5DK2A

Fc heterodimer e356k/d399k + k392d/k409d
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
207
structure length
207
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRKEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLKSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 207
sequence length 207
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk2A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk2A01
2VLKE 3VDBA 4D2NA 4CMMA 5FYKL 3WNNA 3MLSL 3A6BL 4GRLA 1KFAL 2NLJA 1NC4D 4MXVE 3QXDB 1S9WB 4LASH 3VFTB 4GG6F 1AGFB 2FJHB 2ZG3A 4ESKA 2E7LA 4OZHB 3O41A 5I1EH 1FJ1B 3B9EA 1OTUD 2YC1B 4NKIL 3MXWL 3BE1L 5EOQL 5CLTA 3QSKB 4XBGB 4IRJD 2EDBA 4N0UA 3GMOA 5TE6L 2A73B 1FRGH 1S7QA 1KXQE 5E00A 2IPKA 4YO0B 5IV2B 1ERNA 4N1CA 3UTQA 4M6NH 1QVOB 5IM7A 3IVKA 4FFYL 4Y4KB 3QJHB 1EJOL 2EIZA 1Z5LA 3CJJA 2XQBH 4X8JB 5CHNB 4OLYL 5IB5B 5JLZB 1RUKH 4KTDL 2CKBB 5CSZA 2WMPA 3BZEA 5IGXH 2DIAA 4Z8FH 3GMNB 2VLME 5GRYA 2BVTA 4WI3A 5LGHH 3RY6C 3BSZH 4K07A 2V5SA 4MJ6A 1HI6B 4S2SA 4YHPB 5T1DL 1YMMA 2DQDH 5MHSE 1T20B 5EDXA 1F11B 4RIRA 1IQDB 1Q9OB 3QG7L 5EBWA 5TDPA 1M05A 1F13A 3U7YL 3O81A 3IFNL 4YNYA 2MKLC 3NA4A 1LK2B 2APXA 4MLIA 2ITDB 4MVBC 4X7DC 2W9DL 1S7RA 1NDMA 3MV8A 4YBLC 1NGQL 4JM2B 4XNUL 4ALAL 1R3HB 4QRRB 1X5HA 3FN3A 4XVTH 3DJ9A 4XCFL 3U9UA 4MWFA 3CFIC 1FNFA 4OD2A 4TSCH 3E1F1 2OL3A 3VH8B 4PG9A 2AVGA 1L0QA 3KPSD 3E3QE 4Y4HC 3H3BC 3RJDA 4NUGL 3TGXA 1NCAH 2Z35A 4UZGA 4I48A 2IQAA 2AQ2A 3FAWA 4LEXH 5E7BA 1J1XH 4NN6C 3UTTD 3MOBH 1MEXH 3VXRB 2BOBB 2Y6SC 4M00A 4R26H 5JZ7D 4O5LL 4U31A 1HH9A 2FRGP 2Y06H 1W0WB 3R8BB 3E3QC 3FQNA 2HLAB 4OCLC 3TBTA 1MAML 5TH2B 4U1GB 2VXUH 3PWPA 2QQKL 3QHZL 1S7XB 2X1PA 4XVSL 3QUML 1U8IA 3G5VB 1SBBA 3UJJL 2MSPA 5SX5K 1XF3A 5J3HD 1HNFA 2XI9A 3ULVH 1X9QA 5BXFB 4ONHB 2E7BA 5E8EA 1ZLUH 1SY6A 4Z7NE 4JO2H 2R2EA 4UNUA 1CXIA 5B3JF 4S10A 5FAAA 5HTSA 1CFNB 3MXVH 2D7QA 3GO1H 1OM3H 3GSNB 4AIXA 4HIXH 1I85C 1RJZB 4K8RC 4LLQB 4U6TA 3JWOH 4PJHF 4K94C 1T03L 4K3DL 4PJBA 1ZGLM 3TIEA 2LAAA 5HHPA 1S7UA 2VN4A 4KKNA 2MHAA 3IS1X 2Z91B 3ALPA 1F00I 5D70L 1MCWM 4JFZL 4P4KA 4POYA 4KAQL 1WBYB 3VG0H 1WV7T 1FYTA 4UAOB 3VI4F 2R1YA 1DBKL 4MZ3A 2X6MA 1SEQL 1U8NB 3M17A 1S5HB 5CGTA 1A6ZB 4NQEB 3D2UD 1AQDB 5FUZH 3EAKA 4G6ML 1I7TB 3I02B 3F7QA 3IKKA 5DC4B 4LLWB 4MB4A 2BFVH 3IDJB 1QFUH 5DJZA 4YHOH 4APQD 1XGRA 4YWGH 2UUDK 3O6MH 2HA1A 4WFED 3NCBB 4DUWA 2VXTH 1CD1A 1TJHH 1OD9A 2W65A 5FGRA 5EUKB 3UTSE 3FO0L 3QG6B 3BGFB 1I7RB 1S7TA 3MRBB 2H1PL 3L95B 3L3GB 5I1CH 3WHXA 1S3KL 1YDPB 4NQVB 4RMQA 1KYOK 3VFSB 5EBMA 1A7RH 2RAMA 4JZNA 4UTAH 1T7YA 1BREA 4R8WH 1XZ0A 2R0ZL 1RUPH 1IGYA 2APFA 4I0KA 5GS0C 1XEDA 1IILE 1MQ8A 3K4AA 4JAMA 4GRLB 2NLJB 2VAAA 3VI3E 3V2AR 3O41B 4BZ1H 5BV7B 5L7XH 1J1PH 2YPVL 3PJSB 1NUNB 3QQ4A 1M71A 4KQ4L 1AJ7H 3Q3GB 3D69A 3V52L 4CN6A 4IJ3C 4N0UB 3GMOB 2C4FT 1ZV5A 1RUAH 1MJ8H 4YLQT 1S7QB 1P6FA 5E00B 3QIWC 2FB4H 2IPKB 5EZJA 5JOPE 1RUQL 4JANA 4POUB 3O4OB 4LQFH 3BKML 2BSTA 4O51A 5IM7B 5KTEH 5EOCL 1NANI 3QIBA 2EIZB 1Z5LB 5I2IA 1U2HA 4HQQL 1XMWA 3QWQB 1AQKL 4UQ2A 5CSZB 3BZEB 4GAGH 1QNZH 4D0CA 2B0SL 2QKIA 3GDBA 3NZ8A 1PZUB 4RQQA 4YXHH 4MJ6B 2XTJB 2GT9A 5DURD 4S2SB 1GH7A 3VGGA 4F57H 1YMMB 2JELH 5JA9A 4TUOA 4RIRB 4ZTOL 4RWYL 1D9KC 4UBDC 3EO9H 5TDPB 5D6CA 1M05B 5L9DH 3MCKA 2W1NA 4YNYB 4RX4D 2YPLE 4NFCA 5C7XL 4JN1H 5E1AA 2NPLX 4X4MA 1EA9C 4JO1H 1S7RB 1NDMB 3MV8B 3KR3H 5HBBA 4GS7C 2W60A 4JDTL 1GAFL 1XIWA 5GZND 1WFNA 2I24N 3UTPD 3U9UB 4MWFB 5TF1L 4OD2B 2IGFH 1S5IL 4JRYD 2OL3B 4PG9B 2AJSL 3MC0A 5FCUL 3H3PL 4PJCE 4KGLA 2HKHL 2IQAB 1ODAA 2X2YA 1MI5A 3ES6A 4GAFB 1JPGA 3W0WD 1C5DA 3BKJL 3WKNA 2NZIA 3S9DB 1YEFL 4RISL 2VZSA 4JPVH 1HH9B 1N5AB 3HE6A 3I85A 1IC4L 3FQNB 3TBTB 3W9EA 4TTGA 3RUGE 5I1IH 4OZFA 4QT5A 1HHHA 3PWPB 1DFBH 4JPKH 4PS4L 2UV3A 1U8IB 4L4TB 2J5LC 5F8QC 3UROR 3WXWH 1XF3B 2HFTA 4X83A 4X6BA 3HI1A 5AZEL 2QQQA 2VO5A 5E8EB 3SE8H 4YK4C 3OKOB 3BPNB 4M62H 1RFDL 1IGFH 2ZUSA 4PJFE 1V3KA 2DQGH 4CU7A 1EHLH 3E6FB 1EGJL 3ZDXE 1SMAA 3SE4A 4PJBB 1KJVA 4P0DA 4GXUN 5HHPB 1S7UB 1QFOA 1EMTH 2MHAB 3V6FA 3OL2A 2HTKD 2CRIA 1MIEH 2Q6WA 4P4KB 3TN0A 2GUOA 3OQ3B 3NGBB 4JY5H 4UTBL 1FYTB 3D9AH 2EICA 2DAVA 1OW0A 1K5NA 1AGBB 2R1YB 2VUYA 3ULUF 3MV9A 3RGHA 5IHLB 1GGTA 2UY7A 4I4WA 3M17B 1LILA 5DHVA 5JDJA 2DQCH 3VG9B 1BFSA 3LQAL 4PLJC 5LCVL 4OZIA 1KC5H 5HYJD 1MAKA 5DJZB 2FEEL 1MAJA 4LLYA 4M1GL 1XGRB 3QUXD 2H2PD 3BQUD 4YDVA 1H5BA 1E4XI 2AJUL 3A6OA 5JDSA 2Y9RT 1CD1B 4JCMA 2W65B 4NQCE 4PG2A 4JDVA 2YRZA 3LKSA 1PLGH 2XN9E 1S7TB 1F4XH 5DQDL 5CEYA 1JV5A 3WHXB 5F7UA 1RSFA 5EBMB 1CICD 2WAHA 4TSBH 4X4YA 4GO6B 4JZNB 4NJAL 1XZ0B 4K3GA 5TGBA 3L5WA 5BRZB 5HD8D 5I8KL 1IGYB 3Q6FA 3C8KA 4JAMB 1DQQA 3HC3L 3FFCA 2VAAB 3WJLC 4G8EA 4L29A 4F7PA 2ICWI 1UVQA 2Y25A 3O6FC 5E8DL 4X6FA 3RVWD 4CUCA 1JMZA 4PJXA 5I8OL 5GSVA 3BMWA 3VWJD 4YFLI 1M71B 3C5ZD 3D69B 3MRJA 4ZTPL 3SJVA 5GXBB 3VA2C 3RA7H 4QXUH 1UWXH 1YQVL 3REWA 3MACH 4C57C 5EZJB 4WI5A 3S97C 2FNBA 4JANB 4O51B 2IAMD 2BSTB 5E2JA 3IB4A 2F8OA 5FHAL 2HAZA 3QIBB 5HYQA 5I2IB 4JPIA 2A77H 3BI9X 4KC3B 4Y5XA 4UQ2B 3T0VA 5I19H 2R4SL 1YECH 1OP3H 4WEUD 2QKIB 