5DK2A

Fc heterodimer e356k/d399k + k392d/k409d
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
207
structure length
207
Chain Sequence
b'GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRKEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLKSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
molecule tags Immune system
source organism Homo sapiens
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
total genus 36
structure length 207
sequence length 207
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk2A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk2A01
1FYTA 1FZMB 5I16B 1F90L 2EDNA 4OKDA 1ZWIB 3OKLA 5D1ZB 3AREC 5E5MB 3O6MH 3L3DA 5AWNH 4IMLA 3ULUE 3E6FA 1IAII 1OAQL 3FB5A 4MJ6B 2YA1A 3BZDA 5IW3A 4UT7H 4LMQI 3SDYH 4WDIA 3LHPH 5DD6B 4XNZC 2W91A 3GKWH 2IADB 2ZG1A 5F1KC 1U93A 2VITA 3IYLW 3QUYA 3KPOA 2FGZA 4RGMC 1UWGH 1T2XA 1T6VN 3NGBC 4M00A 1HHGA 4HKBA 4UV4L 4XCCH 5J1AB 2MTPA 2Y4SA 4ZNEE 3MOQA 3S4SB 4TNVF 5DEFA 5E8EB 3LEYL 3Q5OA 1AD0B 2DM2A 1CVRA 4ODSL 1T1ZA 1ZHLA 2R9HD 4ZXBC 4YHLL 4TRPL 5J12C 3JZ7A 1NGQH 2QSCH 3KPSA 3L6FA 3TN0B 5D93B 4RISL 3MMEB 4GMSH 4MJIA 5K9QG 4I4WA 2MSPA 2HYMA 3OAUH 4GRWE 2JK5A 4Z7OE 3VE0A 4MLSA 3SCMB 3F6LA 4HJJH 3O11A 1F97A 1B6DA 4HT1H 5FXCH 3PL6C 4OCSL 3T77A 1GPOL 2XTJB 4BELD 1TZIA 4QHKI 2VAAB 5ILTH 3FO1A 4YHPB 4KQ4H 1ZGLB 3LQAC 4QT5A 3IDJB 4LVOB 1F8TL 3NPSB 2NZ9D 3HAEB 2K7PA 3PDOB 1UM6H 1CGSH 5DO2C 5C0BE 3TWCH 5BCAA 4JKPL 4MWFB 1A7RL 4G9FE 2F5AH 4ISVB 3S5LB 5C0GB 2A6KA 3ZSSA 4LCCA 5IT2L 5A3ID 3IKCA 5C6TH 5K59F 1E28A 5E8PA 3E3QC 4FQ2L 1I7ZA 1I9IL 3PWVA 4QRSB 1HXYA 2O5ZL 1CG9B 1PEWA 3B9EA 3KLHC 1MIML 3MREA 5L0QC 3Q5TA 3N1MC 4FTVA 2FL5B 3AB0B 3LMJH 4CDGC 3MRBB 1JFQH 4AG4L 5L2KD 3THML 1F4XH 2P5EA 3WNMA 3FMGH 1J8HA 2B2XH 5I9QB 4D0BB 5TE4H 3QO0A 1G9NH 3HHRB 3LQZA 1WWWX 5E6IB 4Y4FA 3H0TB 5FOBB 3HMXH 2GJ6B 2E7HA 4GXVL 4P4KB 5D7JD 1X7QB 1FVCA 5HGGS 1F2XK 4YHOH 4BZYA 2JLLA 5J6GA 5I0DA 4WV1A 4ZUTA 1ADQA 5IJVB 5EU4A 4OBSA 4AMKL 2K7QA 3RHWF 3H9HA 5KVGL 4LLVB 4JM4L 1TCRA 4ZFZB 2EIEA 4Y0GA 5GS0H 1K4CB 3CVHA 5KJRL 2QADC 1V7NH 5JW5A 1JPGB 1MH5A 2EDJA 4G6ML 1R3LB 1AGBB 5DJCB 1HOCA 5GJSH 1KB9J 1YNLH 5I73B 4F15B 3QDJB 4U05A 4ZG1A 4S1QL 4HUWB 1G7HA 3NABL 4KMTL 3MLUH 4GBXA 4MB4A 1ACZA 3BZFB 3CDGA 5AAMA 4U3XA 2R2BB 1LP9E 1IGML 3T0ED 4YDVA 1YNKL 4Y5YA 5FOBA 4M6AA 3I3EA 2FYYA 5F7EL 4QRQB 5BOPA 1MRDH 2EE6A 1BZ7B 1J8HB 4HUVA 2EYTB 5LWYL 4Y5YC 3UTSD 4M93B 3QQ9D 4JFQA 1MCJA 3T0EB 5C0RH 2HJKA 1J11A 1I7RB 1WSST 5IEKB 3DSFL 3V0AC 1KIPB 4PB0H 1Q9WB 1MCFA 1FDLL 1FN4A 5IG7B 2IH3A 2UY7A 4OZ4B 2NW3B 4GRLB 3QXUA 3WJJC 3MLVL 4GBXD 1W0VA 4LKCB 5I73C 3QEQA 4HPYH 3VXME 3V0WH 1JHKH 2YD3A 1CTNA 3C9NA 4N5EC 5CP7A 4TYUA 5TF1H 4OZIB 1MWAH 4QHUA 3LMJL 1DQJA 2H3NA 4HFWB 5ID0A 2DQDH 3U0TB 2AXHA 1RIVH 4G3YL 4HK3N 5DFTA 2FLBT 3A6OA 1HINH 5TQ2H 3MUGB 1BFSA 3VXUE 3TA3D 5EIIB 4FHBD 2LABA 5IROA 4FOMA 1Q9OB 3RZCA 1A3QA 5CJXA 3VGFA 1LP9F 4FRWA 3O2VL 3ULVD 2EE9A 2MPAL 3NIGE 5EBLB 4WGWB 4Y4HC 2APTA 3QULB 3QG7H 3V52L 3PP4H 2XZQL 3ZTNH 4YXKH 5FF6B 3ZKND 5BJTB 3WNOA 3E6HB 1FQ9C 2AGJL 2YPLB 5L0QB 3Q3GB 4QXWA 4JLRB 3O9WD 5D6CB 5GJSL 5ALBH 1BVKB 1Y18B 1P69B 2FEEL 2Z91B 3UTTE 4DTGL 3G6JB 3U48A 4WFGD 4DK3A 3M1BA 4YX2L 2HVJB 4LRIC 3DJ9A 4FG6D 1BOYA 2KH2B 4JPKH 2A1WH 2H8PB 3BPNC 3JV6A 5B8CA 3HG1E 1RUKL 3DRTB 1E6OH 1I9RL 4XTRC 5LQBH 2VLJE 4LPUA 4FFWD 4ZTOL 4C58B 1RUAH 4HXAL 2HJLB 2DQUH 1HQRB 1INEL 2ZUYA 4I18C 5DRXB 4HMDA 4HCRA 2X4QB 1FVDB 3VGAC 5H35B 2R8SL 2BJMH 3ALPA 4H0IA 5D2LB 4O51B 4OFVA 1FG2A 2C3VA 3ECBA 4FZEH 3M07A 4ORGB 2DYPB 3W0WD 3EOBA 1P6FA 5CJOH 4X6DB 5CJQL 1T89C 4XGZB 5CGTA 5DTFA 1OOAA 3TYFB 1CE1H 5D1QA 4FQXC 4HPYL 5DJZA 4LAJH 4OI8A 3BZFA 5JR1H 3ESUF 3TZVB 4PJBE 4HEPG 1KENH 4LCIL 2GJZB 3VFVB 3GIVA 5DEGB 1EHLL 1TDQA 1D5IL 1AJ7L 5HPOA 1HH6A 4XP9H 3RNKA 5JW3L 2PTTA 4ZS6C 2XRAH 4JGMA 3DETD 3SKOB 1YYML 2EDXA 5E8NA 5EU7E 1CI5A 4QO1A 1X4XA 3OKEB 3W5NA 1A7RH 1KB5B 4JZJA 3B2VL 2FEDC 4GKNB 4NQEA 2UVFA 1EV2E 2AV1A 2CIIB 2HP4A 2BRRL 3I3DA 2V2XB 4LRNH 3U82B 3ZKSD 2LVCA 4KZDH 1NMAH 2ADIA 5SX4H 5B3NA 4M8QA 3D25A 3O3AB 2ORBH 4QRPD 3NIDE 4K71B 5GHWH 5HI3D 5JIHA 3H2WA 4NNXA 3I6KA 3W9DA 4UU9A 3O4OC 5D1ZC 4UTBL 3EFFB 5GGRA 1WGOA 4GW5A 1FL6B 3FMGL 4NQCD 1CF8H 2XA8H 5TE4L 4GFTB 4PG9A 4OLYL 5DZOA 5GS0D 1JNLH 3C87A 4L8DB 1DSFH 1OAUL 4OAWA 2YMXL 4KJWC 4OGZA 2DQHH 1UZ8B 5AG8A 4OLUL 4PRHA 3JBG7 1VPOH 5IVXA 4F7CB 1YQ2A 1RZIB 3U2SB 5T1KD 5JDJA 1A6TB 3TA3B 2DQUL 1T21B 2K9UA 3K2UH 4BSWB 4D0CA 4J3UA 4O9HH 3EIFA 4NFCA 3EJZC 1DUYB 4H1LB 1VFBA 1JRHI 4RMQA 4HIXL 2DJUA 1RK1B 3KPPA 3CCHA 4OZHE 1FYHB 5ISZD 3S7GA 4XPHH 4OI9A 3TH4T 2D7QA 1AGCA 5GSRB 2Z31C 5IFJB 3ARSA 3T2NL 3OB8A 4B50A 2YWYA 3F12B 5D7SH 4Q9RL 3DVNB 3W9DB 1KLUA 3W81A 1GVIA 4LHUD 4KU1A 4ZD3L 1K9TA 1P4LB 2D0HA 4WFED 2I24N 3EOAA 4XZUB 1ZK9A 3KPSB 3L6FB 1LEGB 4X6BA 1JI1A 1A0QH 5KS9A 3MGTA 1TETL 1OP5K 1IAMA 4O4YL 4P5TD 4BFIB 5TDPA 3TYGH 2DIAA 1UH3A 3HRZB 2YK1L 2GJ6A 1UADC 4FA8A 4L4TA 1QA9B 1UWEH 2OL3B 4P9HC 3WKNA 1BIHA 6CGTA 3CMOH 4QRPE 4KTEL 3VGDA 1RZGB 3D0LB 4OFKA 5C6PB 5HGBA 5GXBB 1HXMA 4P5KB 2XG5A 1MWAL 1F6AB 