3L9RB

Crystal structure of bovine cd1b3 with endogenously bound ligands
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
97
structure length
97
Chain Sequence
b'IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD1b3
publication title Crystal structure of bovine CD1b3 with endogenously bound ligands.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune response
total genus 13
structure length 97
sequence length 97
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l9rB00
3MX0A 3L5IA 4OCLC 1KTLA 3FQTB 3FFDA 5D1ZA 4GAGL 2A74A 4CW1A 5JHDD 2ZCHH 7CGTA 3TNMA 4DUWA 2JB6B 5KW9L 2JJSA 1L4IA 5HGHB 3AFLA 3QEQE 3BO8B 5F6IB 1BP3B 3HG1A 1CFVL 3VFPA 3LIZL 4MJIE 1XT5A 1MHPH 3OL2A 1LK3L 5TQ0H 1ZVHA 4N0UA 2Q8BL 5IK3B 3RZCC 2UZIL 3REVB 3ARGD 4P2OA 3QHZH 5H8DA 1UM4H 2I9LB 2CR3A 5J9PA 1WFOA 2YD6A 5F96H 4HIEA 3EFFA 4JREC 4RISL 1T2QL 1UB5A 1MHHB 4Z7VE 3BIBX 1BGXL 1YNLL 4X98B 2I5YH 3RUGF 4L8SB 3I02A 3QI9C 2P48B 3FFCB 1JGUL 1JHLH 1OAXH 2B1HH 2EXWD 1BHGA 4LLDA 5F1OB 4JO4H 1NGWA 4N9GB 4XVUC 5T5FL 2OL3A 1RPQA 2K3TA 1ZT7B 4WU5B 3CFCH 5E4EC 2BNQB 4XNZC 4H0GA 5KSAA 2QHLA 2VC2L 1U8HB 5GQBA 3H3KA 2YRLA 5ITBL 1YPZA 5HHOD 4RGNC 4WW2F 2NTFA 4C56B 1SJHB 1FVEB 4JRYE 3BWAA 1II4E 1HYRC 4N0FA 2OM5A 1X9QA 4I9WE 4R8WH 3RPIA 2G9HB 5F7DA 4U0QB 3KPLA 3D69A 1KBGL 1I8MA 2PETA 4LSTH 4OD3H 4O58H 4PJ5D 3ULVE 4BFIB 2YWZA 4OZGE 5DVKA 3IFNL 1CXFA 4MA3B 4QGTA 4P2RD 3P11H 1SVZA 3OG6B 4MSWB 1JPGB 1PG7W 3QEHA 4LCYA 1MUJB 4XNMB 5C9JB 4P0DA 1Z3GL 4LFHD 3THMH 2ED7A 1D9KB 5FYJH 4G8FA 1S3KH 5EU4B 2O5YH 3FO0H 3QFDA 4MDJA 2XG4A 1MCKA 4Y5VA 3P77A 2VWEE 5CKAA 3RWFA 5F6IC 4NRYB 2QL1A 5FB8A 5F1NB 3R0MA 2V9RA 3GEWB 4GW1A 3VMNA 3L6FA 4L3EA 2Q8AL 4C54A 1WBYA 2AJVH 4ELMA 4JGJA 5MHSD 4RDQF 5E08H 2VMFA 3TP4A 3V6OA 4L4TE 4NQEA 3KPNA 4OZIB 4KGLA 3UAJD 2ZG2A 4UDTB 2OMBA 3QEUB 1A9BB 3O2VL 4OBRA 2H32B 4XPTH 3QEGH 4ZUSA 3QUYA 4J6RL 1X5KA 3K0WA 1IFHH 5GRVK 4BH7B 4L8SC 3ULSA 3F6IA 1JPST 2NY5H 1BJMA 1HEZB 3O6MH 4KXZH 3HFML 1MFDL 4NQCB 1RZ8A 4LLQA 5I16B 4Z7UE 1WQVT 3QFJE 2ITCB 3I9GL 3GI9L 1D5MB 4M3JA 2DLTA 4XP1L 5DMYA 3C8DA 2NW3B 2R2EA 2ICWB 3SCMB 4YFDB 3CDGB 2LU4A 3GMMA 3SGEH 4RZCB 5HGDA 3QWOA 3LKQA 4HFWA 3BIKA 1ZLVK 4JQIH 5HI5C 4NJAL 4N8CH 1YMHB 2VDLL 4M3KB 3UMTA 3G5YA 4APQA 2BFVL 2RAMA 2X4RA 4PLNC 4D94A 5BVPL 2DQIH 2P49B 3DX6B 2F54E 2GAZB 1FVCA 4Y2DB 3IRPX 3T0EA 1DANT 3HNSL 5E8EB 1FP5A 1HIML 1X5JA 5F8QC 5IVXF 1HQ4A 3ARBD 3OHXB 4MDIB 4E9LA 1U8MA 3DSFH 1AXSA 4QOKE 5IB4B 5KS9B 1OP9A 1A7RL 3ESUF 3O3AB 3KG5A 2E7BA 3MRQA 4LCIH 3TH2T 2GK0A 4UMGA 5JHDB 1BF2A 4Q0XL 3INUL 3L3KB 4HC1A 4JM4L 3ZSTA 5C07D 1OCWL 3MGOA 2HVKA 2VO5A 3FQTA 3HI1A 5CD5C 2V7NA 1D9KC 5EA0L 2XTJC 4YHNA 3CXHJ 4H1LB 4KH2A 4LGRB 2VR5A 1AGCB 4JN1H 1ACZA 1S7TB 2PYFB 5EZJB 1B2WL 3ZYZA 5EU6A 2XQYK 1BQLL 3EJZD 1FCGA 2HN7A 4PP2A 3ARGB 3MRMA 3AGVA 2WWKT 5EO9B 4Q2ZB 5LAXA 3ARUA 4PY8J 2E27L 4D0BA 5IK3A 3W5MA 1BAFL 1QNZL 3REVA 1P2CA 2V7HB 3IJSB 1FYTE 2W65A 5BQ7B 3PP4H 4LIQE 4LL9A 1IKNA 1JYVA 3CLEL 1VADB 1KCLA 2WP3O 3ULVF 4QXGL 5FM4A 35C8L 4F9LC 3MO1B 3GBMH 2R15A 1VA9A 4FQ1H 3QT2A 2P5EE 3PJSA 1T1ZB 5I1DB 3HPLB 3B83A 5LGJB 4WWKD 1A9EA 4TTDD 3SCMC 4V1DA 1T1YA 5HYJD 1NBZB 4Z7WB 3ULUC 1I4FB 2RB8A 4URTB 5CAYB 1GJIA 4OZ4A 1YY8B 4NKMB 4ONGH 1INQA 1HHGB 3E6HB 4JE4B 2IAMD 5C3TA 4C56A 3VG9B 2Y72A 4ZDHA 1JTPA 2KDGA 4P23A 4Y2DC 1ZTXH 3UJTH 2EXYD 3HC0B 4KMTL 4G42A 3V8CA 2G9HA 4NN6B 4P2RB 1QSVA 4U1KB 1ZHLA 5J1SC 2EYTA 5DMKB 2UY6A 3C5ZA 1HSBB 3PHOB 1GGCH 1EJ6A 5ID1A 1FZKB 3FZUC 4PJAF 5IROA 4E5XA 1OPGL 4MSWA 1Z5LB 1CVRA 5DFVC 4U6TA 5C9JA 4HWUA 1BLNB 4JFOA 2VR9A 1C1EL 4P5TA 1UWGH 1BM3H 2VJXA 2YPKA 3E8UH 1WZKA 2VDOH 2FEEL 5EU4A 5C0ND 1MFNA 5LVEA 3SY0B 2MFNA 2BVPA 4R4ND 4OM1L 5BZWB 4NRYA 3TBSB 2FYYB 4P59L 3ARGC 3H0TA 2L0DA 5FO9A 4KKAD 5DJYA 4LCUA 1J1PH 1R24B 3WS6A 4YK4B 1CLYH 4NBYB 4HJJH 2X4OA 5I76B 1A21A 4TSBL 1IGYB 4YBQD 2PXYD 3O4LA 4MXWH 4KKLD 4IMLB 1RV6X 5HBBA 1IMHC 3WE6B 3ISWA 1T83A 4P3CH 5FYJU 2EXWC 4HAFA 4Y16A 4KMQA 2BXZA 2RIKA 1INDL 2DQUH 1DBMH 4RBPH 5T3XD 3G6JA 4J3SA 2EYRB 3RL1B 4NQCA 1G9ML 1BJ1H 3IYLW 5DJAA 1NBVL 1MFCH 4HIXL 2ITCA 5JIPA 2DB8A 4JHAH 4HSQA 3TO2A 1O5DT 4IOSD 5TPWH 1J8HE 2NX5D 3L3IA 5FKPB 1AFVH 2ENYA 2VLKD 5HGBA 2GJ6A 4YAQB 7FABL 4Y1AB 4GRWB 3UZQA 2DQTL 1NGQH 1OB1B 2AV7B 1NGXB 3BDYL 3BH9A 3IKCB 4L1DA 1FNSH 5CZVL 5GS0H 3HAEH 3AAZA 4BQBA 1YEIH 2ZCLL 4D3CL 1GZQB 4NN6C 2P24A 1RFDH 3BT2L 1F4HA 4IOIB 1J7VR 3O2DL 1LO4H 2NZ9D 3DHMA 3OHXA 5JTWA 4OZFB 2FNBA 1F4XL 1NDMB 1JWSB 1NKOA 4GXVL 5C07B 1F02I 5KSBF 1FORH 1MCCA 1WT5A 2IANE 2HP4A 4PJIF 4QXTA 4R7DB 3FT4B 3VRIA 2XZZA 2VDKL 5ACZB 3L3KA 3OKEB 4G7VL 4X9FA 4AMKL 4UNUA 2A6DA 2R0KL 4J1UA 1KJVB 4Y7MA 4DN3L 1ZAGA 4M00A 2VQ1B 1MREL 5D93B 1GL4B 2ZPKL 1V3JA 4WFHD 2ESVD 1AHWB 1NEUA 3ZTJG 1YA5A 4CVZB 5EBMA 5D1XA 2PYFA 4JGMA 3ROLA 2ORBL 2BY0A 4ZO9A 1S9YB 2DMCA 3UAJC 4MNGE 2J4WH 4YK4C 3OJVC 1MFEH 5JHLL 4Q2ZA 4U1NA 1S7VB 5IMLA 1WAAF 4QY8A 3LHPL 3QB7C 5T1KD 3QIWB 2V7HA 5EH1A 5FGBC 3SOBH 4XBEL 3GMLA 1OGTB 4RWHA 3S88H 4K2UH 5BQ7A 1YEGH 3VFVB 3BP4A 2HJLA 3LQAH 5A16A 3G08B 2CD0A 4YZFE 2EH8L 3HI5L 4KDTC 2EE2A 