1A6VH

B1-8 fv fragment complexed with a (4-hydroxy-3-nitrophenyl) acetate compound
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
118
structure length
118
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARYDYYGSSYFDYWGQGTTVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B1-8 FV (LIGHT CHAIN)
publication title X-Ray Structures of Fv Fragment and its (4-Hydroxy-3-Nitrophenyl)Acetate Complex of Murine B1-8 Antibody
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 20
structure length 118
sequence length 118
chains with identical sequence I, J
ec nomenclature
pdb deposition date 1998-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a6vH00
2NX5A 3D2UA 1L7TH 4FFVC 1JI2A 5FYLL 3DX6B 2GTWA 5F7LB 3MRDA 1AJ7H 2B1AL 4DW2H 5DD3L 4U6VH 4S0SD 4CN6A 5IUSA 5F96H 1H3PL 4N9OB 3QQ4B 3VFMB 4ZPTB 1R3IL 2I26N 2NR6D 4XP4H 3TYFB 1MCJA 3ILPB 1E28B 4RGNC 4Z7UE 4Z0XA 2ZCHL 2O5XL 4QT5B 5I8EB 1NGZA 1P4BL 1MJJA 3RI5K 1E4JA 1RIUL 4D0CB 4ZXBD 4JQXC 4OUUA 3WLWC 3QA3B 2D4DA 5ANMA 2ZUQC 3IFOA 5JO5B 1BJ1H 5ERWA 1IM3B 3D39D 3G5ZA 1BQHB 3GIZL 4YNYB 3CDCA 1G9NH 2EC9U 1KGCE 2R23B 5I19L 4XMPH 2NY5H 4XCNA 1CXLA 2NXYC 2VLJB 5MEPA 5T3ZL 3MLTB 2VIRA 4WVRA 1ZT7B 5DJYB 4S1DC 5KVGL 1S3KL 3BE1L 4HD9A 3ARDD 4HPOH 4LSSL 3V6ZB 3UO1L 2W0FB 2W0PA 2VXTH 2OS7A 2XG5A 1CE6B 4TRPL 1N6QL 4NRZB 2HJLB 3GNML 1WITA 4MQTB 1DDHA 1NFDE 3RWGA 4CMHC 5EFIA 3HUJE 3GGWB 1OWRM 1UB6A 4Y1AE 3KXFA 1SM3H 1Q9KA 3RNQA 3L95A 4KAQL 1A64A 1QTYT 3WJLA 5L2JA 3G5XB 4TTDC 4GT7A 1NAMH 5I1JL 3ULUF 1ZAGA 1FL3B 3ARFB 1CLYH 5LGJA 1QLFB 1NC2A 5J9PB 1F3RB 3D18B 1LILA 2NY7L 5GRYA 5I1LA 3UTTD 4U05A 1BZ9A 2VL5A 2HWZL 1JGUH 2ZPKH 5CJ8A 3SBWC 3L3HB 3E6FA 5E4EC 3ZO0A 5HYIA 5EBMA 4LSVH 3RA7L 4QRRA 3VGDA 4HUWA 3KPSD 4OV6F 1RULH 1KNOA 2Q8BL 4P2QA 3CX5K 4HK3N 4MD5A 1GGIH 4OGAD 5AZEH 3EYVA 3IJSB 4YHYB 1HEZA 4R7NB 3QXAB 1H9VA 3FFCA 1QYGH 2VDOH 1CT8B 2QQKL 2MNUA 4LCCB 4FG6D 4J4PA 4MWFB 1YJDL 3KR3L 3MRNA 4LP4A 35C8L 4JZOA 5JZ7D 3PNWB 1R3KB 4NPYB 4BK5A 4OZFH 1EDQA 3L3JA 1N3NA 4BH7A 4X7TB 4KH2A 5DEFB 4MD4A 4Z7WF 4O2EA 4OFPA 3HKFA 5FM5O 4A2LA 1MHPL 1D9KD 5D72H 3TBTB 4UV4H 2V2TA 1B6UA 1JWMB 1R3JB 3SJVE 3ZKND 1OAXH 3MJ7B 5C0ND 4FABH 1AXTH 1FZMB 3T77A 5BV7L 4PB0H 1TVBB 4PJBE 1S7RA 5E8OA 2R0LL 4P9HL 4C55A 3BX7C 1T1XB 4JZJA 3KPLB 3WL9A 5FXCH 1QQDB 1CFQB 3P30L 4NUJA 4O2FB 5CP3H 4O58L 3V6FA 4EJ1C 4ZFOB 5I1AA 1NMCC 2CUIA 1SYVA 3DWTA 4AIZB 1Z2KA 1XAUA 3QEGL 4OBSA 4FNLL 4C56E 2X9YA 2FSEB 1T20A 2CUMA 2XZCH 5E8PA 3EHBC 2DKMA 4E41A 4F33A 5JA9A 1MCHA 1MRCL 4JDVA 3BIKB 2CIIB 4NKOA 4Z8FL 3ULSB 4Q97A 2ATKB 1HQRB 3KGRA 4NBZB 4NQXB 4XP9L 1LEKA 3S36X 1LDPL 3QIWC 3QYCA 1OAKL 2O26U 4WTZA 4FQLH 4X7FC 3ARQA 5F7YC 4OBRA 1JTTA 4LLVB 5IM7A 4HUUA 3L3DA 1CGXA 1I1CA 3H9YA 1Z9MA 3DHJA 5EH1A 2B8OT 5I8KH 5F9JA 3DROB 1FL5B 5IK3B 4RAUA 1OCWH 1ZT1A 3HLAB 3QQ3B 3JWDC 4LASL 2XG4A 3BKYH 3GIVB 3IDUA 3L5HA 3QNXB 4M7LL 3LPFA 4RZCA 5HGHA 4YDLC 2GEEA 6FABH 3OKDB 3U2SA 2CLRA 3DUHA 3Q6FA 3T3PE 4NIKB 2LAAA 1I7TA 5INCA 1HZHH 3QH3A 4KPHH 1NSNL 4BZYA 4GJTB 4PYGA 1VFAB 4L4TA 1ZA6B 5HSFA 4G9FD 2G5RA 5SV4A 4H8WC 1TENA 5ISZA 3NPZB 4XP5H 7FABH 5JMRA 1KTRL 2CMRH 1CU4H 2BDNL 3TIDB 1AGDA 4NFDA 4YDVB 2J88H 3AM8A 3GMMA 3QUYD 3HR5B 5IHUH 1I3GL 3BGFC 2C7UB 3MRBA 4GW5B 2RAMA 3JSSA 3S5LG 4Y7MA 2H1PL 3CLEH 1Z5LB 1FIEA 3QDJA 1B0WA 2F58L 3VRIB 4WTWA 1CFNB 4LLYA 2CJUL 4U6YB 1HYSC 2A6KA 4Y4FC 3DYPA 4ODBD 1QFHA 2NW2A 4NWTL 1HHKB 1C5DB 1JTPA 3VW3L 1JHLL 2PETA 5C07E 4J2XA 1HILA 1I4FB 1MFAH 2FH6A 3HC4H 4XAWH 2W38A 1NBZA 3QZWG 4APQC 4DWHA 1II4E 5KAQF 1ZEAH 2FX9L 1MIMH 1HHJB 3STLB 3HNSH 4J23A 4LGRB 2N7AA 3VFSB 3ZTNH 3QIBA 1D5MB 5F9AC 4G6MH 5FO8A 3L5XL 1EEUA 3HNTH 1YQ2A 2P5WE 4PJFF 4LLUB 5FYLE 3PP4L 5D7SL 2PXYD 3CH1B 4GG6A 3ARSA 1A6AB 3Q3GB 5HI4C 3IDGA 4LHUB 5D1QD 4XBPB 2EZ0C 3NCFB 4PRIB 1EO8L 3CXDH 1YNTA 1IM9B 4HMCA 3PWNB 5D5MB 2N4IA 4NC2B 4HKXA 4DCQA 1I7UA 3L5IA 3GMNB 3LQAL 2I07B 1F3JB 2A2QT 2QLVB 4LEXH 3TN0B 3CSYB 2R56H 5JPMA 1J12A 3EYUH 2DYPB 3TBWB 3KPPA 3W2DH 1ULVA 4ZAKA 1ZS8B 4PRPB 2J5LC 5HI3D 3VMOA 2JE8A 1U8PA 3BRGC 1ZHLA 4YHKL 4H1LH 2R9HC 3ES6B 5SWZD 2A73A 2AJYH 3P0VL 1FDLH 1K4CA 4FQHA 5C0AB 1IRAY 1INDH 4P59H 2WANA 3GJFA 43C9A 3PXHA 4PGCA 4F7PB 4OLUH 3RI5F 4EVNA 4P5TC 1EK3A 4PRIE 4QHNA 4F7CA 1YMHA 4LQFH 4R4FL 2R2EB 1PGRB 2I5YH 2EKSB 4UQ2A 4N0YH 5D2NE 1N59A 3U6RA 4W4OC 2APWA 3FB6B 1DQLL 2DMCA 5F1SA 1K3IA 1OP5H 1CICC 5EOTA 5DD1L 4TVPE 4YHPA 4U1GC 4I48A 4YZFF 4MDJA 3LRGA 4PRPE 3T0EA 3OG6B 3QNZB 1SBSL 5ESAA 5H2BB 3C09B 4LCYB 3QUZA 2FHCA 4N9GA 4Q9QL 4NCDA 4XPFL 3RVUC 3KLHC 4HLJA 2IAMD 4OGXL 3CAFA 3EDDA 1RPQA 2OJEB 5A16A 5ELIA 5IVZA 1AGCB 3UAJC 3VXUD 2DL9A 1FSKB 5KS9A 1KIUA 1PYWA 4GW4B 4YEEA 2EDRA 4LAJH 3L5WA 1FFNB 2D0FA 4KHTH 4C4KT 5C0BB 4JVUA 2A9NL 4MGXA 4GRWH 5BV7B 1BMGA 5ALCL 3OF6A 5JDJA 1RUMH 1HNGA 4DKFH 4HV8B 2XPGB 4HJGA 1EUTA 2H26A 2FJGB 2YD8A 4WFED 3L3GA 4IRJA 4FTVB 3RWFA 5HY9B 1N5AB 1T0PB 3KPRD 1DVFD 4TUKL 1U36A 4KVNH 1YYLH 3IKKA 3QJHA 2XWBA 3MRIB 4KJQC 4P4RB 4UDTA 1RJZB 2Y7QB 3GSRA 2J6EA 1TQBB 1PQZB 2VSCA 4D0BB 2BC4B 4LMQE 2BFVL 4HWBH 3WDIA 2APTA 3BZ4B 2XZQH 4YHNA 4JRXA 5ALBH 3RPIB 2AXGB 