2E8YA 4ODUB 1XF4A 4HCRL 3MREB 4IRJC 2AJUL 1XGRA 4YWGL 1S9WA 1PKQE 1MH5B 4Y4KA 3MLZH 3V79C 1CU4H 1DLFH 3MRKA 5AG9A 3RWIB 2DYPA 5LGHH 3V6ZA 4JRWA 3VWKA 2H6PA 3BWAB 4YDIL 1QHPA 4YK4B 3HUJF 3D1MC 4TSCH 2XYCA 4OLUH 3ZDYF 4U1HB 1RJYA 4U1JB 3C8KA 1X7QA 4LLWB 3DETC 2P1YA 4ZS6D 3WFHB 2J1KA 4BZ2L 3IRZA 3TBWA 2JJTA 4W4OC 3IB4A 1TVHB 4Z77B 1IGYB 2YN3A 3X3GL 3MRDB 4JFFA 3BQUD 2VN4A 2OYPA 4PG2C 2CKBL 4X5WB 4D0CB 1A2YB 5CFHA 2FO4B 4NBYB 3I75A 2XFXA 4Y2DA 2P48B 3QNXA 2XFXB 4YHOL 1NAKL 2IAMA 1BVZA 3ARDA 1D5XB 1EFXA 2YD2A 3SKMA 4OFYA 3KPQA 1ZVHA 1IL1B 4N90D 4FQPA 3OJ2C 4HUXA 3DLQR 5CKGA 1LP9A 1A9BB 2EXWC 3QPXL 3FB7B 3FFCB 1LP9B 1R5IB 1CDHA 3NPZB 3P40A 4LIQL 1QLEH 4PV8A 1JPST 4PJHA 4Y4FC 3IDIB 4JFPA 5DD0H 2QR0A 5E8DH 1RUQH 2Y6SC 4C54A 1PQZB 2L7JA 4PP2B 5E4EC 1KJVB 2BSTA 3MRCA 3VGAB 5KVEL 4NWTH 5T1KB 4JFZH 3WFBH 5KVFH 5C0EA 5JXED 2CRIA 5DJYA 4D9QD 5I1KL 1LE9A 5D7IB 1I9JH 1VFOA 2JB5L 2AEIT 3OPZL 3GMPB 3ULVE 4KRLB 3F7RA 4PJHE 5C0RL 4ZUUB 1KC5H 4S0TD 1QNZH 4YWGH 4QOKB 2JIXA 2P24A 5I17A 1YMHB 2ICEB 3WDIA 3OKLB 5D1ZA 3BPCA 1KPRA 4RFEB 1FSKB 3PIQA 1I3RA 3RHWK 5GZOC 3DRQB 3PHOA 3LY6A 3MV8E 1AFVH 1NCDL 2AKRB 3P9LB 1H0DB 3TPKA 4AM0B 4QXTA 5KSAA 5MI0C 1F58H 3LIZH 1DLHA 1P1ZB 1HIML 5FCUH 1AO7E 3JWOH 1YPZE 1LO2H 2R1WA 3RWHB 5DJ8B 5KTEL 1BZ7A 4EOWL 1U8NB 3R8BB 2NY4D 3PGDB 5DGQA 1CZ8H 2DLEA 5E0QA 1U8OB 3FT4A 3SQBA 1FFNA 5J4MA 2IGFH 2OTUA 1WC7A 3HUJE 5CZKA 2YPLE 5CBAA 2W9DL 1VENA 4F7EA 3G9AB 4TOYL 4HS6B 4Q6IB 5EUOB 3QUZC 4G7YH 4WU7B 1JNLL 1U42A 4NC2B 5J9PB 3MSPA 3NH7L 3RIFK 2X4NB 2Z8WC 2VNCA 4XC1H 3EYQD 5FYLL 1TQBC 5ADPL 3PGFH 5T3XH 4JR9H 5GS2D 2P47B 1X5HA 1K4CA 3CVHB 3IVKB 2GK0B 3D0VA 2K1MA 2BFVL 3SDCB 4HEME 4MNQB 1J1PL 1KIRB 3U36A 1WFNA 2IALB 2D7TH 3C2SA 2I25N 5DK0A 3EJYC 3FOMB 1YEIH 3T0EC 1JI2A 5DGRA 4EXPX 5EZOH 2IF7A 1JMXA 4J3SA 2VZ1A 4GRLD 4LARL 3A6CH 4BFIA 3T0WA 1TJGH 5KN5A 3B5TA 4JPWL 5DS8A 1S7XA 2VLKE 1VKXB 3PHQA 4FXKB 2GTWA 2VQ1A 3V4VH 3O8XA 4OCWH 4PJCB 2X4PB 1NGWA 2EO1A 4KRPD 1UM5L 3CH1A 5C08B 5KSBF 1WAAA 3HI6L 1A6ZA 2YKLL 1Q0YH 1E6JH 5IP4A 1DANU 3WNKA 2BOCA 1IGJA 4UU9B 1DN0B 1HIMH 4DOHE 3OXRA 1TPXC 3QAZC 3UTPE 3WCYA 3CU7A 3BXNA 3GI9L 4GG6F 2P42B 3WS6C 4PRIA 5E2UH 1IEBA 2XRAL 3HCVB 5KN5B 2A0LC 2E7BA 4EI6B 3PGCB 4UQ3A 3VGGA 2MCPH 5LGKA 3ZKXC 3NCJL 3VG0L 4E41A 4GG8A 4P2QE 4FQLH 4YDKL 4ZO8A 2FDBP 4BSVB 3QNZB 3PWJA 4WW1A 5EOCH 3V0WL 3GDBA 3IJSA 1NDMA 4WTXA 3V4PH 2R23B 1ES0A 4QWWC 3KDMA 4FZ8L 1QEWA 1H3VA 3I6KB 1KIQA 1NANH 4KRMB 1HN1A 5DEFB 3DXAE 1D9KC 4NDMB 4FQIL 4PJEB 4U4BA 4K9EL 1M7IA 4RBPK 5DMKB 1FIGH 4KHTH 4NDMA 1CS6A 4OIAA 3DBXA 4HG4J 4I2XA 3QZWB 5CBEB 2R2HA 3S37H 1CDIA 3JWOC 5CGMA 2IPKB 3RU8L 4YEFA 3PP4L 1GGBL 4RX4D 1BWMA 5C1MB 1UM4L 1TJGL 4P5MB 3V5HB 3WE6B 4BH7A 4EDWL 3HR6A 4BSVA 5I8EA 5FF6A 3VFTA 3DUUA 4AENB 5HSFA 5DMIH 1QSVA 5DF0A 3ALXA 4HIXH 4UDUB 2ZP0T 1HSAA 2JJWA 3TBSA 3NFPB 1QBMH 1H8OA 5KS9F 3O6KL 5B38G 3TBVA 4K8RD 4YX2H 3BISA 4RA0C 5I1GL 4Y4HB 5FYKU 2OZ4H 1QFWL 1BF8A 3WFBL 2AABL 4KKBC 3PL6A 1INDH 2A6KB 4ZTOH 5CP7B 3O6FC 3QJFB 4R0LC 3UYRL 1FL3A 3TA3A 1RJZB 1FO0B 4M6OL 4RQQB 3ULVC 2YBRB 5EBLA 3MV9A 3RZCD 3ZL4L 3SDAD 5K9JL 1P7KA 5EZJA 3U9PL 1I8IA 4WI7A 5DJDA 4CNIA 3NOIA 2IANB 3B9AA 1WLHA 4XNZB 3T8XA 3TH2T 3TPUA 4MA1C 3SJVA 4GG6E 1SEQL 1KUMA 2WM0A 3BEVB 3DMMC 3P9WB 4POZC 4ZFOL 1GZQA 4K94L 2R0WH 2WWKT 3QISA 4OF5A 3UX9B 4PRPE 3GUTB 1QR4A 2HTLD 3FFCA 3ILQD 5ELIA 4LQ1A 5M95B 5JW3H 3GO1L 1Y6MR 2D31B 3RWJA 3RJDA 2FJFB 2OQJB 5FKPB 3IAQA 4G8IA 4LLMA 4H25A 1M05A 2FH6A 4MMZC 3WKMH 4B7LA 4TOYH 1R3LA 3DXAB 3RKDC 2BRRH 3IU3A 4NC1E 1NUDA 1QSED 2PTTB 1YY9D 5EC1A 4OM1L 3NH7H 1MCSA 4FMFA 3U4BH 1MPAH 4W6WB 2EDTA 3LEXA 1JIBA 4JEGB 2EH7H 4V2BA 1N5AA 4ZXBA 5FEBA 4JR9L 2ZWLT 2Q6WB 3RUGA 6FABH 2FBJH 1KSRA 3F7PC 3F5WA 5TQ0L 3BAEH 1OTSD 2RCSL 3ARQA 1F5WA 2YD8A 2AAVA 5BRZA 3EYUL 1EGJH 3IDYC 1I1FB 2VDLL 5E2WH 1EDQA 3RWIA 1A1NA 4O51A 1E4WH 1QD0A 3FHAA 4RMUA 4F37K 4FXGB 1NBZA 1CFNA 4N0YL 4J3WA 3GSQB 1QP1A 3A6CL 2WINB 1QLEL 5IK3A 2B5IC 1Z0MA 1S7TA 1Z5LA 4FNLH 4TUOB 4C4KO 3HZVA 3MRJA 1IMHC 4R4NC 1U58B 1XGUB 3SKJH 5T1MA 4EN3C 5BV7C 2UY6A 2YUZA 2VWEC 2XWBB 4PJ9C 2B7DT 3WJLA 5EORL 4JFZL 4EI6A 4UAOC 1MCEA 1SBSL 2X4SB 3LAFA 5D7IA 3EZ8A 3KYMB 2ATKB 3DVFA 2W9EH 3DPBA 3EYSH 3VDCA 4XCYB 2AI0L 4JZOA 2GKIA 3W0WB 4JO2H 4C83A 4GRWF 5CMAA 3LKRA 4PUBH 1WIUA 4LASL 3MLYL 4U33A 1ETZB 3FB8A 5FYKE 3SDXA 3IF1A 4N0UA 4L4VE 1J0YA 4L1HA 1WCBB 1QRKA 4K9EC 3FN3A 1CXLA 4ZOEA 5I0ZA 4U7KA 3MMEA 4KDVA 5JW4M 3G6JE 3OJDB 1AY1L 4Y5VB 3ULUF 5CEZL 3D39D 3VXMA 5MERA 4PJIA 3JWOL 3AAZB 5L2JB 2FEEI 4PTUA 4ZUWB 5GIRA 5ACLA 2LU7A 3QH3B 3SDXF 1NFKA 4HGKC 3T2OA 1A21A 2E9WA 3WIIH 4HWZB 2AV7B 3FZUD 1MEXH 2F15A 3RWDA 3UJJH 3GKZA 5EO1A 1NEZB 4P4KD 4U2ZA 4ZS7L 5EO9B 1S7QA 5BRZD 1XCQA 5HGHB 3QDGA 4KVNH 5LGHL 3BOVA 4KRPC 4UQ2A 4ZSOA 1XCQB 1E28B 2X7LB 3C6LD 5ANMA 2V5RA 4AM0A 1SY6H 1IGTA 4GW5B 5D1XB 5T1DL 1MJUH 3ZT7A 3SDYL 4NQXB 1SJXA 2VABB 2EKJA 3CDFA 4PRHE 4U1IB 5CJBA 5FGCE 1Q9KA 3EO0B 3CFBA 2W59A 1EBPA 2QSQA 2ZCHL 4Q0XL 1NC2A 3DO7A 2HKFL 1MFDH 3DURB 4J4PD 5ALCH 1DBKL 3BDXA 5HYSG 3NTCL 1K6QH 1DP0A 1A7BA 2GY5A 4XCCL 3K46A 