1JGLH

Crystal structure of immunoglobulin fab fragment complexed with 17-beta-estradiol
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
216
structure length
206
Chain Sequence
QIQLVQSGPELKKPGETVRISCKASDYMTSGMQWVQQMPGKGLKWIGWLNTQSGVPEYAEDFKGRFAFSLETTAYLQINNLKNEDTATYFCATWGGNSAYWGQGTTLTVSSAKTTPPSVYPLAPGNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a recombinant anti-estradiol Fab fragment in complex with 17beta -estradiol.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Ig kappa-chain
total genus 36
structure length 206
sequence length 216
ec nomenclature
pdb deposition date 2001-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jglH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jglH02
4OLXL 4V1DE 3GSNH 4WW1A 1D5MB 4G9FA 2BNQB 5C0ND 4JO2H 3IDYC 4ONFH 3DUSB 4KQ3L 2D7MA 5EZJA 3VFTA 4PJAA 2HKHH 3BGAA 2PKDA 3X11A 3QI9B 4N1EA 1S7WA 3RGVC 2AVGA 15C8H 1WWWX 2UYLB 4DGIH 4ODUA 1MLCB 1WC7B 4JLRB 5JR1L 4RMTA 1L0QA 1HH9B 4YX2L 1DR9A 1JI1A 2IBZY 3MRIA 4O4YH 2CR3A 1CFVH 1IC7H 2A2QT 2FBJL 4P2CG 4PFEA 2W0FA 3G5YA 4WV1A 1HHJA 4U1KA 1QVOA 1YEDA 4J6RH 1M05B 3X11B 4MDIB 4RAUA 1T03L 4QOKA 4HFUH 4MQSB 5IK3B 3BGFC 4ZUWB 3NIGE 3EZJB 4NT6B 3HTLX 3W81A 1JPGA 3C5ZB 1GRWA 5C0AD 3DXAD 2VIRB 3CFIC 4OGXL 4PJ7E 4ESKA 1KB5A 3SO3C 2ZG3A 5TDNA 4OCSH 2X4OB 2HJFA 5C0AB 3R4DA 1H5BB 4ZPTB 3I3EA 4M7LT 3WXVH 1AIFB 1F4AA 3OR7B 4DZBA 4ZAKC 1K2DB 4POZD 4HKJA 3ES6A 3FB7B 5IV2B 3T2QA 1E4WH 1NAKH 4DKFL 1PDKA 1OAZH 4LRIA 1RUQL 3RGVA 2Q20A 1B6DA 1FNAA 3QDGE 3RHWK 3RP1A 2QQKH 3S37X 4L4VD 3RI5K 3OWEA 4KDVA 4U33A 1OY3B 4ZODA 4JPIB 5TDOB 5DURB 4EOWH 4APQD 2ADFL 1UENA 1BGXL 4L8BB 4MS8D 4YNYA 3KPOA 1JGUH 5DI8B 5MEQA 1FL3B 1FFPB 3KPLB 2R0LL 5GGVH 3MCKA 5DR5L 3SDAA 1X5KA 1UC6A 3QH3B 5FGCE 5KSBF 3W2DL 4HKBB 5IJKC 3P11H 4ZTPL 1NGXB 3ARXA 1KYOK 3HAEH 2Z35B 4H88L 4HEME 1U8PA 2RJMA 5C8JA 4PTTA 5IB3B 4X4ME 4FQQA 1FAIH 1H15B 1HZHL 2XXMB 3IDUA 4HEPG 3KPOB 4PJEE 3CK0H 1MCWW 5KSBE 5DC0A 3CFBB 3L3HA 4FQ1L 3PWUB 3SDAB 2F54A 1AQKL 1ZK9A 5EU4B 3CDCA 1NANI 4MCZB 4I8DA 4M5ZL 4GW1B 1CXIA 5C6TH 4KK8C 1S7XB 5GS0L 4L8DB 3GMRA 1DN0A 3FOLA 2K1MA 5F9OL 5FGBC 2IH3B 4DW2H 1RU9H 3HZMA 5IB5A 5LGJB 3S36X 1R5WB 2EE6A 5EBLB 1S7VA 4HZLB 2LTQB 1GGBH 5FUCE 2H32H 4U6HB 5SX5K 1JTTA 4PRBA 3SJVE 4JFXB 4TUOB 1RK1A 2Y5TB 3WUZA 4JREC 3KHOA 2XWBA 1EBAA 3SPVB 2P5WA 1EAJA 5HHME 5D1XC 4R97B 1WAAE 3EDDA 4JKPL 4ZNCD 3TVMB 4WHTA 3HG1A 4K7FA 2R39A 4XPAL 4HWZB 3RBGA 2X4QB 4JZJB 2EKSB 3UTZB 1I1AA 2BNQE 2FECL 5I1IL 2APWA 3U4BL 2Z31B 4RISL 4C56A 3STZB 2CK2A 1CXLA 3EJYC 2W0PA 4FQIH 3G9VA 4LSTL 5FK9B 3UTTB 1C16B 3SHSA 2X4UB 5JMOC 3RTQA 3ROLB 3ZYZA 4ODHH 3GEWB 1W8NA 5HSFA 1OAXL 2KZWA 5ALBL 2PYED 5FDWB 4BSWA 3T04D 5E5UB 3CVHL 4GRMA 3LPFA 2FJHB 4JFEA 4JRWA 4FABL 2YPVH 3IRPX 4HFWB 1OARH 2GJ6D 5EO0B 3LRSB 1G9NH 2IPTL 5I15L 5IJVB 1TJIL 1AXTH 2OYPA 3DV4A 5DJCB 2NX5A 2NW2A 3MRDB 2GEEA 5JXEC 1Q38A 2C3XA 1FAKT 3RAJH 3RVWC 5GGRB 3RWIA 3BRGC 2R69H 3KNBB 1X5FA 3RZCD 3RX7A 4BH7A 2A77L 4MNQA 5DMKA 2GYSA 4OCYL 4CVWA 1YPZE 4HK3N 4OV5B 3P0GB 3FQXA 3EYQC 4M6OH 2AI0L 5EU3A 4XMKH 3VWKC 2JJTC 3LQMA 5F7MC 3FQTA 2ZJSL 1QRNB 4YWGH 2ZKHH 4DEPC 3OQ3B 1Y18B 1E6JL 2ZCHH 4RSVA 3T09A 1UZ8B 1T21A 1UJ3B 1R0AH 4JB9L 3KGRA 5I1DB 1GGCH 3AU1B 4HX1B 1RHHA 3NFNB 3CFCH 2VZ3A 1IGFL 2VLLB 3PV6B 4NQTA 1R24B 2V9RA 1QFHA 1NJ9B 2DOCA 5GZNC 1JTOA 1A7RL 4TTDD 2BFVH 3MLWL 4QT5A 4FQXD 4NHUB 4S0TD 2HTKD 3GM8A 2H6PA 3CDFA 2GSIB 2VLJE 4U6VL 3UDWA 1N64L 3LRHA 4PJ5A 4WVRA 2Z9TA 5MEOB 5DJYB 3PGCB 3AY4C 2XY1A 3VXTA 3SDXA 3G9AB 2R29H 2FO1A 4HS6A 1NC4B 2IGFL 3GBMH 4DK3A 4D9LL 4L4TE 2W60B 4RFOH 1MFAL 2HWZL 4JN1H 2ATPB 4Y2DD 4AIZA 2HFGH 2BERA 5DJDA 4P2RB 3T3PE 3SGJC 4QXGL 3NCBB 2R2HA 2R0WH 4WW2B 4L3EB 5TF1L 1R3IL 2I5YH 3D39A 5LWYH 1DVFC 4KVNH 5D7KD 3RVUC 5BS0A 1W72H 2K3TA 3U4BH 1LK2B 2WWMD 2DD8L 2X40A 1FYTA 1EMTL 3LQAC 3KPPA 3QDAA 3VFRB 4I13B 5GGSB 1IMHC 1A9BB 1Z3GL 3MRJB 5A2LH 1WZ1H 5D1QD 2J7LA 1SJHA 4NIKB 2QADD 4ZQKB 1EZVX 4B7LA 4OSUH 5IM7B 3FMGL 2EDQA 4RNRB 2AGJL 1CG9A 3U48A 35C8H 1OAKH 3L3JA 5K59E 3KWWA 5DSCA 4J7RA 3LS4L 1UWGH 4OF5A 4KTDL 2HH0H 4MJID 5F1OB 5DA4A 4HPOL 3PWPA 1S7WB 4EI5D 1LEGA 8FABA 3FB8A 3IRZA 3MRPB 5FYLH 2Z91A 1IQWH 1BBDH 3B4NA 4N0UE 4DKEH 1C8PA 3PJSB 1HEZA 5DJZA 5CIPB 4ZNEE 3UX9B 1CG9B 4LCYA 3OXRB 4Z7WE 4BZYA 5DT1H 3O2DL 2NY7H 5TE6H 1WIOA 3S88H 2CLZA 2EZ0D 5BO1L 2GSGA 3BIAX 2D9QB 3FJTA 5BVPH 3LHPL 3ZKXC 3QCVH 3PJSA 4EUPB 3FHAA 2R56H 4TVPL 3B3IA 4LSSL 3UMTA 3NCJL 1YEGH 5FYKH 4ZUSA 2JJTA 1A6TB 4M00A 4HUVB 4NWTL 4D0DA 5J1AA 4WEMB 3W2DH 1I7TB 1FVEA 4KKBD 5DVKA 1OP5H 3T4AB 4XP4L 2DM4A 5C0CB 2DN7A 1OTSC 3HR5A 1UB6B 4P3DA 3F58H 3IETB 1D9KC 4BZ1L 5IB1A 5I75B 5C3LD 5GRZA 1EHAA 3CU7A 1GPOL 3C6LD 5IBTL 3UJIL 4QO1A 5ACMA 1NDMB 4UT9H 3EO9H 5IR1B 1DN2A 2HFTA 3LEVH 3MRGA 3WS3A 1I7TA 1BAFL 3BPNC 2G5BA 1UYWL 4Y4FB 2DQEH 4JFDA 4GJTB 4QXUL 5J3HD 3PGDB 2D0FA 4F2MA 4NJ9L 3T2NH 1YPZB 2HN7B 2OS7A 3G6JF 4I0PB 4K8RC 4RMQA 5MEQB 5GGQH 2O5XH 4AK1A 5DK3A 1ERNA 5DUBA 4PP2A 3KPSB 3PDDA 4S1DD 1YEKH 2XN9E 4F7CB 4NQEA 4RRPA 5IVZB 3TPUB 3TH4T 3ARBD 2J88L 5IVXB 3BYTA 5FV1L 4GUPB 5DJ6B 1CF8L 4S2SA 5DT1L 