4F7EB

Crystal structure of bovine cd1d with bound c16:0-alpha-galactosyl ceramide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
b'IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD1D antigen, d polypeptide
publication title Crystal Structures of Bovine CD1d Reveal Altered αGalCer Presentation and a Restricted A' Pocket Unable to Bind Long-Chain Glycolipids.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f7eB00
5DZOA 1TCRA 3H9HB 3OR6B 1BECA 4O9HL 5DSCA 1QEWB 1TVBB 4KKLC 3MRDB 2V2WA 1ZHBA 2OR7A 4JFQA 1GOHA 1MI5D 2XA8L 2IH3A 3IDJA 4UINL 5T5NG 4WWID 1DBBH 5GQBA 4C58B 3QQ9C 5HHOA 3CFDA 1F4WH 5C0JB 2NY4B 1WBZA 2VXQL 4B7LA 3TBVA 2DICA 1F3RB 4F7CB 1B4JL 3UJTL 3TNNA 5IOPA 1ZSDA 2R1YA 3IF1A 3AGVA 5D2LE 3MBXL 3V4VH 5KTEH 5JPMB 4HIEA 2QLVB 5DJ6A 2Q86A 5BJTB 1YMHB 1UWXH 4PB9H 2XN9E 3BP5B 4BZ1L 3QXTA 3ROLA 4HIIA 4IJ3C 2P5EB 4I18C 2PXYC 4MD0A 4PP2B 4CVXA 4K7PX 3KJ6L 4BH7A 5IM7A 3V0WH 5BZWA 1ZEAL 4PJFB 2EYRB 4QRSA 2HAZA 1JYWA 3MGOA 4LCWE 1G9EA 4F33A 2P46B 2E7LA 5CHNA 5INCB 4CGTA 2BRRH 4H1LH 2VXSL 1G7IB 3L1OL 5KVEH 4LSQL 4X4XA 5HPMB 6FABH 3ZE0F 3PGFH 5H37H 3RVVD 1HH6B 5I15L 9CGTA 3O2DA 3I50H 1MLCA 1MCBA 3PJSA 4X80H 5DJDB 4JFDA 3MRQB 4OCSH 4JO3H 3TZVC 2YPVH 1EJOH 1ZLWH 1TQCB 1S7WA 1WFOA 1LQSR 5KSBB 5DJ8B 3R06B 2VDPH 1U42A 5EPMB 2LQRA 4JY4A 3CGTA 4XCFH 4M9PA 1HWHB 1K8IA 1ND0B 3IDMA 3CFCL 3KLHD 1W8OA 2JCCF 3HC3L 1D9KD 2OTPA 1RJZB 4H0IA 1N5AB 1AR2A 3LY6A 2OI9C 3GRWA 1DQDL 2F19H 5E8OB 4NGHL 4OLVH 2Y36H 4O02L 3G04A 5ETUA 2X44D 4OLWL 2DQIL 1SJEA 3VMPA 4FQLL 5EIVA 1GC1L 2H9GB 3ULSA 5KS9E 4ACPA 1G7PB 2UWEB 3MUJA 3KWWA 3QR2A 3RY6C 5CUSH 3QEUB 3MX0A 2WBJA 2JB6B 2EDWA 4LRIA 3VXRD 3KPSD 4OZFA 3PDDA 4NBXB 3O6FA 4R8WL 2NY0B 4KKBD 5GRUH 1BIHA 3G5VB 4OCXL 