2EYTA 4XC1L 2A74A 4JFYA 8FABA 3NZ8B 2VXSH 3LCYA 2DQHH 3B9KD 4RQQB 4XRCA 4LGPB 3OZ9L 4ZNEA 4F9PC 2GT9B 4NKDA 3MRDA 1WTLA 4KHXH 5E2UH 4PJGA 4DWHA 4DW2L 4TUOB 2R56L 4F58H 2Y72A 1NEZG 2ZSVA 4KVCH 3V4VH 5D6CB 2YK1L 1NQBA 4JZJC 3MCKB 4LLAA 2ZSWA 4RMRA 5E1AB 3O3AA 3RY5A 3MRGA 3TBVB 4OD1H 1EAPA 1SJXA 2W60B 1INDH 2PXYA 4ISVB 2R39A 1XGYL 1XIWB 1GRWA 1GGIL 1UH3A 4XNZC 4OFPA 4YFDB 5K59E 2Q86A 3GRWL 4RAVA 1H9VA 3CLEL 5KVGH 2APVA 1KF9B 2BY1A 1A3LH 4GMSH 2XY1A 1N26A 4M3JA 2IQ9H 2BVEA 4RX4A 3ES6B 1RY7B 2DLFL 1EEQA 2FGWL 2FX7L 3AUVA 5C0IA 1A0QH 1OCWH 4XAWH 1C5DB 1KB9J 3AXLA 1BWWA 5E7FA 4HUMB 2DMBA 2VQ1A 1L6XA 4G42A 3IAGC 3HE6B 4YPJA 1RHFA 3W9EB 4Q9RL 4HC1L 4OZFB 1RMFH 1HHHB 2I60H 3DUHA 2M8XA 3O8XC 3ZE0E 1J86A 1JUFA 4X4ZA 4PTTA 5HHXH 1ZLSH 2CR3A 3KPTA 1I1CA 1R3LA 3UTTB 1IGTA 3JTSA 1AIFA 2NNAA 3HI1B 1MCCA 2Y36H 2JCCA 1D3CA 4CW1A 4LLUA 3D85D 4MJID 5ECJE 4K71C 3MO1A 5EZIL 3PG2A 1T2XA 4NHCH 3Q1SL 2DQTH 1ZK9A 5LAXA 1AR2A 3MRMA 2FECI 4HKZA 3BH8A 3NTCH 1FLRL 5ADOH 3EYUH 4P2RD 1R5WA 1P69B 4P23A 2LU7A 1KJVB 4TQEL 4JY4A 4PJDF 4Y19D 2FBOJ 5DVNA 3V6FB 4MNQE 5C2BL 4GLRH 3MOAL 2KPNA 2Q6WB 3ESUF 1FAKT 3TN0B 5GHWL 4AEIL 4E42A 4FFZH 5LXGL 1FE8L 2WIIA 1K5NB 2PYEE 3MV9B 3ZKXB 5B21A 4I4WB 5FFLA 2E9JA 4LDEB 4RGNE 5DHVB 1JTOA 4PJ9D 3DNKA 1SBSL 5J8OA 4EOWL 4XPBL 1T0PB 2FLBT 1YJDL 4JGJA 4OZIB 1NC2A 1B2WH 4PGCA 4LLYB 1CDBA 1V3LA 1LHZA 4YDVB 4JREC 2F53D 1H5BB 2NZ9D 5JW5A 4Y4FD 4RGNC 4QRPD 5D1XD 5JDSB 2PKDA 4P46D 4QXGH 4KKBC 5H94A 4JDVB 2ZKHL 3LKSB 3D2UB 3MRFA 5A1AA 4OLZL 3ZDZE 4IHOA 5CEYB 3NH7H 2NY6C 1JV5B 4GRMA 1R0AH 2X89D 2DTML 1V7ML 2YN5A 4X4YB 1XR8A 4NQUA 4K9EH 1U9KA 4XWGH 3MLUL 4X99A 5TGBB 3L5WB 4OLVL 2J8HA 3F7YA 3DURA 5D2LA 3NACH 3Q6FB 3T2NL 4QXWA 2V7HA 3C8KB 3UPAA 1K2DA 1FZMA 3TVMD 1K85A 1DQQB 1NKRA 3FFCB 4G8EB 4L29B 5DRXA 4F7PB 1UVQB 1JGVL 1QACA 3QUZD 1BOYA 1P7QD 5DUPH 4X6FB 4S1QH 4PJXB 4N0CD 5I74B 1X6NA 5GSVB 4Y16A 4AH2A 3MRJB 3SJVB 2NXYC 1HHJB 4I8DA 4ORZC 4QEGA 4EUPG 1JYXA 3REWB 3ZKSD 2F5AL 5BMFL 1MCOL 5GGVY 4KKAC 2NY7H 5KSBB 4S11A 5CEXA 1R24A 1H8NA 4I9WD 5BCAA 5HYQB 4JPIB 5GISH 2ADIA 3QCVH 4Y5YC 2J2ZA 4Y5XB 4OJFH 4XPAH 5A16A 2VDKL 3WDHA 4UINH 4AYFA 4KXZI 4P3WA 2V2TA 3FQTA 1MNUH 2AERT 2UVEA 2EYTB 4ZS7H 2A74B 3MLYL 4JFYB 8FABB 2XA3A 3P4LA 1U3ZA 5INCA 4XRCB 3GSNH 5F7NC 2C26A 4NKDB 3MRDB 5BW7C 4LVOC 2X4OB 2DF3A 4PJGB 4V1DE 1YEIH 4HGMA 4KI5E 4X4XA 4Z7UA 4QHKJ 4PRHE 3AU1A 5D8JH 5AZ2L 2ZSWB 2YWZA 3O2VL 2R2HA 3O3AB 4X0KA 3MRGB 3GRWA 1C16A 1EAPB 1NGZA 3HI5L 2PXYB 3FB7A 3QDJA 2ICEA 1MWAB 4Z95H 5HY9A 1TETH 5DURB 2Q86B 4RAVB 1KELL 5J57B 1JF1A 1HOCA 2HFGH 3FONA 4HK0A 3EBAA 4CMHC 3QXVA 1RJLA 5E2VL 2F58L 3WIIH 4MQTB 5SWSE 3NVQA 5C0IB 3TEUA 3AXLB 3VWKA 3EFDH 2VQ1B 2VL4A 1XGQA 4G42B 3IETA 3VXME 4OTXH 1CDUA 2R1WA 3QEQE 3V6OE 3U9PH 4BSWA 5AG8A 4HCRH 3ILPA 4MS8D 4C58B 3V0WH 4KPHH 4OLUL 3E2HB 1A3RL 1FPTH 4YHML 2L7JA 5JTWA 1JUFB 5IIEA 3ARDC 1FCGA 4N90D 4OZGF 4PTTB 5C70A 3NABL 3C2AH 5HHOA 1R3LB 3JWDL 1IGTB 1IAIM 3JTSB 1U3HD 1AIFB 2NNAB 3T77A 3S5LA 5ID0A 4PV8A 3QAZB 2JCCB 1M7DA 4CW1B 4LLUB 3CLFL 3MV11 3MO1B 2VR4A 5LAXB 5SWZD 3PXHA 4JFFE 3MRMB 5FHBL 3UTZA 3V9FA 4HKZB 3BH8B 1A7NH 5DK0A 4I18C 1OOAA 3R1GH 3RDTD 1R5WB 1GHFL 4X6CE 3RWCA 2LU4A 4P23B 1H0DA 4LIQH 3MCLH 4FFVD 3GHEL 3QYCA 2PTTA 4WFGD 1NCDH 5EO9B 1B90A 3VFOA 1MFDL 1IARB 1HZHL 2BJML 5C6WH 1IAII 4HIHA 3ARWA 4E42B 5ID1A 2WIIB 3CH1A 4UOJA 4LCYA 2IJ0C 2DBJA 3HA0A 4P5KA 4CDHA 3RVTD 1E6OH 4FQ2H 4JFDD 2NY5L 3V0VB 2V17H 3B2VL 3LSOB 5EU4A 1OVZA 5EUOA 4P2OD 3HG1D 5J9PA 2YMXH 3MBEC 4K55A 5IB1A 4PGCB 2N56A 5HDLA 4W6YB 1FGVL 2DWDA 3DLQR 4NN5C 3SDXF 5A3IC 3P4NA 3CFEA 2E8ZA 5KZCB 5H94B 5HDQH 5KOVC 3MRFB 5D72L 4R96A 3S3PA 1IJ9A 1NLBH 4GQ9H 5J6GA 12E8H 3MA9L 4GRMB 4DTGL 1RZIA 1UM6H 3D25A 2UWEE 5JHLL 2NX5E 1XR8B 1T83A 4H20H 2YD9A 4X99B 3BQUB 3P9LA 2F53A 3F7YB 4LNRA 5D2LB 5K9KA 1VB9A 2V7HB 2VDRL 1FZMB 5I73C 2HYMA 5E6YA 5KN5A 5DRXB 4TYUA 5FGCE 1J0JA 2COQA 2JJWA 5JW3L 4YPGA 1T7VA 4I0CC 1IGML 5CZVH 2GEEA 1PEWA 3SDDA 3WS6C 3L7FA 3MYJA 4Y16B 4AH2B 3ARUA 1OAXL 3SDAA 4D9LL 4FFWC 4OLEA 3DSNA 1PZ5A 5JW4N 1LNUA 2VDLH 4YUEH 4RFOH 1MCWW 5HHMB 2I9TA 4G9DA 5CEXB 2CDGA 3VFRA 3NAAH 1BJ1J 3WUWG 2ADIB 3V4UL 4ODBD 4E41D 3QUZA 1KOAA 5IW6A 1NUDA 1UA6L 2IBGA 5A16B 3OKYA 1UH4A 1X5XA 4HFUH 4W70A 4GAJH 4GFTB 1OWRM 2BZDA 5FUCC 3HMWL 1SY6H 4NNPH 5IQ9A 3UJIH 3RWEA 2Z0BA 1V7NH 3VRLF 5EU5A 4P5TD 1I1FB 5INCB 1JNHA 2AP2A 2L7UA 2Z8RA 4Z7QF 4BSVA 4NBXB 3NZHL 3MBXL 2EDFA 3DV6A 1OLLA 3JWNC 3ZKMC 2VE6A 4LDOB 3CDGA 4RMUA 2P49B 4UOW0 1LQSR 4X4XB 4Z7UB 5FOBA 3AU1B 1HKFA 4POZD 3QCTH 1T1ZB 5DUBA 2R2HB 1CXLA 4X0KB 1C16B 1NGZB 3FB7B 5E6ID 2ICEB 5HY9B 3BVNA 2AJXH 3VDCA 5L2JA 1JF1B 1HOCB 2OS7A 3FONB 4Y7MA 3UZVB 4HK0B 3TT3L 1RJLB 1QRKA 5EPMB 4WFHE 4MA7L 4WEBL 3EYOB 5LGJA 4XNYH 3QEHB 4PY8J 1NKOA 4NUJA 1HILA 1FH5L 3VWKB 2ADFL 3C6SA 3HN3A 1MRCH 1WTGT 3IETB 4I0PC 1F90L 5KVFL 2R1WB 5IBTH 1MLBA 5D93C 1AY1L 4BSWB 3ILPB 1I9IL 4G5ZL 3MLSH 3SGKA 5E4EB 1MHPH 5IIEB 5F93C 1A14H 2VKWA 1KFAH 1VADA 1DQJA 1NFDF 5HHOB 5TJWK 1TITA 5ID0B 3T77B 3S5LB 1Z0MA 4JFQA 4M6ML 3MFGB 1M7DB 3MXWH 1D5MA 