3EJYD 4NWTH 4EVNB 2XWJA 5I1AB 2NPLX 3CUPB 2IPKB 5E2UL 1DLFL 2E7LA 1HNFA 4DN4H 3EHBD 4LVOB 2F19L 4QOKB 1RVFL 3NABH 5E8PA 5FOJA 2PO6B 1BBDL 4DKEL 1N6QL 4EBQL 4YLQT 5GXBB 4F7CA 5IROC 2HRPH 1D9KA 5K9QI 1OQXA 3QWOA 4YZFF 2Z8VC 4Z9KB 4G3YH 2B4CC 3QNYB 1ZHKA 5KSVA 5T1LB 5C08A 5HGHA 2ZUTA 4X6FB 2CLVA 3QUXC 4G8IB 4U05A 3QULB 4OSUL 4U1SB 3AB0B 4G6AD 2ZNXA 4ZUWA 4CGTA 3X13B 4L3EE 2AJYL 1XF2B 3GKWL 3WS3B 4F9LA 4R9HA 5T5NF 5CCKH 4HPOH 2X89D 3CD4A 5TDNB 4O51A 4FP8H 4YHPA 1U3HC 4OLXH 5HGHB 4P9HL 4NKMB 1WICA 5B4MC 4KHTH 1JYNA 2VL4A 3H9HB 3V6BR 1RSFA 3CVIL 5JHLH 1BF8A 1P5UA 3A6CH 1U91B 3EGSB 5DZLA 1N4XH 3LOWA 4TRPL 1Q0XL 3M1BB 4EXPX 1WTGT 2QSCL 3T0BA 2CRIA 3MV9D 3NCCB 4LGSB 1S9VA 1WITA 4MAUL 2DI9A 4FQHA 4QRPA 1EHLH 1CQKA 1SBSL 2ZOKB 3L3GA 2IPKA 5T1KD 1PY4A 3K74B 2EECA 1WBZA 3FRUA 3O0RL 1OSZA 2VAAB 3X12B 3L9RB 3EYUH 4FQQB 5FYKE 2GY7B 4QXGH 3K2UH 4YFDB 3I6KB 4LSPH 2X41A 4PJXA 4ELKB 3PWLA 4BM7A 3LKPA 4ORGB 3RFZC 1SYSB 3GIZH 1YQVH 1I7UB 2GT9B 4R2GC 5FYJD 2YWZA 2MPAL 4MAYC 4QWWD 5I73C 3G6DL 4ODVH 3MLXL 3B8SA 4JHWH 1NGXA 3QEHB 4WWKB 5FDYA 3S4SA 1J18A 2HLAB 4XGZB 1I9IH 4Y4HD 2OR8A 3RWCA 3ULSB 4DOHE 1FVCB 3T1FA 3BD3A 1QNZH 3TZVD 2EICA 2XZZA 3MXWL 1S9KC 4PJBB 2MKLC 4YQXL 3JV6A 5JXED 1KPUA 4HWBL 3C08H 4XMLH 5EWIL 2BVQB 2VDLL 1F42A 4YAQA 1ZE3C 2AEIT 3MXWH 1GHFL 3KPTA 1E6JH 1IRAY 2BSTB 3T3MF 4N5EC 2Q7YB 1RMFH 4X6CE 1JVKA 5IGXH 5JOFA 3FQWB 3LS4H 1X5JA 1RHHB 4OI9A 2LU4A 2XWTB 5D7LD 3EYOA 3SEPA 1FPTH 4U6XB 1TCRA 4WENB 4RWYH 4D94A 4FMFA 3FT3A 4UBDD 5KS9F 9CGTA 1INQA 2BC4A 5D7LB 5EB9A 4XXDA 4KMTL 3S4SG 5ICZB 1JL8A 5IW3A 3ARGB 3MC0A 5FB8B 2ITDB 3CSPA 6CGTA 1W72L 3HG1B 1A3RH 1GGIH 1KCRH 1VFBB 3RWGB 1YNLH 4KXZI 2VLKE 4NNYA 5FO7B 2QSVA 4ZFOA 2IAMB 4X99A 5T3ZH 4FFVC 2EKSA 4ZDHB 4U1IB 4GMTL 4HDIA 1ZLUK 1JZ5A 5T5FH 3B9KA 1P4BL 3QPQD 2FX9H 5HDBF 2VISB 4YHKH 5HJ3B 4WW2A 1U8QA 2IAMD 4KZDH 5I8EB 2IQ9H 4PRPD 4JPIA 3PWPE 4MNHB 1EZVY 2EDNA 3A6CL 3EHBC 1MVFA 1XGQA 4S0SD 3MCKB 4KHTL 4F80A 1F6LL 4LSTH 1MUJA 4LCWB 1FHGA 5K9KA 4J23A 1TDQA 2VXQL 4FQXA 4CNIB 4FP8L 5T3ZE 4HWEL 5KTEL 2IADA 4PLOB 4HC1L 3BKJL 3S35X 3QEUB 3PP3H 4ZQKA 1RV6X 4L9DA 3I9GH 1CLOH 1FDLH 2K9UA 3QRGL 4UQ3B 4JRXB 3NFSH 1DVFB 3GI9H 1GGCL 3NACL 2AXGA 1NBVL 2IMMA 4R4BA 4KK5D 3FQRA 1LVEA 2FEEI 5EORH 1ONQA 4ERSH 4MNQB 5GGUA 2F53E 1GOFA 5DEGB 3QQ4B 4OFYD 5H8DA 2Q1EA 4UIMA 4Q9QH 3X17A 4JVUA 3HE6B 5I9QC 2J6EH 1MJUL 1UXSB 1H3PH 1PKQE 4MMZC 4U3XA 1LO3L 1FNLA 5E0QA 4PRNB 2A77H 4NUJA 2NTFA 4KJQC 3L3OA 4CADA 2R4RH 4LSRH 3W9EB 1WTLA 4FTVD 1SJVA 4OB5H 4G5ZL 2HMID 5SWZB 1R5VA 5E4IA 3SKMA 1CD9B 1MIEL 4BKLB 3A67L 4MB3A 4GXVH 2P45B 3LH2H 2ZG1A 3F62A 3IFLL 4FQ1H 4GQ9L 1NJ9A 3HUJF 4OKVB 1JMXA 4RMWA 4WCYL 1I8MA 2FX8H 3O4LE 4UUJB 3UYRH 2ICCA 5D2NE 2YPVL 2CRYA 1I3UA 2GY5A 4RX4D 5IBUG 3VRIB 1K4DB 5J7CC 2VDQH 3HC4L 4FZEH 3H42H 3MV8E 3X14A 1YMHA 3NAAH 4Z7UF 4BQBA 4PRHA 5EC2B 1J8HD 4CMHC 1A3QA 1H3GA 3U46B 1QPPA 2PTTA 4PJGB 3IJSA 1ZVYA 4JCMA 1S9XA 3NGBC 4G8FA 1C16A 4X6DF 2Z8SA 4NPYA 3ZYIA 1UKSA 5CGMA 5IR1A 2IFGA 3FTGB 4N90D 3TO2B 2G5BB 4M8VA 1KN4H 3BH8A 4XNXL 4Y7MA 4LLUA 2YC1B 2DLGA 5FYLD 3V8OA 3BI9X 2MHAB 4QXTA 1U8HA 3C8KA 2PTTB 2B2XH 3KDMB 5TDOA 3WXWL 1I1CA 1JE6A 3VMOA 4K2UL 4Y19E 5IVZA 1IC1A 3Q1SH 4XP5L 3GMLA 1IKNA 1NEZG 3HFML 4POZC 5T1DH 4WCYH 5EN2A 4XVTL 3FB6A 4XWOC 5F1IA 5I1CH 3REWB 1VB9A 2CDFB 4EDXA 1AKJA 1CR9H 5ALCL 4WWID 2XQBL 1FZKA 1ND0A 4XBGB 1AP2B 1U8PB 2GJ6B 3D85D 3T0EC 5F9OH 3W0WA 4MJ5A 2NY7L 2V2WA 5TE6L 5JW5A 3UO1L 1CZ8H 3CFJB 1JPST 4XMPL 5DZNA 5DUPH 1D5MA 5DK0A 12E8H 4ZAKA 4OCWH 5J57B 1TZIA 4L8SC 1DUZB 3QJHA 5F9JA 5F88A 1BPVA 1IQWL 3KHQA 3D3VE 3CDGA 4HS8L 4X6EA 3GMQA 3WIIH 4P23C 3I6LD 3SE4C 2FL5A 1P4LA 5CSZA 2GSGB 2CQVA 1A7NL 3QDME 3K8LA 5EORL 3UTSE 4LGPB 2IAMC 3HE7C 5C09B 1JWUB 1V8HA 3OHXA 4M5YL 4AEHL 2DWEA 4U1GB 5D96C 2MMXA 4O9HH 4U6HA 4QHMA 3BHBB 5JTWA 1Z3GH 5F7NC 1T7XA 4PLJD 2I07A 1OT1A 3RDTA 1RK1B 2Y5TA 2Z92B 3C8KB 3G5VA 4JO2L 5CSZB 4HLJA 3LKNB 5ICYB 4LDEB 4XCEA 5F96H 3WSQH 1IM9A 4FMKA 3R8BB 5AG8A 5E6IA 4CKVX 1JFQH 4KRPD 1NGZA 5GRUH 3TNMB 2QKIA 4TNWK 5KVDH 1QHPA 5DMIH 3TBSB 4LVEA 2HJFB 3B5GA 1ZLWK 3PL6B 4D9LH 2OZ4A 1GJIA 3MOQA 3ZL4L 5T5FL 3L9RA 3OR7A 4G6JL 4PBXA 5KVFH 2I27N 3T0DA 4LLYB 5DJ0B 4X9IA 5FCSH 4LVHC 4HIXL 5EOQL 4ZAKB 1GGIL 1KCRL 1YMMD 3K4DA 3DV6A 4ORGA 2QKIB 3OKKA 1B0RB 2E9WA 4PP1C 3MLWH 1RUKH 2EE9A 3VFSB 1H5BC 1NCWL 4PB0H 3QUXA 4PJHE 5C09D 4KZEL 3T8XA 4LLVB 2P42B 1NGWB 2QBWA 1IGFH 2ICEA 1FLTX 2VABA 2GK2A 4E41D 3QPQC 5KN5B 4OD3H 2IG2H 3QWQB 3NA9L 4GKSB 3IGAB 4AG4H 2A74B 1AO7A 1JNJA 1FL3A 4PYGA 4XPTL 4XVUC 4Q2ZB 4F7TA 3HC0A 1OWWA 4TSCH 1IC7L 4OCNC 1QFUL 5KAQG 3KLHD 1IZKA 3BISA 4F7PB 1JHTA 2YA2A 4XP6L 2ATKB 3MV8B 3QNXA 3B9KC 5EZIH 5I66A 1JN6A 1LE5B 3C6LC 5H94A 1GCFA 4C59B 5DGQA 3EW3B 4Z0XB 1SEQH 4OD2B 1CI5A 2DQHH 2VLRD 3KLDA 1T80A 3ZE2E 1QNZL 3CX5K 2VERN 1INQB 1JI2A 3MLYL 3TH2T 4ZAKD 4O2EB 4BYHA 3O2WL 1ZT4B 1FL5B 4QYOB 3FFCD 4ODUB 3CH1A 1LE9B 4WW2F 1FORL 1DQJA 3O3DB 4WTWA 1HOCA 5M94B 1FFRA 3DMMA 4QRSA 1FZJA 2WIMA 1Z9MA 4NC0B 5FIEA 1DBMH 5F3BA 3QUXB 4Z7UE 4XH2A 1QVOB 3IXAA 3CSGA 4GBXA 1XCQA 4NM8H 5CEXA 2E8YA 2ICEB 4R4NC 5BV7B 5I73B 