1A6VH

B1-8 fv fragment complexed with a (4-hydroxy-3-nitrophenyl) acetate compound
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
118
structure length
118
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARYDYYGSSYFDYWGQGTTVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structures of Fv Fragment and its (4-Hydroxy-3-Nitrophenyl)Acetate Complex of Murine B1-8 Antibody
rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords B1-8 FV (LIGHT CHAIN)
total genus 20
structure length 118
sequence length 118
chains with identical sequence I, J
ec nomenclature
pdb deposition date 1998-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a6vH00
3BQUD 3F65A 3EJZD 2XZZA 3CFBB 3TN0C 3I6LD 5ABDE 1NCWL 2Z9TA 3IU3A 4JO3H 1J12A 2AAVA 2D7TL 4ZPTA 1NDGB 3GMPA 2H26A 2YD4A 3O45B 3QA3B 4JREB 4JZJC 5DFVC 1IC7H 3SDCC 3WO4B 3TESA 3LIZH 1YNKH 5DMGD 3BEVB 1OT2A 2BHZA 3VU2A 3X13A 1T04B 5FO7B 2X70B 4RRPG 5FA4B 2BVEA 1S7TA 1JGLH 3WN5B 3UBXB 2VRAA 1J8HA 2NTSP 4OLXL 4NNYB 2FIKA 3MBXH 5KOMC 3QFJD 4X7EC 4JDTL 1XF4B 1RULH 2IAMA 3RL1B 4GKSB 1M05B 3S98A 3CLFL 3ZMRA 5GJSH 1S78C 1WCQA 2KBGA 2DWEB 1MWAA 5JA8B 2B5IC 3EYSL 1QEWB 1IM9A 1A0QL 3WD5H 4WW2F 2XQYK 3D3VE 1KJ2B 3DRQA 4OZGB 5EU7E 2YWYA 4JJ5B 4JHWH 2BMKB 1HSBB 4JN2A 3MV11 1R3HA 4JKWA 3TT3L 3TBYB 2O93L 1A7BA 4PBWD 3GIZL 1C5DA 4XHQA 4GSDL 1A7RH 2X2YA 3HRPA 3RVVC 1CBVL 2XTLA 4D94A 4APQB 4UNTA 1DQJB 4D9RE 1N5AB 4IJ3C 1JL8A 2GSIA 3SGDH 3RP1A 3BZEA 4YAQB 4UBDD 3UO1L 4NRZB 3K2UL 3NCBB 5LCVH 1X5HA 5HVGB 4WU7B 2GYSA 1RIHH 2K1MA 3TIEA 3BH9B 4R26H 1T03H 2A9NL 5CZVH 1PDKA 3NAAH 4HC1H 1N6QH 1JFQL 3ZKNC 1ZOXA 4OZIB 4GFTB 1EEZA 3D69B 2DDQL 3S7GA 3E8UH 4PTTA 4I4WA 5IESH 2CJUL 5DRWB 3DMMB 5ICXB 2ADJB 4ZOCA 3TYFA 3UTTD 2P5EA 4HT1H 2WQ8A 3RVWD 3QIUB 3T2NL 3U7WL 2HT4C 3SDAC 5BZWB 1CLYL 1U3ZA 4WENB 3DPBA 4WU5B 4HWUA 3RTQC 4Z0XB 2DLHA 3FO2A 4ZNCD 1QSVA 2NX5A 9CGTA 3PE9A 4ZMAT 4F15C 4UIKL 4X80H 3VD7A 1G7MA 5EO1B 2V9TA 5HDQL 4RMVA 5ACMA 3RDTB 3HR5B 5TFSH 3EDDA 1QBAA 4YR6B 5BV7C 5J1SC 2IALB 2NLJA 3AROA 2Q87A 4F9PC 4NCC1 5AZ2H 4PJDE 2FIKB 4P5KA 3VFVA 4IRSA 2J88L 4RMQA 1RZFH 3BYYA 3SHSA 5IJKA 4K3DH 5JOPD 5E8DH 1GVIA 5I1DB 2R0LL 1AXTH 3PNWA 1L9NA 5CEZD 1G7PB 2ICWB 4NQVB 1M7IA 1IQDB 1FIGH 4N0UB 1XGUB 3CZJA 4JFEA 3QIBA 5F6IC 4LSUL 5DVMA 5FKPB 3DURA 3MLZL 1F4WH 4S0TD 4ONGL 5EU5A 1LMKA 2AXHA 4FP8H 2VZ1A 4K7FA 2DQJL 5E6IB 5JZ7D 5IVZA 1FV1B 1U36A 1HHGA 3FCTA 4MMXC 5L2JA 2HRPL 3WYRA 2EEAA 3H9HA 2KDGA 3MV8D 4HIXL 4MWFA 2CKNA 3TA3A 4X5XA 1EUTA 3EJZC 4NHCL 1K3IA 2X9XA 3I84A 5J89A 4MQ7A 5C0AB 1YC8A 1AXTL 5GPRA 1Y18B 1ORSB 3ISWA 1ZTXH 3NCYP 3IDJA 4K2UH 2WIIA 3QEQD 2DQHH 1IILE 3MV9A 4NFDA 2J6EL 4F3FA 1XCQB 2DM3A 3KLDA 1NMCC 5DS8B 3VDAA 5I1JL 1KEGL 4YHOL 5FA3A 1CR9L 4MAYA 4BM7A 3MQIA 1RAMA 4XZUB 1W72H 2NW3A 5IEKA 1QPXA 3W9EB 2Q7NA 3VFNB 4XZUA 3MRJB 5I19L 3MJ7B 4QTHB 2XXMB 2XZAH 1Q9WB 4ERSH 3S37H 2PNDA 1T5WB 5C07D 3FO1B 5CGYC 2VDLH 2HWZH 3Q3GB 5I1CL 5I15L 2WIMA 1WWCA 4E5XB 3GSVB 1F58H 1FC2D 1LO2H 3EJJX 5FGBC 3I9GH 1XGRB 1PQZB 2J5LB 3V0WH 1ZWIB 2WW8A 5E2UL 3ULVL 5JUEH 3G9AB 4M6NH 4OLZH 3QUZD 5JPMB 4OSUL 1JWMA 4PRPA 4MWFB 3QFJB 3QT2A 1PG7L 1KTDB 1F6AB 3TA3C 3LPWA 4LKXA 1S7XB 1OB1B 2XPGA 1UM6L 3GKZA 4JO2H 5D5MB 4OZIE 4JRXB 1S5HB 1F5WA 2J5LC 4U6XA 1DBAH 1JV5A 3W9DB 1FYTB 3MRDB 3CD4A 4N68A 3EUUA 1OTTC 5BO1L 5DEZA 3VXSD 4JR9H 1S9VA 1AGFB 2H32H 1UWXH 4XB7A 3RZCB 1DVFB 4PJ5D 4K9EH 1LQSR 1CZ8H 1FBIL 2EC9U 4YNYB 1YYLL 5GRVL 3RHWF 3BWUC 3LRSB 4IOFD 1KT2B 3ZE1E 1P4IL 4WFGD 4HPOL 5CJOH 5I18L 1A7RL 2YPLA 3PWJB 2XRAL 5TPWL 1CFVL 3RY4A 5H2BA 3X17A 1EHLL 5HSFA 4GQ9L 1JBJA 4IOSD 4DUWA 3TT3H 4K8RH 3AS3A 4P2QB 1E0OB 5EBWB 2P5EE 2L4OA 5EOCJ 4LKXB 5E2VH 5TDOA 3AREB 1RZ7L 4XC1H 4Z7OF 1E4XI 2R2HA 3TNMA 1KB5H 3HB3C 5CEZL 4AL8H 3L1OL 1ZWIA 4R7NB 5EZLB 4DFHA 3UXFA 4GG6B 1I1FA 1YYLH 2Q86A 5F9JB 3REWA 2ZG3A 3PUCA 1F4HA 3JV6B 4LSTL 3VCLB 2JJUA 4JLRA 3ZYZA 4YHNA 1L9MA 5DC4B 5FYKE 4TULL 5CKAA 2ESVB 4TVPH 5A2LH 2X10A 2R0WH 2M2DA 3QXDA 2QKIA 3OGOE 4Q2ZB 1KPUA 4XCNB 3HUJF 4MQSB 3EHBD 2QKIB 1JGVH 4D9LH 2GJ6D 4HKZB 2XWJA 5JIKA 4M9OA 4Y4HB 4M62H 1EH9A 1A64A 2EIBA 2BOCA 1QSED 5ID0B 2GK0A 2Q7YA 2GAZB 1MIEH 3D85B 2JJSA 2QL1A 4M43L 4F58H 1X7QA 3MUJA 1ZA3B 1N3NB 4DEPC 4PRAB 3TIDB 3FN3A 2A38A 5FGRA 1WBZA 2E8ZA 4HJJH 3T0VA 3FFDA 5J9PA 2ZUQC 3F12A 3D87B 4IEFB 3MLPA 1YUHB 2JIXD 4Z7VA 1TQCB 4KRLB 5L2KA 3GIVB 4PP1C 3TPUB 4TUKL 4M7ZB 2R8SL 1MFNA 4Z76B 1RD6A 5BZDA 1CL7L 1MIMH 3UTTA 1A6TA 1IAIH 2GFBA 2JCCE 1HDMA 4B0MM 4LDLB 1JJUA 4PTUA 5GJTH 4M7KH 4S1DD 2P5WB 1U8NB 4P59H 4BZYA 3U48A 1M7IB 4KK6D 4LP5A 1EJOH 4M02A 4ZTPL 3RL2B 1PKOA 3S96A 3T2NH 4GRLC 2ZOKB 4QYOA 5C0CB 3D18B 3BPLB 5F72S 1Q38A 1TETL 2CKBA 5E03A 2O5XL 2R39A 5B8CA 4R4BB 1KLUB 2XKNB 3QUYA 4GAYA 4OUUB 3V8OA 1L6ZA 1JFQH 4WHCA 3VXUD 5HYFA 4Y2DB 3M8OL 5J11C 1EGJL 4Z0BL 4TNVK 2AK4B 3MUGA 3QFJA 2J3SA 3NCJH 2ZP0T 4YHYB 4HGWB 4ZYKB 4NN7B 4LCUA 4MA1B 4OFYA 5B21A 3MRNB 2X4SB 4FTVD 5EUOE 1CD9B 5E8PA 1FO0A 1QLEL 3VXME 2WM0A 5JOPE 2FB4L 3NACH 5FYJD 2DQGL 4TN9A 3S4SA 2XIDA 4JVPA 5C9KA 4E5XA 3FB8B 3B43A 3HE6B 3OPZH 3SBWC 4HJJL 3T65B 3V5KB 2YRLA 4R97C 3HFMH 