4QTIL 5B38G 5EOCJ 4OLYH 1LEIA 4XNUL 2E7LA 3SJVA 4WWKB 1BVLB 2FGWL 4RNRA 5K9KB 1JUFA 3RI5F 1KNOA 4PJFA 1U3YA 5F7UA 1DZBA 3TVMD 4UNTA 5C0RH 3SGKC 4OF5A 1FGVH 5DRNA 3B2UD 3TT3H 2DIBA 3QEQD 5L2KB 4YPGB 2HFGL 2YN3A 4OCYH 3OV6A 1PX4A 1KEGL 4N90E 4MJID 5IG7B 5FECA 3QUZA 4S1QL 1B0RB 1NSNH 2WUCL 5DDHB 3MV11 12E8L 1NCAH 1VFBA 2DTML 4X7CC 2D4FA 4AM0A 1RUML 3ARVA 1F6AB 1T20B 3TT1H 4PPTA 5DYOA 3S4SG 3WHE1 1A02N 3CFJB 4OFYA 1UWXK 1MI5A 2GEEA 4HIJA 1NBYB 5D7LA 2NY4D 1VGKA 4YHZL 4F3FB 3OXRB 4CVUA 4OCWH 1V3MA 4RGOH 2OTPA 1ADQH 2AQ2A 4HWBA 2OSLB 1FAIH 3OKNB 3B2VL 1BLNA 1TJHH 3D3VE 5D93C 3DX9B 3EJZC 5LGHH 1I1YB 1AHWC 1NJ9B 4AEFA 1FL3A 4ZUWB 4PLJD 3SY0A 4I0CC 2M2DA 5EOTB 3SPVB 1C5CH 4EBQH 4PJ9D 3QUMH 1ITBB 4U3XA 2FYYA 4RMWA 2PXYB 1MCFA 2DQDL 3H9HA 5FO8B 1NCWH 3L9RA 4LHUB 4M6MH 4WHTA 1S7UA 5I1IL 1IEAB 4I9WD 5FO7B 5AZ2H 1A3RL 5CLTA 3TBWB 4XRCA 4DGIL 4GG8A 5D5MB 3FMGH 5INDB 5F9JB 1XR8B 5ECJE 2O5XL 2EDEA 1PAMA 3SDCD 5BZDA 2PNDA 4LSUL 3QUXD 4HAGA 3PABB 2FX9H 5DI8A 4NT6B 4WWKC 4FQCH 4KI5F 5I1KL 1KN4L 5BJTB 3MRRA 1ZHBB 2BCKA 3PG2A 4GH7B 1JPTL 1MRCH 3ALWA 2DMBA 3FO1A 3KDMB 5JW4M 5E6ID 1OM3L 3BXNA 1RZFL 2K7PA 1KN2L 4FZEH 3HMXL 4PJGE 3OX8B 3D0LA 4G6KH 4MNHB 3RDTA 2J8UE 2VXQH 1F42A 2DI8A 4AEEA 3GSNB 3NA9L 1NCUA 1JWMA 3OJDB 5JOEA 2EXYC 4KZEL 1EJOL 4Y1AA 1OB1A 1P1ZB 1DE4A 2PW2B 4L4TD 3VXUA 3IKCA 1H3PL 3VDBA 1UACH 5IQ7L 4X7TB 4G6AC 4JDZB 2I27N 2Z31A 3EOBA 2ADGA 4GAJL 2OL3H 3T04D 4PRDA 3EO0B 4A6YB 3OZ9H 3K2UL 3O11B 1T22B 5DK2A 4TTGA 1KTDB 4XXCC 1NCDL 2XZCL 4OZFA 4RIRB 4LCWD 3L3DA 1NFDF 3C8KB 4MXVE 4PV8B 4YHLH 1GC1H 4LDOB 3V5DB 3BKCL 5GJSL 4LRIA 4MD5A 2QQKL 2H9GB 1RZGB 3U7WH 4HXAH 3B9DA 4YXKL 5ACMA 3IJHB 4KKAC 5T3XL 5J06A 3UTSA 3O6KL 2D0FA 5KVDH 4NIKB 1JGLH 3L7EB 3BMWA 2QQLH 2QSVA 3IAGC 1T1XA 4YJZL 4YBQC 2PXYC 1NDGA 4N5UA 5GRWA 3C6LD 2DD8H 4KJWC 4JFEE 4KKLC 5T1KB 3MJ9H 2X4PA 5DC0A 3MV7B 3EDDA 1XAUA 2F54D 3EOAB 3BAEH 5FUZH 1RIUL 3QIWA 2BHZA 2VN4A 1WZ1H 4QOKD 1EAPB 3BDBA 5GSVA 4PUBL 2HWZL 3OBAA 5JPMA 1UM6L 1M6OB 4OFDA 5EO1B 4Q6YA 3MUHL 5CGMA 3SGEI 5DK0B 1RUPL 3WIIH 3RWCA 4HGMA 4U6HA 4HKXB 5KSUA 3TVMB 2DWEB 2FJHB 3LKPA 5B4MD 3T4AB 3FJTA 3MREB 2EC9T 3QEQB 4NRXA 5DC9B 1A4KB 1OL0A 4A6YL 1S9XB 2DLGA 3VH8G 4MJIB 4O9HL 1X7QB 2GT9B 5DHXB 3GUTA 3EYSL 4KVNL 1QKZL 2Q7NA 1G1CA 5CFHA 1YNTB 2YS4A 2JJTC 2MQ3A 4GBXB 2XZAH 1YEDB 3IU4H 2W60B 5MERA 1WZMA 2OJEA 4NP4L 5DJZA 2APTA 2W9EH 1VFMA 4ONFL 5IVZB 2CLZA 4MAUH 2UUDK 2R0ZL 3GMRB 1V7ML 4Z7VB 1AE6L 2DQJL 2ZUXA 1QLRA 1FYTD 1VEMA 3BP5A 5T33L 1L7TH 3N9GH 2VABA 1FHGA 2NY4B 5DT1L 1TITA 1UCTA 2Q6WB 2F19L 1N5YH 2VAAB 3IDXH 3EYQD 3SE3A 3JWDH 1XCTB 4I77H 1IGIL 3T2QA 3MYZA 1A64A 4F3FA 1P7KB 2J8OA 4WCYL 3RRQA 43C9A 1D5IL 4JFFD 1PG7X 3GFUA 4KQ4L 4MNQD 4JHWL 4ALAL 4PJ9B 4ZTOH 3TF7C 5IV2A 1HH6A 3QCTH 4LK4A 3OJMB 3HRZA 2D0HA 3NPSB 4JPWL 1P9MC 4JRYB 3OQ3B 3P4MB 4OLVH 2OBGA 2DLFL 4LPTA 1FNLA 4O2CA 4XPHL 1BEYH 3W9EA 4JPIB 1KIQA 3MNWA 3ZL4L 4EOWL 3IETB 2J8UF 4LAQL 4XAKE 4DZ8B 2YD1A 2M1KA 4E42A 1FO0B 4OZGB 8FABA 3MRCB 4HC1H 4M48L 1R5WB 3RUGA 3C08H 3TBWA 3DIFA 3AB0B 3QUXB 3UTZB 3UZEA 2XN9E 2ARJA 4JR9H 2VL4A 5D7IF 5F9JA 1XR8A 1WITA 5ALBL 2ZUQB 4XT1C 1I7ZA 3S5LB 3VXPB 3BPCA 1QR4A 1MHEB 1RZIB 1QUNA 3VWKB 3TYGH 1HKFA 3TVMC 1AGFB 1ZK9A 5E6IB 4JRWA 2G60L 3B2UC 3BRFA 1ZLUK 3S35L 1G7MB 4WW2A 1EIBA 3KDMA 4UTBL 4IDJL 3N50A 3TBYB 4GG6A 3CMOH 4UILH 3FN0L 3RIFK 4R2GB 1P4IH 1DQDL 4WDIB 2ZUUA 4BK5A 3DXAD 3DV4B 2Y07H 4L4TB 4BSVA 3JTTB 2AEIT 3GJEB 1LO3H 4JRXD 5BXFB 4JG1L 5D6DA 4LNVA 5A1AA 5E8NA 2FBJH 4KKCD 3RHWF 5LBSH 1CE1L 2GJZA 3FB6B 4JPKL 5L9DL 4HMDA 3DVGB 3GJFA 4ZFOL 3V5HA 1HK6A 1F58H 1N4XH 1W72L 1NGZB 1CDJA 2NY4C 4UBDD 4LCCB 4JO2H 5HVWA 1EEYA 1KPVB 5ERWB 4M7JH 4Z7UB 3QFJB 2EIZB 2AJYH 4Y5YB 1FFOA 1EAJA 4F33A 4LLVB 4KUZH 2CLVA 4BKLB 1ZANH 5DFTA 4LBEB 4M1DL 1A22B 3LKNB 3V79C 4HK3J 4AIXA 3EJYC 4JKPL 4PRHD 4PLJC 2W9DH 3E0GA 2UZXB 4RX4A 1LDPL 1KENL 4PJ9C 5BS0E 4AEIH 3KWWB 4XP9H 2DIJA 1J8HD 3C6LB 4PJXF 2DM4A 5IR1B 4FFZL 3C60D 4KK6D 3NABL 2B4CC 3FOLB 1IC7L 2F54B 1AH1A 3EYOA 3NIDF 3CPLB 1ZT1A 3GMPB 4YBLB 3O9WA 4MCYB 4PRPD 5E24E 4QHLB 1N6QH 2VKXA 4QOKB 5BMFH 5J8OA 4ORZC 3AB0C 3QUXC 3GHEH 3EOAA 1NC4A 5GS2D 5K93A 4ZFGH 5A2JH 4OLZL 3BGMA 2OZ4H 4PS4H 2ZUQC 1FPTL 1CL7H 4X9GA 5KOMC 1SVCP 5E99H 3VCLB 5JDJA 4RAUA 5EO0A 3VWKC 3KHOA 5EO1A 4KJYB 1IGTB 1U95A 4PG9A 1CT8B 5E6IC 3KXFD 4HMEA 3BDXA 4M8QB 2B8OT 1OVZA 2YD8A 4YGAB 1XF5B 2FIRT 4HWNA 1WEJH 1A4KA 1QA9A 3CU7A 4F37F 2GT9A 4C83B 1LMKA 4YC2B 3S3JA 1SM3L 4S1RH 3V6FB 1MJ8L 1P69B 3MUZ1 2GJJA 2R0LH 3LV3A 4Q9RL 1YNTA 5IVXA 2BDNL 3U6RB 1DN0A 4DCQB 4GBXA 1FYTB 1T4KB 5FA4A 5F3HA 5LCVL 2VXTH 3FTGA 4Y4KB 1P53A 1U36A 4Y4FB 1EGJL 2VLMD 5IVOA 3FT3A 1KPUB 5TDOB 1Q72L 3CSYB 4Z5RB 3UYRH 1PEWA 4MD0B 4OIBA 1R5IB 2VZOA 4Y5YC 3PL6D 5ADOL 3IDGA 5EUOF 3GKWH 3G5ZB 5H35A 5JZ7D 4HUUB 5FXCH 4FP8L 2VLJA 3FCTB 1FYHB 1X5FA 5DO2D 4IRZH 1YUHB 1JGEB 5HHNB 4S0SD 2VL5B 1P7KA 4P46D 1IC5L 2CMRL 1G6RL 1AKJD 1E4JA 2APBA 1MWAH 4FTVD 4ETQB 2XWJB 3ARFA 4MS8D 2ICWJ 5IMKB 4Q6IB 4M4RA 3C6LC 1OAZL 1G7QB 5DS8B 2R29L 2XRAH 4NPYB 5ICYA 4N90D 5KG9A 2KUTA 4K94H 3X11B 4JFHD 