5DK2A

Fc heterodimer e356k/d399k + k392d/k409d
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
207
structure length
207
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRKEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLKSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 36
structure length 207
sequence length 207
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk2A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk2A01
4PJ9A 4PLJD 4YE4H 2EIZA 2PCPA 3UJTH 3ZLQC 3REVB 1A7NH 4MA1C 5HHOA 4YWGL 3SGJA 2OMBA 5A40E 2ATPB 1R3JA 3LEVH 2XRAH 1QKZH 4P5TD 2R2HB 4TULH 5B4MC 3L9RB 1I8LC 1H8OA 3O2WL 1A4KA 2YPLD 3BD3A 4XRCB 4IJ3C 3GRWA 3AB0B 3C6SB 1LO3H 5C0ND 1UJ3B 4JDTL 3PWLB 2HT4D 3D39B 3QG6A 3QNZB 1J8HD 4JFPB 2IAMB 1QEWA 3TT1H 1U8QA 3NA9L 1X5XA 4NQSB 3IFPB 5E5UB 1S9VB 1F90H 4BFIB 3BESR 3VXUD 1IJ9A 3D69A 2F15A 3OAYK 1Q8MA 3BMWA 4AG4L 2QADB 3DARA 4NBXB 1VACB 4F58L 3TM6A 3PWPE 3VMPA 3GDBA 3O2DL 4WWKC 4JZNA 4M6OL 3ILPA 5FUZH 1UB5B 2FSEB 1LEIA 4NRZA 4ZD3L 5F44A 4KFZC 1FAIH 2CIIB 1D5BB 3LS4L 1Y0LB 3FQRB 1NDGA 3VD3A 4XXCA 3U7YH 1XZ0B 4QF1A 5CLTA 3QNYA 3PIQB 1CTNA 4KKLC 2Z31D 4RNRA 5E4IA 3ULSB 4N0UA 4LVHC 5DJ6A 5C9JA 3F58L 1XGUA 3JBG7 5HGHA 3F65A 4XHQA 1WT5C 2BNQD 1MRFL 3V2AR 4PD4K 4HHAA 5C8JA 5BZDB 1RHHB 2XT1B 4R6UA 2VLKE 2EYRA 2EDLA 1IZJA 3HC0B 1JNLL 1T22A 9CGTA 5J9PA 3GO1H 5HPMA 1E4XL 4K9EC 4BFIA 1FQ9C 1G7IA 1RU9L 4NCC1 4UV7L 5H2BB 5FOBB 4DVBB 4Z77B 2XKSA 2CKNA 1JWSA 4G3YL 4NRXA 5B21A 4QRSB 5IOPB 4JO2H 1CDGA 4LHUG 2ZUQB 3UTTA 1BLNA 5IKCA 4PLKD 1CS6A 1MIML 3KHQA 5D7JB 2VR4A 2RJMA 2W65B 5GS0C 4HWZB 4LK4A 3SCMC 3HUJA 2LAAA 4K8RC 5IVXE 2YUVA 1T4KB 2VAAA 3GBMH 2ORBL 1JFQH 4DCQA 5E70A 3Q5TA 3X14A 4M7KH 1BD2E 3GUTB 4IIQC 5TPWH 2IAMA 3UEZA 5EUOF 1U92A 1J1OH 1Z5LA 4Y5YC 5D1XC 5E2WL 3T4AA 3IFPA 2GJZB 2XTJD 2NX5B 3OGCA 5DFVC 5E94A 4Q6YA 3I2CH 1DBBH 2E8ZA 4M61A 4QRPD 4OZGB 3KLHC 3UPCA 3MJ7B 4G9FA 1INDH 4N9GA 3TYGL 5HYEA 3KGRA 1CG9B 4EBQL 1WAAE 1BIIB 4XMKH 1RZKC 5JW5A 3CFEB 1NKRA 4IJ3B 1FNSL 4OGXH 1I8IA 3RKDD 5DRNB 3VI3F 2FR4A 3X3GH 1R3LB 4W6YB 2DBLH 3OAZK 2J8HA 2VZ3A 2HMIC 3Q3GA 1NPUA 4IRSD 5C7XH 1HKLH 4N5ED 1OSPL 2WSKA 2O93L 2FIKB 1VGKB 5ISZB 3WIFA 2B0SL 1Q9OA 4MQTB 2HRPL 3GSQB 3OKNA 1D5IH 2APVA 4NJAL 4POUB 3QJFB 3TFKC 1OY3B 1KLGB 3K4AA 1N4XL 5IW1B 1G7QA 1G9MC 1NCNA 2WBKA 4I18A 3IS1X 4LLDA 3D0VA 3AXLB 4L4JA 4JRYA 4DUXA 3ZE2E 1IM9B 3GI8L 5CZVL 4L29B 3G5VB 4F7TA 1RUKH 2EDQA 2YR3A 4E0RA 4FP8L 2L7UA 1XF4A 4D9QD 4WNQA 3ECBB 2WINA 3QUXA 3SDAC 2D03H 4JM2A 4X6FB 5GZND 3VWKD 1CXLA 1T0MB 2Y07H 1A7BA 1IM9D 1T2XA 2VL5A 4WU5B 2HG5A 5HYQB 4Q74A 1CICD 2AABL 4AIOA 1IGYA 4G42A 3D3VB 4WUUB 1WFTA 2XPGA 5L2KE 5DQ9A 1OGAD 4FZEL 1A6TB 2UZIL 4PGCB 1M7DA 2YWYA 4NWTL 5F6IC 3DMMC 2YC1B 3RNQA 5KN5B 1DLHB 1CXHA 3WO3B 1GVIA 3FTGA 2NW2A 2BHUA 1OVZA 2GCYA 3C8KB 4MVBD 4R4BB 2YKLL 1C7TA 4M8VA 2ZOKB 1RHFA 2PO6C 5HPOA 5HGBB 4KUCD 4LSPH 1KPVB 1NCTA 1I1AC 4KROC 2N7BA 2MKLC 1MOEA 4NQDA 4Z7QF 3GBNL 4HGKC 1TCRA 1CICC 1MCDA 3TH2T 1AJ7L 1A3LL 1BIHA 4RGND 1XH3A 4P23A 4WI7A 4PJDE 5JOFB 1VB9A 2D4FA 1D9KD 5I8CB 2CXGA 2X1QA 1LO5B 3FT4A 1AXTH 1OWWA 5J57B 3PV7A 1OAYH 5SWSB 4I2XB 4JFOB 1G7JA 2EH8L 3UTTE 4OCXH 4PJIF 1DBML 3OB0H 1R5VA 3QHFL 3DTXA 3BP7A 4DFIA 5FCUH 1I4FB 2B39A 2ZPKH 1RULL 1MPAL 5JW4R 3OB0K 4OD1H 1QLRB 1R3LA 2J4WH 4DKAA 5IESH 4YXKL 2Y36H 5T1MB 1J0JA 1WBYB 1GIGH 2WW8A 2B1HL 1NAKH 2XFXA 3UBXB 2JELL 1ES0A 4WIQA 1KB5A 1DLHA 2ZG1A 3WFBL 5FK9B 4OM0H 4UAOC 5CSGA 2R29H 1LE5A 4WUKH 3JV0A 5LXGH 3NFSL 2X4TA 3WD5L 4PJ7E 4AM0A 3HZVA 4AQOA 2I9LA 2UVEA 1RVFH 1F4AA 2GSIA 3WEXB 1UWEH 1M71B 5GHWL 2BSTB 2HG5B 4H0IA 3WHXA 3BE1H 3L3OA 5I18L 2DTSA 4P23C 2IADA 1N5AB 5DHYB 3QFJE 5K59F 2FATH 3K80A 3FHAA 4OCNC 5C0FA 4ZOCA 4XMLL 1TVHB 4GOSA 1CFVL 1A21A 3OKMB 4NZTH 1G6RH 4AYFA 2UWEE 4QLRA 1CL7I 2ZG3A 5FA4A 4YWGH 1G9MH 1YC8A 4YHZH 3LEYH 4LGRB 3EO9L 4ZO9A 3OGCB 5DR5L 3SE9L 3BRFA 4EI6A 1UKSA 1T5XB 4LASH 3VRLF 1YUHA 5I1JH 4ZFFB 4LAQL 4TNWK 4OD3L 3KYOB 4S1QL 2Z9TA 1E27A 2Q8BH 5AG8A 4PGCA 2CK2A 3K2UL 1XEDA 4JDTH 2BCKA 2V5MA 3FRPA 4M7LT 3SO3B 3FO9A 1QG3A 2VH5L 4X7TB 5CGYC 1MRFH 1D6VH 2NR6D 2DM2A 4GG6A 5CKGA 3WS6A 4TSBH 3QUZD 2OI9C 5I8EB 1I3RA 5IVZA 1I1FA 2N56A 4HXBL 4LVNB 5TFSL 3WIHA 5EO0A 4MGXA 4NFBA 3JV4B 4DTGH 3QQNA 3ZYIA 1ZGLB 2PXYD 4KJYB 1S5IL 1CR9L 4N9OB 4CW1A 2QSTA 5E6ID 1IC5L 1QBMH 1QPXA 3VXME 3A6CL 4QTHA 1AGEB 2AVGA 1W72A 3KLDA 1ND0A 4JAMA 1WGOA 1L7IL 1EO7A 4GAFB 4H0HB 3VFWB 4HG4J 2AJSH 3OHXB 1EEYA 1UM6L 4QHUB 1DDHB 2ED7A 1ZHKB 2NX5D 3H9ZA 4AEHH 1S3KL 1WWAX 5EOQL 2ADIA 5IEKB 4OLWH 3C60A 4JR9L 2Z92A 3IDIA 2EDRA 1QNZL 4BA8A 1JGUL 3NABH 2BSSA 5D6CA 1U8LA 1OAKL 3CD4A 3MLYL 4HKBB 1IQDA 4U7SA 3B5TA 2B2XH 4X6DF 2F5AH 4HIHB 1QUNA 3BQUB 3RHWF 1D3CA 3RVXC 5DMGC 3MNZB 3IETB 2CLVA 3FO2B 3V6FA 3ELAT 1YA5A 4NKQB 5CP3A 5SWQA 1CXKA 3UZVB 3QUXD 1ERNA 4CU8A 2WQ8A 1A7OH 1NAMB 3IU3B 4E5XA 3L3IB 1Y6NR 1GHFH 1X4ZA 2ZSWB 1LEKA 3MXWH 1EPFA 3BKJL 4JN2A 1HYRC 4FQJH 4C59B 3HI6H 2AK4E 3QJHA 2R2BA 2VLKB 4XI5C 5JLZB 1UT9A 1VGEL 2G75A 3OKKB 1I3RB 1CVSC 5EUOE 4NFCA 4NSKB 1ZVHA 1SY6L 1XF3A 2OMNA 4M7JL 