5EOQH 3I3EA 4HWUA 2MOVA 3TJEH 3FO1A 3K7UA 4LRIC 4QKXB 5I9QB 5TE6H 3UTZB 2GW5A 5DK0B 5DD1H 4ZSOA 2W9LA 4GAYA 3CX2A 2J6EL 4EDXA 3RWCB 2HKFL 4F9LC 4FFYH 5A2IH 2PTTB 4KKLC 4M1CC 2NY0B 4UV4H 3VFOB 5B3NA 3CVIL 3VMNA 2DTSA 4KTDH 5L2KE 1DE4A 4J3TA 2EIEA 4PJ7A 4HIHB 3X14A 3CH1B 3PDOA 1VSCA 1DBAL 3LMJH 1AFVH 4PJAF 3TC9A 2J12B 5SWZA 1U2CA 1KJ2H 1UEMA 3DI3B 2E5EA 5ADPH 3HUJF 4QRSA 3NOIA 2GTWA 4JFOA 4LFHD 4P2RB 3MODH 5T1DH 4GOSA 5EU4B 3RI5F 5EUOB 4RZCA 1QUNA 5J9PB 5IB1B 4HWZA 1B88A 2DWDB 3DXAD 4OSUH 1N64L 1AC0A 3MRQA 3U7YH 3WV0A 2NQCA 2JJSC 3QBTB 3ZHKA 3LPGA 1CYGA 3CFEB 3GJFB 4B5EA 4PRPD 2VXQH 4FNLL 1HYRC 3TNMA 2W9DH 1NGQH 3ET9F 5CILH 1N4XH 3MPCA 4R96B 5GSRA 4GRWH 4XCFH 1YQ2A 5F88A 4BA8A 3WN5A 5J6GB 3BZFA 3CCHA 3TZVD 4O00A 1RZIB 3D25B 4HDIA 4Y8DC 4F7EA 4DKFL 3KPRE 2D9CA 4NUGH 4IOIA 3T2PA 1BFTA 3P9LB 3SY0B 2F53B 5C0JA 1FLTX 5K9KB 1JTTA 4WV1C 1NPUA 3DV4B 4PJ8C 2EEDA 5KN5B 3FO9A 4WFFD 2PTUA 4IRZL 2A9MH 4YPGB 5FGSA 1R3IL 4ELME 4IIQB 2Z4QA 5HGGS 5FM5O 3SDDB 3L7FB 2QQKH 3QHZH 3MYJB 1UGNA 3BJLA 3QUMH 4JY6A 3SDAB 3LVEA 5ICYA 5H37G 5CIPA 1PZ5B 4LSUL 1LNUB 4XP4L 1OAKL 3V5KA 1ZOXA 1JHLL 1VHPA 2I9TB 4G9DB 4J23A 1KSRA 2CDGB 1FZKA 3VFRB 2QQLL 4D9RD 2YXFA 1EXUA 4S1DC 4LHQB 2WBWB 5C07E 3TLRA 3QUZB 4D9QD 5IW6B 1P7QB 2A9NH 3MGAA 4B7IA 1FG2A 5IVXA 1LDPL 4P9HC 5IQ9B 4GG6A 2MCG1 3RWEB 2Y7QA 3U1SL 2D03H 5EU5B 3VD3A 3MUZ1 5JPNA 1RU9L 4ONOA 4FZEL 4NM4L 1HHIA 3U7AA 4NDMA 1JNHB 5ACZA 4BSVB 4R6UA 3G5YA 5D70H 3DV6B 3BYTA 3G5ZA 4A2LA 1WK0A 1TQCC 2VE6B 4Y2DA 4C55A 3CDGB 4YEEA 1F97A 4NOFA 1DBKH 3ZE2E 4E41A 5FOBB 1SEQH 3RZWA 4PGZA 3BZDA 5IHBA 5E70A 4WO4C 2IPTL 2EKSB 5DUBB 5CUSL 4LCWE 5DD5H 4GKSA 4H26A 1W72L 4LGRB 3IAQA 5A2JH 1FP5A 5DHVH 1UZ8A 3BVNB 4AK1A 2X9WA 4MNHA 1VFMA 1MCSA 3O2DA 4X6DF 3V8OA 4YBHA 5L2JB 2VERN 4KDTA 3VD9A 2CMRH 2WK2A 1T22A 4M4PA 2QADD 4PLOB 2VQUA 5LGJB 4LNVA 2FX9L 4KK5C 3FO0H 2ERJB 1HILB 3R4DA 3HAEH 3BD5A 2BNRD 3C6SB 5D1ZC 2KZWA 5DJ2A 1T5WA 4YE4L 4NRYA 4Z7WE 1MLBB 4C54A 4LSDA 3WFEL 4HPOL 2ATKA 2R0ZH 3WNKA 2IH3A 1QD0A 3SKJH 3C60A 5IFHH 2QSCH 5CZKA 5DRZA 1KULA 1CLZL 1A9BA 1DQJB 1G9NC 4P2QE 1ZT4A 3LAFA 1JZ4A 1KCRL 2NR6D 4JFQB 5JHDE 1IE5A 1D5MB 1A6VL 4J3VA 1A7PH 2YPVH 5IJKA 1GPOL 2IANA 3SE3C 3ARED 2J6EA 5KSUA 1KN2H 3FO1B 1KTKE 4KRNA 2VLRA 3P9MA 3QH3A 4GG8A 1RUQH 4ZSOB 4GAYB 4EDXB 2E6JA 1IQWH 4HHAB 1NGWA 2YWYA 1NCCL 3IDXL 5J1TC 3RTQA 1WIUA 5CEZE 4DKEL 3W81A 1DE4B 4LCIH 4PJ7B 1AHWC 1F4HA 5GIRA 1QYGL 5DC0A 5CZXD 3X14B 5E03A 3PDOB 2B0SH 3ARBD 4RDQF 1G7PA 2AKRA 4QYOB 5SWZB 4HJ0D 3VCLB 4QRSB 1OTSC 5J11C 2GTWB 4JFOB 4LAQL 4KQ3H 3RDTB 2J8UE 1AP2A 4RRPG 2WWMD 5EC1A 3KAAA 4LPXA 5E9DD 4RZCB 3U82B 4K3JH 1T5XA 2KUTA 4HWZB 4HJJL 3LS5L 1L4IA 2FWOA 5DFWH 2RQ8A 5FEBA 1ROWA 1UKTA 4JQIL 3TYGL 4M7ZB 1JGUL 3TNMB 1EV2E 1F3RB 4OF0A 5GSRB 5F8RC 2RJMA 2X4RA 5F88B 1XF5A 4WCYH 3WN5B 1K3ZA 5TF1H 4XP1L 3MZTA 4JFDB 3DOSA 3BZFB 4L8DA 3CCHB 1S5IH 4EIGB 3CC5A 5AAWA 1SMOA 4HDIB 1JJUA 1LP9F 3HG1B 2AJSH 4DCQA 5FCUH 3PIQA 3VXOA 3H3PH 4IOIB 3ULUL 2YUWA 5BJTB 1S7WB 4LAJH 4HEME 2HKHH 5DVKA 2P8PA 3SO3B 5C0JB 4NZUL 1EUUA 3CGTA 4OCYH 3OKNA 1C5CL 3FO9B 1INQA 1IT9L 3S8WA 2H32A 3MYZA 3L7EA 2Z4QB 2B39A 1IC4H 4JPWH 1Z9OA 3BHBA 5HSFA 7FABL 2VDNH 3CXHJ 3V79C 3AMLA 1N8ZA 4JY6B 4Q9QL 5ICYB 1NCNA 5CIPB 2WBJD 2NMSA 3V5KB 3VGAB 5AZEH 1IL1A 1P2CA 1FZKB 1EXUB 3KPPA 2VLMD 3QDGD 4Z7VF 1LO4L 1R5VA 1RFDH 1MUJA 1FG2B 4MVBD 5IVXB 3SKMA 3QJFA 2XACC 4KWUA 5MHSD 4TN9A 4GG6B 2Y7QB 1EGJH 4BSJA 5JPNB 3O4LE 1AE6L 5E8NA 1HHIB 2EDLA 4NDMB 5ACZB 2Z31C 2EXWC 1JK8A 3KHOA 3G5YB 3RPKA 3VXUE 3G5ZB 5ANME 4Y2DB 5EU6A 4UTBH 1HIML 2Y4SA 4E41B 4PGDA 1B4JH 1W72A 1F58L 3VW3L 2Y6SD 1NEZA 2NY1D 3IT8D 5BZDA 2VDQL 2AK4D 2EH8H 1CBVL 5J0BA 4GKSB 3FN0L 4H26B 3CX5J 4LQ1A 1UZ8B 3IYLW 4MNHB 4JO4H 4M1GH 2JF1A 4R97B 1FVDA 2D7NA 3C9NA 2AJUH 5EO1A 2H2SC 2OLDA 1CVSC 4FQPA 4LOUD 5I1KL 3DYOA 3LZFH 4UU9A 4J7RA 4NOBA 4ZAKA 1AXSA 3W39A 3EDFA 4LSQL 3V4PL 5ETUB 3OR6A 1G0YR 1SYSA 2GJ6A 4HJGA 5DJ2B 1T5WB 2ED9A 2ZUQB 4NRYB 4NJAH 4GKOA 4KRLB 2ATKB 5GGVL 2IH3B 2XXCB 5I8KH 2G75A 3HNVL 2B7DT 3ALXA 3C60B 4PJIE 2D7OA 1K6QL 5DRZB 2BXZA 1DSFL 4IDLA 1IEAA 1ZT4B 5ALBH 3RVXC 1DVFC 3V7MA 2H26A 3EUUA 2J88L 5I8OH 2M26A 4O4YH 1IGCL 2IANB 3H7LA 5KSUB 1QG3A 4HT1H 1YQVH 2Q8BL 4YC2B 4KUCD 2VLRB 3P9MB 3QH3B 3BEWA 3CXDL 1MHHA 4QXTA 1NGWB 4HXBH 4MNGE 5D4QA 4K8RL 1VERA 4NGHH 1UADC 1JWMA 3RTQB 4UV7L 1CR9H 1S8DA 4OZHF 1AO7D 5GIRB 7CGTA 1KXVC 2R4SH 2IFFL 3CDYA 4KROC 2HT4D 4J4PC 1UG9A 2BNUA 1G7PB 4XC1H 5FYJH 4MA8L 4W4OC 4B53A 4XMLL 3OTTA 1GC1C 4EEEA 1MVUA 3OZ9H 1MQKL 3UDWC 4J8RB 1AP2B 5EC1B 1B6UA 4DW2H 2R56H 4PB9L 1T5XB 1JYNA 2K3TA 3ARTA 4ERSL 5GS0D 3UTSD 2Y07L 4CAGA 1NH6A 3A0OA 3S34L 4YHYC 1KCSL 1OSPH 1NMAH 1XGYH 1GGIH 4CJ1A 3MNZA 4UT6L 1RZFL 2X4RB 1XF5B 2OQJA 5C3TA 4L8DB 3CLEH 3CC5B 2P5WA 1TCMA 4DCQB 3H8NA 4TPRH 1ZWIA 1QSFA 3PIQB 3VXOB 4ODHH 1MFAH 3EYQC 2DQJL 2P8PB 2DLFH 2FGWH 3OKKA 4BUHA 2A6KA 3QXWA 4MMXC 5GS0L 4JG1L 3OKNB 5IB3A 1INQB 1EDQA 5IQ7L 1FHGA 4Q74A 2H32B 35C8L 3SGDI 1CK0L 2BVOA 1IVLA 3WCYA 2VLKA 3SQBA 3L7EB 5A43C 2WP3T 4Q9RH 4HC1H 5JOPD 3BHBB 5T3XE 4IRJC 1Y6NR 