3JVGA 1RK1B 2P43B 2KDGA 2YPKB 3DIFB 3SGDI 3O0RL 4PJXF 4LMQI 4U1SA 2VAJA 2V5YA 3FOMA 4MVBC 1GIGL 4JG0L 3UPRB 1KB5B 1CGSL 2VLMD 2VR9A 4JREB 4DGVH 4EKXA 3ARRA 3VFVB 1MLCA 2PTTA 3A6BH 1ED3A 4IS6A 2X40A 2H9GB 3B9VA 1ZMYA 2EYSB 5E8DL 3VXSE 1CL7I 2QSCL 4XNQB 1S5HA 3DV6A 1BEYL 1Q38A 5CJQL 2VZSA 3H0TB 4FTVE 4MAUH 3UTSA 5ICXB 5CZXC 2PNDA 1HHIA 5EU7C 2L7UA 4Q6IC 2WM0A 3IDNA 3MCG1 1G84A 1HN1A 4GRLD 1HOCA 2AEPL 4P2OC 2MHAB 5HGBA 4KQ4L 2G75A 1UZ6F 1XGYH 1QLEH 1EX0A 1NLDL 3MRQB 4Z7VB 3CFDA 4PP1D 4X4XA 3O81A 5DRNA 4NM4L 3N85H 1CFVL 3G6JA 2EYTA 5IMKA 2DDQH 3FOLB 3T1WA 1BVLA 4H1LG 1UYWH 5ABDE 4F7EB 3WDJA 1YEDA 2BVQA 4PRAB 1HXMA 1P7QD 1KEML 2B4CC 1S7WB 4PGEB 4EUPA 1JZ7A 1CGUA 1UKQA 3RWJA 1JYXA 3SHSA 2P24A 3EO1A 4JO1H 5E1AB 1U3HD 4G6FB 4X98A 2CDFA 4K7PH 4KWUA 4M48L 3QIUB 2AQ2A 2C1OB 4UAOC 3H42H 5KZCD 4W6WB 3B2UC 5EU5A 3VXOA 5DJ8A 3S8WA 1TIUA 1IC5L 2FJFA 4I18B 2VN7A 3SKUD 2NY1C 5FO7B 1ADQA 3V8OA 3MXVH 1D5IL 1A0QL 4FFVD 3TA3D 1CZ8L 3UTQA 1N2RB 3ET9F 3HE6C 5F6IB 1PKOA 3WO4B 2IH1B 5E70A 5CCKL 2GITA 4JDTL 4G7YH 4UT6L 1YC8A 3JWOL 3VGGA 3HMXL 1RJYB 2NQCA 1CLZL 3FFCD 2QR0B 3AVEA 2O61B 5DEGB 3W9EB 2OQJB 3X3FL 2FX7H 2ITCA 2CDEA 2OR8A 3VG9C 3B6SB 4LVHB 4LSTL 1LEGB 1S9XB 3QXUA 1HHGA 4GLRI 1OP5K 1GZPB 5I1EH 2YPVL 5HVHC 3NCYS 3X3GH 2BOCA 4P57B 2EDJA 3PUCA 1A1OA 3GBML 5HGAA 2VDNH 4ZFZB 1MFEH 4I0PB 3MGTB 5EZIL 5I73B 3C08H 2VN4A 1V3KA 1YEKH 2Y36H 1RZGA 4KROD 3R0NA 2W1NA 3ULUE 1BM3H 1YYML 2A1WL 1DLHB 4W70A 4RGMB 4WFGE 3DTXB 1RZKC 2E7CA 2KQMA 5MERB 3RL1A 1A4JA 2HFEB 3HB3D 5DVKA 4YPGB 1KIPB 2PO6A 2HKHL 4WI9A 4UNUA 3ULVH 3VFGL 1IVLA 5C0CB 2O93L 2HFFA 2JJTC 2VH5H 4Y5YA 3KHQA 1RSFA 4EI5C 1CTNA 4DZBA 1OB1A 3ZDXF 5HHMD 5MHSE 4OIIL 5GRJL 5GJSL 3MROA 2DOCA 3S88H 3KS0J 3WKML 2YN5A 4OZHB 3C60A 3U7WH 1U92B 1BGXH 1OTUC 2FJHB 3PQYB 1WWWX 4Q2ZB 3GFUA 2DQHH 3B9KA 5FGSA 4PV8A 5GS0C 1CLOL 2YWZA 1NEUA 3FQTB 4ZS7H 4BZ1L 2UWEB 1T83C 4LSPH 1FFPA 1NUDA 2FO1A 1A3LL 4OF7A 4M93C 1IC4L 1UACL 3X12B 3UYRH 2D0HA 5IB4A 3B43A 5DWUH 2AGJL 4TNVF 3SDXB 1F97A 3GSQA 4Z7WE 4DVRH 3UTPD 5C0CE 3SKNB 3O8XC 3BWAA 4M6OH 5F1NB 4PR5B 4GAGH 2VUYA 4ODTH 2R4RH 3NZ8A 5TE6L 3K8KA 1DBAL 5GZND 3Q5TA 4NKIH 4OZHE 5C0JA 1SEQL 4NQVB 5I15L 3RY6A 1C5CH 2OXGA 3FB8A 2RGSA 2PKDA 4X8XA 3VFTA 1P1ZB 2OSLA 3CVIL 1AKJA 1Q94A 3WHE0 2ATPB 4D0DA 5HD8C 2AJSL 2ARJQ 2UWEE 2EE6A 3SCMA 2HLAA 1A2YB 1AIFA 5DUPL 1K85A 3NOIA 3IFLH 2WUCH 1FBIH 2DM7A 2YSSA 1ES0B 2D7TH 4NKQB 5INDB 2YWYA 5EC1B 4GW1A 2E9BA 3RUGF 3F65A 3IDXL 3PHQA 3SDXE 1KYOJ 4JE4B 1PSKL 1T6VN 4WWKD 1KPVB 4Y88A 1MFBL 4F15B 1A02N 2A74B 4KZDL 1VGEL 1U42A 5BMFH 1IGTB 3T0DA 5FUCE 4D9QE 4QY8B 5IFHL 3O4LD 4CU8A 5DGQA 5CJXA 5AZ2L 2YC1A 2AS5M 1UT9A 1RUAL 2DWEB 5BS0E 1BREA 2ILLA 3V6OC 2IMNA 4OCRL 1BOGB 2VXVL 3OKEB 2X05A 3QDJD 3VG0H 1C08B 1Q9LA 5FCUH 3MNVA 5EOQL 5KW9L 3QB7C 4DUWA 4MZ3A 3MRPB 3OR7B 2XTJD 1A4KB 1C7SA 1KCLA 5FM5M 1L7TL 1PY4A 5JNYA 1NEZB 4GKNB 2CR3A 5DS8B 5C7XH 3VXNA 4L5FL 1U58B 4DW2L 4U6VL 1RUPH 2X4UA 4DZ8A 1P84K 3BYYA 5F96L 5FYKH 1K6QH 1J86A 4PJIA 2EDQA 2J1KA 4JVWA 3T0XA 4Y5XB 1IC7H 2EDLA 2NTSP 3WUWG 4XCCH 1MVUA 4X7DC 2R1YA 3PGCA 3QRGH 1ADQH 1Z0MA 4Q58C 1NCAH 3BH9A 3GSWA 3DXAE 3MBEC 3KYNA 1PG7X 4TN9A 5E94A 4HKBA 2AVGA 1G9NL 2NY2B 4XMPL 4KKAC 2NY5L 3BP6B 3NCCB 5GGSB 4PJCB 1XCTB 4J12A 1ZHNA 4NQDD 1BLNA 4L8SA 5FFLA 3LEXB 3LS5H 3VDBA 2WQ8A 4V1DD 1D5BB 2YHGA 4L4VA 1JIBA 4QXTA 5DJAA 5KBNC 3F8UB 3GZKA 4KKBD 2BRQA 4XGZA 4Y4HD 2HN7B 3D87B 1SM3L 3HI1A 4ZXBB 3KJ4C 3R8BB 2WP3O 4HIJA 3D39B 3P0YH 5ITBH 5J13B 2JLLA 3KHOA 3TO2A 1R3LA 3LEVH 4PJFE 3EOTL 2QHRH 4PJCE 2H2SD 3ULVD 2XNAB 4MMXC 1M4KA 1NDGA 1JGUL 4JO3L 1XF4A 4NO3A 2ZPKL 1EERB 3BEVA 1EZVY 3BHBA 3BQUD 3ETBF 3RWHB 2B4CH 2C3XA 4LSVL 3TVMC 1PD6A 4I3SH 2X9XA 3ARDB 3I9GH 4NFBA 2NZIA 1RULL 2VAAA 2Y72A 2K7QA 3QEQB 5KSAD 2IFFL 4KKLC 4ZUUA 3IKCB 5AZEL 3T3MF 5GRVL 3BZFA 4K3DH 1J8HD 3OZ9H 1QYGL 2KPNA 2BERA 1TETH 4MDIA 2EIZA 3D25B 2YUZA 5E00B 4IHOB 1D5XA 1ORQA 4S1RH 3TO4C 1TZIB 1N8ZB 3U46A 3IETA 2DM2A 2FR4A 5I30H 4K7FB 5I76A 5B3NA 3LH2H 3GM8A 2V17H 1FYTA 4P0DA 5H94A 3G5VB 3U48A 3HZKA 4DK6A 5EIVA 3MRLB 5DK2A 4DOHB 4TOYH 3AFLA 1CFTA 3OJMB 4TUJA 4QOKE 1MY5A 5GSRA 4UV4L 3VXPA 2A6IA 4N8VA 1OAXL 2XXCB 4KK8C 4FABL 1AXTL 2D9CA 4PB0L 3HZVB 5L0QB 5CGMA 3GMRA 3U82B 1BBJB 1MHEB 4HCRH 4PRNA 3KPSB 1ZT4A 3SGEH 3TZVD 4PBWD 4ZNEA 4LIQE 4GBXD 5C08D 4I4WB 1LE9B 1SMAA 3TJHD 5TE7H 2B0SL 1J0JA 1AHWC 1EXUA 2Z35A 4LCIH 4R96B 4M7LT 2GCYB 2P45B 4U49A 5C9JB 1EPFA 2VNCA 1KG0B 3BW9B 3T2PA 4ZUSA 2Y5TB 4M61B 4AK1A 4I1NB 3QJFB 1SYSB 5CSZB 3OKNB 4P23A 3DNKA 1Y6NR 5I6XC 4NN6C 3UTTE 1IL1A 1O7SA 1G7MB 5JHLH 4L8CA 1RZ8A 1PZ5B 3IGAB 1K9TA 3PP3H 1D9KB 4IRZH 8CGTA 5MP6L 4MAYC 3KPSE 1G7QB 1KOAA 4NM8L 4PRDB 1YEEL 3PL6C 2A9MH 3ARGA 1IGIH 3UJIH 1KBGH 3A6OA 4Y2OA 1ZVSB 3KPTA 3OGCA 2C3VA 1OY3B 4FQLL 3BD4A 4GAYA 1IQWH 5IB2A 1E27B 3C5ZA 1WICA 2W9DH 4ELMA 1GGCH 2CXGA 1G9ML 3L9RB 5IHBA 2X89D 2YD4A 5I8KL 1UH3A 2FIKA 3LD8C 4LLDA 1OCWL 2EC9T 5FYKD 5E08H 2WLZA 4K07A 4Y4KA 3CX5J 1S9VA 2V2WB 1WCBB 5E6IC 1NC4D 3BP7A 4PJ5D 2ESVA 6FABL 5KSBB 5ICYB 1SQ2N 4YBLB 4OKDA 5KANG 3RVTC 1CG9A 1KTLB 4L3EE 1HZHL 5B8CB 1NANH 5JTWA 4XBGB 