4OBRA 4QHUA 4J4PD 4M6MH 3H3BC 3ZMRA 2P8LB 3F7YA 5E8PA 2XQBH 1UACH 4IMLA 1RUKL 1G9EA 4XCCH 1CWVA 4NZUL 3P77A 4Y89A 5B8CC 1FO0A 4D94A 4NKIH 1AC0A 2D03L 2FHCA 2AAVA 4G5ZH 1CFNB 4GUPB 1T83A 3SE3A 2IMNA 2GTWA 4R97B 4K8RD 5EPMB 1F13A 4MJIB 2GYSA 4TQEL 2EDNA 3WNLA 4EBQH 3VWJD 2HJFA 3TVMC 2YRZA 2W60B 5T3XL 5AWNH 1Q9KB 3DIFB 1JYNA 1FV1B 1RJYA 4HFWA 4DFHA 1FSKB 1Y18B 1QPPA 4OCSL 3TZVB 1ZEAL 4LKXA 3JUYA 2C1OA 4I13B 4WWID 1CFBA 3E6FA 3RTQC 1CDBA 3LRSB 3O0RH 4BZ1H 2VRAA 5JZ7C 2FX7L 5DHXB 4FG6C 3R4DA 4FG6D 4OI8A 1RY7B 4TUOA 1KCKA 4G8EB 5DZNA 1YMHA 2AJZB 1BZ9A 3VWKC 15C8H 1DBKL 2XA8L 5D5MA 1QVOA 3PWUB 3U7WL 3KJ4B 1JRHL 5J06A 3GMOB 2M2DA 3GI8H 3RL1A 4JFXA 2PYEB 4PJCF 3FQNA 3MRNB 5B38B 3CFBB 1XGTA 5HDQH 5HHOB 2Z31B 4OT1L 4LLYB 2DAVA 3H9SB 4QO1A 1HNGA 2VDMH 3DMMD 1QFWI 3LZFH 1NCWL 4LLUA 1YN7B 1PEWA 1EX0A 2HN7B 4KWUA 3VXSB 3C6SA 1OP9A 4HXAH 3VG0L 1WZKA 1UQSB 3GSNL 4H1LA 5D70H 3VRIA 3D39A 4JFPA 3EYUL 5MERB 3PWVB 5T1LB 4H0GA 4MMZC 3TP4A 5D6DC 1OAXL 4U6VL 4MNGA 4OZ4B 1JPGB 1A7RL 2W91A 4PJHA 1MI5E 4G8IA 3C5ZD 2DQFA 4AIZA 1T04A 1P6AB 4YLQT 3H7LA 2B8OT 2CQVA 2CRYA 1S7UB 2VC2H 3NAAL 3BOVA 1E4XI 4WU7A 4G80B 3UTOA 5DUML 3REVA 4ONFH 1T5WB 3BX7C 1MI5D 2C26A 3AU1A 4OAWB 4ELMA 3BDYH 3CMOH 2CR3A 3PP4L 3I75A 1NEUA 4G42B 1K4CB 1J86A 1NCBL 4I3GA 2HT2C 1LD9B 3CPLB 5FFLA 4HK0B 5DD0L 2O5XL 5IIEA 3BI9X 3SN6N 4HFWB 2E7BA 3HFMH 3NCJL 1KBGH 4Y4FD 3CXDL 4B7LA 1AO7E 4GRWB 5JOPD 3OKEA 2P5EB 1UXSB 1QA9A 4M3JA 5CEZD 4JVWA 3OQ3B 5CCKH 1WICA 2A9ML 3IDNA 5GGVH 1BWMA 4RA3A 1XF4B 2ZOKA 4HSQA 5GS0D 3OZ9L 5TF1L 1NGXA 5FF6A 5D1ZC 2CLRA 5AAWA 4HFUL 1J5OL 1KIPA 1SJEB 1JYVA 5SX4I 3W11C 3V9FA 1L6ZA 2XN9A 4TVPE 4TSAH 2R1WB 3U2SB 1U36A 2A6KB 2IQAA 3T1FB 3JV6A 1EAPB 3HZYA 2AJ3B 4F8TA 4L1DA 1CGWA 5JW4M 3CFDB 1WEJL 4K23H 3FCTA 3QJHB 3F7PC 4YBQC 3WD5H 4UDUB 2PYFA 4QXGL 4M62L 3C5ZB 4YHML 1GGIL 4OUOA 4YXHL 1WIPA 1OAQL 1BF8A 3LV3B 1K6QL 5IFJB 1P84K 4Z5RA 5KSUB 4KU1A 1A9EB 2DLFL 3O8XB 4DK6A 2EXWD 4J2XA 2FBOJ 1QSED 4KY1H 1TETH 2K7PA 3ESUF 4PG2A 2JIXD 3DRQB 2H6PB 3O4LD 3MLVH 3MV9A 3NPZB 3TCXA 4MX7B 1KXTB 5F7LB 1NGWA 2PO6D 3CVHH 4N8CL 1T22B 4QOKA 4DN3H 1ZHNA 1PEZA 4HKXA 4B41A 1QLEH 1HWHB 4HZLA 5EU4B 4BKLA 4H25A 2MQ3A 2EXWC 2DJUA 3A0OA 4PJGA 1WITA 1JHLL 3DVGA 4QYOB 5HHPB 1BFOB 4MDJB 3L6FA 3FFCB 3MRHB 2YMXH 4PJ8C 5C0BB 3EYVA 3RAJL 3O3EB 1FYHB 1RIVH 2C4FU 3REWB 3UTTB 3FRUB 2OL3B 3UJIL 4HWEH 1CCZA 3DX8B 2FZ3A 3NFNA 4JO4H 3LPFA 1D6EA 3B5HA 5F9JA 5BXFB 4H8WC 1PKQA 1FYTA 4EQ2A 2A6JB 4OZGF 2QQNH 2V9TA 1YNTA 4HJJL 5IM7B 4LQFH 1JGVH 2AJYL 2GY5A 3A6CH 1UA6L 1SMAA 1JIBA 2Y7QA 4FXLA 4ZFFA 5F1OB 4Y2OA 1HXMA 5ISZA 2YK1L 4NCC2 4JJHA 5F89A 3RX8A 5DK2B 2COQA 4XP4H 4FQJL 5H2BA 4JDZA 4NN5B 4PY8I 2X4QA 4X6CA 1OGAA 5D7LE 5IB4B 5DSCB 3SGEI 2ZKHH 5I76B 3CDCA 4L3AA 4JFEE 1G7PA 1ZHLB 3FO1B 1AQKH 4ISVB 4N5EC 3SE3C 3CFJB 2DD8H 1W72L 1DANT 3HI5L 5D7JA 4IRJD 2Y06H 3V6ZA 5GS3A 4OLEA 1DSFL 4FFVC 4JFDD 5K33A 4KZDL 3B9KD 2XWJA 1HDMA 3FO9B 3L7EB 4MA8L 5FB8A 5CINL 3HC3H 4XX1E 3MGOA 3UPRA 5E9DA 4JZNB 4FFZL 2AW2A 4G3YH 1H0DA 5D2NE 2E9BA 5DMKA 2FD6H 5IP4A 3BRDA 5FHBL 3KPRD 3O3EA 4QRRA 4DKFH 1IAIM 4JRXB 4F9PC 5JHDB 1AXSA 1S9YB 2EXYC 3LSOA 3OX8B 4XGZB 1MRCL 3C5ZC 3FOMA 2BSRA 4PB0L 1BVZA 1DVFB 5FGBA 4PRHE 4POZD 4M03A 5IM7A 1IGCH 1WFUA 2FEDD 4FQXC 3THMH 4Q6IB 3T0XA 1ZA3A 2Y7QB 4XPGL 3QI9A 1NGQH 3MRDA 3RA7L 3C2AL 4WW2B 3LQZA 2XZCH 3BIKB 3TT3L 5DQJA 5BO1H 1S7VA 3IXAB 4PLKC 1D5XA 3KPMB 2Q3ZA 3FZUD 1X5GA 5DJCA 4I0PA 1CD1B 4MDJA 3DSFL 2Q7YA 4GH7B 4G7YL 3RZCA 4OT1H 3RWGB 5IGXL 3RPIA 5IBUB 4LCYB 5D7KD 1ZGLP 3LZFL 3MNVB 1AQDB 4LCCA 1RZIB 4GJTB 2DQIL 1U8IB 5A2FA 1K4DA 4G9FD 6FABL 1OP3H 1Q38A 1LP9F 3JWOL 2VERN 4MAYC 3RTQD 2PYED 3QEGL 4NWTH 5CIPA 2D7PA 2VLRB 3B2UC 1A7QL 1D7FA 3HI1B 3KPSA 4RX4A 4BFGA 1NUNB 3AY4A 4FXGB 3VGDA 2GTZA 4K3DL 3WN5B 1F58H 3LH2L 1MJUL 3PWNA 4P3CL 4XP6L 5ETUA 1U8OA 3NPSC 4U3XA 4AIZB 3WL9A 1W8OA 1MWAH 1NL0L 1XR8B 5C0RL 1A8JH 3S3SA 2R1YB 3PV6B 5D1QB 4BELD 1EEZA 3W5NA 5I1KL 3DGGA 3RL2B 5F1SA 5C3LD 3P0YH 4G9DA 4O2EB 3S36L 4GRWF 1WLHA 2XQYG 1MI5A 5DD5H 4FP8H 1E6JL 4KQ3H 1FC1A 2R15A 4LVEA 1NEZG 1BMGA 4JGMA 4Y1AB 2OTWB 3D39E 2G9HB 4W68A 1WBYA 3ME0A 4YPGA 1NMCC 1NBYB 2HVKA 2ICEB 4QHNB 5SWSE 1XH3B 4KI5C 1W2KT 5JHLL 5E8OB 2WBJD 3EJYD 1YJDL 2IPKA 4NQCE 4MJ5B 1U8IA 3G5YA 4GRMB 4U1NB 4QRUB 4X5XA 4PJCB 3MZTA 4PUBL 3U1SH 1L4IA 2FJGB 5CZXC 1D5XB 3LDBC 1LVEA 1O7VA 5SX4H 2VNCA 5C0GA 4X4XB 1HQRB 2NXYD 3R06B 4PJGF 3QCUH 2UY7A 4IOSD 5FGCB 3HNSL 2D7NA 3OR7B 2ICWJ 4HC1A 1FV1A 1RJYB 4L8CB 3QDJD 1KENL 5DK3A 4NPYA 1OAQH 4NZRL 4LPWA 5KVDL 4TUKL 2ED8A 5I1LA 3V0VA 25C8H 2X4OB 4CADB 1UWXK 5I1EL 4YPJA 4LHUD 1E4WH 4F33A 2PYEA 3B6SB 4J1UB 1MREH 5MERA 1JZ4A 3NCJH 3MGTA 1YEIH 4JHWH 4ZPVA 3WUWB 5FB8B 4XNZB 3IRPX 3U30B 3F12B 3FB7B 4OD3H 1U2HA 4ZS7L 2AJXH 1X6NA 4YXKH 3ZSSA 2WWMC 3PQYD 1IEBB 1XF5B 4LSRL 3RHWK 5LGHH 1S78C 1ADQA 1PG7X 1UQSA 1E0OB 5E5MA 3MLWH 4W4OA 2V7HA 3NZHL 3P0GB 3CNKA 3QDHA 1B4JH 5DD1L 3RGHA 4IMKA 1INEH 5I1AB 5FHAL 3RGVB 4P23B 3QXDB 2EYRB 3QXVA 5KS9A 4QXGH 4R0LA 4XPBL 1L9MA 4JO4L 3VFOA 3IU3A 3LQZB 4LIQE 3N06B 3I85A 4I0PC 3ZE0F 1NBVH 