4ZXBD 5T3ZH 2VIRB 4FMKA 2CUHA 4LSSL 1S9VA 2QJDA 4YBLC 3MRJA 4JN2A 4IOFD 1LD9B 4NYLB 4DW2H 1WBZB 5ABDE 5IM7A 4JFZL 3C5SB 2GY5A 4NQSB 3EDFA 1E4XH 3P73B 4GW4B 3WHXA 5LQBH 4TVPL 1I1AA 2DM3A 3CVHB 2X1OA 3QJFB 4NO5B 2C1PB 4D9RE 4OLUH 3HNVL 1MLCB 1EEUA 4LKXA 3PHQA 5C0FB 4JPVH 5ESAA 1OGAD 3VGEA 4KTDH 4WTWA 1ZLUH 1PY4A 1YEFH 3NIFE 5CJOH 3MRDB 4KZDH 3S96A 4G43B 4AL8H 2GFBA 1LO0H 4X4XB 5D72H 1WFNA 5IOPA 2PCPA 4EN3B 1NMCB 1A1NB 3MV8D 5C08A 3TBYA 2HMID 2ADFL 4WDIA 3AU1B 4LVHB 4WNQA 3MRLB 4P2QE 5DRWB 5MP6L 4BQ8A 4Y8DC 5EUKB 5KJRL 1FDLL 1J86A 1SMOA 1MELA 2VLRE 2ICES 3ILQC 3EYQC 4IRJD 1HSAA 3QWRD 5LXGL 1U8PA 4PJAA 5J7CC 3HAEG 4X5WB 3W2DH 1NGZA 4LCCA 5GHWL 3I75A 1LWRA 2QKIA 5IB1A 5ICXA 1YN6A 4PBXA 5C92A 4M9PA 2EIZA 4FS0A 2EE6A 3D1MC 1RK1B 2R2CA 2R8SH 1T04B 4MHHI 5KVFL 2WW8A 2HT4D 4LBEA 1UT9A 1J8HB 4X6EB 3OKLB 4JEGB 1RIHL 3C60B 4Q6IC 2HLFD 3HS0B 1A14L 1BQUA 1CIDA 3QDGA 3DV6A 1A0QH 1FGNH 4NKDA 4FXKB 4DQOH 5HDQL 2J8HA 2VXVH 3KJ6L 4XNYH 4OLXL 3ROOB 1C5BH 3PWPD 3JV0A 5DHYB 5GGUB 2FX7H 3GM8A 3OAYK 1XGYH 3WSQH 2XQYG 3HMWH 3DUUB 3A6BL 3Q5OA 2C7UB 2YPVH 4QHLA 3VFSB 3Q1SH 1JF1B 4XP5H 3NGBC 3PIQA 1FG2A 1EV2E 1IM9D 2A83A 3RBSA 1FE8H 1JPSH 3AC0A 3I6GA 1NQBA 3RVWD 5IESL 2IANB 5IB3A 2AXFB 4L29A 4QXUL 2IJ0C 3FOMB 1WTLA 4QCIA 1QP1A 4OGXL 1DUZA 2Z4QB 1F4AA 4G6ML 4KHTH 4HCRL 3FONA 1IGTA 4MX7A 1IEBB 3V5KA 4KUCD 4GKOA 4QTHB 3TIEA 3VW3H 3B3IB 1JVKA 5F7MC 2HKFL 4XBPB 3QNXB 4MNGB 4YHMH 5DRXA 2HRPH 4YE4H 1NMCC 3K7UA 1MPAH 4FQJH 1A7NH 4N8VG 3IDMB 3MMEB 3ZLQC 4LVHC 5K9JL 5J1AB 4JFED 4R90L 5J11B 5KVEH 1TJGH 2R56H 1HH9B 1JGDA 4UBDC 3JWOH 2XZQH 3WNKA 4JZOA 4Y4KA 4OTXH 2YUZA 4Y4FA 5CEZD 2YK1L 4ODWB 5KSBA 3T77A 4MA1B 1CIUA 4NNPH 5F7YC 1D6VL 4PJIA 4FG6C 4B7LA 1R0AH 2AAVA 1KPUA 5TDOA 1A5FH 2FWOA 4Z5RA 5J13B 2IFGA 2P5EA 3AM8A 4EEEA 5DTFB 4P46B 2D4DA 2H6PB 1CGTA 2CKBB 2Q76A 2MKLC 4M1GL 1E6OH 3V0AC 4ACPA 2HT3D 4K8RD 2AXGA 3MBXL 1YUHA 3BYTA 5HHNA 5BO1L 2VL5A 4FZ8H 1KB5L 1JHKL 3HR5B 3RAJL 3C60C 4PTUA 5C0BD 3ARDA 5HDBE 3B9VA 2B20A 3CZFA 1BZQK 4ZXBB 5IMKA 1WAAA 5L7XH 1MFBL 1U9KA 3ZKND 4XPAH 4G8GD 1C08B 2PTVA 5DS8A 4ONOA 3VFOB 5E9DE 4BZ2L 1AD9A 1KFAL 3AS3A 4JB9H 4LSRL 1UWEH 2R1XA 3PQYE 4R96A 2VIRA 5D6CA 4LSVH 4BQCA 4I0KA 2A1WL 3KPPB 3GNMH 3T3PE 1Z9SA 4UV4H 5D1QA 3VFNA 3MLTB 1CK0H 4LF3A 5FYJE 2FHBA 1U8KB 1TJIH 3GRWL 4M7ZC 1S7XB 5HYSA 5GRUL 5AAWA 4NZRH 3D3VB 3NCBB 2EDJA 2CJUL 2C1PA 2ICEB 5K9QI 4J8RA 2EDXA 2WQRA 5D2LE 3RWEB 1QVOB 3KYMB 4LGSB 2X89D 2QSCL 1RSFA 4IBLT 4OM0L 5DK3A 3HR6A 4PJEE 3SGDH 2L7UA 4XH2A 3H9SD 2UYLA 4EN3A 1A1NA 1HHKB 1K8DB 3QXAB 1QLEH 5J11C 5F7LB 3ZT5A 5IHUL 4U1LB 3WFEH 2CRYA 1CDHA 1PYWA 5JA9A 3QNYB 1OSPL 3EO1A 1ZGLM 1AD0B 1MEXL 4MA1C 4HJ0D 4UT7L 4AYFA 5JZ7C 1T7WA 3WDHA 1VEOA 4X5WA 1CGXA 2CDFB 4KY1H 5D7JA 5J13C 4CADB 4P46C 1K4CB 2BHYA 1N64L 1UC6A 1OW0A 3IJYA 1CE6A 2MQ0A 4PJBE 3LEVH 4RWYL 1FFRA 3X3FH 4PJGB 3V6ZB 4IM8A 5TDPA 2J8UB 3T2NL 4UV7H 3ZKQD 1RJYB 1S9KC 2Y06H 1FL6A 4ZXBC 3IKKA 1WTGT 3L3JA 4HQQL 1VKXA 4FXKA 4ZFFB 2WK2A 3ZE1E 3ROOA 4IIQA 5IB5A 4C55A 2Z91B 3WIHL 1JL8A 1REIA 5E94A 2O61A 4GAYA 3QA3B 5GS3A 4M6OL 4CN6A 2X44D 3VRJA 5I1EH 2BX5A 4XCYA 4R4BB 4QRPA 4DGYH 3OKDB 5DJDB 5SWZD 3HC4H 2H2PD 3EYUL 4FQQA 2ZJSH 3BEWB 3OMZA 3W9DA 5DUBA 3UC0H 4D0CB 4XPBH 2RJMA 3F6LA 1JFQL 3MUGB 3U1SH 3HN3A 1JPFA 3FN9A 1KELH 3HCVB 4CMHB 1IQDB 2AJZB 3DBXB 4CL7A 1M7DA 2IBBA 1MJ7L 5SX5K 1TTFA 4JFEB 5GGVL 3HUJE 1EERB 3V0VB 4KPHH 3PV7A 5HDBF 1DBAH 2FB4L 1CZ8H 2B0SL 2V2TB 4K7FB 4POYA 2EDHA 4QNPF 3IDJA 4PRNB 1XGQB 2ADJA 3IDMA 3MMEA 4NJ9L 4HUVB 1ETZB 1JZ6A 1AQDA 3FAXA 4LHJB 5CCKH 3V6BR 4YFLI 3RY6A 4WFGE 4FQXB 5J6GB 1KACB 4K3HA 1WIPA 4LAJH 1NFDA 4Y8AA 1BOGA 3CIQA 2AK4D 1JV5A 4U31A 4XAWH 5FYKD 3T3PF 3RWJB 1JNJA 3JV6A 4NGHL 1ZSDB 5IVNA 2FJFA 4WHYH 2NNAB 4HUXA 4NKIL 1E6JL 1R3IL 4YEFA 2HG5A 3PWNA 5F6HI 1IAIL 2H6PA 4OGAD 5FOBB 3NZ8A 3C5JA 4P3DA 5T1MB 2HLFC 4H8WL 5B3NA 3LRSA 2ATPA 2IH1A 5TH2B 3QDJE 2R2HB 4UOJA 1N5AA 2ZSWA 1Y0LB 1DR9A 4N8PA 5CZKA 3RWDB 1DANU 4WI4A 2A73A 3L3OA 5D2LF 3NACL 4F7TA 4ODTH 5JW4R 3GJFH 3MV9A 3ZKMD 4UI2A 3EGSB 3O0RL 2HKHL 3RNKB 2BOBB 1BQHB 3QIBA 4XVSH 4YHIA 5C0GB 4PP1D 1K8IA 3BQUD 1OWWA 5CJQH 3TJHD 1CI5A 1CL7I 2IMNA 3SKJH 3L5JA 1YDPA 1UQSA 3F58H 4NZJA 1BJ8A 1B0WA 1TZIA 2NY7H 3IAPA 3RVWC 3U0TB 3ARPA 3EO9H 5I15H 3V7AG 2ZNXA 4YO0A 1MIML 4GKNA 3L1OH 1RK0A 2WZPD 1OLZA 1G7IA 4IRSD 1CICD 1OHQA 1U8KA 3AS1A 1GIGH 5CEZL 4K3EH 4WO4D 2OR8A 4UUJB 1WCQA 4BZYA 1JN6A 4LASL 3MBED 4CMHC 5AZEL 3AMKA 1TLKA 4GT7A 4QRTB 1EMTH 5F88A 5HHVL 4R0LA 2YD7A 2ZCKH 5FV1L 2AGJL 4K8RL 4ODXB 1NCBL 1NAML 2Y36H 4I0PD 1AGDB 5J4MA 4MQSB 3QUKB 3ZT6A 4K3JL 1K8DA 3QXAA 5HVHB 4N0RA 4D9LH 1JGVH 1H9VA 3MRBA 2XN9B 3WLWC 3HPJA 5EOCH 2NY2D 5DQDH 4AIOA 3RGVD 3G5XB 5FKAA 3WD5L 1EFQA 4FQXC 1J8KA 4H26B 3A67H 4OQTL 5I71B 2G5RA 1AD0A 1UKTA 1NMAH 4PGEB 1LE5A 1I3RA 4HBCH 4JCLA 3U7YH 5IFHL 1IGJA 3BKML 3HE6D 5I19L 4D9RD 2GUOA 2A9ML 4X83A 4O51B 1JZ8A 3C9NA 2IPUK 1I1RA 5BV7B 2HFTA 3ZTNL 1GAFH 4CDHA 4XNXH 1QSEA 4KQ3L 1NC2D 1JNNL 4H5SB 4NFCA 5EU7E 3ZKNC 3MCG1 2AV1A 1CDUA 1I8IA 1GOFA 2OR9H 3CDFA 2IGFL 4ZUUA 2JELH 3RWIA 4UZGA 1U58B 