1G7IA 3UX9B 2XZQL 3GSQA 2IG2L 1N8ZB 1WQVT 4W68A 3SEPA 5DMYA 5FYJD 4XNMA 5I17A 5GRXG 2ZJSL 5HYSA 1M4KA 2EO1A 3UO1H 2C5DC 1P5UA 4ACPA 4EUPA 5BVPL 1D9KD 5IHUL 4UBDD 1IL1B 1P2CB 3N85L 3BAEL 4PR5B 3O2WL 5GGTL 3W9DA 4OFYD 3KPPB 1NGXA 2OMNA 1R5VB 4PJ5D 4AT6A 1MUJB 3Q1SH 3LEYH 3TPKA 2BRQA 2LTQC 3QJFB 3L5HA 2DYPA 1OB1B 4JJHA 1C5BL 3RY6A 3O3DA 1WZKA 3HE7A 1WBZA 4TQEH 5E8NB 3VGFA 3AY4C 1WCQA 3BDYL 1X4ZA 1ZMYA 1KXTB 4ODWA 2YPLD 5J6HB 5GHWH 4JHWH 4AEIH 5EU6B 3FMGL 1F6AA 4WU5A 5LXGH 1FE8H 4PGDB 4ZUTA 3OAUH 5TPWH 4NN7C 1NEZB 5BZDB 4L4VA 2F15A 5LG1A 1MCDA 4EOWH 4XPBH 1GOGA 4JG0L 4JDZA 1ADQH 5GGQL 1HINH 1P4IL 1FDLL 4Y4HA 3QXAA 1FVDB 1U92A 3MRPB 3C9NB 3H9HA 3OAZK 1JGDA 5T3ZL 2X1WL 3LOWA 5EO1B 1FORL 3S36L 1KTRL 1OGTA 4J3SA 3BDXA 1L9NA 4C59B 2ZKHH 4UU9B 4JLRA 4OLZH 5DT1L 5TQ2L 4WHYG 1AXSB 4ZAKB 4U6VL 4X98A 3W39B 4KVNL 3OR6B 1SYSB 2GJ6B 4HJGB 3GK8L 2Q7YA 4BM7A 3OKLA 5I76A 3KJ4C 1V7MH 3HR5A 3D3VE 5FO8A 3MLUH 3NIDE 3K46A 4OLVH 1INEL 4KJYA 4LSVH 2G75B 1VPOH 4JQVC 5F3HA 3PWJA 3OKEB 2C3WA 4OCRH 1I3GH 2QADB 5SX4I 1IEAB 1X5KA 1JGVH 3BX7C 3UPRA 5FK9A 4L5FH 2H26B 3E8UL 5CSGA 1RZJL 4CVWA 2UZYB 4XTRC 2OI9B 1DQML 3SHSA 3V6BR 4PV9A 3VGEA 1BZ7A 2EIDA 1AXTH 4EXPX 3WEXA 3QCUH 2F5AH 4F15C 2AXFA 5BMFH 4WUKL 1MCOH 5JO5A 3BEWB 3VXSE 4QXTB 1JZ7A 2DI7A 4LHUG 1SM3H 2WUBL 1HQ4A 1AC6A 3B8SA 4FRWA 1S8DB 2B1HL 4GW1A 2F54A 3KYMA 1MCQA 1YMHA 2VDKH 4YFLF 3EO1B 1X5ZA 1FCCA 1UM4H 4HBCL 2BNUB 1FFRA 3MLYH 1BFVH 2AQ3A 4U1LA 1MVUB 5IFAL 1NCTA 3IFPA 4LL9A 4LVNC 3TP4A 4BFIA 2CO6B 3ULVE 5KJRH 5JUEH 3ARXA 4NQCD 5KSAC 3D5OF 4P3CH 4HG4K 2XN9D 3S88L 3WYRA 3RWGA 2AJYL 4PJDA 3ZE1E 4C56D 5T1KA 5FUOL 4OLXL 3O6FD 3LIZL 3RL2A 5IWLC 3D0VA 1OGAE 2DIBA 2EDNA 4JRXA 3ULVC 2OQJB 5DVOA 3ZL4L 5DO2C 1KELH 2VZOA 2P5WB 3LRHA 1ZWIB 1QSFB 3MUY1 1KBGH 2DMCA 5E2VH 2F58H 4FQ1L 1MJJA 3HFML 4ZFZA 3BN9C 5HHNA 3OKKB 4LSPL 4PUBL 3JWOC 1ZLWK 2X40A 4MAUL 5IB3B 1DBJH 2BVOB 4CJ0A 2VLKB 3P0GB 4OIIL 1N5YH 5JXAL 1NCWH 1G7IB 2DJUA 4OLUH 3GSQB 4YHLH 2X4PA 4YHMH 3QIWA 1BZQK 4XNMB 2X10A 1KCLA 5I17B 5GGTA 1A6TA 4MXWL 1VFUA 1X5YA 3NABH 3EDDA 4I2XA 5HYSB 3JWDH 3IDUA 4EUPB 2VYRE 1IZKA 2YZ8A 1UZ6F 1QP1A 5AYUH 3W9DB 4IMKC 4LLDA 3CLFH 4EVNA 1P4BH 1NGXB 1RV6X 1TZGL 1BD2E 4AT6B 1A6UL 4FQJL 1XGPA 3DUSA 3WUWA 4WUUA 2NY4B 2EKJA 5FHBH 4U1HA 2X1XR 4HZLA 1HYSC 2DYPB 3IAPA 5E24E 1KB9K 3STLA 3VH8G 3O3DB 1GHFH 3HE7B 1WBZB 1DLFL 1T89A 1FIGL 3GHEH 2AJZB 4EN3C 1MFNA 2VZ3A 1MFDH 4ODWB 5DTFA 1D9KA 3UTPE 2VC2H 4AG4L 1F6AB 4WU5B 4WTZG 5C1MB 3ARQA 5DVLA 1RAMA 5FM8A 2UYLA 4ZUTB 4XBPA 5CLWA 4L4VB 1MPAL 5F96L 1PFCA 4EI5D 4R2GB 2BX5A 4PJBF 3D6GA 1IM3A 2BXYA 3B2VH 3P11L 1CFQA 3I75A 1BZ9B 4XMPL 1F02I 2HWZL 1FGVH 1KV3A 3MROA 3O8XD 1I8IB 1UWEL 2CRMA 4C83B 4Y4HB 5DJ8A 3QXAB 1A1NA 1U92B 3IXAA 3H9HB 1JGDB 5K9JH 4OF3A 4LVHC 4NN6B 1EFXD 1JFQL 1OGTB 1JZ6A 3QO0A 5D72H 2YPKA 3KPMA 4JLRB 4KRPC 4HS3A 4ZQKB 3MA9H 4U0RC 4PYGA 4Z77A 5F70A 2Q7YB 3OKLB 5I76B 5JHLH 2ICCA 3HR5B 2YOCA 5FO8B 1G6VK 1WCBA 1F42A 1NGPL 4KJYB 4YDLC 5F3HB 4N8PA 3PWJB 2OZ4A 1IKFL 1DQDH 3BOVA 4WNQA 1ND0A 4NZTH 3OKDA 3X11A 3WFCH 4JKMA 5FYLE 1HHGA 3UPRB 1KNOB 5FK9B 3RUGA 1HEZA 1U8JA 4OZ4A 4P2YA 1E4WH 3FQWA 4Y89A 1OAXH 3NCJH 4NP4L 4PV9B 1BZ7B 4MNQD 3WEXB 1KJMA 1WWWX 2AXFB 5JO5B 3QDAA 4QF1A 1G6RA 5HI4C 4QHNA 1HQ4B 1N59A 5FKPA 4NKOA 5C09E 4IOFC 2FZ3A 4GW1B 5DJ0A 4FS0A 4PJFA 1NBYA 5E8PA 1YMHB 3LKPA 4QWWC 4YDIH 4OZGA 4KKBD 1CD0A 3NFSH 4OGAC 2O5YH 1KLFA 4JVPA 1G9MC 4RMWA 4U1LB 2NY6D 4PJEF 1CD9B 4HUWA 3ARZA 3QPXH 2OBGA 4OFKA 2XWJB 3DTXA 2E7MA 3WSQL 2LFGA 3ZSTA 3IFPB 3KLHD 3QPQD 4Y5VA 2P48B 1RJYA 4GMTL 1QLRA 1G7JA 3RL1A 1YEGH 1Q0XH 2H2PC 3VA6A 3O6LH 1BFOA 3PWUA 1WZ1H 3RWGB 5CJ8A 2X70B 1CWVA 2DDQL 1FL3A 3KXFE 3RL2B 4MDIA 3MV01 3D0VB 1JPTH 3NFPA 3QNXA 1MHEA 3N1QC 2CPCA 2NXYD 1CICC 3OAYK 3O9WC 2XIDA 3QI9D 1DZBA 4KKAD 3S6CA 5HD8C 2XN9A 4MA7H 1MJJB 4ZFZB 5CSBA 5HHNB 2G5BA 5DMIH 3H9SE 1B6DA 3F6IA 3SQOL 3FZUC 1FH5H 2LE9A 1QLEL 1KN4L 4PLKD 3X17A 3O6FA 5E5UB 3ARGD 3HMXL 4R4FH 5KVFH 5CMAA 1BAFH 1OL0A 4QRTA 3LRGA 1CGTA 4IJ3B 3C5ZC 1E4JA 2HRPL 4AEHL 4NNXA 2FBJL 2X4PB 3QIWB 2FHBA 3K4DA 4RBPK 1A4KA 1A6TB 1XF2A 4I2XB 1YN6A 4TNVK 4YBQC 2CSPA 4U05A 2IAMC 5I18L 3FHAA 3RIAK 1CQYA 1EO8H 4N8CL 3FQXA 4LLDB 3TNNA 3MV7E 1XGPB 4U1HB 3VMPA 4HZLB 3STLB 5IFJA 2J6EH 4V1DD 4I3SL 4F9PA 1FC2D 3U6RA 2HJFA 4KI5D 4XB7A 2JB5L 3IU4L 4PRHD 1FFQA 4KK9C 4QCIA 1I75A 4U6XA 5KVEL 5LQBL 5DTFB 1ZLVH 1D9KB 2FD6L 1QBLL 1DBAH 4XBPB 2BERA 4U7KA 4J3OC 4NZRL 5DZOA 3U30B 2JJTC 3PP3K 2O5XL 1IM3B 3U0WH 4GBXC 4PRIE 1CFQB 1F3DH 3I75B 4UUJA 4ODSL 4BZ2L 4EKXA 4X5LA 1G7LA 4M7JL 1YNKL 4LSSL 5DJ8B 5SWSD 1A1NB 3IXAB 1C12A 4HBQA 3ESVF 4FNLH 3IRZA 3CAFA 1OARL 3MJGX 3VXMD 5DR5H 3QO0B 2YPKB 3KPMB 3QEQD 1DLHA 2BHUA 4HS3B 4M7KL 5JIIA 2IF7A 4BQ6A 3BT2H 4Z77B 4X9GA 2QHRH 4DKFH 1QSEA 2DQUH 3O8XA 2R4RL 3B5GA 1UACH 1WCBB 1T3FA 5DK2A 4OB5H 5IW1A 2J5LB 1H3PL 3RBGA 3CFCH 5F44A 2MPAL 4WNQB 1ND0B 3OKDB 4G8GA 3X11B 2DBLL 3C87A 4JFFD 5L0QC 4HH8A 1R3IH 1HHGB 4YK4B 3RUGB 1GIGL 1HEZB 1U8JB 1VA9A 4OZ4B 4UDUA 3OV6A 3CMOL 3HC4L 3FQWB 3U4BL 2BSSB 2WINA 5C0AE 1KJMB 2JTDA 4LSUH 