 4LGPB 4MCZB 4PJXE 2KBGA 3MRQB 4OGAD 4C57C 4U1HA 3V6ZA 4XP5L 4Q6YA 5F89A 4LBEB 5FHAL 4ODUB 1CLYL 4BZYA 4LVHB 2WIIA 4WI7A 4FQQB 4QRTA 4ZFZB 1J5OH 2BOCA 3QWRD 4WO4A 4FFZH 5HYJD 4EN3D 3OXRA 5J11B 2AXJA 1KTLA 3REVA 3TJHD 3HPJA 4P59H 4UI2A 5EC2B 5EUOA 1PG7L 1PQZB 2HT2D 5LWYH 5JXEA 2F9BT 1N5AB 4XMKL 5BVJA 4MNGA 1OAKL 3WFDH 1SM3L 1CFVH 4IIQC 1DANU 4F7PB 5J3HD 4GRWH 4KRMB 4XPAH 3RWHB 2EYSB 3T0EE 4NQSB 4JJHA 1CDCA 2Y06L 5I1EH 2EXWD 1SJHA 3VXOB 1WBXA 2WW8A 3PWNA 1UM4L 1CF8L 1PLGH 4MNHA 3SN6N 1IAIH 2BSRB 3BKML 3IDGA 3STLB 3TJEL 3CVIH 4MDIA 2BSSA 1FP5A 4MYWB 4KVCH 4GAYA 1FORH 1R3KB 4U6VL 3EYFA 1HINL 4FABH 4Z7OE 3O6MH 3EJJX 3VMNA 3ABZA 1PKQB 3V2AR 1ZLUK 5ALCH 4RA0C 3UDWC 1QPPA 1CT8B 4XPHH 3TVMA 1VGEL 5HGHB 4LSTL 5F44A 1FPTL 1KTDA 4YFDB 1M7IA 3BN3B 1LE5B 3QR2A 4I3RH 5FGBC 1B0RB 2AEQL 1YEDA 4M7LH 3BQUB 3IS0X 3N85H 1V3KA 3JWDC 4XVUC 1SEBA 3P0YH 3U48A 4M48H 4U1LA 4WCYH 5EO9A 4KMQA 2HAZA 3QZWG 4XBPA 3WFHB 4O5LH 5DJ0A 4NQUA 1VADB 3OKNA 5DGRA 1VFBA 3OB0K 5DRZA 3HPLA 1MWAB 4DKEL 3FCTB 2JB5L 2ED7A 2ZCKL 4D0CA 1NAMB 3X14A 3D25B 5ICYA 1AGEA 5ID0B 1HHIA 4LLUA 1IGCL 3L7FB 4TN9A 4OZGF 3O3AA 3WSQL 1Q0YH 1FNEA 3BD4A 1N6QL 1KEMH 2AQ3A 2FSEB 2YPLD 4U7MA 1AJ7L 2C26A 5CGYC 1KEGL 1I7TA 3TYFA 3OKOA 3EFFB 3CVHA 1WCQA 3HE7B 3TEUA 1SEQH 3GSOB 3WIHH 5D7JB 1RJZA 2NY2C 5GGSA 5ID1A 4OT1L 1KN4L 5IHZB 5D1QB 3MCLL 4PJHF 5GGRB 5B4MC 3VGEA 2WBKA 2D7NA 4HWBA 3IFPA 1HXMA 3LPGA 4X6DA 2I5YL 2H41A 2EE9A 1F6AA 3O3BA 3HHRB 4GMTL 2DIAA 2HVJA 4MAUH 2V17H 2Q8AL 15C8H 1LD9B 3LN5B 4LCCB 2NNAB 1RZJL 5AUMB 5IJVA 1FN4B 2BHUA 3U7YL 3ULUD 1G9ML 4DZBA 3FTGA 1DANT 2GK0A 3VFWA 3N0PB 2QQKL 5ADOH 1T1ZA 1L6ZA 4C56B 5CJOH 4OIIH 5IJKC 5E9DB 4XCEB 3TBWA 3HC0B 5CEZE 2EEDA 4NQCE 1ITCA 2D0GA 1ZGLB 1WFUA 4MJ4A 1OQXA 4YDKL 3JWNC 3MJGX 3E8UL 3S5LG 3H3PL 1BZ7B 3OAZK 3P9LA 3QFDA 4UBDC 3OKLA 3VRJA 4OCNC 1ZXQA 3O45A 1A0QH 3VFUB 4ZO7A 1T89A 3L7EA 4JFOA 1E6JH 3LSOB 1VPOL 5C0RL 2FATL 4GFTB 4XPGL 2OR8A 3SDCA 3LEVH 1A5FL 5C2BH 2RFXA 2Z93B 1TMCB 1MELA 3BO8B 4QTIH 1Z9LA 4U6YA 3F5WA 3L3KA 3O4LE 4PREA 3QUZB 2H9GB 3MOBH 3BT2L 1AGCB 1EFXD 1CK0L 2VDQH 3U2SA 4JM2B 1GPOH 2FX7L 1C5CL 3RVTC 3SDYH 2IAND 