5DWUL 1AC0A 1ONQA 2PR4L 2J8UA 4UU9A 2P5WE 3MRFB 5I8EA 3DX7B 1CFTA 3MA9H 3SDYH 2CUIA 3MYJB 4I4WA 15C8H 1T89C 1IL1A 1CXEA 5CINL 4P2QD 1E4XI 2XPGB 4X0KB 1PZ5B 1OAQH 3C2AL 5D7IA 2VISA 5IB2A 4TUJB 5MEOA 4PJ5A 4WUUE 1NCCL 5ICZA 5SV3A 4P4KD 1OP5K 1GXEA 2OK0H 1G9NC 1H3VA 3ORJA 4PG2C 2HTLD 3QA3A 4OFIA 3UX9B 4NO0A 5HHXL 3MJGX 4OKDA 2X4TA 4WI5A 4Z7QE 5I1GL 1S9WB 1HDMB 3LEXB 3VFGH 5C0IB 5BS0B 5F7EH 3BSZH 3MUGA 1QBMH 4G8EA 1I1FA 1LHZA 3BUYA 3MLZH 3PWVA 4MMZC 4PJ8B 4ODUA 2NW2B 4X80H 4KK9C 5FCSH 1T7ZA 1SJVA 4KV5E 5I17B 1FJ1B 3TIDB 5TE6L 2A6KB 3O2DA 3ZSSA 1F4WH 3QULA 4K9EH 3LKSA 3DMMD 5T1LB 2Z93A 5HVHC 4BZ1H 3RI5K 5L8KB 4X4YA 2F74A 4PREA 1U8OB 4XP6H 1QBLH 3UROR 4HJ0C 3EYVA 5CHNB 1ETZA 1IC4L 4UDUA 4TULL 1N3NA 3WKML 3UJIH 5I71C 3GSXB 2BRRH 3BD3A 4ORGB 1RIVH 3U36A 1FL5A 3JWNC 3LN5B 2OJZL 3ZMRA 1ZSDA 3P0VH 3UCRA 3SE9L 3QIUA 1QQDB 2IFFL 2CIIA 1QD0A 2BSTB 1DVFD 3IAQA 4PJXA 2X2YA 3FQUA 3O2WL 2R2HA 1MRDH 3B9KA 5MENE 4C4KT 4XCNB 2B39A 4R7NB 1BQSA 3MTRA 4XCFH 3BQUB 4HBQA 5HHPB 3G6AA 1WJ3A 5A40E 4U6YA 1E4KC 3M17B 1OSZB 2ZSVA 3QHFH 3MLUH 4PD4J 3HC3L 4J2XA 1IQWL 4G9FE 5GJTL 2YR3A 4U1MA 4JM2D 1YJDL 3HZVA 1OAKH 3MRGB 5ANME 3ARBA 3RA7L 4DJMA 4O02H 1SEQH 1NL0H 4HPYH 4NWUL 4CNIB 3L5HA 3MCLH 2H2PC 1CGYA 3OGCB 4MJ5A 1G84A 2I26N 4YHKH 1B88A 2I07B 5DGRA 1N8ZB 1XGUA 4BUGA 1ULVA 1QTYT 1VGEH 4PRAA 1NEZA 1LO2H 4ODVH 2I9TB 5JR1H 3MBEB 3TYGL 4NOFA 2YC1A 3RNQA 3P9MA 4EI5D 2QSQA 4WFED 3O8XD 5FYKL 4H1LG 4P49A 4RMUA 1FC1A 4PJ8C 1YJDC 2E6QA 3CSPA 5EBLA 3K46A 4LRNL 4MQXD 4PGCB 5F71A 4JQVA 2GHWB 4HG4K 3M1BA 1INEL 3LQZA 3PGDA 2DQHL 3RWHB 1LP9F 4ODXA 4U6VL 3TA3D 3MOAH 3V4VL 5E9DD 5J89A 1ZGLB 2WIIB 1QO3B 3UO1H 3K4AA 4AY0A 5AYUH 1G0XA 3P4OA 3MZTA 3QQ4A 4RMTA 3LS4H 3BEVB 1IAKB 1JNLH 3HG1E 1XGRB 1YC8A 5EUOA 5IQ9A 3IDNA 4PRBB 4H26A 5DSCA 1MQ8A 4OGAC 4X6CF 4HIHB 32C2B 4N0UE 4QT5B 3MRIB 4JFXA 1EFXD 2YBRA 4CU7A 1XF2A 2ATKB 5CEXA 3VFRB 4NQVB 4EJ1C 4L8DB 1G7LB 3HZKA 1NC2B 2V5YA 4A2LA 4Z7QF 4LKCB 4ERSH 5HYJA 3QDHA 3PXHA 3ZKMC 1QFPA 4Y5XB 1I3VA 1I75A 4H5SA 4HX1B 1CDCA 1MCPL 1P7QD 2OTUB 3HZMB 3I6KB 2YWYA 3VG0L 4O4YL 4XGZB 1RVFL 4GAGH 3BQUC 3NVQA 4P2QB 4PP1C 3TJHC 2IAMA 4ZUTA 4LSQL 4WTXA 3FQNA 3O41A 4U1HA 5CIPH 5KW9H 4P4KB 2FJGA 2VNCA 4XHQA 5CSZB 2VLRB 3SDAB 1TZHA 4MA7L 3CMGA 4JDVB 1BREA 2R0WL 4P5KB 5E5UB 3KNBB 1CFVH 5H2BB 4TUJA 5KANI 1KCUL 1YPZE 2VE6A 5FAAA 1LK3H 1P4LB 1QRND 2BK8A 2Q8BH 5DJ0B 4OSUL 1CLOL 2UZIH 4GRLA 2H26A 4PY8I 2GIYA 2LTQB 3L5XL 3MBEC 3SBWA 1QFWL 5DEFA 1SJXA 1MHCB 4RISH 1T2QH 3SGDI 4ZMAT 1PX3A 1BGXH 3QSKB 4G5ZL 1YNLH 2NXZB 1WIOA 4I0PC 1N59A 4PB0L 5E8OA 1XF4A 2EDBA 1BD2A 1JGUH 4Y19A 3A0OA 3PWJB 4QF1B 2FLRT 1HQRB 1I8KA 5T5FH 3S36X 2DQGL 2FATL 2NY2C 4XPFL 2D7NA 5DVLA 3WUZA 3QXUA 2VC2H 2C3WA 4M7KL 3IVKA 2G75A 1K4DB 1S78C 5DEZA 2VDNL 5ITBH 3T8XB 1VACA 2HJFB 2YZ1A 5KZCD 2J2ZA 1VSCA 4OGYL 3HE6C 4L3EE 1SY6L 4S0TD 5F9WC 4ELME 2J88L 2NY6B 2QADD 5GSRA 3VXSD 4NUJB 3I3BA 3VD4A 3S98A 1RZJC 1KBGH 4NQEE 2D9QB 3SKOB 1JZ5A 4P9HC 3IFNH 2Z35A 2ZOKA 3B6SA 3CZJA 2C3XA 2DBLL 5GIRB 1QQDA 2BSTA 4Y5XC 1BIHA 4P57A 1H5BB 1QFOA 2NX5A 4R4FL 4HS6A 2VLKA 1Z3GH 2AI0L 3TFKD 2GSIB 3NTCL 3IDIB 3AVEA 2HVJA 4JFQB 3H6JA 1NUNB 2GITA 1S7RB 2H3NB 4P4KC 3SDAC 2V5SA 5L6YL 1E27A 2K7QA 2BVYA 5A2KH 1HXYA 4WFGD 3RQ3A 3WFHA 2Q8AH 1CFBA 1A1MB 3BPLC 3BKJL 4OZFG 1FBIL 2RCSL 4NKOA 3STLB 4JO1L 4EI5B 5IFJA 1GYAA 1KCRL 1XR9B 3AREB 3O8XB 1AIFB 2LTQC 2QQNL 4HDIA 4TNVK 4Z78B 4L4VE 1HHJB 2Z92B 3O2VH 1AO7D 1BFOA 4B7IA 3F7YA 3FKUS 5GGRB 3VGHA 4J6RH 3AUVA 2QSTA 5KVMC 3DVNA 1U91B 3QDJD 1TQCB 2ESVA 3VFWB 1I85C 3HFMH 2GQHA 1MFDH 1ES0A 4PGCA 1G9EA 4PJHA 3V7AE 1PLGL 5E9DB 4KRMB 5EIQA 43CAB 1DEDA 2X1WL 3I9GH 3GI9H 4POZD 1NLBL 3PQYB 4AT6B 1CDIA 4XP1H 3RWHA 5JW4Q 2X5PA 3LN4B 1BBJB 1KC5L 5EN2B 1DBKL 5C2UB 1ZGLA 3GKZA 4PTTB 4AG4L 3QXDB 3G04B 5DQ9A 4M02A 2CIKB 1R3LB 4NJAH 3B8YA 3GSQB 4ZUVB 1EXUB 1ZHNA 2EH7L 2EC9U 2E8ZA 2VDLH 3PNWA 5EU6E 1WV7T 4XNQB 1XGRA 5DEGB 2BFVH 2XKSA 2NY6C 2GTWA 4R26L 2XG5A 3QQ9D 4X99B 3RX5A 5CMAB 4IMKA 4QT5A 1I3UA 1DVFC 3QCVL 5ESVB 3HNSH 1GGUA 1HIMH 1A47A 5TF1L 5D2LB 3B9AA 3MGTB 4I13B 3RHWK 3U46B 3GGWB 5KOVC 1JI1A 5D9SA 1A7RH 4LKCA 3MXWL 1NMBL 4PJEB 3VD3A 1JJUA 1H5BC 2DLHA 4LLUB 4Q0XH 3OAZH 3INUH 5ESQB 4JM4H 2E8YA 3RTQB 1FGNL 1OCWH 3HZMA 1HILB 1Z9MA 3SHSA 2UV3A 4GJTB 5EA0H 2FO1A 5IT2L 2DRUA 3QBTB 2H32H 1F97A 2X4QB 1T7XA 1MJJA 3PDDA 3LOWA 4BJLA 3TESA 3KLAA 4V1DE 4NZDA 2APFA 5B21A 1ED3B 4JDVA 4U7SA 1B2WH 3IXTB 3TNNB 1BQLH 5H94B 5H2BA 2KZWA 4KVCL 2CRMA 4M43L 3LKRB 2O5ZL 4EI5C 1FNAA 2VDQL 3SDDD 3V4UL 4TQEL 2E27H 3AREC 3O8XC 1WLHA 2H8PB 3JVGC 1BAFH 1QNZH 4PFEA 4PJBB 1LGVA 4ELMF 4ZOCA 1A6AB 2Q1EA 3LS5L 3CLEH 1XF3B 4QXGH 5E7BA 3S8WA 1KULA 4FNLL 35C8H 3FRUA 3IF1B 4HKJB 3RX8A 5HD8C 3DUSA 1MCBA 3FB8B 3KGRA 4LVNB 5FM5O 4OZHE 2NY0D 2EICA 1ZVYA 5GS0D 1ZEAL 4ZFOA 5C0AD 4LPUA 4XTRC 5DQJB 4LHUG 5EC1A 1W72A 5D7SL 5CBEA 1JZ4A 4FXGA 1T5XB 1QR1B 1KJ2L 2GCYA 4NQXB 1F11B 1X5LA 2FH6A 2BXYA 3TZVD 1Q9KB 1UJ3A 3GIVA 4EIGB 4D8PA 1A2YB 5L2JA 3T8XA 3C6SA 3DGGB 1CD1B 5HI3D 5CKGA 2PTTA 3SDCA 5A43C 3D85B 3L7FB 4G3YL 2VQTA 5AAMA 1CYGA 4UQ3B 4HLJA 