2HLFC 3O3EB 4QOKE 1QA9A 3MBED 4QF1B 2BRRL 4NZDA 3LH2H 1O7SA 1G6RB 1CE1L 4QHNB 5FKPB 1N59B 2QQLH 5A3ID 2FZ3B 5DJ0B 1HSAA 4NWUH 3PUCA 4PJFB 5E8PB 3I6LD 3LKPB 3RWIA 2HJKA 4OZGB 4J6RL 1YEJL 1NFDA 5GRUL 4L3EA 4N8VG 5JW4R 2AQ1A 1NBVL 4QRPE 1RU9H 4PJ9C 4NM4H 4UB0H 4HUWB 2E9IA 4FTVD 4Z7OE 5ELIA 3DTXB 3OPZH 3GBLA 5KSBF 3LY6A 2B4CL 1EHAA 1K3IA 4Y5VB 5T1LA 1RJYB 3AS0A 2PYEA 4PRBB 1QLRB 4NWTL 1G7JB 3RL1B 1ZT7A 4RRPA 3LKOA 5D71L 2NZ9C 4Y4FC 3ISWA 1BFOB 2FO4A 3PWUB 5D1XC 3SGJC 5MEQA 2NCMA 3MOQA 4P46C 2IPTH 1KB5L 5CUSH 1FL3B 3WDJA 2YKLL 4NNYA 5JQ6L 1W72H 3P40A 4MDIB 2NX5D 3NFPB 3QNXB 4DAGH 4IBLT 4AMKH 4XCCL 1MHEB 4PJGF 1HN1A 2RGSA 3FB8B 5D7SH 1KLUA 5DS8A 2GK2A 3HUJA 4LSTL 4XPFH 4P4RA 1A7OL 1FAIH 3GKZA 2XN9B 4YDJB 2I9LA 2CDEA 2G5BB 3QWRD 4XMKH 3TVMC 3SGEH 4PB0H 4H8WL 3O6FB 1TVDA 1TNMA 2IWGA 4LSRL 4BZYA 1X4XA 4O02L 4TULL 4N0CC 3U2SA 3S3SA 4Y4KC 4QRTB 1JBJA 1I1YA 4KV5F 4NNXB 1W8NA 4LLVA 2YN3A 1A4KB 4DVBA 1XF2B 3ZKMD 2BDNH 2VL5A 4FG6C 3P4OA 2WP3O 4Y5YA 5HPOA 4HLZH 4H88H 2WUCL 3DHJA 1T04A 3FQXB 1A6VH 3C2SA 1GPOH 3FJTA 2YA1A 3BIAX 5GGUA 3TNNB 3CSGA 5BZWA 4PD4J 5DQ9A 3SPVA 5L8KB 4NRXA 4PP1D 5IFJB 1U8OA 4W6XB 5EZLA 5TQ0H 1NCCH 3U6RB 5BW7A 2HJFB 4A6YH 3V6ZB 3IDXH 2E9WA 1UYWL 4QCIB 3K2UL 4U6XB 3T0DA 3WD5L 1PX4A 4GSDH 4DKEH 4JM2C 4ODUA 4D8PA 1QYGH 3VXRE 3L5JA 2EC8A 2N7AA 4K9EC 2IADA 5D5ME 5I1HL 3EJYC 1YZZA 1FL6A 4G7VH 4JQXC 3WIHL 3WLBA 5DD0L 4LAQH 3U0TA 2ESVE 2VDPL 2ZUYA 3PWLA 5HGAA 4UUJB 5GZOC 3F7VA 2WLZA 5KS9E 2GHWB 4HJJH 2RCSH 4WFHD 1G7LB 5DK3A 3N1FC 3TYGH 4EI6B 1C12B 3TA3C 3VMOA 3NIFE 1YPZE 5E5RB 4U1GC 4WGVB 3OHXA 2D0GA 1DLHB 2X9YA 3RFZC 3OG6B 4N9GB 1JNNL 3T3PF 1EO7A 1JN6A 4Y0GA 5T5FL 1T6WA 32C2A 1BF8A 3O8XB 2VH5H 3ARDA 1R3KA 1T3FB 1BQLL 2D4FA 5DK2B 2J1KA 4KKLD 4M1CD 5IW1B 4NZUH 1ACZA 5EWIL 3GJEA 3M45A 4X6DA 1C5CH 4G8GB 1IT9H 3VXMA 1YNLL 5FB8A 1EX0A 5GGRA 1U3HC 3QFDA 5IBUG 4K71B 2V2WB 3PWVA 1LWRA 7FABH 5DJAA 2WINB 4I18A 4Q9QH 2PR4H 3UZEA 3E0GA 1BM3H 1GGYA 5D2LF 1NMBL 2FIRT 1NCBH 5L2KD 1QA9B 3DVFA 3BIKA 1MFBL 4FFVC 5C9KA 2W92A 2R0WL 4PGEA 5DA0B 4JFFA 1PKQE 1HSAB 4P48A 3T1FA 3MGOA 2HJKB 5GGSY 4LKCA 3M8OL 4O2EA 4X6CA 4DEPC 3CDCA 1NFDB 5BO1L 1LO3L 1NDGA 4YEFA 5JMRA 3U7WL 2ITCA 2OJZL 2P5EA 1XF1A 2HT3D 3QFJA 4RA0C 1KEGL 3MBEA 5TDNA 4P2OC 4NO5A 5T1LB 3TCLB 5DJYA 5DHYA 4LPCA 1N0XL 2PYEB 3ZT7A 2HVKA 4KK8D 5F7WC 4JREB 1CTNA 1KB5A 1ZT7B 4RGNB 2BCKA 2XWBA 3LKOB 1F58H 2FO4B 3O3UN 5MEQB 4LPTA 3IDGA 4QHUA 1JHKL 1CBVH 4NNYB 3FN0H 4LU5L 3QA3A 3KPRD 3WXVL 4XNXH 1T0MA 4LIQE 1F8TL 2E27L 1KLUB 5DS8B 1UH2A 4Z7UF 3HUJB 4ODXA 4NC2B 2XQYG 2E7LC 1H15A 3S4SG 4P4RB 2C1OA 3GSVA 4DVRH 5BV7C 2K9UA 2CDEB 4E0RA 2FEDC 3DGCR 3DI2B 4S1DD 4FQXA 4BQ8A 2PUQT 3EOBA 1GOFA 3P9WB 3LDBC 1J0ZA 3LEVL 4ONFH 1CS6A 4R7DB 3O4OC 3WS6A 5I1GL 3U2SB 2BVPB 4ZO8A 1I1YB 1A6AA 4ZO9A 2VJXA 4LLVB 4JHAH 4G6FD 4P49A 4LHJB 4DVBB 1DSFH 3ETBF 4N9OB 3OJDA 4OF5A 1OQXA 5TE4L 1LP9A 2VL5B 5T5NF 3QWRA 3I9GL 3P4OB 5HVHB 4Y5YB 4HXAL 3HKFA 3RAJH 1T04B 1DQLL 1SJHA 2YUZA 3MV8E 3FOLA 5GGUB 3CFDA 5CJXC 3GIZH 2UZIL 1F3JA 5BZWB 3DMMA 5DQ9B 1UXSA 4JFPB 5IEHA 4AL8L 3SPVB 4CKVX 4YHZL 5KW9L 4NRXB 3CXDH 1U8OB 4P9HL 1FFPB 3OAZH 5EZLB 5DUMH 4LVOB 1H3GA 2MFNA 5HHVH 2YD7A 4P9ML 4UV7H 4NO0D 4QHKI 5E94A 4BQBA 4ODUB 4D8PB 3S37L 3X3FL 3WIHA 2IFFH 2YZ1A 1MFEL 1TIUA 4DQOL 2IADB 4KK5D 4XMLH 1FL6B 5D1ZD 4JN2A 3WLBB 3QUYD 1FNSL 4DOHE 3BGAA 3PWPE 4Z7VA 3U0TB 5E6IC 2BY3A 3PWLB 1Z0NA 5HGAB 3MR9B 2R29H 3F7VB 4X7EC 4CL7A 3L1OH 4MQ7A 3MNWA 1G7HA 5BOPA 1XCTA 3J7HA 3QB7C 3PP4H 1I3VA 3OHXB 4WRLA 5ISZE 1IBGH 4UT6H 4P59H 3PL6D 1OAUL 4M4RA 4I0PA 5D7JA 1JN6B 1V5JA 3I2CL 3MTRA 5D2NA 4RMTA 2N7BA 3GBML 4OQTH 32C2B 3H6JA 3ARDB 2DQJH 1JNLL 1R3KB 3BPNC 3BPOC 2EDJA 3TF7C 4R90L 5JHDD 4XZUA 5DEFB 4Q0XH 1B0WA 4X6DB 1QBAA 1UT9A 1LK3H 2XV6B 3VXMB 5FB8B 5GGRB 1CK0H 3QFDB 3PV6A 4H1LG 5TFSL 2LVEA 1G9NL 1LE5A 3PWVB 3RVUD 2D3VA 3QRGL 4LRIA 2MCPL 2X4UA 4JFED 3FQRA 2XZQH 5DJAB 4I18B 5HDBF 4FQLL 3NGBC 4GKNA 1ZGLA 4F9LA 6FABH 5CEZD 1AKJA 3PDDA 3TBYA 5BVPH 3OSKA 3TFKC 3BIKB 5IHUH 3HI6L 1BBDL 4R0LC 3BAEH 3O2WH 4U2ZA 3ZT5A 4PGEB 4LF3A 2D0HA 4JFFB 4LHUA 3MGOB 2YSSA 3DXAE 1ZTXL 4LKCB 1U41A 5D7KE 2EH7L 4O2EB 4X6CB 1E4XL 4CU8A 1NDGB 4KTEL 5GRJL 1AGEB 4PFEA 2ITCB 1TENA 2WBKA 2P5EB 5GRVL 1FG9C 4PRPE 3S98A 3QFJB 3C5JA 2AGJL 1NFIA 3MBEB 3LS4L 5TDNB 4NO5B 3CXHK 1QKZH 4NN5B 1ZLWH 4OBSA 5DJYB 5DHYB 2HVKB 3FMGH 2B1AH 1KB5B 1I3RB 3VFMA 4AEEA 1CGWA 2BCKB 2XWBB 3AVEA 4KZDH 3IDYC 3KGRA 3VFTA 1UEYA 1W0VA 1N6UA 1AD9A 2FJHA 3IDGB 4QHUB 4I3RL 3RVVC 5EZOH 3BWUC 4OZHA 1A9EB 1T66C 3QA3B 3UC0L 2CH8A 1T0MB 2EECA 5GGQH 5J12C 4EJ1C 1P4IH 1FDLH 1Q72H 4MXQD 3GSUA 3BRGC 3TZVC 5D6DC 2A73A 4UNVA 1DANU 1K9TA 1VFAA 3DX6A 5T3ZH 4ODXB 1H15B 4HUXA 2QL1A 3GSVB 4JR9L 1QBBA 5I73B 4PJ8A 4E0RB 5TQ2H 2P4AB 3LEXA 4FQXB 4KVNH 3EOBB 4X9HA 1RVFL 4ZYKA 3GK8H 2NXZC 1YYML 4D9RE 2YD6A 4NFDA 3AAZA 2Z93A 3KLAA 4ZD3L 2GSGA 4YFEA 1A6AB 1MCRA 3CX5K 3V0AC 5HPMA 4OGYL 2Z31D 3GMMA 4OUUA 3N9GH 1OAZH 3OJDB 4ELMA 4CRPA 4K23L 2EDOA 1LP9B 2X5PA 2G60L 3KYNA 4Z0BL 3HR6A 2XOTA 3ZHLA 2F19L 3RJQB 1SJHB 4UDTA 3FOLB 4TVPH 3CFDB 