4HIIA 5F97E 3UZQA 1A5FH 2WWKT 5D70H 3CCHB 1KXVC 5C0GA 4XP5L 7FABL 2PYFB 4O51B 1CU4L 3S37X 3VRJB 2D03H 3O6KH 5CD3A 2QADC 3QDAA 3I84A 5CZVH 1T7YA 2QSTA 5IHUL 4X6FA 1IEBA 5BRZD 1MF2H 1AXSB 4FXKA 4IIQB 3LKNB 4XX1G 1U95B 1KJVB 3VWKC 5I9QC 1CE1H 1NFKA 1M7XA 1FVEA 1WBYB 3J8F7 1I85A 2AJZB 5DSCB 1YDPB 3HPJB 5D7LD 5D93C 4LVNC 3DI3B 2F53A 5E03A 2AJXH 5MI0B 1MFAL 3HC4L 3OKKA 4H25B 3CFBB 4KI5F 4XAWL 3JV6B 3RWCB 3MCKA 1NGXA 1JZ6A 3GSXB 1IC1A 4YFDB 1EGJA 1JF6A 1MIML 2V5MA 5SWQA 3CSGA 3HNSL 2J8UB 1EEZB 3TJEH 3K2UH 5SWSD 4NO0A 4U1IB 2P42B 5K9KB 3GMLA 3QUXD 4X8JB 1JNLH 4G6ML 4G9FB 1WZLA 1H0DA 5DMGD 3HNTL 2NZ9C 4U1JB 3MV7A 5DQJB 4LF3B 1MAKA 3SE3C 4BQ9A 5FKPB 2AABL 5GS1A 2YN3A 5GSVB 3QUYB 3CXDL 1H15B 3BH8B 3TT3H 4CRPA 3W81A 1CXEA 2OTWB 4U6HA 2GJ6E 3MRMA 3MZTA 5CD5C 2EKJA 5A3IC 4G8EA 4FHBD 4N0FB 2B39A 4JG1H 4LEXL 3C60D 1TJHL 5AAMA 2R56L 1F8TH 5EUOB 4K3JH 2K3TA 3EYUL 3ZL4H 4GG6F 4G6AD 4PLOB 2XN9B 3AS1A 3PWUB 4FQXD 5JHDE 1FVCA 4P4KA 5CSGA 5B4MD 3VGFA 2CUHA 4M9PA 1QD0A 1LK3H 1HH9B 2NY3D 3O9WA 1NAMB 1BJ1J 2E27H 4ONHB 1Y6KR 1DP0A 4I2XE 1KTDA 4PLKD 1IAKA 1QPXA 1FDLL 4WCYH 3CMOH 3SE4C 5EPMA 1A9EA 3HRZB 1VESA 1INDL 1BZ7B 1RK0A 1SEBA 1XGPB 4P59L 3W11D 1QSEE 2XACC 4OLUL 3BUYB 5EU3B 5I1DB 1FN4A 1OW0A 4G43B 5DQ9B 3ZE1E 4AH2B 2PXYB 4LQFL 1RZJC 1F4YH 5FUZH 5GGVH 5D1QB 4JPVH 3ME0A 4N0YL 4YHIB 3KYMB 1JWUB 1H8NA 1ONQB 2FHFA 2O5ZH 2V7HA 4JKKA 5EUOE 4X6DA 2VLKA 4HFWB 15C8H 5F8QC 5KVFL 1AGEB 3S5LB 4G8GE 4AMKH 1XF2A 2AEIT 3OXRA 2WV3A 2E7HA 5JR1H 1AKJD 1RVFH 1FJ1A 4XNUH 4JFYB 5HYJA 5FO9B 5ACZA 1W0YT 3RGHA 5JOFA 3ZDXE 4JFDD 3DARA 3K80A 1LE5B 2IPTL 4OZFB 1DEDA 1XGRB 3DV4B 5J6HA 4Y2DA 1ZTXL 1T1ZB 3QZWB 5SWZB 3WS3A 4MD0A 5D6DC 4G3YH 3SDAA 1G0XA 1A47A 4OLEA 3IU3B 5HHXH 4KHTL 4Q0XL 4D94A 4E5XA 3BVNB 1J8KA 5JDSB 3QT2A 1QSFA 4BQ8A 3HI6L 4YWGH 5J1SC 43CAB 3BGMB 2C3HA 4ZQKA 3W39B 1RUML 4WW2B 4DKFL 2H3NA 3JTTA 5KS9F 1M7IA 3FTGA 4NRXB 3TEUA 1WEJH 4JY6B 4JCLA 3KLAB 4KVNL 5E2VL 3CFKA 1MUJA 1FNGA 1YYLL 2QEJA 1A6TB 5JW4M 3IFPA 3FQXB 1IE5A 1L0XA 2C4FU 1A1MB 2ARJA 4HJJH 1EFXA 1P6FA 4HWBL 5HYSG 4CW1A 2XZQL 3WFEH 5ALBL 5SWZE 5DT1H 5DEZA 3ZZ1A 4F2MA 2AJ3B 1E0OB 1U93A 2VERN 3VXUB 4ONFH 1YUHB 4JFEA 3QNYA 4HG4K 4X5XB 4GXUM 4QHUB 2VXUH 2EH8H 4GAFB 5ESVA 2J4WL 3RUGE 2EIEA 2E8YA 1P5VA 2Z31C 3H8NA 5DA0B 4EEEA 2HP4A 5IESL 4GKSB 3AUVA 4HH9B 2FX8H 3SDYH 3B3IA 1DVFB 3KPRB 2DIJA 5EG6C 2CLZB 3QO1B 2XWTA 1DFBH 3M8OH 3K46A 1P5UA 1AO7D 5FK9B 4BUGA 5DDHA 1XGYL 2E7LA 2NYYC 3BPLC 4DUVA 5DHXB 3JUZA 3REVB 3F7RA 3S35X 3N85L 3VXUE 4MLSA 1OHQA 5IW1A 2DDQL 3QDGA 4K94H 1UYWL 2X4OA 4MJIA 2C1PB 2YD6A 2Z8WC 1TTUA 3OJVC 1Z3GH 5HHOA 4QRPE 3PHOA 1JFQH 4XI5C 1MNUH 3TBVB 4GUPB 1A8JH 4Z18A 4OZGB 4UQ3B 2XQBH 1XGQA 3I6LD 1YY9D 4JO1L 1JP5A 5FYJH 1IILE 4CMMB 3RVXC 3G6JF 4K7PL 4XTRC 4WFEE 3SBWA 5I17A 2KZ1B 3H42L 4HQQH 5I8CB 5EBLA 4GRLB 2PW1A 3SDCC 3MXVL 4LPUA 1JV5B 4ALAH 4YGAB 3K8LA 4HZLA 4P46C 1WISA 2VZTA 1ZSDB 4N5UA 3MLSH 3QHFH 4CU6A 3JWDL 4LU5H 2ADIA 1T2QH 1U9KA 4R2GC 4GS7C 4HSQA 2VLME 5EZLA 2OK0H 4IDJH 1I7RB 2FX7L 1P2CB 3MFFA 1P7QB 4YDKH 3ESVF 1GC1H 3MGAA 1FNHA 5ANME 3MODH 3KPMB 1T7WA 4LHQB 1U3HB 3BD5A 3QEUB 5I1EL 4ZDHA 1ZA3A 3X3GL 1J10A 5JQ6H 1IEHA 2ADJB 1T66C 5KZCB 1TCRA 1T1YA 2HTKD 2PR4L 5DR5H 4DGYH 4PJDA 4LOUC 4NZUH 1MAML 1WGOA 2VDNL 5EB9A 3HE7D 1MFEL 3U1SL 4LEOA 3TA3B 1WSST 3C08L 5ID1B 3MJGX 2D2OA 1QBML 2Y36L 1OSPH 4X99A 1QRND 4BSVB 4K3EH 3QUKB 2UUDH 3F7PC 3V0AC 3LKOA 3JUYA 3H9SB 4MNGA 5AYQA 3U0TA 3CVHL 3KXFE 1T0MB 1IGML 2GYSA 3UEZA 3WEXA 1T3FB 2VH5L 3MSPA 4H1LB 2FGZA 1EO7A 5T1KD 5IMMB 5JORB 1B3JA 5DI8B 4U0RC 5I1GH 3U7WL 4BH7B 3AS3A 3RY4A 1BGXL 1YPZB 2HTLD 3U83A 4XH2B 5IVXA 5B38G 2DQHL 5DC9B 3MRGB 2WBJD 3QIWA 3B9DA 4ERSH 3MQIA 4MYWB 4QRRE 1A9BA 4GMSH 4ZS7L 1RHHA 2AAVA 2AXFA 4U1LA 3ARGD 3NN8B 5KOVC 3I02B 3UYRL 2IPUG 4N0CD 4KROB 4P3CH 4P9MH 3CZJA 2R4SL 3FFCE 5D2LB 1KC5H 5DHYA 4DVRL 2BVPB 1W0VB 3IXTB 4WHCA 4NUJB 1FZKB 3MV8A 4KK5D 1KUMA 1AGFB 4M6OL 4JFPA 4CJ1A 4NGHH 2P1YA 4ODTL 4HWZA 4KHXL 2R4RL 3IAGC 2GT9B 5DRZA 3RDTD 5CKAA 3C6LD 3VFPB 4TTGA 1MHCA 4NKIL 5HHMB 3V7AG 4Y4KD 3GUTB 5LGKA 2X1PA 1C5CL 1C16B 5DJDB 2M2DA 5FKAB 1A3RH 4F33B 3MRJB 2BX5A 3NTCH 4WUUD 1KN4L 2X4SA 4GRWB 4TULH 5TDPB 3P4MA 3SKMB 1KJMB 3TT1H 1R5WB 5CINH 3EYQC 1HNFA 5E4EB 2D7TL 1VCAA 4M5YH 4X4MA 1U8MB 4BFBD 3IYLW 1KXTB 4XBEH 5D2LE 4F80A 1KCKA 3HC3H 2H6PB 4BSWB 3MRCA 2XXMB 3LN4A 5EBWA 2C4XA 5IQ7H 3AAZA 5BMFL 3GO1H 2QQLH 4H5SA 5FGBC 3KPNA 4MNHA 4PRHD 5JLZA 1J9CT 4ODWB 5FA3A 5DTFA 2BHUA 1D6EA 3OKYA 5EC2A 4MXWL 3SPVB 1FCCA 3CVHA 3T4AA 1IAII 1A6ZA 4JN2B 3VG0L 4E41E 5LQBH 3KDMB 4APQA 5FCUL 4V2CB 3RHWF 3VE0B 3DX7B 2P5EA 4PBVC 2IFGA 1FNEA 3ARFC 4KRMB 4MMZC 5FYJD 4XB7A 1RU9H 4UI2A 4KMTL 5C7XL 2OL3A 1F11A 1IGYB 3C2AL 5FYKL 5KN5B 5E99H 2W07A 3QI9C 1IC7L 3K4ZA 3EJZC 4WWKB 3UTPE 3LKSB 1AC0A 1AGBA 3QEHA 3MV7D 1NAKH 4N90D 4PLJD 4XCCL 1ORSA 4YHYC 2WUBH 1B0RA 3FQNB 1M71B 3O4LB 4HDIA 4LLQA 3QRGL 1CQYA 1NMCB 2VOTA 2OYPA 3DBXB 4ODUB 3HG1B 1NCAL 2DQGL 4WU7A 4LCCC 4PJIF 4UUJA 4Y16D 1Y18B 3V5HA 1S9KC 1ZGLB 3P9LB 5J4MA 4FQPA 4M03A 1QFUH 3GSNH 2M1KA 1S7TB 4ORGA 4OFYD 3X14B 2ZCLL 5DF0A 4PJ7A 2F8VA 