5BRZA 2DL2A 3X12B 4CGTA 3V9FA 1BIIB 4G7YL 5KVGL 5HY9A 3D25A 4KMTH 3SE8L 4L3AA 3O4LE 4QYOA 4YDIL 4OKVB 4FQPA 3MJ8B 2GYSA 5J3HD 3HUJB 4B41A 2V2WA 4F7MB 1S5HA 4NUGL 1OPGH 1GOGA 4N0CD 5L8JB 4KK5D 5HSFA 1UFUA 2LQRA 1BVZA 1SYSA 3G6JE 2UWEE 1B4RA 1C1EH 2YZ8A 5J12B 1NLDL 4M6AA 3U83A 4UAOB 4PB9L 2NY5C 4NC1E 5JO5B 3TV3L 4AIZA 1DDHA 3RL2A 2JF1A 1A6TA 3WS3B 4LEOB 1CD0A 1U8QA 4I1NB 4OM1H 3Q0HA 3W39B 2EDTA 4P59H 5EZOL 5JDSA 1F2XK 1XH3B 4YR6B 3FQRB 1H3GA 1IAOB 2DKUA 1T3FB 2GJ6E 1E28B 4BQ6A 5JXED 1JZ7A 1D5BB 5IF0B 1TCMA 4TSBH 1B3JA 3MROB 5EG6C 2ILLA 3KPMB 4HV8A 1XR9A 4HWEL 1QLFA 5DRZB 3QDJB 5LG1A 1U2CA 4BELD 4MJ6A 1NBQA 1Q0XL 2HA1A 5D2NC 5IEHB 3PP3K 1PQZB 2F5BL 2VKWA 5GGRA 4FFWD 2XIDA 3K81A 1MVFA 4C57C 4D9QD 1U42A 1INDH 4LVNC 3CX5J 5T3ZE 1SQ2N 4MWFB 3VFWA 3IT8D 1J05A 2WMPA 4GSDL 1G9MH 1EEQA 2W07A 1XZ0B 43CAA 4HIXH 2YOCA 3S3PA 1KJMB 3TN0A 2OI9B 2G2RB 4KAQL 1AY1L 2AEQL 1I7TB 3U9UB 2P8PB 4G9FD 4WTZA 5EWIL 5ISZE 3A6CL 1U92A 3FB7A 4YFLF 7FABH 1G6RA 2DQTH 3BDYH 1RZKL 1W2KT 3H3PL 5I1LA 5CZVH 3MCKA 4LPVA 3QHTC 2C4FT 5DD6A 3S34L 2ZCLH 5ID0A 4D3CH 5DURB 3BT2H 5EZIL 5CMAA 3Q3GB 2VLLA 4LNRB 5FCUL 1TCRA 3SDXF 1ORQA 3O2DH 5D2LA 3SGJA 4G9DA 3T1FB 1QPXA 3TO4D 1F4XH 3MRHB 4GXVH 1PKOA 1JHTB 4YBHA 1IAMA 3U4EA 4W4OC 4DEPC 3BJ91 2X10A 2IALB 1IE5A 5E7FA 1WISA 2MHAB 1CFSB 3F7VA 2VDKH 5ESQA 4G7VH 4AMKH 3SJVE 4OZHF 3RTQA 3B5HA 5J12C 5D1ZD 2R0KH 2WBJD 1CLCA 2ZUYA 2NQCA 4UAOC 1FV1A 4DN3H 4PJFE 3DRQB 1MREH 5SWSD 4N1CA 2ZPKH 3BKYL 1J87A 2NMSA 3D2UD 4QHMB 5FDWA 4ISVB 4QRUB 3GM0A 4P2CG 2VZUA 2ORBH 3NFPB 1NFIA 3HG1D 3IXTA 2BSRA 5DJ2B 2X4NA 3NIGF 3TBVB 2J5LC 1IGML 5JHLH 4RFEA 4PY7A 3Q48A 2XXCB 1JBJA 2R1WA 4YWGL 3IGAB 4M5ZL 1QFHA 5C9KA 4J3OC 3LHPH 4P2OD 5SWQB 25C8L 1Q38A 2C4XA 4XBEH 2EEAA 4P5MB 1MF2L 4JFFA 4MNQA 1K9TA 4M61B 4KC3B 2NY0B 5IHLB 3EYFA 1LK2B 2YA2A 2P5WB 4M7LL 3HAEB 4POZC 2EH8H 3HI5H 4QTIH 5DD1L 4NFDA 2FR4A 3IF1A 1KGCD 3MZGB 4UTAL 4XC1L 4XNUH 4QKXB 3TCLA 1MI5E 4JZJA 2FGWH 4WY7L 3E3QE 5D7LE 1X5AA 1EVTC 3TZVB 2LAAA 2FO4A 3NCYS 4RQQA 1FIGL 2OI9C 2EIDA 2E9BA 4WUUB 5GGQL 2V5RA 5LWYL 1QR1A 2UWEF 1A7PL 3CH1B 3KPSE 3PV6A 5KSAD 5F3BA 1YECL 1WCBA 4XBGA 2HFGH 2QLVB 4JANA 2XKNA 1DQML 3REWB 5F70A 4D0DA 1KEGH 3L3GB 3MSPA 1FH5L 3QQ9C 1KIRA 3S5LG 4S1QH 1Q94A 5C70A 2WUCH 4F9PC 1XGTB 12E8H 4F7PB 2DTMH 2AKRA 5GRVL 3CUPA 3ZE2E 1RUMH 1K3ZA 1FC2D 3P0YL 3QDMA 3HRPA 1BIIA 1FRGL 4W4NA 4UOW1 3CFBB 2CDGB 5HJ3B 1R3HB 3U0PB 1LEGA 2DBJA 1ZLWK 3QH3B 5GS1B 1PG7L 4QHNB 3AY4A 5IUSA 3PWUB 2C3VA 1T03L 4YHZH 1UZ6E 1MAML 2D31B 4S1SH 4F7MA 5KAQF 2HFEA 2CDEB 3OR6A 1XIWB 4PIRF 3B2VH 3JBG7 4JRXA 4U2YA 3VFTA 1HNGA 3QO0B 1T6WA 3NCJL 4EUPA 3QWQB 5F1KC 4U7MA 3IFOB 3WS3A 5C8JA 1KIPB 1S7WA 4YDVB 1OT1A 3GSUA 1S8DB 4HCRA 5CP7A 5K33A 3WN5A 4W68A 4O5LL 2ZP0T 4WFFE 2DQDH 1XH3A 1UEMA 2H1PL 4HUMB 5MEPA 5I1IH 3X13B 4OAWA 4ZYKB 1MLBA 3MNVB 4E41D 1A3RH 3S37X 4DGIH 1TPXB 3B5GA 5ACLA 3RZCD 3VXUE 3EOTL 4NQED 2CKNA 4BH8B 1UZ8B 4M6NL 4DN4L 1V8HA 2A77L 2O5XH 4YDJA 3O3BB 3MLWL 5EU7C 1FZMB 2DMKA 3NCMA 4PRHA 2NLJB 1DFBL 5MENB 2AQ1A 2NY0C 2DDQL 2PYED 1BZ9A 5GS0C 4LSUH 3QUYD 3DI3B 3MRKB 3HZYA 4HWZB 4JAMA 3T4YB 4AENA 1UXSA 1YYML 4JY6A 5I1KH 2W0KA 1KN4H 3NBNA 3TZVC 5I66B 1RHHB 4G9FB 3MRNB 2BVEA 5E5MB 1SYVB 1FZOB 4GW5B 1JPTH 4KJPD 4NHCL 4OQ1A 1NANI 5ANMB 4PRPA 4RMVA 2OTWA 1IGFL 5HI3C 1A7OL 1OM3H 5F9AC 1RZFH 1Y18A 1AP2A 2W0FB 1I7TA 1KN2H 4PJFF 5DJCB 5DQDL 3HMXH 5CP3A 1S7SA 4X8XA 4CU8A 3UTSE 5C0DB 4Z0XB 4UIKH 2FSEB 1CN4A 3NA9H 9CGTA 1IRAY 4L3CB 4KZEH 1OF2A 1EJOH 1KB5A 4APQD 1ROWA 1H3PH 5CBAA 5IQ7H 4ZQKB 3GMOA 3GSWA 1H15B 3KXFA 4WHDA 2MPAL 4LLAA 3QUMB 4ZOBA 4ZPVB 5J3HC 3MLSL 4GAJH 1Q9LB 4JCMA 2V2XB 1P84J 3T0ED 4CJ0A 3Q3GA 3VU2A 4LNRA 3GSOB 4K7PX 5GS1C 2EDQA 1A6VL 3K2UH 5CWSB 2AJ3B 4PLOB 3T1FA 3UTPE 3PDOB 1NCDH 5F1IB 2XZCH 1I9JL 4RCAA 1ZA6B 1KTLB 2AK1L 3FFDB 5D1ZB 3RVTC 2IPUG 3BKCH 2A74B 2IEPA 5GJSH 1XIWC 1ACYL 1IBGL 1CFSA 2QQKH 3TNMB 5IBLD 1FG9C 4KK8C 3LQAC 1IKFL 5DMGD 4YXKH 5T3XH 3HG1B 2VQUA 3O6KH 2I60L 5F93C 1WIUA 3NCEB 4N0UB 3HB3D 1TETL 4GMTL 3TBTA 4P2OB 3PL6A 3C09B 1JK8A 5J9PB 2RBLA 4ZO7A 1TPXC 4JJ5B 3WXWL 3EFFB 5EULV 4FFWC 1UB5B 3ZE2F 2PUQT 1RIUH 3CX2A 5SWQA 3IS0X 1CXHA 4JKMA 5DR5L 4PUBH 2HWZH 3I02B 5EU3B 4JGUA 1UM6H 1LP9A 4QRRA 2G5BA 1TVBA 4LLDB 5CS7A 1RUPH 1NGWB 2OL3B 3PF2A 3ZZ1A 3CC5A 4PJCF 4NZTL 3BWUC 2BVUA 4HKZB 1F90L 4OD1L 4ZS7L 5F9OL 4A6YH 2VOTA 2JJWA 5H37G 4O9HH 1YPZB 5DVMA 3PHSA 1M05A 1C16A 3EYSH 4AQOA 4V1DD 4KVNH 1QKZH 2BNQD 2NTFB 4U05A 4X6CA 5M7QA 2RFXA 3N0PB 1B6UA 3BWAB 2RQ8A 3L3GA 4N0FB 1RIVL 4HFUL 4OBSA 3RPIB 3VMOA 4NP4H 5HYSG 4ONFH 4C56D 1LDSA 5F7DB 2XA8L 3KPLB 3D69B 1M7IB 1I8MB 4F7PA 2R0ZH 2IQAA 3GK8L 3ETBF 3TO4C 4NSKA 1V7MH 1EEZA 1AE6H 2DQJH 4GS7B 3MUY1 5T33H 1OGAA 2KKQA 3CK0L 1ZHKA 3RUGE 2X05A 4LARL 2CGRL 5DT1H 2CDGA 1MCNA 1PSKL 2F19H 3S6CA 1SEBB 2DJUA 3QEHB 4LCYB 1OTUD 4QHNA 3WNLA 5D1ZC 1IGIH 3C5ZD 5INCA 3KPRA 3WIHA 4GMSL 4OFPA 5CJXA 2R2BA 4Q7DA 4G8FB 1NGPL 2E9JA 3QFDB 4MDJB 3VXOA 2R9HD 2JJSC 1CG9A 4WCYH 1Q9WA 2CK0L 1J1XL 3P77B 4M1CC 1D5IH 1F3RB 4KQ4H 4JHWH 3RWFB 4P5TD 4ALAH 3SO3C 5FB8B 4GW1B 1QACA 3L6FB 