4AL8H 4EI5D 4NQCA 1AIFA 1R5VA 3KVQA 1SBSH 2QQLH 2AV1B 3GSNL 4YR6B 1KCSH 2HWZH 2DL2A 4PJ7E 2ADJA 4IOIB 3EYSL 4J3VA 4OF7A 4RMSA 1T7XA 4OGYL 2Y7QB 2WBJB 4JDTH 5F9JB 4IRJB 3MNWB 4BJLA 1JZ3A 3MLXL 3G04A 5ISZB 1GGYA 4M4RA 3D9AH 4RZCA 3PP3H 3INUL 1UM5H 3QR2A 5J6HB 1JPFB 1R3HA 4ONHB 2YRLA 5F9WB 5EOCJ 2VLKA 3ARBA 4DAGL 4KV5E 3B5GA 3BPCB 3FB7A 3WLBA 1U6AL 5ID1A 1K2DA 4S10A 4K3DL 3ZT6A 2PO6C 1T0NA 2NXZC 4J6RL 2NXYC 1HI6B 1AY1H 8FABB 4UOJA 4OCMC 3ULUH 2OJEA 3P4NA 5FM5M 2ORBL 1FNAA 3TF7C 5TDPB 4OV5B 4KKAC 1I9JL 1NL0L 2JB5H 4XP5L 5DWUH 1HQRA 3UZEA 3FFDA 1CDCA 3Q2CA 5IK3B 4APQC 4Z78A 2IANA 4PJ5A 4KDTC 3VXUA 3U0PA 4LLUB 4RNRB 2EYSB 1INQA 2VDKH 1KJVA 3GO1H 1NFDF 1KN2L 4KTDL 4QGTA 2DQIL 3GRWH 1U8MB 5HTSA 5HHPB 1F11A 3SGEH 1B4RA 4L8SC 1VEOA 1T1XA 1ADQL 4PJEF 1MOEA 3UTQB 1Q0XH 2EICA 1HHJA 3SEPA 4E41E 2HT3C 1EFXD 4QEGA 4YIQA 3CCHB 1OAZH 4F7CA 4Y2DC 1A9BA 1M1SA 4IRSC 4JM2C 4L8SA 1LO0L 1I1AC 2X10A 3EYFA 3H42L 3K8KA 5K59E 4MLIA 5GGUA 3L3HA 3HMXL 1U36A 4PJ7A 3UTTA 5LXGH 3C2AL 2R4RH 3TN0D 5GGQH 4IDLA 2G75B 3O6LH 2HFFB 2ATKA 5BVPH 2V5YA 1BJ1J 3RU8H 4PRHB 1KACB 3MRDA 4PRPD 4MDIB 1WFUA 1NDGA 1QSFE 1SJVA 3S35X 2DLTA 2W0FA 3BIBX 4NUGH 4Z7OF 2HLAA 3VXSD 4NO3A 4QXUH 1R5WB 2FX8L 5C71A 4IM8A 4BQ9A 5INDA 4KVCH 5EC2B 1W72A 1YEHH 5IFHH 1IL1A 4IRSB 4OF3A 1RZ8A 1AGFB 4PLJC 4U7MA 5C2UB 5I71C 5J6HA 2V2WB 2OM5A 5IV2B 1ETZA 2W65B 3KS0H 4BH8B 2ZOLB 2YUWA 2O5XL 2OJZL 5GRJH 1P7KB 3BHBB 5CILL 3WUZA 1GGUA 3W39A 1DQTA 4S0SD 3VFGL 3BPOC 2HRLA 3WUWG 4WDIB 4JPWH 3IDXH 5LVEA 1B2WH 4EEEA 2YUVA 3S3JA 1UACL 4KZEL 5IBLD 5HHXL 3PGCA 4OCYL 3GSVB 3NIGF 3G5VA 4PJBF 4M6ML 3VFNB 4BZ1H 1GAFL 4RAUB 1ZHNA 1AO7A 1NCAL 2PO6B 2H26B 4HIEB 3VWKC 1XF4B 1EAPA 5TJWK 4M7ZC 1CDJA 4BZ2H 1J0ZA 1FC1A 2VC2H 3KPRE 4LSSL 4F7TB 2JJVA 5KSUB 3IXTB 3C5ZD 3HNTH 1MLBA 3S96A 3OKDB 5C3LD 3WNPA 1V05A 1MQKH 1A47A 2A2QT 2AERT 5IF0B 4XMLL 3FCTA 3PV7A 1PZ5A 1A6ZB 3BH8B 1RV6X 1S5IL 3D2UA 4K7PH 5I1DB 2MPAH 1I3VA 4N90E 3B3IA 3KS0J 3NCJH 3VG0H 3RTQB 3KWWA 2FX7H 3RAJL 5F89B 3BUTA 1DQDH 5KW9L 3C09B 3IFOA 4NZJA 3RTQA 4R7DB 2Q76B 3IS1X 5CJ8A 3LQZB 1L6XA 3REVA 4ELME 2CDEB 2WIMA 4NO0B 2FD6L 1JBJA 4RIRB 1TJIL 4LAQH 2V17H 4ODTH 4XP1H 4W6YB 5GSVB 1GPOH 4LVNC 1F4XL 1J8HD 5FK9A 4F2MA 3OAYK 3MBXL 5LGJB 1DBAL 5JXAH 4WW1B 2X9YA 3QRGH 1XR8A 1GHFH 4NWTL 4JZOB 1ZA3A 1IC7H 3VRJA 1I9RH 4BK4A 2JJUA 2GK0A 5ID0B 4KRPB 1CGUA 5FYKD 1C16A 3KPLA 3MRMA 5C08D 2P46B 4JDVB 4ZAKB 3QEGH 2ESVB 2P4AB 4LHUB 5IT2H 4U0RC 4Y16C 1JK8A 3OHXB 4U1SB 2NY5H 3OPZH 2R4SL 3QEQB 4M1DL 4H20L 4XBEL 3S3PA 1NC2D 2A9NL 4KFZC 2R8SH 2B8OT 2C26A 3P0YH 5CUSL 2H1PH 3VFTB 2XTJD 3EHBC 3OXRB 4PRAA 2C7UA 1KIPA 4NKMA 5EORH 1XMWA 3MV9B 1EEQA 3VRIB 3NACL 2ENYA 5GISL 1ZT4B 1P7HL 2GJ6E 1QBBA 3N1GC 2DI8A 4HF5L 3VXNB 1AD9B 5ETUA 3VWJA 4ZFGH 5ADOH 3I6LE 4UT9H 5FCUL 5DQJA 8CGTA 1JGUL 5C08A 1T66D 4N1HB 3NIDF 1R3JB 2UZIH 4XP6H 1T7ZA 4XX1G 1AJ7H 4M4PA 1M7IB 4JO4L 5DMKA 4OCXH 2CO7B 2WLZA 5EOTA 5IBTH 4NRZB 1KTDB 5DJZB 5FV2A 4YXLL 1JF1B 2DIBA 1OD7A 1QEWB 3BP6B 4CMMA 1B0RA 2E6JA 3DHJA 4JFFE 5JHDB 2HFGH 2R23A 4L8BB 1U8LA 2AJYL 5TE7H 3QDME 3FZUC 4HDIB 3VD3A 1GOFA 2AXGA 3K1DA 3ZDZF 5MEQB 4NSKB 2RHEA 3B9VA 4PGEA 2VXVL 2BX5A 3MNZA 3O2WL 2W1NA 4LDLB 3TT3L 4QRPA 3VXRD 4JRXB 4P23B 1Q0XL 5GHWL 4LCCC 3ARYA 1EERB 2CRMA 5F70A 4HZLB 2R0WL 4EQ2A 1U93B 1CVSC 1YYLH 1JGEA 1T1WA 2H45A 1V7ML 2ZUUA 2WMPA 4PPTA 4G3YH 3CGTA 4N0CD 2DTSA 1CLYH 3LQMA 4OZFB 1DBAH 3DMMA 1DDHB 3VXRB 1AP2B 2GW5A 4N0FB 4JRXD 3EOBB 4NPYA 1RJLA 5F9DC 3CC5A 1HNGA 4P49A 4LDOB 4L3CA 2FIRT 2HRPH 5EU4B 3WFEL 1PX4A 1MI5E 1DQLH 2WUCL 2VH5L 3ZTNL 1JUFA 4W68A 4MB3A 5I1JL 3DX6A 5DJXA 1CIDA 5HYJB 5E9DB 5ESAA 4M1DH 4XBEH 2KZ1B 2Y07H 3QXTA 1U8NA 4OCWL 1ZOXA 4H1LH 3MA9L 3NFNB 4LCCB 5CUSH 5IMMA 4PRDA 2GFBB 4P23C 2GSIA 5B8CB 4EKXA 3GFUA 4DZBA 3I75B 3A6BH 4TTDC 2ESVE 4JHZA 1U0QA 1RIVL 1TTFA 3DYOA 3RP1A 3WXWH 3VD7A 4U6YA 4Q9RH 4WWKC 5SWZA 3AMKA 5KSBA 5BZDA 3MRPB 3SHSA 1WAAF 5D2NA 1FZOB 4JFEA 4P2RB 4XP6L 5CILH 2P5EE 3MZGB 3P30L 2NW2A 3INUH 4XB8A 4FABH 1G0XA 3MV9E 4U6HA 3GBML 5DQDH 1U8IA 3GGWA 1ONQB 4TSBL 5HHPA 3VFSA 4YXKL 3KXFE 4ONHA 4DZ8B 2FIKA 4WFFE 4AYFA 1CGWA 4HAFA 4G80A 4GG6A 1Z3GL 3KNBB 2LQRA 3T4YA 2DS4A 4OCYH 3QFJD 3MRCB 1MHEB 5IKCB 2JJSA 3KLDA 1GGTA 1EH9A 4U1GC 4YR6A 1DQJB 2CH8A 2OJEB 3MNZB 5JIKA 4Y16B 4IJ3B 1V7MH 3N85L 2VC2L 5F44A 3MA7B 1BWWA 4E0RB 3DXAD 5SWQA 3QHFH 3MLYH 5IVZA 4AT6B 1NBVH 2KKQA 2CK0L 4B0MM 5JUEL 4O2FB 1T1ZB 3W2DH 5JHLL 5T3ZL 3CZFB 4PY8I 1WBZB 1JF1A 2XV6B 4TSCL 1NFIA 2YA0A 3FQRA 3HG1A 3JUZA 4HKJB 3EYQC 4YH6A 3HPLA 1J5OH 4LOUD 3T4AB 1NMAL 4EIGB 1NQBA 3WIFB 3L5HA 4OZHF 1QFWM 1N5YH 1WWCA 2R0KL 4KK5C 4A6YL 1CE1L 4U3HA 3MA9H 5GJTH 1NGZA 1G7LB 1RULL 2HA1A 1YEGH 4I5BA 3SDCD 1FZMA 1WVZA 1YECL 3V6FA 2YSSB 4MJ5B 3T04D 4LLWA 3T0DA 3JV4A 5C9KA 2B1AH 1WEJL 4HQQH 3MBXH 4ZFOB 1XCTA 3JWDC 3CXHK 4Q9BA 4PTUB 4ZUWA 4QT5B 2O61A 1IC5L 4ZS7H 3PGDA 4UB0H 4AIZB 2DQHL 2Q87A 1KTRL 3K4AA 1M7XA 5FO7A 3N06B 3I02A 2AABH 3RBSA 3MRHA 3BD5A 4LRIA 1MJUL 1O0VA 1WV7T 3UYRH 4ODUA 4NYLA 2XZAH 1F3DH 5FUCC 1ZKAA 1NC4A 5EC2A 1A3LH 4N68A 4KROC 4UNTA 4U0QB 1CGTA 4L9LA 3V5DA 1MCOH 5DD5L 