1DQMH 2WIMA 1F3JB 3MJ9L 3FN9A 1UXSB 4QRRA 1J8HD 5IEHB 1Z9MA 1ZHKB 1PX3A 3MJ8A 3VXUD 5J4MA 4KGJA 1JGEA 4ODVL 4S0SD 3KYKL 1E6JL 2PCPB 5C07A 2VZVA 1T1YA 1QSVA 3EZ8A 1BP3B 4QTIL 3U0PA 2EDRA 2H2SD 5GS2D 5KS9F 1MI5E 3QIUA 2IPUG 5T5NG 2GSIA 2OL3L 4DN3L 1GC1H 4HBCH 4XCYA 4WO4A 4X9FA 5HI3C 4WTZA 4GQPH 2MQ0A 1YPZF 3K8LA 1QHPA 4Z7VB 2Q8AL 1W0WA 1MCHA 3W5MA 4DGVL 2VIRA 5CWSB 4MQ7B 3K2MC 2XWTA 3MNWB 3S88H 1G7HB 3T0AA 1BGXH 4OQ1A 2AJYH 1YEKH 2ICES 4LCWA 2ZUTA 3CMGA 3EKCA 1XCTB 3N1PC 5FUOH 3QISA 3LIZH 2ZCLH 3UTOA 2OK0H 1ZT1A 5M7QA 4I0PB 5D7JB 4JFHE 5D93B 5D2NB 1A7QL 1LO2L 3SKNA 5GRVK 4TVPD 3ARRA 3QO1A 1MVFA 5ACLA 2FECL 3O0RL 3WLWC 4MB5A 2EE6A 4OCWH 4LSPH 2ZPKH 4XZUB 4M8VA 5IBLD 5ITBH 1WBYA 1Y18A 3MV9E 5HGHB 4Z7WA 4KMTH 3PV6B 4KROD 1J18A 4J4PD 1LE5B 4OM1L 3SE3A 2PNDA 5JXAH 4RA3A 1A6ZA 4XGZB 4OZIE 3TWCH 4L9LA 1UFUA 4RCAA 4GKNB 4P2QA 4MXWH 3KS0H 1AKJB 3TBYB 5JHDA 4P57A 4HKXA 3NCYS 1MH5A 1AHWA 4K2UH 4LF3B 1TZGH 1ITCA 4LHUB 3RGVD 2ZOKA 5H37H 1A6UH 2EDXA 2YSSB 4FQIH 1H3WM 3ARBC 4HK3N 1HCFX 2QSVA 4J3XA 1I7RA 1B4RA 2V5RA 1DLFH 3UAJC 1FIGH 1H5BC 3C5JB 4K3EL 4XHJC 1NFIB 2WWMC 2G2RA 2OP4H 1VGKA 2FATL 3EYQD 3W5NA 3VFMB 3FFCE 3DETC 5IVXF 5F7KC 3ZYIA 1OAYH 1U8MA 2ICWA 1J5OL 1W0VB 2J8UA 1AD9B 2M2DA 5F96H 1SHMA 1BJ8A 2OMBA 1KUMA 3PJSA 4XMPH 3GM0A 2R15A 3Q3GA 2B8OT 4IDJH 1UWEH 3GSUB 2PW1A 4JE4B 1VFAB 5L88L 3DX6B 4GJTB 4HUXB 1MCLA 3MLTA 3KJ6L 2ZNXA 4PJ8B 4JB9L 3LEXB 5T3XD 3ZTNH 4ZYKB 5F7HA 1JPSL 4ZUUA 5IK3A 4ZNEE 3AAZB 2Z93B 3QDGE 3KLAB 1ACYL 2GSGB 3RHWF 1FNAA 5HPMB 1RUMH 4Y5XC 1HH6A 3GMMB 1IKFH 4OUUB 2WBJC 1O5DT 3JUZA 4LPUA 1DUZA 4ELMB 3KYNB 2V5YA 1L0XA 1M6OA 3MJ9A 3MUHL 3PP3H 2N4IA 4UDTB 1NAML 2EO9A 3DRQA 2ZCHL 1HSBA 4NP4H 5GJSL 5DC9B 1CU4L 1NMCC 3MJ8B 2AEQL 2XPGA 5HI5C 2AK4E 1JGEB 5C07B 3FRPG 4LRNH 1T1YB 4UT9L 1Q9LA 3BYYA 3U0PB 1VDGA 2OCFD 1JRHL 2AI0L 5FF6A 3QIUB 2PXYC 4ZUVA 2GSIB 3B2UD 4HKJA 3O4LA 3NCEB 4XCYB 4WO4B 4WTWA 2NY1C 1OP5H 3SCMD 5C0RH 3VXUA 4FZ8L 3WSQH 1N5AA 5ANMA 2DD8L 2VZUA 2VIRB 3G08A 4LASL 2ZP0T 4FHBD 5TE7H 1WEJH 2XWTB 5EA0H 5I1EL 4L4TA 1I1AA 4ODTH 4LCWB 1MCFA 3CVHH 5E99H 1JVKA 1SJVA 2DDQH 2JCCE 4NYLA 3WUZA 5EO0A 4LOUC 4DN4L 3FAXA 3OKOA 1FRGL 3D3VD 3E2HC 4OIAA 4M6OH 1ZT1B 4XTRD 4JO3L 1URLA 3BKCL 4M6NL 3TO4D 1QO3A 2FHCA 3SKNB 3T0WA 1ZA3B 3E6FA 2XQBL 1FFNA 3QO1B 5FDWA 3QUKA 3AM8C 2BNQA 1JYVA 1HCVA 1U6AL 3SQOH 4LGSB 4Z8FL 1KN4H 1DVFA 3STZA 1Y18B 5DJ6A 4Z7WB 5LGHL 1ZSDA 5FKAA 1AGBA 1FFOA 3HMXH 4P23C 1IAIL 5DYOA 1P4LA 1AO7E 3VXSD 2G5RA 2V9QA 2AS5M 3CFKA 4AEHH 4L9LB 4P2QB 5FA4B 1CE6B 3DO3A 1YEHL 1KENH 3RP1A 3DHMA 5JHDB 1HQRA 1QR1A 5KSAD 4P57B 2VKXA 1EZVX 4HKXB 4N8CH 3V7AG 1MH5B 1AHWB 2CK0H 5KG9B 4ZO6A 4XVTL 2QLVB 3P3YA 2ZOKB 3B6SA 4XX1E 4NM8L 3TH4T 4W4OA 4OV5A 2HT4C 4IOSD 3UMTA 1PG7W 5IVNA 4MNGA 4X8XA 3QP3A 5J11B 3TT1L 3ULVD 3UDWA 5HVFB 5DO2D 1NCAL 2JB5H 3QQNA 3IU4H 2XNAB 4N8VA 1KTDA 3QNZA 5KVEH 3MOBL 1MEXL 3UP1A 2G2RB 5A40E 3T65A 2FD6H 3F5WA 1VGKB 3L5XH 4R26L 5BRZA 3IF1A 4HF5H 3DRTA 4N0YL 3BN9D 3IFLL 3T4YA 1F4WL 4QRQA 1OGAD 2NW3A 1U8MB 2ICWB 2J8UB 2VXUL 4NZRH 4LPWA 5F1KC 2HN7A 2VDML 1DBMH 1I7UB 3OF6A 3RY4A 4BZ2H 1BBJA 2EDYA 2JIXD 2PW1B 3ZDYE 4LSSH 3CIQA 3CD4A 3CZFA 4PJEA 5HHME 1E27A 4M7LH 3PHQA 1QFWM 1OARH 3MLTB 4FN0A 1NC4A 4FQCH 2XFXA 5FYJE 3GIVA 1OM3L 3O6KH 1V3MA 4XH2A 4HIXL 1RZGB 4JGMA 3JWOL 3FT4A 5IVZB 1LVEA 4GRWF 4IRJA 1HYSD 4ZUUB 1FC1A 3SE9H 5IK3B 2R4RH 4GW4A 4MD0A 3O11A 2Z8WC 4HIEA 4PJ5E 3IDMA 3VG0L 1H3PH 4EN3D 1HH6B 1I9JL 2MPAH 3G04A 3LHPL 5ESAA 3SDCD 1QFWI 1BD2D 1NAMA 1DUZB 1QEWA 5FDYA 4QLRA 3TM6A 5GS1C 3KYOA 3MUGA 1GIGH 1M6OB 4AQOA 5JA8B 3WE6A 3DRQB 2YRLA 1TQBC 2B5IC 1WT5A 3HZVA 2VDOH 3U4BH 1HSBB 1T7WA 3F7RA 1L7TL 3QDJE 3TBVA 1XF4A 4YXKL 5FYLH 4ISVA 4M8QA 2BSED 4XWOC 2AK1L 2XPGB 2BRRH 4YZFE 5F9OH 3MRKA 1WAAF 1MWAL 4HKBA 3LN9A 4ZG1A 1Q9LB 2QTEA 1L0YA 2AXJA 4I13B 5FF6B 1E4KC 1G9MH 4ZUVB 3WL9A 4XXCA 4J6RH 1V05A 1RZ7L 4HKJB 5GRUH 3O4LB 2OR8A 4ZFGL 4KRPD 4RFNB 1T80A 4UTAL 3NN8B 5I30H 1NL0H 1RUPL 6CGTA 5F1NA 1A1MA 3ZTJH 3VXUB 4OI7A 3WHE1 5EC2A 5ANMB 5IKCA 4Q9CA 3CZJA 1TFHA 3G08B 3QDHA 3KPSA 1LE9A 4KJQC 3VWKC 5HHOE 5D71H 1L9MA 1KT2A 1I1AB 4EZMA 1J1PL 1UXWB 3UTTA 4NYLB 1CDYA 5EO0B 5JQ6H 4Y8AA 4V2CB 1RUAL 4S1RL 1MJ8L 1P7HL 3HPJB 2FB4L 4WHTA 3WO3B 1Z2KA 4LQFL 4U49A 4H25A 5KTEL 3C08L 1QO3B 1EEZA 2ZWLT 2E3VA 2R23A 1FFNB 4XPTH 5FDWB 4JQVA 3CDFA 3JV5A 3QUKB 5FYLD 1NSNH 2JE8A 5HI4D 4GAGL 2BNQB 1UM5L 2OJEA 5CGYD 4IOFD 2ADJA 4K3HA 1QR4A 5I9QC 3QHTC 4H8WH 3S96A 1DVFB 5GPRA 3STZB 3V5HA 4ZFOL 3RZCD 4QWWD 5DJ6B 1ZSDB 4LSRH 3D3VA 5FKAB 1FFOB 4BKLA 4OGAD 5JOEA 4L9DA 4TULH 5DYOB 1CT8A 1P4LB 1JI2A 5T1MA 4F57L 5L6YH 1TJGH 2NY0C 5DZLA 3CFKB 3K1DA 3VFUA 5KBNC 5EUOE 5C09D 4WWKD 1ZKAA 4HULB 3BD3A 4UOW1 3VFVA 3UYPA 5IJVA 1HQRB 1QR1B 1C7TA 4JO1L 1ZLUK 2D9QB 2WUCH 3KR3L 3MUJA 3QDME 1BQHG 1KPUB 3B6SB 5DMKA 4KROB 5IB4A 3T3ME 4WEMB 4LFHG 4OV5B 1BWMA 1PVHA 2IGFL 3D2UA 4MNGB 4MXVF 5KVDL 2APTA 4C56E 2DKUA 2XQYK 1UYWH 4OT1H 4N8VB 1KTDB 3C09C 3QNZB 3BEVA 3O9WD 4NPYA 1N6QL 3WD5H 4APQA 4YJZL 5KSAA 3T65B 3F5WB 4MCYA 3STBA 2DJ4A 3IF1B 4WJ5A 3DRTB 3KXFD 1F4YH 