1CD1A 1PW3A 4MNHA 3HLAB 1TTUA 3DETC 3CPLB 4FXGA 1G7MB 3RUGA 1YEJL 3D69B 2FO4B 2DBLH 2NR6C 3DMMD 5DHXB 1JPTL 3ULSA 3BD4A 4ELME 1Y6KR 4OLYH 5CINL 1DQLH 2XQYG 3MUZ1 2LV4A 4XNUH 3EOYG 2XKNA 1EEUA 3TNNA 3MJ7B 3H0TB 2FLBT 2YPLB 3W11D 4OGZA 4G8EA 2YSSB 1YEFH 1YN7B 3VD9A 2ID5A 3HZYA 2D31A 5EUOB 3FO2B 4ZPVA 3PABB 1MH5B 1ZSDA 4JRYA 3HE7A 4Z7VF 2FGWL 4HXBH 1PG7L 3NN8B 3CMOH 5E8DH 4C58B 4HLZG 1U8MB 1XZ0B 1MFDH 4NGHH 3CNKA 4I18B 1KELH 3PHOB 4JG0L 3FQWA 3CFKB 2OI9B 4ZOBA 1G7PA 2AXFA 1T5WA 4G7YL 3AUVA 3QA3B 3WFBL 3JV6B 3VXUA 1HSAB 4KMLB 5C6TL 4FG6C 3OXSA 1CL7I 3MJ8A 5TFSH 2YD8A 3F7QA 5I18H 3HRPA 2A0LC 4HXAL 1UM4L 1DN0B 3EYFA 3RZCC 1MIMH 1WZKA 2H32B 3FT2A 2D7TL 1JRHH 3QUKA 3BH9B 5EO1A 1BFTA 4ZUTB 4HIHA 1DLFH 5IHLB 4PJ7F 3UEZA 5FFLA 3NIDF 1IT9H 5JDJA 3IAGC 3EOTL 1C5CL 4U1IA 1H15A 3BPOC 4GRWH 1TFHA 2X1WL 5EBMA 1DQLL 3VA6A 1EBPA 4K71C 5KSBA 1OM3L 3O9WB 4QCIB 1CK0H 1S7QB 2XWBB 5JQ6L 4X6DA 3LN5B 2R2EA 1KENH 2XKUA 3DGGA 4FXLA 3SOBH 4WO4A 3DUUB 3FAWA 1QSEB 4HC1H 3MLTB 4NM8L 1W0VB 3RL1B 4XVJH 3KPMB 4YDJB 5EIQA 2IJ0C 4NJ9H 1HIMH 3EO0B 5E00B 2CIKB 1NCTA 4Z7NE 4JGJA 1NDMA 5TQ0H 3QCTL 1WT5C 2E7BA 4OM0L 4EIGB 3QHTC 1P4BH 1XGQB 3TN0B 5C0CE 4EI5A 4YHOH 4BSWB 5I1HH 2A6KB 5T3ZL 2EEBA 1TNMA 2XA3A 1MHEB 5E99H 1A6ZB 1MLBA 2AW2A 3DXAB 2GUOB 2FR4B 3KR3H 1AJ7L 4NQCA 2E7LC 1CTNA 2X2YA 3U6RA 4TSAH 3IDNB 1I1AB 3Q6GH 1T04A 4OJFH 2X4PB 1IQDB 3DX9A 2BY1A 1LHZA 4XP9L 3SGEI 4ZYKA 4D0CA 4TVPH 1A1NA 4LP5A 4Z7WA 2NY6C 2ZSVB 4JM4H 3WCYA 2R15A 4CW1B 2ESVD 5E2JA 4I5BA 3IDIB 1C12B 5TFSL 4UU9A 1K8DA 3WJLA 4NQCB 2CSPA 3L95A 2H3NA 1FH5H 1TZIB 3LPGA 2KL6A 1HKFA 4JO3H 4U1NB 4OIBA 4DGVH 1U8IB 3O3EB 5LKNA 2BSSB 4JFHE 3MJ9L 3NACH 1IGCL 4U4BA 1N0XH 1WBYB 3RIFK 4ZOAA 3X14B 4JZOA 2HTKC 3HC3H 1ZHNB 1IKFL 3AREA 1NCWH 4PB0L 3REVA 3MRHA 3NFNA 1U92B 3MUGA 5IW1B 4UOW0 3U7YL 4LASH 5E00A 4POUB 3O3EA 1P7KB 2XXCB 3C5JA 3P77B 3D9AL 3QQ9D 4HUUB 4E0RA 3MLXH 1OSPH 3GB7A 1YNKL 4HGMA 5EU7C 4KQ4H 1CBVL 3BDBA 2RQ8A 3IDXH 5CD3B 3F8UB 2H8PB 3H7BB 2OR9L 3FQXB 4YHNB 2EDLA 1JHKL 1AGBA 1K9TA 5KG9B 5HYJE 3WLWC 3DROB 4MDIA 1VA9A 3DXAA 2HT3D 1IC5H 4CMMB 3BT2H 1E6OH 4IDJL 1I8KB 2DI8A 2FSEB 2Y6SC 4IDJH 3TBSA 5I6XB 3GB7B 1WFNA 4L3EA 4QHNA 1Q94A 3EAKA 3GSUB 1HH6A 4FTVB 3QIWC 1GOHA 4TRPH 4Z78A 4PJ5E 2W1NA 3VDBA 4HH9A 1YDPA 3CVIH 1FPTL 4E5XA 4KRMB 3Q6FA 1O7VA 3GMMB 1N3NB 3K0WA 4K3EL 3V6ZB 3QCUL 2H26B 1ZA3B 5HHOB 1ONQB 3FZUC 2OJZL 4YHYB 5DD6B 3GKWH 5JNYB 1TQBC 3C60B 4JJ5B 2FD6H 3K8KA 1L0XA 1EH9A 3LKOB 3FO1B 1T83A 3LQAL 1KCKA 3U83A 2P5EB 4NOBA 1G6RL 4MYWB 2EZ0C 3P4OA 4XP6H 5CIPA 4HAFA 1MVUB 2ENSA 4QHUA 1KTLB 3LB6D 4HUKB 5I76B 2XQBH 3E6FA 5EOCJ 4UNVA 3BW9B 5EU6B 1PEZA 5LBSH 5E08H 1XGTA 1XGYL 3QO1A 4I0PD 4JFOB 1RUAL 3VFUA 3TFKD 4P3CL 1VHPA 4XPTH 5L2KD 5IJKA 4O5LL 1YEHL 3QQ9C 2IG2L 1KXVC 4LSUH 4KJYB 5HXMA 3QDGB 1TVBB 3GSNA 1AJ7H 3MBED 2IAND 3EYUL 4R97C 5HHPB 1M7IB 1MREL 1CGUA 4QHMB 1FRGL 3MLRL 1AY1H 1OF2B 1XT5A 1WT5A 2ARJA 4LQFH 2PR4H 4DQOH 4PB9L 3HZVA 1SBSH 1T4KB 5FECB 3PWJB 4AM0A 3QUML 4WO4D 4I4WA 2YK1L 1G7HA 2ITDA 3CLFL 4RQQB 4P5KA 4XNYH 3IVKA 2NXYD 3BH8B 4MAYA 1NAML 1E28B 1KJ2B 1SMAA 4JFFD 4F3FB 1I75A 4LCUB 5KVMC 3GSRA 5EFIA 3DO7A 5FM5M 4CVXA 1PZUB 3EIFA 5D5MF 5TJWK 3P2TA 3GHEL 2J1KA 1KOAA 1KN2H 2UWEF 4EQ2A 2PXYC 1QD0A 3U9PL 1KJ2A 4EUPH 1UXWA 5DQDH 1KT2A 3TA3B 4XI5C 2WIIB 1OAYL 1S7XA 1F5WA 4GFTB 5IFHH 1AQDB 5AZ2H 5J13B 4TULL 3TBTB 5ESQB 1FZKB 1CFNA 3EFFA 3JV4B 2YZ8A 2ZCKH 4MXQD 4KK9C 4M7ZB 3OAZK 1BMGA 3HNVL 4APQA 4DJMA 5J1TC 5I1AA 3MRFB 5IQ7H 4JPKL 4BQCA 5DRNA 2YUXA 3TYFB 4MA8H 4Y2DB 4ZD3L 4R90H 4WI6A 3VXUB 2DLFL 1A1MB 3L3KB 3NZHL 3B43A 4PRDB 3ZYOA 4JQVA 4XMPH 3ZDXF 1IE5A 5CJOL 2BY2A 2GCYB 4PV8A 4Y1AA 4QKXB 3ARZA 5DQDL 1RY7B 5LAXB 5SWSB 3MBEC 5DVLA 4PLKD 5D8JL 2XG5A 3TVMA 3ARYA 1OW0A 4K7FB 1HILA 1QOKA 4X7DC 1QTYT 3ARTA 1L6ZA 3IXTB 1KBGH 1EEQA 1MELA 1U8LB 4FTVE 3QIWD 2NW3A 2A1WL 2FJFA 1MRCH 1N6VA 1CD1B 2VXUL 4OKVA 1MWAH 5CINH 5EC1B 1EO5A 4PY7A 2CMRL 2GIYA 5GGVL 3FFDB 2EYRA 2VQUA 3VDAA 2DWDA 2HFEB 5IF0A 4LCIH 1HXMB 5C0IB 1CDIA 1KG0A 2WBKA 3M1BA 4JFED 1H8SA 4UV4L 1WIPA 3VWJD 1CFTB 3KG5A 5ILTL 3QHFL 5SX4H 4ENED 1YQ2A 2VTFA 1FRGH 4OZIA 3X3GL 3CMGA 1JNNH 1R3HA 2FX7L 1UT9A 2Y06L 3OAZH 5GS0C 3OJDB 3QZWG 1CWVA 3ARBA 3BJLA 3UBXA 1HQ4A 4ZFOB 5HHMB 2WQRA 1RAMA 3QHZL 2OTWA 3B6SB 3CU1A 4IOIB 1A1MA 2IPUK 4NQSB 1MLBB 2V5RA 3TNNB 4KROC 3BXNB 5EUOA 4K7PY 3UP1A 4RIRA 3HG1D 4XPHH 5CIPH 3RWJA 2WBWB 5DWUL 1X3DA 4L29A 1V05A 1DEDA 5I1KH 4G5ZH 1CS6A 4U1JB 3ZT7A 2YS4A 5EWIH 3BN9C 2PUQT 5EZJB 32C2A 3ULVF 5B38A 2Q8AL 4TTGA 5J1SC 1PG7W 1DQML 2C7UB 3S5LG 2ZSWA 4HJJL 2AQ1A 1XGYH 5DRZB 1XH3A 2ZJSH 5EC1A 5I71C 3ARUA 5GISH 1F97A 5E7FA 3P73B 5CBAB 2EYRB 2P4AB 2DQIH 2XIDA 5DFWH 3BPLC 3KPRA 1HI6B 4RGMB 5A3IC 3WNLA 1UFUA 3DUUA 4P2RE 1XIWC 4OFYA 4O00A 2OSLA 1D5ZB 5AYQA 4UIMB 4HIJB 4PJXF 1YMMA 2OQJA 4DGYH 5IHBA 4MD5A 3D3VD 2SEBB 4EUPG 1ZT4A 1FDLL 2ZUSA 3KPSD 2ZPKL 5ESAB 4YDJA 4LF3A 5DD0L 4PRHE 4JFQA 3P30L 1Q9KA 3TBWA 3QFJD 3BKJH 2VDKL 2BC4B 1MRFL 1MCIA 4M3JA 2ICES 4HJGB 4LCYB 5EOTA 1CD0A 4LNRA 3W0WE 4QRUA 4I3SH 1HI6A 4GKZA 1IKNC 3TESA 3GJFA 3U1SH 3MNVB 4G8GB 3E3QE 5HHQB 3WJJA 3GMOA 1AXSA 