1G6RA 3O3EA 2LQRA 4HFUH 2XTJB 4UZGA 3FZUC 4LPYA 4Y5VB 4L4TE 1XFPA 2DAVA 4P5TA 1S8DA 3CK0H 4KRPD 3LS5L 4LLMB 4PJ8D 2Q6WA 1HSAB 4JRYA 5IJVB 2UUDK 1DEEB 3EOYG 4UILH 2BOBA 1IKNA 5FGCE 3WFBH 5C0FA 2M8XA 4PB9H 1U8KA 1I1YB 4W4OA 2HG5B 1A7RL 3TFKC 3RVVC 1X5LA 4XHJC 1CICA 2HRLA 4KI5E 2HYMA 1ZLUH 1QR1B 5MEQA 2EDNA 3QPQC 4MJ6B 4NQSA 3AC0A 3QDJE 3BO8A 2ZP0T 1WJ3A 1VACA 3P0YL 3B2VH 5ITBL 4F7MB 2G5BB 3LEVL 2QHRL 1MCQA 2GSGA 2WINA 2CK0L 2XTJE 2A0LC 1E4KC 4XVUC 4NFCA 3LKRA 3S3SA 3MMEA 5F3HB 3VCLB 4ORZC 1VKXB 3QXTA 4ZO8A 2B4CL 2BY0A 3QCTH 1PY9A 4LPCA 4WY7H 4HT1L 4NQDB 4I3SL 1HHHB 1L0YA 3VI3F 4HIEB 2WWKO 3PDOA 2VLRA 3ZYJA 3L1OL 3SE9H 4LAQL 4V1DB 4MLIA 3MYJA 3MA7A 3OZ9L 1OLLA 3LDBB 4GG6E 3C8DA 2P7TA 2IH3A 5F88B 4Y4HB 2X41A 1E6OH 4F7CB 1YMHB 4S1RL 1KN2L 3DUUA 2WSKA 5L2KD 5CSBA 5K9OA 2BCKB 3W82A 3EKCA 5I30L 3T1FB 3WUWB 4Z95L 3QAZB 2A83B 1QFWM 2V17L 3IXAA 3U36A 5EOCL 1ZGLP 2RQ8A 5KTEH 1P84J 1XIWD 3D6GA 5GXBB 4TOYL 4U1MA 2BSED 3FAXA 1BVKB 4O4YH 4U31A 4Y4FB 2BNQA 3G5YA 4S2SB 4D3CL 1MCWW 3BQUB 3C6SA 4U1KB 5FGRA 1AY1H 2DLFH 2W65A 2DQDH 4MSWA 4V1DE 4M6NH 4HCRL 1G0YR 2CD0A 4G9DA 4ZFFB 5KSAB 1XH3A 1FVDA 4X6CA 4PJGA 1RJLB 1X6NA 4BYHA 1J8HB 5JW4Q 1EEYB 4JFED 1P9MC 2ED9A 1F2QA 4M3JA 2BSSB 1WWCA 4Q6IA 1UJ3B 4QRUA 4A6YH 4W4NA 3P77A 4WJ5B 2QL1A 4JM2D 4P2OA 3FQRB 4MJ4A 5CJOH 3TBSA 1BECA 3O3AB 2RIKA 3V5DB 4QWWD 3UJTH 4EQ2A 1X4XA 3ULVE 1TPXB 4HKZB 5IEKB 1U91B 3WD5H 3H2WA 4CL7A 3PV6A 3G04B 3BUTA 3H3BC 3R1GH 5GGRB 4PYHA 2VXSH 4XPGH 5J6GB 3EZJB 3Q48A 5JPNA 4Y19A 2A9ML 1IGIL 1XR9B 1KBGL 3NFSH 5KS9E 8FABB 3TZVB 4R26H 2MQCA 4HGWA 3BMWA 2X9WA 4GBXB 1IQWL 4JVPA 5C08B 2W9DL 4MJID 1GGCL 3EOBA 5DFVD 2LU4A 3VMNA 1OGTA 4WRLA 1BJ8A 2ZUXA 5IFAH 3T2QA 4RIRB 3FB5A 3FT4B 1JZ5A 5GS0L 5I2IA 3BDBA 1YZZA 2DJUA 2PYEA 4PG9A 5E08L 3S97C 4IMKA 3RP1A 3HE6A 5F9WB 4ELMF 5ETUA 1ZVHA 2HT2D 3RZCD 5DHVB 1ZLSH 4TQEH 4ZFGL 2QSVA 3TN0C 4YJZL 1Q9OB 1QNZH 1GHFL 4QKXB 5KJRH 4JRXE 1FGVH 2GFBB 2BVTA 1ZHBA 3RX8A 4X4XB 1X4ZA 5D70L 3WFCL 1I7ZA 3DGGB 4KK6D 5C08E 3UTOA 4FN0A 2LE9A 5IMKB 3QFJD 1OSZB 3NFNA 2D03L 2A6DA 2I24N 1ZLUK 2P8PB 5CZVL 5JOPD 1J05A 3PGDA 1MF2L 3K4AA 3EO1B 1JPFB 3BP4A 4ZS6D 1W72A 2FZ3B 1U8JB 2WWMD 2MFNA 3E8UL 1AI1L 1KT2A 3TIEB 3Q5YA 3KYOA 5HJ3B 1JPGA 3OSKA 32C2A 1NC4B 3HN3A 4PJ5B 4JZNB 4E42B 5CAYB 2AJXL 4LSQH 3L7EA 2XKSA 4YGVB 5IBUG 4MX7B 4LKXA 1J7VR 5CBEA 4I5BA 2YRLA 1UM6L 3QULB 3TJEL 3K2UL 3G6JE 4NO5B 3NVQA 2EXYD 3H9HA 1YJDC 2FWOA 1TNMA 2FBOJ 1N6VA 2G2RA 2JJTA 1JPTH 4EI5A 3KYKL 4YAQA 3HA0A 1P4LB 3KPQB 2AV1B 1FSKC 1RY7B 4KJWD 1KB9K 1I8MB 1BHGA 5IMOB 1TZHB 5M94B 3VD4A 4WV1B 3TT3L 5BRZB 4XPHH 2XKNB 3U4BH 3R0MA 3RPKA 5FCSH 3MRFB 4XTRD 3IFNH 4NQCB 3RL2A 1V7ML 1X7QA 1UB5A 1T83A 3U4EB 1PKQB 4JDZA 5D7LB 4K3JL 3ZL4L 4PJHA 1U8NB 4OD1H 1LO2H 5HHNA 4XNYH 1LK3L 4F58H 1GGUA 1KLGA 5TFSH 2MOVA 4DN4H 3UMTA 3DO7A 5MEOA 2ICEB 2E27L 2SEBA 2VKXA 2HJFA 3O8XA 4OM1H 1TQBC 5J11B 2OTUA 5C0EB 5SWSB 1RZGB 2X4QA 1J87A 5D7IB 4JPWH 4WCYL 3CMOL 1MJ7H 2YA2A 3MGOA 3QUXB 4JFHE 4ONOA 3PWLB 4XC3H 4G8IB 4ZSOB 4OGZA 5ID0A 3MV8D 2BNUA 5BRZE 1F4YL 5FUZL 5GGVL 4I77H 4HJ0C 2EXWC 5IBLC 4JPVL 4UU9B 4F7TB 4JREC 1F13A 3VFUA 5L6YL 5ACLA 4P2RA 4Y5YB 3VFOA 2F5AH 2HLFC 4KFZC 4JY5H 2O5ZL 4U7MA 5D7LE 2W0LA 3A6CL 4YDIH 5BXFA 15C8L 4N5ED 4MCZB 3HS0A 4NN5B 1B6DA 3SGKC 2R1WA 4NHCH 3V2AR 1RVFL 2YBRB 1GGTA 4GRMA 1JF1A 4JQVA 2BZDA 4XNUL 4FQXB 2EIBA 2AJVH 4NO2B 5HYSA 1UXSA 2LTQC 5AD0B 4C83B 2KQNA 4BFIA 5D7IE 3N1GC 5E0QA 1NCCH 4X6DF 2Q1EA 1CS6A 4U6XA 4CVXB 4G8FB 4G3YL 3V6OA 4X6BB 3VH8B 5HHXL 1CFSA 1JMXA 1X5YA 2COQA 4YWGL 5ICZA 5EIIB 4B0MM 2C3GA 5HYQB 3MR9A 1DQJB 4R3SB 1NBYA 1FLTX 1BFOA 1S7QA 3OX8A 2IF7A 3EGSB 3QDMA 1WEJL 5HVHB 5FA4B 3TP4A 3QIUC 2VQ1B 1I8LA 4G5ZL 2OJZH 4I18C 3WFEL 2YSSB 4L8BA 4JFDB 4IOFD 1YEFL 1IAIM 5DT1L 5H35A 2VISA 3SKOA 5IV2A 2Q3AA 5F6IC 5KVMC 3PHQB 4DGIH 1SVCP 1I1RA 3EO0B 3WO4C 2IQAA 1ND0A 2PW2A 2VXUL 2EH8L 3T8XB 1N7MH 3MBEA 5IEHA 3F5WA 3P4NA 5F7MC 4PS4H 3FT3A 2ZUUA 5E7FA 3FT2B 4ODSH 5BZDA 4LVHC 3X13A 3EAKA 5FOBA 3GM0A 1QVOB 3IAPA 5IJKC 4Y1AD 1PFCA 2FX8L 3SDYL 4GXVL 3QWOB 2WNGA 4RISH 4L1HA 1VGKB 1JYWA 2X09A 4JJ5A 1DFBL 1YPZF 3ILQC 4JFDE 1W0WB 3CIQA 1WZ1H 2X4NB 4OGYL 3ZMRA 3UBXB 4M93B 4I0PC 3GI8L 1Q9WB 1G7JB 3E6HB 5I73C 4K94L 1W72H 4OZIA 3K1DA 3NA9H 4WNQB 4Q7DA 1WAAA 1Z3GL 5FB8B 1QRKA 2QQNH 3QCVH 4K3GA 3T65B 4KMQA 1MNUL 3GB7B 2VDKH 4RX4D 2XQBL 5DRXB 1XGUB 3VI4F 2R1YB 3IJHA 1ACYH 5FYJL 2AP2A 1XR8B 2Z92A 2KH2B 1NCBH 1H3UA 3NZHH 5GRUL 5B3JF 1KJ3H 2D7NA 4GFTB 3TVMA 4HQQL 3CC5A 4L29B 4PUBH 1J0IA 1B90A 5B39A 3OHXA 3LKQB 5F7DB 3AU1B 1AO7B 5TDOA 4RQQA 4GRWF 3OJ2C 4FQ1H 2BVOB 1IGCH 1KIRB 1OGAA 3MLSL 4PJ9D 4XXDA 4JKMA 1X3DA 3TBYA 3QUMA 1CBVL 3V0VB 4PGBA 3O6MH 4LPTA 4XPTH 1I3UA 25C8H 4LU5L 3UBXI 1SJHB 1T2QL 3TO4A 1IKFH 3VXRA 1FFOB 2X4TB 4EI6A 4KZEH 2OK0L 4IDJL 4NQEA 1FORH 3JZ7A 1UENA 1GC1L 1OAYH 5ENWA 3MODL 1F6LL 3EJYD 2JK5B 3VGAC 3ARXA 1NFIA 1JHTB 2W91A 4TVPH 5FUCC 5HTSA 4HIJB 3OG4B 3LV3A 5CBAB 4YR6A 1JNJA 2EDFA 5JQ6L 3TO2B 1JGDA 2J7LA 1EO5A 4M1CC 4M6AA 2Z93B 4EDXB 4HF5L 1AO7E 3HAEH 5DR5L 1BOYA 4C56D 4DGYL 4NZUL 4HG4J 1H5BB 3G6AA 1LK2B 1S7XB 3HZYB 3C9NA 3WFDH 