1TZHB 1AC6A 2N56A 3DVFA 4L4TD 1CDCA 1Q9KA 4KRLB 4YHZL 1H3PH 2M8XA 4NN6C 2IF7A 4RWYH 4DUVA 2FR4A 2N4IA 4L9LB 4OUUB 4R0LA 3TNMB 4BFIA 5E56A 3BPCA 4IOIA 1S9WA 4HULB 2AGJH 1KB5L 3KYKH 1A1NA 5KVGL 1MCJA 3PL6C 5CZXC 1QLFA 4DVRH 3SGDI 3GI8L 3N9GH 5J13C 3GUTA 4JN1H 3HE6D 1UCBH 3OB0H 5E95B 4Z76B 3MO1A 1L0XA 4HW6A 4GW1B 3HAEH 1URLA 4KU1A 4OTXL 2EXWC 2ZPKL 1YJDL 3QG7L 1GZQA 1FPTH 1LO5B 3REVB 5I1IH 3QNZA 1JF1B 1VPOH 5FA3A 4XPTH 3WXVL 4QF1B 4NKOA 5IHZB 5L6YH 3MRRA 1RJLA 4KRNA 2DD8L 4PJCA 4W81A 1RZFL 5C0BA 1XF5A 1TIUA 2D4DA 3EFDH 2J2ZA 3D0LB 1RFDL 3L7FA 4R96B 3S7GA 5JA8B 1FORL 1MIML 4NZRH 3QCVL 1CD0A 5E99L 4EI5D 3FQTB 4IMKC 3K7UA 2H2PC 4HIHB 1RZIA 3V5DB 2IFGA 3AM8A 1BJ1H 3TBTB 2BC4B 3SJVE 4LVHC 3O3BA 1BOGA 1MFCH 3UTPD 3UTSB 2FJGB 5EN2A 1QFOA 25C8H 4LL9A 4EXPX 3CDGB 4Z0XA 4JGUA 5CBAA 4NSKA 3WSQH 5HXMA 2B1AH 4ENEC 5J6HA 5IB1B 4FFWC 2ZG2A 3MCKA 3P11H 1EH9A 1BIIB 1B9ZA 1OAUH 3V8CA 4S1RH 3HG1D 3MTRA 4PJXF 5C8JB 2R9HD 1D5ZA 1FYTE 4M8QB 4TRPL 4UT7H 1J12A 1OTUC 2YN3A 3BRDA 3UO1H 3EJZC 4L8DA 2GSIA 3MA7A 5D1ZB 3RVUD 3QCUH 5BS0A 1J1OL 1FZMB 2JJVA 4CVUA 3ZKND 3WXWL 5HGBA 3SQOH 3IGAA 5CS7A 3DTXB 3LKQA 4HS8L 2PW1A 2VL4A 2DKUA 3UTTE 4OD3H 2E9JA 3GKWL 4TQEL 3MJ9A 4Q58C 5C92A 4NHCL 3DV4B 4Z7QE 5HHQA 4XCCL 1QR1A 5GRXG 3MMEA 5E2UH 2XXMB 4P57B 3DX7A 1MH5A 4J7RA 2A73B 1FL3A 3EO9L 5D7LB 4FABL 1DFBH 4NRZB 5DRXB 2MKWA 3EIFA 3DMMD 3L3HB 4R6UA 2R1XB 2YZ8A 4IJ3B 3KAAA 3FCTB 2Y07H 5FYJD 4K2UL 4I18B 2PXYB 2GITA 5HYSB 1T89A 3B9KD 4I3RH 3CZFA 4BKLA 1N0XH 4CMHB 4NRXA 3JTSA 1P6FA 3I9GH 4J4PA 4DTGH 4P4KC 5I2IB 3WL9A 4X9HA 4M5ZH 1F6AB 4M6AA 3BZFA 2HJLA 2HLFC 4M03A 4OLUH 2UZIH 1QFUH 3ZHKA 5EU4A 5IB3A 5JHLH 3STLB 3TZVB 3VMOA 4RBPH 1U92A 2F53E 3NABL 4XC1L 3ARSA 3TJHC 3TGXA 3TO4A 2HRPH 3P73B 