3MMEA 3T4YB 4JPVL 2XZAH 2NW3B 4GXVL 4QRQB 5I1HH 3FZUD 4MHHI 3L6FA 4YQXH 3WIHH 5IWLA 4JPKL 2HN7B 3RNQA 1UJ3C 2FLRT 2H45A 2VDPH 1DEDA 3OR7B 2NY3B 3L5IA 1A3QA 3P0VL 3WXWL 1BBJB 5FYJU 1HHJA 1JI1A 3CZFB 3H9SD 4PJEB 4HLJA 1ZHLA 3BXNA 1J88A 2E9BA 3RX8A 1E27B 4YBQD 3PHQB 1MHCA 4K7PL 5KSBA 4M62L 1IGFL 1NC4B 2XFXB 3GIVB 3S4SA 2DQGL 4DUVA 2PF6A 4XH2B 4KUZH 1S9YA 3FT4B 2W9EH 1JNNH 4TSAL 3RWFA 2EEAA 5E95B 5F6HJ 4IRJB 1JF5A 5GRZA 2FJFA 4GW4B 1BF2A 1MIEL 3IJYA 3O11B 4HIEB 4MD0B 3IDMB 4OGXL 4WHYH 5F7DA 1BQLH 1PAMA 3ULSB 4JY5L 3BP6A 4EQ2A 4KK9D 3MLVL 5GGSA 4WY7L 2J4WL 1QBML 2X4OA 3O3BB 3W82A 3DGGA 1G7MA 3G04B 5ESAB 1UCBL 1NAMB 1DEEA 1QEWB 5B39G 3MV7D 2DQCL 3KYOB 4G7YL 3MUGB 5F7EL 3KWWA 2IEPA 1ZANH 3QXTA 2DI8A 3WE6B 3JV4A 3QQ3A 3HZVB 2WV3A 1XF4B 4TTDC 4Q97A 1L6ZA 3IJSA 4M8QB 4GBXD 1WC7A 1M1SA 1MWAA 1NMBH 2ORBL 3FO2A 1IFHL 4EN3A 1MFBH 3UBXA 3UJTH 3MRKB 4HKBB 2A1WL 1PLGL 1F4XL 3WL9B 3M8OH 4NN7B 3CH8A 1ITBB 3U7WH 3MRRB 4PRID 2OJZH 3JV6A 4TSBL 5J1AA 4U6HA 4EI5C 4TOYH 5F1NB 1A1MB 5ABDE 5EC2B 4F7MA 4Z7NF 1KG0A 5IKCB 4YX2H 3EHBD 4JRYA 1N0XH 4HIJA 1WUNT 2WQRA 3KPSB 1LE9B 3CK0H 3R0NA 1KT2B 2ZOLA 1BX2A 3GHBH 2EE2A 4OV6F 1JHKH 3D18A 3W0WA 4ONGH 1CL7I 2SEBA 4KUCF 5AEAA 3MFFA 3RA7L 5E4IA 3JWDC 4FQQB 4OI9A 1B9ZA 4WHTB 1MIML 4F33A 3B5TA 1F8TH 1A47A 3KJ4B 4H25B 2E27H 1A4JA 4X80H 1UWGL 2YD3A 1EEZB 1T1WA 5C0BD 1XCQA 2HLFD 2R23B 4TUJA 2PTVA 1I3UA 4MCZA 4ZFOA 1VEPA 2R2BA 5EO9A 1MRDH 1CDGA 4PJ7E 2OJEB 4Q6YA 2ADJB 1JPFA 3S96B 1FQ9C 2IBZX 5D1QD 1NANH 3V5HB 2CJUL 3KYAA 4U1NA 5I8EA 3D3VB 5C0AD 3LEVH 4BKLB 3I84A 2CKBH 4KHXL 1CT8B 4N0FA 5T1MB 2W59A 4QOKD 1NAKH 4B0MM 5IBUB 2DQIL 4H1LA 3RWHA 1IKNA 2XTLA 5HVGB 3VFUB 4F15B 2PN5A 2Y23A 3V0VA 3LSOA 3VFVB 3QNYA 4JGUA 5C0FA 5TE4H 5IJVB 2NY5C 4HXAH 5EIVA 1DQLH 3H7BA 5JORA 3G6DH 1OTTD 4YGAB 5DMKB 2UZIH 5IB4B 2HJLA 2X41A 3RBSA 4OFVA 4AL8H 1T0NA 4U0QB 4YHZH 3G9VA 5KVGL 5KW9H 2CIKA 4A2MA 1FGNH 2ATPA 3VI3F 5C09A 5HYJA 3AB0B 1NBQA 4XAKE 4NKMA 4LVNB 4P9MH 5KVMC 3BEVB 2IC2A 4NPYB 3KLHC 3QPQC 4APQB 1Q38A 1OCWL 3SDYH 1A6WL 4XAWL 1CGXA 5KSAB 3QUXA 2R0KL 3BQUA 3HZKA 4MCYB 3S37H 3X3FH 4WJ5B 1KEML 1OT1A 4G6KH 1ZEAH 1MFEH 1K8IA 4DQOH 1MY5A 3MMEB 2P43B 3ZT6A 3P77A 1DANT 3L6FB 3FB6A 2I60L 1TDQA 1FNSH 3RNQB 2D7TL 1J7VR 1D6VH 4Y4KD 1ZLSL 5CP3H 1CICA 5HYSG 3O9WA 1YEEL 2Y36L 3MZGB 1OHQA 1ZHLB 3BXNB 3QI9C 4AQ1B 3WKMH 1MHCB 5I6XC 4NHCL 4MMZC 4FG6D 2QEJA 2DQTL 1OGAB 1JZ8A 3S4SB 4FXKA 5ADOL 3EYUL 4PLKC 1ETZA 2DM3A 2KH2B 1S9YB 2DLIA 3RWFB 3I2CH 2YA2A 3ARGC 3VWJA 2AABH 3GBMH 3C5ZA 4LP5A 3U4EA 2EDDA 3VGAC 2FJFB 3BKYL 3IJYB 5SV3A 1I1FA 5IMMA 1NUFA 5FO7A 1JNLH 5F7DB 4W4NA 3PGDA 2IPUK 3BP6B 4FFZL 4R90H 3D48R 5GGSB 1KACB 4OD3H 2IAMA 3DGGB 1G7MB 1DBBH 3I3DA 4JM2D 4G6AD 1DEEB 4YZFF 2OTWA 2BSRB 3KWWB 3JV4B 3EJYD 3QRGH 1GOHA 4PJCF 5DMGC 1T1ZA 1B2WL 3QQ3B 2AXHA 4Q7DA 3ELAT 1AXIB 4OLWL 1UWXK 3IJSB 4Y2DC 1WC7B 3A6CH 3B9KA 2R8SL 3FO2B 1PY4A 5GZOD 2X4NA 1BMGA 1YY9C 3P30H 1PKOA 4EN3B 2X1QA 4KI5C 4RMSA 3VXRD 5HYEA 1JRHI 2XY2A 3UBXB 1BBDH 4QXGL 1RZ8A 2AV7A 3ZLQC 2YRPA 2CGRH 3RUGF 1RIHH 3T2OA 3TA3D 5EPMA 2VQTA 3NH7L 5JIPA 1OP3K 2DM7A 2APBA 3EYOA 1R0AL 1E4XH 2ESVD 4KTEH 3QEHA 4LBEA 5F7FA 3ABZA 1MLCB 4YXLL 3JV6B 5J1AB 4NO2A 4K9EL 2JJTA 3F62A 4U6HB 3VU2A 3Q0HA 2YEZB 3ZYZA 1DCLA 2W91A 2AGJH 4KDTC 5DGRA 3MREA 4F7MB 1KG0B 4UQ3A 4JRYB 5CJOH 5DFVC 1HWHB 4HIJB 4HS8L 1H3VA 4PJFF 2BHYA 2GYSA 1O0VA 3S3JA 4LVHB 2ZOLB 1BX2B 3ZDXF 4S1QL 1OAQH 4N5EC 3D18B 3W0WB 3LPFA 2SEBB 3MFFB 3V6OC 1QFHA 4DGIL 4U0RB 5GRWA 2R0LH 2GTZA 3C60C 5E2TH 1PY9A 4F33B 2VLRE 3GJFK 1J10A 3JVGC 1A4JB 5BV7H 1T1WB 1XCQB 1JL8A 3QCVL 4RGOH 4TUJB 4UT7H 1UKSA 4JR9H 4MCZB 4ZFOB 5LJYH 2R2BB 5IJKC 4UINL 2K1MA 8CGTA 3FFDA 1WGOA 4X9IA 5JIKA 1JPFB 4G6JH 5AWNL 4YC2C 5I8EB 4U1NB 3D85A 4MJIA 5MERA 1T2QL 1E28A 3MRHB 4N0FB 4EDWH 3RWHB 1UQSA 3FRUA 4H1LB 5DF0A 4ZD3H 3I6LE 4X7SH 1YEIL 5GJTH 5B3JE 1CD8A 4P2RA 4JKPL 5E2WH 4OGYH 1P84K 3SOBH 3KVQA 3MRLA 4Y19A 3QNYB 5AYQA 5C0FB 1XR9A 1MSPA 2Q20A 4PJHE 4DGYH 4Z0BH 4FTVE 1Q1JH 1GXEA 3QT2A 2QHLA 5E08L 3H7BB 5JORB 3GJFA 1CFVH 3WFHB 4Z95L 1CCZA 1FVEA 2HJLB 1A1OA 4Z5RA 3VI4E 3V8CA 1T0NB 4PJ9A 1YN7A 2CIKB 4PLNC 2ATPB 3IS0X 5C09B 5FO9A 4GRLD 4ODVH 5F1OB 3VD5A 4MA1C 3WNLA 3KYKH 1E6JH 3PWNA 4YHIA 5HYJB 2VLLA 3WIIL 4NKMB 4QTIH 2P1YA 3QUXB 3HZKB 3EOTH 1YNTA 2OL3H 3SY0A 3F58H 3PNWB 4Y4FA 3X12A 1K8IB 4QRPA 5D1XA 3SGJA 2FEDD 4LPVA 1I1RA 4P46A 3P77B 3DV4A 3B43A 3WFDH 2XA8L 4AZ8A 3MLPA 1KGCD 3FB6B 4HCRL 4YHNA 3SBWC 4KPHL 2FO1A 4IIQA 1FPTL 2Q8AH 5HYFA 3MLZH 5EU3A 5BOZG 1CICB 2X89A 3O9WB 1UB5A 2JB6A 2D4DA 1YUHB 3TV3L 3CPLA 2P8LA 4GKZA 3TVMA 4G9FE 2IBBA 2WNGA 3T2QA 4HGKC 1GZPA 2VTFA 4TNVF 4FXKB 15C8L 1ETZB 1P7QA 2APWA 3RIAF 2LV4A 4FXGA 1K4DA 5IMLA 3MCLL 2FHFA 1A7QH 3DO7A 3VWJB 4E5XB 3C5ZB 3U4EB 4AM0A 4KK6C 4NJ9L 1QOKA 5FA3A 5IMMB 4XI5C 3O0RH 3DPBA 4XVUD 5FO7B 3PGDB 3AC0A 3QRFM 4ZOAA 2IAMB 3MV8D 3RU8L 5K59F 5KAQF 2EYSB 2OTWB 4HW6A 1E6OL 4FQ2L 3MA7A 2P44B 4ZMAT 4UILH 3L3JA 2EKSA 2YMXL 2OX5A 1KPRA 4TRPL 4CVUA 3B9KB 2Q1EA 4PP1C 3Q5OA 4JHBA 2EEBA 2X4NB 3BO8A 5SX5H 5HVWA 2IALA 3TH2T 3ORJA 3UBXI 1RZ8B 