3E8UH 3QWOA 1S7WA 4WUUD 5ESAA 1IM3A 2YD1A 4JPVL 1EUUA 4M5YH 2GIYA 2A77H 3EO9H 1Q72L 3E2HC 1UM4L 3VFGH 1F8TL 1S8DB 4L8DB 2E6PA 4GAYA 4DQOL 1HHJA 2XZQH 4JPIA 3WXVH 4S1QH 2DM4A 4O9HH 4BM7A 3F7RA 1ACYH 4OZFA 3IJYA 5DSCA 1W72H 2VABA 3HUJB 5F7NC 1PZ5B 2PW1B 4ODHL 2GHWB 2GI7A 1V7MH 4OIBA 2R0ZH 1G1YA 3DRTA 3W11D 1AC6A 2XOTA 3L3IA 4M1GL 3IRZA 1H8SA 5F93C 5JIKA 4BH8B 3DV4A 1NAMA 3B2VL 4MA7H 1RZJC 1UB6A 4PS4H 1NCAL 2VWEE 3MMEA 2Q76A 5GGSA 4LCIL 4AL8L 4CVXB 4XVTH 1ODAA 1IKFL 3MUHL 1XAUA 1CLZH 4XBGB 4NIKB 3TV3H 3EDDA 4NQCA 4HWZA 5D8JH 2VR9A 4U1GC 3SE4A 3OKOB 1NAMH 3U9PH 4BZYA 5ESAB 5FDWA 1S3KH 1U2CA 3Q3GB 4M1DL 5DI8A 4NM4L 1BFOA 4XGZA 4YK4B 4U05A 2DRUA 1N0XL 5EU4A 5MEPB 1I8IB 2QQLL 4FFVD 1HWGB 1SY6H 2MMXA 5T1DL 4R7NA 4UV4H 5IHZB 1S7QB 2JB6B 1KGCE 2VLJD 3QA3A 5TQ0L 1AQKL 5BO1L 5ICYB 1ZSDB 1D5MA 1ULVA 4XVSH 4HIJB 4GAJL 3V8OA 4NHCH 1P9MA 1RJZA 4JFYA 2NX5E 4PRNA 4NQVA 1C5BL 1AP2B 1U8QB 2EYSA 4NKIL 1FYTB 2E7CA 4JKMA 4U31A 4HUWB 1SBSH 2NY4C 3G5XA 3FB5A 4QYOA 5HHPA 5JQ6H 1MQKH 4ORGA 2R2HA 5I15L 5SWSD 1H3TA 3IJHA 3OF6A 4YGAB 2JTDA 1Q1JH 2I5YH 4OFIA 3T8XA 4OZIB 1ZWIA 4CU6A 3CJJA 4MDIA 3BKMH 4G6FD 3IAQA 5EU7C 1CLYL 4BQ8A 4ZUTA 1NCUA 1ZLWH 3VFTA 5DQDH 1QSEE 2H32H 4F7MA 4D0BA 4ZG1A 1LK3H 3IS0X 2DLTA 1KB9J 5TDPB 3U7WH 3F12A 4RMRA 2NYYC 2ZCLH 1UWGH 4CN6A 4DGVL 3FT2A 2VZUA 1N2RB 2FLBT 2R1YA 3IB4A 4HBQA 1CFTB 3V0WL 4J3SA 3VD7A 5F3BB 1E6JH 4O5LL 4UUJB 4PRPB 3P11L 2V7HB 4MVBC 3QQ4A 3B3IB 4JFOA 1NCWH 4PJ9D 4GKSA 4WHTA 2BP3A 4YDVB 1J87A 1JPGA 4JRYE 4PJHB 1DLFL 2PF6A 3QULB 3T3PE 3QEHA 4WI8A 3S7GA 3KPOA 3SJVB 5EWIH 4BSJA 1FIGH 2FO4B 1ZT7B 4HWBA 3RVTC 1NBYA 2HVKB 1ZHBA 3VE0B 2HJKA 2FGWH 3HR5B 1GPOH 3NMEA 3VU2A 3FB6B 1NGZA 1QHPA 4HS8H 1OQOA 4WHYH 5T1LD 3TYFA 4FQHA 5HHMB 5D7SL 4YBQD 1KEMH 4OKVB 5IWLC 2E9WA 3LHPL 5DMIH 2Q6WB 4MXVE 2DQDH 5TQ2L 3VFRB 3QEQD 3C6LC 3IDGB 4P4KB 4X5LA 3NZ8A 1OPGH 4R90L 1QLFA 2VDLH 3PDOA 5IMMB 3FOLB 1ZLUH 1Q94B 3BPCA 1NBZA 4P23D 2EYTA 3UROR 3WV0A 1ZA6B 2CD0A 3KLAB 5E2TL 2A2QT 1IC1A 4GQ9H 2IQ9H 2ILLA 3BP5A 4RZCA 5DJ8B 5SWSA 3RI5F 2JF1A 2QSVA 2XTJC 2KH2B 3L5HA 2DDQH 4G8FB 5FO7B 1B0WA 2QQKH 3JWNC 5CJXA 1ZOXA 1E4WL 3NH7L 1A6ZB 2EIEA 1R5WA 4P57A 4UUJA 2ZSVA 4PJ5B 1PAMA 4PJXF 3U79A 4AENB 4JG1L 2CLRB 2LABA 1P4IH 2Q7YB 4WTXA 1KB9K 3QUML 3RNKA 3WSQH 1CGTA 3KJ6H 4ZS6D 5FYKH 4RA0C 4BSWB 3BT2L 5IFHL 1RUML 5ETUB 5TGBA 3SDXA 3P9LB 3CU1A 5JIPA 1UZ6E 4PUBH 4HV8B 2H9GA 3EJYC 3SJVA 1DVFD 4KVNL 1NMBH 1WJ3A 1UC6A 2X4SB 4YIQA 5BV7L 1OM3L 5LQBH 4MJID 2NX5A 5DUMH 1R3KA 5F7DB 2VLRD 3C5SA 4XAWL 4J3VA 4LARH 3IF1B 5D9SA 4KKBC 4JFXB 4QRQA 3ZKMC 5HHNA 5HYSB 3CMOL 3UTSB 3STLB 2QADC 5GXBB 5E2UL 5KVFH 1H15B 4IIQB 4XP5L 1BIIA 1H3GA 1HN1A 3QFJB 4Y5XB 2DQEH 3EDKA 5DJAA 3NZ8B 2VLME 4NCDA 4F3FB 1ZLVH 2CDGA 1MHEA 3BJ91 4L9LA 2MCPH 3LD8C 3V8CA 1OWRM 3ARGD 3O2WH 2EDTA 5D1QC 3QFJD 3QSKB 4LHQB 1TENA 2GUOA 5J13C 5INDA 5HYJA 4QHLB 2UWEA 4QNPE 3V6ZB 4LSRH 1NCCH 5EZLA 3L3JA 4PJXE 4W70A 3AREB 3KXFB 4DVBA 1QRNB 3ZO0A 1J18A 3PDGA 3FFDB 5CMAB 4NUGH 5DEGA 5EU6B 3GSUA 3DX8A 5IUSA 3SY0A 5JORB 5FGCE 5TE4H 1NFIA 3PJSA 5JHDD 4MAYB 4ZFZB 3S34H 2X41A 1DP0A 2VXVL 4PRAA 1HKFA 5DMKB 5L8KB 3S36X 2HKHH 1PGRB 1I1CA 2ED9A 4HJJH 5JPMB 1QSEA 1AO7D 4YBLC 1IE5A 1JWUA 5C0BD 1MJ7H 3C6LB 1PG7W 3IETA 1A1NA 5I2IB 3MLRH 1PY9A 1MIMH 4YGVB 4PJXA 3TESA 1U92B 4EN3B 5MEQB 2J1KA 5E4EB 4LHUA 2D9QB 3MRBA 1UCBH 4U0RC 4I1NB 2G75B 3CVHL 4DN3L 4PJEE 4PPTA 2RQ8A 4ENED 4HUVA 4WI3A 3VFUB 3H2WA 4KRPB 2H1PH 3CFEA 2RCSL 1CE6A 4WI2A 2DLIA 2P5WE 4GAJH 2HTLD 2YPKA 3EJJX 3I6GA 3OMZA 1FVEB 5IFAH 1IBGL 3BKCH 1ONQA 4NNYB 2JJWA 3N1QC 4HWEL 4PJHE 5F7HA 1MCWM 3RY6A 3ARRA 3VXOB 5JPNB 1I1RA 4YR6A 4O2FA 2DQHH 5JW3H 4HF5L 2YS4A 1NUFA 2QKIA 1MFNA 3OPZL 1Z9SA 5B39G 3TO4A 1IEHA 2F5BL 4HPYL 4R0LB 4ZFZA 3WNMA 2FB4H 2DI8A 4L3EA 3PNWB 4OCLC 5KTEL 2BDNL 1U8JA 4Z7QE 2R2BB 2VLKA 3ILQC 1A7PH 4WFFE 4RIRA 1BD2B 2V5YA 1SYSA 2W9DL 5JA8B 3JTSB 1G0XA 1TZGL 4PGEA 2HYMA 1CGSL 3MZGB 5HI5C 2W07A 5EU6A 4ODTH 3TNNA 3A67H 1KXQE 1TLKA 1D5IL 2J6EH 4KMQA 3T3ME 1I8KB 2EIZB 2PCPB 1KTKE 3QXTA 4HPOL 5DT1H 3LDBB 1VSCA 2PN5A 4U1KA 1JZ2A 5C0IA 3TBWB 1WIOA 5D2LE 4EN3A 3LKOB 2GSIB 5E56A 1T5XA 3C2SA 4J6RL 4KZDH 3OJDB 2VLMD 3RVWC 1QSEB 1BPVA 3MA7B 4L8BA 1UB5A 1T20B 3Q6GH 4LGPB 2X7LA 5CINH 5E03A 5GS1C 3OKMA 4YX2L 3IAGC 2Q8AL 5EU5B 2APWA 1YEFH 3MV7A 5DEFA 1NLBL 5DJZB 5IB2B 2BXZA 4KPHL 1T7VA 3K1KC 1YEJL 5I8EA 3G5YB 4RSVA 2F8VA 4LVHB 1IGFH 3RWIB 4RRPA 4UTAH 1WZ1L 1JNHA 3VRIB 2AQ1A 4ZOAA 1VPOH 1FPTH 2ITDA 4GXUN 5F7FA 2IWGA 1PYWA 4GT7A 5K9OB 3THML 3PGDA 2V2TB 1AGEA 1XR9B 3QRGH 3X3FL 4MB5A 4NJAH 5I1IH 5C0RH 4OKVA 3WNPA 1T5WA 3V7AG 3OXRA 4LEXH 3TBSA 3DOSA 3HLAB 4GQPH 5IV2A 1QSFB 1BAFH 4JZJB 3V5KB 4TTGA 4ODUB 3K8MA 1B2WL 2HH0L 3DSFH 1T1WB 4IOIB 2ESVD 2YD3A 2WIIB 4XC3H 4KQ3L 1F4YL 3I9GL 1RIHL 2R1XA 4BSVA 1U8OB 3JUZA 4WVRA 1FIEA 2QQKL 2HT3C 1NUGA 4WEUD 1NLDL 4RWYL 1RZJH 3N1MC 5I1GH 3WS3B 1PW3A 2YN3A 1Q9WB 2OTUA 3MUZ1 4H8WL 5TDOB 1JI2A 6FABH 4YO0A 3TPUB 4G9DB 2D3VA 4R7DA 5KSBA 5T1KB 4BZ2L 5H94B 4PFEA 4EKXA 3O4LB 4I3SL 3VH8A 3EGSA 3VD4A 2DQJL 5F96L 4U0QB 5H35A 1GIGL 5E9DD 3T2OA 