2PTVA 3FB7B 1MFDH 3TWCH 2JELH 2WBJD 4LLMB 2OP4H 4MNGA 5L0QB 1F11B 5ALCH 2DQUL 4I3GA 4PJGA 4GS7C 5HDQH 2P42B 2VLJA 3T4YA 4D0BA 2R2CA 4F3FB 1Q0YH 1KCUH 3LKRA 4G8GB 4MVBC 4F7CB 1OAZL 2IPUK 2GUOA 5DQ9B 3L7FA 3N9GH 4M62L 1MUJA 5JOFA 5TQ0H 5CGMA 4DJMA 2W9DH 3QUXD 2YPKB 1QR4A 1QBML 2NY7H 4ETQA 2G9HB 3RZWA 1UKQA 2PR4L 3MXVL 3VXSB 4PJEA 4MHHG 5ERWA 4P48A 3K4AA 5SWZB 1UKSA 4P5TC 5FGSA 4XBEL 3D39B 2LAAA 2V7HB 5I75B 5DUBA 2XY1A 3B9KC 2ARJB 3G6AB 1MJ7H 2PUQT 2C3HA 3SDDA 1QEWA 4M1CC 3UO1H 4E0RA 3P9LA 3OB0K 2XRAH 2DKMA 5IB2A 4NRXA 1M05A 1FJ1B 2P5ED 1VB9A 4PGBA 1Q0XH 2DIBA 5CJOL 4FQ1L 3VXMA 3ARQA 4DN3L 3ZTNH 5CEXB 3KPOA 2DJ4A 4FFZH 2IG2H 2VDOL 1DDHB 4UV7H 4M7JH 4XNUL 3H3PL 2R69H 1NMAL 2CIIB 1BAFL 5CP7A 2PTTA 1MJUH 2D0GA 4YJZL 3WHXA 3WIIH 1KIRA 4NM4H 1ROWA 1GJIA 4BFEA 2DDQH 3DETD 3RDTA 3QQ9C 3S3PA 2ED7A 4TNVF 3WEXB 2NY5L 3IDUA 2NX5B 4GBXC 4HZAA 3WLWC 1KG0A 5F3BB 3D85A 5E2UH 3ULVH 4NWTL 2ADJA 1UC6A 3HUJA 4XVTL 4YE4L 1KJ2H 2JCCB 3MJ7A 4QTHA 4DN4H 5GGTL 5CJBA 3W0WA 5F9DC 2J8UE 4U6HB 2AKRA 1JNLH 5IB3A 4TQEH 5CZKA 3WJJA 3EO1A 2O61A 3D3VD 2XZAL 4XNZC 1KCSL 5K59F 3ZKMD 4DKAA 3QHZL 3A6BL 4XNYH 4HLZH 3HI5L 3DUSB 2AABH 3ROLA 4IMLB 4HFWB 4G8FA 4OZFG 4CN6A 4KDTC 3QI9C 1AH1A 3WEXA 4DAGH 2R2HB 1YEGL 1FO0B 3TNMB 1FZJA 1GIGH 3E2HB 4NZRL 4OFKA 4M3KB 4GLRH 1JMXA 3CJJA 1UEYA 1KIRB 1RZ8A 4B5EA 4H20L 4KROC 1CF8H 1RHHA 2BOBA 5T3XD 3C6LC 1G7QA 1M7XA 4CMHC 3AM8C 3O3UN 4Q9RL 5ESAA 5EC1B 1MHEB 1Q94A 4DOHE 3PHQB 3QCTL 1FNSL 1UM5H 5EU5B 2GTZB 3G6JF 4K3EH 4KJPC 5BXFB 1MF2L 3ZKSD 5JO5B 4YXKL 3OGCB 3PDGA 4C54A 1OCWH 4JRYB 5E5MA 1IM9B 3DROB 3VG0L 5FUZH 3HAEB 4HS8H 1X3DA 3EYUL 4AMKL 3DMMD 2VZTA 4MD4A 3PGDB 5C0DB 2XPGB 4G6KH 1NGYA 5DSCA 1MCEA 2R0ZH 1MCPH 1QO3A 2WK2A 4X6FA 4ODUA 2FJHA 3V95A 4Y0GA 4KTDH 4JQIH 1A02N 5JHDE 2X05A 4OCMC 1S7TB 1D5IL 4IS6B 4NNPH 5KSBF 5ISZB 4XRCB 4YDKH 5INDA 3EYOA 2R0KH 4CADB 5B3JF 3VJ6A 1NAKH 4LHUD 4MD0B 4EVNA 4LPYA 4GKZA 5C07B 4YDIH 1YEIL 3MNZB 3C8DA 5KVDL 3VXUA 3D25B 3M1BB 2GTWB 4ALAL 2NY2C 2H45A 5CHNA 3TT1H 4Y5VA 3CFJA 2P5WD 5C0NC 2HJFA 4M1CD 4JHZA 1IGIL 4TPRL 5J3HC 2W59A 4XP4H 4XPGL 4Q0XH 1YPZF 3MRIA 3EYQD 5BS0B 1F45A 1U8PB 1HQRA 3S9DB 4RSVA 1FL3A 1RIVH 4JPIA 5I8KL 5F7HA 4J1UB 1HHHA 1S7WB 5DVOA 5D6CB 3MV9B 3KPSD 4Q9CA 1NFDB 3MLSL 5I1HL 3RQ3A 3EHBC 2OJZH 4YC2C 1JYVA 1NGZA 3QQNA 5DMYA 2DL9A 2VLKD 5GJTL 2FEEL 4DW2H 4FA8A 5DGQA 3SDCD 5BVPH 4XH2B 3ARFA 2ZPKH 5A3IC 2BVOB 4R9HA 1AFVL 4ZS7L 4BUGA 5BRZA 3OKKA 1KENH 2PO6B 5D1XD 2OL3B 4P57A 1Q9KA 2AQ3A 3VFUA 4Q0XL 4NJAL 1MCDA 4TUKH 1QG3A 1F2XK 3QDAA 1BZ7A 3TBTB 2YEZA 2R2BB 2OSLA 2YD9A 4YHIA 4NN5B 3C2AH 4F7MA 5ITBH 1YY8B 5D7JC 5KSVA 1U95A 2XFXB 3AXLB 4LIQE 2NXYC 3FQNA 4HV8B 4AQOA 1MRCH 1T6WA 5EZOL 3WFBL 4I18C 2ZCKH 2B0SH 5JQ6L 1GGTA 2APXA 4X9IA 5IB5A 3PWVA 1LEGB 4MCZB 1V8HA 3FQUA 5JHDB 3VFOA 4W68A 2UUDH 1R24B 2Z8RA 5IOPB 5C0GA 4IOFC 4XVJL 5C0BB 2FEEI 3IFLH 1SVCP 5B3NA 4V1DA 1FLRH 3LEVH 2BC4B 2EDEA 1ZGLB 4HH9B 1JK8B 1NC4A 4P2RA 4A6YB 2ZUSA 3KR3L 2XWBB 3L5HA 3MBXL 3HR5A 3C9NB 3BRDA 3O2VH 5DMKA 1XCTA 2FSEB 3U83A 3RGVC 3NPSB 2MHAA 3SOBL 3O6FA 1VFBB 2CGRL 3ARFC 4OCYL 3GUTB 2CK0H 3UJJL 3C8KB 3HR6A 3GMQB 5D2NE 3AB0B 5BV7H 2W65B 4FQXA 4EDXB 3ULUC 2QR0B 2VUYA 3NIDE 2X4RB 2B1AH 4I8DA 2BDNL 3NPSC 1SM3L 4F2MA 4J3TA 4KJWC 2P8MB 1CXHA 5F7DB 3U1SH 3BKYH 1I1YB 4I13B 3P30H 2VDMH 1IC1A 4NNPL 3HFML 5EO9B 1ETZB 3ROOB 5FYJE 2UVEA 2OZ4A 3S34H 4ODHL 2QSCH 3MCLL 1HI6B 1GIGL 1I75A 1HXYA 2X7LB 3MV7B 4HMDA 4DWHA 1TVHB 4KMTH 4EKXA 5FYLH 1T22A 1ZLVH 4U1GC 3EO1B 3WKML 5DZNA 2ZSWB 3JWDL 2F5BH 1IT9H 4QKXB 4Y4KD 3C60B 3OZ9L 3BP5A 1LDPH 4XCEB 4Y16A 5BVJB 1W0WA 4XB8A 1R3LA 1A1MB 4LPUA 4W4NA 4CVXA 4N1HB 3O6FC 1JGEA 1U92B 4MAUL 4HAGA 3F8UB 4WNQA 4M5YH 4XCFH 4YXKH 3PABB 3EO9H 5CJXC 4LLWA 1TCRB 3IU4L 4GKZB 2F74A 1XIWB 4OGAC 3O2DL 1CXLA 4H5SA 4MD5A 3VRJB 4UMGA 3U2SA 1D9KC 2WP3T 2H8PA 3ORJA 4JFXB 5HDLA 1Q1JH 5DUPH 2C4FU 1UZ6F 1OD9A 4HCRL 3CPLB 1WCBA 3KGRA 2NY6D 1AP2A 1ZE3C 4EUPH 3MOBL 1J8HB 1MFCL 1W2KT 3DYMA 3K1KC 5AYUH 2DQEL 2FBJL 3TZVD 5KANG 4NNXB 1J0YA 1FSKB 1EMTL 5DJ6B 1C12A 5HI4D 5DVNA 2C9AA 4M61A 4UQ3B 5SX5K 1C16A 4NNXA 3NZHH 3O9WA 4ZAKA 3BRFA 3T0EC 3CVHL 3DHJA 2NYYD 4HXAL 3LSOA 4R8WH 2Y7QB 3DX7B 1OF2A 1X5AA 3S34L 5HHOD 1S7UA 3TLRA 1A4JA 4WCYH 3T1WA 1VA9A 2B8OT 4U1IB 1Q94B 5DYOA 4CVXB 1JNHB 1HH9A 3QPXH 3I75B 3BD5A 4M7LH 3Q3GA 5JPNA 5HVHB 1QQDA 4LEOA 2IGFH 3PF2A 1OARH 2AQ2A 2FH6A 3NIGF 3VXSE 2V5YA 5KVGL 1LGVA 5J1AA 4LCCA 4MCYB 2DQDL 4PJFF 2E9WA 4MX7A 3MACL 5DK3A 4NM8H 3VWJD 3WIFA 5GZOD 2CO6B 4ZOBA 2NW2A 4QRUB 4M93B 3QH3B 3IXTB 1MY5A 4O2EB 5FM5O 1J86A 3G5YA 2OK0L 3WIHL 5C9JA 5IB4B 3JVGC 1LNUA 3QH3A 1KTLA 5FXCH 3D39D 5BS0A 1SJHB 4PJXA 3FOLA 5TH2B 4UU9B 5IWLC 1AHWA 2VYRE 1XGYH 4YBQC 3H3BC 4APQA 3QG7H 4QHKI 5CINH 4IRSC 4JY6A 3IFOA 5DJAB 5ADOH 4XXDA 5EPMB 2D7TH 1DJSA 5HGAB 4PRIE 4NHUA 3DYPA 2HLFC 4D0DA 4GRWH 1U8IB 3RU8L 5IW1B 3ARBB 4QRPE 5J12C 1LEKA 2HT3C 1UWGL 2CDEB 5DMKB 1I3UA 4X6CF 1KYOK 3UROR 1EAPB 3MGTB 2ZOLB 4U6TA 3CIQA 1WJ3A 5IQ9B 1FBIH 4LL9A 3SO3C 1R6VA 2V7NA 5EC2B 4FFYH 4WUUD 3MV8E 2KZ1B 1T7YA 3QIUC 1QRKA 4LARL 3GSNA 3IETA 2P7TB 2J1KA 4MD4B 1ULVA 5DJDB 4RFNB 