4JPWH 4JHZA 4L3EB 4TN9A 1IC1A 3KLHD 4IRJA 2ICWI 2X4UA 1WBYB 3WJLA 4ELMB 1KUMA 2DLFH 3MODL 4XPHH 4YDVA 3WLBA 4GG6E 5L88L 4P2OC 3ZL4H 4EOWH 4LAQH 4NQEB 3KPNB 1IEHA 3C09C 5DHVA 1KYOJ 3I2CL 3ZDXF 4M48H 2GI7A 5HHME 2P42B 4ZUSB 2Z8VC 5IW1A 2BNRA 4BQ9A 4JJHA 5ALBH 1G7JA 3DYPA 4CVWA 3ULSB 3WNOA 4UINL 4K3DL 1MCWW 3U4BL 1F5WA 1RZ8B 4LLQB 4Y16D 1YEJL 4J3TA 5TJWK 4ENED 1DQLL 2JB5L 3I84A 2G60H 5KSAC 5E8DL 2R2EB 1TVHA 3S35H 3CH8A 4NQCD 1K85A 4WI8A 2VRAA 5HGDB 3QWOB 3LKQB 4HFWB 2ITDA 3BIKB 1GC1C 4UTBH 2X40A 4IDJH 5T1DL 5C0JA 2VUYA 3U79A 1JF6A 1IM9A 3G5YB 4APQB 3BESR 5IHBA 1RURL 2WQ8A 5E00A 3RKPA 3WEXA 1RULL 4Z0XA 1FLRL 2GJ6D 2X4RB 1OY3B 4ZS6D 4JG1H 1X6NA 1FVCB 1CE1H 4PLKD 4JPKH 5L9DH 1DQJA 1HQ4B 2OCFD 4GS7C 2R39A 5C0EA 1AXSB 3TPUA 1W72H 3QR2A 1Q9LA 4Y2DD 3MRQB 2BNUB 2GK0B 1RJCA 1K2DA 3I6LD 5CD3B 2FEEI 1MCLA 3C8HA 2AJSL 3PDOA 4JO3L 1A8JH 5T3ZD 3MGOB 1J0HA 1ZA6A 2HVKB 3HI1B 3NFSL 3OR7A 2V7NB 3WFCL 4M1DH 4YHNB 1ZT4A 4Q9CA 4JKPH 3GO1L 4Y5VC 3FZUD 4NC0B 1OAUL 1TNNA 2EIBA 1LDPH 1KENH 5DFVD 1R3JA 2ARWA 3D0VA 3T0XA 2WINA 4FQLL 4X4ZA 5EU6B 1EK3A 2HN7B 4PP2B 1KTKE 1R3KA 3MRMB 4OI9A 4FFZH 1R5VA 4O00A 3V4PL 3VFUA 1K5NB 5LAXB 2UZYB 3ARRA 3H3BC 3NABH 1IC7H 4G80A 1WBXA 4MJ2A 3V6OC 4D0BB 4EI6A 5E2TL 2VDML 5IVXE 4P4RA 1P2CB 2BC4A 1YMMA 4AJ0A 1VESA 2B5IC 2W65B 2WUBL 4PR5A 3TH3T 1NAMA 3CLFL 3QUYC 4JJ5A 5IJVA 4DKFL 4GLRH 4OLZH 2YMXL 4HK3N 1FPTH 5TQ2L 4UIMA 1OTSD 5C0BA 5FFLA 5EU3A 5EZLA 3MR9A 3PJSB 3UDWA 4KJPC 3FO2A 4R3SA 5J6HA 3SJVD 4OQTA 1A9EB 2I25N 2VLJE 4V1DB 1T1YB 4XCCL 4OI8A 3JWDC 3Q6FB 1NCTA 4HKZA 1T1WA 4OZ4B 3UBXI 3F7QA 3RZWA 1INQB 5F89A 2AERT 4ZFZA 4I8DA 1SM3H 4APQC 1MJ8H 3QDAA 5F7HA 3DPBA 4ZDHB 4YEEA 2AVGA 4P23B 4Q9RH 1XF1A 2BDNH 4GG6F 3Q5YA 5GGTL 3UTQA 3T0EC 4XI5D 5LCVH 4G42B 4EDXA 4YIQA 4DTGL 1M7IA 4AK1A 1EGJH 2VDRL 1ZHLB 3MLYL 2EYTB 4NNXA 4Y89A 4MZ2A 3C5ZB 3SKMA 1Q72H 5ID1B 4OZHB 5FM8A 5HTSA 3MJ9A 4E5XB 5IBLC 3UPAA 4DZBB 5ADOH 1SEBA 1ZA3A 2IG2L 5FYLE 4ELKA 4OFYD 4FP8H 3RVVD 1MI5D 5DMGC 4JFOB 5D7LD 4P5TB 1N2RA 3BZFA 1BX2A 2YPKB 1P5UA 1IC5H 2CMRH 1G6RH 4F7CA 3ZHLA 2AQ3A 1CS6A 1EZVX 2LAGB 2BVPB 2DI7A 3NCCB 3HB3C 2OP4L 3UPRA 3H0TB 2W59A 5FO9B 1OAZH 1XCQA 5DJYB 4LCUB 4BFBD 2R29H 3LRGA 4KDWA 4KRNA 2HRLA 2YSSB 4JKKA 5C08E 1VCAA 1M4KA 2X4OB 4LSSH 3O4LB 4Z77A 3FB5A 3WYRA 2VR4A 5IWLA 3LAFA 1IKNC 3H42L 1KXTB 4JFZH 3QPXL 5BW7A 4Y16B 1U8LA 3U4AA 4TVPH 4TSCL 4PJAE 3QG6A 4MMXC 3G6JB 1X5YA 4MAYA 2UWEB 5DMJB 4RBPK 3BZEA 3E1F1 3HNVH 4LPXA 3GHBL 1CR9L 1ZS8A 5DJAB 1CTNA 4XWGL 2JCCF 2PO6B 3M07A 3K3QA 4X6FA 5D70L 3TO2B 3OKOA 5EBWA 1ZMYA 4CBPA 3KYNA 2WLZA 3L3IB 3BHBA 5HGBB 2GJ6B 3N1GC 3QG7L 3QDGE 2ADFH 4IJ3B 3DARA 4P23C 3BH9B 4WFFD 5MP6H 3CFEA 1M71A 3AAZB 5SWZA 3BW9B 3F62A 5IMMA 2Y5TA 5KJRH 2EE3A 1FDLH 2VITA 3P9LA 2P24B 1YYLL 4L4VA 4Y1AD 3LRHA 4DOHE 2Y25A 5K59F 2AJUL 1YC7A 3NMEA 3VXUD 2VZSA 2Z0BA 1OTUC 1Q0YL 5LXGH 4X7DC 1CQYA 3C5ZC 3SQBA 5GHWH 2OXGA 2BNUA 5IROC 2R9HC 3VRIB 1YEKL 4QXTB 5CD3A 4FABL 4WUKL 3MLRL 1S7QA 4P5TC 2A6DB 3GMNA 4J1UB 1PW3A 3TC9A 5KVFH 2W91A 4W6WB 2BVOA 3KLHC 4PYHA 1A6PA 1CLZL 4FFVC 5ISZB 4PGDB 1WICA 1MVUA 4Y4HB 4K71B 1RIHH 5AYQA 4HXBL 5EBMB 1A14H 5D1XB 3ROLB 5IFAL 4KRPB 3UTSD 1B0GA 3BE1L 5HDQH 3WS6C 2AK4A 3KJ6H 4U1NB 1K5NA 4OLXH 5IMLB 5E2VL 4QY8B 2FL5A 2B2XL 1Q8MA 4PJDA 3A6BH 1BMGA 5HYEA 5IMOA 3ULUL 3GMLB 1T83C 4Y16C 3BP4B 2HJLB 2RR3A 5A16B 5IESH 4P9ML 1AJ7L 5DVNA 5KSBE 5C71A 4QXUH 3QIWD 4ENEC 4EUPH 1LEIB 4NDMA 4PJIE 3SJVB 1KCKA 4OGXH 4RNRB 5E03A 1EBPA 3OPZL 4G6MH 1JUFB 3MFFB 2EO9A 4HCRH 1KNOB 4PJFB 4NC1C 1CWVA 3PDGA 1KB9K 4X5XA 1BQHG 5B38A 1CGVA 2JIXA 5AUMA 3X3GL 1YN7A 1BF8A 5DRNB 2HKFH 3BFOA 3K1KC 3Q6FA 2HLAB 2J6EL 4ZS6C 1J5OL 5I1CL 5FECB 3QUZB 4NWTL 1LE9A 3UJJL 1X5HA 4IJ3C 1D3CA 2EZ0D 4PLKC 5K9JH 1WAAE 5L2KD 1I9EA 2E9IA 1UB6B 4NNYA 5CILL 1TXKA 1VFBB 4R90H 4AM0B 4IRSA 1CICA 4RAVA 1JP5A 4RGNE 3SDXA 5F7NC 2E6PA 4L1HA 4WO4A 1A3QA 1H8NA 3WL9A 4DFIA 1U0QA 4K94C 5DYOB 3L95A 2YK1H 1D6VH 1I8LA 4G6AD 2BY1A 3LD8B 4J3XA 1MI5B 4X4MA 4HIJB 5D7LB 4OZHA 1VGKB 1WT5C 5CP3H 5GS2H 3S4SA 4M1GH 4DZBA 1SJEA 1HWGB 4NKQB 3QXWA 3ZDZE 4YPJA 3FL7A 3MBXH 3KPSB 2OZ4A 1O0VA 5BO1H 1D5XA 4OIIL 1MCOL 3CVIL 5CSGA 1KB5H 1JHKH 4K71C 3RAJH 4NOBA 1FL3B 3RGVA 5D1XC 1MOEA 1M1SA 4DAGL 4OT1L 4KRPC 4DKEL 5J0BA 1MFBH 3H9HB 4NO3A 3ARYA 3L9RB 2IPTL 1XGPB 4WHTB 1S7UB 4Q74A 3HTLX 2YSSA 4BZ2H 1KFAH 2WWKO 4LSRH 2R4RL 3DJ9A 4XRCB 3MC0A 5C6TL 4GG8B 4XC3L 2A1WH 4LHUD 4KJWD 1OTSC 2YRPA 3O4OB 4N1EA 5I8OL 5BZDB 4HKBA 4A2MA 2IC2A 3EW3B 3GI8L 1VFOA 2NTSP 2Y23A 4CDGC 2YUVA 4NQDA 2B1AL 4XMKL 2DI9A 1GH7A 3O3DA 5DI8B 3GRWH 2E7LC 2X70B 3LH2L 1EO8L 1QEWA 4LU5L 5GRUH 3MRRB 4X6DF 5GGSA 2CJUH 2UWEA 4G6FB 1WFTA 4U2ZA 4XX1E 2AW2A 2BCKB 4HH9A 4N1HB 3V7MA 3FO1B 1SY6A 5C0CA 2PO6A 3BXNB 1EHNA 3BVNA 5C6WH 3IU3A 1RJZA 3D0LB 3D39A 4M7LT 3F65A 5C3LD 2QSCH 4OM0H 3RDTB 5CLWA 3QUZC 1UYWL 1JWMB 1J0KA 4HWBL 4XI5C 1TIUA 3VG9C 3ES6A 3GBNL 3VXMA 2A6IA 1DE4B 2XNAA 3VXUB 1MWAA 1DP0A 5IHUH 4PV9A 3ZKSD 2YN5A 1DN2A 3BW9A 5EFIA 2Z31B 3EOBB 2ADGB 1A4JA 3IS1X 2F53A 4PRDB 1OSPH 3VXQA 1URLA 5HHMD 4NC2B 1MEXH 5I8KL 5DK2B 4UT7H 1UVQA 