3NIGF 2YA0A 2VQ1B 2BZDA 1MJUH 1T1YB 4HJGB 1S7TB 3P9WB 3UZQA 1RUPL 4PY8J 3UJJH 1PYWB 5GRUL 1G6RA 5D96C 4UQ3B 4R90H 1UWEL 1C5CH 4KMLB 1IL1A 1JK8A 2FDBP 3V95A 2BOCA 2HFGH 4HJ0C 4XP5H 4KK6D 4ZUUA 4P3DB 2AJVL 5CHNB 4XMLH 2VLLA 4FTVD 3OR7A 4UOW0 1KIRB 4WFFD 1JNHB 1CBVH 4BQ9A 5J12C 3LEYL 2PR4H 2HJLA 4WFHD 5BJTA 2MFNA 2BVTA 5DA4A 2D31B 3KPSB 1IM9A 4OF5A 1RULH 3T0EA 2VTFA 2D2OA 3QIWC 5TDOA 4HGWB 4BUHA 3K81A 3ULUD 2A83B 4ZO8A 2XY2A 5FYKL 1CF8H 5CSZA 4XBEL 3MLSL 4WW1A 2V17L 5BRZA 2BVOB 1CD0A 3RUGA 5GSRA 3KR3L 1Y18A 4WV1C 1W0VB 3DIFA 3AREC 1EEZB 4HAGA 1A3RH 3JTSA 4M7LL 2B5IB 5JXAL 1MI5B 1MLCA 1WK0A 1I8KA 1SM3L 4NZRH 2VXUL 1EFXB 4P2CG 3TBTB 4ZQKA 3N85H 4RFOH 3ES6A 4XBGA 2GW5A 1AGCB 4P0DA 4ZD3H 3QJFA 3SHSA 4HBCH 2WLZA 1EZVY 4HUKB 3C08H 3B9AA 1MAML 1FFRA 4HS3B 5GS1A 1T1ZA 3OJDA 3TO2B 4NC2B 3AXLA 3BN9D 4LPTA 4P4KC 1U95B 3QDMB 3ZYOA 2JE8A 4H1LH 1ORQB 5KN5A 3H9SE 1OP3K 3WNOA 1CGYA 5KANI 3JV5A 1YDPA 2CR6A 3QIBC 4BUGA 4KKNA 2A73A 3QIWA 2PYEE 2RFXA 5GRVK 3UO1H 3QXWA 1IGYB 1V3MA 3CSBA 3DMMB 3C9NA 1ADQL 5DZOA 5E7BA 4ODHH 2IAMC 4L4TD 4MWFA 4NO5A 3FONA 3U7AA 1IKNA 1D6VL 1FE8L 3L7EA 4I77H 4PGDB 2C5DC 2Q20A 3KPQB 4NNPL 2H8PA 4PP1D 5GS2H 3VXRB 2PXYB 1S7XA 2BNRD 1S9XB 1KCSH 2YOCA 3EO0A 4JY4B 5CJOL 5FECB 3BWAB 2JKXA 4OBSA 3OJMB 4UOW1 1CR9H 5DS8A 2OL3L 4QNPF 4QRTB 2XWJB 4OFVA 2X5PA 3P3YA 4NQEB 4WGVB 5C09E 3VXRD 4M5YL 4HULB 4HKJB 3BKJH 4KDWA 2ZNXA 2AK1H 2AJUL 4Y5VC 5KOVC 4EDWH 1OGAB 3KLHD 4JRXA 4P9ML 4BFBD 1UM5L 2ARJB 3OF6D 1NC2D 5EOQH 3W81A 3SY0B 5JORA 4OZHE 4PTTB 5T1DH 3WFHB 5HGHB 3VWJB 1BX2B 3HMWH 35C8L 3RZCC 5D1XD 2R2CA 5L7XH 4JANB 2ZUYA 3M07A 5T3XE 2E3VA 1RZGA 3OBAA 1NFDB 1T21A 4ODXB 1RUQL 3L3OB 5I74B 3KPNA 3RGVA 2GQHA 4YHOL 2B2XL 1BM3L 4LBEA 2VMFA 1W0VA 3KXFA 5E7FA 4MA7L 5DHVH 3BH8B 3IFOB 1EAPA 1MQKL 4S1RL 5IVXA 4KRLB 2UZXB 4XNZC 2R1WA 1DEEA 1FCGA 1HK6A 3EW3B 4DGIH 1QP1A 1IAOB 1I9RL 3P4MB 3T08A 1IRAY 4J3XA 3QUYB 1VFAB 4KK8C 2F53E 1KELH 3H8NA 2OYPA 4GKNA 5D8JL 2F5BH 3WHXB 5E9DE 2GT9B 2WNGA 1MCOH 1KB5L 4Y16A 1UZ8A 1T7YA 1YNKL 4G6KL 4JREC 4YDKL 3DMMA 5CUSH 3MLTA 4Q9BA 1KIRA 5D2LF 4KJWD 3VXTB 5J1AB 5A16A 4CMHB 1JTTA 5J13B 2HLFD 4JPKH 5LCVH 1RPQA 1MVUA 1TJHL 2VDQH 5E8DH 1FL3B 3QEQA 4GMSL 4M7JH 4C83B 3DRQA 1YPZA 4C57C 5I1HH 15C8L 1DBKH 2XA8H 3T0EB 5LBSL 4DOHB 4NO5B 5GPRA 4OLVL 2W0FB 4KJPC 3QO0B 5EIIB 1TVBB 4K94H 4DUWA 2AV1B 4RQQA 2LU4A 2ZSVB 4PJ5A 1GC1L 3MRHA 4G5ZL 3MR9B 2HJKB 3QUZC 3MRKA 4NDMB 5E08L 1U91B 1FNHA 1AR2A 1IAKA 1AD9B 1G7HA 5EZIH 5FGRA 1WFNA 5TE6L 3C60C 1N8ZB 1FYTE 4P5TA 3WCYA 2NLJB 2O26U 3VH8G 3EYUH 1ZS8A 5D2NC 2AKRA 4PRHD 1CD8A 4HWNA 5ILTL 3RJDA 5IHUH 2X4SA 5DLMH 1QYGH 4LAJH 4F33B 2EDOA 4PG9B 2GSGB 2YPVH 3DETD 3QRGL 4ZPVB 4HK0A 3WBDA 1OPGL 3X3FH 2KPNA 4OLUH 4GRMA 5I0ZA 1PSKL 4QRUA 5KAQF 1N64L 1C12A 1AJ7H 5IB3A 2ITCB 5ALCH 5C6TH 4OSUH 3P30H 1QACA 4U1IB 2YPLE 3CH1A 1R3HB 3I6LD 4YK4C 2ICES 2JCCE 3V0VB 5CD3B 2DF3A 4FQQB 3X12A 5C6PB 1CXIA 1IGIH 5D7KE 5FF6B 2VZSA 2J6EA 4TYUA 1UXWB 2NTSP 5FKAB 2NY5C 4JRXE 4LRNL 4XBPA 3O45A 2Q7NA 4C56D 1N5YL 4MD0A 3CFCH 1OF2B 3QXAA 2QTEA 1FP5A 4A2LA 1IAKB 4JZJC 1F6LL 3MLXL 1MH5B 4P2OD 4NDMA 3FMGL 3CLFL 3MNWA 1W0WB 4NNXB 1KEML 1JN6A 3ARBB 1JMZA 3WFBH 2YA1A 4M48L 4HUNB 5F6HI 4X6DE 5D93C 4H20L 3S3PA 2YUZA 1N7ML 5E2VL 1BHGA 2BVQA 2VDRH 2DKSA 3TZVC 3LPGA 3B4NA 2VDLL 4OQTL 2WANA 2BFVL 4LL9A 3MOAH 1C5CL 5SWZA 4JFZH 1C12B 4LSQH 1UYWL 4NKOB 1XF3B 3PABB 5FUCE 1N26A 4GKSB 3OAYH 3MO1B 1TQBB 3WLBA 3E2HB 1R3HA 3D48R 2XNAB 3LKQA 3X13A 4HLJA 3NH7H 3UTQB 5D5MF 4LLVA 2PR4L 2VDKH 4LKXB 1DUYA 1BZ9B 1EK3A 3PHQB 3IFOA 4CMMA 4KVCH 2EZ0D 4LF3A 4P5TB 1MJJB 4JY5H 5BQ7B 5IFHH 4U2YA 1W0YT 4WW2A 1RI8A 3GKWL 5GZOC 5F1IB 3IU4H 3K4ZA 1FRGL 1PLGL 1HEZA 2ENSA 1HHGA 5E8EB 1S9KC 3FQTB 3T2QA 4YHLL 1B6UA 4MNGE 4NGHH 4OM0L 3MRNA 2R29L 5B38A 1HHHB 5H8DA 5LQBL 2KBGA 3KR3H 4OI7A 3GMOA 1UZ8B 4G8GD 3RZCB 3VFSB 5IMKA 5KZCB 3MRRB 2EKSB 3H9SA 5IT2L 1WEJH 4U6HA 4XNXL 2XKNA 2Z31A 1HZHH 3NACH 2BK8A 1QRND 4FQ2L 4R7NB 1RUAH 3R0NA 4NKMB 2YRLA 1RQ5A 2Z93B 5B39B 3ULUL 1KCSL 2QKIB 3IKKA 3DVIA 3GK8H 4YBLB 3JZ7A 4M1CC 4ZFOA 1KJ3H 3G6DH 2FYYA 1YMHB 2AJZA 2XN9E 4RX4D 4N0UB 1OLZA 4HUXB 4OFDA 5JUEL 5JIIA 3U0WH 5I8KL 3VXQB 4OLZL 4L8SC 4NN6B 1AP2A 4ZO6A 2G2RA 1T83C 1FDLL 5F1KC 1ZHKA 5HD8C 4D9RE 4AEHL 5HPMB 3OTTA 3IDJB 3P4NB 4LASL 3MLVL 4Z7WA 1HXYA 1AO7A 2DYPB 2QHRL 3O3AA 4O58H 3L7FA 1CU4H 1B6DA 5IHZA 3VD5A 1OAKH 1FORH 3DBXA 1H0DB 3VWJA 4CL7A 1S9WA 1JTPA 5AD0B 4TNVK 3DRTB 5DI8B 4DJMA 5JHDA 5C08A 1JHLH 1RHHA 4PJAB 1DSFH 3BKCL 1A14H 1HHGB 3FO2A 3V6FB 4YHYB 3HMXH 3O4LE 3DYMA 4FS0A 3U0TA 3BH9B 3IVKA 4EOWL 2NY7H 2X4NA 4QTHB 2DL2A 3PHOA 3V52H 4LRIC 4FFWD 2WIMA 3CUPB 4LHJB 1F6AB 3P9MA 1CDJA 3K8KA 5EOCL 3ZDZF 4D0CA 4Y4KA 1EFXA 4TTDD 4JCLA 2XWBB 2KDGA 2HFFB 4CADA 1TZGH 1YNKH 1J88A 2VITA 1BLNB 2OR8A 3NIGE 4EXKA 3E6HB 4G6AC 5DRWB 4UINH 4Q6IC 4G7VH 1B88A 1P84J 1F4XL 3A6BH 1FNAA 1SBBA 3TPKA 4AIXA 2F54E 4XWGH 3AREA 3B8SA 4YXLL 4Y88A 4DWHA 1NGQL 1HXYB 2RCSH 1P5UA 3O41B 3T3PF 1S9XA 1ZTXL 3IT8D 4XVJL 2Z8VC 3IGAB 1QSZA 2X4PB 4AM0B 2APBA 1OOAA 4NBZB 3VGAC 4K2UL 2BY3A 4KK6C 4CJ1A 5IW3A 