4HBQA 2WUBH 3V0VA 4YHZH 3GMOB 4JCLA 2QV2A 1CICB 3JTTB 4MQSB 3HRZA 3U7YH 4P9ML 2G9HA 4G9DB 2VLME 3MGOB 1SJEA 3GMMB 3NA9L 5TFSL 3GRWA 3MRBA 4GMTH 1QFHA 5DD3H 4GS7C 3BPOB 4GKZB 4PBWD 1CICD 1KC5L 1XF5A 4K07A 3WNNA 3ZDYE 4PRIE 5DJDB 1UB5A 4JFDB 1WJ3A 1BVLB 5D7JC 3MRRB 1DJSA 4PLJD 4A2LA 1A0QL 4U1KB 1LK2A 3OJVC 1F13A 2GJJA 4U3CA 4ZTPL 5EBMB 1AHWB 4NN7B 1R5IA 4P2OC 5FYLD 1UWEL 1ITCA 5SWZB 3MUHL 2H2PC 2H2SD 1N5YL 4JPVL 5BRZB 3HE7C 5KG9A 3FRUA 1A02N 2OK0H 2VAJA 4KMQA 2CLZB 5E1HB 3QUXA 3PABB 4L3EE 2RCSH 1CBVH 3UTOA 5DRNA 4OSUH 2NMSA 3IDNA 1BD2D 4EI5A 4NM8L 2VDKL 1S8DB 1DVFC 4JCMA 4RDQG 1DBMH 5FGBC 5FYJH 5ACZA 4IRSD 2X4QA 1DQDL 5KW9H 4WTZG 1RU9H 1YPZF 3RWEA 2HT3D 2UWEA 3ZE0E 3HE7B 4X80H 2GSGA 4S2SA 3TYGL 5KSVA 4NCC1 1UCBL 5IW6A 1GOGA 3QEUA 1C5BH 1JZ7A 3WFCL 3LV3B 4JM2B 5F7MC 2R1XA 2FJGB 1T5XA 2AXFA 1JWUB 2I07B 3GJFK 1IZKA 2ICEA 1WIOA 4E5XA 5DURB 5DRZA 2X9XA 5MP6L 5C9JB 1CDYA 2VDNL 4FQQA 5FKAB 1IEAA 4JAMB 1FYTB 4C56D 1ZA6A 2CXGA 1T80A 4P3CL 1PBYA 5J8OA 4GXUN 1KGCD 4TNWF 2DDQL 3F12A 3RDTA 2FSEA 1BMGA 4LLYA 1U91B 3IJSB 4K7FB 1C7TA 4X6CA 1KPUA 4DEPB 4QRRA 3C5JB 1Q94B 4JRXE 1AC0A 3V4VL 4UTAL 3VGBA 4YC2B 2ITDB 1ZLWK 4GMSL 2J8UA 2F58H 3V6BR 1EMTL 2DQGH 4NHCH 2A77H 4OFIA 4RGOH 4NZDA 3WIHL 3SGDI 1MI5D 1AQDA 1J88A 1U8HA 4HPOH 1I8MA 2IPUK 1G0YR 4RWYL 3KYKL 1L7TH 1RPQA 1H8SA 3U0WL 5AD0A 2LAAA 5E8OB 4P59H 4JFDE 4MCYB 1KLUB 1FSKC 4OCXL 5FGRA 5T3XE 4EUPA 5AYUH 1H15A 2OK0L 2BOCB 5I15L 3EJJX 2VN7A 4JFED 2LAGB 2AJZA 2R2EB 2NZIA 2F5AL 5BS0D 1KCLA 5JOFA 2ZG3A 5E99L 4NNYA 2J88H 5IB2A 5BRZE 2DLFH 2Q86A 4OJFH 3H7BB 3AAZA 5L2JA 4OFPA 5FYJL 5JUEH 5E2TH 4LIQH 1CDBA 4NNPL 1S7XB 5L6YL 1GAFH 5DC0A 4V1DB 3QCTH 5GRVK 2RJMA 1A6TA 2EYTA 1T03L 1OT1A 2MQ0A 4L3CB 4I0PD 4XXCC 3HZMB 1J1XL 2W38A 3C08H 1IM9D 4FZ8H 1NMCC 2WBKA 3MCLL 2R0LH 2D4DA 5AD0B 1DUZA 4O02L 3DX8A 3QDHA 1G7JB 2FZ3A 3KAAA 3RX8A 4FQ1L 2DWDA 3EFDL 3QO1B 3L7FA 4DGIL 3RGVA 3S88L 4LVHB 1T3FA 1JNHB 1AXIB 4XXCA 4Z8FL 1F6AA 5HI5C 5HD8D 1ES0B 1GC1L 3B9KD 3FFCD 3L3OB 4W70A 5HHMB 1VFAA 3V4UH 1IEHA 2FHBA 4K7PL 2CKBA 1ZHNB 1N8ZB 3QIWB 4Z0BH 1QRNA 2HKHL 5HHVL 4KWUA 4XCNB 5FHAH 1F6LL 5EG6C 3SDDB 4DFIA 3QIUA 4W81A 1PAMA 3T3PF 4QHMB 5GZND 1DANT 4GQPH 4CL7A 5T1MB 3W9EB 3STBA 3MLUL 4OZHB 3SE4A 3SY0B 5I1EH 4YBHA 1IGCH 1IGMH 3HE7D 1JGVL 2HFTA 5IVXF 4HJGB 4ZPVA 4KPHH 2X4OA 4Z7WE 1I1FA 2P8MB 1INDL 1BEYL 2F54B 1AHWA 4P48A 4FABL 4H5SB 3BIKB 2MCG1 5AYUL 2HJKB 1KJ2B 4JFEE 5D1QB 4TSBH 1Y18A 3QNZA 5F1NA 1HNFA 1W0WA 2A9NH 5B3JE 4I3GA 1ZEAL 5F6HJ 1LEIA 4BUHA 1L0QA 4GW4A 2AXJA 1KPRB 2BSED 3ZL4H 3MACL 4WIQA 5FYLH 3SKNB 2X4UA 4PJXA 4XPTH 3TIEB 3LRSA 4MA8L 3ABZA 4ESKA 4F9PA 4NOFA 1JF6A 4YUEL 5A2LH 3NABH 1C16B 1SEQH 3PDDA 5DSCB 2GJ6D 2IEPA 3FO0L 3B6SA 5HI4C 2E27H 3P3YA 3RNQA 1UWXH 2YPKA 3T3MF 1FGVL 5KZCD 2PTVA 1HILB 2UUDH 2R1YA 5FYJD 1IAIL 1F45A 4PLOB 5DUBA 3SE9L 3UBXI 2PYEE 5ERWB 5E2UL 4P3DB 4KH2A 1HCVA 4G5ZL 2CDFA 5IHZB 4D9RE 4L1DA 4NO2B 1TZHA 4J1UA 3ZMRA 3O9WC 4HUMB 4JKWA 5IJVA 4N8CH 5E03A 1R24A 1YEFL 4LPWA 4FQQB 4Y5XC 4RISH 2XY1A 2HN7B 2PR4H 4XNXL 1W0VB 4OZGA 4G6KL 4HGWB 4BQCA 1XH3A 4LP4A 2ENSA 1B4JH 5H94B 4GAYA 2YKLH 4Y4HD 2ICES 1SJEB 3GMMA 3L3KB 2FX8H 5HY9A 2G5RA 3OWEA 2DRUA 3JV4B 4OGXH 5F3HA 3REWA 4R26L 3NCCB 1LVEA 1W2KT 4PJXE 1UENA 2J4WH 3FFDB 5IFHL 2BCKA 4IMKC 1NBYB 3PJSA 4S1RH 3R8QA 3UTTB 5EU6A 3ARVA 2RR3A 3DECA 1AR1D 3K7UA 4Y1AB 3GSUA 1BFVH 3E1F1 5IB3B 3U46B 4KXZI 1IGYA 2Y25A 1CK0H 2DOCA 2IADA 5JW4N 3L1OH 3LD8C 3DIFB 2W0PA 3TO4A 1KNOA 2P5WB 5D9SA 4LSPL 4DGVH 2X4NA 3V6ZB 4YDKH 1B2WL 3KPSD 3DUHA 5HDOA 4NP4L 4YXHH 2O93L 2AK1H 1ZANH 1MCOL 5DD5H 5EOCL 3DMMB 3NAAH 4MA3A 1JPGA 4KZEH 4R4FL 4J12A 2DWEB 5CJOL 2VDOL 3WIHH 2YSSA 3PWNB 1BQLH 2VL5A 3MFFB 1K3IA 2GCYA 3NN8A 1U8OA 1I1RA 1FNFA 4HPOL 4R90L 5F1IA 4DTGH 5D6DA 4F8QA 3CK0L 4XC3H 2WP3O 1KENL 2A1WL 3DRTA 1HH9B 4U0RB 3SPVA 5EU3B 4JY5L 5F6IB 1UVQB 3SDXE 3TCLA 4ETQB 2BCKB 4YZFE 1MHPL 2I9LB 1CFQB 2N7BA 4C56E 3M8OH 5K9KA 3CPLB 4X4YB 2LU3A 1X5IA 2VLJB 1IQDB 3RFZC 1MI5A 1MQKL 1W72B 3C5ZC 1OVZA 2YPLD 3LSOA 5GS0L 2LFGA 2ZNWA 1KJ2H 4JG1H 2BJML 4JY6A 1YEFH 5D1ZD 4XWOD 2VLLB 4M6NL 2GITB 1BM3L 4Y19A 43CAA 4RFOH 5JW5B 3HNVL 3OKNA 2LU4A 5L6YH 4OD3H 4OV6F 5I8KH 3SKMB 3QI9C 3C6LA 2FLRT 2WK2A 3MBEA 3RVUC 4ETYA 2KBGA 1UZ6F 1YA5A 3BIAX 4XP1L 2BERA 3HCVA 4S1RL 5AYQA 4O02H 5HY9B 1GC1C 1NLDH 2EH8L 3D69A 4P4KA 4Z18A 3RNQB 4PJCF 3G6JF 5MHSE 1N4XH 4WVRA 5EUOE 4D0BA 4X99A 1VEMA 1F3JB 1TZIB 3IDIA 4JFPB 3LKOB 3VXPA 1A14H 4MJID 1G9ML 1R0AH 3OAYH 1NCNA 5DA4A 1VPOL 4LPCA 5ITFB 4U6HB 1D9KA 4LMQE 5EBMA 3LVEA 1T1XB 3DUSB 1J5OL 2ZNXA 2XN9A 2A83A 5CZXD 3IF1B 1CTOA 2E9BA 4N0UB 3I84A 4HHAA 3O3EA 4O9HL 1FN4B 4UT6H 5IG7A 4OKVB 5EUKB 2D9QB 1KJ2A 1LEKA 2VDNH 3UJIH 4TVSa 3K80A 3BVNB 5GZNC 2BNRB 1FH5L 3L3IB 2ATPB 1MCLA 5HYQB 4P2OD 3ARGB 2XACC 3P9MA 4PLNC 5HVFB 3SGKC 5GISH 1IAIM 2VOTA 1ED3B 5I1IL 4JO3L 4R90H 3AM8C 3RGVD 4QRQA 5BS0E 2C5DC 4JRYB 1ZHKA 1GXEA 1ZVSA 3IETB 5D5MF 1X5ZA 2BHZA 1MFBL 3TBWB 2BVOA 5B39B 3NCMA 4Y8DC 3SKNA 4DGYL 3GJFA 3X11B 3VFMB 2YR3A 3ZHLA 4K3HA 3HTLX 3KPOB 1JNJA 1A6UL 3F7YA 3I3BA 2DQGL 3VE0B 4JFFD 2YD1A 4KKNA 