2QSCH 2Z4QB 4MX7B 3GNML 2YOCA 4HGKC 1NFDF 1VFMA 4PJFA 5CJ5A 1U3YA 1X5XA 3MRJA 4YHKL 4Z77B 4R8WL 4HKJB 3O8XD 1SM3L 3O3BA 5K9JL 2JJWA 2F54B 1BLNB 4F57H 1DEEA 1Q9OB 3QZWA 4WGVB 1NFDE 1DCLA 3MGTB 5HHQA 1KGCD 4YR6B 3U7YH 4Y5VB 4LSVH 3N50A 4KDWA 6FABL 1RUPH 1MH5A 4L8SA 4G9FB 2YMXH 4WUKH 2BVEA 4HK0A 3KPRB 3MXVL 5C08D 1IQDA 3DX9B 1TCMA 4NFBA 2GQHA 1MEXL 3SKOA 1BQLL 2A9MH 4HJJH 5BJTB 4DAGH 1AD9B 1YUHA 4NZUL 4OGAC 4EBQH 4LF3B 2ORBL 2I60H 2WK2A 2X10A 1MCHA 1NMBH 1Q9WA 1OOAA 4WTZG 1XR8B 5D71L 4DN4L 1TQCC 1MWAB 2H32A 4HUMB 3GGWB 3UO1H 2IADB 5IUSA 2A38A 3EOBA 4KH2A 3MNVA 1ACYL 4H20L 4NBYB 4HLZH 4Z8FH 1EO7A 2GKIA 3WS6A 1FN4B 5JO5A 1F2XK 1UB5A 5JXEA 1QFOA 3PWVB 1YEKL 4NZTL 4K8RL 5L88H 2V9QA 4P2QE 1MFEH 2Q76B 1XF5A 2YD3A 4EEEA 4QHLA 3MNZA 4N0UB 2ICWJ 4GRWE 5F72S 5DJAB 5INCA 2Y5EA 3KR3L 3D85B 5DUMH 1UYWH 2E6QA 3GSUA 2P5WE 2EDJA 3WO4B 3NPSC 3OAUL 3S36L 2VN7A 4U1MA 5AG9A 4J4PC 2R0KL 1I4FA 3BKCL 5HPMA 1HE7A 4CMMA 2VC2L 1RJZA 3GDBA 3FFCE 4KKLD 1E4XI 4UB0H 4NPYB 3C8DA 2DRUA 5DRWB 2DYPD 1LDPL 1NLBL 2KH2B 4JM2B 5KW9H 1CD8A 2GTWB 4S1DC 3ROOA 1FQ9C 3VXQB 5F9AC 1CLYH 2CUHA 3ZHKA 3ZKXB 1X44A 2M8XA 4ETYA 1BVKB 4HKXA 1BZ7B 1RJYB 2Q86B 3QO0B 4NYLB 2JJSA 3NCJH 5FYKL 4R26L 1ORQB 5FKAB 4MA3B 3P0YH 4Y5XC 5A43C 3CZFB 1KENL 4P9HC 1N3NA 3F5WA 3H9SB 2QSQA 4OFIA 3AU1A 4HXAH 5I1GH 3TN0D 4OGAD 5BO1H 4OGXH 3RU8L 5A3ID 4PR5A 1U95B 1OB1A 2X9YA 1F90L 1H3UA 5GGSY 3SE9H 1DQTA 4M62L 3MNWB 4MAYD 1FNSH 3FRPG 4JO1H 3TFKC 5D71H 3ZO0A 3A6BH 4J3SA 5AYUL 5F7UA 5E9DA 1PZ5A 1SJXA 5KZCD 1EDQA 5DMKB 5DK0B 4JY5H 3MRNA 4PRPB 3BZ4A 1UM6L 5CD5C 2FH6A 4M1GL 1MF2H 2HLFC 3TJEL 2ZCKL 2CK0L 2YD9A 2ICWB 4LKCA 1AO7B 2AJVL 5LAXA 2Q8BH 4JAMA 1PFCA 5E2UH 3IAPA 1QQDB 1NGYB 4PGEB 5JMRA 4HZLA 3FO9B 3AC0A 1JJUA 5C6PB 3TIDA 5KSUA 2H9GA 4V2CB 5DD1L 5C0BE 3CSYA 2H2PD 3AM8A 4KGJA 2CXGA 3WLBA 3GHEH 4UINL 1YA5A 4LHUD 2DQUL 2RAMA 2MJWA 2OCFD 4HKXB 4TVSa 2V7HA 3D25B 3PP4L 5HYQA 4KKLC 2JK5A 4ONHA 2A6DB 5INDB 3QJHB 5F9JB 1NCAH 4JG1L 1EVUA 4OLYL 1ZOXA 3WJLC 2XFXA 1BAFH 3QDJD 4TYUA 2A83B 1AFVL 3EO1A 3O6MH 1RI8A 2IQ9L 3V5KB 1QR1A 4YE4H 4LSQL 4UZGA 4Z0BH 4K3HA 4QTHB 4OTXH 3U1SL 4M7KL 3OJDA 4PB9H 3GM0A 4PREB 4BFIB 1WIUA 3ARPA 1TJGH 1DUYB 4PTTB 5FKPB 2VR4A 4GRLD 1HHKB 4U0RC 5GS2D 1NCUA 3EO1B 2WANA 3TZVC 3VMPA 2AABH 2EIZB 3QR2A 1N2RA 3VFRA 1FYTE 3O41A 1MQ8A 1KB5L 2NNAA 2P46B 5ERWA 3GI8H 3RWJB 1XMWA 1A7PH 3IU4L 3SDCB 4NDMB 4LIQE 4DN3H 2BHYA 4PRAA 4K07A 5FO9A 2OL3L 4D0DB 1RMFL 3ARQA 2HG5B 3TCLB 3KWWB 2CXKA 5LGJA 4H20H 2HVJA 2YXMA 2J8UB 3RY6A 5C2UB 1U8JB 3OZ9L 5B38B 5HGBA 5IMOB 3IT8D 5EU4A 1XGTB 4PGDB 1ODAA 1OHQA 5D5ME 3C08L 4XMLL 5CP3H 4CW1A 3LCYA 3BEVA 2PW1A 1LEIB 3X3FL 1UH4A 3QIUB 3FONB 1NLDL 5FB8A 2RFXB 5L9DH 4KTDH 4PJEB 1FJ1B 5MHSD 4HCRA 1BQHG 2AXGB 3T0VA 5EOQH 1HWGB 4JFDB 1CGTA 4I3RH 5D7SL 4CN4A 3QUYC 2GI7A 4QTHA 5B8CC 1XF1A 5E6ID 5F1NA 5IB4A 1VPOH 2X4TA 3BX7C 4PGJA 5BCAA 4LLWB 1BIIB 3RVXC 5L6YH 3ULUH 1WISA 3OF6A 4X7EC 4I4WB 1UM5H 2VDML 3QFDB 3CIQA 1C5BH 4RFEA 1JNNL 4X8JA 4ISVA 1OD9A 3TPUA 5GJSH 4HF5H 4NNPL 4NNPH 5I8CA 1FL6B 1J9CT 1ZA6B 1CLZL 1FIEA 4XHQA 1J0IA 3K4AA 4FQLH 3HS0B 2Z31A 5I1IH 1LK3H 1UA6L 4Q74A 1NSNH 3TA3C 4OF0A 4ZUUB 2DQJL 1S5IH 1IGJB 4OD1H 1KNOB 4ZG1A 5KVDL 5CZKA 3P40A 2YUWA 5F70A 4WO4B 4MB4A 2BNQD 2NY6B 4MSWA 1MCOL 3DPBA 3ZMRA 1MY7A 5MENE 3TVMD 3QYCA 4JY4A 4OZHF 1CT8A 1TZHB 5IMOA 4I3SL 4LNVA 1NAMA 3QXUA 3TBYA 4N0FA 5IQ9B 2AK1H 1VGKA 5T1LA 3TWCH 2G9HA 1NKOA 4RAVA 4M61A 5AAMA 5ISZA 3N85H 4ETQA 1K6QH 1T1ZB 2R4SH 3WEXA 1ED3B 1BVZA 5D7JD 4BUHA 2XRAL 3VCLA 12E8L 2AJZA 5DHYA 5D70L 4WI2A 3V4VH 1RIHH 3INUH 3V7AG 1RK0A 2MQ0A 2CKNA 3DIFB 5D96B 4HKZA 2C9AA 1H0DA 1XEDA 4RAVB 3OB8A 3SKMB 3P4NB 4G6FD 2VB5A 5LXGL 2FJGA 5ISZD 4JFZH 5E94A 1UKQA 2PXYD 1FNGA 5DHVH 4GW5A 2YUZA 1CLCA 5F71A 4GLRH 1RUML 1VEPA 4LNRB 3WYRA 3JVGC 1EA9C 2J5LB 4GLRI 1CF8H 2VQ1B 3VFTB 4JANA 1VDGA 2LU7A 5F7EL 1WSST 3HPJB 1MCNA 5ALCH 3L95B 2WWKO 2P49B 5I15H 3DYPA 5JORB 4MCYB 5D93C 2XICA 5BZWB 3T4YA 4AIZB 4MNQE 4N8PA 3ULVH 4FABH 3Q5TA 5J89A 1QRKA 2BMKA 1WBYA 2M2DA 3T4AA 4NCC2 1KTDA 1M7IA 5DD5H 2EDDA 4Q97A 4M3KB 5IB1B 5HDOA 3MRCB 4TNVF 3LV3B 4GG8A 3WNMA 1E4WL 1NAKL 2P8PA 4Q9RL 1CFSA 4ALAL 4PRIA 5B39A 4XNYL 5C09A 1G7HB 4RQQA 4P9MH 1K2DA 4K55A 2OXGA 4QY8A 1BQSA 2IFFH 1UZ6F 2PYFB 3SE8L 2QADC 4LVNC 1Q9OA 3MLZL 3KJ4B 3SGDH 3F58L 3O4LB 1CDUA 3RGHA 3OKDB 4IRSB 5F7EH 5D7JA 1S7QA 4IOSD 5DUML 3CCHB 1PVHA 3BE1L 1DSFL 3BXNA 3EUUA 1CGSL 4MWFB 5DUBB 1I8KA 4NQDE 1K3IA 4EI5C 1T6WA 1KIRA 1KC5L 5FYJU 5L8KB 4OLWL 4O5LH 4X9BA 1TTFA 4HK0B 1H3VA 5CP3A 4AEFA 2YPKB 3GMQB 2WUBH 4D0CB 3CJJA 5CJ8A 2XQYK 3A6BL 1MQKH 5AYUH 3IF1A 5E2VL 5GPRA 3VXSB 3ARGA 4PJ9B 3WFBH 4XPFH 1QBBA 1I85C 4RRPG 4DGIL 4ZFOL 4TN9A 4DUVA 1NBVH 3MBEA 1HQRA 5FF6A 2XRAH 4DUXA 3W5NA 4LKCB 4D9RD 1ADQA 1X6LA 4L4VB 2B0SH 1OT2A 3CK0L 2EH8H 4NZJA 4PJBF 4GG8B 1WCBA 4KK6C 3VWKA 5IB3A 3B9DA 4NO0D 4HIIB 4XC1H 3RVWD 2NZ9C 5LVEA 5E95B 2ERJC 4P4RA 3B3IB 4Y4HC 4L9LB 3QFJA 3PWUA 5BOPA 1T2QL 5DA0B 2YR3A 4J4PD 2X4SB 4S1RH 5MENB 1ZS8A 4H25A 4G8GA 4U6YB 2AJUH 3RWEB 3N1MC 3OB0H 3D85A 3WE6A 4U49A 3PGDA 2H8PA 3H7BA 4Z7WF 1Q1JH 3IJYA 4M9PA 2C3WA 4KVNL 