5J89A 3CX2A 1QQDB 2IH1A 1KIPB 1SJEA 1DZBA 4O2CA 4LEOA 4Y4HB 1T3FB 4YQXH 2DQIH 1GGCL 3EYFB 3FO0L 2VXSH 3WLWC 4PR5A 5D71H 3N1FC 3BGFB 5H37G 4JFFD 3QNXB 5ILTH 3DUSB 2WQRA 5K93A 1IM3B 1J0IA 3HE7A 4XP9H 3LH2H 3VXMA 5GJTH 1YECL 4P5KA 2IGFL 1BEYH 5KSUA 1RZFH 2C3GA 4X6CE 5MHSE 5CEZE 4M6ML 3LCYA 3MRMB 3U30C 3RA7H 1TTFA 2HKFH 4S0TD 5FIEA 2J8UB 1WUNT 2AI0H 4FFYH 4LSSH 1CN4A 5A2KH 5DC0A 1G7MA 3S96B 2HT3D 1F4YH 5EO9B 3NIDF 3DO7B 3QQ9C 5D1ZA 4HIEA 2GFBB 2IBGA 3OAUL 3GGWB 3G6JB 1WAAF 1T66D 5CKAA 1MY7A 1JPFA 3FQTA 3ARGB 4YO0B 3TPUA 5JMOC 3QRFM 3O9WC 2Q8AH 4AH2B 1ZT1A 2HN7A 4R4BA 3FN3A 1RJCA 3BVNB 2Y5TA 2CRIA 4M43H 3TF7C 3ZT7A 1IGJB 1FO0L 1MCPL 3FN0L 4HGWA 3RWHB 4AEFA 4L8CA 5EZIL 1LEGA 1TMCB 2AEQH 3INUL 3VFNB 1YJDH 4RFEB 2V5TA 4EJ1C 5GISL 3S88H 4G6MH 4MNQB 3BW9A 2H32B 3SE8L 5MP6H 4HH9B 5DLML 2VC2L 4PRID 4U1JA 4QOKD 3RVVC 4Z8FL 1QFWL 1OT1A 4I2XA 4Y8AA 5CHNA 2QHLA 4P5TC 1MJ8H 1HYSD 1MWAL 2ADGB 3O4LA 2QSCL 2W0FA 4OQTH 2BFVH 3NOIA 2DQGH 1CI5A 1J1PH 2F19L 4P2QA 4GFTB 5C9KA 1NCBH 4FNLH 4QKXB 5JXEC 3ROOA 1CFSA 1ZLVK 4YIQB 5HDQL 3CDYA 4LLUB 3NVQA 5F72S 5CIPH 3TVMB 5I8CA 1WISA 4N0YH 4JM2F 3DUSA 3ZDXF 4H8WH 1RZKL 2UYLA 2UWEF 3QPQC 2BSRB 2EDJA 4WWKA 4LPYA 4HKZB 1EHXA 4R4FH 4CDHA 2P48B 5CJQH 1BREA 4F7PA 3M45A 1T04B 1QTYT 1J5OH 2JB5L 3MRMA 3RWHA 4BQCA 3IJHB 5D72H 3UP1A 1FFNA 1KYOK 2OLDA 2E9JA 3DTXB 5CBAB 5F7EH 3DX7B 4X4YB 3VXMD 2AKRB 3MYJB 3BD4A 4PJDF 1X5HA 2F74B 3CH1B 4HD9A 2IALB 1A22B 1KPUB 4MQXC 3BHBA 4PYHA 5ICXB 2VQTA 1KUMA 2B1AH 5BS0A 1KENH 3G6AA 4JFED 2JK5B 3LY6A 5SX5K 3O2DH 5CD5D 3VD9A 4PG9A 1VFMA 3G6DL 3KXFD 1SQ2N 5HYJE 1OLLA 3IXTA 2AXFB 4P2RB 4LSUL 4OLZH 3O9WD 3BO8B 4N1EA 1GL4B 5DJYB 3U4EB 1F8TH 2CGRH 4JN1L 2ADJA 1Z6JT 4NQCD 4X9BA 1IGJA 5IEHA 5F9OH 1JGLL 2F54B 3HG1B 2E27H 2AV7A 5IB5B 1LO3L 4LU5H 5LJYH 4MB4A 2OI9B 3ALXA 1OAUL 1RZ8B 1YNLL 4UIKH 1FL6A 5KVEH 1A9BB 1UH3A 3LN4B 4LCYA 3WDJA 4GRLC 4GRLD 4ODBD 2CMRH 2VZ1A 3NZHH 5EBWA 3NCMA 2PXYA 5CEXB 1LHZA 4CVWA 1F90L 3FRUA 1F02I 4B5EA 1ZAGA 4EIZC 3T0EC 3C60B 4KH2A 4MD5B 4ODSL 4JB9L 1MHHA 3ARFC 4P2YA 4XHJD 4U4BA 3GSQA 3OKNB 3WDHA 1V5JA 3PL6D 4RNRB 1G7QB 4I18B 4LLDB 4GW4B 1CLZL 2WLYA 2YN5A 4NC0B 1FAIL 1PX4A 3L1OH 1PKQE 5FV2A 3W0WA 1IFHH 1PD6A 2AXFA 3HC0A 2X70B 5IVNA 1DR9A 5A2JH 3HB3D 2X2YA 4UINL 5EIQA 5GGTA 1L6XA 3DXAB 5AZEL 1Y6MR 5EO1B 1A0QH 1ZLUK 1JMXA 3FQWB 1FLRL 3HUJF 2XZZA 2NY2B 4NRXB 4OF0A 1JF1A 2RB8A 4NKMA 3EYVB 2Q86A 3ARWA 3GIVA 3CVHB 3PG2A 1B0GB 2DWEA 4UB0H 1T1XB 1I7ZB 4R2GD 3SQBA 1Z5LB 3MNZA 4MA8H 5DRXB 1DQDL 1UGNA 4ZFGL 4OIAA 4XTRC 5HHOD 4OF8A 2H9GB 3QFDB 5FYLE 2NY7L 1HQ4A 4JRWA 3M1BA 4M6NL 1OAZL 4OLYL 2CLVB 1AGFB 4HT1L 5DHVB 5KS9E 2FBJL 4EUPA 4LIQL 2BHYA 5FAAA 2VLJA 4UNTA 4EDWL 2YEZA 1H3PH 1KJ2L 3MROB 4MJ6B 1OD9A 2GJ6A 3UDWA 1G9NH 1S9WB 2BMKA 2AXHA 2Z4QB 3B8YA 3AY4C 1HYSC 1N0XH 4IRJA 3OGOE 4KC3B 3RU8H 3WS6C 1KPRA 1P9MC 5HHNB 5HYSA 5INDB 1IC4H 4OGYL 4NN5C 1C1EH 3IFLH 3VFOB 3MUY1 2NXYC 5AAMA 4FTVE 3S98A 4XZUB 4C4KT 5ECJE 4NC1E 3HB3C 2OP4L 1HOCA 5SX5H 2FEEL 5DVNA 4MJ2A 1NFIB 4K07A 5LAXA 1KJVB 3DURB 4N0CD 3L5JA 4L8DA 2I9LB 2EO9A 1N6QH 1Y0LA 3FQRA 4XWOC 5F7WC 1ZA6A 1GGYA 1HCFX 4GSDH 5IHUL 3IDMB 5EZLB 2P8MA 3JTTB 5FXCH 1FZOB 1QEWB 4WEBL 4ZUSA 4KV5E 3BN9C 4ALAH 4G8FA 3DVNB 4P2RA 4GLRI 5F3HA 5I6XB 5L8JB 1TTUA 1TVHA 3HTLX 5D7IF 4L3CB 3RQ3A 3NTCH 5EN2A 5C0AE 3U83A 3QIBB 4KTEH 2XZCL 3TT3H 4TUOB 2NXZB 4IRZL 1TJGL 2X6MA 2C3WA 5F7KC 4E42B 5DJ0B 5I6XC 4FNLL 1VKXA 1EDQA 2J8OA 5E6ZA 3BGFC 2NW3B 3NGBB 4L1HA 3EYOA 1KT2A 3WLWD 4JRYD 3ZDYF 3TBYB 3GMNA 1GC1H 2IG2L 3L3DB 1OSZA 3FT4B 5CEYA 1N0LA 1WBZA 3TJHC 4NNXA 1VADB 4OZIE 3RY6C 1KIUA 5I1DA 2NY4B 2ZPKL 5IBLC 1P4IL 3PP3K 4U1NA 1NGPL 4OCRH 5BJTB 4TN9A 3MV8A 4P46D 3DURA 3TGXA 3LRGA 4OF3A 3GIZH 1QQDA 2IH1B 4RGNE 4R4NC 2JJUA 4XP1H 5F1NB 4D9LH 3WL9B 2I9TA 1NAKL 2NY3C 3SEPA 5IIEB 1MAKA 3WFEH 3VG9C 3QDGA 3PWJA 3CPLA 3GSXB 4PJFB 3MV8D 1I7UA 3D9AL 3UYRL 1PSKH 4G6AD 3ARGA 5E00A 4LSQL 3QUKA 3DSNA 5T3XD 1OL0A 4MCZA 2MKWA 2LFGA 4NO3A 4L4VB 5C0IB 1XT5A 3BUTA 1WCBA 3DGCR 3F7QA 3VW3H 3CZJA 3RPIB 3L5XH 2EE6A 2H32A 1VKXB 2MCPL 5DRZB 2X7LB 1G7MB 1IGTA 3S96A 1H8NA 3I02B 3IJSA 2DWDB 4ZS7H 3D85D 4GMTL 1HQ4B 5F8QC 5DUPL 3MLXH 3QIBA 4MB3A 4APQD 2ZUVA 1AXIB 3BWAA 3F58H 5DC4B 1YNLH 4UIKL 3QCVL 3F7VA 2YSSB 4DGYH 1NC4D 2HVJA 2I60L 1T7ZA 8FABB 2P5WD 2GTZB 1JNNL 1ZA3B 1FGVL 5LVEA 3HHRB 2IC2A 5EZOL 3GUTA 4H20H 1RK1B 2HFTA 3MOBH 3B83A 5DJDA 2GJZA 4BYHA 4YZFF 2X4UA 1FNGA 4MA1B 5KSAB 4WRLA 1XIWC 4YDVA 1CD1A 5C0CD 2VXVH 5IQ7L 1EMTL 2FH8A 2Y5EA 5B3JF 4HWBL 1DBJL 1CG9A 3C60D 5M95B 1UVQA 5BVPH 4ZPTA 5SWZD 4N9GB 4DKDC 5DD3H 4GAGL 3IDJA 5AYUH 1JF5A 1AGBA 1Q9OB 4PRDA 2XRAL 5ESQA 4TSCH 1UKQA 3L3GA 4F57L 1FH5L 1MFCH 3BUYB 1CDYA 1D5ZA 1QSFD 4ZOBA 4DZBA 3WXVL 3HRPA 3VFWA 3HNTL 3O8XD 2AJXL 1R5IB 2E27L 1FYTD 2A6JA 5C07B 4JANA 1VFAA 2GTWB 1MY5A 3G04A 1X9QA 2I27N 5ABDE 1ZGLA 4LLMA 3DX9B 4AJ0A 1IKNC 2DS4A 3T0DA 1U8JB 5C0BA 3V7AE 4EOWH 2FIRT 3E3QC 3BP6A 3IDYC 4CVXA 5LGJB 4HF5H 2EDKA 3DROA 4F9LA 1NBVL 3U4EA 5ID1A 2FBJH 4LLVB 1O7SA 3U0TB 2OL3A 3ZTJG 3RVUC 1I8MB 4CBPA 3B6SA 2BDNH 2KUTA 2DKMA 2DMCA 1PQZB 