5JW4Q 3HC3L 4PJCE 3VXSA 3U4BL 4TUKL 1S9KC 3CSYA 2CIKB 1AP2A 5DHYB 2F54A 3SQOH 2EKSB 2NNAB 4G8GD 1QBLL 4I2XE 5DQJB 4FFZH 5DFVC 3CSYB 4HIHB 5DRWA 1RY7B 5I1AA 1VFAB 3VXRE 2YD9A 4Y5XA 4KTEH 5IGXH 4G9FA 4NUJB 5HD8C 1I8LC 2VL5B 3GMLB 4WWID 1D6EA 1NMBL 2EDYA 1EGJL 1G7IA 4POUB 2VDLH 5BVJB 3MNVB 5E6ID 3MV11 3OTTA 2H32B 5IB3A 2XWBA 4OJFL 2Y36L 4BFGA 5CP3H 5GRUL 4I0KA 3KPNA 2JE8A 4M7LT 1F6FB 3GNML 4JQIH 1EO5A 5D72H 4MQXC 2BXYA 2HJLA 5I76A 1T03H 5EZIH 3W11D 4OM0H 1C1EL 3EYVB 1AGEB 1MCBA 4X9GA 2ZUTA 4QRRE 1AC6A 1T4KA 5E8PB 5I30H 1T7VA 3PWUA 1GIGL 3UZVB 1MHHB 1OSPH 5EU7C 1NGYA 2FATH 1CXKA 5GSVA 1WITA 5A16B 5BV7H 4N5UA 2J5LB 4JKKA 1YZZA 4WCYL 3LKSB 3GBNH 5DR5H 4Q7DA 4X9FA 3WDJA 1JTPA 4MQXD 1AH1A 4JO3H 3SE3A 4YGVA 3QUZB 4OLWH 5C09A 4OD2B 5JNYA 3I9GL 4ZAKD 4MCZB 4EI5C 2BSTB 3JVGA 5E6IC 2OR9L 5C0IB 1CIUA 3DXAA 3OG4B 1FNLA 5E8NB 4MX7A 2J6EH 3T08A 3RZCB 3SDAB 4XPAH 5I1HL 2R1YB 4Q0XH 2APXA 1NAMB 4CJ0A 4CBPA 2VQUA 5HPMB 4K3JH 4MZ3A 4EJ1C 1F4YL 3X3GH 2GK2A 5CIPH 2Z8VC 4JFEB 4P0DA 1C12B 2V5SA 3QUKA 3QFJE 4L4TD 1UJ3A 5GS1C 1F2QA 4PJGA 2H26A 3UJJL 2BZDA 2OX5A 1LE5B 4HW6A 1A22B 1MREL 3IFLH 3ROOA 3JWDH 1MLCB 1A9EB 1P4BH 1JN6B 2J2ZA 4H0GA 1Q9LB 3ARUA 3HI5L 2AVGA 3RY4A 3SOBL 1A1MA 5L9DL 1MVUB 1F42A 1VESA 2NW3A 3RPKA 4JN2B 3U30C 5L2KA 5I18H 1U8QB 4ZODA 5DHVB 2CK0H 2X05A 1EUUA 1NGXB 3FRPA 2VDPH 5CHNB 4XBPB 1KPUB 2N1KA 3SBWC 1H3WM 3T0EA 3HS0B 1FO0A 1FFNB 4TUJB 3C8KB 3OAZK 5DVKA 4M5YL 1NBZB 4JG1L 3RDTB 2CSPA 2C4FU 3P4NB 1FE8L 2Q8BH 3L3DB 5E4EB 3IDNB 1M71B 1D6VH 2X70B 3STLB 4EZMA 1FGVH 4MNHA 1YJDH 4ODBD 3L95A 4EOWH 1CLOL 1FZKA 4PRPB 4Y2OA 1LO3H 1HK6A 1AO7B 5D8JH 1YEGL 3BO8B 2J7LA 5CLTA 4UILH 4XGZA 5I75B 4JGUA 1T3FB 1QNZL 3T09A 4UDUA 4WUUD 1S9VB 5I75C 5I1CL 3DV4B 3IS0X 4KDTA 1CFSB 4XC1L 2ILLA 3MRGB 1H3TA 1WCQA 1U91A 4PG2A 3F7YB 3UC0L 4LAQL 1OAZL 1WISA 2UWEE 2YD4A 1N6QH 3NIFF 1N2RA 4S1DC 3RVXC 1XF5B 1OD9A 1JZ6A 4M8VA 3H42H 3JV6B 2HTKD 2DIJA 3L95B 5F93C 1MCWW 1ZT7B 4YK4C 2Q86B 4O58L 4XI5C 4N9GB 1GHFL 2GIYA 3KHOA 2HG5B 5FAAA 1OTTC 4RAHA 1S9YB 1BVKA 3QUYD 5TGBA 2AJUH 2QL1A 5I6XB 3VW3H 1Q8MA 4G6JL 1C12A 5KOMC 3WFZA 2HKHH 5HHVH 1MLBB 4KK8C 2D7OA 1MREH 3IFLL 5DURD 1G6RA 4QF1B 3RVWD 4YFLF 4DGVL 4MCYA 2BRQA 2QHRH 4UQ2B 4ZSOB 5F96L 5E70A 3IFPB 3GSNA 5DLML 3BH9B 5LJYH 1NSNH 1WT5C 3ARXA 4P4RB 4JKMA 1ADQH 5LCVL 5CEXA 1NEZA 2V2TB 4LCWB 3KYNB 2EDFA 5JQHC 2ZZUT 1JK8B 3OHXA 4OQTH 2CLRB 3P4MB 4KI5E 1A1OA 4MCZA 4WTZA 2DJSA 4LL9A 1IEBB 4LPYA 5F7KC 1YY9C 1SJHA 1OL0A 3CK0H 5HDBE 3B2UD 1OT2A 2Q8BL 2X1WL 4JY5H 2X4TB 5HBBA 3T77B 2DD8H 2MKWA 1NAMA 5GGTL 4MJIE 3UAJD 3MR9B 3LEYH 4X7SH 2EXYC 1IFHL 4MX7B 4V1DD 2YEZB 4NNXB 5KSAC 4OSUL 1N59A 4L8CB 1AE6H 1IEAB 4JAMA 2W65A 2VKWA 3IJHB 3C8HA 4LBEB 5HHXH 3UPAA 1XGRB 4M6NH 1N64L 4Z7NF 3D85A 3BW9A 2R1XB 4MAUH 4CW1A 2VXVH 4TQEL 5D1XD 2FSEB 3S9DB 4D0DB 2D0GA 5E5UB 1TVBB 5BS0B 2YRZA 1OAXH 3D3VB 2IBZY 1C1EH 4QYOB 3QHZH 2KUTA 1VGKB 3S36X 5FECA 5E6IA 3TCLB 1JCKA 5KVFL 5T5NF 4J4PC 4UOW0 1PG7X 5IM7B 3LV3A 1VGEL 4KHTL 4CVZA 3RIAK 4O58H 4J3XA 1A14L 3PV6B 4EDXB 5HHOB 1CGSL 3LOWA 4PLKD 5IOPA 5K9OA 3C60D 2UWEB 4H88H 4EUPG 1YDPA 3N1QC 4ZOCA 2MHAA 1B4JL 5EO9A 5HGHA 4TTDD 3EDFA 2ADFL 1TCRB 3BZEB 3RY5A 4Z7QF 3R1GH 3SO3B 2BC4B 1OWRM 1MUJA 4WUUB 3QUXB 3BP7B 3OR6A 3LIZL 5IROC 3HS0A 5CS7A 4Z76A 4AEFA 1AHWC 1JGDA 3MRQB 4AG4H 1ZGLP 2DYPD 2ADGB 2W0KA 3H9ZA 4MAYA 1ZLVH 4PGDB 1X44A 3OQ3B 4M7LL 1G9NL 3B4NA 4DKFL 4F57H 5I8CB 2X5PA 2VUOA 3RVXD 1S5HA 3VXOB 3S37L 1S78D 4LCWE 4X6EA 2ZUQB 4GQ9H 2LV4A 1IC4H 2AEQH 2VISB 5I15H 4LSPH 3DX9A 3GSOA 2FECI 4KJQC 4NQSA 3ULSA 1IFHH 4AIXA 3UZQA 5FB8A 4TUKH 1V7NL 1R5WA 1AE6L 4P2RA 1XGQB 1F02I 3MLRL 1SMAA 4L9LB 4M7JL 3GUTA 4HUXB 3KGRA 3GKWL 1BLNB 5HYEA 4MAUL 5IW1A 4IOFD 4GKOA 1ZLUK 4YHYC 3HAEA 1DQQB 5E8EA 3KG5A 3PHSA 3QQNA 1U2CA 5DXWA 2C3XA 3GSRB 3TBYA 1E0OB 1CICA 2XTLA 4KJQD 3V95A 3C08L 1YPZB 4QRUA 4NKDB 4F33B 3VMNA 4I18B 3QIBA 3GZKA 2A0LD 1YN6A 1RK0A 1C5CH 4TNWK 3EDKA 5E7FA 1C08B 4YE4L 2ADGA 2JCCE 1DQMH 2PYFA 1BIIB 4LIQE 5DJXB 2VUYA 2X1PA 3L5IA 1YC8A 4HV8B 4NQCB 3BPNB 4RQQA 2P8PA 3QEQE 4PRHD 2NY7H 3UPRA 1U41A 1UJTA 2JJSC 5JIIA 5HHQA 1SQ2N 4FFWC 3K81A 3GEWB 3JTSA 1HQ4A 5K9JH 1OAKL 4TN9A 2FHFA 3MCKA 3PWUB 2BY3A 2QSTA 5D2NB 5HVGB 3S34H 2VTFA 3QHTC 2XXMB 1YMMD 3GMQA 3OBAA 1S9WB 4NRZA 4OGAD 4UNVA 3ULVH 1BFOA 1NCCH 4HKJA 1AXTH 5DTFB 1Y0LB 1U3HC 2LTQC 2YS4A 4MNQE 4P2QA 3H8NA 5D71L 2P8MA 1BD2A 1Q1JL 2GFBA 5GGSY 5ILTL 3H9SB 1KJMA 5HGAB 3WHE1 5CJXC 3ARFA 5B4MC 3TJEL 4JFFB 4EI5B 3B9KC 2DQCL 1JGVH 3MXVL 4Z0XA 3MFFA 2EDHA 4JHAH 3TV3H 4XVSL 5JZ7D 4N0YH 5K9QI 4IEFB 4Z7WA 3O2DA 5HXMA 4PY8J 1LNUA 2VH5H 4OIIH 4UUJA 4NQDA 1GZPA 5I1JH 2QEJA 4NWUH 3K4ZA 3KJ6L 1WZ1L 1OM3H 1ZVYA 3HPJB 4NFDA 4I0PC 3O2WH 4NQVB 1YQVH 4LBEA 5SWZE 3MACH 5JPNA 3QA3B 2PCPB 4P5TB 2AJXH 3ARWA 4Y16A 1MHCB 2HH0H 5T3ZE 1FC2D 4NO2A 4PJHF 5EU6D 2XWTA 1P2CB 3L3OA 5TQ0H 4KI5C 2O5YL 1NCTA 4MDJB 2EZ0C 5CIPB 5DJ6A 3PF2A 5TE6L 5JO5A 1EEZB 1I1YA 5DD3L 3LKRB 4PJDE 5T1KA 4JO2L 4WUUE 5I66B 1OW0C 2NY4B 4PUBL 3B6SB 3MROA 5I18L 4LGSB 5E4IA 5F3HB 3REWB 4MXWH 4N1CA 3QEHB 1Q72L 1CT8B 1DQML 5DFWH 3RWGB 2I27N 1GGBH 