3LSOA 1AHWA 4EOWH 1OSPL 3D48R 4WI3A 4L4VE 1NGQH 2YD1A 2H45A 4J6RH 4NSKA 1OAZH 2XA3A 3C8HA 2XA8H 4MQ7B 1BFVH 3O2DH 4XNMB 3MJ9H 4PJDF 5IHLB 4XHJD 1JPSL 3BSZH 3O3BB 3QO0A 4QXWA 4XPBH 4F15C 3I6LE 3RWIA 3VFNA 4UIMB 1UGNA 4YQXL 5KG9B 1KJ2A 5I76B 1JE6A 1I3RA 4DUXA 3T04D 1JK8A 5H94B 1WBXA 2YPLB 2NW3B 1QBBA 2C4FT 4MAYA 4PY8J 1SJXA 5DJCA 3PL6A 5F7WC 3SGDH 3GRWA 4XZUA 4DVBA 4ERSL 3HE7B 3PJSB 3TH2T 4RMUA 4GMSL 1LEIB 2Q76B 4P3DA 4M43H 5HHQA 2VDLH 2NLJA 5TH2A 1T04A 4P3CL 5GGTH 4GAJH 4P9ML 1CL7H 1QRNB 2BMKB 3D9AL 3BAEL 2E8ZA 3IDJB 5IVXF 4FFZL 1VADB 5E1HB 5EO0B 4IRSD 3KWWA 4Y5XC 4AG4L 1EMTL 4NGHL 5E6IA 1SY6A 4PJAA 5HI5D 5T1KB 4YIQA 1PEZA 1A3RL 2V2XA 3ORJA 4F57H 3NTCL 3QQNA 4DTGH 5I75B 4POZD 3T4YB 2WBJB 1ZK9A 3TT1L 3WMSA 1DUYA 3V0WH 5CINL 1VENA 4YPJA 4R4NC 2NY2C 2H32B 1RZJL 2R0WH 4M5YL 4OQTH 4N0UA 4X7CC 4ZNEE 4XBEL 5C07D 3ARGB 1QA9B 1MH5B 3HC3L 4JPIA 1JGLH 3SQBA 1PZUB 3PWPA 1DQDH 3GO1L 2QQLL 4NJAH 4LBEB 4LHUG 3MRKB 4FQCH 1T6WA 1UEYA 5JW5A 1MCOH 1J0ZA 2HVJA 3IT8D 2P5WD 2NR6C 1FL6B 4BJLA 3RDTB 4BQ6A 1KCVH 3C6LB 5LQBL 4AENB 5E24E 5CEXB 4Y4KB 4ZXBC 2I9LB 4PTUA 4KDTC 3F12B 3VD9A 4WUUB 4FQIL 2X1XR 4JB9H 2R29L 3WNMA 5IKCA 1RHFA 4XP1H 5IB1B 1KV3A 1CG9B 4ODXA 3VA6A 1RU9L 2GJJA 4J8RB 5E5UB 4Z76A 3LRHA 4JFFA 3TF7C 5B38B 4YBQD 3IF1B 5E99L 4R0LB 4B53A 4BA8A 3ARDC 1FG9C 4ELME 1A7PL 4NKMA 4GLRH 2FRGP 3RIAF 5IQ9A 4KTDH 3BPCA 5DC0A 2WUBL 4PRHB 4OD3H 2ADGA 5IOPB 5BZWA 4GMTL 5GRXG 3FRPG 2GSIA 2UYLA 1MOEA 1QFUL 2ESVE 4J3VA 3GSNL 4LNVA 1HCVA 3C5JA 4WUUE 2EEDA 2OI9B 3DRQA 4BK4A 3HZMB 1RIVH 3P9MA 4B5EA 3JBG7 3MLXL 3WN5C 2CRMA 3SE4A 3WBDA 5IG7A 3RGVA 2X4PB 4TVPD 3ULUH 1UWEL 3PWVA 2FL5B 1OP3H 3IDIB 3WHXA 4IMLA 4AIOA 3NIFF 1AR1D 5BVJB 4UILL 5L0QC 1U8QA 4XCEB 4I9WD 3WFBL 4PB9L 4PJ7F 2IJ0C 2VL4A 3P11H 3CDGA 4PRHE 1G7PA 1U3YA 4OGAC 3RX5A 1RMFL 5KSVB 2EO9A 1H8OA 3ZHLA 2J12B 4NDMB 4NC1E 4J3TA 4OCLC 4P2RD 3BP5B 1P7KA 1F4XH 1DBJH 3IVKB 5GS2H 4Y16B 4FG6C 3MUGB 2KBGA 3DMMD 5DC4B 2F53E 2Y6SC 4XT1C 5I1HH 5JZ7C 4MNQA 3D69B 3FCTA 5FYJE 5JW4N 2EYRA 4W81A 5GJTH 2VE6B 2ZWLT 4GSDH 1FVCB 4OLYL 5D6DA 3QCTL 4WY7L 4XPAH 2X7LB 2DS4A 4IDLA 1I1FB 4OKVB 1D9KC 4LL9A 3X11B 2Q8AH 4KRPB 4PJ8B 3SE9L 1KJ2H 3CJJA 1YY8B 2VLLB 5LCVH 3ZKNC 5C0NC 4L9DA 1E6JL 4FOMA 2GIYA 3MV7E 4N90E 3HR6A 5E56A 5C3LD 2IADB 3FO0L 2FEEL 4HUXB 5IHZB 1R5IB 1E6OL 1G7HB 3U30C 1DBBH 3OKMA 5E9DA 3VWKB 1J18A 2R69H 4UDUA 4QHLA 5D1XD 5KTEL 3N50A 2JIXD 4XCYB 3RWDB 4N8PA 3VXSD 4LVNB 5FDWA 2HT3D 3O2VH 3Q0HA 5KSUB 3MOQA 2A77L 1OVZA 2VABA 4P5MB 3ZKMD 3CLFH 3H3PH 5FECA 3GSVB 2DQDL 5C86A 1DE4B 2HH0H 3WXVL 4EDWL 2CIKA 1F2XK 1CF8H 3TWCH 3EOAA 4Z7QF 4KY1H 1MI5B 4QTIH 5DD6A 3HFMH 2Z31A 2D7MA 3LZFH 5MENA 4UT9H 4J3WA 4HHAA 4QXGH 3GMQB 5GRZA 1JGEB 4A6YL 2UZXB 3OB0H 3EYFB 4IJ3B 3OL2A 2DQEH 3QXWA 1DUZB 5L2KB 2HFTA 3KG5A 5C09A 1T22B 3S4SA 1T7VA 1FO0L 5CIPH 5DLMH 3TNMB 3ZDYF 4X6CF 2MTPA 4PJGF 4RWYH 4OLWL 3UJTL 1JGVH 1XIWB 2VC2H 2B2XH 3GJEA 4U0QB 1DQQB 3S34L 3WD5L 3SDDA 1T5XA 4RMSA 5FUOL 1FNGB 4NKDB 3WIFA 2ZUWA 1F02I 5GGUA 3R1GL 5J8OA 1EHNA 2VXSL 1YN6B 5T3XH 4XPGL 3UC0H 3WE6A 4K9EH 2W59A 4H26B 4Z0BH 1EEQA 3PGFH 3NFSL 1JRHI 4OLXH 1KIQB 3MUY1 4X7EC 3O3DB 4R26L 4NZRH 4PV9B 5CEZH 1T21B 2Y06L 5CP7B 2H8PB 3EDKA 3WFHA 4G42A 1FV1B 4H0GA 3MLRH 5BOPA 1QSFE 1G9NC 4J1UB 3FRUA 5L2KE 5I8OH 4K2UH 2NY5C 1MFCH 2I9TA 3UPAA 5DD5H 4KUZH 3OKLB 5DMJB 2GI7A 3QCUH 2Q7YA 4JM2B 5LKNA 3MV9A 3QUYC 5GS3A 4LLWB 3RFZC 4DFHA 1MJUL 2FYYA 3D3VA 1INQA 1ZLSL 4TQEL 1QACA 5IVOA 4KXZI 1VHPA 2Z91B 5EU6A 5GIRB 1QNZL 5KJRL 1FGVL 1GZQA 3THMH 3K4DA 1EAPB 2Q86A 2ZOLB 3ARVA 2OZ4L 3LQZB 4I0CC 4YO0B 2M26A 3GMOA 3CX2A 2F9BT 4JFEE 5DMYA 4NQED 5CILL 1AFVH 2MPAH 2GHWB 4OCMC 5EO1B 3ULUD 1A6WH 4FQQB 2R1XB 3K1KC 2AKRA 4WFGD 1IAMA 5K93A 2PXYC 5D6CA 1DANT 3DURB 1E4WH 4XC1L 5D1QC 1MWAA 4AEFA 2DQJL 3T0VA 4PY7B 4RAHA 1FO0A 1IZKA 5F7UA 4X5LA 4X83A 4YFEA 2F74B 2AI0L 1UWGL 3RNKB 4LSQL 2ED7A 3HCVB 3RZCB 1LGVA 1RZIB 3GBNH 5J57B 2PCPA 2APVA 4QRQB 1LP9A 4HZLB 4K23L 1WFOA 5GS2D 3RVWD 1S7VB 4YHLL 5T5FH 1MCKA 1YQVH 2IWGA 3CD4A 2OR9H 3GSNB 1I8KA 4Q9BA 2Y07L 4NHUB 1MQ8A 4ZUTA 4MJIE 4OF6A 1CK0H 3V9FA 3I6KB 5HHOE 3P4LA 3QFJB 3ISWA 4WU5A 2KUTA 4RRPG 4Z7UA 3CFEB 3MLVH 1QEWA 3VXMA 3ARBD 3I85A 1CXFA 4XPHL 3MJ6A 3U4BL 3MO1A 2BY3A 4WI2A 4WO4D 1M6OA 2QSQA 1ROWA 3BJLA 1XCQA 4WW2C 3NCJH 1N0LA 3EYOA 5GZOD 1TCRB 3IAQA 2BVYA 4S1SH 1KCSH 3DX6A 4OD1L 5F44A 4XNYL 1HKLH 2L4OA 5EA0H 4F58L 5TFSL 3MLWH 4RAVB 5FM4A 4P99A 3H7LA 5LWYH 3N1MC 4RBPH 4ZMAT 1JNHB 4OM1L 4H0HB 3QQ4A 1U8HB 5DVNA 2RFXB 3MPCA 3VFMA 3DGCR 3GEWB 4HGMA 1DQMH 3WIHH 3V52H 4ZPTA 1MJ7L 3QR2A 5H37H 3TYFA 3MV11 2IEPA 3K74B 3ILPA 2IAMC 1YNLH 4PJHF 2IG2H 4QT5A 5I8EA 4D0CA 5JOPE 4ZNCD 2JCCB 3W0WD 3QA3A 5E6ZA 3UJJL 1FLRH 3OB0K 3OTTA 3ALPA 5JO5A 3CFJB 4NNYB 1IM3A 1T5WB 1QPPA 5EZJB 1BQHA 2F5AL 4YNYA 1F6FB 1YEIH 4BKLB 3GSOB 4YDIL 1U3ZA 2R23A 4L4JA 5K9QI 2VLJA 1CVRA 4HLZG 5BS0D 2A38A 4PJDE 3MLTA 4NHCL 1ZT7A 5DJYA 4XVJH 3S96B 1OAUH 2IAND 2DRUA 4U7SA 3SDCB 2AJVL 4PJEB 2W0FA 1DVFC 2NTFB 5E2TL 5TQ2H 1CE6A 4P46B 4XCFH 5FGBA 1S9WB 3E1F1 3L6FB 3FAWA 3V6BR 4NRZA 5HPMB 3AXLA 2HJLA 1LO5B 2DLIA 2ORBH 5ITFB 5IBUB 2R2HB 