3PWVB 4PTUA 1TNNA 3GSRB 1HSAB 4PRHD 1AQDA 2W0LA 1H3UA 2OI9B 3MLZH 1XH3A 4WU5A 4KC3B 5IBTL 4Z7OE 4BUHA 4YXHL 3GGWA 1WFTA 3MRBA 3B5TA 3F5WA 1QRNA 5IB2B 3LB6D 3CH1A 3X12A 5IR1B 2ICWA 4LCIL 3CFBA 1U8PA 5I1AA 1WT5C 3BKCH 2XY2A 5C09D 5T1KD 1GH7A 4KZDH 2D9QB 2ARJB 5FUOL 4FQIH 4G6JH 2Q6WB 3L3JB 3VFTA 1QSED 5ENWA 2B20A 2PYED 1ES0B 3O4LE 5KBNC 3O8XD 2F8VA 4ZNCD 3D5OF 3PGDA 4NUJA 5DFVC 1HCFX 3MACH 1EXUA 3MCLH 4NN6B 3MGAA 5FGBA 5J1AB 4Z0BL 4F9LC 3O9WD 2GK2A 4PREB 5I18L 3QUML 4PGDB 1FH5L 2WWMD 3SDCC 3TA3A 3QIWD 4U1JB 5J1SC 5CKGA 1RVFH 3N1FC 3VFSB 2IANA 3PL6B 1F8TH 3EUUA 4GRWB 4WENB 1UENA 4UQ3B 5J13B 5F21B 4U6XA 3REWA 3INUL 3HUJF 3EO0A 1MVFA 5E9DD 4N0UE 2XTJD 4D0BA 1RZ8B 3JUZA 4LPTA 4WTXA 3RL2A 3HB3D 5DMJB 4P59L 5ACZA 3OKLA 3F7PC 4O2FA 3OF6D 1I3UA 4M7KL 4EQ3A 3WD5H 5SWQB 4JQXC 1DUYB 5EORL 3SDAA 3QZWG 5HGHB 3ARFC 3P30H 3QEGH 5EC2B 2XQYG 2UUDK 1FZJB 1AXIB 4HKJA 3CXHK 3GSNL 1CQKA 1GOGA 1KN2H 4C4KT 4KGJA 4YWGL 4YHIA 1RI8A 1WCBB 2XPGB 3QUYA 4RGOH 2V7NA 4PV8A 5KJRL 1IGTB 4K3EL 5MENB 4LVHB 5EFIB 5FOBB 1XCQB 3WDHA 4QXTB 4D2NA 5FHAL 4PLJD 2EIDA 3LEYH 5T3XH 1BEYH 5GGQH 1LP9F 4GAGH 3WHE1 4YHMH 1XCTB 3ARGC 1R5WB 4Q9RL 3WHE0 2D7TH 3HR5B 2IH1B 1PEZA 3LDBC 2Z0BA 4IRSD 2EDEA 3K2UH 5T1DL 2EH8L 2Z92B 4MQXC 4H25B 3D25B 5EU6B 3QG6A 5EU5A 5DQJA 4PJGF 4ZTOL 2J8UF 2VXTL 1HHGB 1ORSB 4BZ2L 2NY2C 5IBLC 2EXYD 5D7SH 4OD1H 2DLHA 1NC2B 1SMOA 2MTPA 3QPQD 1A2YA 4JN2A 2HLAB 5LBSH 3T0EC 1YEFH 5ID0B 3IAQA 5HYJB 1KPRB 2NY6D 3VWJD 4DQOH 2BNQB 4YDLC 5E6IA 3PV6B 4G6ML 3I3EA 1BX2A 4CDGC 3IAPA 3RI5F 2VDNH 1RZJH 4CNIB 1NBYA 2CRZA 2J88L 5CMAB 1D5IL 4Y4FC 1OTTC 2CO7B 1XIWA 2W38A 3MRGA 3AUVA 2Q20A 2V7HB 4LLMB 4WFGE 3O81A 1JZ5A 1DQML 2VLKB 3Q1SL 3R0MA 2APFA 5EBWB 3QULB 1XT5A 2VDMH 4EIGB 1CICA 4NO2B 