3LN4A 3FL7A 5SV4A 4YPGB 1Z9MA 5BXFA 1FZMA 2JB6B 5IWLA 3K8KA 4Y8DC 1V7NH 3HPLA 4G8IB 4QHKJ 4L3AA 4XGZA 4AIOA 4DGIL 4F37F 3U0PA 4W6WB 4QY8B 2FLBT 5F9OH 1MJUL 1MHHB 3H0TB 1QOKA 2X4NB 3GI9L 1FL5A 25C8H 4X6EB 2VB5A 3MZGB 1EEQA 1SJEA 4HIJA 2HWZL 5C0JA 1ES0A 2CRZA 4NRYB 3IYLW 4NQDE 5D7JB 3VXOA 1JI1A 5FO8B 2VXTH 3BRGC 4D9RD 12E8L 2YUVA 3VRLF 4KQ4L 4LSQH 4GUPA 4YDIL 4LASL 1UM4H 1DTUA 1AHWB 5I0DA 2ZKHH 5ILTL 1YECL 5D2LF 1KENL 4IMLA 4KHXH 1WV7T 3BHBA 4HS6A 4U6VH 5F1IB 3MRMA 1BFOB 5B4MD 3E3QE 4AEHL 5IK3A 3QO0A 5HPMA 3LEXB 5GRXG 3MUY1 5IHUH 4PY8J 1FFQA 2IPUG 4AIXA 3SCMC 4NHCH 2NCMA 2CIKB 4JFPB 4AH2A 3JUYA 1CFNB 3V52H 2FATL 3CFJB 3KJ6L 4UILL 5IBTL 4B50A 4MQTB 4LVNC 4OLYH 4PRHD 2CLZA 3CCHA 4OLWL 1C8PA 1CQYA 1FHGA 1FVCA 1QPPA 1T1ZA 3GMNB 5C09B 1VFAA 4MAUH 2EKSB 3LD8C 4UIMB 2QR0A 4WW1B 3O8XD 2VL5A 1I7ZA 2C4XA 1N2RA 2W0FB 3H7LA 1UM5L 2EDFA 1W72A 3DRQB 4JDZA 3SOBH 2Y5TA 4HGKC 5JW4M 2P8LA 4PRPE 1A6UL 1CL7H 3EFFB 4KJYA 1YQVH 5JXED 3JWDH 1S7UB 4LK4A 4NSKB 4EBQH 4KK5C 1H5BB 1IAOB 3OHXA 3VH8B 5KSUB 4PJFE 1IGFH 1YEJL 5BCAA 4PYHA 4P5TB 5DSCB 4HKJB 2NTFA 3C5JB 4HUVA 1JZ5A 4YBLB 4M61B 2X1WL 1J9CT 4RX4A 4HWZA 1MJJB 3D9AH 2F8OA 4RFOL 3CGTA 1G7HA 4LSPL 2R4RL 1TZHB 5ILTH 1JPSH 2ZUWA 1L0XA 3OKOB 5B22A 1R0AH 4L4VD 3O3AA 3V4UH 1X5YA 2ICEB 2NMSA 4I3RL 4L4TD 1KN2L 2QHRL 5D7SL 4AIZB 5ITBL 4L4TA 1JF1A 4F80A 2CDGB 4UZGA 3BPNB 3MV9E 3Q48A 1U8HB 4TNWK 1KELH 1XIWA 3QFDA 5A2IH 2EH8H 4PBXA 4L8DB 1KXQE 4O5LH 2NTFB 5DJYA 4YHKH 3QDJE 3F7RA 4OIIL 1GGBH 3BP7B 1FVDB 4PJBE 4X4ZA 4XMLL 5J9PB 2JK5B 2LAGB 3O0RH 3BEWB 4ENED 2IPKB 1JI2A 1NCCL 1YJDC 3LEVL 1UCBL 5E0QA 4QHUA 4QHLB 5CEZH 1T22B 4H8WH 4MJ4A 1RVFL 1ZV5A 3N1GC 3KLHC 4OZFH 5JMOC 2X4OA 2YK1H 5EFIA 2DD8H 5SWQA 2J8UA 3BPOB 3TO2A 3BP6A 4ZO9A 4EI5B 3L3HB 2Z91A 4J8RB 1HEZA 5DHYB 1C1EH 3W9EA 2YBRB 4HBQA 5HHME 2EO1A 3IF1A 3MO1B 5D6DC 2FX7H 3MLUH 2ARWA 3BKJL 5K33A 3I3DA 1ZLWH 4QCIA 5JMRA 2J8HA 4MAYC 3CZFB 2GY7B 1OLZA 2ZG2A 4M8QA 2FJFB 4JHAH 5DLML 2PXYA 3CK0L 2MKWA 2AK1H 4DGYH 2HN7B 2ADIB 3KPQA 3O2WH 3EYOB 5LBSL 3DRTA 3VMNA 1DSFL 5HVFB 5SWSA 1D9KA 1UM6H 4JO2L 4AM0B 5DGRA 7CGTA 3SBWA 4Z7OE 4QXWA 1FV1A 4KI1A 1NBYA 4OSUH 4KZEH 3F7VB 2WBJA 1OPGL 1AQKL 4IOIB 4JM2D 2YWZA 3QUYB 4GAYB 4IDJL 4M4RA 3HG1B 3IJSB 3TNNB 2V2TA 1EZVX 3V0WL 3TN0A 1KULA 2HFTA 4KKLC 2NZ9D 2FJGA 4DK3A 3V7AE 3UP1A 4XMPL 2Z35A 1U58B 1Z9LA 2IG2L 1WGOA 4JQVA 1YZZA 2GITA 3TCXA 2BNQA 2VDLL 3W0WD 1U8KB 4LVHC 5E8EB 3PNWB 3VMOA 1F3JB 3W39B 1KCVL 1FNSH 1KIPA 4E0RB 2BP3A 3KHOA 3OAZH 4NGHH 1TZIB 3Q6GH 5EZIH 1SBSH 2CKBL 2NYYC 3UAJD 1A1OA 2FL5A 3ALWA 3MROB 1A6TB 4OFVA 2IH3A 4J12A 3D9AL 3HPJB 4Z7NE 1JWMB 1IKFH 1ZT1B 2HJLB 1JGUH 5CEYB 4HXAH 2J2ZA 3GIVA 1KPRB 3BT2H 2ADIA 1UH4A 1DE4A 5IFAH 3DO3A 3KLSA 4NYLA 1MHCB 2GJJA 3U4BH 4PD4J 3X3FH 4KZDH 3IXAA 3NZHL 4ELMF 2AABL 1FYTE 1KJMA 2ICCA 2P4AB 1HZHL 3MRRB 4X6DF 5EIVA 1YQ2A 3L3JA 1ORQA 5C0CD 1ZA3A 1A6UH 2DKSA 4FNLL 1QBMH 3I3EA 5I16B 1HINL 2BSTA 2CUHA 2AV7B 3MACH 3B2UC 4U3XA 1F11A 3GKWL 4MDIA 4KI5C 1I8IB 4URTB 3VFRA 1IGML 2R23A 1MJ8L 4ZUTB 2M26A 3B8SA 4XX1E 4TTGA 1I8IA 5GGUA 3MRBB 3U7YH 3RKDC 3UTSB 1F4YL 1NJ9B 5F88B 4ZSOB 1OGAE 4HKZA 5CP3H 3LKPA 5I9QB 1JYXA 2Q20A 2B7DT 3KR3H 5B38G 2AJYL 3L3HA 2IADB 3UTSD 3UTPE 1JYNA 3KPRE 4ZFZA 3BAEL 4S2SB 1B2WH 1AXIB 4Q9QH 2W0KA 1RUQH 1RJYB 3VFWB 4PRNA 2WNGA 4KMLB 2BZDA 3RVXD 5TE7H 2YPVL 4OCSL 3F7YA 3NZ8A 1KBGL 1MCQA 3MRRA 4P2CG 4M5ZL 5FKAB 3UTZB 4TVPD 3HC3L 4MCYA 4G5ZL 4NO3B 4I9WD 3NACL 2FB4H 3HKFA 5JIIA 5B3JE 5I71B 3QNZA 1BGXH 3RWFA 3FQXB 4X4ME 3PJSA 2VE6A 3GSXB 4L4VB 4X98B 4F7EA 1QHOA 3V6BR 4MJ5A 3SDAB 4WO4C 1HSBA 4JN2B 1T66C 4PJ9B 1FFRA 4Q6IC 3V6OC 4NJAH 4YXLL 3O3AB 4I0PC 4LGSB 4IIQC 5L7XH 1ADQL 4NFCA 4NWUL 3UC0L 5KVEL 4F15B 4DFIA 5AAWA 4K8RD 2FJGB 3HE7A 4BZ1L 2OM5A 5GXBB 5IF0B 1IM3A 2GJ6B 4PY7B 4LSVL 3FOMA 2G60L 5C6PB 4DZ8B 3QR2A 4Q58C 5EC2A 1EA9C 1D6VH 4KK9D 3DNKA 4GRMB 4RAUA 1GC1H 1S9WA 2A74A 5DFTA 2AERT 5D7IA 2BY0A 1G6VK 4HPYL 3O81A 4NQXA 2YPLD 5D7IE 4LSUH 5EBLA 5EU7C 4I0PA 4OD2B 3NH7L 3CPLA 3MBEA 1IEBA 2NY5C 3O11A 4HQQL 3STLA 1X7QB 5J06A 5EU6D 5F7NC 4NKDA 5GS2H 5F89A 2QSVA 3BUTA 4MXQC 3RNQA 1GYAA 3AB0C 1YNKL 1U8LB 1QFHA 2D9CA 3P77A 4I77H 5EN2A 2J4WH 2OTWA 2W9EL 3JUZA 2Q76A 2P5EB 4LU5L 4S2SA 2DMBA 2WLZA 1N26A 3L5XH 1MEXH 4OCWL 1CLOH 1FNFA 3CU7A 2AJUH 5D4QA 3VFPA 3D69A 1XT5A 3IJYB 1BZ9A 4FQPA 5BVJA 5DJZA 4WI7A 1BZ9B 1LO4L 2O5YL 1CFNA 1TTGA 3RUGF 1M71A 5JXAL 1RFDH 3BP6B 2F54D 3U7AA 2XN9B 3B6SA 4OTXH 2AJXH 1KG0B 1UKTA 3BISA 4NQDB 3QDJB 4FQXC 5FYJH 3MJ9H 1BM3L 3P0VL 3IDMB 4HF5L 4MQ7B 5C0AA 6FABL 4L9DA 5F89B 3QIWB 3KPSE 3DTXB 3QFJE 3V6OE 3LPFA 1T0NB 3MNWA 5EUOB 2B39A 3EIFA 1O0VA 3K80A 3NTCL 4Q74A 4F7PB 5F21B 1VGEL 2A9MH 2F8XC 3M8OH 4NIKB 5E70A 1WWBX 1XGTA 4YWGL 1OARL 2X1PA 3AREC 2FX9H 5AWNL 3OKNA 4K94H 3I6GB 4K7PY 3SE4A 5KVMC 4Y5XB 1T1WB 1SY6A 1SVZA 5FKPA 1Q9LB 4UILH 3INUH 2P44B 4NWUH 3UC0H 5MI0C 5FM4A 4ELME 2VDQL 4PGBB 5ALCL 1FL5B 1O7SA 3TJHD 2XKSA 4JFFE 5FGBA 2JELL 2VAAB 4N8CH 3LRSA 5CZXC 4YGAB 4FQCH 3T3ME 4NCDA 4ZO8A 1DBBH 5CSZA 1HXMA 3O3BB 5DQJB 2QHLA 1FYTA 2AEWA 1GZQB 1J1XL 4JCMA 3TBVB 5ICYA 3F6LA 4RGNB 1EIBA 1ZHBB 