1IT9H 1DCLA 2DBLH 2YUVA 4R9HA 3PWPD 4WEBL 5CGYD 3GGWA 4O2CB 4MNGE 1ZKAA 2V7NB 4PP2B 4JKWA 5T3XD 1YN7B 4UT7H 4YXLH 4JFPB 3G5XA 1UXWB 5JW4R 5D7JD 5E2WH 5KAQG 1FL3A 4ISVB 3JTSB 3ARFA 1MCEA 1DR9A 1QLFA 5CEZD 1TTGA 4HS8H 5J9PA 4HC1A 3D18A 4ZUVB 2BY2A 3L3HA 4UTBH 4HUKB 1KB9J 3R06B 4A6YB 3DXAD 4LPWA 1XGTB 3O11B 1A7QH 1IGJB 2VR5A 4X5WB 4GRLC 4MA1B 3HMWL 3S9DB 5EBGA 3IJSA 4R7NA 3LQMA 3QXAA 1PW3A 4DGIL 4EXPX 3ZHKA 4M8VA 2CKBH 1CT8A 4PP1C 3MV8E 4LCCA 1MCPH 4MWFA 5JW3H 1N7ML 4LDLB 4PS4L 5CHNB 4OT1H 4HS6B 5GQBA 3PNWA 1R3KA 4NPYA 5EC2B 4ODSL 4X7TA 1IAOB 4YDJB 5DEFA 5DRWB 1XF3B 1W2KT 4Z6AT 3M17B 1HDMB 2ZG3A 2DQUH 3HI5H 1AD9B 3OKOB 1U3HC 3BDYH 2EDHA 3TBTA 5TDNB 1C12B 1JWMA 1KCRH 1R3JA 4RISL 5E5RB 5EDXA 3LPWA 3MJ7A 1FZMA 3CUPB 1TVBA 4K7PX 3RGVD 4KQ3L 4X4ME 5E5MB 1WZ1L 1T1XA 3NMEA 3DHMA 3P4OB 4ZYKB 2H2PD 1R24B 4CVZB 2DF3A 3KPLA 5C0RH 3BN9D 3TA3C 1QQDA 1CFQA 1NBVH 4AY0A 4HWEH 5L9DH 4O2FA 5HPOA 3NA9L 3QISA 4NYLB 4ZFOA 3RIFF 2QQNL 3QCVL 4AIZA 3FO9B 3C8KB 5H37G 2VDKL 2F19H 2VZVA 4FP8H 3UPCA 2FSEA 1ACYL 3G6DL 1JMZA 1NCBL 1E4KA 1NFDB 2Z8RA 4UUJB 3LKPB 3HUJB 3NCYP 4L3AA 4OZIF 3BIKA 1NDMB 1KJ3L 4M7KH 5IWLC 2JJUA 4Y1AB 1WAAF 2CIIA 4OLZH 4PUBL 3ZLQC 5F89B 1CD9B 4ELKB 3ULSA 2DKUA 2ATKA 1HQRA 4YC2B 5C6PB 1VFOA 1YNKL 4NQXA 4FQ1L 4M3KB 4RBPK 1IGCL 4MB4A 1R0AH 3MXWH 1Q8MA 3VXTB 2V5TA 1JPST 4JQIH 4QOKD 5T1LD 1SJEB 3O6ML 25C8L 1F00I 4JRWA 1MCLA 4MJ5B 1IKFL 4O9HH 3CSBA 4LLVA 4KZEL 4KROC 3V8CA 1SHMA 1FL5A 3DROA 4G80B 5IK3A 3V95A 1AQDB 3HLAA 3QQ3A 1OAYL 3GIVA 3CFCH 1GL4B 3HB3C 3QNXA 1CIUA 4TVPL 3SN6N 1NMAH 3OKDA 1QFWH 4JLRB 1G0DA 4CAGA 1OWWA 1IQDB 4PJ7E 1UCBL 5CKGA 5J89A 2LFGA 4PLNC 4WDIB 1VFBB 1UWXK 1EJOH 1VFAA 5I71C 2NPLX 3WFDL 3QQ9D 1GH7A 3REWA 4QNPE 4E0RB 4JRYE 4EOWL 5I1IH 4PJ9B 3L3KB 4MA7H 1NGQL 3TIDA 4FXLA 3D85B 3SJVB 3QI9B 1BFVL 3O2DL 3OXSB 4LCWD 2OMBA 3MJ9L 4YDVA 3HR5A 5D1ZD 3BSZL 4PJBB 1IMHC 2C7UA 4XPBL 2X1WL 4GW5A 5MEND 2X42A 2GJZB 2F5BH 1CXIA 3DUUB 3T2NH 1Z5LA 3VRIA 2BNRD 5CEYB 4U6YA 4O5LH 3Q1SH 4NP4H 1T4KB 1HHKA 1C5DA 3D0LB 3MLUH 2Y6SD 3OAUH 5AUMB 1I4FA 2XI9A 5GZNC 4D8PB 4EN3A 2B20A 3BEWB 2GAZB 1QBLL 4C56B 1M1SA 4HMDA 4HUVB 1HHJA 3STLA 1UM5L 1QKZH 2IPKB 3VFSA 4NJ9L 3BZEB 1D5MA 1FGNL 2VDLL 5IFJB 4P5KB 2G9HB 2NXZD 3CXHK 3WS6C 4RMVA 3NABH 5GGTL 1CL7L 5SX4I 3PF2A 2KL6A 5IB5B 4L3ED 3CH1A 1FVDB 5C2UB 2GTZB 1A6AA 1LWRA 3Q3GA 5EN2B 4YUEL 3HC0B 4LHUA 4XBPA 3RTQD 2ZSWB 4PRIA 4AL8H 3EFFB 5IT2H 1G7IB 4FXGB 4WWKC 1IM9A 3PWNA 5D5MA 3LRSB 1T89A 2IGFH 4UOW0 1U8OB 4UMGA 5T1MA 3GMNA 2I07A 4ZOEA 1F3JA 1TCMA 2NNAB 5TF1L 3TN0A 3CSYA 3IDMB 1HXYB 3WNOA 2DYPA 3TBWA 2BNQE 2FATH 4Z78B 3KYAA 1QSVA 3AROA 1ZS8A 1WC7B 5CZKA 4PRPA 4D9LH 4DTGL 3D0VB 2DLHA 1Y0LB 5C0DB 3NCMA 4PJAF 4PREB 5EU6D 1ZVYA 4KV5E 3ES6A 4OQTL 5J12B 1KB5L 2FCBA 4NUGH 2XTJC 3U0PB 5C0AA 4X6CE 4PJGE 3BT2H 4Y5VC 5LGHH 5L8KB 5DJ2B 1Q72H 4F7PA 1Q0XH 1FPTH 3JXAA 1DQDL 5FOJA 5EUKB 4NJAL 5EU7E 2R2EA 4OM0H 2BXYA 2EKSA 3CPLB 4O02H 4IRSB 4MB3A 4FQCL 4R7DB 1MCOL 1HWGB 3FB6A 3V5KB 1YECH 1TJIH 1T0NB 3EJJX 3MUJA 1S5IH 5JXEA 1MCFA 4OB5H 2GY7B 4WFHE 1YMMD 3QHZH 3SY0A 3QNZA 4JHAL 2W9EH 5ETUB 2WP3T 5H2BA 4LCYA 2GJ6D 4JB9L 1YEGH 3EDEA 5GISH 4XP1L 5JUEH 2OJEA 4K71C 1HIMH 1AGCA 1ZHBB 4GW4A 5C07B 5JHDD 2IALB 4LDEB 4NNXB 1FFNA 3RJDA 4TNWF 3LN5B 1BQSA 5C0BA 4GOSA 4KTDL 4OI9A 4LKCB 4HBCH 4Z77B 3N9GH 5FF6B 4OD3L 4JFOB 1N64H 3VMPA 1Z9LA 2VITB 1LO3H 1KCUH 3LDBC 4S10A 4HV8A 4KKBC 1GOGA 2PYEE 2XPGA 5TJWK 1QSED 2CRZA 2P5WB 2DWDB 4Y4HC 2FJGA 5F1IB 1N5AA 5F7NC 5E2JA 3QAZC 4P4RA 3MRIA 1RJZA 2Y7QA 5HDOA 1RIVL 4ENED 1PQZA 5C6TH 2F54D 1I1AD 2AERT 3Q5OA 4D0BA 3O6FD 2AEQL 3PXJA 2BC4A 1PDKA 1S7UB 5KVEL 3OV6A 3BZ4A 1BFTA 3RPIA 2AXGA 4LSDA 1RK1A 3ULUL 2H2SC 3QWRD 3ULVC 2YPKA 3DIFA 4G8GD 4OZFG 4XNXL 5DJ0B 4PGDB 3BQUC 2VKWA 3STZB 1KB5A 3UPRA 4FFYH 3VFVA 3P11L 4Y0GA 4ONGH 1WCQA 2H9GA 5KSAC 2E7BA 3FN0H 2EYSA 4XNQA 2EDKA 3MNWB 4G7VL 3H0TA 1KEGL 5ICXA 3SGKA 3QDHA 4TNVK 1F4XL 1DBJL 2VZOA 1U8IB 2FO4B 4PGJA 1OTSD 1UJ3C 3I2CH 4S11A 5F6HJ 3JV0A 4UIKH 3LMJH 2BSRB 5I1HL 2MHAA 5F6HI 5D2NB 4WGWB 4BQBA 4LDOB 4Z7VA 1TPXC 3IU4H 4ZD3L 3TH3T 4XAKD 4XPAL 3F62A 3FOLA 1OQOA 1OTTD 1FNFA 2Q8AL 4JAMB 5DZOA 5LCVL 2MCPH 4F7EA 4QHMB 5CMAB 4PRAA 3VWJD 2BSTB 4QRTB 3HAEB 1S7WA 3JVGC 4PGEA 5HDLA 3FONB 2O5XH 3TZVC 4MA3A 4G6KH 4QRSB 2AXHA 1AP2B 4GBXC 1VFUA 5E1AA 1DBBL 1TQCB 3TJHC 1UA6H 1CDCA 3QIUA 2DQTL 4K55A 1H3XA 2C1OA 3BN3B 1OL0A 2R69L 4OAWB 1P53A 5DA4A 4K8RH 3DMMB 4I18A 4PJHE 5FO7A 2VR4A 3O2VL 5D96B 3TPUB 1N2RA 5IR1B 5F9WC 5KVGH 1MREL 2IH1A 3CLFL 3H3PL 3I75B 3UTZB 1YEJH 2OTPA 4TRPH 1HCFX 1N6QH 4BFEA 5DJXA 3GNMH 1RJYA 4I9WE 1CF8L 3TWCL 2Z0BA 1IAIH 2QR0A 5A2FA 1UVQB 3F7YB 4KY1L 2O61A 5DEGA 3W9EA 2OQJA 1EBAA 2VRAA 3B6SA 3HFML 3RAJL 2XY1A 3LZFL 1LEGA 1S9XA 4UT9L 5IJKA 1I75A 4QXGL 3P73B 4KAQH 4P2RE 3AGVA 4KVCH 2BRRH 3LHPH 2DQEL 3C2SA 5F93C 1GZPA 3NIGE 4Q6YA 4QRPD 4P57A 4WW1B 4RWYL 5D1XB 1HE7A 1JGVL 2JIXB 3H7BB 1UM4L 2VC2L 2B2XL 3VU2A 4ZFZA 3VXSB 3DPBA 1MHHB 4I0PA 3MGTA 4IOIB 3KJ6H 4UTAL 1FAKT 3RA7H 5C92A 1F5WA 3NGBC 3UC0L 4K9EL 4Z0BL 2XRAH 2Q8BH 1DLHA 1FC1A 5F8RC 4KGLA 3LS4L 4MCYB 2NX5D 3D2UD 4OLXL 3WHE1 