2QV2A 3LD8C 2F58L 3ABZA 4GRMB 1DLFL 3RVVC 3E3QC 5DUPL 3KPQA 3L3DB 1EO5A 4KI5E 4MD5B 4QRPE 1N64H 1MH5A 4TOYL 2ZKHL 3HLAA 5B8CA 3DMMA 4RWYH 4AH2A 3D87B 5ENWA 5GRJL 1RU9L 3UTSB 1FVDA 4TRPL 3EAKA 5ISZA 4PGDA 4RX4D 1WC7B 4Y4HA 3T2NH 2XTJE 1BZ7A 5GISL 3GB7A 1T1XB 2H2SC 3NN8A 3BH8A 1NDGB 4HQQH 5HGAA 1JMZA 1TTUA 2N56A 2X4PB 5IKCB 3FQXA 4OUUA 2JKXA 3HNTL 2Z8SA 3WIHH 4AZ8A 3O4OC 4M6OH 1WZLA 3E2HB 3MV7D 3ZT7A 5GSVB 4I5BA 4M5YL 4L5FL 1NC4D 5JPMB 5C7XL 3RY4A 4J3WA 1NFDE 3MJ7A 3JWOC 1KLUA 1CFQA 2OMNA 3SEPA 3RWCB 4U6HB 5KSUB 3WCYA 2CRZA 3LKPB 3EYUH 4I3RL 1JFQH 1X5IA 2MQCA 3MFFA 4MCZB 4NRXB 4U3CA 5DD0L 3HE7A 1KCVL 3ZDZF 3W82A 1A6UL 4JM2A 5DHVH 3GUTB 3PGCA 4DUXA 1U2HA 3SKNA 4NN5B 1MJ7H 3DO3A 3BD4A 3RDTC 2HLAA 4NZUL 5GGVH 2FB4H 3MV9E 2B0SH 2QBWA 3VH8A 5MERB 2OJEB 5DJZB 4OCRL 1LEKA 2CLZB 4NJ9H 1UB6A 1AGEA 2FX8L 1X5XA 2Z31C 4GBXD 1QLRB 3BP5B 2A0LC 2VABB 5CGTA 2P8MA 4Z0BL 2XQBL 3STZA 3UXFA 1LVEA 4OLWL 2KZ1B 5EIIB 3WJJA 4NGHH 2E5EA 4NKIH 1QSFA 1E6JH 1R3IH 4LRIC 3P4LA 4S1SL 5HGGS 1OLLA 1IAIH 1XEDA 3UEZA 1DQQA 3TA3A 2VYRE 4ODSL 43C9B 1MCSA 4H8WH 4OD2A 2VLJD 4I48A 1J0ZA 3IXAA 3BN9D 1A7BA 5EPMA 3KPSA 5IV2B 5HHQA 1HH6B 1F00I 3HRZB 1EPFA 1T66D 4XVTL 3EJYD 3GZKA 3NACH 4OCSL 2P45B 1PDKA 4O2CB 3VFMB 3W9EB 1KIQB 3MNWB 4JFYA 3O0RH 4NCDA 2YXFA 2HKHH 4GLRI 4JRYD 5I9QB 3DTXB 1XGPA 3DI2B 2CRIA 4E42B 1EFXA 2FEDD 8FABB 5K9OA 3C87A 2EYSA 1UCBL 2GSGA 3D9AL 3RUGB 4P48A 3DIFB 2ARJB 1BVKA 4JY4A 2NXYB 4U1IA 3QIWC 3QZWB 3E2HC 4EDWL 4MQ7A 3ULVD 3RP1A 4NO2A 2CLRB 1MIMH 1I7ZB 4V2CB 3BPCB 1KJ2A 4ZTPL 2ZUSA 4PJCA 5JUEL 1KEMH 4KU1A 1I1AD 3OB8A 4H0IA 2X70A 1VHPA 5FYLD 1TZGL 4DK6A 3S3SA 5CEZH 4HS3A 2UVEA 2BHUA 1DBBL 3JV4A 4LASH 4WW2B 3VWKD 2DQFA 4U1JA 1AR1D 4BSWA 2AJXL 4CMMA 5AZEH 1QSEE 2EZ0C 4NN5C 2D9CA 3K2MC 5HHVH 4GG6B 4TYUA 2AGJH 5HHOE 3DROB 1FNEA 4K8RH 1NCBH 1NAMH 3CGTA 4OV5A 4B50A 4BSVB 3BZ4B 5ADPL 4HIIA 1QRNA 5FOJA 4JQXA 4UIKL 4H88L 5C08D 4QRSA 4K3JH 4L8CA 5E8NB 1U3HA 4R2GD 5HHMB 2GJZB 4NBZB 5F7WC 5ILTL 3GJFB 3V5HB 2VDPL 3WD5H 5D7IE 3BD5A 1YNKL 2WBWB 4PJ5E 4OQTH 1EEYB 2HJKA 3SE3C 2IPKA 3ECBA 4OJFL 2Y5EA 5JNYA 4OZIF 1FFOB 4ZG1A 4GRMA 4F33B 3QISA 2CLVB 5IFHH 3BKMH 1W0VA 5I19H 1T7VA 4Z95L 2A9MH 3LPGA 4H0HB 3QFJD 3ZTNH 2BOCA 3VXRA 1OT2A 3VWJA 4KQ3H 2A9NL 2YUWA 4NQUA 1JNNH 4CVXA 1DSFL 2IGFH 1ZLSL 5DWUH 5CJ5A 2PR4H 2EDNA 1WC7A 1ODAA 3BP6A 3EYOB 3QDGD 5EU5A 5I9QC 2W0LA 5MHSE 5CINH 1S5IL 1ZT1B 2WM0A 3O9WB 1AI1L 3ULUF 3C2AH 2C3GA 1VFUA 4Q97A 2F5AL 4HJGA 1NC4B 1NCCH 5IKCA 3OKKA 2NXYC 1IT9L 3BGMB 4NCC2 1CF8L 2DOCA 3IDUA 4XCEA 3V0WL 4ODBD 4I2XE 4RAUB 4C59B 1Z2KA 2VXUL 2P43B 3GSNL 3ME0A 5EO0B 4F15B 5HHXH 4WI3A 1OD7A 5I1GH 4EQ2A 1U95B 4PG9B 1CCZA 2R23A 5FF6B 3S36L 2DYPA 1QZ1A 4WW2C 5KS9F 3O6FB 5J1TC 2BVQB 5ETUA 5J57B 4MCZA 2HTKC 3QAZB 5I8CB 1QA9B 3T65A 4PJXE 4DKAA 1DLHB 5FHBL 1K3IA 4DVRL 3NIDE 5TE6H 3WFDL 3LV3B 5IVXB 5D6DC 1RUKL 1DN0B 4GFTB 3FHAA 1NPUA 5FA4B 5F3HB 4S2SA 3FTGB 1L0QA 5GXBB 1AO7A 5F44A 1IC4H 5JA8B 4TULH 3WKMH 3FT3B 5AWNL 1T5WA 4HS8L 3OB0H 4Y4KD 1CGSL 3KPOA 4Y4FD 5EIIA 3RBGA 1OWRM 3ILQD 3IDGB 2OJZH 1IVLA 4YHPA 5H35B 1LNUA 3CNKA 4ETYA 2VLJB 3RIFF 3SE9H 1C7SA 3EFDL 1A7QL 2P5ED 3ESVF 3MFGB 1YEHL 1ORSA 2IFFH 3ILPA 4WTZG 4Q9QL 4X9BA 3WUWA 3ARFB 2C4FU 4LP4A 4ZAKB 1AGBA 3DVIA 3O2WH 4UT6L 1C12B 1FFNA 2DAVA 2XY2A 3LZFL 5ICYB 1CD9B 5KG9B 3J7HA 3VFMA 3FAWA 1EHLL 1JNHA 1S9VB 3UTTA 3H7BA 3O9WC 4LLYA 3HC3H 4OF7A 3MRJB 4JN2B 4Z7WF 1IQWH 2R1YB 2YD5A 5GJTH 3DTXA 2FECL 1F8TL 1YJDH 1KT2A 1V05A 1LO5A 5IM7B 4ODHL 1YY9D 3GSRA 3RA7H 1JWUB 3V95A 4OCXL 4NWUH 3WHXB 2DN7A 1I1AB 5TGBA 3QZWA 3KYOA 2CLRA 1QBBA 5D1QD 5EUOE 1BBDL 5I0DA 3FT2A 3NA4A 4QRQA 4LVOB 4S1DC 5TE7L 4LKXB 3F7RA 5JLZA 4F2MA 3VGAB 3PHQB 3DURA 1D6EA 5ESAB 5FYKH 4EXKA 3ZTJH 1A1OA 2QTEA 3QAZC 5CUSL 3WMSA 3S96B 4LRNH 4H20L 3MOBL 5HYJE 2GFBB 4Z7NF 1A6ZA 5IOPB 2PN5A 2PCPB 5IIEA 1INEH 5C08B 3OAUL 3BP7A 4PRIA 1IARB 2DQHH 3DROA 4WNQB 2BJML 3BZ4A 4U6VH 3SDDA 4GBXC 3V4VH 5AD0A 1TDQA 3PE9A 4EN3D 5KSVB 4XPGL 2IH3A 3WO3B 3VXTA 3RU8L 1HSAB 1U8PB 4PJAB 5DJ6B 1CQKA 4ZNEA 2HH0L 4PYGA 3LSOA 2QR0A 4Z7OF 3O6LL 1BWWA 3I75B 3SE4A 2QKIB 5ICXB 5IB1B 5JMOC 4QHUA 1YN6B 1HZHL 2B4CL 3BI9X 5B39A 2BMKA 2VUOA 5C0AA 3BN9C 3GDBA 4FG6D 5D7JD 3ULVL 1FO0L 5GPRA 3W0WA 1T66C 3EZJB 5DXWA 4X6BA 3ARFC 5SV4A 5KN5A 1ZOXA 5FYLL 3ELAT 3JTSA 3QDGB 3DV6B 4NKDB 3NPSC 1MCPH 4JY5L 3VG0H 4O4YH 1ERNA 1RVFH 5I30L 1BD2E 2FEDC 4Y19E 5CJBA 4HGWA 4LSQH 5I74B 1H3UA 1IILE 2NPLX 3WNNA 1J9CT 5ELIA 1NCNA 1L0XA 4DOHB 3ARQA 1HOCA 3ULVC 5D8JL 4MA7H 2R0WH 5MEQB 5TE4L 1U8NB 3PIQB 1FG2B 1KCUH 4YGVA 2A83B 1CBVL 1I1AC 3I6GB 4GRWF 4KHXL 5C09A 3VI4F 1BFTA 5IB3B 4L29B 4KDVA 4OSUH 1CLOH 1MIEL 3Q6GL 4UQ2A 4QCIB 4ZSOA 1DUZB 4ESKA 5A2LH 1NGYB 1T21A 2JCCA 3AMLA 4IEFB 3L5XH 1VEPA 4KI5D 4LVOC 1QFWH 1AR1C 3WIFA 3FONB 3VGAC 4MX7B 1EDQA 5T3XE 2X7LB 2IAND 5BVJA 1I7UA 2YD4A 3V5KB 3TIEB 3EHBD 2VWEC 5FF6A 2P4AB 1G0DA 4WV1A 2D0GA 1QSZA 4G5ZH 3O6FA 2BVQA 4K23L 1CDGA 1U93B 4YDLB 3GMQA 4XVJL 4TNWK 2YKLL 4PB0H 5I8CA 5DRXB 1T6VN 2XWTA 3QO1A 2NX5E 2YD3A 2VLKE 1HHHA 4R2GC 4I18A 1FFPA 5DZLA 2DQGH 2FATH 5JXEA 2EE9A 4XPFH 