3WO3B 3MODH 4JO4H 1MPAH 5CMAB 4WVRA 4XAWH 4WTZG 3D2UA 1TNNA 3WUWB 4XNYL 4EOWH 4HBCH 4PRPB 5LWYH 2DMCA 4WJ5A 1I1RA 4U3HA 2BNUB 5ERWB 2DQEH 2FBJH 3BXNA 3MGTA 4X7FC 4KKBD 5T3XL 4Z7VB 2Y6SD 3L6FA 3LKNA 1RJLA 1IAOA 3OHXB 3MPCA 1XGRA 4BFIA 3HG1E 3WFCL 2E7BA 2YA1A 1J7VR 4YZFE 1BD2E 3IFPA 1JZ2A 4K3GA 2HMIC 2I9TA 1K2DB 4CN1A 1HIML 3TVMC 3DIFA 4NUGL 2ZNWA 1QLFA 4Q9BA 4DN4L 5HHXH 2H9GB 3HC4H 2ZUQB 1BZ7B 4I2XA 3EOBA 2DLTA 4MNQB 2GK0B 4OQTL 3LKOA 3PWNB 2P24A 5MERB 1CG9B 3VFNA 4Q97A 3MTRA 5J4MA 3SDYL 1HYSC 3OKEB 4KKCC 1FFOA 3TYGL 3MLYH 1NUNB 5ITFA 5IR1B 4WI9A 3MJ8B 4GMSL 3BKMH 1KJ3H 1F8TL 3VE0A 2J8UF 2Z91B 2HLAB 2AV7A 3ZE0F 3QG6A 4QHNA 6FABH 3P9MA 3QRGL 5LAXB 1ND0B 1F00I 1WC7A 5D8JL 1R0AL 1B0RA 3WLBB 1A9BB 4JG1L 4BQBA 1QR1A 4D8PB 4ZFOB 3OAZK 1FVEA 4HMCA 4K9EC 1LE9B 4N8VG 2A73B 3OKMB 4PJDB 5D7JD 2C3GA 5FHBL 6CGTA 3O6MH 4YUEH 3V79C 4H88H 4JFYB 1FLTX 2NY2B 3FCTB 4MZ3A 3W11D 1MFEH 4OD2A 4YHZL 4QXUH 3SGJA 1AY1L 4HIJB 4OZGF 3VG9C 4KDVA 2BFVH 1A6ZB 1FAKT 3M1BA 3CC5A 4GKNA 1F2QA 5C7XH 3BIKB 3QG7L 4L4TB 3EYUH 4AMKH 5K9JH 1PKQB 1P4IH 1CQKA 4NZUH 3PP3H 2DQFB 1CI5A 4C4KO 1OWWA 3G6JE 3HA0A 4NC1C 4OCYH 5D7LE 5J57B 4L8CB 3RWCB 4GKSA 1AO7D 1MI5A 1O5DT 3VA2C 4MA3A 5D9SB 1U58A 2DWEA 4UQ3A 5EG6C 2AJSH 1G7LA 3RZCA 2OJEB 3LQMA 2YR3A 4DCQB 3QEQA 5FIEA 4HWEL 5DC9B 5EDXA 2YSSA 2WQRA 1MJJA 2OMBA 4XPTL 4M4PA 5F7UA 2AW2A 4MB5A 1RZKC 5I1LA 5D5MA 2NX5E 4J3XA 3UYOD 3OF6A 4OZFB 2EO9A 3AUVA 2DAVA 3K7UA 2NY1B 2Z31C 4AM0A 5GGQH 5KVFL 2HFGH 2H8PB 5IW1A 1TFHA 5C8JB 2HJKA 3V7MA 4WFFD 1X5IA 2QQLH 1WISA 1JZ7A 1A7NL 4ZPTB 5IKCB 4PRAA 4PGCB 4XC3L 3TIDA 3H3PH 4GW5B 4ZD3H 4X80L 1W72B 4L4TE 3AFLA 1BMGA 4WW2A 5K9KB 2MCPH 3SDAD 4FQ1H 4YQXH 1I8LA 2HVJB 1IFHL 3RPIB 4MJ2A 3CMOL 2EDRA 43CAA 4RGOH 2NY4B 2OR9L 1QLEH 2CIKA 4JFPA 3QRFM 2QTEA 2VXVL 4JFYA 3C5ZB 1RIUH 1HEZB 5DHYA 3ARUA 3ZKND 3BGMA 1INQB 3PHSA 4G7VL 4S10A 3GJEB 5IW6B 2Z0BA 2QQKH 2X4OB 1YY9D 1VGEH 2A9ML 2NW2B 2YRPA 2XWTB 2Y36H 4LCYA 4U1KB 1VFUA 4HFUH 2VZOA 2XTJD 1OAYH 3V4PL 1X5JA 5J1AB 3PWNA 4M7KL 5IIEB 3P11H 2ED8A 3GKWH 1MH5B 4LDEB 5IT2L 2PCPA 3RVUD 3B9KD 3VFTB 3GBNL 1JNHA 3NA9H 3FQRB 4ELMB 2VISA 3IDXL 1DQML 3LQAC 4AENB 5E5RB 1U3JA 5L6YH 3QDMA 5C08A 1KEGH 2F53A 1FAIH 3GMLA 2OQJA 5KANI 4ODHH 3B9AA 2HG5B 5EOQH 1C7SA 2D7QA 4OCSH 3X12B 1OD7A 2ATPA 4UNUA 1GCFA 1BP3B 4H1LA 4FABL 2MQCA 4RGNE 4JQIL 1GAFL 2K3TA 3DWTA 3FKUS 1S5HA 1YEJH 4V1DB 1RQ5A 1AGEA 4JRXE 4F33A 5F7EL 5CD5C 3HI6H 3T0XA 1IC4L 1DLFL 1IRAY 3L3GA 4IHOB 4MVBD 1ITBB 1LK3H 1HQ4A 1IAIM 4JPWH 3X13B 3D48R 1T80A 3DX6B 4R2GD 3TYGH 3FQRA 1INDH 4Z5RA 4Y1AD 3U4EB 2NY6C 4K23H 3MBEC 4OLUL 3NFNB 3MLTB 4QOKA 5J6GB 5F6HJ 1S9YA 1MF2H 3FB6A 2FHFA 2V7HA 2R2EB 3D6GA 3F6IA 3P4NB 4L5FH 5IIEA 3KNBB 1CICA 4BH7B 2OL3A 2P5WE 3BGFB 4LSSL 5LGKA 2D0FA 4NFBA 3LY6A 2FATH 5ICXA 4HW6A 2H6PA 2PF6A 3RWEA 4KKCD 4CMHB 4LPWA 3LQAL 1Z9OA 5DVKA 5ANME 4AL8L 3QUMH 4GAJL 2G9HA 4HMEA 1OP9A 4FQQA 4KI5E 2AGJH 3S36H 5KTEL 1AGBA 1E4KA 4WHTA 4Y5YB 2MJWA 1KB5B 3KPLB 4Y5VC 4M48H 1WIOA 1AGBB 1NAMH 2Y1VA 5TFSL 2QEJA 4JG1H 3SY0B 5TGBA 2Z93A 3UBXG 4OCRH 2JJVA 4NQEE 3ABZA 4RMUA 4ZXBB 3QDGD 2V2XB 4XWGH 1CFQB 5DRXA 2CRMA 1DQJA 1MRDH 3QULA 4OGXL 3N50A 4LLAA 4FXKB 2HVJA 3RPIA 3NGBC 4XNMA 2EE6A 2E9BA 5CWSA 4CAGA 1HHKB 2Y5EA 4JAMA 3VXUB 2W91A 2V9QA 1I7UA 2D03H 5EN2B 3MJGX 1UENA 5FUCC 1HOCA 5FO9B 3GSRA 1RUPL 1TETH 4DTGL 5ESVA 3KXFB 1FZOB 4X6CE 2PYFB 1ZLSH 4UAOB 5HGDA 5J13C 1JE6A 2HJKB 2JKXA 4POYA 1BBDL 1ODAA 3O4OC 4NQXB 4HEME 2UYLA 2XY2A 4F57L 1R3KB 3MUGB 2VLRA 1G7HB 1CDGA 2YSSB 3WIIL 2M1KA 5D1XB 5DF0A 4Y2DA 5CS7A 3VFOB 1LO2L 3QBTB 5BOPA 5I73C 1C12B 4O2CB 2OQJB 4ELKA 1QFUL 4WFFE 3NCEB 3QEUB 1V05A 2ATPB 3OL2A 1U93A 1KFAH 1G7LB 2X70A 4JE4B 1WITA 5DMIL 3QQ4B 2NY3C 2EDNA 2YA2A 3RWDA 1MI5E 3T4AA 5ACZB 2C7UB 4CDGC 4JKPL 1FFNB 2DIJA 3CVIH 3LDBB 2EDOA 1JUFA 1A6PA 4UIMA 3RY5A 2UV3A 1MCJA 1UWEL 2AJVL 5ID1A 5IHZA 1AGCA 2YD8A 4HXBH 1C5BH 4L9LA 3PIQA 3W82A 4NJ9H 1YUHA 4DKFL 3TZVC 1I7TA 4XPAL 2BVQA 4ZFFB 1DQQB 3AY4C 4YK4C 1PX3A 3QO0B 1FO0H 3U30C 5HPMB 5ANMB 3ZDZE 4R2GB 1FE8L 4N0FA 3G5YB 2ZJSH 2HLAA 1YPZE 5ID0A 5ANMA 1IC5H 2CPCA 4G7YL 3SKOA 3S88H 4AEIL 3EZ8A 2VDPL 3ZL4L 2HKFH 3SJVB 4HIHB 1T0MB 1DBJL 4I5BB 3R06A 4GUPB 4LLMA 2PW1A 4LCCB 2RBLA 4L3CB 5IHZB 4NBZB 2AJUL 2PKDA 4X6BB 1EHLH 1QLFB 4KKNA 1M6OB 3QCUH 5DJCB 3DV4B 4EVNB 3MV7D 1MWAB 4XAKD 4I18B 2Q8AL 1BIIB 5DJ2B 4NCC2 5GRUH 2DTSA 3GJFK 5I1KL 1Q72H 5AG8A 2VXQH 4DVRH 2O5ZH 2WANA 5D2NB 4P9HH 5IOPA 2EH7L 1XF4A 4PJ8A 2SEBB 5KSAB 2E5EA 4HUXA 1YJDL 3GJFH 2KKQA 4TQEL 4BELD 4JFDE 4OCNC 3QUML 2YPLB 3LQAH 1A3RH 3L3KB 3V5DA 1OAXL 5DD3L 1T20B 1OSZA 1XZ0B 2DWDA 5FECB 4IDLA 2IANB 5IMLB 2YD6A 3UTPD 1EAPA 3VXTB 3IU4H 4MQXD 4PJ9A 4OKDA 5JO5A 4PJAB 4RFEA 2XTJB 3MR9B 1EHXA 3OG4B 4MNQE 5E95B 1JIBA 2R2BA 3ARVA 2WBJB 4N5EC 3MRQA 4KJQD 5FAAA 1F90H 5I74B 2XA8L 1X5FA 4OKVB 3V4UL 4ZFOL 1I8LC 2X4QB 4NUJA 4U1SB 4JPKL 4NKIH 4AJ0A 1QSFD 3DVIA 4RGND 1I85C 4ISVA 5J6HB 2Y06L 4LHUG 4R96B 3BH8A 4HFWA 4R4FL 2HT2D 1UA6H 4CBPA 2J12B 2DF3A 1IKNC 5HGBB 5C0EA 3B9VA 3N1QC 3ARTA 2BJMH 3S3SA 2V5MA 2LVEA 1EXUB 4JB9L 1BECA 1TVBA 2FWOA 3LS5L 4P4RB 5I8EA 4PREB 1FL3B 