4QO1A 2AV7B 5DA4A 3W2DL 5HDQL 3MV7B 4HWEH 2E6PA 4AIZA 3O2DL 3ZE0F 3UYRH 4GQ9L 3FRPA 1MFCL 5D7LE 3PWPD 4F2MA 4KHTL 4LBEB 1UM6L 4JQXA 4BUGA 3EIFA 2GJ6E 5CD5C 1DL7H 4NO2B 4H20L 2P24A 1H3TA 1B0RA 3MREB 4MD4A 5CJBA 3NFNA 3VFGL 4UQ3B 5FYKH 5D5MA 4XCEA 3A6BH 1A22B 3TA3A 4MDJA 5ISZD 5HJ3A 2ESVA 4PRIB 4IMLA 4NKIH 5KS9A 3BE1H 2I5YL 2YD4A 4OFIA 1I8MA 2GTZB 4RFOL 1TNNA 1J12A 4P4KD 3NAAL 3SKUD 1S9KC 2UUDH 3BN3B 1OPGL 3K8KA 1FNLA 1YPZA 4HHAA 1GGUA 3TFKD 2O61A 3KJ6H 1EJOH 1ZAGA 3FFDB 2OI9C 4OLYH 4XPGL 4MAYC 1SEBA 5L0QB 4S0TD 1U3HA 3WIFA 5ICXB 2F8XC 3D85B 4MJIB 1JPSH 4PRNB 1K4CA 5MERB 2WWKT 4QYOA 5DEGA 1E28B 3VCLA 1J0IA 1ACYH 4KXZH 1UQSB 3FRUB 4L1HA 4Y2OA 2YA0A 3RDTA 1OF2A 5I1AA 3ZDZF 4URTB 3ZYJA 3MRLB 4Y19B 1MCEA 3QCTL 3QG7H 1XR9B 5D7KD 1H3XA 3GSRB 5JW4Q 2AJ3A 3IFNH 1NAMH 1F3DJ 5FECA 5FYKD 5C0AB 2ZCHH 1RZKL 4CBPA 1FVEB 3HB3D 3RVVD 4F7CA 1A1OB 4XNUH 4ALAH 1BVLA 4Z5RB 1T66D 2XRAL 4PJ9B 1CU4H 3ULUE 1G7QA 1YN7B 2AEQH 1CLCA 2VISA 2P5WE 2HT3C 4JFDA 5FO9B 3PWNB 4YHIB 1QSFE 2VLLB 4P2OA 3HG1A 3RNKA 4UT9H 4OBRA 3FTGA 5ESQA 4XNYL 1JRHH 5BJTA 4J3WA 5JNYA 1S7WA 2VZTA 4KK8C 1YNTB 4HCRA 1IZJA 1MRCL 4Y4FB 1MJUL 3X12B 3HC0B 1KIRA 4QRPB 5D1XB 5IHZA 2HVJB 4P46B 4RAHA 1HK6A 5IBTL 4YHNB 4O5LH 4FZ8H 4KH2A 2NXZD 4J12A 1K8DA 1MHPL 4Y1AE 1LD9B 2DD8H 1MAMH 1CF8L 1A14L 5EU3B 2OYPA 3QIBD 1WFUA 4XVSH 2WZPD 5JR1L 1UB5B 2JB6B 4JKWA 3UJJH 5C71A 4OZFH 4AENA 1JGLL 3CPLB 2P8LB 4GKZB 3TJEL 4L8BA 1Q0YL 4H5SA 3TVMB 4DN4H 4MGXA 1GZPB 1UENA 5DD1L 2DB8A 4JO3H 5FOJA 4KI5F 3BKCH 1EVTC 2IMMA 5IB2A 3SO5A 4FXGB 1K4DB 3RHWK 1M7IA 5IMLB 3WS3A 3DO7B 3EYVA 4AM0B 3D1MC 2GIYA 5DLML 1A5FL 4UV4L 4U1JA 4D3CL 4M9OA 5FA3B 4K3DH 1T03H 4LK4A 1B3JA 1QTYT 4BH8A 1U6AH 1TXKA 4R3SA 2NY4C 4JFZH 3LMJL 1AFVL 1KIPA 4KAQH 1KJ2L 1I9RL 1XIWD 5ADPL 5BVJA 1X5FA 3HE7C 1IC7L 4LCUA 1IAIH 3P73A 4L4VE 3MODL 3MA7B 5CJXA 5HI3D 3L3JB 5ERWA 4M43L 4G6MH 3G5XA 5DD6A 1KPRB 4M9PA 4P5TA 4OSUL 3ZSSA 2AJVL 2CDFA 2YHGA 2OSLA 1YEHH 1MI5D 3BO8B 1WICA 1MREL 2IALB 1CZ8L 1KLGA 4O9HL 2VXQL 1TPXC 5CILL 1N4XL 3DYPA 4R2GC 1H8SA 4AIZB 5KAQG 1P9MC 1LO5A 4NM8H 3HE6D 2X9XA 4PREA 4ETYA 5FCSH 4F2MB 2D0FA 1WWAX 2A0LD 2H1PH 3K80A 2FSEA 3TT1H 5ETUA 1S3KH 2P24B 3JUYA 5E6IA 3QUYC 4I1NB 4KI1A 1B0RB 5AD0A 4MD4B 3NFNB 3D39E 4EXKA 5I0ZA 3WBDA 4L3AA 2CQVA 2F8VA 5D5MB 4XCEB 5EORL 3WLWD 4N0YH 1X5LA 2A9ML 3IFLH 3GSWB 1F4WH 3TA3B 4MDJB 4X6CF 1Q94A 4LCCC 1BVZA 4K7FA 3VXQA 5HJ3B 2P45B 2ESVB 4JFHD 4BH7A 2VDMH 1DR9A 4IMLB 5KS9B 3QEUA 5B38G 3PL6C 4KQ4H 1I8MB 1KIQA 2ARWA 3NBNA 3V52H 1IGIL 3TN0D 3OJMB 2A6DA 4HMCA 3WMSA 1YPZB 2QJDA 3VFNA 5CBAA 1M7XA 3BKMH 3MV9D 4JFEE 2O61B 1J0HA 1OWWA 2A9NL 1OSZA 4NRZA 5EOCH 5ISZA 2F54E 5FM4A 4HQQH 1SEBB 1CIDA 3NPZB 1U3HB 2D03L 1AQKH 4HWBL 3WIFB 1XGTA 2CKNA 4HZAA 5KANI 1K4CB 2VB5A 4HV8A 5DEGB 3RVUC 1F2QA 2OR9L 5J89A 3UAJD 1FNEA 4N1HB 4TVSa 3AS3A 4XHJD 4QHLA 5EU7E 1OF2B 4J8RA 4M61A 5I1AB 1GGBL 1I9JH 3LHPH 5E5MA 4ZTOH 2BY2A 4R0LA 3RX5A 4RWYH 2X4TB 4XBEL 2MQ3A 4PJDE 5DD5L 2UWEF 1JTPA 3DETD 1U8LA 2AJ3B 1I4FA 5FECB 5C7XH 1BPVA 3BGMA 4DEPB 1WZMA 1L7TH 4F7CB 4YXKH 5EU7C 5B22A 4JDTH 4CGTA 1BVLB 4JRXE 2GFBA 1GAFH 1BQHA 4DZ8A 1AGCA 1G7QB 2AK1H 2VISB 2CMRL 1LGVA 3GKWL 3FFCD 1PKQB 4P2OB 1MWAH 3RNKB 4L4JA 1IEHA 1XFPA 2XZCL 3FTGB 5ESQB 1C08A 3DXAA 5JNYB 1CLOL 1RULL 3RIFF 1U8PA 1RZ7H 1KIRB 5IHZB 4ZFGH 4PRPA 2GITA 1Y6MR 3BKJH 3SJVD 3ME0A 3JV0A 1YEFH 2DJSA 2DRUA 4BFGA 4RISH 4PGJA 4CMMB 3I6GA 1K8DB 3SKJL 3JXAA 5IFHL 2QSCL 4RWHA 2NY2C 3TZVA 5D6DA 4PS4H 4MLSA 4MXQC 2HRLA 2L4OA 4I2XE 3WNOA 1VEOA 5C2UB 3DBXA 4AENB 5EFIA 4H0IA 2VRAA 3H0TA 1A7PL 3BDBA 3T0EE 5D7IE 2ZUWA 4L8BB 4H5SB 1XH3A 2X05A 1KN2L 4PR5A 4NQDE 4S1RH 5MENE 1CFSA 3LDBB 4WUUE 4PRAA 3UTQB 1IQWL 4GLRI 5IB2B 3GMRA 1M7IB 3C08H 3WS3B 3IVKB 3T0BA 3EYVB 4OKVA 1OB1A 4YHKL 5FGBC 3EYSL 4OCMC 2G9HA 4U1JB 2PETA 3CSPA 3Q5TA 3ZKNC 5HI5D 1FO0L 3T0EC 1LEGA 2AEWA 3NCFB 4LCIL 43CAA 1KJ2A 1UM5H 4BH8B 1J8HE 2DLTA 2JLLA 2EDHA 4R3SB 2DIJA 4NQSA 5J6HA 1KIPB 1JP5A 2PXYD 3L3DA 3DROA 5BVJB 4U1KA 2O5ZL 4LCUB 3P73B 4KQ3L 4YR6A 1KJ3L 1T89C 3TBSA 3THML 5B39A 2PO6C 5LVEA 3BPLC 5ERWB 4ZUSA 3G5XB 4K3JL 5DD6B 5F21B 3LQAH 3AGVA 5LCVH 3OXRA 4P5TB 5EBWB 5T3ZE 2CO7B 2CDFB 4H1LH 2OSLB 1NLDL 4N1EA 2KL6A 2BP3A 1KLGB 4IRSC 3MRPA 3C5SA 1L7IL 3GBNL 1RIUL 3U30C 2FCBA 4IEFB 1LO5B 4WCYL 4PREB 1MCIA 4RGMC 3WDIA 3RQ3A 5KVDH 3G9AB 4HD9A 5DQDH 2FSEB 3LKRA 2WW8A 4U4BA 5ICZA 5E6IB 2Z35B 4HS6A 3RKDC 3IJHA 4I48B 5I1DA 4ENEC 4HGWA 5AD0B 1N6QH 2D7PA 4OCYL 5HHQA 2E8YA 1U8KA 3QUMA 3OKEA 4GXVH 3HC3H 2H8PA 4TVPE 1Q94B 4JPWL 4DOHB 3IRPX 4K7FB 3VXQB 1WAAA 1C8PA 4BH7B 2VDNL 5H2BA 5E8DH 4P23D 2BNRA 5DJDA 3QEUB 4X5XA 3P0VH 1KIQB 1Z9SA 1JF6A 4ZTPH 4PTUA 2C3VA 1VGEL 3L3KA 1RZJC 2A6DB 5FV2A 1CLYL 3B8YA 2R2EB 3BPOB 3VFNB 5CBAB 4K7PH 4HWBA 4HUVA 5FHAH 1OSZB 5CINL 4NRZB 5ISZB 2WANA 4K94L 1P1ZA 3MLXL 5IBLC 5DMJB 4OZGE 3Q2CA 1XGTB 3IDNA 1CQKA 1RD6A 2GJJA 3EO1A 4NIKB 4TSAH 1NC2D 3TIEB 3AREA 1F2XK 4HV8B 4XXDA 3DYMA 1FNEB 4OGXH 1VFOA 1FSKC 5IF0A 4QHLB 3MLVH 2LABA 4WY7H 2J4WH 1QBMH 4M61B 4ZUWA 1B4JL 5E5MB 1UCBH 5KZCD 1Q9KA 1AI1L 4R0LB 1PJ9A 4G7YH