2MNUA 4YC2B 5TE7H 3WNPA 4JCLA 1NC2A 3O6FC 4MD4B 1TQCB 3V5KA 3RWFA 5LGKA 4ZOEA 2Q3ZA 1RUQH 5TGBB 3SDDB 1NAMH 2E5EA 1C5BL 1OP9A 2HFGL 4IIQA 2AJXL 1DBJL 2UZYB 2FH8A 4TTDC 2EYTB 5FA3A 2EXYD 4B41A 4Y4KC 5IT2L 4GKSA 1UXSA 3HZKB 2AS5M 1U3JA 3MBEB 4KU1A 3EDJA 8CGTA 3SO3B 3V5HB 1ORQA 3V6OE 2EDYA 4Y4FC 5KJRH 1L0YA 1NFKA 4AL8L 3UTZA 2BFVL 3DMMC 5JPMA 4H1LG 3W9DA 5IB2A 2DMKA 5KG9A 2E9BA 4O2FA 2BNQA 2EYTA 3T0ED 1A6WL 5FXCH 1LP9B 4D2NA 1BWMA 4ZOCA 2J4WL 1P53A 1QSZA 4XZUB 4JRYE 1JN6B 2VDNH 5CKGA 1HHIB 3LEYL 3OKNA 3DOSA 5ID0B 4OZ4A 4R4BB 4ELMF 1QLEL 4PGDA 1KF9B 4JHZA 3KYKL 4X98B 4ODXB 1G0YR 3PL6C 1QFPA 4JLRA 3WKMH 3JVGA 5DC4B 1A7PL 3IU4H 2GITB 5BXFA 1JYXA 4XVSH 3UTQA 4ORZC 1VGEL 4DTGH 1KCUL 2IH1A 3DV4B 3LN4A 4M4RA 4NHCL 5DJCA 3BUTA 1LE9A 1BOYA 2IF7A 1L7TH 3DVGA 3QQNA 4NUJB 4C4KO 5DJ2A 5DWUH 5T1KA 4QOKE 5C9JB 2QL1A 4AL8H 1N0LA 3F7YA 5JIIA 4LP4A 4NM4H 4PS4L 3WD5H 4OQ1A 2X4TB 1J8KA 1OGTB 1NUDA 3QI9A 2I24N 2OI9C 5GIRA 2B5IC 4B53A 5IWLC 3AB0C 3F12B 4JFQB 3RKDD 1IEBB 4DUWA 4L3ED 5JIPA 3K80A 1UWXK 2IPUG 5DDHB 3PXJA 4P57A 4HJGA 5BZDA 3S8WA 2J6EA 4AMKH 1T21B 3QWRA 1OQOA 4ZFFA 2B1AL 4HS3B 1HIML 2QV2A 3MV7B 1DBAL 4M03A 3QISA 2XTJC 4NQCD 5D9SB 1G7QA 3BMVA 5FA4A 3MJ7A 1MFNA 4IS6B 5L2JA 3K2MC 4KDTC 1P2CB 4MA7H 4UINH 1UVQA 1TZGH 1IEBA 2NY3B 4MJIA 2QTEA 5FUZL 4UTAL 4FFZH 3MRRB 2NNAB 3GSRB 4MSWB 2FB4H 4OI7A 5J12C 4J8RB 3CZFA 3QZWB 2HAZA 1HNGA 4BUGA 4KQ4L 3WNKA 1INEL 1IL1B 1U8JA 3WDJA 2XT1B 2DQIL 1RFDL 3WL9B 3RA7L 1A4KB 1I1FB 2BJMH 3QUZD 3QA3A 1RZGB 1CDJA 2F15A 2CK0H 1KPUB 5C07A 4LHUB 4GOSA 3OHXB 2FZ3A 1I8LC 3ES6B 3RDTD 4NO5A 3QUZB 4XAWH 4WHYH 1HCVA 3B9EA 4K3DL 5C8JB 2BNRE 1F6FB 1OL0A 4DW2L 4NQSA 3MO1B 4IM8A 1IL1A 3MJ9H 3MRNB 3MRLB 3L3HB 3QQ4A 3H3KA 1UGNA 2A6JB 2EIBA 1FH5L 5GGSA 4MCZA 2DYPA 4MZ3A 1AD9A 5CWSB 3WMSA 4IBLT 4OBRA 4KV5F 4OUUB 2BP3A 5DDHA 1PG7H 4JREB 1D5IL 4UT7H 4XCFL 4YXLL 2R1YB 3KNBA 5BMFH 1OAQL 3VI4E 4MQ7A 4AENB 4X6EB 4CDGC 1F11A 1D5BA 1Q72H 4OCMC 1A7QH 3I3BA 3I6GB 3WV0A 5AZ2L 1RFDH 3MV11 2RBLA 4RGND 3WXWH 4PJBE 3T2NL 3AROA 1OD7A 5CJQL 5HVHB 4O58L 3ULUE 1A14H 1HEZB 1MHCB 2PW2A 3LEXA 1W72A 2JK5B 3PGFL 3QQ3B 3FOMA 1MRDH 2NXZD 5ITBH 4M7LL 2D2OA 3BHBA 5CEZE 1I7RB 1EGJL 3KLSA 2AEQL 1ZLVK 3RIAF 5E2WH 4Y4FD 3TM6A 4HJ0D 2EDEA 1MCSA 4LHQB 3TYGH 4OZGB 3FQNA 4C83A 5ID1A 2VXSL 1DBAH 3VGAC 2B4CL 4PREA 2V2TA 5C92A 2OXHA 1T0NB 3D6GA 1J5OL 2VLME 2W59A 1A5FL 2VLKD 3H42L 4XXCA 2FIKA 3L5XL 3EDFA 1OGAA 3MV8A 3UBXB 3ULVL 4CJ1A 3DX7B 4XCFH 4YXLH 4BH8B 1A6AA 1B0WA 3TBYB 4W70A 4NBXB 4HKZB 1MIEH 1LO2H 1DBKH 4PPTA 1IM3A 1AHWA 1KYOJ 3VFWA 5J6GA 5EO0A 1X7QA 3ZDZE 3HKFA 1HYRC 1MSPA 4L1DA 1FBIL 4X80H 2BSSA 4XHJC 4YH6A 1U41A 5B3JE 3TBVA 4LLVA 4YZFE 3RTQD 4M48H 1AKJB 3U9UA 3ALPA 1F6AB 1IAMA 4LCWE 5BMFL 1YNTA 5KN5A 1RK0B 5AZEL 3OKMB 5GRJH 5C7XL 1RUAH 3KYKH 4QNPF 4F7MB 3V4PH 2EXYC 3HNVH 3W39A 4Z76B 3RTQB 3IDJA 5FGRA 2F74A 1MEXH 1U92A 2HH0L 3IS1X 3LDBC 4F7TB 3SGKA 4TULH 4LFHG 3O2DH 3KPSA 4OZIF 4FFVD 1OWRM 4A6YL 2F53D 2X42A 3W9EA 2HTLC 3U9PH 3ZKNC 1G7LA 3GMNA 5E8DL 3AM8C 3NPSB 4X4YA 5I2IB 5JHDB 1OTUC 2Y23A 2MFNA 3VFOB 4JANB 2LFGA 3I02A 5D4QA 2VO5A 2DS4A 1ES0B 3QULA 1BM3H 1QP1A 1EUUA 4FNLH 35C8L 4UTBL 4ODWB 1GGYA 1PKQB 2CJUL 3VDCA 2ARJQ 3LKQA 4NC1E 4WHDA 3DX8A 1WQVT 1BREA 5F21B 3QWOB 5MEOA 2KQMA 2R0ZH 2X4NA 4JN1L 1MHPL 1TETL 2DF3A 3BZEA 1DTUA 4LMQE 3G04B 3LD8B 1KLGB 4XNQA 5DMIL 3QJFB 1O5DT 5DTFB 1I9EA 4QRSB 4NO3B 1U91A 3THMH 1EAPB 4IIQB 5I1DA 3IDYB 4MMXC 4UDUA 5D1QA 3LS5H 1R3IH 2BNRB 2I5YL 5C9KA 5D2LF 1JBJA 1DFBH 3QG6A 4KAQH 1UM5L 2APVA 4C56E 2Y7QB 2LAGB 3EYSH 5BS0B 4OLZH 5C0AA 2RHEA 5CZXD 1JGDB 5FHBL 5I17B 4G7VL 5CP7B 1XGRB 5HYIA 1A3LL 4J4PA 1FYHB 3VXSA 4MJ6B 4LPXA 5B21A 5FKPA 5DLMH 5ESVA 3WIHA 2VXTH 2RCSL 3WKML 3NBNA 2YD2A 4S10A 4ELMA 5HBBA 3BVNA 4ELKA 3WFZA 4ZS6C 1NLDH 1ZANL 4Y8DC 1IKFH 5IFAH 5ADPH 3L5WB 2DIJA 2C5DC 3RY5A 2BOCA 3M17A 4YXKH 4ZMAT 4JB9H 4GKNB 4JQIH 4N1CA 3HI1B 2O5YH 2EC9U 4K3JH 2DLEA 1JK8B 2HVJB 3VWJB 3LKQB 3ZT6A 2E9IA 5HGDB 3T0AA 5BXFB 1FYTB 3ARFD 3I50H 2X4NB 3IU3A 3SJVD 5GRYA 4HV8B 4XMKL 1MI5E 2RCSH 2QLVB 2Z92A 3L5WA 4N5UA 3CXDL 5HHXH 2EC9T 3GRWL 3CSBA 3PL6D 4OD3L 3UYOD 4CVUA 1NPUA 4I18C 3RGVB 2R1WB 3C9NA 4UDTA 2JB5H 2JIXB 5FYJL 2UVFA 2AJXH 2GAZB 5TPWL 3IVKB 5J6HB 3L3IB 3GKZA 4ZUSB 4K9EH 2P5EE 3I6LE 1HXYA 3MLSL 1RJCA 2BCKA 5GIRB 3MRPA 1MCEA 3QUYA 5B8CA 5MHSE 4L8BA 5DJAA 5INCB 3THML 2WV3A 5KSBB 1G7IB 2P24A 4UV4H 2DQFB 3D0LA 2CGRL 1JGDA 2R23A 3BSZL 2X05A 4X6DB 4LCIL 1NCDL 3TZVB 1G9ML 2NCMA 3MV7A 1OTTD 5F3BB 2GAZA 4JKKA 1AFVH 4X6CA 3EZ8A 3BRDA 2PYFA 1J7VR 1OPGL 4XHJD 4HSQA 4X7TB 3KYOB 1BEYL 3DLQR 2R9HC 1QSVA 1JFQL 2V7HB 3D25A 3QDMA 3QEQE 4NKMA 1FIGL 2HYMA 1SEBA 2H3NB 4LPUA 4J1UB 3VXMA 1IZJA 5F9WC 1BD2A 3UBXG 3H8NA 4YHZH 2ADGA 5F7LB 3RWHA 3OKKB 2VLRA 5H35B 4HDIB 4KJWD 3N1PC 5GS1C 1ZMYA 1ACZA 1T1WA 2VOTA 5CJOH 1K8IB 1J88A 4LSRL 1EHNA 4EXKA 1BFVL 3AAZB 2LQRA 4R90L 2EC8A 1DBBH 1NH6A 1K5NB 2HRPL 1MFBL 1UQSB 3RWHB 2XPGB 3UYPA 5E8PB 4E41E 2WWMC 2P7TB 4GRMB 4F7PA 2V5TA 5DUPL 3ZE2F 4PG2C 2AV7B 3ESVF 5AWNH 1FLRL 3TJHD 4HCRL 4V2BA 4GRLB 3EOAB 4MA3A 4M5ZH 3UDWC 1CU4L 4WU5B 2VDPH 5D1XD 5JUEL 1IFHH 