3BIAX 4KXZH 1I1YA 5B38B 4QHMB 3V6FA 5HDBE 2JE8A 3CFIC 4LU5H 4PV9B 5MHSE 4PIRF 1CVSC 5I1GL 3SE3C 4E42B 5C92A 4MNGB 1K8DA 5EU4A 2EE9A 1HKLH 3NN8A 2QLVB 3EOYG 5E9DA 3B3IB 4K71C 3HHRB 4FQXB 3L5WB 2B20A 3UJIL 1S9XB 1A21A 4LSTH 5IBTH 4YBQD 1T1YA 1U3HD 2OS7A 5M95B 4PG2C 4YX2H 3I50H 1I8MB 4L8BB 2UVFA 1BJMA 3C9NA 1WIPA 2CLVA 1CF8L 3RI5K 4NZUL 1EO8L 1IARB 5DK0A 4NC1E 5EU3B 5IMMA 1JGDA 2CDFA 3CSGA 2BC4A 3QNYB 1IM3B 4TSAL 5HI3D 2J7LA 4DGYL 1S7VA 1W0VA 4JKKA 1EUUA 3HI1A 5IJVB 2LTQC 1AY1H 4KY1L 4WUKL 3PWVB 5F44A 4N0UA 4DVBA 5IMLA 1HYSD 3BZDA 3V2AR 4M93C 2HLFD 2NNAA 1RJCA 4EN3D 3FZUC 1TVDA 4YHPA 1TZHA 3JTTA 4Y4HD 4ZD3L 2BNQE 2XT1B 5HYJA 4JFOB 1J5OH 5HHMD 4JZOB 2IWGA 2PYEB 3MRLB 3QIWD 3SKMB 3MX0A 1DR9A 4RISL 4MJID 4QOKE 4MSWA 4YR6A 3E8UL 3GSXA 1V7NL 2K7QA 2HFFB 4OCLC 5KSUA 3QIBC 1JPTL 3FFCD 1SEBA 3BZ4A 3CDYA 2VN7A 4UT9H 5GJSL 4YZFF 4OFDA 5J13B 3CX2A 4U1LB 1IZKA 3EYFA 5EZJB 4NDMA 3ROLB 5HHVH 2Y5TB 4MHHI 1JVKA 5SWZD 5E2WH 3TV3H 1XF2B 1NEUA 4DTGH 3C09C 4LLUA 2VO5A 3CFDB 1HXYB 2X7LA 2F19L 4O5LL 4JFDD 4ZFOA 3LKRB 4HK3J 5EBMB 1RZIB 4J4PC 1DZBA 1VGKB 2EIDA 2OL3H 3RVTD 5IUSA 1IAMA 1DLHB 1TQBC 3J7HA 5FCSH 3RUGB 1IGIH 1NDMA 4LSDA 3QPQC 3VD9A 4FFZL 1A3QA 2WUBL 3P4MA 4L4JA 2BRRH 1P4BH 1IJ9A 1HNGA 3EO0A 1C1EL 3B2VH 4KTEL 2V17L 1A7PL 5FB8B 5EOCL 4M8VA 3QDGE 4N0UE 2MPAH 1F13A 2WBWB 2BVYA 3GMQA 5EA0L 3UTOA 4YHNB 3BH8B 1MFCH 1KPRA 2AK4D 3IVKA 4ZUVA 4HWBL 2BVPA 1S8DB 5ISZA 2APVA 3MMEA 5FOBB 5D2LA 1I9IH 1MCPL 1P84J 5E6YA 3U1SL 3TBWA 5J7CC 4XBEH 4U6YA 5TDOB 3O0RL 1C7TA 5HJ3A 2CLRB 2WP3O 1CL7I 5IW3A 3TFKD 1JK8A 1EO7A 4X6FB 2HRPH 4PY7A 4ZTOL 5H2BB 2XKNA 4HIXH 5AUMB 3VG0H 1JZ8A 1ZHBA 1EDQA 5EBWA 3JTSB 1JF1B 2FR4A 2BHYA 2PYEA 3MRLA 3RDTC 1JZ6A 4UTAH 4UUJB 1QFPA 1UEMA 3TVMD 5INCA 3KPNA 5BV7B 4S1SH 1FNHA 1F4WL 1XH3A 4MMZC 3WHE1 2OBGA 5F1KC 4X9FA 1CXKA 1IC4H 2C3WA 3PWLB 4OTXL 1F6FB 3FQXA 3OKYA 1DVFA 4F8TA 2X9YA 3UPRB 5KZCD 2OSLB 2VC2H 1RK1B 1OB1A 1JGUL 2X9WA 4L3EE 5EOQL 4RA3A 2AEPH 5E00A 1BBJB 2GKIA 4I18A 1JGDB 1NBYB 3F62A 2XN9E 4LSRH 5HGDB 5A2JH 1A7PH 4DAGL 3LD8B 2F54B 4XNXH 3LZFL 2EYSA 3N1FC 3IKKA 3QUZB 1LP9E 3HI5H 2P45B 5BZWA 1P7QD 4MXVE 2FHCA 4GAGL 1F3RB 3S37X 3SE9L 4DKEL 4QCIB 3LKQA 5ENWB 1XIWD 3CUPA 4WFHE 3OJDA 3CFBA 3S97C 1T4KB 1KGCD 3RBSA 4HT1L 3HCVA 1SBBA 1F3DH 4FFVC 4ZS7H 1YMMA 4MNQD 4OM0L 1HE7A 1MCRA 2F58H 3PL6D 2V2XA 2HJFB 1J1OL 1CTOA 4P5TD 1EHAA 4BSVA 3RGHA 5IEKB 1U3HC 2QBWA 4J6RL 5K59E 3CLEH 3GSOB 4JANA 4PREA 1BLNA 1H3PL 5I1HH 1TJHL 3P40A 3QUKB 3MSPA 5HYSA 4OLZL 1I1FB 4H25A 2OR7A 4O02L 1QZ1A 4YH6A 1MNUL 4FZ8L 4KC3B 3EDJA 3T1FB 4LKCA 4JM4L 2R9HC 3GMMA 4LAQH 2X4SA 3GM0A 1MVUB 1J5OL 1QFWI 1GZPA 3G6JA 4O2FB 2FJHB 4BZ2H 1GGCH 2RGSA 5FHAH 3LRGA 4PJBA 5GRYA 4ETYA 5ESQB 1J1PL 1S7RB 4GRMA 4Z8FH 1CYGA 4NZDA 4ZS6C 3DGCR 3L9RA 4ALAH 2GT9A 1MY7A 1P6AB 3LHPH 5GS0H 4M9PA 2VWEE 1VFOA 3MJ9A 3IKCA 1BQHA 1KJ2A 1FDLL 2A6IB 4IRJB 1UZ6E 3OAYK 4PBVC 2YN5A 4PJAA 4RFEB 3MRGB 1KYOJ 5HHMB 3HZMA 1P7QA 2FNBA 2R4SH 4IM8A 1A0QH 1IQDA 3UTTB 4DW2L 1UH2A 4M1GH 4K94L 5EORL 2HKFL 4LOUC 2ARJA 4CDHA 5BOZG 4LDOB 1G7IB 5L88L 2AJYH 5CBEB 3ZYJA 3THML 4JQVC 2QV2A 2ITDA 2LU3A 2AJSL 1RULL 1ADQA 4P46C 3TBWB 2C3VA 1F4YH 3S8WA 2E7CA 3OKDA 1I8MA 3C60C 5MI0B 1HHIA 3D1MC 5AD0A 1LO0H 1ZVSB 2GK2A 3FO9A 4FN0A 3LPGA 5DD1H 4LKCB 1OAQH 3MCKA 3KPRA 2A2QT 2NY6B 1D6EB 2W9DL 5EIQA 3WN5C 3G5ZA 4HJGB 3DYOA 3BO8B 4J3OC 4ZPVB 5T5FH 4I0CC 3IFNL 1BLNB 1T89A 2PXYB 3ET9F 4NOBA 5L7XL 3IFOB 4RBPH 4B7IA 1WFNA 4RMTA 1MQKL 2B5IB 1TENA 2CR6A 4LIQH 3QI9B 1BHGA 4LFHD 1QNZH 2Y23A 3TGXA 4FG6D 3R8QA 2OI9B 4ODSH 4H88L 4KK9C 4OV6F 3KPTA 4LGRB 1UXSA 2Z92B 3WV0A 2ZUUA 4MAYB 5EB9A 3IAQA 3QEGH 2Q3AA 4J3UA 1NC2D 4N0FB 2DQGH 3BH9A 5JLZA 4LLQA 3C6LB 1HH6B 1RU9L 5GS2D 3BEWA 3HC3H 1IEAA 3EJYD 5AYUL 1R3IL 2ERJC 2F53D 4HS6B 5KBNC 3PG2A 3MLWH 3RZCC 2X4QA 3ZKXC 1DBAL 1C5CH 2VKXA 4M6OL 1NCUA 1AJ7L 4JGUA 4WI2A 1T3FB 2PTTB 1TLKA 5D7IB 3S5LB 1VHPA 4FXGB 4EN3A 5C0AE 2OCFD 4JFDB 1AXSB 1CT8B 1AO7E 4N0RA 3TBYA 5DFVD 4L8SC 2AJ3A 1U6AH 5SX4I 1MHHA 4EEEA 3QQ4A 1QACA 1I3RA 3HZMB 4WCYL 2IF7A 4PJIA 3F58L 3BMWA 5KN5B 4NZRH 4PJAE 1I4FB 3RVXC 2P43B 4IRJA 5F6HI 4WO4A 4EIGB 5DRNB 4HUNB 1KN4L 4HBCL 3HB3D 1W72L 1LO5A 2DL2A 3ZE0E 5F96L 2DS4A 2V7NB 2Q8AH 1ZA6A 3BYTA 2I07A 2I60H 2LE9A 2MTPA 4GOSA 3RTQA 2BRRL 4OCXH 1NBZB 1KF9B 2FHBA 4FQCL 3ETBF 4X8JB 4HEPG 3RU8H 5HHNA 2P8LB 1BEYH 5BW7C 4L8BA 4Z18A 4WU5A 1GSMA 1SBSL 1MIEL 2CKBH 3K8MA 3QIUD 5TDNA 3Q5TA 4WFHD 4IMKC 4WEUD 1LP9B 32C2A 3QXWA 3UJTL 3CFEA 2VLJD 2WUCL 3TYFB 3EYSH 4ZFZB 3DXAE 3C6SA 2HKHL 1DVFD 4QT5A 5JW4Q 5J12B 1S9KC 1BQHG 4DZBA 1U8JA 1T7XA 3ILPA 4YX2L 4KI5F 4FXLA 2UWEE 4FMKA 5ADPL 3ULUH 3E1F1 4MNGE 3T2PA 3KS0H 4L3ED 3WNKA 5FYJL 4NBYB 5SWQB 4HF5H 3K4DA 1IBGH 1NSNH 2COQA 4HIEA 1FNLA 3HRZA 3M17B 1V5JA 2H2SC 1B0RB 3GGWB 3WLBA 5HVWA 1J0HA 1WFUA 5TQ0L 3MRMB 1FFPA 4GS7B 3IXAB 4K3HA 4U1SA 1KCRL 1RZ7H 3IDIA 5HYSG 5E56A 1MI5D 5C6TH 3IDYB 3RA7H 2YUWA 3P30L 3G04B 5J6HA 4BQCA 4KRPD 4P2YA 2DRUA 3OXSB 2DTML 3CX5J 4HK0B 3I75A 1ACYH 5CLWA 3O6KH 1FL6A 4HD9A 4YHML 2V17H 5JW4R 1ZT7B 4PJCF 4G43A 3BOVA 4NBXB 4RNRB 4E41D 4ORZC 1FZMB 5GGTA 4N5UA 1OAQL 3OJ2C 