2I07B 4MLIA 1MCNA 3GBML 4JDZB 4J8RA 1HXMB 3LOWA 4ETQA 4WY7L 2FLRT 1UCBL 1A3QA 4UV4L 4POYA 3C09B 3IXTB 1MCKA 3GMMB 5D7JC 5D9SB 3QFJA 4Y5XA 1T89A 3D3VD 1JPSH 2NMSA 4X6DB 3QXUA 4F7EA 1FG2A 2EH7H 3UTSA 2F5AL 5J9PB 2X9XA 4P2RD 3EAKA 1M7XA 43CAA 4XCFL 3CFKA 5TE7L 4GW4A 5C92A 3BJLA 4UZGA 1MF2L 5GSRB 2HTLC 4BSWA 5FOBA 4L9LB 4ZFOB 5BRZD 2FYYB 3UZEA 4F3FA 4JFDA 5BVJA 1GGCH 4F8QA 5C0FB 1I4FA 4JKPL 4TTDC 1BP3B 3DXAA 4F15C 1CIUA 3CDFA 5JDJA 1ZMYA 3P73A 4Y5YB 3KYKH 4RAUA 4KJQD 5AWNL 2Z8WC 3P4NA 2AEIT 5AEAA 3MQIA 4N0RA 2JCCB 1II4E 1IARB 1A7PL 3MRJB 3MRLA 3QO1A 4PP2B 3SDDD 5DGQA 3FFDA 5CMAA 1T1ZB 3L3JB 2GJ6E 3TO2A 3A6BL 4ODTL 2ICWA 1RZFL 4U6TA 4AMKH 5EDXA 1HE7A 1KB5B 4YHNB 2VSDA 4XNUH 1CTOA 1UG9A 2FCBA 2GFBA 2LVEA 2YZ1A 5IB3B 1MFBL 4Y4KC 1JRHH 1N3NA 5IJVB 3S35X 4Y2DA 5D7LA 4O5LH 1F3RB 4NZUH 3LIZH 3V4PL 1J12A 2XXCB 1WZLA 2ERJC 3CAFA 4F37K 1GSMA 2IG2H 1MCLA 4PP1C 1UENA 4L4TE 1DQLH 2M8XA 4WFHE 4FTVA 2HAZA 1A5FH 4LVOB 2CH8A 1Z0MA 3HG1D 2Y1VA 3QCTH 4Z0BH 2OSLB 3BPNC 4CVZB 2WBWB 3KLSA 1HHIA 3PXHA 2LU7A 1GGBH 4UAOB 3ALPA 3GI9H 3D85A 2APXA 1VEPA 2OTWA 1U8MA 4IHOB 5DVMA 4Z5RB 2M1KA 3OKLA 4LPXA 2ZUWA 4MNQE 3EFDL 3LHPH 1I9IL 5C70A 1MUJA 1V7NH 3SDCD 1N4XH 3GBNH 3PHQA 5EBLA 4KK9C 3NTCL 2Z8RA 3D0VB 4U1LB 1MH5A 4MHHI 3CFIC 4UU9A 1FSKC 5F88B 2ZCLL 3B9VA 3RI5K 4LEXL 4D8PB 4FXGA 3UAJD 3LD8B 3JVGC 4HEME 2ICWB 1HINL 1YMME 2A38A 3LQAL 1OB1A 3E0GA 1Z3GH 5CSZB 4Y5XC 4M02A 2GK0A 2APTA 5C0GB 3QHFH 2EKJA 3BMVA 3BEWB 2YPLA 1MCPH 4ZYKA 3RL2A 1AR1D 4FABH 5C2BH 5EUOB 3ZDXE 4L3CA 3OKEB 2K1MA 3SOBH 5I71C 4LSVH 5E8OA 5ENWB 1CGVA 4JQXC 2P47B 3SQOH 3TIEB 4DK3A 5M7QA 3QIWD 5J1TC 2I25N 4ELME 2XWTB 3LKPB 5JR1L 4K3EL 5DMIL 1GXEA 2P8MB 3JTTA 5ICYA 4GBXB 3UX9B 1ORSA 1KNOB 5FGBC 3I50H 3ZKND 3EYOB 1KTLB 4H26B 4M62H 5JXAH 1WBZB 1MAJA 5IQ7H 4XC1H 4OCMC 3VXPB 1B0RB 1KIQB 4U1KB 2LE9A 5M94B 3PGFH 4Y2DB 5D7LB 5ALBL 3SDAB 4UIMA 4A6YA 4PRPA 4LSUH 2EH8H 5JLZA 1RFDL 1CXEA 4U1GB 3QO0A 2LVCA 2CGRL 4KRPD 3NCEB 4M61B 5IOPA 3PXJA 4RFEA 2W1NA 1C7SA 3PUCA 3RRQA 2IF7A 1ZT7A 4JFHE 3PHOB 2Q8BL 2NY1D 1Q9KA 4XXCC 1IC7H 1G7HB 4G8GA 4QTIL 2V2TA 4PJDA 2NY2D 3CUPA 3L3DA 5F97E 1J0ZA 1BVKA 4EN3D 2R23B 4ZSOE 4L9DA 4Z0XA 4YZFE 4M93B 1G7LB 5F7EL 1JNNH 1U8HA 2IPTL 5EIVA 3GMQB 5HVHC 1T1WA 3C6LD 3FFCE 5D7IE 4M93C 1DVFA 4HXBH 3V5KA 2YMXL 4K9EL 3LSOB 4P9HL 4GBXD 3P4LA 1OP5H 1GAFH 5I18H 2DQUL 1HHKA 2A74A 4V1DD 4FQCL 4JVPA 4JFQB 1LO0H 4PJ7B 4GRWE 3L95B 3OG4B 2ZWLT 5BS0D 2W59A 5KZCD 4WCYH 1LO2H 2YXMA 5L6YH 1GGTA 5MI0C 3BGAA 3UTZA 1QRNE 2W60A 4LVNC 2MNUA 3DV4B 4DN4L 1JCKA 1FH5H 1LQSR 3EOBB 2GJ6D 1UM5H 1CDCA 3ET9F 3D2UA 5ERWB 5FYKD 5C08E 2H2SC 1FNEB 3HNTH 3BZ4B 3WN5C 3VFUA 5AD0A 1BGXH 3G9VA 4YAQB 3P4MA 4UNVA 2OR9H 2E7LA 2VITB 1A2YB 1RUQH 5HGDB 4KXZH 1YEGH 4OJFH 3K1DA 4ZFGH 4NQCB 4UBDC 5KSBF 1MEXL 4I77L 3NCBB 2YSSA 4ONGL 1PG7L 3HAEG 3HPJB 4FFZH 3VXSE 3GIVB 4OZFG 3RVWD 4UDTA 3HPLA 5HXMA 3W9EA 5CJOH 3SGDI 5ACZB 4MSWB 3FRPG 3WNKA 1JGVL 1FNGB 2IFGA 2YUXA 5KSAA 3RZCD 3UMTA 5FOJA 1NSNH 2UY6A 3CFJA 4ZUVA 5I0DA 5CUSL 2IBZY 1AE6L 3CXHJ 4I2XE 1JTOA 1FVCB 1P7QA 5L2KB 4NZDA 3I75B 2AS5M 2K9UA 3HMWL 1I9EA 4QXWA 4LSTL 4JPKL 4A6YL 3L3GB 4OF7A 4X6EA 1CZ8L 1ONQB 2H2PC 4PGZA 2C9AA 4QHMB 3WO4B 2J88H 4DZBB 1TFHA 1K5NB 1BJMA 2E5EA 3DJ9A 4RRPG 2DI9A 2CRZA 1WVZA 3HE7D 3PJSB 4HHAB 4YBHA 3RDTC 1OGTA 2BOBB 3DX9A 3CK0L 2FX8H 3B9KC 1WT5A 4EZMA 5GRYA 3VG0H 4KTYA 5E08H 1F4WH 4GRLA 1U6AH 4ZUWA 2PETA 1KTLA 3IDNB 2ZCHL 3ZHKA 5J1SC 4Z78A 4QXUL 1RD6A 4J23A 5C71A 5I2IA 3BP7B 1CICB 3CSYB 5DDHB 3QQ9D 2CDFB 3MFFB 1MCEA 4RAVB 4ELMB 4ALAL 3VXQA 3B3IA 3VWKB 2A6KA 5DMJB 4QOKB 3JVGA 3G08B 1QFUH 4UI2A 4RDQF 2ZCKH 5C1MB 3W2DH 3MRIA 1MVFA 2RIKA 3G9AB 2YD7A 5DA0B 4PJEF 4N90D 2CJUH 3NCYP 4J6RH 4EI5C 5E6IA 4L4VA 1QA9B 3P0YL 3PV6A 3S36H 4JGJA 4JQVC 4X7TA 3MLUL 4JY6B 4HIIB 1A7NL 3ZTJH 4P5MB 5E5MB 2HLAB 5DUBB 5C0CA 2IADB 1Q9WA 2OTUB 2HFEB 5D1XA 5HHQA 4Y1AA 2NY5H 3NA4A 2V2WB 2DM7A 3BHBB 3SPVA 2C1PA 2AGJH 1CFSB 2HJFB 1GOHA 5JDSB 5KW9H 1JZ7A 5HVWA 3JWOH 4RGNB 2CKBH 1XGPA 2R2EA 4ZUWB 5IMMA 5KVGL 2Z35B 4PGBB 3VFMB 3N1PC 2ZOLA 4L5FH 4U1JB 4JFFE 4TNVF 5BOPA 1WF5A 4KQ4L 4NQUA 3K8LA 3DI3B 5DURD 4M4PA 3BPLB 3QUXB 4RDQG 3WHE1 3HNSH 5IBTL 4MCZB 3MUGB 5ESVA 4EDXA 1IAMA 3PWUA 4ODVL 1EEUA 1K6QH 4OCWL 4JRYB 4CMHC 2ICEA 2XPGB 3BQUD 1KG0A 1P5VA 3B5GA 4OSUL 4GG6E 1VDGA 1P7QD 2WWMD 2IBZX 3WS3A 1JBJA 5DD5L 5DD0H 3KYMA 1I7UB 5DVOA 4YEEA 3DLQR 3ARBC 1RZJL 1I85A 1GCFA 4BQBA 3D5OF 4X98A 5DEFB 4WEMB 2XWBA 5CZXD 5FUOL 4U6YA 3KYAA 3DYOA 1TCRB 1C08B 4U7MA 2Y6SC 5GQBA 1KJMA 2G60L 2P1YA 1EV2E 4J3TA 2ICCA 4JFEB 3V0AC 1DEEB 3MV11 4K3JH 4IMLB 5IVXB 1MUJB 3FQXB 4H88L 4HUUB 5LGHL 1FL3A 4RAVA 2WUCL 2EC9U 4Q2ZA 1QBAA 2ZZUT 4U7KA 1HH9A 1H3UA 3ZTNH 3UYRH 4WW2F 4YHYC 2X09A 4IOFD 4JY6A 2FGZA 1B9ZA 2P46B 5DJ0A 1F2QA 2GT9A 1FGNH 4LKCA 3C09C 3FQWA 4J12A 2WZPD 1WWCA 2ZUQC 3N85L 2X9WA 1JGDB 1LO0L 1DANU 4TUKH 5CJ5A 4GW5A 2DYPA 4HBCL 2VUYA 5JMRA 5EU5A 5ICZB 3RVXD 1NDMB 5I76A 1LK2B 5T3ZD 3DO7A 1FFOB 1CBVL 1TETL 4XP4L 4MHHG 3L3KA 3RWCB 4W4OC 3GJFA 2E7LC 4JO3H 2MJWA 4JFYB 3KPRA 1FL5B 4GXVL 5MI0B 2C1PB 1S7VB 