1BIHA 1LWRA 4PTUA 2OMNA 1ITCA 1D6VL 3DMMB 5IBUB 4YHLH 1FAIL 5I0DA 2Y07L 4OM0H 4FOMA 2UUDH 4GQPH 4S2SB 3REVB 5T1LD 3KVQA 3S96B 4WY7H 3VXOB 1QA9B 4LHJB 3JV0A 4Z7VE 5BZWA 3FQTB 4R4ND 3U0TB 2NTFB 4L8CB 5MP6H 3RWFB 1Y18A 3FQNB 4C83B 4ONGH 3GSWB 5T3XD 2FYYB 3ZTJH 2ADFH 5FCUH 5DD3L 3LIZH 4I0KA 4FQLL 2XFXB 3ALWA 5HY9B 3PQYE 4OF7A 4HFWA 1FE8H 5CMAB 4OBSA 3S96A 1TPXB 1YNLL 3OL2A 1A1OA 2VITA 1B2WL 4EJ1C 1NMCB 3ZLQC 1QBLL 1A14L 1KXQE 2E9JA 1LNUB 2NX5B 1BZ9A 5CJQH 1KULA 2ZOKA 4AEIH 1U3HB 3DO3A 1JPSL 5SWZD 5I1LB 3G5ZA 3MV9B 2NX5D 5IVXF 3VI3E 4M43L 1JNHA 1XCTB 4MJIE 3A0OA 2VDOL 4AZ8A 1GIGL 1J10A 1RURL 5A2FA 4Y89A 3IFLH 3B2VL 5EBWB 5E08L 4XCCH 1KJ2L 3QG7L 5F9WB 3GSQB 2NY4B 4WI3A 2D7OA 3RWCB 5ICXA 15C8L 1NL0H 3OGCB 3GSVA 1WWAX 4PJ8D 2X70B 4NRZB 1NMBL 1NUGA 1NEZA 2NY4D 2YEZA 2R2BA 4D9QE 3FO0H 4JKMA 4FQCL 1ZANH 2VAAA 3X12A 2DYPB 2XA8H 2MCPL 3VXTB 1EO8L 1YECL 4OZFG 4XRCB 4YX2H 3K4ZA 1JPFA 3EYFB 4K3EH 4MNGE 3PV7A 2GSIA 3RA7H 1TXKA 1JHLL 4CJ0A 3LQZB 1IM9D 3MJ6A 3RY4A 3OKLA 4IHOB 2AERT 4J3UA 4D8PA 5C3TA 5HDLA 3TIEA 3R06A 4XC3H 2FJGB 3IDGA 2AABL 1JNLL 1BFOB 5F89B 1MFCL 3KPMA 5HI5C 2E6PA 3F12A 3PHQA 4I0CC 3ZKND 5LG1A 5DI8A 1MHCA 1ZV5A 2BSRA 2PW2B 2VWEC 5EUKB 2DAVA 3O11B 3CXHJ 2ZP0T 2CDEA 2CIKA 3OBAA 1U36A 1MWAA 4XB7A 3BT2L 1X5HA 1CXEA 1XCTA 4G80B 1UJ3C 1UG9A 3NPZB 4R8WH 1P84J 1AC0A 3B83A 4ZPTA 5IM7A 4LSQH 5D72L 4KKAD 5C1MB 4KI5D 4ZDHA 5MEPB 1N6UA 3H6JA 1M1SA 5LQBL 2CKBH 2YD5A 2Z8WC 4G6AC 3HB3D 3DVNA 2R29L 1CBVH 2J5LC 5B39G 1L7IL 5IMLA 3U2SB 1LEGB 8FABB 3QXWA 1A6VL 2DQUH 5EC2A 5F96L 3WSQL 2YN3A 1QPXA 2YBRA 4FQJH 4X5WB 2DJSA 5CCKL 2A73B 2VZUA 3X3FH 4G8FB 2YA1A 2YUVA 2O5ZL 1ZHLA 2XACC 4G8GE 4L1HA 4F7MA 4Z76A 4K23H 3NFPB 5EBLA 2VWEE 1U8OA 1X7QB 1OCWL 4OFPA 4OLUH 3RJDA 4OGYL 3BN3B 2ZCHL 4G9DB 3MGAA 1H3TA 2QJDA 4W4OC 4FQCH 5ECJE 3UC0L 2ZSVA 1KSRA 4MDJB 4EN3D 5FM8A 1NFDB 1N6QH 4UT6L 4ZS6D 5CBEA 2YRPA 2VDLH 4OCYH 3TLRA 4OCWL 1GZQB 4PD4K 3CFBA 2OX5A 1TNNA 2R69L 4Y4HA 4YGVA 1BBJA 4PJDF 4KVCL 3CC5A 4DK6A 3VD5A 1IC4L 1PKQA 4R2GD 3IKCB 4NKOB 4JDVA 2VZSA 5EOCL 3GMNB 1G7LB 5I2IA 2R1XB 1QSFA 3FQUA 4NRYA 1GL4B 1S3KH 4XVTH 3CFJA 5EA0H 1JMZA 2OTUA 3MUY1 3ARBB 1EK3A 4D0BA 3FOMB 3U2SA 5IMLB 3B6SA 4QLRA 4DKAA 1BBJB 3P77A 1BX2B 1ZEAH 4LAJH 4P2QA 3S98A 1FGVL 1KFAH 1KIQA 4QOKD 3MV9E 4QXUH 4NO2B 5E8OA 1X4XA 4XAKD 2UWEB 4X4XA 4X8XA 1T7VA 3BKML 3EO9L 5EZOL 5TE4L 4Z78B 4X6CB 3BP4B 2HVKB 2R0KH 3BKCH 3VXRD 1FO0B 3BDXA 3SDYH 1T83C 2B1HH 3ULVE 4QHNB 3VFGL 5HYJD 2W9EH 1YEIH 3BEWB 4OFVA 5FYJE 5JHLL 2VXUH 2Y25A 4LPWA 5IEHA 5EU6D 5L8JB 4NN5B 4P9HH 5HYJB 1DE4B 3OX8B 1NC2B 5JW3H 2DLHA 1I8IB 3VFMA 3MRMA 5C0GB 5BRZB 5E7BA 3DYOA 1OAQH 2VLKB 4UOJA 4UOW1 3ZHLA 4X5XA 2VL5B 3BQUC 3MMEB 3TBTA 4PJ5D 4X9GA 5J11C 5J4MA 1U8KA 4LBEB 4IMKA 3CPLA 4PYHA 1CZ8L 4ZO7A 1ZHKB 5KSVB 2H6PB 3F7RA 2R4RL 1CDGA 5HI5D 4NC2B 3O4OC 1B0RA 3UBXI 3QUXD 1VSCA 5KSUB 3GJFB 4NFCA 1B3JA 2J6EL 5CILH 3EJZC 4Y5YC 3WHE1 1FVDB 3CFKA 1PX3A 2VABB 1TMCB 4W6XB 5IFJA 2JCCF 3CDGB 4PJIF 5IVNA 3VFOA 3K81A 4Z77A 3OKOB 4CBPA 5IFHL 3VXPA 1QR4A 2R23B 4PG9A 3SKNB 3RTQC 2NLJA 3RU8H 1GGUA 4NQED 2BX5A 2W92A 1EX0A 4LPTA 2OLDA 3BH9A 2FB4L 2A83A 4KDTA 5K93A 4IRZH 1D5ZA 5L2KE 5IFJB 4XNXH 1OSZB 3BEWA 4LU5L 4EOWL 1NGQL 2NQCA 3VXRA 3C2AL 3BIBX 5H94B 5JHDD 4FQHB 4QRPB 4U6YA 4PJXE 1Q9KB 3TBWB 3VXPB 1P69B 5MP6L 4RGNE 5DTFA 1K3ZA 3FRUB 2AK4D 4KKNA 5DJYA 4NO3A 1OPGH 2W0FB 4QRPD 2CKBB 1VENA 1H8NA 4NO0A 1KG0B 5MI0B 1ZEAL 1VEMA 5HD8C 4APQC 5IV2A 3BFOA 1NGZB 4KZDL 1RJLA 3EYOB 5AUMA 5D1ZC 4X7TA 3MOBL 3T1FB 4YNYB 2HT2C 2FX8L 1E4KC 2WIIA 1F3JB 3LRGA 3CX5J 3S4SB 4LK4A 4KJWC 3V2AR 3LH2L 4PJBA 4Q6YA 3T08A 1I9RL 3G5ZB 4KJPD 4O2CB 3RVTD 5DD0H 1QFWL 2FIKB 4YDKH 5FV2A 4PJ7A 3MLTA 2NXZC 5IKCB 5AWNL 2VLMD 4DGYL 4HBQA 3DURA 3RY6C 4XBEL 1P2CA 4TUKH 2YN5A 1RZ7L 1EUTA 1M7DB 3TF7C 1LO3H 1CDBA 1K85A 1XF4B 5IB2B 2VZOA 1FP5A 2D4DA 4JFDE 4Z6AT 2ZKHL 3ILPA 1YYMH 3U6RB 4KK8D 4GRWF 2G75B 2VKXA 3IDNA 3HI6H 3HPLA 5C71A 3HMXH 5HVFB 3VGDA 1E4JA 4JFYB 1GHFH 2YPLA 2FCBA 3V4VL 2CRZA 4FXKB 4YXKL 1T5XB 4HV8A 3OKMA 5C07B 3N9GH 1VFAA 4RA0C 2AV7A 5IFAL 1PKOA 1DDHB 2FD6L 4LEXH 2HKHL 2WBJC 3KPLA 2UWEE 4OLEA 3SCMC 3RAJL 3VRJA 3QRGH 4GRLA 3QI9D 2NY4C 4R96A 5GHWH 5EO9B 3GGWA 4WU5A 5IMMA 3VMNA 3PDOB 5GRWA 5K9QG 1A2YA 3TIEB 4HIXH 1FIGH 1CL7L 5E4EB 2DIBA 4LGRB 5DHVB 1J8HE 1HHIA 3B9KB 3JWOH 5EZLA 3VD3A 1QSFE 2XZCL 2DQFA 2V9TA 2XV6B 5TQ2L 1S5IL 5I30H 4JZJA 4E0RB 1J05A 4OT1H 2CGRH 1RD6A 3VGFA 1WZLA 3NIGF 2AQ2A 5JIKA 4JM2C 4WTXA 5H37H 4XX1E 1P4IL 3QDMB 4HUWA 1MY5A 3O3BB 3QIWB 2MWCA 3GNMH 4MLSA 4O9HL 5DK2B 1G84A 1W8OA 3FN0H 3HHRB 3UJTH 2ED9A 3D69A 2BXZA 1K4DA 5F1KC 1I8LA 1MCWM 1A7NH 3V9FA 5F3HA 5GISL 3V6FA 5IGXL 1VFAB 1EO8H 1XIWA 2ITCA 4WIQA 4U6TA 4C56D 3QIWA 5LJYH 3MZGB 1JWSA 5J06A 3WFEL 3CFDA 1S7RB 2Y1VA 2QSTA 1ZSDB 4G42B 3HE7B 3TO2A 4PJIB 4NN5C 2IALB 4LEOA 4XPFL 1RIUL 5ITFB 3DHJA 1MJ8L 1MHEA 4PJGF 4XCCL 3ZYJA 4H8WL 1E27B 1P5VA 3MNWA 2J8UF 1XIWD 3U7AA 3UTSD 4M7JL 1YMHB 1IAOA 2L7UA 1ZWIA 3MGOA 1HZHH 3NVQA 3GRWA 1G1YA 4OZHB 4KUCF 4EN3C 3K1DA 2DQGL 5E56A 3H9ZA 4YHML 3QHZH 3LRSA 4TSAL 3DVIA 1EIBA 1UB5B 2R8SH 2MKWA 2NYYC 4QRQA 2FX7H 