5IMLB

Nanobody targeting human vsig4 in spacegroup p212121
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
QVQLVESGGGLVQAGGSLRLSCAASGRTFSSYGMGWFRQAPGKEREFVAAIRWNGGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAGRWDKYGSSFQDEYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords V-set and immunoglobulin domain-containing protein 4
publication title Structural evaluation of a nanobody targeting complement receptor Vsig4 and its cross reactivity
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5imlB00
4MNQD 1CWVA 4NQEA 4H0HB 1QBMH 1T03L 5EZOH 2KUTA 5A1AA 4HEPG 1NBYB 3KPNB 2VNCA 4JLRA 2J6EA 4KXZI 1D9KB 1U9KA 3RWHA 5I1GH 3WNOA 2R2EA 3UYRL 4ELMA 5EBGA 2IH1A 4J4PD 4NUJA 5BVPL 1QVOA 4JFZL 4EVNA 3I6LE 1FLRL 4C4KT 3QWRD 3WHE0 3BSZL 4NKQB 3V5DB 4BQ6A 5T1LD 5F7KC 4WNQA 3W0WB 4QHMA 5E2UH 1B88A 3ARBD 5KSVB 1CDJA 1AXSA 4O2EB 5HGDA 2E9IA 1DUYB 5D5MA 2ESVA 1IVLA 4WI9A 5T1DL 1MCPL 3U36B 2VDOL 1H3XA 3N1FC 4LCUA 4PRPD 3I6GB 5F44A 4R4FH 1A3RH 1VADB 3GJFH 1H9VA 5IBTH 1U42A 3G6JE 4PJXB 4YR6A 1OAYL 2XWJA 2HKFL 2EXWD 3GMMB 1QFWH 4PJ9B 1D5MB 2YSSA 1QUNA 2QHRL 5C07D 3BEWA 3BN9C 1PSKL 3V6OE 4EI5D 4YFEA 2CIKA 4WHYG 1PDKA 4Y4HA 1XIWC 3EJYC 5INDA 4NJ9L 3GJFB 5F6HJ 4ALAH 2Y06H 1GAFH 2Q1EA 4UU9B 1I1YB 5IIEA 4LFHG 1D5IH 2AV7A 1TCMA 1TJGH 4YBQD 2CK2A 4X99A 1FNLA 3HNTL 1IKFH 4KDTC 5C0BE 1MLBB 1CFBA 3OB0H 3GSOA 2WIIA 3MSPA 1ZMYA 3RX5A 1UQSB 5JIHA 3IJSA 1JNHA 2F9BT 1YYLL 3W0WD 2J88H 1ZHNA 1IEHA 5TE6L 3IU4L 4ERSH 2WUCH 4QXWA 2CQVA 3K3QA 1R3KB 3MUZ1 4NJAH 3ARGA 4JY4A 4A6YA 4U4BA 2GYSA 2EKSB 2VH5L 3RU8L 2ZJSL 4WV1B 4P46A 2AJ3B 3ALPA 4G3YL 4PB0L 5CZKA 1VFMA 3LN4A 2UWEE 2QQNL 1JHKH 4LCWE 4PRBA 4DUXA 1Q94B 4HIXL 2X89A 1M7DB 4OF0A 3PGFH 5DD5L 4U1LB 3ZT5A 4PV9A 3KPPA 1E4KA 4PTTB 4N0FA 1SQ2N 4M3JA 1DE4A 3RDTD 4F37K 1XGQB 3ME0A 4L4VA 4TULL 4AY0A 3L3IA 3KPRA 2AEPH 1ED3B 4FQ1L 4RGNB 3R1GH 4N0RA 2I24N 3CDYA 1RZGB 2X9YA 2XNAB 1OM3L 3S8WA 1X5YA 4U1HA 4KJPC 5CZVL 2MQ3A 1PZ5A 4K71C 4UILL 9CGTA 1A2YB 4LIQH 3ULVE 2NY0C 1ZS8A 5FKAA 2XPGB 2Z31B 3T04D 1FFOB 1QG3A 1IC4L 3P9MA 3WLBB 1ZHKB 1N5YH 3RUGF 4BA8A 3K8LA 3E2HB 1OP5K 4PJCA 4UZGA 4PP2B 4NRZA 5MERA 2XQBH 3QPXL 3FT2B 3L9RB 5EUKB 5T3ZL 3UTSB 3O3BA 3OV6A 4OT1H 5HI3D 1YEIH 1HYSC 1G7LA 1MSPA 2ZPKL 3ZMRA 1RK0A 2DS4A 1MHCB 2XY2A 3VWJA 1L6XA 3MLUL 3C60D 1R24A 1T2XA 2BRRH 5CP3H 5T3XE 7CGTA 2YC1B 4ZUSB 4AIXA 1RUKH 3BD4A 5EG6C 2OTWA 3IFPB 3B5TA 3K80A 5EFIB 3VXUA 3O9WD 1MVUB 4M1GH 3MNZB 5B21A 3HMWL 3TN0A 4XNZB 3V52H 2NTSP 2Z31D 4J7RA 3DVGA 5J06A 2H9GA 3MMEB 4QRSB 3D69A 1AQKH 3SKJL 1RUMH 5D2LA 3X17A 1UG9A 4EDWL 5K59E 1MCFA 1K5NB 2AEIT 2YUVA 4M5YL 43C9A 1FL5B 2XN9E 5ICYA 1TZIB 3FCTB 3BWUC 3NFSL 5HHMB 4HX1A 3Q2CA 4YWGH 2KDGA 5EBWA 5FGRA 3EFFB 4ZXBB 2QADC 3UTSD 4X7SL 1S7UA 1KLUA 3HPLB 5EIVA 3TN0C 3WLWC 3REWB 3EDDA 1DL7L 4NGHH 4MA1B 2BSRA 5DA4A 1MWAH 5I76B 2XTJB 4JQVA 4PS4L 5CCKH 5DK0B 2DWEA 1CK0H 1LQSR 4OLUH 4HPYL 1KJVA 2P5WB 5CEZE 4BSJA 1X4YA 4NO2B 4WJ5B 4XBGB 1IGCH 1NCBH 5DTFB 3GSVA 2E6JA 1ZSDA 4D9QD 4BSVB 1MWAB 2Y7QA 1NEZA 4YUEH 4NRYB 1JPFB 4PREB 3PE9A 3GZKA 3CZFB 1RIVL 1A7RH 4TQEH 4JZNA 2GTWA 4KROD 5DQJA 3DVNB 4OBSA 2Y5TA 2EXYD 1I1AC 1RMFL 5SWZE 3H9SE 4XWOD 4XMPL 4LVHB 1UYWH 4JQVC 1LE5A 3OR7A 4Y88A 5EOTB 4UOW0 4ZPTB 3H7BA 4QTIH 1X6NA 4U7KA 5FYKD 2FL5A 1A1OB 1SEQL 5J1AB 3SGKC 3N1PC 5JXAH 3M17A 1RZJC 5I30L 5HHMD 4ONFH 3ZE2E 5AG8A 2DWDA 3CPLB 3V4UL 3QUKB 5TE7H 4K3DH 1IAII 2LVCA 3JWDL 4P5KA 2FEEI 2OSLA 1CGUA 3MJ6A 3PG2A 5I75B 1D6EB 1AR1C 4L3CA 2P47B 4TNWK 1S7QA 5CJOH 1KIQA 4DZBA 5I0DA 4G7VL 3RHWK 3ULSB 5GGUB 3BH9B 3S36L 3F7RA 1NCWL 3TA3B 3TBVA 1DLFH 2VKWA 2BVEA 4LAQL 4O5LL 5GS0C 5EU6B 3TNMB 1XR9A 2B1HL 1WISA 1J8KA 2OX5A 1WFNA 2PCPA 3GKWL 2YZ1A 3AROA 3QQ9C 4HLZH 3GMRB 4YXLL 4MQXD 3REVA 1T21B 3JSSA 1KFAH 2YA2A 4PGDA 1FZOB 3RVWC 3VH8G 1N2RA 5I15L 1AI1H 4LHUA 3X3FH 4HK3J 5BCAA 3HR5A 2ATPB 4OGAD 4P5MB 1OP3K 5C0CB 1DJSA 2W92A 3QDMB 4HC1A 4PTUB 4X6DB 2ICES 1PG7H 4U1JB 4PB9H 3MOAH 2Z8WC 5C6PB 2N7AA 4LSVH 4J2XA 4X5XB 3QULA 3LIZL 5IHUH 3H9ZA 2VLJB 4WTWA 4X7CC 2VXVL 1TPXB 2YD7A 4OSUL 2FX9L 2J8HA 2WZPD 3LV3B 5IMKB 3PP3K 2EICA 4OGXH 5DD1H 4QOKE 4HGWB 2HRPH 3KHQA 5D7LD 2EIZB 1MHEA 2X2YA 1JRHI 3P9LA 4PLJC 3D2UD 5K93A 2VDPH 3U48A 3WE6A 1CICD 4HH9B 5EU6D 1SBSL 3GUTB 4NN5C 3W5NA 1HQ4B 4R0LA 1JN6A 1BBJB 1F97A 4FFVD 4PJ5B 4NCC2 5C0RH 2FD6L 1IM9D 4KY1H 4CNIB 3G5XA 4GW4A 4LVNB 4LU5H 3MLVL 2R0LL 1D5BB 2ZG1A 1LEIA 1BVZA 1I3RA 2X1XR 5C0CD 3VDCA 3PJSA 5I8OH 3LMJH 1OAQH 1ZA6A 4Y19E 1AO7B 4U1MA 5HYEA 2VIRA 1QSEA 4PJEB 3VA2C 1A7QL 3CUPA 2NMSA 1BLNB 5GGTL 3KXFD 1W0YT 3BMVA 3QDHA 2VLJD 4MDIB 1PEWA 4TTGA 2R4RH 1W8NA 4K7PL 4PFEA 3MCKB 2BSTB 3D85D 1WC7B 4G8FB 4Z7QE 2ZUXA 5L88L 3MFFB 2IALB 4KGLA 1GPOL 5HY9A 4O2CA 3HI5L 1YN6B 1XF2B 2FIKA 4XNXL 1S5IL 3DSNA 3HC0A 2B4CH 2BC4A 2RB8A 3QYCA 2ITCB 4PJ5D 4GRWH 3INUL 2XI9A 2XTLA 3CFEA 4D9LL 3OXRB 4IBLT 2FB4L 4N0UE 4F15B 2FHCA 3GSQB 5J56B 4X6CF 5IV2B 4POZD 4MB3A 5TH2B 2ZUVA 1A6AB 1U93A 4OUOA 4P23A 1KULA 1P7KA 1AO7D 2A6JB 5JW4M 3THML 5IMOB 1IQDB 2GT9B 1DUZB 3F7VA 4OLEA 1K3ZA 4Y4KB 3S34L 2W1NA 3S88L 2VXTH 4EIGB 5C1MB 1YECL 