3IXAA 1TNMA 4WW2C 1OW0A 4R8WH 4E41D 4GRWH 4URTB 1FORL 4M7ZB 4C55A 3GSRA 3QDMD 4AZ8A 5KS9B 3JXAA 3MLSH 4WFGE 1IQWL 1G6VK 4G8GE 1KN4L 3BGMB 3RVTD 1X5YA 2X70A 3SDXF 2NTFA 2R56L 4WTZG 1LILA 2V9QA 5GZOD 1ZWIB 3KPQA 2VE6A 2HFFA 4L3EE 4Y4KB 3QIUA 3LB6C 1BQHA 4NQDE 4OGAC 3FZUC 1RU9H 4UV7H 1R24A 4R2GB 4QRTA 4LQFL 4QGYA 4EI5A 1I7ZA 4OZIF 3ULVD 3HPJA 1U95A 3QDMA 2IPUK 1HILB 3NIFE 4Y19B 5JPMA 3PIQA 3RX5A 5HSFA 2EEDA 1RIUL 1HSBA 5CGYD 3OKDA 3SGEH 2DWDA 4EUPH 3HR6A 4S11A 3GM8A 4B53A 4DZ8A 1LK2A 1OSPH 3I6GB 4Z7VA 5EO0B 2CIIA 1U8HB 2AQ2A 3ZKMD 1VERA 2PW1A 1QFWM 4YFEA 3SDAA 4S0SD 2BNUB 3RWDA 4NKOA 2QHRH 4FMFA 4OZGA 5KJRL 3V6OC 3MLZL 3QZWB 5JPNA 1REIA 1G84A 2RHEA 3MJGX 2P5EE 1ZTXH 3MMEB 4TVPD 3D25A 4RGMB 1NFDF 5F7MC 5FYJD 2VB5A 1B4RA 4PJIE 4LHUB 4LCUA 3ZT5A 4XCFH 4YNYA 3SGDH 2W92A 1NDGB 1NDMA 3BAEH 3PDDA 5I16B 5CWSA 4XXDA 3QIUC 5DS8B 3MUJA 4NN7B 3RWCA 3MNWB 3AAZB 4BK4A 1MCFA 1P53A 1J8HA 1LDPL 3LQAC 3Q1SL 4PJCA 1HCVA 2BSSB 5D6CB 2YRPA 3OXSA 1P7KB 4WWKB 3JV4A 1AY1H 2DBLL 1K9TA 1FNEA 2WAHA 2E8YA 5C7XL 4PLNC 3MRRA 3MBXH 2Z0BA 3D18A 1R3IL 3OHXA 4IEFB 1U3HD 2P5EA 3E1F1 2NTFB 5T3ZE 4AMKL 3ARUA 2AEPL 2ZKHL 5CJXC 2CSPA 3MYJA 4WHDA 4GW1B 5LCVL 1TJHH 2VDQL 4N8PA 2DD8L 1DUYB 5IJKA 3WEXA 3CDGB 3O6LL 1KJMB 2Y25A 1MSPA 2EDFA 5ADPL 3DX6A 4YHPB 3K46A 2XG5A 4PJ8B 4WDIA 5GS2D 5T5FL 4C56B 2VAJA 4QWWC 3TC9A 3SKJL 3MGTB 3EJZD 4U1MB 3VRJB 1NC2B 4PJBF 3S37X 4S10A 4YAQA 1YQVL 1SBSL 2NW2B 4MNQA 4KMTL 3L7FB 4QRRD 2FJGA 1BBDH 4X0KB 4XCEB 3LV3A 3EOTH 4WI6A 2AABH 2VLRE 4Z0BL 5GGRY 5I17B 2AGJL 2BNQA 3HAEB 5FM5O 1Q1JL 4Q9QH 2V2WA 2J4WL 3RWIA 5IESL 3QUYC 2EO1A 4U1LA 3FB7A 1AD0A 3RWJA 4I4WB 2B1HH 1CYGA 1ZXQA 3PGCB 3O11A 5ACLA 2HA1A 4P3CH 4XP6H 5HTSA 3VXUB 4XAKE 1NGXB 4LSPL 4HQQL 1YECH 4OLUL 1J0HA 4N68A 4NKDB 4PBVC 2UYLB 3IDYB 2HWZH 3U36B 2C4XA 1S78D 3CXHK 1LNUB 2B5IC 5C09D 1EO8L 4HKZA 1X5FA 3TCLA 4FFYL 3LKNB 1S9VA 3ZSTA 25C8L 4K8RH 4PY7B 4Y1AE 3HR5A 1YZZA 3WFDL 3LEXB 3FKUS 3T0EE 3TZVA 5CSBA 3BXNA 3BZFB 4YFLI 4PJHF 3AFLA 3O3DA 4I0KA 5CBAA 3ARDB 1XF5A 1CICA 1V3LA 3CSYA 2OZ4L 3KYMB 3RFZC 3AMLA 5I19H 1CD9B 3QUKB 1Z9OA 1MFEL 4LDEB 1N5YH 1WTGT 3Q6FB 5C2BL 4IDJH 4OV5A 3KPSD 4YHKH 4OLXL 3V6OE 4YFLF 5HI5D 3PDOB 5EPMA 3CCHA 3W82A 4R4FL 4DW2L 5I9QB 3O6KH 4PJBE 3QWQB 1KTRL 1QVOB 3BT2H 3MLWL 2EE2A 5FUCC 4U1HA 4H88H 1KFAL 5IK3B 1JHKH 4D2NA 4RAHA 4ZODA 4KVNH 3QDGD 4Y4FC 3RWEA 4WNQB 4I4WA 1B0RA 1A6WH 3WUWG 1X4YA 3MRFB 5DRXA 2BERA 3KPNB 4LARL 1LP9A 5BMFH 3ZDYE 3DGGB 4X0KA 1G6RB 1UYWH 4XCEA 5HGGS 5E2UH 3SKMA 5KVFL 2J2ZA 3UJTL 3PP3H 5HHQB 2Y6SD 1F97A 1TVBA 3IFNL 3BPOC 1DJSA 2NY3B 2GK2A 1CLOL 1T6VN 1ED3A 4JVUA 3VFGL 1L9NA 1K3IA 5I9QC 4Y5VB 3SCMA 4KUZL 2X40A 5DFTA 2ZUXA 3LS5L 4JO3L 4KKCC 4PJAF 3RIAK 2R8SL 5TDNB 3O3BA 4NM8L 1QNZH 1JGLH 1I1AA 2BVPB 3HE7B 3T0BA 1SMOA 4XVUD 1BJ8A 3LRHA 5F7UA 3DUUB 5FYKU 4X99A 1U41A 3SCMD 3NA9H 3RUGF 5D1XB 5HD8D 4JHAL 1TNNA 4F7MB 3QQ3A 1FBIH 4AH2A 3NN8B 1K8IA 2WBJC 4TPRH 1INEL 1NANI 2I07A 2WWKT 1IVLA 2R0KL 4D8PA 3I6LE 4PGEB 1Y6KR 4PR5B 2X4RB 5AZ2L 4MD4B 3HPLB 1QRKA 3CLEL 1XGQB 4HUWA 3KPMA 4LCIH 1CE1H 4AL8H 3QPXL 4MAYD 5ITBH 1T2QL 5ALBH 2A73B 2EDBA 3QIWB 5F6HJ 1LO2L 1OP5K 5FA3A 3HN3A 3EOBA 2Y72A 2D0HA 4PRBB 1JWSB 4PJ8D 1K3ZA 4HMEA 2WM0A 5E1AA 2DWEB 3U7YL 3IDMA 3CFKB 3QZWG 4RMQA 1PX3A 5SV4A 3CVHA 2CKBB 3EO1B 1P2CA 4JREB 2VZVA 4OB5L 4RGOL 1K4DB 4GXVH 1VGEH 4D0BB 5I1JL 3GSOB 2VDOL 2EE9A 2KZ1B 2YUWA 1GOFA 2D7TH 4ZMAT 3MV7B 3B2UD 2N7AA 4LNRA 4PYGA 5F6IB 5GRVL 5B8CB 4NUGL 1V7ML 2R56H 1E4KA 2DIBA 1YEEH 3WIIL 2G5RA 3GO1L 2BNQE 3BRGC 2YD6A 1SHMA 4OD2B 3JV6B 1TIUA 2X4NB 3MBEA 5FYJE 5TFSH 1R6VA 5DTFB 4RCAA 5J7CC 1ND0B 4FQIH 5K9JH 3QWRA 1FL5A 3VGBA 1QBML 1FVDB 4JM2D 5JUEH 3P2TA 1R0AH 3OWEA 3VWJC 1NSNL 1GZPB 2A77L 2H8PB 1QSVA 4Y5YA 1GZQB 2PW2B 4UT9L 3WJJC 4L3EB 5HHXL 1MHCB 4KKAC 5IVZB 3NN8A 1JGDA 1CGSH 3BIAX 2I26N 1IGMH 3STBA 1CU4L 3AS3A 1U93B 4A6YH 3VXOA 4JJ5B 1YNTB 2CKBA 3EO1A 1X5LA 5ANME 4JKKA 1F6FB 1NBZB 2UUDK 4ENEC 2DQCL 1YEGL 4OJFL 3OJ2C 1U3HA 1JNLH 4M6AA 5HJ3B 3I2CL 1T21B 4ODXA 4TRPL 4XCCL 2JIXA 1HIMH 1YN6A 3RWEB 2UV3A 3VG9B 3U82B 2VQ1A 4KDTC 3GSNB 4BJLA 2W9LA 3TIDA 5K9QG 1V05A 2BY1A 3QP3A 3X13B 4AENA 3ULVL 1MFDH 3H9HB 1V8HA 2Z35A 3IDIB 2WV3A 4JM2C 2LTQC 2F74A 1KTDA 4IRJC 4ZFOL 3QG7L 4Z7OF 5J6GB 5E0QA 4ZXBB 3OR6B 1A7RH 1XZ0A 5GRJH 4NM4H 4FXKA 5DQDL 5I30L 3WNNA 1Z2KA 1HILA 1UEYA 5IHLB 3GMNB 3SGKC 1A9BA 2G5BB 2QQLH 1A6PA 1CK0L 4LLYA 43C9A 4OFKA 3CC5A 1AGBB 4QHLA 1BQLL 5DMGD 4NFDA 4N0FA 2ADFH 5IJKC 4JHBA 1A3LH 1HQRA 3R06A 4X80H 4XCNB 4PGJA 3O3UN 3V4VH 1BJ1J 1IT9L 4KJPD 4Z7UA 1RIHH 5EU6D 2ARJQ 3D6GA 3Q6GL 4LMQE 1DBMH 1Z0NA 2CRMA 4ERSH 2BVOA 4UTBH 1LDSA 1SJHA 1FCCA 1ZVYA 2P7TB 1MPAH 3TO4C 2GK0B 4CVZA 2BSTA 4OZGE 5KW9L 2HLFC 1FNSH 4H1LG 4R9HA 1UJ3A 4MDIB 1F3DJ 1ZK9A 5F7DA 5TH2A 5CGMA 1JF6A 2P8PA 1LE5B 4HFUH 3TIEA 2XYCA 5I71B 1NQBA 4UQ2B 1CFQB 2YKLH 3WKML 3ES6B 3GNML 2ATPA 4KTDH 2HRPH 3QEUA 3ZDZE 3FB8B 5EBLB 4ZTPL 3VGHA 3NAAH 4PREB 5KBNC 1SY6A 2F53A 5EU3B 1SYVB 5DJ2B 3WMSA 3GHEL 4GKZA 1TZIA 4ONFL 5ENWA 3H6JA 4NO0B 2DQGL 3DHJA 1MIEH 4PJBB 1TVDA 4FXKB 5GHWH 3V6OA 5IVOA 