3V6OE 4NZRL 5CEZL 4YPGA 3BDXA 1KIPA 3PE9A 2QQKH 5C0CA 3PWJB 4CDHA 4OV5B 4NWUL 3BXNB 4K2UL 2VDPH 4M62H 1I9JL 1F6AB 1FC2D 1M05A 1MFCL 1OARH 2JCCF 3N1PC 2F8OA 5DD5L 1A7BA 4KUZL 3ZTJH 3QCUL 4OZHA 2C5DC 3WYRA 4WV1C 1U92A 2FJHA 2ARWA 4NOFA 2CDGB 3PQYA 4Q2ZA 2B7DT 2OR7A 1N5YH 2HJKB 1MHPH 4JANB 4M6ML 2QV2A 3O45B 3FQTA 2UWEA 1X6LA 1A1NB 4ZUWB 1RD6A 3CNKA 1Q0YL 2LTQB 4P9HH 3X12A 3THML 3MZGB 4PJEF 4CN1A 4RDQG 3OR6B 3FMGH 1MCDA 3SDXA 3BPNB 2HVKB 3P30H 3SKNA 5J11C 4RRPA 1RFDL 3PDGA 5IGXH 5F1NA 4PR5A 2MPAL 3QUXC 1UG9A 5DMGC 2ENSA 5HHPB 3DVGB 3FQUB 4FNLH 4NQVA 4QCIB 3K2MC 1WUNT 3KXFD 1DL7H 1M7DB 2HFGL 4Y5YC 1NGWB 1P1ZA 4JEGB 4JM4H 2ATPA 5HVWA 3ROLB 3O2WH 1A2YA 4MS8D 4J3XA 4RNRA 1ES0A 5F9OH 3C60C 5INDA 2P44B 5EC1A 1NC2D 4NN5C 4JFXB 4F3FB 4G6AC 3VFWB 4JJHA 1O0VA 2JB5H 1LDPH 4GKZB 4FQXC 5T5FL 4AEIH 1KPVA 1YQVL 1NJ9B 2YRZA 5B4MC 2Z8SA 4OZIE 1A6PA 4KKNA 4Y8AA 3B5HA 2NY3C 1IGTA 5CJ5A 1CK0L 3LN9A 3VXQB 2YEZB 1WAAE 4QRRD 5D7KE 4QY8A 2MMXA 5C0IB 4PLKC 3F7VB 1NCNA 5ILTL 4HXBH 2RCSL 4NQEB 4P2QD 3VD5A 3MLVL 2DWEA 2XOTA 5HGDB 1LP9F 3W11C 4XRCB 2V9RA 4XWOD 1BOGA 4U1NB 3OKEA 1NLBL 1A14L 1C08A 4ZO9A 4BH8B 4J4PD 3O41B 3R8QA 4X9GA 4XWGL 3MRPA 3NCJL 3E2HB 3OR7A 3PABA 5IF0B 4EN3D 1A4KA 4Z7UF 4HAGA 1KCSL 5IVNA 1NEZA 4GKNA 5DS8A 4NRYB 4EXKA 1HKLL 5EA0L 1T1WB 1U58A 1OGAE 5LWYL 4LIQL 3JV4B 3GJFH 4K8RD 4ODVH 3VXRE 3WIHL 4X4YB 4LLAA 5M95B 3V52L 2MCG1 3E3QE 4WTZG 3MFGB 4NQEE 1R5VB 2IG2L 3VJ6B 3DUSB 1HI6A 1J5OH 3MCLH 2ZOKB 1I3GH 1EAJA 4LPXA 1FLRL 4N1CA 3VFNB 3ARBB 3BKJH 1JN6B 2QTEA 3LPGA 4UOJA 2F58H 4Z7WB 2UZIH 1SMOA 5DJZB 4POYA 3UCRA 2ZKHH 3RWEB 4WO4B 3BP6A 4NWTH 2K1MA 3ZTJG 4PJCA 1JHLH 4NZTH 5E8EB 4XVJL 1OAUL 5EWIL 4IEFB 4X6EB 3NCEB 4E41D 2FNBA 3VGBA 4ZPVB 4MJ2A 4HS3B 5TQ2L 2ADFH 5C3TA 1D5BA 4I3RL 1LHZA 5C0AD 2ORBL 3L5XH 3KNBB 1IT9L 3MRHB 3FQWB 2DBLL 1GGBH 1YA5A 2HN7A 5D7SH 4CGTA 2QKIB 4GH7B 3L3OB 1HSBB 3BPOB 2D7QA 4UT7L 4ZXBA 1EVUA 3W0WB 1L6XA 4XVTH 1W8NA 5E2WL 3VGAB 4ETQB 3D39A 3LQAH 4HMEA 3HMXA 5JXED 3ZYZA 3OPZL 4OI8A 4HS8L 2XNAA 2PTVA 5HDBF 2J6EH 4HKJB 2ZCKH 3LIZL 2V2XB 5BS0B 4HUMB 1J1PL 3RWHA 4UTBL 2IANB 3ARDA 1A7QL 3TNNB 3QEQA 1CGTA 3IKCA 5EO9B 1KPUB 1MRFH 5CIPB 3VGEA 1DQTA 4N0UB 4MB5A 5DMIH 1R3HB 1FQ9C 5HBBA 4TSBH 3N1FC 1K5NA 2CKBL 3D25A 1WZMA 4L8SC 5I16B 1ZHKB 4IHOA 4L4TD 5E00A 3W0WE 1P69B 1MCPL 1TZIA 1N8ZA 2VTFA 3ALXA 4K7FA 4PJAE 4FMKA 2X70B 5ISZD 4OT1L 1PAMA 5D7JB 3G5VA 3T0AA 3ARYA 5LJYH 3MRLA 2FECI 5GGQH 3V4UH 1FZJB 2CKNA 4DKEL 1Z0NA 4NC0B 4KI5D 1YY9C 2DQUL 3HI5L 2C9AA 5ESQB 4OCSH 1L7IH 3BDYL 4AT6A 1INEH 1V3LA 4L3CB 2IANE 1KCRL 1U8LB 5EORH 5DUBB 2MWCA 4Q9QH 1BBJA 2CLVB 3DXAB 1MHEA 2B5IB 1D5ZB 4LNRB 3KPSA 4N0UE 2A6JB 2LVCA 1H5BC 1VPOL 4LCUB 3VFRB 4I4WA 3ZKQD 3PWPE 4KI1A 4HWEL 5L9DL 4EUPH 3QG6B 4GKOA 4JHBA 1AJ7L 4R96A 3QIBD 5T3XE 2GCYA 5C9JA 1KG0A 3P0GB 3BW9A 1MPAH 4OUOA 2F19L 2Y5TA 4FP8L 3MACH 2UZYB 4M61A 3QJFA 1SYSA 4XP4L 5CSZA 1HH6B 3OKNA 3ECBB 5CEZE 3RKDD 1NCUA 3U9PH 1OAQH 4RFOH 1A21A 4JHWH 1G7MA 4U4BA 4Z9KB 3DETD 4TUKH 5CLWA 4M7KL 1NGPH 5D4QA 1PZ5A 3IGAA 4OLZL 3FO2B 2JTDA 2AEWA 1D9KA 3QXDB 4KUCF 3DSFH 3CGTA 1IZJA 1G7QA 4PRDA 2OP4H 2HTKC 1ZVSA 1QLRB 3GJFK 3FB7B 4PJFB 4ZAKD 5JMOC 3HE7C 4KJPD 1S7SB 4JFQB 1E27A 4JG0H 4O9HL 4HPOL 3L9RA 1LO4H 2R2BB 2VXTL 5TQ0H 1G1CA 1UZ8B 5DJ6B 3B83A 2DI8A 5GHWH 5D9SB 5E8DH 2PTUA 4DEPB 2QSCH 3FO1B 5D8JH 2V2WA 4QYOB 1WCBA 1Z6JT 1NMAL 2DLEA 5KSBA 5ICYA 4OIBA 1K2DB 4XMLH 2AEPH 1NAML 5DMKB 1KTLA 1RURH 5TGBB 1CLYL 1PEWA 5B8CA 3CU7A 3K3QA 4XBGA 1EJOL 2HTLC 5I75C 4ZOCA 2ICES 3T0ED 2E6QA 3CCHA 2WBJC 4MA7L 4QOKB 5T1LB 1FG2B 3QUZD 4O51A 1XF5B 3KVQA 3VRJA 4HZAA 2UV3A 5BQ7A 5JIIA 3DRTB 1MLBB 2NY4D 3ARGC 1FZOB 1AE6H 1GGIL 2W60B 4N0CC 1K8IB 1AXSA 4IIQA 3LKNA 1U95A 1KJVA 2F5BL 2VJXA 1AD0B 3T2NL 3W5MA 2VDOL 5IIEB 1WBYA 4KK5C 2AJZA 4JO4H 4M48H 5DSCA 1YDPA 3HPJA 2XWJB 3Q1SL 4NP4L 4O5LL 4JY4B 1OM3H 3JWNC 2Q87A 3RDTC 3IJYB 3OF6D 3C6LC 2HMID 4CN4A 4H25A 4PTTB 3CFBA 1I8IB 1ZWIB 3JV6A 4Y4KC 5CWSB 2AJUH 3RWCA 3GSXA 4OD2A 3CZFB 4WHDA 4IRJD 2J8UA 1EEZA 3WN5B 1QKZL 2CRIA 1TDQA 1DLFH 4U1IA 2XZZA 5K9KA 1F4HA 3WNNA 3UTTB 4X8JA 3RZWA 4G9FA 4JDTH 5D72L 2X2YA 3WXWH 3NABL 4FMFA 4U1JA 3U9UB 5DQJA 1OD7A 5TPWH 4LF3A 2BK8A 5FKPA 4JRXD 5F9DC 1Y6MR 3WIIH 5GSVA 4LCWB 3QUYA 4R0LC 4AL8L 5D1ZB 1H15A 3BH8A 4ETYA 3RY5A 5IT2L 3I6GB 4EUPG 4KK9D 2OTWA 1JUFB 2IGFL 4YZFE 1FNSH 3M1BB 4TUOB 4N0FA 2BNRB 2P8LB 3FFDB 5LXGH 3DX9B 2CXKA 3K0WA 2BP3A 3FL7A 2EDDA 4NC1C 2XN9A 3DVNB 3PWUA 4K94C 4OZ4B 4D9LL 1DN0B 3UTSD 2XZCL 5HVFB 5C1MB 2P8MB 1HH9A 5D5MF 2GK2A 2OI9C 2DQCH 4ONHA 4PJXB 4WHYH 4WIQA 4QF1B 2VQTA 3S98A 1D6VH 1YYMH 4XNZB 3HRZA 1BZ7A 1XGPA 2HT4C 2NXZB 3GHBH 5J1AA 5LGHL 1Q72L 1GOFA 5J3HD 1FPTL 3BUYA 4LCWE 1JCKA 5EU3A 5I1DA 4G43A 5DQ9A 2PXYA 4L3EB 4GG8B 1ITBB 3GSUB 3WFHB 1QO3B 2HKHH 1KPRB 4OM0L 5MENE 3MBXH 5D1QA 3RTQB 4HX1B 5I66B 1JTOA 1KFAH 3KYMA 2BNRE 1QZ1A 1JWUA 3U30B 1ONQA 1TJIL 4OIIH 5E7BA 4PLJC 1S5IL 4NN7B 3DYOA 2FDBP 4HFWA 2R39A 1AGEA 4OB5L 2GK0B 4L1DA 3S5LA 1BD2A 2CKBB 3BOVA 5M7QA 4HK0B 2W9EL 3BKYL 4JFYA 1WBZB 4Y16C 5FO9A 4PJXE 1CLOH 5JQHC 1DBKH 5GISL 2AXJA 3HHRB 1LE5A 4OZFA 5JUEL 1XGRA 3DV4A 