4P2OD 1U8MB 3TVMA 3OX8B 3T0AA 1XZ0A 2IQ9L 3VXRD 4ONHB 1YNTB 1F4XL 4YHYC 1L7IH 4IIQB 5DK2B 3VXTA 3RL2A 4X8JA 5LJYH 3DX6A 4NQVA 4LMQI 4X8XA 3HTLX 2BNUA 4O2CA 4XTRD 3TO4B 3WSQL 1BBDH 1INEH 5BZDB 1R5WB 4ZODA 2UZYB 1PG7H 3NVQA 2A0LC 4WO4B 3V8CA 3F7VA 1YDPA 1DN2A 5D70L 5T1KD 5L2KE 4AENA 1UJTA 2IH1B 3MMEB 5FOBA 1HIMH 3PQYA 1EFXB 1H5BA 1CGSH 4HV8A 1WCBB 4N8PA 5CP3A 4Z7UE 1S7QA 3BW9A 1N7MH 4FQIL 4HKBA 2GSGB 3V4VL 1UJ3B 1LEKB 1JPGA 1UB6B 2VISB 5J1TC 5C2BL 3VMPA 1PG7W 3HS0A 1OTUC 1RMFL 4P57B 3B5GA 3CVHH 3LH2H 1DEEB 1MELA 2CD0A 4G43B 3B9EA 5MENB 4EI6B 3P3YA 2EE3A 3VGDA 4PR5A 4LF3A 5C0BD 2OZ4L 2RCSL 1WBYB 1T0MA 4XH2A 5KG9B 2FO1A 1Q9OB 4NO2A 1IZJA 4WY7H 3IDIB 3FQWB 3R06B 1G6RH 3QAZC 4PJDA 3MCLH 4G42A 5DMJB 1KJVA 3TCLA 3DV6A 3NPZB 5T1KA 4JPVL 2XWTA 2EXWD 1HI6A 3RI5F 1H8SA 1KIQB 1GRWA 1KEML 3NCCB 5IQ7L 1U6AL 3MV7A 4DGIH 1IGYA 3W2DH 1YYMH 4ZUSA 5F9JA 3S5LG 2I5YL 4QRPD 2FGZA 3MXVH 4ORGB 4D9LL 4U6HA 1XEDA 2F53E 5CD3A 5C0RL 3GK8H 1ZKAA 3PIQB 1ZHLA 3SDXB 4K3EL 2C7UA 1JP5A 2GSGA 3P77B 5IG7B 5FM5M 4Y5YC 2DYPA 1H15B 2ATKB 5D93C 4GW1B 1IGTA 4M7LT 5FYJU 4PJ5A 4AIZA 1DL7L 1XCTB 2FSEA 5HHNB 2DLFL 3BUYA 1A7OL 3ZT7A 2YD3A 4ODTL 4NO5A 3MV7E 5I1LB 2UWEF 1AGEB 3PQYB 1EFXA 1PBYA 2VIRA 2VN4A 4OQTA 5D1QC 2C3VB 4WGWB 3ZKQD 2VNCA 5DXWA 5DTFA 5CMAA 4H1LB 1FNEA 4P0DA 4P2RB 2AXFB 4X7TB 3DXAB 2OJEA 4K8RL 2OZ4H 2RCSH 4WWID 2JJTA 4G6KL 3WNPA 2VOTA 1NGQH 4NQDD 2EYTA 2UY6A 1BVKB 5CSGA 2I9LB 2YZ1A 2IPTH 1CDJA 2VDPH 3ZL4H 5IVXA 1U95B 2XFXA 3AXLA 2ENSA 4GT7A 1SJXA 4G3YL 2BNRA 1VFMA 3WXVH 2EXWC 5EUKA 3V5HA 1AO7B 4PJ5B 4X7CC 3BIKA 1CT8A 1U8MA 3TVMB 1ONQA 2HVKA 4KUZH 4OLYL 5ESAB 5JW3L 3OKNB 5DURB 1A1MA 2E8YA 4PJHF 4ZOEA 5CFHA 4HUMB 1L6XA 1OPGH 1FCGA 1TIUA 3P2TA 1GZPB 5L8JB 4L29A 3V6ZB 1X6NA 4DQOL 3AS0A 4PJXE 4OGYH 4JJHA 1Q9KB 4MLIA 3BI9X 4LARH 4QHMA 1LO3L 3GHBL 3DTXA 2HTKD 3SY0A 3T1FA 4YIQB 1J1OH 3AU1B 5GGSA 4N8VB 3HC0B 1E4XL 4UINL 2LABA 5MEQA 3CK0H 3FRUA 4OIAA 5I1KH 4Q6IA 5H94B 1TJGL 1OGTA 3DX8B 1UXSB 5GRJL 3F7PC 3TA3D 2ID5A 2O61B 4KQ4H 1XR9B 1H3VA 3HE7D 1NCDL 1IFHH 1KLFA 4MA1C 2Y4SA 4MJIE 4QOKD 1CWVA 1TXKA 2CUMA 3LKOB 3FB6B 3FB7A 2AI0H 1QLRA 4WW2B 3ZHKA 3C5ZD 5GGTH 3HE6C 4WUUE 4QXGL 4JFFA 3DIFB 3C6SB 1E4XH 4HC1A 4UINH 2NY1C 3RNQB 3W0WE 2HYMA 1D5IH 2W38A 5TE7L 4C56B 4I2XB 3DETC 4Q6YA 4CN4A 3QUMB 3KPRB 4CJ1A 2PO6C 3NFNA 1EHNA 5I76A 1D5MB 5IROA 1BIHA 2YS4A 1K3ZA 4HJGA 3CLEL 3X11B 4G80A 2IANA 3RX8A 2EKJA 2NR6C 4P9MH 5D1ZD 1NUGA 1E27B 4RFNC 5FUOL 2I07B 1CFSA 3DOSA 4IHOA 2ITDB 3QCVH 3QEQB 3KLAB 4U0RB 1JNNL 4FQLH 2NY1D 2X44D 4E41E 4WJ5B 4XPGH 4M7JL 4OQ1A 2I26N 3FRPA 2IALA 2H2PD 2IPTL 1T66D 5T3ZH 3REVB 4PJ7F 3SE3A 3SPVA 3FMGL 2R29H 3RWCA 4NRXB 5TQ2L 4I3RH 2OLDA 5D9SA 1U8QB 1DN0B 1PKQA 4PTUB 4UBDC 3G6AA 5CGYD 4U1HB 4JZNA 1IGTB 2GT9B 4JFDA 1FNGB 4YXHH 1HCVA 1BQHB 3IKCB 4PJHE 4PLKD 4XPBL 4XVUD 3A67H 1X6LA 5SWZA 3C6LD 2CH8A 1MVUA 3ARFB 3L3OB 4DOHB 1PKQE 4GW4B 2PO6A 2FIRT 5I2IB 4B41A 3F12B 1CLCA 3MA7B 1ZHNA 3EGSA 3QUXC 4GJTB 1MCOL 2HN7A 1KCSH 1A9BA 4PRNB 5FUZL 5IW6A 1MOEA 3LQZA 5CJQL 1BQLH 1YPZA 3IRPX 4OLUH 1MUJB 3MLYL 2Z92A 3ARXA 3AY4A 1B0GA 3ZSSA 3MJ8A 2HKHH 2OTUB 4HIEB 4QRTA 3GI8L 5HD8C 1MCWM 3TCLB 3PWUB 2VLRD 1A6AA 3QPQD 2CK2A 3DUHA 4O51B 4ZQKA 1IMHC 2I5YH 3DVNA 2WBJC 3CDGA 1FIGL 1BWMA 5DUMH 3MYJA 3RY6C 3VFPB 4NWTH 5DD3H 2BY1A 3DSNA 1XGQB 3OAYH 3Q2CA 3WFCH 1FLRL 4OAWB 4EI5D 5JHDD 5ENWA 3UPAA 3MRCB 2HT2C 3FO0H 5HI4C 3SDDD 4JPVH 2DYPD 3MZTA 3HS0B 4WV1B 5ALBH 3TEUA 4IRJD 2HVKB 3P0YL 3IAGC 4TSBH 5AZ2L 5HYQB 1U8OB 4WY7L 4XI5D 1UB5A 3DSFH 4NO0A 2EXYD 4GW5A 2F5AH 3MBEB 3WKMH 1LD9A 3O6FB 1UACL 3CFKB 4OZ4A 4XAWL 4ZYKA 4LCWD 1EMTH 1QO3B 1NQBA 1YMHA 4BK5A 4R0LB 4QRPA 3BZFA 3Q6FB 1L0QA 4N8CL 3VD4A 5A43C 1MQKH 4JZOA 4JKLA 5DRNA 1ZTXL 3T0BA 2FLRT 1BREA 3SKUD 3U7WH 1BZQK 4KFZC 1DDHA 2QQLL 3QQ9D 1OAKH 2VDQH 5ETUB 1WTGT 4PUBH 3WNNA 4RZCA 3OQ3B 4MXQD 5EBGA 1Z6JT 2F53B 3MNVB 4UT6L 5IVNA 4C56E 1FSKC 4J23A 4ONHA 3QJFB 1Y0LB 5F97E 3K1DA 3PWPD 4YWGH 2JF1A 2QSTA 2YUZA 3P9LB 2PO6D 4JEGB 4OF6A 1XF5B 5FO9A 2C3XA 3IJSA 3NTCH 3QYCA 3QNYA 1AE6H 2Z31D 3G6JB 4O2FA 2A6KA 4FQ2H 4FFWD 3KPMA 3ESUF 1S7RA 1VADB 1GPOL 1W0WB 3T0EA 4ETQB 1S8DA 3U4BL 4UV7L 2B4CH 4OZHB 1Z5LA 3BPOC 2GIYA 3MRHB 5D6DA 3IFLL 3ZSTA 2O5YH 2GY5A 3RY6A 5SWZE 1AC0A 4JZJB 4I3SH 2B2XH 3VWKA 3P0GB 4WW1A 4P3WA 4W70A 5JQ6H 3G6DH 4HKXA 4PJDF 1N0XL 4PJ9D 2RFXB 3QUKA 2KQMA 4Z7WA 3RVVD 3B6SB 4Y1AE 1A6WH 1ETZA 4PLNC 3GSQB 4XP6L 1U8PA 1AD9A 4TOYL 1CG9A 4HPOH 3WS6C 2R15A 3IJHA 1CICD 1X4ZA 4PV8A 3OKEA 4XHJC 3QHFH 5C70A 5LG1A 1CLYH 1IC5L 4WGVB 3WIHA 5D8JH 2VXSH 4E41A 3H42H 1YN7B 4WWKA 3EOBB 5F7WC 4GRLA 3ULUL 3H7BB 4X6CB 5T1LB 1RZIA 1A14L 3O11B 3STLB 1OAUH 3U4EA 1A9EB 1LE5A 4PJ8C 3U6RB 2AP2A 2P8PB 4YEFA 4AYFA 3UYRH 3WHXB 1A4KA 1PYWB 4ZDHB 1R5VA 1VCAA 3U36A 3RVUC 4H26A 3ELAT 5T3ZD 4APQD 2VSDA 4M7LL 2IQAA 4PRBB 5L9DH 5E2VL 3N1PC 4U7KA 3JBG7 3WDJA 2NY3D 4ZOAA 1RIUL 5D1QA 5I73B 4PJCA 2B0SL 5C0DA 4YXLH 4GMTH 4UOW1 3CDFA 1V3MA 1CU4L 3FFCA 3CSPA 4BQ8A 1URLA 2HTLD 5EH1A 4QXTA 3S37L 8FABA 4MJIA 4BSJA 2EH7H 2YPLE 3OKLB 4NQEB 3TC9A 3UEZA 3ZHLA 1G9MH 1BGXL 3DUUB 4PRID 4G8GD 2EDBA 3ARZA 3I6GA 