4JQIL 1KIRB 4HUWA 3AAZA 4XX1E 1VFAB 2Y36H 1IL1A 3RY5A 3M07A 4AT6A 3V0WL 4HS8L 3QI9D 5DQ9B 5JPNA 4XPFL 1RZFH 2XKSA 1IEBB 3LD8B 3QBTB 4P23C 5JO5B 4CAGA 3ULUD 4RWYH 5DUPH 4BH8A 4KJQC 3F6LA 3WBDA 4FQIH 1DBJL 3MRFA 4FA8A 4LHJB 5BS0D 1V7NH 5JDSA 1W72A 5F8RC 5FUOL 5JZ7C 5BOZG 3EOBA 1KXTB 5BZDA 3LQZA 1GGBH 1CDCA 3C08L 3FRPG 4LASL 5K9JL 4YGVB 3SDDD 3VWKC 5IHZB 1PVHA 3AGVA 4S1QH 1VDGA 3CFBA 5HVGB 5LCVL 3MRPB 2X7LB 1HYRC 1NLDH 4NQXB 4BSWB 3BZEB 4NKIH 2GI7A 1SMAA 4GKOA 2YR3A 1QFHA 3LKRB 3HNSL 5FYJE 4XTRC 3KPLB 4XPHH 3V6ZB 4G43A 5MI0C 3NA9H 2F74A 2JLLA 1W0VB 2I07B 1OF2B 1YDPA 4IMKA 1PLGH 1MFCH 5FUCC 3KPSE 3KWWB 1A6TB 3LPFA 1AE6L 4PJ7B 1M6OA 4V1DA 2C3HA 3ZKXC 3TBWB 4FFWD 1GAFL 4PG9B 1CGTA 1JF1A 5DRXB 4UOJA 4NP4L 5IEHB 3ARVA 3FFDB 4LSTH 3W5MA 1XR8A 1JNJA 3HC4L 2VZ3A 3QQ3A 3I75A 2DQGH 3WIHH 4IOFC 3EKCA 2IPTH 1HWGB 4YPGA 2F53B 1CXLA 4JHBA 2WUCL 3DX8B 3WO4C 4NJAL 4LPXA 3VXSB 2W9LA 4G9FE 2BNQA 1YQVH 1OCWH 1UJTA 2OJEA 1S5HA 3B8SA 4XCFH 3S5LA 3B6SA 4IRZH 4PJAA 3TBSA 3V6FA 2NLJB 4KK6C 2X9XA 3GHBL 4O58L 3S3PA 1JHKL 2ZOKB 4EN3D 4N8VA 5DJ2A 5CILH 2O61A 32C2A 3OGCB 4RBPK 1JHLL 5ESVB 4Z7NF 1ZLUH 2BNUB 1RZKC 3UYOD 4UT6H 1BM3H 5BQ7A 4KRPC 5TF1L 1SJHB 5FXCH 2OMBA 3TPKA 2DTML 3QXAA 3VXRD 1NC4D 2DQFA 3LEXB 4QRPD 3GI8L 5FEBA 3C5JB 1DQLL 4MD0A 2OMNA 3OKEB 1T20A 3ZYZA 1AGDB 2BDNH 1FL6B 1KJ2L 2UY7A 3PHQA 1GGYA 4NQUA 4LIQL 4DOHB 1GVIA 5F7YC 1K9TA 2OJZH 3LQAC 5K59F 4JFXB 2CJUH 2R2BB 1JL8A 3RX8A 3FT4B 4XNUH 5I1CL 3W9EA 2M26A 3ARDB 4E5XB 3FT3B 4QWWC 3S4SB 3HC3L 1AGBB 2F54E 3G5YB 1CU4H 2BXYA 1BD2D 2VLRE 3N1QC 4TVPD 1RZ8A 4ZS7H 4ISVA 4M43L 4Z7UB 4YHZH 1ITCA 4OLYL 3ECBB 1UKSA 2PW2B 3SDYH 2YN3A 2NXZC 3MV8B 3EJYD 1E6OL 4TTDC 1QSVA 2GK2A 3HRZA 2R56L 1CVSC 2VL5A 5FDWA 3O8XB 4YE4L 5HYSB 5DFTA 3SHSA 1ORSA 2HMIC 5EB9A 4CRPA 3H0TA 5FHAL 4H1LA 5F1KC 3PDOA 4WIQA 5F89A 5I1HH 3CC5B 4PJBB 4M1DH 4ZOBA 3P77B 1KEGL 2H32H 2AJSH 1XAUA 1MAML 4M1GL 1JWMA 2DTSA 4G6MH 4GFTB 4LSRH 1S7TA 3IKCA 1LO4H 2VISA 5EC2B 5FYKL 5CEXA 4MMZC 3L95B 5D7IB 5GZNC 2QQLL 5CIPH 1JYNA 2UZYB 4UDUB 1RUML 3V8OA 2H32B 4KKCD 1KPUA 5L7XH 4PV8A 3WSQL 4XBEL 3ZE2F 3V9FA 3FQXB 4DEPC 3LZFL 1BQHG 1P84J 5CIPB 4XXDB 3WFBH 2Z91A 4AZ8A 1RJLA 4YWGL 3FB5A 3CMOL 3BZFA 1FZJA 4IDJL 5E6IC 3TFKD 3HG1E 1JWUA 1N5AB 5HHOA 3VRJB 1U8OB 1HI6A 5GZOC 3IJHA 3T3ME 3NAAL 3P4LA 4JFFE 4FQLL 5CCKL 5F3BA 4PY7A 4LSQL 4OLUL 1RUQL 4L3EE 2Q6WA 2P8LB 4LSPL 1Y6KR 3RPIB 3KYKH 3IDIA 3LSOA 2HTLC 3BMWA 4YUEL 1VKXB 5IOPB 5HHVH 3O4LB 43CAB 3FQWA 4OLZH 4CVXA 3SDAD 3P4MA 1ETZA 5FYKU 3ARRA 1N6QL 3RWEA 4I77H 5IVZB 1J8HA 5CUSH 5CINL 4AEFA 5I18H 2BNRB 4AENB 1JZ3A 1MREH 3SBWC 3UTTD 3VG9B 1MIEH 2XWBB 1QFWI 1KXQE 1S9WB 5DJCA 5E99L 1SEBB 3HAEH 1VHPA 5GS1A 1U8IA 3Q6GL 4I2XA 1KEML 1DFBH 3HUJF 4YHYC 5EUOF 1U8PA 1G6RL 2HFTA 1KTLA 3H3BC 4RISL 1JMZA 2X42A 1Z6JT 2ZUTA 4AL8L 3DROA 2A2QT 5LGHH 4KKLC 1CDGA 1A3LH 1FGNL 1LD9A 5HHQB 4GMTL 3C8KA 4NWTH 3ZL4H 4I0PB 1H8OA 4PJDE 5AUMB 1F02I 4WHTA 4Q9QH 4F7PA 4RGMB 1DLFL 1AFVL 1F58H 3O4LD 5GS1C 4Q9RL 5DD6A 1T1YB 5KSBE 3D3VD 4FXGA 4ETYA 2QQQA 2IF7A 3WYRA 1FPTH 2NZ9C 3O4OB 2ILLA 5EU5A 2WBJA 4XT1C 3DUSB 3DHMA 3GNML 3B3IB 3T2NH 3R0NA 2BNRD 2IANE 4PJGE 1QRNA 1RJYA 5IW3A 4RAHA 3UJJL 3O6ML 1AI1L 2XZCL 2ADIB 1UWEH 1OOAA 1OHQA 3BGFB 4FNLH 3E8UL 3LB6D 5JHLH 4BFIB 3S9DB 2OXGA 3C9NA 4BQCA 2QADD 4PB9L 5C70A 2I60H 3MOAL 4P2OC 4DVBB 4LKXB 5ALBL 4QRTA 1D6VL 4K8RC 2QEJA 4XCNA 4MA7H 1FYTA 1B3JA 4F7CA 4P2RB 4Z7QF 3RA7H 3QIUB 2FX8L 4LOUD 5IB5A 4OF8A 4ZO9A 1AGEA 5DD1L 4I0PD 3ZYJA 5I1JH 2NY2B 4J3TA 1NGZB 1QACA 1HINL 5C09D 4QLRA 5LG1A 3U1SH 4QF1B 4ZMAT 3GM0A 1P5UA 2EDBA 5DD0L 1T1WA 4OFKA 2VSDA 4M4PA 3EYQC 4JPIB 1IGTB 1I1AD 3QZWG 2VDMH 1KN2H 4PRPE 4Y1AB 2IFFH 4IOIB 3PWUB 2C4XA 1SJEB 4PJ8C 5MHSE 1U92B 4MQSB 5I0ZA 5AZEL 3WJJC 1SYVA 2IPKB 4ZOEA 3JWOH 3UROR 4CN1A 3PGCA 3T8XA 3VFWA 1WT5C 3VFUB 5C07E 1CXIA 4QYOA 5DS8B 4FZ8H 1A0QL 5BO1L 2CXGA 3WHXA 1ZA3B 6FABL 5GJTL 1NSNL 4XCEB 3F58L 3MLPA 1FVEB 3QHZL 1FH5H 5IFHL 3CVIL 3RZCC 2CKBA 1C5BL 2DBLH 3QIUD 3TVMB 5C92A 4U1IB 3PQYB 1G7MA 1U3HA 4LLYA 3ULUL 1MCSA 5CJ5A 1I8MA 1F4YL 2QV2A 5FM4A 3AY4C 5K9OB 3TZVA 4D0DA 1N64H 4PJHB 5BMFL 4YFLF 2JELL 3BP5B 2XZZA 4NO5A 2C26A 2JE8A 5IMLB 2EDJA 2DQJL 3W0WE 4TNVF 1AGFB 3QO0B 5D1ZB 2ZUSA 2AQ1A 3PWPA 1PY9A 3DIFB 5JR1H 2V2XB 3BJLA 1UJ3C 4DKEH 2M2DA 3NCCB 4KUZH 4OIBA 4L9LC 3VRLF 1OQOA 5KS9B 2FJGB 3QFJD 3IJYB 4JN2B 4OLWL 2YPKA 1U3HC 4ODHL 1NPUA 4PJXE 2GTZA 3TZVC 1YYMH 2DB8A 3QO1A 3HA0A 1JPTH 3MRHA 5F7DB 3MX0A 4XPBH 3GGWA 1HIML 4C56B 5JORB 4E9LA 1N0LA 3W2DH 5DT1L 1MFEL 3RPKA 3CCHA 1YY9D 3CZJA 3TVMD 4MAYA 5DRWA 4ODTH 4LQ1A 2GW5A 1FNSH 5E00A 5LAXB 2JCCB 4PLJD 4PY8J 1WAAE 5K9KA 3KPTA 3O6FC 3TYGL 2X4TB 4XP9H 3RUGA 1FYHB 4GKSA 2BCKA 2I27N 3NPSB 1V7NL 3ZSTA 5C3LD 2EDYA 4I48A 1KCRL 5JLZB 4OQTA 2X6MA 4MAYC 3V95A 4L8CB 1HHIA 4X80L 4OFDA 2Z93A 5H2BB 3ZYIA 1Q9KB 1U91B 4DK3A 4R9HA 1YMMB 2X4PB 4P4KB 3FOLA 2AVGA 1T1XA 1HKLL 3WXWH 3RGVB 2HLFD 4W4OA 3V79C 3EOTL 4QRQA 3MJ8A 1OT1A 4NKIL 4C56D 1BVLA 5FO8B 1NBZA 1KB5L 5TQ2L 4TUOB 3MNWB 2GSGA 2VB5A 5L2KA 4KV5E 1G7PB 1FIGL 2DM3A 3ALWA 5JW5B 4RGNE 3EOAA 2W9EH 5TDPA 1MJUL 