2VE6B 1EX0A 3QQ9C 2BNRA 1OW0A 3X12A 3KLAA 2Z92B 3KPLB 2WIIB 3BP4A 3SGJC 3UBXB 4J3OC 4G8GE 4OF8A 4KJYA 5MEOA 3GHBH 4ZPTA 3OKKA 4LF3A 2YEZA 4GKSA 15C8H 1TQBB 5FYKL 4HC1H 4TVPE 5H2BB 5IBLC 3SJVB 2AW2A 2OS7A 3SO5A 2W9EL 1ACYH 3BQUB 4GRLA 4JPIA 4LEOB 1SM3H 1BQSA 2I60L 5BXFA 3O3AA 1KCUH 1G7PA 4U1LA 3DSNA 1OTTD 2CGRH 4YHNA 3D2UD 1MUJB 4P4KC 3KLHD 3MO1A 5EOQL 4QRTA 3VG9B 4WO4A 1IM3B 3BH8A 1QKZL 4H88L 4P23A 5IVXB 2G2RA 3MYZA 3SKOA 2VSCA 3NMEA 5I30L 3KPSE 1TIUA 1WZ1H 5EC1B 5MI0B 1CL7H 4MJIB 2AK1L 3TBVB 3W0WA 3CVHL 1QBAA 4P2RD 1RHHB 4PTTA 4R3SA 4MXQC 4UBDD 1KCKA 2MQCA 4GRMB 3ZE0F 4HIEA 2Q7YA 4D3CH 4JRXA 3HE6C 3V7AG 3EKCA 3FO2A 5DRZB 5TDOB 1OAUH 3K74B 4UIKL 2IQ9H 5CEYB 1IAKB 4NJ9L 3D3VA 3ARGD 3MO1B 3QIBD 1OTUD 1K5NB 1TJHL 4PBXA 1IAKA 4RGOL 4CW1B 1IKNC 3WS6A 2XXCB 3VCLB 5AZEL 2OI9C 3EOTL 5GGVY 3QDMD 4CNIB 4CU6A 3FT4B 4Y2DD 3QO0B 4ODXA 2DTMH 2IANE 1IGFH 4KQ3L 5E95B 2NX5A 4MD4B 5HJ3B 2FBJL 3HNSL 5EWIH 1OF2B 4P9MH 4OD3L 4L9LC 4NM4L 1A6AA 3TN0C 4AEEA 2CD0A 4LLQA 4JPKL 5H37G 5IHUH 3DX8B 3MRPA 5KAQG 3VXUD 3QIWC 1OP3H 1N5AB 1NLDL 2EH8H 4ZXBB 2G5BA 1MVFA 4HH8A 3RY6A 4KKAD 4QOKA 4F7MB 4PJFA 5JHDE 3RWGA 2D0FA 2NY5C 4UMGA 4U7SA 1RI8A 4TSAL 3ISWA 3S98A 1FYTD 4OLVL 2CRYA 2DQJH 4NO0A 1VHPA 4DKEL 3D69B 4GAYB 5IB2B 1KCVL 2BNUB 4MS8C 2CDGA 4JPVH 3O11B 1LO3L 5EULV 4NGHL 5C0AD 5EA0H 3BEWA 5J11B 1C5DA 4GKSB 3UTTD 4GMTL 4XAKE 3MRIA 2CUIA 1KYOK 1S7WB 4RIRA 3L3GA 5E8OA 3O6LL 3CH1B 3IJYB 3QA3A 3LH2H 5J3HC 2R0ZH 1HSBA 3UBXA 3RWCB 4OZFA 5IWLA 2AXFB 2ADIB 2EDOA 4XHQA 1DEEA 4YQXL 5JPMB 3KJ4B 3BJLA 4DUWA 3IRPX 4NNYB 3AS0A 2NY3C 4ZTPH 1NDMB 1D5XA 3QEQD 1WZMA 3MRGA 3VFOB 5JZ7C 2ITDA 3VXOA 4HXBL 4DWHA 3ZE2E 1H3UA 3RNKB 1MFAL 3MUZ1 2B0SH 1T04B 5T33L 5SWSA 4HFUH 2IAND 4KK6C 1NCWH 2XOTA 4AEHL 5CCKL 4M7LH 4YPJA 3ZHKA 5HYSB 4KQ3H 4UQ3B 3V2AR 3MJ7A 1T0PB 3K8LA 4X8JA 4MJ6A 4OQTA 1OLLA 3BN3B 3JUYA 4GAGL 2EDQA 2CR6A 3GSXA 3RVTC 4ODVH 3IDXL 2ARJQ 2ICWA 4KVNL 1I8LA 4QY8B 5D5MB 4UTAH 1RU9L 1IBGL 4HIHA 4WU7A 5GQBA 2XQYK 4NO5A 3VFUA 5H35A 1J0KA 2CIKA 1EMTH 1I7TA 2YWZA 1HWGB 3R0NA 1H3GA 4KY1H 3LRGA 2D7PA 3WFCH 5E8DL 5JXEC 3MOBL 4XVTH 2SEBB 1SMOA 1MFDL 1FORH 5DJ8A 5DUMH 5HHOD 2Q8AH 2PETA 5KVEH 1RUML 4P23D 5J89A 1BD2B 3DGGA 2X1XR 3LB6C 1MY5A 1OSPL 3WN5C 2P5EB 1KCSL 4NGHH 4ZOBA 1X5GA 3P73B 2XZZA 5DR5L 5IB4A 1FBIL 4RMWA 3VXMB 4LKXA 4KJPD 4MVBD 3U7WH 5DK0B 3T3PE 5IBUG 3L9RB 2J12B 3E2HB 1EZVY 4L8CA 4Z5RA 4HS8H 4IRJA 1UKTA 4NNPH 1HYSC 3GMPA 4TQEH 3UBXG 1MWAA 5HDQH 4GUPB 4O4YH 2YD5A 3IVKA 5IHZA 2Y23A 1MFCL 2VXSH 1U8IB 1U8PB 3CVIL 4HUUB 5EZLB 4DN4H 3Q0HA 4RFNB 2V17L 5EU5B 3WDHA 2FWOB 3UYPA 2CLZA 3DI2B 4JQXC 1S7SA 1SYSA 3P4OA 4KJPC 4MVBC 3MRNA 4L8SB 1HKFA 3TJEH 5AAWA 3CFBB 3E2HC 2BHUA 3O81A 4Y5VA 5GS2H 4CN6A 1Z6JT 4Y8AA 1PZ5B 4U1IA 5B3JF 4ZOAA 2IGFL 5F88B 3EGSA 2Z0BA 3KYNA 5C0CD 4CVWA 4YFEA 5C0AB 2BNQE 1JWMB 1DLFL 4JJ5A 1VEPA 5GRWA 3BZ4A 1FV1A 5C86A 1YDPB 5AWNL 4JJ5B 1CXIA 4X8XA 4G6FB 3ARDB 4C83B 1T66C 1MELA 3CZFA 1ULVA 4NO5B 2CQVA 2GYSA 3RY6C 2D9CA 5C0NC 3IXAA 1A1NB 4RFEA 4RMRA 4Z7UF 1J1PH 1CXFA 3G08B 1BBDH 3S4SA 5JXAL 1KXVC 4HF5H 3DNKA 4K55A 3CFEA 3ARDD 1UA6L 1JGUH 3GMOA 4Z76B 2R4RL 3OJDA 4ONOA 2IALA 3V4UL 3RTQD 5F1IB 3QEGL 4NQEB 4PBVC 5HYSA 4HH9A 1LEGA 2HTLC 4WFHD 5C8JA 5L8JB 4JM2F 1BD2E 4R6UA 1IM9A 5TE7L 2QSCL 5CWSB 3MLRH 1IM9B 1DE4A 4N5ED 2H1PL 2P8LB 1BM3H 1EFQA 3CFJA 3T2PA 4OZIF 1T5XB 1QRNE 1YN7B 4MQ7A 3LSOB 4QHLB 3BJ91 1EJ6A 1MFEL 4O2FA 3QPQD 3VI4E 3UXFA 1J86A 1ZLSH 4YHMH 4NQUA 2FR4A 1A64A 5ANMB 3SDAC 4ZFGL 5ADOL 2O5XH 1XR9B 4X6DA 2R15A 3G5XA 1G7LA 1R3JA 4GLRH 3C5ZA 2VDQL 4LFHD 4KAQH 2UZIL 5KOVC 4MD0A 1XF2B 1UXWB 3DX7B 3MV7B 1TVBA 4K23H 2OL3L 4X9HA 5IQ7H 1NBQA 1DLHB 1P1ZA 4JKPH 2D7MA 1NKRA 2DMKA 4PRDB 3VW3L 3QFJA 4L4VA 3VDBA 2R0ZL 1II4E 3H7BA 2WBJD 5C2BH 3MODH 3QWOB 5HVHC 3QDGB 4K3EL 2YOCA 4PJIB 3MBEC 1ND0A 4YNYB 4FTVD 5ICZA 1Y6NR 3RVWC 1KV3A 1J0JA 1KT2A 4R4BB 2XKUA 5GRXG 1R3IL 1MJJB 4M1GL 3C60B 4PGCB 4QLRA 5KANG 1EEYB 5DDHA 1F11B 4XPFH 2HG5A 5JIPA 1KELH 1GYAA 3QDGD 1JZ8A 3QUKB 4XH2B 1JTOA 1DDHA 5C09E 3U6RA 3K2MC 3Q3GA 32C2B 4LLQB 4IBLT 4HWUA 1CK0L 4M93C 1K8DB 3O45A 3KPMB 2NY6D 4YO0A 1PG7L 1WK0A 2NY1D 4K8RH 5BQ7A 2FEDD 5DQDL 4DZ8A 2CJUH 1UZ8A 1OCWH 4JM4H 4UINH 3REVB 1KB5H 3QZWG 4QRRB 2GAZA 4DCQB 3KWWB 3GIVB 2Z35A 5DMIL 1FFPA 2CK2A 4P3WA 2PXYA 1HYRC 1TJIH 3ILPA 3FQUA 2J4WL 1BQLL 3QP3A 2D03L 3DX9B 3ETBF 3GSOB 2O5YH 1QBML 2YXMA 1KCRH 4NN7C 1EFXB 3ZKQD 1RJLB 2DQTH 4O2EA 3D39B 4XC3L 4NQCE 4J23A 4I8DA 3WHE0 2GTZA 1XGPB 4ORGA 2FJGA 2I07A 1DN2A 4ZYKA 1I85C 4MSWB 1CWVA 3VH8G 1HYSD 5EZOL 3WSQH 4UV7L 1A6VL 2ZUWA 5DI8B 4JN1H 4MXQD 4UBDC 1A5FL 1D3CA 3HB3C 1T83A 5ABDE 5JHLH 1HHIB 3ARRA 2HJFA 2AP2A 1EK3A 4TVPL 3AS3A 3DV4A 3SKUD 4PJFE 3P0YL 2AS5M 2R2HB 4OM0L 5DJ2A 5CINH 1FDLH 5I19H 4DKEH 1OAQH 3TNMA 1FLRH 3WEXB 3L3JB 4K3EH 4OT1H 5DK2B 4FTVE 5DD1H 1I4FB 1L9NA 2GI7A 2V9RA 1LQSR 1ZXQA 4JJHA 5IBUB 1W8OA 4ERSH 4JM2D 5F7HA 5BV7L 1FZKB 2PF6A 3QDAA 3MFGB 3F7VB 1RSFA 1RVFH 4Q9QH 5FYLE 4LSQH 1ZE3C 4NKQB 3BQUA 5CZVL 4G7VH 4PJ8A 2NY1C 1G7JA 2FZ3B 5IBTL 3BD4A 2QTEA 2NY6C 2VERN 4AQOA 4LVOC 4WHTA 4LF3B 3RA7H 4PS4L 1NGXA 