3FTGB 3WFZA 5F7YC 3AM8C 5AUMB 3U48A 2NY2C 4N0FB 3O45B 1EO8H 3HI1A 3CC5B 1LP9B 3BDXA 3IFNH 3X12B 4YDLC 5E4EC 2C1OB 4Z7UB 4HUUA 4NC1C 4FQQA 4WO4B 4M43L 4MJ6A 3CXDH 5DVLA 1KCUL 2EEAA 2VLJB 5JW5B 4OD1L 1EGJH 5CCKL 4TOYL 4JZOB 2AQ3A 5DD6B 3C5JA 2HJLB 2GITB 4NO2A 4NM8H 3ARFA 1GPOL 1EXUB 2HT4C 3VXUA 1S7UA 4WENB 4H1LB 1NKOA 3NFPA 1OAXH 1CL7H 4XI5D 4K94C 3MRGB 4XNQA 2NY6D 5CBEA 1LP9E 1BZQK 2YXFA 3FT3A 3PWPA 3G08A 2P43B 3I3DA 4PY7A 4WUKL 4Z8FH 3MV9D 2JCCA 4NJ9H 4K55A 1DQML 5B4MD 43C9B 3MCKB 5KAQG 1N6UA 3O41A 3MA9H 4DAGH 3LEXA 3HZKA 3SKUD 3V4UH 3VXSA 4RWHA 4YHMH 4G80A 4V1DB 5GSVA 1T0PB 4HKBA 4DVRL 3CLEH 1NCDH 4KKAD 4XZUA 1E28A 1K8DB 3MV9E 1T2JA 2VDPL 5EA0L 4QRRB 1I1AD 1FFQA 4KROD 4FQLL 4OZHA 4PV8A 1XGYL 3TLRA 4NKDA 3RY5A 3T77A 4KUCF 5IEKA 3SE4C 4ZAKC 2JJTA 3G5ZA 1MCJA 4JN1H 1FJ1A 3BFOA 4ZUSB 1KEGL 1YY8A 4OIIH 1URLA 3QYCA 2DB8A 4Z7OE 4G6JH 3MLYH 5FO8A 5HYJD 4TUJB 2D7TL 3UAJC 3FAWA 3TBWA 3OZ9H 5TF1H 1UKTA 3BP6B 3RGVC 2EC8A 5BV7C 2XY1A 2XV6B 3QAZC 3JWDC 1HOCB 4BQ6A 2DQTL 4KHTL 4XBEH 5IW6B 1JGEA 4X5WB 2PKDA 1FBIL 2CUIA 1QO3B 1I8MA 1IAIH 5IB1A 1JZ5A 5B8CA 5IMKB 4J3OC 2R0KH 3BQUA 3WYRA 1OCWL 1RK0A 2B1AL 5DK2A 1O0VA 4C58B 4GS7C 3R1GL 5E8EA 1KCRL 5T1KD 4Z7WB 1EJ6A 2P8LA 1DBJH 5FHBH 1QBBA 5DTFA 3DWTA 1EH9A 3LMJH 7FABH 4X7CC 3I84A 4P2OB 2HRLA 3FHQA 5FECA 3QWRD 1R0AL 1G9ML 4YHZL 1JV5B 2AJSL 4XVUC 2R0WH 4TSCL 2AK1L 4HUXA 2CO7B 2FEDC 3A6OA 4XNMA 4NT6B 5GZNC 5I73B 4LAQH 2WBJA 5JXEA 5HI4C 2IANE 2ARJA 3O3AB 3RKDC 3L6FB 5I16A 5KVEL 4MS8C 5GGQL 4KHXL 3HUJE 2VXQH 5C09A 4JQIH 5GSVB 4YC2C 1XMWA 3QH3A 5A2IH 1DN2A 1AKJA 4IRSB 2OQJA 1FHGA 2WP3O 1PKQB 3MCKA 3WIIH 4YX2H 3TNMB 1Z9MA 3QUZA 5FA3B 3HC3L 4X99B 1UADC 2APFA 4M6NH 1LDPH 1FZMB 4O4YH 3REWA 4POZC 3HC4L 1U8KA 1U58B 3HS0B 1C16A 3D18B 1KELL 4MJ5A 4PJGE 3PHSA 3QDGE 5D6DA 1X7QA 5I66B 1U42A 1NJ9B 1R3IH 2SEBA 3TJEH 1PZ5A 3GRWL 1F3DH 4UT9H 3DVGB 3VA2C 1BWWA 3EYSH 4XPTH 2F58H 4XX1G 4HPOH 2AV7B 2NY0B 5HYFA 4LMQI 4N8VB 35C8H 4OGYH 4HMDA 2H26B 2XQBL 2EEBA 4M9PA 3ARFB 4NPYB 3O6FA 3MBEB 2GY7B 4CN1A 5T5FH 1IGTB 4JM4L 4KK5C 2W9EH 4AEEA 4LPUA 3QIUB 2P24A 1BJ1H 5D4QA 3QUXC 1D9KB 1BD2D 2VLLB 5IGXH 4Z7VE 3DO3A 4P3DA 2Y23A 1M05A 4OKDA 5KSAC 3MRPB 4LNRB 3RVUD 1S5HB 2FRGP 3PWVA 4OQ1A 5GGSY 3WJJA 1KCVL 1YPZF 5TE6H 3SDCA 4I3SH 3MXWL 3RX7A 1KACB 3C8DA 5CP7B 2Z31C 3CZFA 4QY8A 4Y4HC 4ELKA 2EIDA 3L3HB 1MRCH 4OTXL 2W9DH 1LNUA 1KC5H 3S35H 1OB1B 2JJTC 3U36A 5FK9A 3WKMH 4FA8A 3EHBC 4I0CC 3D1MC 5GGUA 4D9QE 3AS1A 3O6MH 2OK0L 4U6XA 5BZWB 4PGBA 3VFMA 1TJGH 4X7SH 3M8OH 3T2NH 1MIEL 1F00I 1TCMA 5CFHA 1SYVA 4PJ5E 3ARTA 4GMSH 1N5AA 3EJZC 5DK0B 1J8KA 4S1DC 3KAAA 4K8RL 5FA4B 4JE4B 3E6FB 3VDBA 1IT9H 3IF1A 3SDYL 2MQCA 3OL2A 3SDAD 4G7YH 1OSZB 3HZYB 4KGJA 4F9PA 2X4TB 1IMHC 4OV5B 1KBGL 3VFTB 1RURL 1H15A 1I85C 4F80A 1GH7A 1LD9A 4X8XA 3ZE2F 2PYFB 4MQSB 3TCLB 1SEQH 3IDXH 1Q0YL 4FQXD 8CGTA 4P2QB 1AQDA 4TOYH 5HYSG 4UTAL 1AFVH 1BQUA 3N50A 5ISZD 5F1NA 5B22A 4MAUH 1CDUA 1S5HA 2UVFA 3V5HB 5HHME 3RWFA 5ICZA 3JWOC 5K9OA 2EICA 2R69H 4K3DH 2R0LL 1A4JA 1F11B 3D9AH 4CNIA 4KKCD 4OM1L 1ZLSL 2NY6C 5I1IL 1I3GL 4X8JA 5C0DA 5HVGB 2HWZL 4HX1B 3RTQB 4G6FB 2GEEA 3OR6A 1XF2A 3WUZA 1HSAB 2H26A 4WFED 1L0QA 2VO5A 5C0NC 4WU7B 1ACZA 4JFDB 4RISH 5BVJB 3KDMB 4YH6A 4LPVA 5DFVD 5LGKA 4U49A 4ZNEE 5E1HB 4P9HC 4MS8D 3LEVL 3AU1B 4ZUVB 5TH2B 4H5SA 2CLZB 4P49A 43CAB 5GGVL 2GCYB 4OV6F 1QLFB 1YEIL 1I1YA 4JHWL 5FO9A 5C0JB 5T33H 4O02H 5E8NB 1N3NB 5IJVA 3QCVH 1SJHB 3STZA 5L9DL 3BQUC 4YEFA 1JHKL 1X4XA 3GKWH 3MLTB 3ARPA 4AEIL 3BP5B 4RZCB 4HMCA 5DJ8A 3FB6A 4YHLH 4RIRB 1T0MA 5F21B 3VMNA 3UJJL 4HC1H 4OD2A 1N7MH 4X6FA 1M1SA 3UJIH 1DQMH 2DJ4A 3TNNB 3QO1B 1CE6B 4I3RH 4Q9RL 3BWUC 3LKNA 4MLSA 4P3WA 4NUJB 1P1ZA 1HZHL 1FN4A 1AHWB 5HI4D 5DC9B 1NEZB 4Z76A 2A6DA 3NCCB 5GS0L 1MCCA 5D93B 5A43C 1G1CA 4X6BA 4PJ5D 5L6YL 3PGDB 4ZAKA 3HNVL 3TJHD 3G5VA 4V2CB 4O2FB 5C0AB 1RFDH 4I0PD 4YNYB 1M7IB 3MA7A 4L8BB 3NIFF 4BK5A 5SWQB 1NFKA 4Y19A 4E9LA 4DQOH 4C83A 3MRPA 4OGAD 4X4MA 3O8XA 4N8VG 3UDWC 3WDIA 3MACL 4FTVB 1SYSB 3TVMD 4DGYL 3BGMA 4KKLD 1ACYL 5TPWL 1SVZA 5GGQH 5I1CH 1T3FA 2V17H 4KHXH 5EU6E 1LEKB 1G7PB 1KYOJ 1ZHLA 4OFYA 1JP5A 4NHCL 5ITFB 5LWYH 3ARYA 1B4JL 5CEXA 1S7RA 2R0ZL 2Z91B 3RDTB 5HHMD 5E94B 2DL9A 3TN0A 2FJHB 1EJOL 4DGIL 2QADD 5B38G 1SM3H 4EI5B 1NCAH 2DQUH 2EXYD 1T03L 2GUOB 2VXTH 5E9DB 4LCUB 3VXTA 3X3GL 3BUYA 2OXGA 3S5LB 3SO5A 4C54A 5E8PB 1NEZA 2DI7A 1DVFC 3EDFA 3EIFA 1NGYA 1Q72H 1BFSA 1KLFA 3BIBX 3D39D 2BNUA 1JGEB 4X5WA 3T77B 5C08B 2VUOA 5IQ9A 2ORBH 4NRZB 2VDOH 3C2AH 2RFXB 3TBVB 1BQHG 4P48A 1KIQA 1P69B 3GMPB 2X9YA 3VI4E 1M71A 4LLQA 4IOFC 4NUJA 3O2DA 3H42L 5EO1A 1KN2H 3ZZ1A 1MRDL 4X4ZA 4EQ3A 2ICWI 2OR9L 2EH7L 1DQJB 1KOAA 3ZE0E 1FNFA 2J88L 1UWXH 4XPFL 3SGKA 4YHIA 4JFEA 1UCTA 4MZ2A 4PJXB 3OAZH 1H5BB 1E4KC 1JRHI 5ITFA 1DBBL 2OBGA 1B0GA 5FKPB 4GG6F 4UIMB 1I3VA 2C4FT 3X11A 1JF1B 4JY4A 3QDAA 4F2MB 1PG7H 1VCAA 3PABA 1AHWA 3VI3E 5IWLA 1UB6B 4MNGB 4OZ4A 3ARZA 4XMKL 1UVQB 1C08A 5FDWB 5T1LA 4J8RB 5D71L 4KDVA 2R23A 3NCFB 3QHTC 4PJDB 2YD5A 2DMKA 4MNHB 5C9JB 5KSBE 1OD7A 5GJTL 3ULSA 1HHKB 2A74B 1W0WA 4IS6B 3MRQB 4P2OA