4K23L 4M7JH 3VFGL 3DXAA 4R3SB 1XGPA 4PGBA 3ARYA 3C8HA 1G0YR 3GDBA 2GJJA 4EDXA 3VFRB 3OWEA 3TH4T 1MJ7H 4W4OC 5IFJB 1CFVH 4G42A 4JM2C 4GBXA 1T7XA 4RFOH 2R9HC 1MFBH 2PTTB 5C0AA 5I19L 4LSTL 4LIQE 2E9JA 4XC1L 3TO2A 4LMQI 1SY6A 2HJFB 1W8OA 3O3AB 4U1GB 3MRBB 2DQGL 4EJ1C 3FO0H 4NWUH 5JIKA 1AHWB 5DLMH 1S9VA 1DLHA 1S9YA 3UTSE 4P4KD 2Z8RA 3RGVD 3VH8A 4X6EB 1T7WA 3O45A 4TVPL 1C16B 4UBDC 5GSVA 4IRJA 2D7MA 4F58L 4K9EH 4UMGA 1B0RA 5F9WC 3EYFB 4HKXB 5DJDA 1G9ML 4KI1A 4LRIA 4H88L 4Y2DA 2B2XH 4ZFFB 5E03A 4GBXC 2P24B 1HEZB 5C0IB 3EYOB 4X7TB 1YNKL 5ISZA 1G7IB 2YPLA 3MXVH 3NABL 1B4JL 4RMVA 4L4TB 3ZKNC 5DHYB 4RMTA 1WICA 1AJ7H 1DBBL 5FKPA 4W6XB 1F4AA 1CL7I 3SGJC 2X4NB 1ZK9A 3KPQB 4ZO8A 4IRJC 4PJIB 4KJQD 3FQUB 4IM8A 3FO2A 1X5LA 2ICEA 5DMYA 5F6HI 3DMMB 3QH3B 5KVFH 35C8L 1V05A 4P49A 5J6GA 4P2YA 1NLBL 2HFFA 3C09B 2A6IB 5HHME 4J3UA 2NY4C 4XGZA 3IAQA 3VWKD 4WGVB 1RUAH 2E9WA 2ED9A 4XBPA 3IDJA 4KGJA 1F6LL 2OLDA 4MCZB 4UINH 2XTJE 4P9HC 3FQNB 4XTRD 5I8EB 3OAUH 7FABL 2Y07H 4X7EC 1KB9J 2EH7L 2DQTH 2PW1B 3MGOA 5IVNA 1OGAD 5T1MA 1YEDA 2P5WE 2FGWH 2X44D 5SWSA 1KCUH 4M7ZB 3MLTA 4EOWH 2DMBA 5I74C 1P6FA 2BVUA 5FUZH 2NCMA 3SQOL 3WFCH 1WBYB 5IB1B 15C8L 4AIOA 5GS2H 3D48R 4M6AA 4KRLB 1J1PH 3VW3L 1QLFB 5DMGC 5JDJA 5DFWH 2NXYC 1HSBA 1GGCL 2GJ6A 4LNVA 1XT5A 1IC1A 4UT9L 5FA4B 4DGYH 1V7ML 4M1DL 3MROB 3T0ED 1J7VR 2ZWLT 5AG9A 1AQDA 4JZOA 5F9DC 3NFNB 4F7EB 1ERNA 2WWKT 1F90H 4DGVL 3RGHA 4MJ6A 3VGEA 2PYEA 2EEDA 1H5BB 3UBXI 4FABH 4HWEL 5ICZA 4J23A 1H8SA 1RI8A 2O26U 3EGSA 2VZVA 5EPMB 5IEKA 1RURH 1EERB 1FORL 2C1OA 4QT5A 4D8PB 2DIAA 4OI9A 4Z0XA 1J0KA 1R5VB 5JUEH 1T3FA 4K94C 3NIGF 2GSIA 4PRHA 3SGEH 1P69B 4KK6D 3QUXB 2VJXA 4LBEB 4QRRB 3EIFA 4ZTPL 5M95B 4FMFA 1FG2A 5EU6E 2A83B 4N5ED 5EZJA 2YXMA 3VGAC 1MCOH 3NTCL 2AV1A 4J1UA 4MAUH 2CRIA 4JN1H 1UACL 4LNRA 2FECL 4U6YA 4YQXL 3F8UB 4KRPD 1GZPB 4TSCH 4GAGL 5E8OB 1ZT1A 1Q1JH 4GG6B 4Z78B 1S9XA 3JWNC 3MRIB 5FCSH 2YD3A 4OZ4B 1JZ8A 5HHPA 2FX7H 5DZLA 1WCQA 5C0CE 5FGBC 3QDME 3TIEB 4X6DE 4ZUVB 5D2NA 4ODUB 4MXVF 2VAJA 3BDBA 3FRPA 3ILPB 1EFQA 4Y5VB 4I77L 2J4WL 1NGQH 3QJHA 4HUXB 2ZUQC 5FCUH 1H3UA 3UCRA 4FHBD 2YBRA 5C08B 4UV4H 4X98B 5B4MD 4JFEB 3FO9B 3MRKB 3L3DA 4HKJA 4RAVB 4KVNL 1UM5L 1C8PA 3PABA 5HPMB 1NCCH 3BDYH 4XC3H 2PN5A 1WBZA 3K8MA 5TDOB 1RU9L 2E27L 3IT8D 1EHAA 3H8NA 2EDDA 2NXZD 4BKLB 3NZHH 1K4CA 1QA9A 3HE6A 4G6AC 1N7ML 2APWA 4PJ5E 4MWFA 4HQQH 3QJFA 4LPCA 5T1KB 2YD9A 4QHNA 4Y4FA 1IM3B 3ZL4L 1CXEA 2HMID 2DDQL 4GUPB 4IDLA 4X6CA 2F58L 3T4YA 1JTPA 1VERA 1YPZB 2AK4A 4Q6IC 2W9DL 1CLZL 1LP9B 2FLBT 1JNNH 5KN5B 4N90D 5JHDA 4GXUN 1EEUA 1GIGL 3R06B 3VXTA 3SO5A 1UXWA 4OF6A 1CFTA 1AO7E 1BBDH 3KS0H 2UUDH 3B9KA 4MJ4A 5D70H 2XACC 1NMCB 5ABDE 3O2WH 4PJEE 1DP0A 1X3DA 4MNGA 1FPTL 3T2OA 3FB6A 1FZKA 2EIEA 3HMXL 1GOHA 3D39D 1OTSC 5HGHB 3T2NL 4ZAKC 3SDCB 2G5BB 3DECA 4OZFA 4Y4FC 3PL6B 1UWEL 2P42B 3WV0A 3FMGH 4ODVL 4MHHI 2I60L 2JJWA 1YC7A 5E6ID 3VDBA 3O6KH 1CIUA 5C0BA 1KG0B 1ZANL 3MFGB 3ARFB 2ORBL 5T1KD 1A9BB 3GBMH 3V6OC 1CVRA 2JJTC 2JB5H 4YHKL 2MWCA 1SYSA 5FF6B 5K33A 1CLYH 2HTLD 5HDQH 4X4YA 4X8JA 4NO3B 2FCBA 1KCKA 3STBA 2EH8L 5ESAA 2Q86A 4OCXL 3BH8A 4WENB 3V2AR 3WIFB 1F3RB 2VO5A 4L29B 4DQOH 4G6KH 3TYFB 1BFOA 2AXGB 3PL6D 4HLJA 4AIZB 1UZ8B 4QTHA 1EGJH 1HXMB 4TSBH 4Y16B 1BVKB 4AMKH 3GRWL 2FNBA 1OY3B 2W91A 3PIQA 4GRMA 3DX7A 1NL0H 1NGWB 2C3VA 5EO9B 3OSKA 4S2SB 1JPGA 2EZ0D 3GHEH 1FH5L 4ZNEA 4KMTH 4RMRA 4JCLA 5DWUL 5EOQH 3C2SA 4IJ3C 2EDWA 1JGEA 2R29L 2HVKA 1BQLL 4JRXB 4MD4A 3C6LC 4CW1B 5KSAB 3QCVH 5FHBL 2NNAB 1CXKA 2DBJA 1RUPL 2ADFL 1KC5L 1Z0NA 1HHJB 1OB1B 1MHPH 3E6HB 3HCVB 5E9DA 2VXSH 3QCUH 4YGAB 4HIHA 5JIIA 1CZ8H 4FFYH 4X4XA 4NQTA 5L2JB 5JR1L 3MV9B 3HZKA 5EN2B 2CIIB 3OR6A 1TCRA 1P4BH 3DGGB 4U1KA 1MJ8H 4X8XA 4YBLC 2AXFA 4PRDB 1IGIL 4R97C 3JUYA 2AJYH 1I8IA 3IFOA 5DVMA 2IC2A 3JV4B 4HGMA 4QXGL 4PJ7E 4P2OD 5F1SA 1BQHA 1D5ZA 4RZCB 4YHPA 3IXAA 2EO9A 3IS0X 4TUJA 4KV5F 1K2DB 4UI2A 2JIXA 4LLUB 3W2DL 1RFDL 2C7UA 1CLCA 1CD0A 1TQCB 5EBLB 2IADA 1J1XH 1RHHB 3HN3A 3NGBB 1UB6A 3SCMA 1Z3GH 4POYA 1RHFA 4FZEH 3QDJA 3IDGB 4JFYA 2F53E 4QHUB 4XP9L 4H8WC 3QDGB 2Z35A 3UPCA 3VXSE 5D9SA 5CEYA 3J7HA 3S37X 5DUBA 4MX7B 1QLRA 3H6JA 4BH7B 3VXPA 3F5WA 4YDLB 2HFGL 3TP4A 3ROOB 5SV3A 1HHKB 2QSCL 1Q38A 1GH7A 5HGBB 5E8NA 3SCMC 4M93B 3KLAB 4K3HA 3I02A 1LO3L 3CLEH 1XZ0B 1HH6B 1X5HA 1CFSA 2XKNA 2CLVA 3QA3A 5D7JC 1CGSH 4OCRH 3U4BH 3CH1B 2BMKB 3TBYB 2OZ4L 3RZCD 4XAKE 5F9JB 4MA8L 4HIEA 3GSNH 2R0KL 2P5EA 3MR9B 1Z9SA 4Y5XA 2NW3A 2CUHA 2MKLC 2LABA 2D9CA 2DLIA 4HJGA 1T5XA 4NHUB 3I9GH 4OB5L 1JCKA 4X9BA 4DTGH 1T0MA 1EFXB 5IB4B 4CMHB 2DN7A 1XCTB 3GSNB 4WW1A 3O2DH 5IKCA 3L7FB 2VDNH 4ZDHB 2CDFB 1LO0H 2C3XA 4L8SA 4XNMB 3FB7A 1I1FB 2X4OB 1F4XH 3FJTA 3TO4C 3STLB 2V7NB 1II4E 3KJ4B 4R26H 4YX2L 1BJ8A 1IARB 5ADPL 3KG5A 1LEGA 2UYLB 5FV1L 4M6NH 1IGJB 3O2VH 4Y5XC 3S35L 1I9EA 1NAMH 3C6SB 4Z7UE 1R3IL 2Q20A 5LKNA 3N9GH 3AXLA 2AJZA 1EJOL 3PWLB 2G9HA 1EUTA 3M1BB 3MV8E 2BVOB 3IRPX 3SO3B 1DBAH 1UB5A 3VD3A 2AK1L 3DGCR 2PXYB 3PHOA 5L9DL 1NAMB 2V9TA 3E6FB 4HV8B 1YEJH 3SE9H 4HK0A 4EUPB 1GZQB 2BY2A 4ZFOA 2B7DT 5IB2A 4LLWA 1KJMB 3DV6A 4PJBE 2DQCH 