2Y06H 1QQDA 4ZUTA 2OR7A 1B2WH 3DRTB 2DL9A 3O0RH 1MOEA 3QHFH 4X9FA 1YEEL 5IW6B 4OZFB 1EHLL 2HTLD 4J12A 1ZKAA 1HKLH 3OPZH 4Z0BL 4NRXB 4Y5YA 3GSWA 5GQBA 4EQ3A 4M93C 3RZCB 5CD5D 2FHCA 5IOPA 1DVFD 1OGAD 2P24B 4X4MA 2H2SD 5HYSA 1FG9C 3O9WC 4ONHB 2VXSH 4UTBH 5DEFB 4BQ8A 2KQNA 3QUKB 1MI5A 7FABL 3V5DA 1QSED 4UV7L 3UJJL 4MQXC 1RZFH 1J1OL 5CFHA 3VXSE 3PDGA 5HVWA 1QBMH 3S5LB 1JNHB 4OCSL 1IFHL 5D8JH 3REWA 4NZRH 1JGVH 1R6VA 2C1OA 2XNAA 5FECA 1MJ7L 4J1UA 1FZOA 4UI2A 3VXMB 1BD2B 2HKFH 3JWNC 1A9BA 1TJHH 2V2WB 2VLJA 5JW5B 4UIKL 3K1KC 1UWXH 4FRWA 4JVWA 4HS6B 1FFPA 4RA3A 4WEUD 1KGCE 4ZD3H 1G1CA 4PJFE 5C7XH 5DQJB 1KT2B 3EYVB 1MCRA 5E1AB 1MJJB 1QEWB 1XGPB 4ZSOE 1CICB 3KXFA 4JDVB 2F19H 4E5XB 2NR6D 3MODL 4P5MB 1P1ZA 5DRXA 2LTQC 3FN9A 3SE9L 1A4JB 1KJMB 1JWUA 4ELMB 3RWGA 2D0HA 4PRPA 5FO7A 3GBNH 5CHNA 1P9MC 2ICWA 1AC6A 2YPLE 4K3DH 5JPMB 1QBML 4H25B 3ARDD 5D5MA 2DM2A 2BJML 1PBYA 2UWEA 5A2JH 1IAKA 1OAKL 3OKNB 4MZ2A 1S8DA 1OAYH 3F65A 3D5OF 3E1F1 2D3VA 4JPVL 4YXHL 3H3PL 3WFHB 2FATH 4CNIA 3OJVC 4FHBD 3L6FB 4MD0B 4N0UA 1N59B 3BYYA 4JM2A 3RL2A 3SY0A 4ZFZB 3QNXB 3P9MA 3ELAT 4XPGL 5IBTH 3UJIH 2L7JA 5A40E 3RUGF 2GTZA 3HUJA 4L4VE 2W9LA 4LQFL 4OF6A 5DJ0A 4X7FC 3G6JE 4NSKB 1WGOA 3FFDA 5FOBB 2QQQA 5I74C 4GT7A 4MD0A 2VDMH 1YPZA 2HN7A 2WP3O 4UILL 1ADQH 3IXTA 5HY9A 3ULUL 2EDTA 4V1DD 2FGZA 2FJFB 2DJUA 4Z7OF 1QZ1A 3TZVA 3JUYA 2WBJA 1MFEL 3SCMA 1RZKC 5K33A 4F37K 1V7NH 4JDTH 2PR4L 4N8VG 3N1FC 3UROR 4P57B 4OZ4B 1T89A 7CGTA 4KUZL 4EDWH 3T0WA 5I66B 4OIIL 1ZLVH 1FC2D 3RKPA 1IC4H 1U2CA 1KLUB 4KVCH 1YYLL 3QPXL 3WDHA 4HUXB 3OKEA 1FNFA 3GHBH 2YD1A 5DZOA 3V6OA 3ARFA 3LQAH 5IVXA 4XVSL 4TOYL 3WFEH 4TQEL 4F8QA 4Z7UB 2NW2B 3MRDA 3FFCA 1AGEA 4P3CH 5CS7A 1NBYA 5HI3C 2D03H 1AD0B 1BQLH 5GS0D 1UXWB 5LBSL 4M8QA 4ZTOL 1JF5A 4JFEB 4OM1H 3H9SD 3AXLA 1FG2A 4JKLA 1X5ZA 3GI8L 3E6FB 4HUNB 3WL9A 1U8NA 3QUMA 3AFLA 1A3LH 1R3LB 5GSVB 4AIXA 3F6LA 3DXAE 4OAWB 5HDQH 4JEGB 3LMJL 1ORSA 4JFOA 4OCRH 1Z5LA 2WP3T 1T0PB 2O5ZH 3FTGA 4PRNA 5HHMD 3NCYP 4LSVL 4Y2DA 2XI9A 2D9CA 5F6IC 5EUOE 4N0YH 1OP3H 4QRRB 1V3JA 1Q0YL 4AJ0A 3QI9C 2GK0A 3QNZA 3MV01 1GC1C 2DIAA 1IC5L 5GSRB 5KVFL 5IT2H 1OVZA 2NXYC 2H1PL 3O6FD 3OXSB 4JFFA 3QCTH 4QT5B 3RUGB 1AKJD 1AO7D 3HZVB 3ILQD 1R3JA 1OAXH 3BP4A 5ALBH 3VFNB 2HT2D 1V5JA 4IRJC 4H5SB 4EN3A 3IU3B 4P23D 1S7SB 2H1PH 1HHKA 4P5KB 1OTUD 4PY8J 5E24E 2CH8A 5EIIA 1FFOA 5CUSH 3ZDYF 4NM4L 4PS4H 3C2AH 3WD5L 4Q0XH 3NMEA 2D7NA 4B5EA 3LEXB 5GRVK 2AJUL 3QDJE 1CT8B 1TZHA 3EFDL 4H5SA 1UCBH 1T5WB 3P9LB 5BQ7B 2F5BL 5GGVY 5HDQL 1HHHA 3D0VA 3K7UA 3QSKB 3PHOA 5LCVH 4AEHH 4IRSA 1I1RA 1N8ZB 4AQOA 3MMEA 1BVLB 3WLWD 1SYSA 1AIFA 1CDYA 3FT2B 2CR6A 3HMXL 3DSFH 2ZUVA 3TPKA 4U0RB 2V2TB 1I3RA 1WAAF 4NQDA 1FSKB 3S37L 3ZTJG 1GVIA 3UPRA 1DQMH 43C9B 3VGAB 5I0ZA 4I48B 1L9NA 1MPAH 4Q58C 3HA0A 4JFHD 1JZ3A 1UWEL 5ETUB 4IOIA 1VCAA 1RZ7H 4Z5RB 3GK8H 5IBLC 1A2YB 2CDFA 2BSED 4LCCB 4EDXB 4M6NL 4M62H 3MREA 2VE6A 1DL7H 5KANI 3BAEL 2QR0A 2I26N 1BJ1J 4JO3L 4DGVL 1AP2A 1T5XA 2GJ6A 2Q7YA 4RZCA 5CJXC 2J88H 1LGVA 4DZBB 1KELL 1ZGLP 2CLRA 1MFDL 4NGHL 4RMSA 4YBQD 5BV7L 4RMVA 4MD4A 5DF0A 4HG4J 3MROA 43C9A 4GAJH 1OARL 2MSPA 3OR6A 5HVHC 3KYNA 3L5XH 5HHOE 4KHXH 1M71B 3KLAB 3OF6D 5TDPB 3FZUD 4XWOD 5JIHA 4XVUD 4HC1A 2KPNA 3RX5A 2R1XA 4GAGL 1NQBA 3BO8A 4XP1H 3E6HB 3B5HA 3T4YB 1KXTB 2B4CH 5KBNC 1IAII 3VFGH 4ZUUA 2NW3B 2LVEA 4XVJL 1FFNA 4PJDB 3BPNB 1BGXH 2B1HL 1M71A 4NZDA 2LABA 5SV4A 1TVHB 2GUOA 1LP9A 2FR4A 1JCKA 2NY2D 3QBTB 1FN4A 2SEBA 2Q87A 5JQ6H 1LMKA 4JZOB 2PYEE 2E7HA 4S1RL 3HR5B 4P3DB 4FZ8H 4LRNL 3HZMB 5D7IA 5E6IB 5IB5B 4P48A 1FGVH 3O11A 3EJJX 5GZOC 1S7VB 3NAAL 3KS0H 4OZIB 4FZEL 2VDQL 3HC4H 4P46A 4XC1L 4O2CA 1A21A 2VUYA 5D2LB 1K4CB 5I16A 1BJ1H 2XNAB 1KJ3L 2AXHA 5A16B 1SYVB 4K94H 5BVPL 2AJSL 4U1NA 3IB4A 1Y0LA 3DIFA 5I18L 3C5ZD 4WO4C 4J3WA 4OD2A 3UZQA 4KTYA 4P4KA 3N1QC 1DL7L 4IMLA 1AR2A 1DVFA 2GJZA 2V6HA 1B4JL 1HK6A 5DEGA 1QEWA 3S3SA 4MA8L 1ZVHA 4LEOB 3V4UH 4HWBA 2VRAA 2DMCA 2VQ1A 3E6HA 1BQHB 4Q6IA 1A4JA 3R0NA 4Q2ZA 4TSCL 4WEBH 3RNQB 1GOGA 2NY2B 2P8MB 4YHNA 4Y19A 3H9SA 4CU6A 3HNTH 4A6YB 3HUJE 4L4VA 1DJSA 3QEUA 3V6ZA 1WF5A 1X5YA 4F9LC 2EXWC 2VLJD 1IBGH 4HGWA 4IRJB 1GAFH 1KN2L 3MRRA 3UAJC 3MRCA 4FQJL 5JOPD 1CCZA 3H3BC 3VRLE 5CEZH 3P4LA 4LL9A 2VXQH 4YC2C 5HHNA 3QDJB 3PHQB 3C60D 4WFGD 2X6MA 3EOBB 4W68A 4XNUL 3BP7B 3DHMA 5TF1H 5DGRA 4PJEF 1Q94B 3CZJA 1GZPB 3FQUB 2HWZH 2AV1B 4G80A 3G08B 2VR5A 1YEJH 5D7KE 5BVJB 1II4E 1A0QL 3OPZL 1S9XB 3BSZH 5HHNB 3BQUB 3C60A 4JJ5A 2ESVB 2AK4E 1GZPA 1NANH 4GBXB 1X5LA 4K9EL 4YEFA 1U93B 1W0YT 4L3CB 1RZIA 3O4LA 5F3HB 3HRZB 1MLCA 1WC7A 2D7PA 4XC3L 1T4KA 2DQGH 3VE0B 1E4KA 4HFUL 2A6DA 4N9GA 2I25N 4KUCD 3WHXA 4M7JH 4GSDH 5DEZA 4OM1L 4CU7A 4A6YA 1HQRB 1F4WH 4N68A 4YWGL 5C0FB 3I50L 4O4YL 2XA8L 4L3CA 3FO2A 1S9VB 2AI0H 3E8UL 2DI7A 4ZO6A 4M1CD 4NHUA 1A02N 4Z7UA 1SJEA 1U0QA 5JQHC 2J8OA 4IRSD 1LDSA 4ZFGL 3NN8A 1NL0L 4MJ5B 1U2HA 3HMWH 3NCEB 1WWCA 1J1PL 3H9YA 3VFVA 4KZEH 2QQNL 3C6SB 4X5XB 3C5ZA 5J8OA 4ONFL 4EI6A 3QCUH 5KJRL 1QFUH 3D1MC 3Q3GA 4Y0GA 1OB1B 3SDDD 2IPTH 5KS9E 3FKUS 2BRRL 1SJEB 4JDTL 1IVLA 2VQTA 1GIGH 4JHWL 5SX4I 4DVBA 1L7IH 2PYEB 2VDOH 2Z35A 2QQLL 1B0GB 