2LQRA 1TPXC 3D87B 4AY0A 3I6KA 4LLYA 1LEGA 4L3CA 3WJLA 1NLDH 1CTOA 1NH6A 2XNAB 4H5SB 1D5XB 1U9KA 1UWEH 5TQ2L 4OM1H 5JUEH 4WTXA 3NH7L 3IAPA 4B5EA 5F3BB 3U46A 1HWHB 4OSUL 2NY5L 4R97C 5CP3A 1I8KB 3SQBA 3VFSB 1OAYL 1PEZA 1X5LA 3F7YA 3QI9D 3Q3GB 4KMTH 4ELMA 1AR2A 3GBNL 4RAUB 5I1AB 3QDGB 3NTCH 5F3HA 1XF2A 2ATKB 1TQCB 3PWJB 1B2WH 3QISA 3FONB 5JXAL 3PIQA 1KLGB 3QH3B 1TJGL 4XVUD 1VEMA 4L8CA 2IQAA 3L3IB 3F7VB 5FYKL 3LKQB 2GI7A 1Z5LB 1T1YB 4UTBH 4P4KA 4C56E 5JQ6H 2Y6SC 1D7FA 5DK0A 4OGXH 4XMLH 2ARJB 2DWDA 2LTQC 1YY8B 4KZEL 3W9EB 2E8YA 1KBGH 1T21A 1K3IA 1EV2E 3BPNB 1ED3B 4XC1H 2XWJB 4JFDD 2P8LA 4QOKB 4ODVL 1YDPA 2AABH 3QA3B 3NN8A 3V5DB 5C9JB 2WQRA 1TJIH 4KUZL 1CI5A 4DW2L 4RWHA 3JBG7 5CGYD 1FNGA 4JDTH 1H3PL 5GGQH 2DDQL 3L9RA 1GHFH 5SX4I 3QHZL 5DVNA 4P3CH 3LQZB 4NQVB 1DCLA 3SKNA 2NY2D 2VZ3A 5HI5D 4NC2B 1R6VA 3AB0C 4KRPC 1YJDC 5B4MD 2VDML 3RKPA 5D7IA 3RWFB 5E24E 4M3KB 4EVNB 2WWKO 5B3JE 3LPFA 1QSEB 3PWLB 2OK0L 4ZTPL 2A1WL 2Q86B 4X80H 1KG0B 4Q97A 2EYTA 5E5UB 4P46B 3MGTA 3WFBL 1OAXH 2FX9L 1B4JH 1CE1L 4PJFA 4F3FA 2DQFB 2W0KA 2PW1A 4GKNA 5E6YA 2AV7B 2FNBA 2OTWA 4YWGL 3RL2A 3DNKA 4L8BB 3WXWL 4AEIH 4DGYL 4HJJH 2DLHA 4NO0A 3EO1A 3QO0B 4J3SA 1B0WA 1F4HA 4L4VA 3MV9B 3SHSA 3OXSB 3KLDA 5HGBB 5JDJA 5IBLC 3WUWG 2J4WH 4R7DB 3QDGE 5T1KD 5JW4M 4HULB 4WHTA 3BD5A 4UBDD 1S5HB 3GKWL 3EYVB 1PSKL 2P47B 3L95B 4OZFH 3X3FL 2R69H 4MNQD 1UZ6E 4HMDA 1TCMA 3TBVA 2ZUXA 4TULL 4NDMB 2CRZA 3A6CH 4ODXB 1P5VA 4UAOC 5IIEA 4O51A 3MSPA 5E1AA 2FD6H 4L5FH 1I7RB 1IGIH 5FDWB 3VE0B 1JGVL 5B21A 1JUFB 3D2UD 2H2PD 5IQ7H 3IVKA 5IEHB 5A43C 2NY6B 8CGTA 5FA3B 1LE9A 2OJEA 3ARXA 4UV7L 5ANMA 1U8PB 3D3VB 1FFOA 2FLRT 3VXRD 3OZ9L 3MV01 2E7MA 1AHWC 3RX5A 3I2CL 3SCMD 3HE6A 2R8SL 5F7YC 3GIZL 5I8CB 4GAJL 3DHMA 3UPRB 3VU2A 2VXSH 2Q76A 3HZMB 5DJZB 4NT6B 5J1SC 3I9GL 2NYYC 5B22A 1L7TH 5A2FA 4GG8B 5DDHB 4G80A 2G5RA 5SX5K 3MRRB 4M7ZC 2OJZH 3DXAE 3PL6C 3NFNA 2IFGA 3LPWA 1NGZA 1AQDA 3WJJC 43C9B 4PV9A 3MGOB 1FFPB 5F9WB 1Q9KA 1CQKA 3FMGL 1F4YH 1FZMA 3ELAT 2RR3A 1IJ9A 4N0YH 3DX7A 1EEYB 4PTUB 2J88H 4XTRC 4KK6C 4QRQB 2Y6SD 5F70A 4K94C 3VXUA 1T7YA 3CDFA 2AV1B 1ES0B 4ZYKB 3G04B 3NCYP 4XNXH 4XC3H 1T80A