4YIQA 3RVXC 2ZNXA 1RIHL 4LVOC 2VYRE 5HVWA 1AJ7L 1EFXD 5CJ8A 4LSDA 3O6FD 1I7UA 4R4NC 2CDGA 4YNYA 1NJ9A 3VFVB 3D87B 4BK5A 3M45A 3P11L 4LPTA 2FO4A 5D7IE 1QKZH 4I8DA 4GAFB 1BREA 1C5DA 3FAXA 3RVUC 3C2AH 4ODWA 5FO7B 5EORL 5EZIH 4YO0B 3QUZC 3SPVB 3B2VL 3X13A 3QZWA 4ZTOH 3HUJA 4I5BB 3VFOA 2Z4QA 2O5YL 3NVQA 1AC0A 1I4FB 1MHHA 2OR9L 3QXDB 5EUOA 4P5TA 5F7HA 3GSRB 3VFSA 2H8PB 3P4NB 2DIJA 3LHPH 5J4MA 4HS3B 3ESUF 4B0MM 5E5RB 4YHNB 4RA3A 3DLQR 2PXYD 3OKMA 3UTZB 1EVUA 4Z0BL 1A02N 4DVRH 1NCDL 2E5EA 4PRIA 4UQ3A 5TGBA 1RZIB 3UEZA 4NZRL 1RZKL 1OAUL 4JFOA 3VG0H 3DTXA 3NN8A 5FUZL 4X5WB 1AKJB 5D71L 2H41A 3O4LE 4P5TC 2L7UA 1ZLWK 4RX4A 4S1DC 3BKYL 2H2PC 2J6EH 2X5PA 1ZEAH 3FO1B 1MRCL 2BFVL 5ITBL 4NKOA 4JM2D 4NQEB 1FCCA 2HKHL 4GT7A 2BNRE 2E6PA 3QXTA 4Y19A 1JPST 3LRSB 3HZVA 5L0QC 4JLRB 4ETQA 2XFXA 2OS7A 4HCRA 1YEFL 2R2EB 1G84A 4XVTL 4ZO7A 5IGXH 1IZJA 1WZMA 4GAYA 3T0DA 3CK0L 1P6AB 1CTOA 3Q6FA 4NUJB 3HPJB 4XNYL 2DKMA 1QVOB 2X1PA 4N9OB 1JGUL 1HNFA 2ZSWA 4UBDD 1RK1A 4J8RB 5DUMH 4WNQB 1VPOH 1C08A 1Q8MA 2XZQL 4WWID 4G8EA 2CGRH 4YHOL 1AXSB 1AD9A 5HGDB 2DJ4A 2IG2H 2ESVB 5DVOA 4KDVA 5J57B 5IWLC 1EO7A 1AXIB 4LCUB 3OB8A 1U58A 4LDEB 3H9YA 4HXBH 4UTBH 5SX5K 1AKJD 4MJ5A 4GH7B 1U36A 4XAWH 3FFCD 3QEQE 5D4QA 1GGUA 3BPLC 1OP5H 4OGZA 4Z7VA 4YR6B 2Q7YB 4NQCA 1OAZH 3TPUA 2XWJB 3NIFF 3MRLB 2YSSB 1MRFH 2DKSA 4JN1L 3BEWB 1HCFX 1YY8A 4NQED 3NCFB 5C3TA 1A3QA 2NYYD 3DETC 4Y4HB 2EYRA 3MJ9L 3OKOA 5INDB 3KNBA 1MI5A 1Q1JL 4Z9KB 2B8OT 1CLOL 1DBKL 3MLSL 3U2SA 3WFEL 2AV7B 3K4AA 5E6ZA 3LKNA 4CMMA 4X99B 1YMHA 3U0WH 4A6YH 3GSOB 5CD3A 3MLXL 4P2CG 3SE3A 3WFHA 2YMXL 3IJSB 4P2RE 1JNHB 1XF3B 1KCLA 1OSPL 4HHAB 3KJ6H 2GFBA 3NH7L 1ZHNB 5HXMA 5SV4A 2OCFD 3PWNA 3I85A 3ARGB 1FNEA 4JY4B 2BOCA 2ESVD 4A6YB 5I1IH 2DQUL 3ZSSA 3QRGH 4P46B 3K2MC 3ULUF 5MP6H 1YEKH 1T83A 1UCBL 3LKOA 2WV3A 4RGOL 2PYFA 1XEDA 3L6FB 1JGDB 3LN4B 4K71B 2DIBA 4EBQH 2NY0B 3U4EB 2G75B 4E41A 3SE3C 2CPCA 4PRBB 3DVFA 5F88A 3EHBD 3MACH 4Y1AE 1KPRA 4MB5A 4GXUM 4Y4HD 1I8LC 3MYZA 1PYWA 3U7YH 4P0DA 4PV9B 1LHZA 1NKRA 3KPPB 5D72L 2NY3B 4N0FB 2VRAA 5D7KE 1DE4B 1YEHL 4OLVH 3WEXA 2D2OA 3OJVC 2XIDA 4L4VB 3QP3A 4W6WB 1E27A 3L3IB 4RAUA 3UJIL 5D70L 1T83C 4ESKA 2EECA 3O2WL 1DCLA 2MPAL 1AIFA 4U1HB 4U2YA 3MRDA 5J12C 1PZ5B 1R3LA 5CHNA 3OQ3B 1WGOA 4ZS6C 2ZG3A 3VE0A 3KPSA 1ZS8B 3WFZA 1Q9LA 5FKAB 2ZKHL 3PQYE 3FTGA 3GSWA 1CDBA 1MF2H 3ARGD 1CFNA 4HJJH 5HYQA 1WZLA 1RSFA 1I7ZB 2DYPA 5IUSA 1JE6A 4PJCB 3MCG1 1KSRA 5MERB 4NRZB 1ZLVK 4AJ0A 1JF5A 1E0OB 4JRYA 3FB8A 3GO1L 5BJTA 2P8MA 4LAJH 2HVJA 2QKIA 2OP4H 1DQML 3NCJL 1G7LB 5KS9E 2IGFH 1S78D 1RK0B 3VWJB 4EI5B 1GGIH 1V3KA 4LCYA 1R24B 1G1CA 3NZ8A 2DQHH 3BFOA 3O41A 4G9FA 4L4VD 3K8KA 4TNVK 4IHOB 3HE7D 4WI5A 3QIWA 3CX2A 5HTSA 1G9NC 4QXUH 3L3GA 2OTWB 5LVEA 1BZQK 1KELL 3SKNA 1NC2A 2YXFA 3VXUB 1INEH 5KVEH 2A9ML 3O6LL 5DYOA 3U9PH 4C56E 3DV4A 3TN0B 4K55A 3MRMA 1UKQA 4K8RL 1IC5H 1T2JA 4HT1L 2WIMA 2D4DA 5T33H 1A4KA 3QEGH 4PJ7F 5D2LB 3B9EA 1EGJL 5EIQA 5I73C 4TSBL 2JCCE 4LGSB 3VXMD 43C9B 4XMKH 5DGRA 4IEFB 3MCLH 4OKDA 2YN5A 5CMAA 4XVJH 2H26A 4G6AD 3VGGA 5JXEA 5CGMA 3MLWL 4OTXL 1KBGL 1S7UB 5EOQL 1KLUB 1WFOA 5AEAA 3OAZH 2VQ1B 5DEGA 2BVPA 2P7TA 1HQRA 4ZYKA 4POUB 4NNXA 1K3IA 3T2QA 4OCSH 1FNHA 1MH5A 4XP6L 4M5ZH 4Q0XH 1YMME 2X1QA 5EULV 2IMNA 3RI5F 4XMLH 2PO6A 1EAPA 1JK8A 2AERT 2BJMH 3GSVB 1ZSDB 3VXUD 3T77A 5J9PA 4JGJA 2Y7QB 1NEZB 5KOMC 4RMUA 1C7SA 4JREC 5JXEC 2UV3A 3BT2H 4MLIA 5DFVD 3I6LD 4JKPH 1JMXA 3KAAA 2XA8H 1KJ3H 4JANA 4BQ8A 1G9EA 1LNUA 2E3VA 3OF6D 4JJ5B 4JZNB 2Q8BL 3GMNB 5DQJB 1WWCA 1SHMA 1MEXH 2AJXH 4PJFF 1LE5B 3OR7B 2P44B 2D03L 3WFDL 2CDEA 3H7BB 4M02A 4HEME 5GRXG 1PKOA 3IB4A 4KDWA 4U2ZA 3WN5C 5C6TL 2FGZA 3M17B 4LCCB 3NPZB 4ODBD 4F37F 4P3CH 2CK0H 3S37H 1TQBC 2FATH 3RNQB 5KTEL 5J11B 4P5KB 1BFTA 2OSLB 4V2BA 4Q9CA 1N6UA 3TEUA 4FXKA 1DQJA 5ITFA 1NBVH 5C0DA 4WI3A 1QP1A 4NFDA 3RZWA 3IGAB 1BZ7A 4L3CB 4G8IA 1S7QB 4DZBB 1KIQB 1Z3GL 3L3HA 4UT7L 2P4AB 1AY1H 1CE1H 5KSUA 4HS6A 5FECB 3W39B 4FTVA 2VC2H 1FHGA 2E7BA 3TBVB 5I71C 3EO9L 2X09A 5EBMA 3RWCA 1F5WA 3TT1L 3OBAA 1XR9B 4Z7UF 4WEBH 3RTQD 4F8TA 2PCPB 4CN6A 1LK3H 4WY7H 4HMCA 4JJHA 5I1LA 4HC1H 4KRMB 1KENL 4U0RC 5ALCL 4P99A 1QR4A 3REVB 4KAQH 4GSDL 5JMOC 5HHXL 2J3SA 4KUCD 4L4TE 4PGDB 2VLKA 1N2RB 3HR5B 2UZIH 1MJJA 1BF2A 3LS4L 4PJIE 1JWSA 1JPSL 4DKFH 3QULB 4BFGA 1JTOA 3C6LD 4LCWD 1TZGH 4M4RA 3V5KB 3OZ9H 4FXLA 4WGWB 5GSRA 1TMCB 4OF5A 3I9GL 1FAKT 4DTGL 4RA0C 1FC2D 5DVKA 1ITBB 3ZTNH 3CH8A 5GHWL 1MHEB 4OCYH 2ZCKH 4KXZH 3P9LB 4PY8I 2VDKL 3T65A 5D1XA 5I1DA 1WIOA 5DD3L 1HZHH 3WE6B 4KI5D 1SMOA 4R0LB 4X4MA 2RCSH 4R26L 1I9IL 3ULVD 3FZUC 1O7SA 3IS1X 4YDKH 4RNRA 4C59B 3IAGC 2FYYA 3G5XB 4GW4B 1UH4A 4OCLC 4WU7A 1C1EH 1VFBB 4OF3A 1ZV5A 1LEIB 2FHBA 3ET9F 2IQAA 4XPAL 1I3RB 1JI2A 3ARQA 4OD3L 1UVQA 3MRGA 4ONOA 4S10A 5TFSH 5I66A 5FO9A 1H3GA 5D1XC 3CSBA 4LQFH 1BP3B 1M7IB 1ZA6B 4U1MB 1UM4L 1A7PH 2VIRB 1QSEB 4NM4H 3CUPB 5BZWA 1A6UL 5IW6A 1YEEH 3BE1H 3BPCA 3WS3A 1YA5A 4JG0L 3NCYP 1AP2A 1N8ZA 2FLRT 1BX2A 1ZVYA 5DQDL 3KVQA 4M9PA 4WDIA 5GGVL 1QKZL 2X4UB 1DVFC 4UDTB 4QXTA 3BKMH 1HE7A 2H1PL 5CZXC 5HY9B 1HHGA 4XPGH 4O2CB 5GGTA 4DAGH 