2WQRA 3QXVA 4PJEE 1QKZH 2VXTL 3HR5A 4IRJD 4XHJD 3UO1L 1CD1A 5F7WC 4L4JA 1TQCC 4OZGB 4RFOL 1BPVA 4Q58C 1NDGB 4U1SA 1ZVSB 3IETA 5FHBH 1BZ9A 4KK6D 2G9HB 5ALBL 2PO6D 3H6JA 1V8HA 4L3AA 4ZFFA 3N50A 1E4XI 5GSRA 1MHHA 2IWGA 4PJ8B 3QO1A 3LN5A 5HPMA 3I85A 2QSVA 3PWJB 1ZLUH 2YPKB 4JVPA 5FDWA 4PRAB 4JHWL 3RIAF 3SGKA 1P53A 1UM6L 3QULA 1LO4H 3GB7B 3IKCB 2CR3A 1DUYA 4ZAKC 3LS5H 3V6OC 3QB7C 3WLWC 5H8DA 1U8HB 1RUAL 4HXAH 4RAVB 5C0GA 3S5LA 5ICYB 5KVGH 1MJJA 3ARFD 3OAZH 1N0XL 3NGBB 1PG7W 4KY1L 4ZAKA 4HK0B 2DQEH 3QCUH 4YHKH 3Q1SL 1FE8H 4GW4B 3MROB 2I9TB 3TFKC 2XQYG 1U58A 1XGUA 5T5NG 2ITCB 3HZVB 3MRJB 1A7OL 4WEMB 4MS8D 3LKPB 4KI5D 4LGRB 3SCMA 4HKZB 3W11C 2OI9B 1P84J 1ZSDA 3WXWL 4MNQD 2JIXD 3D18B 2X4OB 3EDEA 1XGTA 5D71H 2OZ4L 1RVFL 4N8VA 4KAQL 2QQQA 5DHYA 3MUJA 2ICWI 3SBWA 4DGYH 3C6LC 3DTXB 4G7VL 3EYOA 4L3EB 4LASH 4R7DA 4O2EB 4I3RL 4K23L 5IQ7L 1RZ8B 2GTWB 4I1NB 4XCFH 4H26B 4LSDA 3VFNA 1B88A 4PP1C 3FTGB 3HE6B 4M5ZL 4WFHE 3ZKMC 3QIUB 4PRNA 3DV6B 3UO1H 1OARL 4M7ZB 4B41A 1YNLL 1OM3L 5CEZH 2JF1A 2HJFB 1EXUA 1E4KC 2NY2D 1B0GA 5JO5B 5GPRA 2PYFB 5C0AE 3ARGA 3VFVA 1CFTA 1U3HD 5DI8A 5FGBA 2FL5A 2DN7A 3H3PL 3LZFH 5HDBF 5F7UA 3QHFL 5DT1L 4UNUA 3VG9C 2B4CH 4Z7VB 4BFBD 1MY7A 2F54D 1DBML 4XAWL 3BD3A 1IKNA 3TNMB 5DLMH 1YMHA 5CZXC 1PX3A 5A3IC 1BOGA 3ROLA 4EIZC 1HHJB 4HS6A 4WV1B 4NQDE 5D7LB 4F37F 5EZIL 3ZYOA 3QG7L 1T89A 5CSGA 4QOKD 3LS4L 1UH4A 4GXUM 1D5BA 5I1HH 4RGNB 3MLVH 4K3JL 1AO7D 3S8WA 3KPRD 4HUNB 1NLBL 3TO2A 1R3KB 2EH7L 4OUUB 5D7LD 1JHKL 3GHBL 4G8EA 3VXMD 3VXQB 4OF0A 4KTYA 1MNUH 3EGSB 3VXQA 1PEZA 3M1BB 1L7IH 2ESVA 4HC1L 4ELKA 3Q6GH 5IFAH 2ERJC 4RMVA 1IC5H 3QDGE 3S35L 5GIRB 1RUKH 2BHYA 3C5SA 1EVUA 1X5YA 5LQBL 3GJEB 4XTRD 4CAGA 3RBGA 3KYOB 2P24B 3ULUD 3HZYA 3NFSL 3BFOA 1Z0NA 5I74C 3T2QA 4MDIA 5EO0A 3E6HA 1A5FH 1N64H 3UTQA 3BKMH 4OZGF 4U6VH 1WWAX 4QHLA 3UPRB 2FB4L 1NC4B 4PJ5D 1ZT1B 4YNYA 3QCTL 3B9KA 1ORSB 4KROD 1ZGLA 1IT9L 3QUXC 3KPMA 5I8EB 3I02B 4OUOA 3GMRA 5FM5O 1JGLH 5FM4A 2VXQL 4K7FA 4UIMA 4PLKC 4Q6YA 1QFUH 3F58L 4ZFOA 4AK1A 4PJIF 2EIBA 5D70H 2AJSH 1BLNA 4QCIA 3C60A 3DBXB 3P4LA 4I4WB 2VLKD 1IILE 5FECB 4ODWB 4FQJL 2EE2A 2YZ1A 3MLZL 4HS8L 1ND0B 5ECJE 4BQBA 2XPGB 4HIIB 1KLGB 4KI5F 5B39G 1YN7A 4MQ7B 4OCLC 1MFCH 1LMKA 1IQDA 1D5ZA 4X6BB 1JL8A 3WD5H 5IOPB 4M43L 2ZG2A 4ETQA 3LS4H 2MKLC 1JV5A 4NT6B 3IAPA 1JMZA 1D5MA 5M7QA 4JFYA 1NUFA 3NN8B 5D8JL 3N9GL 4ISVA 5IFJA 5IMOA 3PABA 3UAJC 3WIIL 5KSAB 3RTQC 4G8FA 3QXAA 2DWEA 5KANI 1CQYA 3GMQB 25C8H 4I5BB 3KYAA 1LD9A 5J3HD 3VI3E 2AEQL 3HAEH 2CJUL 1DSFL 1EO8H 2F8OA 1QSFD 1NEZG 2YMXH 3BMWA 3DOSA 5FHAL 5J57B 1IVLA 1DN0A 3D3VD 3KNBA 4OD1H 3RVVD 5ISZA 3G5YB 4ACPA 5B4MD 5FUCE 5T1DH 1PDKA 1OGAA 4YAQB 4OZFG 2EXYD 4GUPA 1M05B 1HXMB 1WT5A 4KKCD 4PD4K 1IKFL 1LO5B 1QSEB 4CVZB 1UCTA 2E7MA 5ALCL 4MD5B 2AJ3A 3DVGA 5MHSD 4HWBA 1VKXA 4WI5A 2E9JA 4XPHL 2AQ2A 5FGCB 4G43A 5GRJL 2APVA 2Y1VA 2WNGA 1KLFA 1JZ4A 3M45A 3ULUC 3G08A 1A6VH 1DQQA 1S7UA 4QHKJ 3IGAA 1KJ3H 4D0DA 1QUNA 3PWLA 4FTVB 1KBGH 3P4OB 3WXVL 5F89A 1OY3B 4PJ7B 3FB6A 1CLZH 2CPCA 1ZEAH 3IKKA 2M26A 4PYGA 1B3JA 2CIIA 5LCVH 3TO2B 5ICXB 3O4LA 3D2UB 5I19L 4QTHA 4XPTL 4NQSB 3ELAT 5F7DA 2YBRA 4KK8D 4OQTL 5DD6A 3K2UL 3CLEH 2DLHA 1L9MA 1E27A 2ZUXA 3HRPA 4CRPA 4R7NA 5HYJD 1GL4B 1IQWH 3QHZL 4Y5VC 3MXWL 1F3JA 4I0CC 5C0CB 4P59L 3F7VA 5T33H 4XCYA 1EAPB 4HFUL 4L4TE 1IAIH 1LWRA 4Z95L 3Q6FA 5EU5A 4Z6AT 1NAML 2DJ4A 4JFHE 3L5WA 2ED8A 3TBSB 1CD9B 4JFYB 1RZFH 5C2BL 3U2SA 12E8H 1ZS8B 1FRGL 1FNGB 2PNDA 4HLZG 2V6HA 1K4DA 2GHWB 1QPXA 4G6KH 5HYJA 4KKLD 3VA2C 2BNQA 1R3IH 5ADPH 5IHLB 5CHNA 3B9DA 4PJAA 1N3NA 4WEUD 1G1CA 3QDMB 1ZV5A 5JHDA 5CSZA 2YK1H 1KLGA 4IIQA 4NJAH 2CUMA 2CLVB 1HSBB 5IV2A 4E42A 5C07A 1BFVL 5E1AA 1FCGA 2A74A 2B39A 4N8VB 3QXDB 3VFRA 4XXDB 3UEZA 2YPLA 5IVXE 2HVKA 3SDDA 1KB9K 4YHLH 1EXUB 1DR9A 3JV5A 4PY7A 5I1LA 2J8UF 4XCNA 5C0JA 3VMOA 3DURA 1F4WL 2ED9A 4M7JH 2QQKL 3DVNA 5D6DC 4HMCA 4WWKA 2JJTC 4NQDD 3MJGX 2F74B 3X13A 5KVMC 1MCNA 3IFNL 5LAXA 3K4DA 2PXYC 1JJUA 3WFDH 4P46A 3UCRA 4K7PY 3E0GA 3TA3C 5KSBB 4LHQB 2CKBH 5F9WC 2Q6WA 2DBJA 3V5KA 2D4FA 2P44B 1C5CL 3GSUB 4UV7H 4LDEB 1UB6A 5ETUB 4PGCA 2CXKA 3VWJB 2WP3T 2IMNA 3S4SG 4BQ8A 4DZBB 3SDAA 1KT2B 1SEBA 2C1OA 3DVIA 3TBTA 3VJ6B 2FO4A 4L29B 2QQNH 4M5ZH 3TVMA 5FA4A 5FV1L 4FQHA 1UACH 5LG1A 1OARH 3RZWA 4NBXB 3UROR 3LKNA 3TCXA 5J56B 5C09B 5E7BA 4YUEH 4K2UL 1I9IH 1RJZA 4Z7VE 1CD1B 1K5NA 1MLCA 3NA4A 4LPTA 3ULVL 1CGVA 4PJ5E 3DYMA 1T20B 5FM8A 1TNNA 4QHUB 4AY0A 2H6PB 3OKEA 1Q1JH 1XFPA 2DB8A 4Q9QL 3V5KB 3TH3T 3X14B 2FYYB 1UJ3B 4LNRA 1JYVA 5LAXB 1AQDB 5C0BA 35C8L 3E8UL 4GRWH 3WMSA 1T4KB 3D6GA 3TV3L 2HAZA 5TH2B 2IBGA 2A9ML 4L4VD 1RHHA 4PTTB 2NY4C 1Z9OA 3BGFB 5F21B 4WI6A 1D7FA 1SYVA 3WHXA 1DBBH 1CFVL 1DFBH 3BDBA 5HGDA 2PCPA 2UVEA 3MQIA 5AZEH 5C6TL 4JANB 3LRSB 1YQVL 3D39E 2UV3A 5FHBL 5T1LB 3OL2A 5DEGA 4UT6L 1U8JA 5AZ2L 4DKAA 3AGVA 1IGFL 4L8BA 3MV8D 2ICWJ 3WO4C 5I1DA 1QRND 4ODTL 2E7CA 1D6EB 1JHLL 4L3ED 3F65A 2QLVB 5B39A 2R2CA 3V6FB 3H9SE 3T0EE 3IFNH 1ZHBB 1ZHKB 2AEPL 4QHNB 1BZQK 5CD3B 5F6HI 5ITBL 1MCPH 2XWJB 3HB3D 4HX1B 4J8RA 4GRMA 4XNUL 4HD9A 3QEUB 1ZSDB 3L7EB 1SHMA 1MJ7L 