5DJ8A 2XI9A 5I1JH 5C2BH 3SDAA 1MH5A 4NQSA 3ZE2F 3C5JA 2IMMA 2V2TB 4OF8A 4CU8A 3DI2B 3DMMC 5GS1A 4OV5A 5EU3A 2CLRA 2YMXH 4HCRH 3PQYE 4NOFA 2VDRH 1RJZB 1ZHKB 2EDDA 3PHOA 3U0TA 1ZAGA 3UTZA 1YEKH 3SQOH 1I7ZB 1LP9F 2F58L 1K4CA 5HHVL 4WV1A 2IADA 4PLOB 1QSFE 3STBA 5C3LD 2KUTA 4OJFH 5HYSB 1ZSDA 2NY5H 5HGAA 4PJ7B 3O3EA 1YMMB 1VDGA 5K93A 2R23B 1N4XH 3HUJE 1LDPL 1FO0L 3J8F7 4FTVE 3KG5A 1WIUA 1RV6X 3SGDI 1HHJB 3Q0HA 4KDTA 4XMKH 1EFXD 1N59A 5DA4A 4APQC 3ECBA 3HAEH 4OCRL 5HHOB 1DBMH 1GC1C 3B5TA 3KYOB 4TRPL 4YK4B 1B6DA 1AC6A 3QHFL 2EIEA 1FPTL 3CFDA 4QXUL 1ZLUK 1XMWA 3VA6A 4R2GC 4ZS6D 4PG2A 1PZUB 4DKDC 2VH5L 4NRZA 4XXCC 3HE6A 5A40E 5D7IF 1MCFA 2EDXA 1OGAD 2CR3A 4U1LA 2VQ1B 2XYCA 3ZKMC 1K4CB 1DUYB 3VWJB 1PY4A 4JRXD 1XF2A 4O58L 4XBPA 1VADA 1S9WB 2A74B 2YXMA 1KV3A 2WINB 1YNLL 4OCWH 4EBQL 1HHGB 2P48B 1BOGA 4MSWB 1Z5LB 4I0PB 2BDNH 4P2QA 5I1AA 1KCRH 3RVTC 1ZT1A 5F9WB 5FV2A 5HGHA 1J05B 5T5FL 1SJEB 2VKWA 3NOIA 5DMIH 1JRHL 5DJYB 4LAJH 4CW1A 2DM4A 4GRWE 4QY8A 1JF6A 1NC2A 1P84K 2ITCB 4QRRE 4OUUA 3QJHB 4OD3L 5E8EA 3SDYH 1I4FA 5E8OA 5C3TA 2R0WL 1P4LA 3UYPA 3FFCE 4CGTA 2BRQA 3LN4B 1AKJB 4KAQH 1KT2A 1T7WA 4C58B 3RIAK 1BVKA 4P9ML 1VENA 3S96B 2NNAB 3W2DL 2P7TA 4U05A 1Y6MR 5INCB 3FHQA 5F9AC 5DC0A 3LN5A 1DBKL 2XKUA 3RGVB 1BJ1H 3DXAA 8CGTA 1AIFA 2LV4A 1KB5L 3GZKA 4Z7WE 3STZA 2VE6B 1WICA 5JDSA 1R3KA 1QSEE 4OM1L 4LLYA 3OXRB 1XGPA 3N85H 3CFKA 4OZ4B 3K0WA 2BK8A 2X1OA 4L4VE 2MOVA 2XQYG 3RWJA 4EOWL 5KS9F 5DLMH 1UM4L 3DECA 5BJTA 1CLZL 5DJ2A 5I1EH 2A73A 3OKMA 1RK0A 1QRNE 1CGTA 5GGVY 5GS0L 4E41B 4MA7L 4WEBH 1U91A 2G5BB 2ZWLT 1GXEA 1P69B 3PV6B 4OLVL 5JLZB 2EC9T 4JDZB 4P2RD 4WNQB 1OM3H 1A1NB 1FRGL 3PL6B 4PJGF 2V6HA 4QRRD 1EBPA 4HFUL 2Q1EA 1KJ2L 1NDMB 4HHAB 1I3GL 3QIWC 3R0NA 3RNKA 2DB8A 1BFSA 4FFWC 4J8RA 3NAAL 4HC1L 1LNUB 3FT3B 4FTVB 4OB5H 4H0HB 1TITA 2XZCH 3VW3L 2R1XB 1NFIA 1U8LA 4R7NA 5EZLA 2AK4E 5HHQA 4OD1L 4RIRB 1EPFA 1RK0B 4Y5XC 2VR4A 2LQRA 5C0EB 5HGBA 4J7RA 1TPXB 1KELL 3G5VB 5EZJA 3SDDC 2LFGA 5DI8A 1F02I 2CXGA 1NCTA 3LN9A 4PJFA 1G9NH 4OFPA 3U82B 1IAIL 1KC5H 5CP7B 1LK3L 3OZ9H 3QDGB 1Q0YL 3VXOB 4DZ8A 1IQWL 4R3SB 2W65A 1BFVL 3LVEA 5JORB 1OHQA 2V2WB 3V0AC 3NIFE 4LSRL 4OFIA 3PWLA 4M03A 3ZDZF 1U8HA 1RZGB 4KI5D 3IDNB 3BPCB 4YDKL 1GAFH 5GGQL 4KVCH 5E2JA 5KVFH 5HY9B 1MFDL 1WWWX 2MHAB 4JZNB 3DUUA 3ARGC 2AEPL 5GHWH 1KBGH 4QYOB 5C0CA 1ZEAL 2ERJB 1NKOA 4Y4FB 3MNVA 4GXUM 1NMBL 3VXRB 4PGDA 4CMMB 1IE5A 2ICWI 3QZWG 4X9BA 2NZIA 1DQMH 2EDTA 3X12A 5IQ9A 1DQLL 4FQ2L 3HNSH 2VWEC 1A2YB 1ZANH 3D39E 2O26U 4PJ8B 4Y4FC 1NBVH 5IMMB 3FN0H 1T1YB 4H0GA 4UTAL 3L3IA 5I30H 3QEHB 1T0NA 2PTUA 3G08A 4FP8L 4P4KC 3OX8A 4JREC 5HYQA 1A3LH 1NDGA 4BZ1H 1HZHH 1H8OA 1ZT7A 3BDXA 4OAWA 2PW2B 1KNOA 5IV2B 1MQ8A 3UCRA 2NXZC 3LOWA 3QULB 4HXBL 2OYPA 4PLJC 3O6FD 2G75B 4H20H 3SKNA 3EDFA 1N59B 3DMMA 3PQYD 5CWSB 5GS1C 3G04A 3KYKH 4UU9A 4CKVX 2YBRA 3W5MA 3TIEB 4QRSA 3VXRE 2Y07H 2GQHA 3QXVA 1IGYB 4H1LH 1W8NA 3FT4A 2AVGA 4O2EA 5L8LB 2ADFL 1CD8A 1RSFA 4U7SA 5DS8A 3FJTA 3WFZA 3GB7A 3G9VA 1OP3H 3T0WA 2UZIL 1F90L 4I0PD 4ZG1A 3FT2A 3BPLC 4JN1L 3BGMB 5E99L 5E8PB 1L7TH 1V3JA 2MCPL 4HUUA 2X89D 5DJXA 3H2WA 25C8L 3EGSB 4FQQB 1DQQA 3PWPA 4P2OA 1NGXA 3QFDB 4G9DA 3KPMB 3RAJL 1JUFB 2FO4A 4OZHF 2FGWH 3QDMD 3KYAA 1K6QL 1JGVL 2VL4A 5CZXD 2X4UA 1HH9B 1H0DB 3S88L 2DOCA 1AGDB 1AJ7H 2G2RB 3TJHC 4LFHG 5KAQG 3CVHB 4FQJL 3VWKD 4NM4L 1RIVL 4KROD 5HTSA 4YBHA 4FNLH 2VDKL 4PJAF 5ICZB 1ZGLA 4DGVH 4P46D 5FFLA 1GHFH 1WAAA 1HDMB 1FORH 4LCWA 1FRGH 4OGXH 1QFOA 1LO5B 1MRDL 3EAKA 4AZ8A 1NANH 1UWXK 3VFVB 4NO0D 3VH8A 2FX7L 1AP2B 3GMLB 3VRIA 3TM6A 1FNEB 1QNZL 1LD9B 5TE4L 5JPMA 5GSRB 1SQ2N 3QA3A 4XPHH 1WBZB 1CK0L 4FRWA 1UZ8B 3L95B 1MJ7L 3F5WB 5ESVB 2YEZB 1FVCB 4NP4L 1KPVA 3X3GL 3U2SB 3TBSA 1NGWA 4I4WB 3VXQA 1NMCB 4AEIH 1NCCH 1IGFL 4D9QE 5EWIL 1I85A 2PCPB 3QIUA 2YKLH 4ZQKB 4OBSA 5CD5D 1HHKA 1Q9WA 4JAMB 5DEGB 4OIIH 2FDBP 4JDTH 1G1CA 1G1YA 4D0CA 4HS8L 4ZUTA 4TULH 5FF6B 2X1XR 1LK2A 1TVHA 1TZGH 3BPNC 5ECJE 3SCMB 1DLHA 1A47A 5F1IA 4E9LA 2X4PB 4OD3H 4GAFB 3GB7B 3HRZB 2ZUXA 3O3DA 4ZUSB 1KCLA 1KSRA 2X4PA 5KZCB 5T33H 1KLGA 5E4IA 1ZVYA 3SEPA 1MAMH 1VEPA 4Y89A 1YEKL 3SQOL 1Z9SA 1WBYA 1JHKH 4ZUUA 2N7AA 4GH7B 1C5DB 3TA3B 1CGXA 3FQWA 4W6YB 3AS1A 2PYEE 2JCCA 1B90A 5D1ZC 2ILLA 5DEGA 2BJML 5ID1B 4OLEA 1QTYT 3OR6B 3PXJA 4D3CL 2N1KA 4Z9KB 5LQBL 1I9JL 1JWSA 4B7LA 2X4RA 3RHWK 1VFBA 1KPVB 2Y6SC 1XF1A 2AQ1A 1DBML 4BFIB 2P46B 2D31A 1GHFL 2OR8A 3NCFB 3G08B 4KRPC 5GGSY 3NH7H 3QXAB 3MLVH 5EU6B 3GBMH 4NQCA 1NBZA 4BH8A 5BVPL 4M6MH 2A83B 3MREA 5D1ZA 1T83C 4ZAKB 3RJDA 2BCKA 1Q8MA 1MVFA 1W8OA 5F8RC 3KPOB 5TF0A 4I9WE 2CDFB 1LEIA 1N8ZB 3HMXH 2SEBA 5IP4A 2O5XH 3TH3T 5HXMA 2VLRB 4IRJC 4IMKA 4N90D 5FA4A 2MQ3A 4JFXA 3QUMA 4U4BA 4NO5B 5LGHH 1P4LB 4TNWF 5ELIA 3VGAB 4Z7UF 5DK2A 2KZWA 1OSPL 1BQLL 3QQ3B 35C8L 3PHQA 3WS3B 5IFHH 4YEEA 3MLVL 3DVGB 3TT1L 1SHMA 5CGTA 1GGYA 1SJVA 2G5RA 2F5BL 2VXQL 1Q72L 3ZDXF 4X5LA 5KVDH 1BX2B 1BM3H 3P0VH 1OM3L 2FCBA 5I1AB 4E42A 4P23C 3LH2L 4AEFA 4ZXBA 1QFWH 2YD2A 3VFUB 1GOHA 4WUUB 1MSPA 1EEZB 4HJ0D 1R5IB 3QIWA 3VWJA 1CLZH 3C60A 4K2UL 1J10A 3BKYL 3FOLB 5GS0C 3GO1L 1YN6B 3BAEH 4X0KB 3QWRD 3WIFB 2XG5A 