1QLEL 4MNQA 3HC0B 1IQWH 3TNNA 3WD5L 5JA9A 1MNUH 4G6FB 2ZOLA 2OI9C 3GFUA 3D0VA 3BHBA 4DGIH 1TJIH 4QRRE 3W11C 2H6PA 4JR9H 3H9SB 1BIIB 3MRCB 4TNWF 5D7JD 4DN4H 5C2BL 3FONB 2DRUA 3RHWF 2XN9D 1A7OH 3QWRA 1IAKB 1U93B 4P23B 4HKBA 2F8VA 1F3DJ 1HWHB 5T1LA 1P7KB 3BD3A 4ODXA 4BFBD 4ZD3H 4WFGD 4ZOAA 3A6OA 2XYCA 5E2VH 5D1QA 3F7VB 3ARBA 3KYAA 3R8QA 3T09A 3I84A 3RVTD 5E8PB 4GG6E 4Z7WF 1X5IA 3CSGA 3TV3H 1A6ZA 3AAZB 4YXHH 5IJKA 1IL1B 5IR1A 3MRQA 2EYSA 3G6AA 4ONHB 4NM8H 5I8CA 4AT6B 3K2UL 1ZEAL 4OV6F 4J4PC 3NIDF 1PX3A 5CEZD 5JPNB 1W72H 1R3JA 3P0VL 4P4RA 2MCPL 4EI5A 3TO4D 2GITA 5C08E 4YHLH 4JFEE 3IFNL 4MDJA 2V17L 4BH8B 2P8PA 2UY6A 3BYTA 3MRFB 3ARBC 5KBNC 3QUYD 4YXKH 5JDSB 4P9HL 4G6FD 1W72B 4XP1L 2NY5H 3DJ9A 3EOBB 4TPRH 2KZWA 3H9SD 1A1MA 4NO0D 3LQZB 4X9IA 1T7YA 1T2QH 4DFIA 4I18B 4KK9D 2R2HA 3CFBB 2Q8AL 1J0HA 1AD0A 4QY8A 3BGMA 3W0WA 2EXWC 1ND0B 4EI5C 3UZVB 3ARWA 1S3KL 4K3EH 4ZUUA 1YPZE 4TRPH 2YD4A 1DUYA 4KTEL 1LP9E 3F7QA 1UWGH 3T0XA 3U7WL 4ZFGL 4HFUH 1PX4A 1QO3A 1CF8H 4R4ND 1YDPB 1R0AH 4YBQC 5E2TH 3DNKA 1LE9B 5DJ0A 3QISA 4Y5YB 2J2ZA 5F9AC 1XF4A 4KHTH 3GMMA 4YEFA 1M6OB 1D5MA 4H0GA 4V1DB 3RVUD 4JFPB 3IFLH 1T1ZA 3QB7C 3QUZD 2AGJL 1JF1B 1QSZA 2WUBL 3IDYB 2CUMA 2VXQH 3DX9A 5ENWA 5HDBF 1IKNA 1XR8B 4OLXL 4G6JL 4YDIL 3RDTA 3QQ3B 5SWQB 1GOFA 3I75B 4K94L 5IFAL 3RAJL 4KTDH 1MLBA 2XQYK 5J6HB 3MO1A 4R90L 1YEGH 4YPGB 4PJHF 1WK0A 3EO0A 5I1EH 1UWXK 5FM5M 3VI3E 1XGRA 2IQ9H 5CJXC 2AJUL 3KLHC 2MNUA 1G7QA 2BNQB 2BVQA 1R3KA 1Q72H 2OJEB 4OCNC 1S5HB 1LK2A 1NGYA 1BZ9A 3B6SB 3OG4B 4JHWH 2R4SH 1N59A 2G5RA 4PJAB 3V6FB 2AJ3A 1QPPA 5CFHA 3HLAB 1U8NA 3RDTC 1I9JL 4JVUA 5E08L 2HH0L 3IDNA 4QOKD 1T4KA 1A22B 1S7RA 5DURB 1NMAL 2HJKA 2I9TB 1OARH 2F19H 5FB8B 4V1DD 2F5BH 2O61B 5AAMA 4A2LA 32C2B 3WJLC 5CSBA 4FS0A 1CBVH 4OFIA 5BQ7B 3C60A 1CR9H 3OXSA 4HW6A 3HB3C 4O9HL 4MXQD 4OLVL 1MFNA 4J3SA 2DQFB 4HXAL 3VMOA 1MPAL 2D31B 1IBGH 3E1F1 4WV1C 1XGQA 4MD0B 5IP4A 4NNPL 1FIEA 4IS6A 4F80A 3O9WA 5CP7B 2ZCLL 3BQUD 4M48H 4OGYL 2JCCF 1MVFA 1PQZA 4JRXE 5HI3C 2HP4A 4WFFD 4O4YL 2BNQD 2PTVA 3AREB 1IAIH 1K6QH 1BFVH 3GJFK 2R15A 1P9MA 2YZ8A 1KJ2A 8FABB 3UYPA 1RZ8B 4CU6A 4LARL 3I3EA 4ISVB 5LJYH 3MV9E 1ULVA 3FT2A 3RKDD 4RGNC 4XHJC 3CVHL 1ZGLP 5EUKA 4H1LH 3UTSA 3O9WC 2NY7H 1WSST 1YNLL 4WFEE 4N8CL 2HT3D 3CDGA 5DMIH 4KHXH 1GGIL 4CJ1A 2YKLH 2Z0BA 3HRZB 4NN7B 2Z31C 5FDWB 3P4OA 3OTTA 1YJDL 4NKMB 4U7SA 5LGJA 4LHUG 1ORSB 2DJUA 4DEPB 1MCRA 4NUGL 3H0TB 2VDQH 4ZUSA 1L6ZA 1L0YA 1PGRB 3PDOB 4H1LB 4HDIA 5F89B 3WDHA 4U6VH 3OB0K 4WTZG 1RJZB 1KV3A 5F1IB 1JWMB 2NW2B 1HK6A 1S7TB 3IKCB 1VFOA 2VISB 2J8UF 3H2WA 5CEXB 4C83A 1MCWW 2R0ZH 4GKZB 1ZTXL 3BZ4A 2CKNA 4IRSB 1JF6A 4UTAL 4MQ7A 3LN5B 1KPUB 3ARED 4MNHA 4PV8B 1C5CL 2PR4H 4XMKL 1KUMA 4D0CA 1W2KT 1K5NA 2A6KA 3Q1SL 3G5ZA 4PGCA 2Z91B 1P7QD 1RJLB 4XVJL 4HGKC 3FB5B 3QDGE 3BZFB 1FZJB 2VL4A 2WK2A 1CIDA 4JO4L 3RRQA 5HHOB 3HPLA 4XNZC 3H9HB 1HI6B 2BX5A 2FEDC 1U8JA 1IGFL 1JRHH 4LSSH 3IJHB 4GW5A 3FRUA 3P30H 1T7VA 3A67H 4M5ZL 5FIEA 5HD8D 5F3BB 2EXYC 4KMQA 3IAPA 4XWOC 5DK0A 5D8JH 4HZLA 3QG6A 2NY1B 4MCYA 3WXVL 4ZS6D 3FQWB 2H3NB 4CVXB 3G08B 1ETZB 3UXFA 1ADQL 1P2CB 2IBZY 2BOBA 1JPFA 5CKGA 1HNGA 4ZXBC 3RWEB 4BM7A 1RAMA 4N9GB 1J8HB 4NIKB 4IRSD 5AWNH 1LO5A 2GAZA 4MA1C 1F42A 2DM4A 3JTSA 4M7LL 5FYJD 5DJCB 5CJQL 1WQVT 25C8H 1AR2A 1A1OA 4GO6B 1DQDH 1U8IB 3E0GA 5CS7A 4WHYH 4I2XB 3OKDA 2CRYA 1U8PB 5IG7B 5JQHC 2V5MA 3BI9X 1RIUL 3CLFL 2FR4A 3DROB 4ODSH 1JUFA 4P59H 2OK0L 2FIRT 4MLSA 4YC2B 2VZ1A 5HI5D 3ULVL 3GIVA 1I7TA 3IETA 4MQXC 4WHTB 1FBIH 4F7PB 1G6RA 5D7LA 3V7AG 1KNOB 4HF5H 1J87A 5DD6B 3D2UA 4OGAC 2NQCA 3LOWA 1VACA 5CWSA 4FXGB 1CICA 3GBNH 5EU6A 3MLZH 1XGYL 5HGGS 5KJRL 2R8SH 3CD4A 4JPWL 4JQXA 1ZHBA 5EU5B 2WBJB 1TETH 3U46B 1BWWA 5I75C 1IM9A 3OMZA 1GYAA 3GMRA 1QRNB 1RJYB 1T21A 4APQA 2UZIL 2YK1H 1FZOA 2F54B 5DVLA 2WINA 3C9NB 4D3CH 3OPZH 1KN4L 5C0CA 3JVGA 4DKFL 5LXGL 4QRTB 4OZHF 4GLRI 1JYWA 2HTKD 3ZTJG 1XH3A 2D0HA 2EYTA 3ZDXE 4JQXC 3KXFA 5IT2L 2VLJA 4G7YH 3H3PH 4FFVC 5H37G 1AGEB 2BSED 1ZT7A 3MLRH 2NTFA 3EO1A 3LV3A 2MFNA 3D85A 2CLRA 5IMKA 3W82A 4CU7A 3AB0B 1P4IH 4JY6A 1GXEA 4I3RL 4LFHD 1BECA 1JGLH 2EIZA 1PG7W 1T04A 2APBA 2KBGA 1QFUL 1T1WB 3JVGC 3MA9L 3GUTA 5EOCH 4H5SB 2P43B 5DXWA 1WIUA 4FP8H 5EIIA 2W60A 1FDLL 1SYVB 1TPXC 4X6BA 3PGCB 3T8XB 3VFWB 2HA1A 2F54D 2CKBH 5TFSL 2M8XA 2VLRD 1GSMA 2I9LA 1QQDA 3WHXB 4NQEE 3RWGB 1OD7A 1WWAX 1F4HA 1AO7A 1N0XL 5CEZL 4J3OC 4K3JH 2CKBB 1A9EA 2X4QA 5KVDH 3MBXL 1EK3A 4ORGA 3RBGA 4R4BA 2BSTA 4LLYB 1I8MB 4LVNC 5BV7H 1VGKB 4TSAH 3EZJB 4NO5B 4GW1A 3QI9A 5F96H 4PUBH 3VJ6A 2WBKA 4POZC 5LQBL 3T1WA 4FFZH 2EDTA 1EO8H 3DRTA 4U1NA 5BV7B 2EIDA 5D5ME 2ESVE 3S5LG 3BKJL 4JY5H 5DEFA 1M71A 5IVXB 5BS0A 2MHAB 3KR3L 1GCFA 2YPKB 2E8YA 3AFLA 5EU4A 4DN4L 1NFKA 4H20H 2GTZB 3GSQA 4GQ9H 4N8VG 4WUKL 1NH6A 1A7OL 3QO1B 1A5FL 3SDDA 5E2WL 3MRHB 1T89C 3O0RL 3QI9C 1G7JA 3QNZA 4BJLA 1J0ZA 3HG1D 3MBED 2E9BA 5DRNA 3CCHB 2IAMA 4PG2A 5DRWB 2SEBA 4XPTH 1WEJH 2LV4A 4NM8L 4HKZA 3VFTA 4FQPA 4HBCL 3STZA 1LDPL 4JFFD 4JPKL 5E00B 4FQXD 1OTTD 1Q9WA 5TPWH 1GL4B 3UO1H 4F15C 3BRGC 2A9NH 5K9KB 4OQTH 4OM0L 1CG9A 3Q5TA 4I3SL 1JP5A 4NHCH 