1U3HD 4JDZA 4XTRC 1TQBB 3C60C 3UTPE 1U6AH 4AM0B 5IHZA 5B4MD 1PGRB 3U0PA 3RDTC 1U42A 4OD1L 4Y88A 4ODTH 5F1IB 5JOFB 1J0ZA 1FVDA 5MERA 3B2UC 1D9KD 3WUWA 3X3GH 1BJ8A 3C09C 4G6KL 2GW5A 2I07B 3FHQA 5EU7E 4GO6B 3GMRB 5CGYD 3T65B 5GJSL 4YDIL 3SKJH 4PGEA 3S3PA 1CICD 1T3FB 1UJTA 4OV6F 4FA8A 1QSFD 1MI5B 1QG3A 4XPAH 2ZG2A 3ETBF 4KMQA 1RHFA 3V52H 3DRQB 2KBGA 3MYJA 5E8EB 5DJXA 2FL5B 1NCAL 2H41A 5A1AA 4BQ6A 1UEYA 3D9AH 4BSVB 2CDGA 3PL6A 3M45A 5ICZA 1HHGB 3GIVB 2G5RA 4XZUA 3P9LA 3HG1E 4QHLB 2Z31D 3NCYS 2WM0A 3HZKA 1WAAA 3L3KA 1JWMB 5HYJA 2Q86A 5E6YA 4L8CA 3MA7A 4U1LB 5ADOL 1EFQA 4LEXL 4IIQC 5HI4C 3C87A 4X6DE 3T2PA 4KGLA 1RU9L 4U31A 4M8QB 5HI3D 4XCEB 1NMCC 1JF6A 3HE6C 5I9QB 3DJ9A 1CXKA 1B0GA 3H2WA 2BVOB 4I48A 4YBLC 1RJZB 3E3QC 3TJEH 3VXMD 3LY6A 1H3PL 3ROLA 3WIIL 1YJDL 5CAYB 1MFBH 3B9VA 3VCLB 2LU3A 3V0AC 1HILB 3VXQA 1F6AA 3T0EE 4DFHA 4XP5H 3VI3F 1T20B 4I1NB 4Z7VB 5CWSA 2YXFA 5FEBA 4MXVE 3BZ4B 2GK0B 2HJKA 2NXYB 2XZAL 1NMAL 5E2TL 1LP9E 5DQ9B 4PG2A 4HWZA 5B3NA 3O45B 2J2ZA 1IAKB 5HGAB 3NFSL 4KI5F 4JFFB 5L0QC 3OG4B 2J8UA 4NKDA 1MCPL 4J3VA 1QFWM 3FQRB 4MQTB 5D93B 1J0KA 1RZFL 4L5FL 5ICXB 4A2LA 4Y16C 5D7JC 2FRGP 4S1QL 5FHAH 7FABH 4BFGA 3LDBB 3F7PC 4AH2B 4YE4L 2PW1B 1D7FA 3KYMB 1HYSC 4X6CF 5D6DC 3LPWA 1RULH 5E6ZA 1RULL 5A2IH 5IHUL 5DMGD 1IAIM 1PYWA 4YHIB 3PWPD 1BF2A 1DANU 4HZAA 2BNUB 1U3HA 2V5MA 2VC2H 3QUMH 5SWZA 4R7DA 4RIRB 2ZUWA 4LLWA 43CAA 4GRLC 1OAUL 2NZ9D 2X9XA 2VJXA 3BKYL 1A4KA 1I1FA 3O3AB 4N0CC 4LLMA 1MREH 5B39B 3CX2A 3HI1A 3NCFB 3PQYA 5F6HI 1DQQA 1CQYA 3HNTL 1I3RB 1ZVSA 4BFIA 3BIKA 1RUMH 2D31B 2EKJA 2MOVA 3JWDL 4PRHB 1KLUA 3PE9A 3MJGX 43CAB 4F8TA 5KS9B 4UT7L 3S37H 4GAJL 1IGJA 1P7HL 4Q9QL 4WI5A 4PD4J 1DBBL 1JZ7A 3PQYB 1EEYB 3FFCB 2OP4L 5KSAD 2DKUA 5HPOA 1QR1B 2AXFB 1YMMB 1KEMH 2FEEL 4PRAB 3OR6B 3GSOB 5DQJA 5D2NA 4HWBH 4OCXH 4PUBL 2HMIC 1RZJL 2A9NL 1Y6NR 2JCCE 5HDBE 3PWJA 2AJSH 4ETQB 2AP2A 3KDMA 4Q7DA 1HSAA 4P2QD 3IDMB 5JXAH 1FNHA 3MX0A 4RGNC 1UWGL 4ODSH 5JW3L 1AXSB 1AGDA 1D6EA 1F4YL 4R3SA 1EJOL 1N2RB 3BPCA 4X4YB 4UBDC 2N7BA 4FFWD 3G6DH 4ODVL 3TN0C 1NC2D 4PJEA 1VEOA 4KK9D 3GI9L 3QNZB 5E8NB 4ZXBB 4D3CH 3GMOB 1SHMA 3MV8D 1JPTH 5M95B 3EFDH 3GJFH 4PGCA 4EZMA 1U8MA 1XZ0A 3K2UL 2DQTL 4ODWA 1NSNL 2FX9L 1QSEA 3GMPB 2DD8H 3O9WA 4GW4B 1I1YB 4K7PX 3S36H 1ZVSB 3D3VB 4P2OD 2UZXB 2VLRB 3D39B 4PRPE 4BQ9A 1P84K 4G6KH 3HCVB 2O61A 4YR6A 4N9OB 4AMKL 3UTSB 1CFNB 3EFFB 2C26A 5EIIB 1MFAH 5FYJH 5I71B 2F58L 4JKWA 3BJ91 1URLA 1ZHLB 5B22A 3RQ3A 1I7ZA 5L7XH 4NNXB 3CXDH 5HHXL 1U8OB 2XPGA 5C0BB 4I3RL 4FNLL 3WFCH 4G43B 2BVQA 5D7IE 1MCKA 4G9DA 3U4AA 4Z95L 1U58B 4NO2A 1CDCA 4OZGE 3BAEH 3MUJA 2XTJB 1J1PH 3QFDA 4JQIL 1DLHA 4Q6IB 3GK8L 3BP5B 4A6YH 1XGUB 1GZQA 1IM3B 3VFWB 4KY1H 5KVEL 2XTJD 1T1ZA 4YPGA 3G6JA 4GMSH 3R0MA 5ETUA 5JOEA 4DAGL 3E0GA 4HKBA 4Y4FA 5GS3A 2E7MA 1YNTB 3VXOA 3AAZA 3ARWA 5AZEH 4GSDL 5D6DA 3NA4A 5EUOF 2CLRB 2D4FA 3ZKQD 1JGEB 3ME0A 2EDFA 2OMBA 3U0TA 3C6SA 3OB0K 3A6OA 1JK8A 1OLZA 4M48L 3VWJA 5HTSA 1DZBA 1XF5B 4JZNB 3QP3A 2HA1A 4TUKL 1AD0A 1UCBL 3AMLA 1QKZH 4HJ0C 2MCG1 6FABH 1BZQK 4HUVA 3ZSTA 3QUZC 3IFOA 1KTKE 1QFWH 3PG2A 1HINL 4L8DA 3VW3L 4XPHL 1CFTA 4PLJC 2ENYA 5JDSA 4QWWC 3EOAA 1G9NL 4KKBC 3WFCL 1SVCP 3H9SE 1V7NL 3MRHB 4U2ZA 1ED3A 3QAZC 4LPCA 4JRXE 1F4XL 2GTWA 1NBQA 3T3PF 4HPYH 4JFPB 1MUJB 2O5XL 5JW4Q 4R4FL 3DRTA 3ESUF 5LQBH 4WU7B 1CFBA 1NKRA 1N4XL 4I5BB 4LSPL 1RZKH 5D5MB 1MHHB 3V0WL 1E27A 1N5AB 3D0LB 2BY3A 1QACA 2DQEL 1Z6JT 2APFA 4O2EA 5BRZE 1EEZA 2H2PC 4HIIA 3HE6A 3VJ6B 1S78D 1AGBB 4GS7C 3TJHC 4WFEE 1JZ4A 3MGOB 4QGYA 4YEEA 4RISH 3BP5A 4X6FA 1P9MA 1GPOH 4U1SA 1SY6A 5DJXB 4U1HB 4N0YL 3L7EA 2YA0A 4ZS7L 4F9PA 3OMZA 5J13C 1AO7E 2ZPKH 5ESVB 3TC9A 4BZ1H 1V7ML 5DD1H 3VFPA 4PP1D 1JZ2A 1KB9J 1OGTA 2COQA 1SBBA 1YDPB 3GBNL 3SQBA 4XPBL 1RZIB 4E42B 1WLHA 3EOTH 2EE2A 2PO6A 2JCCB 4X9HA 3OKDA 5D1ZD 3IFPA 3MCLH 5FUCC 3LKRA 4X7CC 4N9GB 3I85A 1JP5A 4U1HA 3KAAA 1MF2L 5FDWA 5I8OL 4LIQH 3ZE1E 4N8VB 3LHPH 3RGVD 4JAMB 2EDBA 4YFLI 3J7HA 5D6CB 3Q0HA 5JDSB 2ADIB 3R1GH 5C0JB 1BFOA 2YSSA 5F89A 5E9DD 1CFSB 4PJGE 3TIDB 2BRQA 2FSEA 4UIKH 5BS0E 3VD4A 1K5NA 3SN6N 4QHUB 4NJAH 3V5DB 1S7TB 4K71B 5T1MA 3RVUD 5E2VH 3C8HA 2P8MA 1DUYA 3U30C 1AQKH 5CZVH 3X13A 4KPHL 4NN7C 2N4IA 1YEDB 4NQVA 3U46A 4PJXB 2VLRE 5IKCA 1N5AA 3DURB 5CLTA 2QEJA 1S5HB 3JWDH 2NY3D 5KVGL 2W9DL 4TNWF 1TVBA 3QDGA 4ZTPH 1BFSA 3T65A 3RNKB 3P73A 2NY0B 4XPBH 4HW6A 1ZLUH 3HB3C 2EEDA 1QBLH 1LO5B 4RFNB 4PJAB 2GITA 1JGUL 1S9YB 1UH3A 1WBZB 4K94C 2IFFL 4PJ8C 3ZZ1A 3QB7C 5CZXC 5DD3H 1RZJC 2X4OA 4KRPC 3ARED 5EZOH 3MJ8B 3BKMH 3FB7A 3O6KH 4X5LA 1EXUB 1TENA 3P9MB 1PYWB 3CVHB 4YHIA 2CMRH 4GG6A 3S35L 5AAWA 5L2KA 4Q9RH 4YFLF 4LMQI 3TCXA 2B1AH 2WLYA 4I2XB 4L9LC 3M8OH 5F7WC 3DGGB 3C2SA 1R3KB 2VKWA 3JTTA 4OIAA 3I6KA 3AS1A 1NC4A 3QEHA 4WWKA 4CVXB 5FOBA 2NZIA 2L4OA 1A1OB 2VITB 5DHVA 3SDAD 4P2OA 4IRSC 3O6LH 5E5MB 3W11C 4QRTB 4GAFB 4P2RA 5EZLB 1KJVA 3QCVL 1LP9F 1H8OA 4PJDE 2C3GA 2EDRA 5D7LA 5L8LB 3MJ9A 1FC1A 5C09E 3OXRA 1E4XH 4WJ5A 4S1SH 3JZ7A 3E2HC 1CXFA 3BQUD 4X8JB 4CDHA 1JZ6A 3LSOB 5I1JL 1A7RH 2HG5A 4NJAL 1SVZA 1L7TL 3MR9B 1T0MA 3QEQD 5JO5B 1KUMA 2B20A 3LKNA 5ICYA 2BSTA 1VACA