3WE6A 4BH7B 4AH2A 2X7LA 3VRIA 3KLSA 4JFQB 3DARA 5SX5H 1L6ZA 5IHBA 3QIBC 1CLZL 5INDB 3O6ML 5D6CA 2NTSP 3Q1SH 1RZJL 2XN9B 2BSRA 2Y6SD 1U8JB 2R69L 3SQOL 4HK0A 4Y4FD 1Z9LA 5FO9B 1ORQA 1S7VB 4WO4B 1FL5A 4X6FB 1JHTA 1B6UA 3GBLA 4MWFA 1GIGH 3CLEL 1EEUA 3TZVD 1VA9A 3FRUB 4M03A 5HYQA 1WQVT 1A4KB 2A73B 2YA2A 5D70L 1P6AB 3FT3B 3QIBB 5HHOE 2XT1B 3MLTA 1HXYB 3LN5B 3M8OL 2ZOLA 1E4XH 1OB1B 1S78C 1NBVL 3VH8B 2BVQB 2VO5A 2G2RB 3HZMA 1H3XA 1PG7H 1SBBA 2Y06L 3GNMH 4JQIL 1U92B 4NKIH 4M43H 4WUKH 4NQVA 1S3KL 3QI9B 4LLAA 2J5LC 4P2CG 3T65B 1CL7L 1NCBL 2XTJE 3CMGA 3SN6N 3IU4L 1M6OA 2RIKA 1U95B 2R0KH 1F4YH 1MI5B 4YZFF 2GT9B 3KPQB 2XI9A 1CLCA 3LKSA 3FCTB 1IAOA 1JHTB 1SEBB 4KKCC 3QI9D 3AFLA 3S96B 3ARED 4OV5A 1RURL 1WEJH 2EDKA 1FGNH 3L3HB 3ARFB 3OXSB 4KV5F 5IMKB 3V5DB 3VD9A 2EC9T 3RWHA 1I7ZB 1EO8L 2H9GB 2XY2A 4MNQA 3SOBH 1HDMB 3T1WA 4XNYL 1Z5LB 3SGDH 1R0AL 4NJ9H 3O8XB 3FAWA 3SGJA 1DBJL 3QG6B 3MJ8B 4RAUA 4N0RA 3RL1B 1DQLL 4PJ8D 4ZQKA 2ZJSH 3FAXA 3ARBB 4QTIH 4HULB 4QY8A 2UUDK 2BNQD 5D5MA 3O6FA 4R0LA 4N8PA 1HOCB 2JIXB 5K9KB 3SDCC 2P5WA 4UUJB 2R69H 4UDTB 4Y4KB 5J1AA 5DJAA 4OFDA 4RNRA 3CVHH 2IJ0C 2YUXA 4F3FB 5K9OB 2DICA 4PJ7F 1YY8A 5CJ5A 1TQCB 2JCCA 5E2JA 1BFTA 4FQCL 4D2NA 4G9FB 1EVTC 5I1GH 3SDCA 4NBZB 5IVNA 4NQEE 5I8OL 3BP5A 3TO4D 2AI0H 3OKNB 3EO9H 5FKAA 1VGKA 4IMLB 1HHHB 3VFOA 3NCYP 2QR0B 4FFYL 1JRHL 1QO3B 4AZ8A 1MQ8A 1IRAY 3L3KA 3LPGA 1BBJB 1NJ9A 3DROB 3TT1H 2P5WD 3CFCL 2Y06H 3EJZD 2X42A 3CSGA 5IVZB 3ME0A 2OSLB 3EYOB 2BVOB 1YEKH 3MA7A 1U92A 2IC2A 1U3YA 1C7SA 3U46A 1TZHB 4J1UB 3OX8B 4YDLB 1YJDL 2V9TA 3BEVA 1P7QD 3TP4A 1O7SA 1G9MC 1MCWM 2XN9E 4KJWD 1JYNA 5D2NC 4XMPL 2KL6A 5DK3A 4XPBL 1H0DA 3T4YB 1RZFL 1FFRA 3FT3A 2A6JB 3BE1L 4MA7L 1BQHB 4BUGA 1VERA 3BXNB 1SJHB 4CN4A 2X40A 3W2DL 4OQ1A 4ENED 4R2GC 1YEEL 5D1QD 3WJLC 1FAIL 5DYOB 3WKML 3U1SL 2KPNA 3BYTA 3LKOA 3VXPB 1VCAA 3U9PH 4ONFH 4P3DA 1C08A 1BBDL 3ULSB 4O00A 4AEHH 5CCKH 1S7QB 1ROWA 1D9KD 4X6EB 1UA6H 5DMYA 1G1YA 3MV01 4P3CH 4DKDC 3SJVD 4R96A 3LH2L 2IG2H 3TNNB 1FFQA 4F8TA 3UP1A 3GI8H 1N7MH 3C8DA 5I1LB 3NCYS 4OLYH 4JZJC 5MEQA 4JDTL 3L5XH 1E4WL 4Z7UE 3T65A 3V0VB 5HHME 2P43B 2OR9H 2QHLA 5L88H 1YMME 2QQKH 4NRXB 4U1JA 4PJDA 4LHJB 2COQA 1BAFH 2YZ8A 1JRHH 1QG3A 4RGMB 2QKIB 5GGTA 4OM1H 1JZ2A 2RBLA 4XZUA 3TT1L 2DLIA 3MLWH 3G5YA 2Q8AL 3MRHB 1HH9A 5F9JA 4CGTA 1RIUH 2JB6A 3D18A 4M7KL 3NVQA 5J9PA 4LLVA 5IIEA 2GQHA 5DMJB 1VGEH 4ELMF 1G9EA 4GAGH 3QXAB 3J7HA 4Y4KD 1MFNA 1CD8A 3ZO0A 5BO1L 5JDSA 4FG6C 4MA3B 3TVMD 5L9DH 1RJYB 1ZMYA 3FRPG 2J88L 2B4CL 2VIRB 2IH1A 3MODL 4LVHC 3EW3B 3MRKB 3U83A 4C57C 5BW7C 5IEHB 4LHUA 4TUJA 2DKMA 1N6VA 2ZSVA 1S7TB 5KS9B 2VXSL 3MJ8A 2ARWA 3LKNB 4PRIB 4XBPA 1QACA 5FUOL 1T2JA 2EYRB 1TZGH 4LLMB 5B38B 4OAWB 1J1XH 3P77B 2I5YL 2JB6B 4ONFL 5E94B 5C0AA 3UTPD 1WBYB 4AT6A 1XF3B 2GTZB 5F9OL 1PZUB 4W4OA 5EDXA 4YDJA 1PLGL 4E0RA 4DFHA 4OLXL 4JQXA 1YJDC 1X5XA 1OSZB 1MCDA 4BSJA 3OZ9H 1NAMH 1MNUL 4BKLB 1GZQB 2C7UB 4NKMB 4XCEB 4XWGH 3VRLE 1EHLH 4F7PB 5MEOB 4KUZL 1D5IH 1U95A 1VFBB 2WWKO 3S35H 3HC0B 4NHUB 3G6AB 5MEPB 4TTGA 2Z31B 5E6ZA 3BKJH 4ONGL 3B2VH 5JHDD 3CVIH 4Y19D 5BQ7B 3RPIA 4HBCL 4C59B 3LQAH 1RAMA 2G75A 4QTIL 4WHYH 1KEML 4HC1A 4HJ0C 3FB8B 2VZUA 1QSFB 5ENWA 1S9VA 3RZCC 4JE4B 1OAYH 3MRLB 5ENWB 3MUGA 1T2QL 3UJTH 5DJ0B 1FNEB 1TITA 4PJBA 1RIUL 4LK4A 2W60B 4XCEA 1AD0A 5JLZA 4YE4H 2MQ3A 1F4HA 5ESVA 1NGYB 3DGCR 4E5XB 5EBWA 1FG2B 2C3VB 4P4RA 4JKLA 2YXFA 3IDGB 2IH3B 4OZ4A 3QPXH 3FQWA 3CAFA 4G8FB 4WHTB 1L0YA 1MAKA 3VCLA 5IWLC 2NR6D 4NZUL 3SCMD 2RFXB 4P99A 5IR1B 1RZ7H 1U6AH 2ZPKH 3E6FB 3VFRB 1AXTL 4RWYH 3CFKB 4PRBB 1K8IA 1KJMB 4MHHI 3O2DH 3S97C 1A3RL 4O2CA 4EBQH 1K6QL 2IMMA 4PJFF 2OBGA 1FJ1B 5CZVH 2BNRD 2QQLL 4OBRA 1HWHB 3FQXB 3GSNH 1RZJC 1OQOA 5I74B 1KG0B 3G5VB 1JGEB 1T1WB 5T1LD 4H8WH 2NY7L 4F9LA 5C0CA 3QRFM 2VXTH 4ZD3H 3PWPA 4KKLC 2NX5B 5HJ3A 4NKIL 1HHKB 3HUJA 4RZCB 4QWWD 4X4XA 3TZVC 1H3PL 2MFNA 2LVEA 3WV0A 4BQ6A 1NCBH 1KF9B 3DO3A 4B7IA 4F9LC 3I6GB 3O41A 4LSTL 5T3XL 1ZLSL 3AUVA 2FD6H 4OGXL 4G8IB 1NCCL 1J8HE 1V3LA 2UYLA 4YHNB 2BFVH 1K8DA 4H26A 5J13B 4HG4K 1K3ZA 1LO0H 4NQED 1IKFH 3QJHB 4EVNB 1HKLH 3H0TA 4HZAA 4Q74A 4Z7QE 1V3MA 4WNQA 5D7JB 5DHXB 1BQUA 3V9FA 3IAGC 4IHOB 1CCZA 4PJDB 3ILPB 5BVPL 2VZSA 5KSVB 1FFOB 1QLRB 5JA9A 4UINL 3Q5YA 3SGEI 3B8SA 3QBTB 4PJIE 5EN2B 3KJ6H 4U1KA 2F54E 1G7QB 4OCRH 5LKNA 4QXUL 5C6WH 1BP3B 1Q9WA 4YXHL 1NGWB 1CICC 1FVEB 1W72L 3FB6B 3PGFL 1MJ8H 5EBWB 5GS1B 2VDOH 4YO0B 1IAOB 1I1AA 1X3DA 4XAKD 4HWEH 3VWJD 1YMMA 4FQCH 2VXUH 1OGTB 2BP3A 2Z91A 2AEPH 3EYFB 2W9LA 1I75A 2D7TL 3JTTA 3VMPA 5EPMB 5I66A 3OGCA 5MERB 1D5BB 3MZTA 3WFHA 4UV4H 3KJ4C 5JW4R 1XR8B 3WLBB 2J8OA 4JN1L 1IGJB 4NC0B 1NAKH 3AREA 3VFGH 1WICA 5DVLA 4JY4A 3UTZB 1AXSA 1AGDA 1Q72H 2DI7A 3NIFE 1IC4L 1A6PA 3QNYA 2C3HA 4JFHD 1U8MA 2J8UB 1RUPL 4KK5D 1NANI 3OKKB 4TRPH 3RX7A 1MHCA 4J3TA 2BVQA 2MCPL 5B38A 3DUUB 4AENA 1A6WL 4KJYB 3L9RA 4PJCA 3VXSE 2WQ8A 4MA8H 4OI7A 4OZFH 3AROA 4ZFZA 4G6AD 4LLDB 4M6MH 2C1PB 4U49A 2C9AA 3QUML 1ZHLB 4G6AC 1AKJA 1MAML 1QLFB 1E6JL 3S3SA 2MJWA 1EHAA 1B0WA 5CEYA 4BKLA 4HJ0D 2E27L 5JOEA 4I2XB 1ACYL 3EO1A 2DI9A 1F4AA 3D5OF 1T0NB 1TVDA