3RUGB 2LVEA 1FFRA 4GKSB 5GRZA 2BCKB 3FZUD 5JO5A 4JM4H 1J0IA 1UENA 4OM1L 5E5UB 1Q9OA 4YXKL 5DHVB 4F9PA 1L7TH 1EHLH 4I48B 5TE4H 2M1KA 2AABH 4UIMB 4TPRL 4PG2C 1DSFH 2VTFA 1I3GH 1HHIB 3G6DH 3BIAX 2Z93B 3VI3F 3CFDA 1B90A 1KIPA 3FOLB 1A8JH 1T1XB 1ORQA 5F6IB 2XRAL 4AG4L 3PDDA 4QRQB 3MJ8B 4F57L 3LD8C 1BVLB 1QBLH 4RIRB 5KANG 3BAEH 4NQXA 4JDTH 2F5AL 4RQQA 2GSGB 5TQ0H 5L2KB 3MXWH 4F9PC 3KPLA 4L4VE 5F7NC 1BEYL 3KPRE 2COQA 2I07A 1UXSA 3EOAB 4WI4A 2VN4A 2KZ1B 1OQXA 5TDPB 1KYOK 3VMPA 1K8IA 5IQ7L 2W0FA 1XF5A 3DXAB 3V6BR 1XGPB 3MUJA 4LCIL 4PGBB 5A3ID 3GBLA 4EDXB 4EN3A 5JTWA 1KB5A 2CR6A 5CJBA 3FOMA 3L5XH 3QSKB 2YRLA 3NACH 5GRJH 3TBWA 5IB3B 3GIZL 2DMCA 4GBXB 4PG9A 3QHFL 4Y7MA 5C0AB 2HWZL 3CNKA 4PJCE 1FO0H 3TO2B 2EDOA 4UB0H 3P3YA 3VXRA 1NC4A 1IGML 2IAND 5JW4N 5F9OH 2HN7B 4QRPA 5ID0A 1S9VB 1DLHB 1S9YB 5K9QG 5D7SH 3RY6C 3V4VH 5GGQH 2CR3A 3VH8B 5IESH 3OAYH 1EXUB 5EU7C 4UQ2A 1FO0B 4GMSH 4EN3C 4IRJB 2PETA 4Q7DA 1R3HB 3NCMA 1B0RB 1BGXH 4NQDB 3TJEL 5DJDB 1ZWIA 1Q72L 4Y2DB 3IDXH 1MCDA 3FL7A 4S1SH 1E28A 2YPLB 2VXUH 5IM7A 1BD2A 4OZGF 4JDVB 3TBTA 3VXUE 2DQIH 1R5IA 1XCQA 5FKPB 3C5SA 2IBZX 1X5ZA 2ZOKA 4Z95H 2QTEA 4G5ZH 4PJFA 1XIWA 1CBVL 3DYOA 5D2LE 5BRZA 3G5VA 3FO2B 2ICEB 5C0AD 5IK3A 4I9WE 4U31A 1A14L 4M62H 1BJ1H 1Q0YL 2HFFB 3FAWA 5MHSD 5C0GA 1A6VH 3LEXA 4U7MA 4KDTA 4XGZB 1A4JB 1MELA 2VZTA 1AGDA 4M48L 4KZEL 1IRAY 2VZOA 2FRGP 3AM8C 1G9MC 2NXYB 5ICXA 4NQDD 2R2BA 5I17A 3FT4A 1EH9A 4E5XA 1VESA 1IAIL 1K6QL 2B1AL 2FEEL 2OBGA 5T5FL 3MGOB 1D9KD 5T1MB 1YEDB 3QIBB 5SWSB 1GC1H 4JHAH 2CMRH 1PZUB 3SGDI 4N0YH 2E7HA 4XH2A 1U8QA 4Z7UA 3M8OL 4RDQG 2NY7L 1CXFA 3ECBA 3K4ZA 2IWGA 5DMIL 2V2TB 2A1WH 2VDLL 4TVSa 1IC7L 2YKLL 3RVVD 4M8QA 4BK4A 4NNYA 1DN2A 1OP9A 4JFQA 3F65A 4NBXB 4O02H 1HSBB 2GJ6B 5C7XL 5A43C 1F4WH 1UEMA 2A74B 4BQ9A 2MSPA 1Z9LA 5HYSA 3RI5K 4KKCC 4QCIA 4XWGH 4JAMA 2RR3A 1HILB 5F8QC 5H35A 4JZOB 1WIPA 4UAOC 2Y72A 2QLVB 2Z8VC 3BVNB 4YHIA 2XG4A 2PYEB 1G7HA 4WUUB 5FYJL 2DD8L 5ICZB 4EI6A 1B4RA 4MSWB 4PJ9D 1OAKH 3SDAA 3EGSB 1P7HL 3KLHD 5IEKB 3TFKC 5B8CA 4XP4H 4KQ3H 2C1OB 4MA3B 5E4EB 3D0LB 5EC1A 4QT5B 4UDUA 3EYSL 4Z0XB 4L8DA 4OAWA 4KVCH 1T3FB 2Y23A 5DC9B 4ZNCD 3QIBD 3PP4H 3UTTA 1FNFA 1GOGA 1U3JA 2GSIB 3RBSA 5J1TC 4KJWD 3V4PH 4O51A 1FG2B 2Q76B 2FHFA 3SOBH 4L9DA 4KI5E 5EZJB 1ZLUK 2Q87A 1G9NL 4AEHH 2J5LB 3ZE0E 1FZMB 1N4XL 2AV1B 4J1UB 1N5AA 3WNLA 3SDAC 1JRHL 4LSSL 4LNRB 4LSUL 4U6YB 5B8CC 2BSSA 3D25A 3HB3D 3T0VA 4OIIL 1S9XB 4FQQA 4OV5A 3B2UD 5AYUL 4ZFZA 3CU7A 1B2WH 3LH2L 2VUOA 3RPIA 5D2NB 1NKOA 4WUUD 5J89A 3EBAA 5FYJU 1XGUA 4GS7B 5EO0A 3D3VA 3GI9L 1NCAH 5AWNL 2YBRB 5EWIL 2EC9T 2X70A 2K3TA 4QGTA 1KCVL 1FE8L 2BNRA 3L3DB 4HKJB 1HH9A 4YDVA 4M3KB 4JM2F 4MD5A 5DDHA 4Q9BA 4YAQB 2XWBA 1DQDL 3PABB 1R5WA 1I75A 1WBZB 4RGND 4XHJD 1QYGH 1EHXA 4KPHH 2N4IA 1K4CB 3AS3A 1QA9B 3HE6B 4K7PY 3O11A 4OKVA 4MWFB 2KL6A 3QJFB 2D0GA 3CXDH 2YD5A 4QHNB 3ARUA 4Y4FB 4X6CB 2AXHA 4ZODA 3T4YB 5GGSB 2AK4B 5E8DH 2A77L 3CFCL 1LO2L 4UUJB 3VG9C 5JHDB 4F7TA 4F2MA 4NZUH 1FVCA 3LB6C 1SM3L 4OZFH 3VXTB 5C09A 2D9QB 1UXWB 1S7SA 3B9KB 4NQSA 1A7NH 4WFGE 1M1SA 4Z7WA 1QSEE 1T1YA 1CE6B 2WWMC 4XP5H 3FB6B 1FZKB 3OKNA 2O5XH 3D9AL 1IAMA 2OL3L 1P4LB 3ZKSD 1I1AA 1H3TA 2EDNA 4LOUC 2OR7A 5INCA 3SGKA 4I0PC 3U6RA 4D3CL 4M1CC 2QQKH 4RGMC 1E4XH 1UZ6E 5JW4Q 4OJFL 3HMXA 4KRNA 3LDBB 2CD0A 1RZ7L 4KK8D 2FEDD 4WU5A 2JJVA 1AC6A 2VITA 4G9DB 4EUPG 1F6AB 1S9KC 3MUHL 3AS2A 1UC6A 3V0VA 3O4OC 2F15A 3BW9A 3WKML 1SYSB 1RVFH 1U8LA 4M6OH 4X4YB 1JGLL 3BGFC 1GGTA 4X8JB 4R2GB 1E4JA 1QSFA 3B9KD 5ESAB 2Q86B 3O3EA 3BH8B 4ZXBD 4PBWD 4L1HA 1GHFL 1MCIA 5FYLH 5F7EL 4FP8L 2R23A 3ZE1F 2KQMA 2DICA 1BFOB 4IOIA 2XTJD 5KANI 3QIUC 3QFJA 1IT9L 1JFQH 2XV6B 1X6LA 1VFUA 2CKBL 3HI6H 1V3JA 4WHDA 1ZLSH 3LKPA 3QUML 2P5WD 5FV2A 4HPOH 4I13B 3PIQB 3MV7B 4GRMB 4MXWH 2DI8A 2C3VB 4RRPG 1HXYA 4L1DA 2D0FA 1KCSL 1MFAL 3DSFL 1ZGLB 4TOYL 4LRNH 1J1OH 1JGEB 2HVKB 4MD4B 4JO2H 3QCTH 4KU1A 1JGVL 3GRWA 2LU7A 3LEVH 4FQHA 5F3HA 4PJHA 2R1YB 5E9DB 1NDGA 2VLME 4S0TD 4HIHB 4HWBL 4NZTL 1A1NA 2AJVH 4X7DC 1DDHB 3T08A 5DRZA 4WTZA 4X4XB 4P3DA 3RKPA 5K9QI 1NAKL 3HZKB 3OR6B 4YZFE 5T3XH 2A6DA 1TCRB 2V2XA 4U1KB 2Y4SA 3SE8L 3BN3B 4JY5L 2AXFB 2MKWA 1FNGB 4S1RL 3U83A 4H8WH 4P9ML 3VFMA 3JWOC 3S96A 4CDHA 1CI5A 1YY9C 2FJGA 1KACB 1FRGL 3TVMC 1I8IB 4DW2L 1RULL 3AS0A 1Z9OA 3KYOA 3MLYH 4D0BA 4UIKL 3VA6A 1TJHL 2BY1A 3T1FA 1MAJA 2ID5A 3MV7D 1BQHB 1D5ZB 4V1DE 3TA3D 4YHPB 3IXAB 4XVSH 2VLLB 4CU8A 4TUJB 1I9RH 1MIML 4L5FL 5D1ZC 3ZHKA 2C7UB 4XCCL 2IADB 3GB7A 3MRRB 4JG1L 2VMFA 3VI4E 2C1PA 4N8PA 1CL7H 1J9CT 1DBML 3VRIB 5DEZA 2FH6A 3SCMB 1U8KB 2VAAA 1OVZA 1MRDL 4KZDL 1NCNA 3WIIL 2A9NL 2B0SH 2JCCA 1IEAA 3MA7A 2WLYA 4AEIH 3QDMD 2X4TA 3IU3A 4C4KO 4LDOB 1Q0XH 2HLFC 4WFFE 5D9SB 2BNQE 1DR9A 5CEYB 5MEQB 5DUBB 3VXPB 4PJAE 1FAIH 3F5WB 5C0JA 4FQ2H 1OAXH 3BKCL 5E8NB 1BOYA 1HKFA 4MB4A 2DMKA 4U49A 1Q9KA 3I02B 3LS5H 1CFSB 2X4PA 2XKNB 2CLVB 3QA3B 4P4KA 1UT9A 4EKXA 4PGEA 1H3PH 3S36X 4BQBA 4HIEB 3CAFA 3F12A 3NPSC 2P5EB 4TUOA 3QHTC 5IBUG 1GRWA 3C5ZB 3FN0L 4Y5XB 2G60L 3ISWA 1G7PA 5J3HD 3L1OL 4HJGB 5KVGH 1T5XB 2J8UA 4X4ZA 1T0MB 2K9UA 1T5WA 3VMNA 3WUWG 