1HIML 1GZQB 1GC1C 1T1ZA 3QZWA 5SWZA 4WHTB 1CR9H 3MJ8B 5F21B 3AREA 2YOCA 3IB4A 2DQFB 3IU3A 4KPHL 1G9EA 3BVNA 5JDSA 4KRPC 4PJ8C 1PVHA 3L3IB 4BSJA 3BISA 2J3SA 43CAA 3GI9H 1RQ5A 3N9GL 3BGMA 1MSPA 1N64L 4F9LC 5TE6H 1KCUL 4JFHD 4WW2A 2CMRL 1DBAH 4M4RA 4W68A 1NUGA 3ZYIA 3MV9E 3OMZA 4NRXA 2J88L 1UZ6E 1RZ7H 3CXHJ 4JY6A 1J1OH 4U3CA 4AIXA 4F9PC 5CP3A 3ZSSA 2IBGA 5BJTB 4M7JH 4KKCD 3CLEL 3A0OA 1IEAB 1YMMB 5A43C 1HQ4B 1A6TA 2B1HH 5C6TL 2AJSH 3FQXA 1A1MA 2GJ6B 5EU6E 2AQ1A 1BWMA 3HPLB 2JB6B 2AJ3A 4C57C 5DK0B 3VXUA 1PSKH 1YUHA 1B0GB 5K59F 4P49A 1ZEAL 5JHDB 4KZDH 4U33A 3MRRB 4X5XA 4QHUA 3VH8G 4ONGL 3ZTNL 3PIQB 3M07A 1CDJA 4S1QH 1WFTA 1X5HA 4I2XB 5C8JB 4HIHB 1K8DB 1XEDA 3SDAC 2DM4A 4DN3H 2DI7A 1BIIB 2IC2A 4GKSA 4HH9A 2PO6D 1QSEB 2X4RB 3EYSH 1FHGA 1YMME 3I2CL 4IJ3C 3KPRA 1DVFA 5EOQH 3TCLB 2CLZA 3LMJL 4UIKL 3QO1A 5F70A 1WF5A 5FK9A 1NGYB 2F54B 1I1AB 1UQSB 1XIWC 3O6FB 2D4FA 4JN1H 3IU4L 1LP9E 3REVA 4AM0B 4L5FH 4Z5RA 3W2DL 3B9KD 4G8GB 4PRBA 2OLDA 1YEHH 3N06B 1N26A 2MCPL 4WHYG 2C1PA 2YUWA 5DFTA 2IQ9H 3TBVA 4GUPA 2D31B 4Z7VF 4OZGA 3VXME 4UQ3A 4G6KL 2AJYL 3VDCA 4QTHB 4CMMA 5LBSH 4ZG1A 2J2ZA 3T08A 1UA6L 5AYUH 1XZ0B 4QHKJ 3L7FB 5DYOB 5I8CA 4QHKI 2I5YL 1FRGH 3BRFA 4K8RL 5F7KC 3MNZB 4GRLA 4L9LB 2F54E 4JM2C 1CGYA 1JV5A 1BJMA 5EU4B 4U1HB 4QWWC 3WLBB 4F37F 1ZSDA 3QEQD 3UBXG 3RHWK 1YEJL 1BQUA 3ROOB 1PG7W 1FE8H 3SCMD 3AXLB 4X80H 2IBZX 1T80A 1IAIL 1I7RA 2QQQA 2E7LC 1LNUA 1QFWI 3VWJB 1P2CA 1P7QA 1K4DB 1V7NH 3BRDA 2AK1H 1FFRA 3J7HA 3RBSA 3KPMA 7CGTA 4ZOBA 1FNLA 4RMQA 4KVCL 3CH8A 2BRRL 3LHPL 4P48A 1U3HA 2J8HA 3QEUA 5DFVC 3ZT5A 4JKLA 2ADJA 1OF2B 4KJYB 3EOTH 2VLJE 1KSRA 1BX2B 4RMRA 2GUOB 4MA8H 2Q7NA 2D7PA 1OPGH 4OF0A 3BD3A 4JO3H 4I3GA 1JWSB 5LAXB 3KPOB 3TA3A 3C5SB 5ID1A 3RUGB 3KJ6L 1QBAA 1TNNA 5DGRA 4XAKE 2WIIB 2HT2C 5J06A 3RZCC 1BF2A 1TVHB 4BSVA 2XRAL 1CDIA 2IFFH 2MKWA 3QUKA 3B8YA 4M8QB 1MRDH 5CUSH 5D71H 3CMGA 5HDBE 4BUHA 3H9SA 2ITDB 5DD0H 2IAMB 1T0MA 3DX8B 2XFXB 1T3FA 4KK6C 5IB3A 3PG2A 4H1LA 1CVSC 4JQXA 5IMMA 2VDPL 4M62L 5IWLA 5JORA 1OARL 4DGVL 2OX5A 1HYRC 5DI8A 4WFFD 3A6BL 2AV7B 1UCTA 4QRPB 1YPZA 4R97C 1EFQA 4XH2A 1N5YL 3MRGA 5EULV 4ZS6C 2WWMC 4MAUL 1BFSA 1CD1A 4L8DB 4E9LA 1DSFH 4HK3J 4G6JH 3MREB 3NN8A 4M1DH 3I02A 4OZHF 3FMGL 5E8NB 2FEDD 3IRZA 5F71A 1VERA 5D2LA 1QLEL 2BVPA 1W0VA 5IW6B 2NX5B 3D2UB 3IXTA 5IBTH 1FZKA 2GTWB 2B0SH 1QOKA 1AGFA 3MRDB 5IGXL 3F58H 2EXYC 1VSCA 5FYKU 2UWEF 3ARTA 4L4VD 2GT9A 3VFPA 2GY5A 1EA9C 1JHKH 3O6LH 3GUTA 4Z7OF 3SDXF 4KJWC 1C16A 5DJDA 4Z0XB 5DZNA 5FKAA 4OSUH 1NGZB 1DL7L 1MJJB 3MRJA 4OUUB 4YX2H 4JM4L 1TJGH 5TDPA 5ANMB 1EGJH 3SKMA 1KJMA 3IFOB 3O2WL 5ERWB 1R5WA 1NBQA 2ZZUT 3I50H 4BZ2H 1V3MA 1E4XI 2VZ1A 3G5ZB 1TXKA 5F9OL 5MP6H 4N8VG 1L0QA 1U8MA 3BKMH 4NM8H 3ZT7A 1YEEH 4UV7H 4LRNH 2JB5L 2H6PA 2NX5E 4N68A 4BSWA 4N1HB 4XCNB 4AEIL 1DJSA 5MEPB 2VIRB 1OT1A 1B4JH 3ZE0F 1G9MH 3ZT6A 4ODWA 4HXBL 4HWBA 1NCTA 4G7YL 4WI8A 2JJVA 3SPVA 1YC7A 3P40A 3EO9H 5DO2D 4JN2A 1QFOA 1DDHB 3KDMA 3RWGB 5EFIB 3M45A 1WIPA 1BBDH 3UP1A 3VE0A 3DX7A 1UB6B 3KXFB 1Q9KB 3NPSB 3RNQB 4F8TA 3L95B 5L2JB 1FYTD 3V4VH 3WS6A 2DMBA 4N5EC 5LGJB 1FIGH 1NC2B 1IGYA 3BKCH 1T2XA 5I1LB 4LARH 5KN5A 1BZ9B 3REWB 1CDGA 4ODVL 2VL5B 4WWKA 3LKSA 2E6JA 3E6FB 4MA1C 4YEFA 5EBMB 1YEKL 4QRRB 3FQNA 1M71A 4HUWB 1J0KA 3O4LA 1J5OL 1BM3L 4UNTA 3MCLL 4AQ1B 1KNOB 4P2QB 3DBXA 4MD5B 4MHHI 2XKUA 4ODUA 5FV2A 3EYVB 3HG1A 1HEZB 3BKJL 1Y18A 1ZGLA 3FFCB 5A2KH 3P9LA 3ULVL 2UZIL 1S7TA 2ZKHL 3X14A 2N56A 1MEXH 4LQ1A 5HHVH 2XN9D 1BWWA 3MRNB 4BFGA 4NZTL 1JRHH 4JZOB 4EN3B 3T3ME 4P23D 4M9OA 4FFWD 3S88L 4Y5VA 3L3JB 1N3NB 1X5ZA 1MELA 3W9DA 4MD4B 4LLMA 4U6TA 4O2EB 1HSAA 2ADFL 3OB8A 4NQUA 2O5YH 5GRVK 3WO3B 5IJVA 1DEEA 3MLYH 2V2TB 1I1YA 2HG5A 4ZTOH 4PJCF 4LSPL 4FS0A 3T77B 1GGBL 1WLHA 4P2QE 4Z7NF 4IOFC 2AABH 1S7RB 5E8OB 1QR1A 4JZJB 5DWUL 4MJ6A 4XVTL 2R8SH 3WL9B 3C5ZD 2ZJSH 5EZOH 5T1MB 4KXZH 3V6FB 4F7MA 2G5BA 4OCXH 3BYTA 4GAGL 5I1AB 1TJHH 3IDYB 1BD2D 1SYVB 2J6EL 2WLYA 1Z9SA 3G08A 2ZCKL 5F3HA 3VCLA 1X5GA 1T20B 4X9BA 1VKXA 5E8PB 1NMBH 1RI8A 4NQDA 2ZG1A 4E41B 3UYPA 1HHHA 2ESVD 4PD4K 3B5TA 4JDVB 4HIEA 4ZTPH 3N0PB 2VDQH 5I71B 3DJ9A 1MRFL 4V1DA 4YC2C 3ARED 1X5AA 4NKOB 5DMIL 3IFLL 1Q1JH 2EDBA 3ARPA 5T3ZE 2WUCL 1FBIL 1VEMA 4TSBL 5T33H 4YK4B 5F88A 4Y4HA 5ACMA 2LAGB 2EE3A 1LEKB 5D5ME 2BCKA 1IKNC 3T1FA 3WUWA 2EDWA 2A83A 2E9WA 5IM7B 4HUUB 5C71A 1GAFH 3L3DB 5GGQL 3V4UL 1NKOA 1BVKA 2ICWA 5KVFH 4Y4FA 5F9JB 2WQRA 3MTRA 4OCSL 1ZLWH 4RAUB 1L7IL 1ZT1B 3SY0B 1INEL 1GPOH 4S2SA 2YXMA 1UC6A 5EORL 3BQUA 4U1KA 2YXFA 2OM5A 5F3BA 4RZCB 5HGHB 2XTLA 2F53D 4EZMA 2IPTH 2FH8A 3U2SB 5FV1L 2CLRB 4ZFFA 5KSAA 5C0AE 3HNVH 3Q6FB 1ZTXH 3GMPA 2HT4D 1I7TB 1RJLA 4NT6A 5BW7C 5INCB 4AEEA 1J8HA 2RHEA 4URTB 1EEYA 5E2UH 3WJJC 3QH3B 4Q0XH 5DXWA 4PJ9C 4OTXH 3TC9A 4NO0D 1RUPL 2BSSA 4L4TB 1UJ3A 1K6QL 3HI6H 1MPAL 1EZVX 2FLRT 4WJ5A 1A3QA 1U2HA 4KTYA 5HVGB 3MACL 3FQRA 5ISZB 5FGCB 3O3AA 2Z4QA 2VZ3A 3DLQR 3V5DA 3MX0A 1AGDB 3U9PL 4HXAH 1OAQL 4RFOL 3I3BA 4HKZA 4JHWL 3GMMB 5IEKA 1U91A 1ADQL 1FAIH 3EJYC 1OQXA 4LRIC 1NGPL 3MRBB 5E2VH 1X5FA 4ZO6A 3G04A 1UADC 1CXHA 5FHBH 3DSFL 5GGRA 3QDJB 1IJ9A 2CR6A 4HIXH 2DTSA 5J6G