1DLHA 3AXLA 4M7KH 4P9HH 5DUML 1JGDB 2P7TB 2VDNH 4HW6A 4JZNA 1E4WL 1UA6L 4N8VA 4JZOB 1MRFL 1I1CA 5AG9A 5KSBB 3T77B 4PJIB 4OGYH 1JZ2A 5CIPB 4LCCC 3PWLA 1SY6H 3D5OF 1ZGLP 2FWOB 3NFNA 4L9LA 1C8PA 2J88H 2P5EB 2OXHA 4CU6A 2JJVA 2Q76B 4LPCA 3UPCA 1BOYA 1CFNA 4OUOA 2AXGB 1IGCL 5FA3A 1JRHI 3OXSB 1CDYA 1UM5L 5CJ8A 1T0NA 3AROA 1B4JL 2DBLH 4OF8A 4PTUB 5TDNA 2D7TL 3ARDB 2KQNA 4O2FA 4WFHE 4ZAKA 2ESVE 3CZFB 4R4FH 5B3JE 5JORA 4MLIA 1C12A 1XFPA 1T0MA 1OP3H 2AI0H 1DEEB 1RMFL 1FN4A 5I74C 4PJHE 3NTCH 4RGNB 1AD9B 4DGVL 2R1XB 4R96B 5D6CB 5L6YH 2MNUA 2ZOLA 1MNUL 4BA8A 2HFFA 4GKZA 2R1YA 4WGVB 1JYXA 1EX0A 4MB5A 5DD5L 2GTZB 5D1QB 3VFNB 3ZO0A 3VJ6B 1JWUA 3BKJH 4E0RA 4LF3B 4TUOA 4J23A 4UT9L 1FBIH 2RCSH 4HZLA 4JO1H 1NUDA 1T80A 1KCRH 5HYSB 2QQNH 3VI3E 3ARXA 3W81A 2HYMA 4LIQL 1UGNA 4J8RB 1F4YL 2WBJA 3MLVL 2VTFA 1U8JA 2CR6A 1QG3A 5SWSA 3D3VD 4YDLC 2PW1B 4J3VA 3KS0J 1RD6A 3X14A 1KF9B 4LLMA 2DQCL 3WXVL 4L9DA 1DQTA 3D2UA 4LVEA 1VPOL 1G7PA 1PLGH 2XV6B 4XH2B 4V2BA 4YC2C 2UYLB 5E0QA 2APXA 1UXWA 2ED9A 3VA2C 1NLBH 1ZV5A 3VRLE 2ZG3A 3NCFB 4LPWA 4WU7B 1KC5H 2VZ1A 2R69L 1DBKH 3U9PL 5KSVA 1PYWB 1I7RA 4AG4H 3EO1B 4Y4KC 2N1KA 4YNYA 4Y4FC 1RJLA 2FHCA 2EH7H 1IAII 5FYKU 5DJ6A 3LB6C 1Z0MA 1EUTA 5D7JB 3AM8C 2EDWA 1J18A 3KPTA 4R26H 5IJKA 2C1OA 4WEMB 5D5MF 4GQ9L 4XB7A 3IJYB 1CE6B 2NR6D 3QCVH 3WBDA 5TF1H 5HPMA 1X4YA 5D7KE 4YDKL 2A6JA 4P2YA 2JK5B 3MXWH 1NMBH 5TDPB 5DLML 3ARDC 3P9WB 4JFPA 1QSED 1FL6B 1W0WA 2C5DC 3CVHL 5E56A 4F7EA 3MXVL 3L3JB 4Q9BA 1ZWIA 5IBUG 1VKXB 3NAAL 4TUKL 4DVBA 5IT2H 2J1KA 3BOVA 2CXGA 1YY9C 5DJ8A 4IIQB 3D6GA 5IB5B 1GHFL 5IEKA 1F3JA 2VXSL 5E94B 2O61B 4GAYB 3VRJB 5D1QC 5MEQA 5C6PB 3LMJL 3DX8A 1U8NA 4JFDA 5CEYA 4XCYB 3TYFB 1A6WL 4KVCH 4M43H 1BPVA 4QRPB 3BMVA 4X6DA 1I3GL 2O5ZH 2VDQH 4JDTL 4TQEH 3V4UH 3MNZB 3ZE0F 4FQQB 3W9DB 2E7CA 4HMCA 4NBXB 5DUBB 5BRZE 1NGYA 2WSKA 4I3SL 4NO0D 4J4PA 3FQWA 1AQKL 4HHAA 4H25A 1JPFB 3LS5H 2X7LA 3MRPB 3T09A 5JW5A 2XTJB 4FNLH 1J10A 3QYCA 1HKLL 1M7DB 1CDBA 1B9ZA 3W5NA 5DGQA 1U93A 5JPNA 3D18A 2V9TA 3U2SA 1ZEAH 4EN3C 5B3JF 3CFIC 1GZPA 2YPLA 3IDJB 5E8PA 2ADJB 5D7SH 5DJXA 1UKQA 2ADIB 1KJ2H 3ARSA 4PJHF 4N9OB 5BOZG 1AQDB 4HK0A 4E41A 3RZCA 5IHZA 2P7TA 1L7IL 1NFDB 5E2UL 1BOGB 2VN7A 1JV5B 2WP3T 2PYEA 3WLWD 3ALXA 5JIIA 4G3YH 3VD9A 3JV6B 5JOFA 5D7JC 2FJFB 4G8IA 5CIPA 4HUXB 4FQXD 4OB5L 1TNMA 2UVFA 2HG5B 4MA8L 3PWNB 4XZUA 1OW0C 4LCWE 4G7YH 5KVGH 5SX4H 3SE8H 3NZ8B 3QI9A 3C5JB 4P3DB 4YDIH 3LRSB 2ATPB 2IH1B 3VI3F 5JXAL 2YEZB 1N5AB 3TWCH 3OXSA 2ZSWB 5FHAL 3QIUD 2CXKA 3P30L 2AEPL 2A73B 4QEGA 2J12B 1ZVSA 3L3OB 4F7TB 3G6DL 4F58L 3F7PC 3IFLL 1CVSC 3MV9B 4EKXA 4NUGH 1PKQA 2IQ9L 3GJFK 3B9KD 4QNPE 4JLRB 4EVNA 4BFGA 4LLWA 1DEEA 3LVEA 1Q9OA 2Y6SC 1NAKL 3QIBB 5JQ6L 4YHIB 1NLDH 5EDXA 1K8IB 1QFUL 4Z76A 2H45A 2XWBA 2Q86A 4IIQC 4PB9H 4YUEL 1YDPB 3TV3H 1UQSB 2QHRL 3VRLF 4MHHG 5GZND 1WWBX 1TZIB 5I2IA 3S37L 3R4DA 3QCUH 5EZOH 4YO0B 4GKNB 1KOAA 2GTZA 3PXJA 4KI5C 4L8BA 1RK0B 2NY1B 3VJ6A 4WW1A 2BSED 2X4SA 1G7IB 4N0YL 3EHBC 1UENA 2ICCA 1P4BL 4Z7VF 4GKSA 4HWEH 1JN6B 1DBJL 2XKUA 1Q0XH 2F5BH 3O3UN 4TSAL 1FNGB 2D03L 5F88B 5GGTA 4R0LB 2PW1A 2JB6A 4HZAA 1L0YA 2WNGA 5HGHA 4GSDH 4OF3A 3BO8A 2CKBL 4WEBL 4WWID 4KK9D 4ZD3L 3MRBB 4KAQH 1AY1H 1GGBL 3HPJB 4YX2L 2AEQH 3I85A 4XAKD 4TVPE 4WU7A 5FKAB 3RVUD 3RY6C 3U48A 5D71L 5E4IA 1TFHA 1J0JA 5EWIH 3A6CH 3JUYA 4YXHL 2I9LA 2JLLA 2XN9D 4K7PL 3LKOB 1LE5B 1I3RB 3OTTA 1DCLA 1RZKH 3H3PH 1MHHA 1IGJB 4OZGF 4WRLA 5HI4D 2GUOB 1G6VK 4X98A 3S34H 2GW5A 4L8SA 4QWWD 5EZIH 3C9NB 3FFCA 5FCUH 1YQVL 4NN7B 1QSEB 4AEHL 3T0VA 4N9GA 5FUOL 2JK5A 4QXWA 5HHOB 5GRZA 2AV1B 4JFFE 1I8IB 4MNQE 4X7SL 4ZUUB 1ZT7A 3RWIB 4WU5A 5ITFB 2BNQA 1ONQB 4UU9B 1U8HA 5I8EB 2W0PA 1CFTB 1JRHL 4RMQA 1FFQA 4FA8A 4I4WB 2X41A 1IL1B 4MYWB 3QIBC 1GPOL 4YXLH 4Z8FL 5GRYA 3R1GL 1SJHA 1FVEA 5D7IB 1K6QL 2VISB 5IB2B 3BKYH 5MEOB 4PJ5B 5ICZB 2MTPA 1VB9A 3MLPA 4F57L 3CJJA 1Z0NA 2AXHA 4LDLB 1U8IB 1FSKB 1YEEL 2NY1C 5IGXL 4BFIA 4NO0B 1IGMH 3TYFA 4LSDA 4BSJA 2X4TB 4MA3A 2MKWA 4YWGH 3MNZA 2DQEL 4M5ZH 4GRLD 1P6AB 3MLXL 25C8H 1JPGA 1MFAL 2EC8A 4YHOL 1MUJA 4XNMA 3QDME 4G8EB 1MF2H 1I1FB 1BFVL 3BUYB 3PWVB 4ODUB 3UBXB 4Z7UF 2V9QA 1D9KA 4M7LH 3MRPA 4R0LC 5DD1H 5BS0D 5BOPA 4UTAH 4XC1H 2Y4SA 2VZ3A 3V2AR 4WY7H 4PJ8D 1BD2D 3IDYB 4Y19D 3DYOA 3QULB 5F1NA 3LKSB 3DXAE 2Z93B 1FIGH 4X4YB 1RAMA 1GGTA 2F74B 4PREB 4JRXE 5GGQH 5LWYH 1A7PH 3EYVB 2ADIA 4XMPL 5K9QG 1V7NL 4JVUA 4KROD 1I9IL 1YECH 4UDUB 1N3NB 5T1LD 4I2XB 1DQMH 4OZIA 5C86A 1MCRA 1FH5H 4UDTA 3QEUA 3U36B 1A9BA 2AS5M 1FL5B 2NR6C 2H32A 4O2EB 2WBKA 3BGAA 1D7FA 3N85L 4QO1A 4BH7A 3QP3A 4X5LA 4F9LA 3QIUB 4FFYL 3TM6A 3P0YH 5I73B 1HEZA 1FRGH 2CIIB 4NN7C 5I16A 4PJXB 2OYPA 1O7SA 3FQUB 1PG7H 4PRHE 3P3YA 2YEZA 3B9KB 1D5MA 2DJ4A 1T03H 2NW3A 2ICWA 1MAMH 3SCMA 2O93L 3CDGA 4KJQD 3G6AB 4RZCA 2E9WA 1ZLVH 4U6YB 2FIKB 2WLYA 3EJJX 2ZSVB 3I50L 1MY5A 4JLRA 1YMHA 3NCJH 4JG0L 4U1MB 4K7PY 3SO5A 3HZVB 1OQXA 2KQMA 4PRPE 3ARBB 4N68A 2EIEA 4Q58C 1G9MC 1QFWI 3DX6A 4LSPL 1FSKC 1J1OL 2GAZA 4O5LH 4MJ5B 4Y2DA 1UH2A 3ARZA 5DZNA 5E8EA 5L8LB 2X9WA 5DMIL 1XGUB 2MWCA 2H1PH 4KKBD 4W6XB 5EBGA 5GZOD 4MDIA