2I5YH 3A6CH 3BUYA 4K2UL 4NT6A 4R3SA 4WW1B 4Y0GA 3UP1A 2OZ4A 5IKCB 4LP5A 5KZCB 3EDKA 4P4KC 4GRWB 2JB6B 3B9AA 3RGVC 1IGYA 3O3DA 4L8SB 3FB7B 3ZDYE 5LWYH 2KH2B 1FO0L 5CBAA 1BAFL 1LEGB 3G6JF 3X3GL 5HYFA 5BVJA 2ZCHH 2ICWJ 3I2CH 5D96B 3MREA 1INDH 1AXTH 5MENB 3AXLB 2LFGA 2AJZB 3VWKA 1F8TH 2R39A 2YPVH 1B6DA 2G9HB 3UBXB 5TF0A 1UB5B 2AP2A 1QBML 3QNXA 5EZOL 1YC8A 1YUHA 4LDLB 1S7WB 2X05A 1Z5LB 3EYFA 3UJTH 4WCYH 2VDRH 4HK0B 5I1GL 3C5ZD 4ZFOB 2VXUL 5IB2B 4LLWB 3DV6B 5HPOA 4YIQB 1NGXA 1OGAA 4FMKA 3EYUH 1WLHA 3I6KA 1I7UB 4U1GC 2CDGB 4YNYB 1NJ9B 1HOCA 2FO4B 4BZ1H 4R96A 1NUGA 5KZCD 1KLGA 4KUCF 5DR5H 3DO7B 2OXHA 2W38A 5E2UL 2DLTA 4OD1H 1C5DB 3KPQA 4ODWB 4Y4KD 2ARJQ 4R7NB 3ZT7A 3HZMA 1KTRL 5B3JE 5DJ6A 4LLVA 4R4FL 3QZWB 2UWEF 3MZGB 3HUJB 4P57A 2Z4QB 2NX5A 5EUOB 1MHHB 5DK3A 1A3RL 3CIQA 3T0EA 4M6MH 2A6IA 5IBTL 1NGPH 5C9KA 3VFSB 5HHNB 5MEND 4PGZA 3BYYA 1E4WH 4U0QB 4K9EC 3ARPA 1QFWL 3P0YH 4K7PX 5I8KH 5HHOE 4C57C 3RWJB 4M7KH 4FQJH 3ETBF 3I50H 3OKMB 5JNYB 3CSYA 5AYQA 3RJDA 2Y06L 4MCZA 3SKMA 4ALAL 3N85H 1MQKH 3BP6A 4PRIB 4UQ3B 3FQNA 2GUOA 1D5IL 1TNMA 5TGBB 1IE5A 2CMRL 1TJGL 3LEYH 4KI5F 3MRJA 4JFOB 3DMMC 3DTXB 3NN8B 3ZE0F 1Y6MR 3ULVF 1IKFL 2AEQH 3B43A 5JOFA 3C09C 3T0EC 1NFDA 4HCRH 4ONGH 2J88L 1J8HE 1ZVSA 4NKOB 4WO4B 2FSEB 4ERSL 2HG5B 1FJ1A 1WZ1H 4OZFG 4RFNC 2EC9U 4KMLB 3LPWA 4PRAA 1T03H 3HZVB 1KOAA 5DO2C 2FH8A 4D2NA 2VZSA 4XZUA 1J05A 4GAYB 3BP4A 4OZHA 3QEUA 3UYRH 4I2XE 3Q6FB 3TJHD 4M7ZC 3LRHA 2ZSWB 4BYHA 1RK1B 3IVKB 5BVPH 4JFZH 2B39A 1FLRH 1C08B 4N5EC 3BSZH 3PGFL 5F72S 5C71A 1AD9B 2HT2C 3PGDA 4FRWA 3PV6B 3KPOA 1U58B 3GMPA 5T1DH 1MCPH 4MJ5B 2AEPL 4ZOCA 2VDOH 4ZG1A 3R1GL 4Z7VB 2ADJA 4AEHL 5IMMA 4NQCB 3TPUB 1H5BC 3HI1B 4WO4D 1YY8B 1RD6A 2F53D 3MZTA 2CLZA 2HKFH 5J13B 1PSKH 2EYRB 3OKOB 4ZQKA 5HJ3A 3KNBB 1PY4A 1QRNE 3VXSD 1N5YL 1MI5B 1DQTA 4LL9A 3QNYB 4NJ9H 3WS6A 3T0WA 5B4MC 3U2SB 1B2WL 4TYUA 2BZDA 3HRPA 5CGYD 2K7PA 2XQBL 4CMMB 5DMKA 5HYJA 5ACZA 1YMHB 3SDXB 3QUXC 5CD3B 3HNTH 5MEPA 4OT1L 3WFHB 1YEIL 1X7QA 3MJ9A 4LF3A 1TLKA 2GFBB 1MCNA 4RMQA 1KTKE 1YYLH 3PWNB 3D39A 1T80A 5E94A 3BZDA 2BRRL 2BOCB 3IU4H 5TE6H 4XAKD 1UFUA 1KPVA 3UC0H 4EEEA 4LLDA 3MGTA 3WS6C 2VE6A 1RUKL 2VH5H 1L4IA 3BIKA 3RU8H 2ZJSH 2W0LA 1QYGL 3LKOB 4KPHL 4G3YH 2PYFB 2J8OA 1QHOA 5IW1A 4PB0H 4JFDA 5E6IA 2ARJA 3DUUA 2RQ8A 4XCYA 3V52L 3OX8A 1TVHB 3V8CA 2QQNH 3OKKA 4Y5VC 5J7CC 4BFEA 3BGAA 2MMXA 2V5RA 3OG6B 1AQKL 3ARDD 4OZIB 3PUCA 1NFIB 4HIXH 5DD5H 1I1RA 4HIIA 4QGYA 3WEXB 1YNTA 4GAJH 1E27B 5DI8A 4RAUB 2VKXA 2GK0A 4TULH 1AIFB 2PKDA 4FQ1H 3MRDB 1R3LB 2O5XL 3VE0B 1OM3H 1Q9LB 3MV8D 5HI4D 3GJEA 5CZVH 4NGHL 4UILH 5IROA 4LLMA 1CGWA 3EFDH 3FTGB 1MWAL 3GSWB 5E7BA 2IPUK 1CFNB 1IC4H 5HYQB 5F1OB 5I1KH 3F6IA 3O8XD 4LEXH 3SBWA 3V7MA 4AM0A 2DYPB 3PL6A 1CK0L 4U05A 3P2TA 2P1YA 4Q2ZA 1IGCL 1NCBL 2AXJA 4JRYB 3FB8B 5BJTB 1UA6H 5GJSH 3QPXH 2HVJB 5D6CA 2QKIB 1DEDA 4U3XA 1NMCC 5T3ZH 1T66D 4F9LC 1A7RL 4TQEL 5IVXE 4I3GA 2ATKB 4ENEC 5IROC 2ZPKH 4LCYB 3RX7A 4WFHE 1UYWL 3NZ8B 1F3JA 4HWNA 3SDCC 3MLUH 3O41B 4QTIL 1L0XA 2W0PA 3PL6C 4XNQA 3UAJD 2VR4A 5JXAL 3QIWB 4ONFL 3P40A 3SKNB 1NC2B 1F11A 3MRNB 4WWKB 4K3DL 5DYOB 5TE7L 3DV4B 3HFMH 2X40A 4QRUA 4PLNC 3HMWH 4KC3B 1D7FA 2EZ0C 3TM6A 1JV5A 3HAEB 3ARFC 5E95B 1ZT4A 5CJOL 1JFQL 4PR5A 1DEEA 1U95A 1A4KB 4X7FC 3BRFA 1KGCE 2A73A 2AXGA 2DYPD 1ZLSL 3SKJH 4EDWH 1F13A 4HPOL 4M9OA 5J0BA 4M5YH 3SJVA 3ESVF 5CMAB 3Q5YA 3VI4F 2H26B 4P2OA 3RUGE 3QEQB 4JREB 3F7YA 2VR9A 3NFSH 4PRNA 2OTPA 4X7SH 1EGJA 2BK8A 2BHUA 5DEGB 1I7RA 2BVPB 2P7TB 1HQRB 2D3VA 4ZYKB 4NNXB 1DL7H 1EHNA 1KFAL 2WLZA 1MH5B 3LEVL 2NNAA 2X1WL 3LCYA 3X3FL 5I2IB 1CDYA 2UUDK 3TF7C 2PO6B 1EAPB 3HCVA 1JK8B 4HPYH 4Y16C 1TQBB 4LLQA 5D6DA 1PG7L 4KFZC 5J9PB 4WWKD 3GSXA 4NKDA 2WWMD 4H25B 4LSVL 2B5IB 1I8KA 2CIIA 5EN2A 4HMDA 4JANB 3X12A 5IHUL 4PYHA 5L2KE 1LNUB 1PKQB 4OZGA 4GRLB 4PJ8A 1RIVH 4PRDA 3B4NA 3WJJA 4OGXL 2Y5EA 3DXAE 1RMFH 2CDEB 2HRPL 4XMPH 1WT5A 2X4SA 4M1CD 1TFHA 4O2FA 1XGTB 5I71B 4J12A 3JV4A 1SEQH 2IJ0C 2VDPL 3QEQD 5D6DC 5I30H 3AC0A 1H0DA 2FJHA 3V4UH 4FXKB 5C0AE 5C0RL 1DQJB 3JWDH 3RZCA 5ITFB 1FV1A 5C0DB 4KY1L 4U0RB 1BZ7B 1WCBA 5IQ9A 2YHGA 4G8IB 4LU5L 3AY4A 3LQMA 5DJXA 3L3HB 2VWEC 2B0SL 5KSUB 4HS6B 2PO6D 4G7VH 3ZDYF 4FTVB 3LN9A 5I8OL 3LMJL 3S36H 1OAQL 5KAQF 1NCWH 4NQDE 5EBMB 1UJ3A 4DZ8A 3QPQD 3RWCB 4F3FA 1OW0C 4LAQH 4O5LH 4P2RD 4L9LA 3F7PC 2R4RL 1FAIL 1TQCC 2B1HH 5GS3A 2YPLE 4GRLD 3TT3H 3GKWH 1J11A 4I4WA 3VGDA 3ROOA 4YXLH 2VLKB 3NGBC 3KHOA 1IAOB 2NY2D 3CFKB 1YN7A 4U33A 5I15H 3SE4A 2NR6D 1CN4A 1JWSB 1AGCB 2BMKA 2QSTA 2B4CL 2BXZA 1FL3A 4Y1AD 3LIZH 5DSCA 1N3NA 2VXVH 3ES6A 4DUWA 4YDLC 4OSUH 2FX9H 2I5YL 2DKUA 5D7KD 1EFXA 3O6FA 4M93C 1XCTA 5D1XB 3FQTA 4U6HA 2XXMB 4X6FA 3SE4C 5I1DB 1VEOA 2AI0H 5EH1A 5B3JF 1ES0A 3QXVA 1DZBA 2VXTL 2X4OA 1F2XK 1SBSH 1U2HA 2V7NA 4RNRB 4HUMB 5ANMB 2FYYB 2AW2A 2D7PA 2ZCHL 5SWSE 2Y36L 3PQYD 1KLFA 2UYLA 1E4XI 1S7VA 2FD6H 4G8GB 4WU7B 4Z76B 2BHZA 3C6SA 5C0FA 2YPVL 2IQAB 3MLVH 2R0LH 3MRGB 1RZFL 3WDJA 4CMHC 5JIPA 3PWLA 3R4DA 5I66B 5FO9B 1BHGA 5D1ZD 3JV6A 2BVOA 2FO1A 5F71A 2H2SC 2CRMA 2OQJA 3KLSA 2GJ6E 3UJTL 2PXYA 2JK5B 2VDRL 5DUPL 4RWYL 