1PW3A 5C0IB 1JTOA 2PYED 5EOTA 1N64L 4DEPB 5E6ZA 4QRUA 1FC1A 3ULUE 1WZ1H 2FD6H 1TMCB 2EDKA 1CD0A 1A3LL 2WBKA 4GBXD 5MEPA 1N5AA 2FX9L 5AWNH 4LEOB 5T3ZL 3ZKXB 1GL4B 5GSVB 1T5XA 4YO0B 5BV7L 3DGGA 3W5NA 4NO2B 3RWEB 1E6JH 1FE8H 5DZLA 2XQBL 5ISZD 5CCKH 4WTWA 1JHLL 1ZANL 1RHFA 2PR4H 3WS3A 3BO8A 4ZPVA 1D3CA 3LMJL 5E08L 2R2EA 3WE6A 1A4JB 1FFNA 3MJ9L 1D6EA 3ARWA 4N1EA 1IAII 2DQDH 2QADB 4XGZB 5IFJB 4WI4A 5IBUG 1JRHH 4PGCA 4ZO6A 5JXAH 3EKCA 1P1ZB 5FYLD 3OKDB 4RDQG 4XC1L 1AR2A 2BSSB 4K94C 1J0IA 1G6RL 1AI1H 3C08H 3O4LD 5GGRY 3Q6GL 4IRSB 4Y2DC 3RFZC 3CAFA 1N5YL 1I3VA 4G8EB 4OGZA 1BFVH 5E4EB 4Y4HC 5EZOH 3RA7L 3UZVB 1R5WA 5IVXF 1HXMB 4LSQL 5C08B 1A6VL 4P5TA 4LVOB 4JQXA 5JTWA 3GBNH 2PN5A 3ULUF 3LS4H 3BP4A 2X6MA 1XFPA 2APWA 1UT9A 1QA9B 2IBZX 3KPNB 1Z2KA 1GPOH 1CZ8L 1B4JH 2I25N 4LRIC 3BQUB 1HSAB 4DGVL 3N85L 4F37K 4JM4H 2ATKA 1WK0A 4CU7A 2QSQA 4KKAC 4TSBL 5AUMA 4EDWL 4R97B 1E4KC 5D70H 2X4UB 4PJBB 5JZ7C 2H3NB 4XWOD 4XVSH 5EC1A 3GMOA 1BOGB 4J6RH 5GZNC 5L0QC 3PV7A 1JF5A 2QADD 4JFEE 1W0YT 4WO4D 2IGFL 4I5BA 1K6QH 1I3GH 4UDTB 5DWUL 5KS9A 5MENE 1I8KB 5JW3H 3G5VA 1OY3B 2YPKA 3KLHD 3M17A 4LCWE 3O6LL 2Z93B 5FK9B 4KJPD 4J1UA 1WAAE 2DICA 1ZK9A 3VDBA 3ZT5A 5C0IA 1M7DA 3S35H 1INQA 3JZ7A 4D8PA 5FF6A 4G8GA 4XCYB 1ZGLP 2NY0B 4YAQA 1JWUA 1H3GA 1OT1A 4KV5F 3QG6B 1NL0H 3ARSA 4G6FD 4N9GB 4QHNB 4FMFA 4G9FB 4PRIB 4WWKD 3GIZH 1S78D 4JQXC 2R56L 1ERNA 3U9UA 4PYGA 1RU9H 4XCNA 4XNXL 5CHNB 1YEIH 3MODL 4JO4L 2IAND 3OWEA 4Z95H 3BWAA 2MQ0A 5DZOA 4MDIB 4NZTL 2LVCA 3S36X 4RFOH 4KQ3L 3QSKB 3EYVB 2D0HA 5ADOL 3QCUL 2J6EH 3A67L 2AGJL 3LB6D 3RZCD 2GI7A 5C6TL 5E9DE 3RKDD 1R3HB 2XOTA 4PS4H 3O4LE 4YXHL 5FEBA 1XGYL 4R4NC 4ESKA 1JTPA 1AO7A 1UADC 2R1WB 4NDMB 4WWKC 2FX8L 32C2B 3ZYOA 3VGEA 4Z5RB 1SEQL 2VQUA 1G9EA 3MRPB 5JQHC 5CEYA 1YEFH 3IDYC 1A2YA 3BP4B 5B39B 4UB0H 2IH1A 5DJDA 4OLXH 2FZ3A 4GBXA 3N06B 1IEBB 1KJ3L 1ZVHA 4OZFA 4YLQT 4GRLD 1KOAA 1MHPH 5T1MA 2ZZUT 1WQVT 1YY9C 1FG9C 1OP5H 3VXRA 3M07A 5C0BA 3P4OA 3I6LE 3ESVF 5JXEC 4H8WC 1DLFH 1K85A 5FUOH 2MCG1 4S1QL 5KSVB 3ZZ1A 1U3YA 1VKXB 3HE7B 1JPSL 4WI5A 4ZXBD 1SEQH 4G6MH 4Q7DA 3DHMA 1I9IL 5AAMA 3MV8A 4YDLC 4HX1B 5GHWL 1S7VB 4ACPA 4KGJA 4LPTA 3CH1A 2IQAB 1A7OH 1AXSA 4UI2A 1D5BB 4F7EB 3ARDD 1S7XA 4POZD 1KB9J 2A77H 2ZUVA 3D39A 5F93C 1F42A 2XG4A 12E8H 3VI4F 3T2QA 3NA9L 3QAZB 4MJ6A 5EUOA 3EZJB 5D5MF 3VFGH 4ZAKD 4KH2A 2N56A 3P11L 1U8OA 5JNYB 3RX7A 5IB4A 5DJ0B 5C9JB 2OL3L 4Z0BH 4GMTL 5CIPH 1T21A 5HYJD 3S3JA 4F7CA 4FQLL 4TUOA 4WHYG 5C86A 1OAYL 3WCYA 1PLGL 2VDKH 4ZSOE 1P6FA 2NPLX 2YK1L 4PG9A 5IESL 4PJ8D 3HE6D 3VE0B 4JY4B 3ULSA 3WFHA 3E6FB 4EI5A 1EK3A 2OJZL 5JW5B 1RY7B 3HLAA 3FTGA 5BS0E 3ARBD 1DEEA 2A1WH 2R9HD 3ZE1F 1TVBB 3O4LA 3BIBX 1C5CL 4M6OH 2FGWL 4NKOB 5IMOB 2ZCHL 4KVNH 4AEEA 3CUPB 1D5XB 4YHKL 4FZEH 1LHZA 3GMRA 4P46B 4ODWA 4GG6A 2JLLA 1U91B 2G5BA 3NCYS 2BSED 4RGOL 2DIAA 3OG6B 2D9QB 2VDOH 3KPSA 4NT6A 3QUZA 3EDEA 1QP1A 3FRPG 2JK5A 3K74B 5EBLB 4PJXF 3TN0D 4DKEH 4YFLI 1NAMB 3PP3K 5IGXH 3FONA 2HFFA 4EI5C 1BWWA 3QNXA 1NGYB 4BFBD 4OF3A 5T3ZE 4I0KA 3BJ91 4CMMA 4ODUB 4JFQB 1GZQA 3WO4C 4KY1H 1SMAA 2B1HH 2ESVD 4WIQA 1K5NA 2R0KL 4N0CC 4N9OB 1XIWC 1R24A 1NBQA 3VFSA 1CVRA 2Z8VC 3UPRA 2BNRE 2ADGB 4GO6B 4KVNL 4CNIA 3OGCA 5IB5B 5J8OA 1BF8A 4RGNC 4P23A 2EDLA 4H8WL 4I48A 2A6IA 4XPTH 2D31B 1I3RB 3PDOB 4TYUA 1CDBA 1REIA 3JTSA 3MRGA 1J11A 3L9RB 3KYMB 4KAQL 2WWMC 3L5IA 2VAJA 1A14H 5E8NB 2HFEA 1MHEA 1U92A 4KROB 1MJ8H 5L2KB 1E6JL 3EOAA 2EH8L 2OTPA 1R5VB 2I24N 2QADC 3ME0A 5DT1H 1RHHB 1J18A 3K2MC 5SWSB 5H35B 4BJLA 3FFDB 4ZXBC 2ZSVB 4JPWL 5K9JL 1OAZH 2WINA 1DQLH 4H25B 4MS8C 1FGVH 1ZS8A 3C6LA 3N9GL 1N2RB 2XN9A 3DX9A 1M6OA 2DQUH 4QF1B 2OXGA 5E9DB 3L7FB 5FB8A 5SX4H 5JOEA 1M4KA 3CVIL 2BOCB 3O4LB 3CZFA 4A2MA 4OI8A 4RWYH 1A5FH 1HWGB 4UT7H 2NXZB 5AZEL 1OOAA 4HHAA 1CFVH 3QO1B 4JPIB 5E1HB 4LLVA 1LVEA 2DQTH 1FH5H 3ULSB 1MCHA 2Z31A 4LHQB 5ITFB 5L6YL 3DVNB 1B9ZA 1ITCA 1T7ZA 3I2CH 3TFKC 4HIHA 3DLQR 2BVTA 4Z95L 4XCYA 1AD9B 4XMKL 4Q2ZA 1QVOB 2X4TB 3X14B 3TBSB 5C1MB 4EDXA 2VXTL 4N0CD 2WIIB 3EW3B 1KC5L 1ZSDB 1NGPH 2Q86B 4ZNEA 1ZS8B 5D71H 3HZVB 4ONFL 1E4JA 4KPHH 5C0FA 3MRHA 5I66B 4RAHA 5INDB 2XICA 3U46A 1SEBB 3T3PF 3ZDXE 3O6LH 3C5ZC 2JJWA 1CXFA 2NY3B 4S1RH 4UB0L 4A6YH 2J6EA 3B83A 3GSWB 5D2LE 3RTQB 1SYSB 4OM0H 4PUBL 4WW2C 4NZJA 1JMZA 1V3LA 5B8CB 1SY6L 2EXYC 4J3SA 4UT9L 1EJOL 4ZTPH 5ACZA 4MCZA 4PS4L 1S7SA 4QRQA 5I6XC 5T3XH 5IM7B 4HG4J 5IF0A 3ARBC 3HNVH 1CIUA 4K7PX 5LCVL 1MI5B 5E7FA 1QBLL 2GJZB 4NKQB 2VR5A 3CXDH 4XVUC 5IBUB 1UACH 3ULVD 3BPCA 2HP4A 4QXTB 1H0DA 2P5WA 1CR9H 4V1DE 4PFEA 1NL0L 3QNZB 1G7JB 5LVEA 1FH5L 5F9WC 5DK0B 4PJEB 4L4VA 3EJYC 4ODBD 4AQ1B 1HILA 4XBPB 3AS2A 3OKKB 1G7MB 4U33A 4HUVB 2X1QA 1RUAL 2YA0A 4OGAD 5BRZE 1NLDH 4R0LA 4XP5L 3MUHL 1KTDA 1F3DJ 4PJ5E 3VFWA 1X4XA 2V5RA 4EQ3A 3L5WA 3GHEL 5DO2C 3MRFB 5SWSE 4KJQC 5E2TH 1OVZA 3RTQD 4EUPA 1EEYB 3VFMB 1TJIL 3ECBB 4P5MA 5E1AA 3KYOA 3RVWC 3GNML 3DGGB 3KHQA 2OMNA 4IRZL 4D0BB 5GISH 3QDME 3QCTH 4QNPF 2RQ8A 5JIPA 5CJ8A 1AQKH 1BAFH 4KKBC 4XPAH 3H42L 4RWHA 3UAJC 3O9WD 4OUOA 3IJYA 3TO4C 2IQ9H 4Q9RH 2NQCA 3LEXA 3QUXB 4X5WB 5B38A 5IFAL 3L3JB 4WI6A 3MLRH 3U9PL 4MGXA </