4FQIL 4N0CD 1WBXA 1SVZA 3E6FA 5BZWB 4HV8A 5F93C 5KAQG 1A7QH 2OI9B 3L3KA 3JBG7 3IDMA 4EUPA 2BHYA 5GGTH 3KJ4C 3BPCB 4LK4A 4XX1G 1KJMA 2LTQB 1GGBL 2E7LA 1AP2B 1N8ZB 4K7PH 4O00A 2PYEE 3GMLA 2HJLA 4WUUE 4WDIB 4Z5RB 5ELIA 3FHAA 4S1QL 5L88H 3QEHB 4QXTB 3PHSA 5E8EA 1HHGB 1C12A 4ZO6A 1K4DA 1GPOH 4MJIA 5C8JB 2WNGA 3SO3C 1NLDL 3T3PE 5I16B 4MNQB 3T2PA 4JM2A 3HI5H 3HZYA 2PXYC 4RFEA 1U8MA 4XNXH 3TNNB 4HD9A 1S5IH 2X4RA 5FO7A 4XPHL 5I1AB 3NA9L 4MZ2A 2ZOLB 4G8GD 3BHBB 4M6ML 1NBQA 1NGPL 1OTUC 2H6PB 1UH3A 4I5BA 1PLGL 1E4WL 1MFCL 5F21B 2E7LC 1T0NA 3QXDA 4D9LH 1EJ6A 2H8PA 2FB4H 1I3UA 3PWJA 1B9ZA 3I50L 4X9GA 5B38G 1RY7B 5T1LB 4U1SB 4RRPA 5D1QB 2ED8A 2ERJB 3ARBB 4Y89A 1ONQA 3THMH 1UWXH 3LKQA 1EEQA 3S34H 3S88H 5IR1B 4JQIH 3DURA 2EYSB 3G6AB 5D2NE 4JKWA 4HCRL 3WIHL 4AEEA 2DLGA 3FFCA 5CAYB 1YMMD 2IPTL 5B39G 1R3JB 4HS8H 3V0WH 3SGJA 1CS6A 4P4RB 4XPFH 1JTTA 2GITB 1HHHA 4MDJB 1YQVL 1OCWL 2P8PB 1FLTX 3LRSA 4XCFL 4IRZL 1DBJH 1P5VA 3KLDA 1A1MB 5FUOH 4F33A 1G1YA 3HPJA 3C08H 4X5LA 4LASH 2R2HB 5CILL 5K9JH 1AD0B 1FSKB 4KKAD 2ZZUT 4QY8B 5GGRA 4J8RA 3BGMB 3QFDB 3S97C 3KYNA 5LCVH 3VFNA 4OFYD 5D1QD 4X6CE 4UT6L 4ZUUB 4GXVH 5SX4I 1BM3L 3ROLB 3QQ4A 2BERA 2AK4E 2NYYC 4DCQB 3UTPD 5JHDE 3HNSH 1QO3B 5C0NC 1W0WA 1CT8A 2BDNL 2P49B 2X41A 3WUZA 1ZHLA 3LKSA 5DJ0B 2OJZL 2Q7YA 4MNGE 5I6XB 1XF4B 3MRLA 2YA1A 2CJUL 1TNNA 3EYVA 4XNUL 1AE6H 4R7DA 1MUJB 1T1ZB 1YQ2A 3JV5A 4NRXB 3CGTA 1RQ5A 3OGOE 3DX9B 5ENWB 1CU4L 3HNVH 2GHWB 2Z92A 2LAGB 4NP4H 2E6QA 1INQB 4ZS7L 3RDTB 4YHZL 3OHXA 4L4TD 3HC4H 3SDYL 3CFIC 4LEOA 3MO1B 3T3MF 1F45A 1O7VA 2YRPA 3EO0B 4HUUA 4L8BA 1XF3A 2XICA 1XGRB 4HHAA 1G7QB 4MVBD 1FN4A 4XI5D 5CGTA 3UC0L 3EHBC 3IXTA 2BVQB 4NN6B 4Y4HC 2X1OA 1PJ9A 1LK2B 1NGYB 3DMMD 1BZ9B 1KYOJ 1X9QA 5I1HL 1N59B 4JZJB 4HUNB 2AJSL 1U8NB 4G6ML 5IVXF 4D9RE 3NOIA 5HGAA 4LSRL 4G80B 1LO4L 3IDNB 1T4KB 1S7RB 3L6FA 4XHQA 4TN9A 1JGDA 3TIDA 5A2KH 3GHBH 4O58H 2HJKB 3O3UN 3WUWA 4ZPVA 3U4EA 3BISA 2G75A 3WHE1 1EV2E 1EZVY 1CYGA 5DO2D 1JHLH 5L7XL 4P2QA 2GJZA 3C60B 2ZG2A 3OXSB 3ARGC 5A2IH 1NQBA 5KG9B 4GAJL 5FYLE 5TF1H 1BFSA 3WFBL 1J5OH 3BPOC 3MV7E 2DTMH 5FGBA 1D5XA 2Y25A 4H26A 4P46C 3HE7A 3GI8H 1DQLH 4IS6B 3MYJB 3O9WB 4ZNEE 1KJ2H 1MCKA 4MQTB 5GIRA 1JZ2A 1HDMB 3EFDL 2J1KA 1PQZB 4Z18A 4HUVB 2HT2D 4PJDF 5I1KL 5DJZB 3E3QC 4LEXL 3L5WA 1S78C 3DBXA 5HVFB 3ORJA 5I1CH 5I9QB 1I7ZA 5E9DE 5GS2D 3HC3H 1JI1A 1KJ2B 3VXMA 1E4KC 5KSBF 2NY3C 3KYKL 5HHVL 1UA6L 2VSCA 5GJSL 4LGPB 3HE7C 2HT4C 4WW2F 4OLZL 4HFWA 4M43H 5E70A 2V6HA 5B3NA 4OLYH 3PNWA 4PJGF 3CDGB 5IVOA 4W81A 5CUSL 1BOGA 2NY6B 2OR8A 5I18L 1E6OH 4LMQE 5JMRA 3GM8A 3P4OB 3MQIA 1MREL 5LGJB 4Q6IA 1MIEL 2EO1A 2R56H 4YE4H 3U30C 1JIBA 4HDIB 4Z7NE 4U6XA 3CVHA 5FHAH 3QUXD 4IHOA 4QRRD 1DFBL 5ERWA 1H8NA 1KEGH 3UDWA 3HFML 2C4FT 1OWRM 1MAMH 2QJDA 4C83B 1NCTA 3SKOA 4RSVA 5FYKH 3BZ4B 1I1CA 5LGHL 5ID1A 4ZAKA 2QQLH 1A3LL 4LPWA 1FFPB 3OJDA 3OF6A 4MQ7B 4NWTL 4KROB 1BWMA 3VWJC 4MNHB 5JPMB 1F00I 3DVIA 3VGFA 2J7LA 3K81A 3QDJE 4K7FB 4Q9QL 4D0CB 2R1WA 3WSQH 4XBEH 1QR1A 3ZZ1A 2A6KB 3G5ZB 4PGCB 3W9DA 1DTUA 1F58L 2PF6A 5ACMA 3LZFH 5JOPE 2XT1B 2YD2A 3ZKMC 3CMOH 4YFDB 3UDWC 1NANI 3G6JA 4IDJH 5E7FA 5DFVC 2NY6D 1U8JB 3V6OA 2VQ1A 1YJDC 2OTUA 2D7NA 2JJTA 4GW5B 4WI2A 5C08D 3FRUB 4JFED 2EE2A 3NAAH 4FNLL 4YDJA 5JHLL 4FQLH 1F6FB 5FA3A 4LSQH 4HZLB 1RUQH 3Q0HA 3QG6B 4MCYB 4LSPH 2MQCA 4HK3N 4MA7L 3RWIA 2BOBB 1QOKA 2P5EE 3RA7L 3GSUB 1BQUA 3T4AA 1N6QH 3RTQA 1EPFA 4JJ5A 1LO5B 3GMNA 3NCBB 1QNZH 2GAZB 5CINH 3EOYG 2DLFH 3JTSB 5I1JL 2G2RA 2EDHA 2CH8A 1EIBA 1ADQA 3U1SL 3DWTA 5E99H 4GRWE 4LCCA 1H15A 3OKDB 2RFXB 4YK4C 1R6VA 4QNPE 3Q6GH 3BRDA 3Q3GA 3RNQA 1OD9A 3RWFA 1KEMH 4X0KA 2DI7A 2FR4B 4ENED 1A21A 1G6RH 2UWEA 4MS8D 1EBPA 2VDML 1KN2L 2IFFL 4PJXF 3C6LA 1JUFB 4RISH 4LCWA 3SDCD 3RNKA 4AL8H 3RTQC 4YFLI 3IGAA 4NQVB 3QWOA 3JWOL 1FGNH 1M05A 1PW3A 3GIVB 4GMTH 5MENE 1I7TB 3IETB 3UPRB 3MTRA 1ZVHA 1B0GA 4FQCH 5KVMC 1G6RB 2HFEB 3EDJA 4FZ8L 5D7LB 5FECA 3HKFA 1TZHA 3W39A 4NCDA 4XVUC 4LCCC 3D2UB 1AFVH 2WQRA 1FFNA 1VACB 5A2LH 5CWSB 1CICB 4Q9RH 2UVFA 5CSZA 3TC9A 5IJVA 1S7XA 1MY7A 3ARFD 5J11C 2DBLL 4F7MA 3TT3L 1ZHBB 3U82B 1UEYA 4JRWA 1IM9B 12E8H 5E0QA 1WAAF 4CKVX 5IHLB 5HVHB 5M7QA 2XQYG 3GNMH 4ZUTA 1N64L 4S0SD 5F7FA 4APQB 1U6AH 4R8WH 3K46A 1T0PB 3UJJH 3O6MH 2XZCH 2WINB 4M61B 2QSVA 3E8UH 1EEYA 2VR5A 1MCQA 3OAZK 4DKEL 1KT2A 3VD9A 4NPYB 1CGVA 4KUZL 5ALBH 1D6VH 1XH3B 2ITDA 2EYTB 4KI5C 2N56A 3KXFB 1TITA 3HUJE 3V5KA 3ULVC 3WO3B 5EUOE 2NTFB 1ZT7B 3EO1B 2FX8H 3D85B 2CLRB 3EDEA 4OCMC 3N0PB 3T3PF 1YYML 4JY6B 4Y16D 1JPTL 4UOW1 3X11A 5GRVK 5AD0A 2AI0L 3FQRA 4XPBL 1T04B 1HINH 3MUGB 4OCWH 3SY0A 1EO5A 3D18A 4PRIE 5DD0H 5C0EA 3DX6A 3L3OA 5EIIB 3NCYS 4ODTL 4JRXD 5KSAD 2W60B 1FNSL 1S8DB 3CMGA 3BUTA 1Z2KA 3HS0A 3KDMA 4NSKA 4X6BB 5GRWA 4APQD 2CO6B 5AZEH 1VFBA 3QXUA 5D7JA 1DQQA 2EDLA 2I9LB 1QQDB 2XN9A 3MV9D 5HDLA 3BO8B 1A0QH 4HWZA 5BO1H 1M7IA 3BPNB 6FABH 5GRYA 4PLOB 5GJTH 1NSNH 3F58H 4WFED 4R0LC 1URLA 4ZUWB 3QHZH 1A9EB 2X4QB 5IFHH 3CVIH 3S7GA 2Y9RT 4ORGB 4R4BB 1C5BH 3WL9B 3X14A 1L7IH 3NFPA 3ULUH 5TDNB 1F4YH 1L0QA 3MJ7A 4GW1B 3WXWL 1A7BA 3L7EA 3QI9B 5BMFH 2X4UA 5CBEA