4X9BA 4QT5B 3GMRB 4WGVB 5DMGC 2I9LA 2IFFL 5E8PB 4LQFL 4NO5A 5I8KH 5EIIB 3KDMB 2C3VA 4M1DH 5DJXB 3O6KH 3V6ZB 4ERSH 1MNUH 5GZOD 2YUWA 1DLHA 1AHWA 2R23A 3RU8L 5EO1B 4P4KB 2L4OA 3MOAH 4FXGB 2AJZA 4PJXA 5J9PA 4KJPC 2FWOA 4QOKE 4HWZA 4UMGA 3O3DA 4XVTH 1BD2A 1IM3A 1UM5H 5DZNA 4DCQA 1CZ8L 3QRGL 2EH7L 1JWMB 1MREL 4QXGH 5DQDL 4HUXB 1CL7I 1NUNB 4Z5RA 5I30H 3A6CH 3ORJA 4R3SB 1KJ3L 1C5CH 4ZSOA 3EYSL 1T2QH 4MNQE 3OJDA 1LEIA 4HUVA 4HCRL 3UYOD 1CU4H 3ZKMC 3TN0D 3RGVD 1PG7X 4JM2C 4MA7H 3ROOB 4NQDB 4DKFH 4I3SL 3QHFL 4JM4H 1ZLUH 5AZEL 2A6DB 2PTVA 2G5RA 3K3QA 5C9KA 1OPGL 5E8NB 2NY7H 1LEGB 3QPXH 2EYTA 4PGZA 5C07D 5C7XL 5JXEA 4LIQH 1DLFL 4YNYA 1TZIA 5E1AA 4MS8C 2J1KA 1HQRB 1B0GB 2WIIA 3FO2A 1OSZA 1MJ7H 1DBMH 2ORBH 4ISVB 1K4DA 4NQXA 5E7FA 3BPOC 1ZK9A 1T03H 4JG1H 5B39G 1AGFA 1I1AC 1KPUB 3WFBL 3QIBA 4LNRA 3JWDL 4JFHE 3SDCB 1I3GH 1HHIA 3CVHB 1T1YB 4ODTL 1TZGH 1FO0H 4UIKL 3ECBB 4L29B 2OMNA 4P5TD 2YD2A 1RY7B 1W0YT 4MAYC 5SWZB 3V0AC 1ZT4A 2AEIT 4K3DL 3AVEA 1A3LL 5CILH 3S37H 2FB4H 1H9VA 1JPFB 3HPJB 1MHCA 4PJ8D 4H88H 2PO6A 4JVWA 4E5XB 2B8OT 3QWRD 1VFBA 3SO5A 4P2OC 1BBDL 5GS0C 2I07A 4CMMB 4GT7A 5GRVK 5KVDL 4N0CC 1P2CB 4K94C 1M6OB 4U6YB 3O3EA 4WJ5A 1UB5B 3ARFB 5ALCH 1SY6L 1JWSB 3I6KB 3B6SA 1V3JA 2B0SL 2FATL 4WU7A 4ODUA 1RHFA 4GLRI 2R2BB 3F62A 4X7TB 1HZHL 4NQEE 2CDEA 5IHLB 4JFED 1PKQE 5DGRA 2NX5D 4RRPG 4I48B 3E3QE 1S9YB 1OP3K 3QEQD 3W9EA 3FJTA 2C7UB 2D0GA 5DJYB 3ARGB 4QTIL 2I9TB 4WDIA 3TFKC 1N64L 4TUKH 1CF8H 3MRCA 2F74B 2LU4A 1ZGLA 2DLEA 5H35A 2V2TA 3LDBB 5ACLA 5FDWB 4NWTH 4OZIE 5CEYB 2ERJB 3A6BH 1KEMH 1G84A 3LKOA 4OSUL 4OF0A 3ILPB 3H42L 1C5BH 4I77H 5T3ZH 3U46A 4WUUD 4NP4L 3PWPE 5ESVA 2P5WE 1BQLL 3HUJA 4CN6A 3QDGD 2NY2B 3WUWA 1A7RH 2WW8A 4HT1L 4J2XA 5F7NC 4Y4KD 5HHME 3T0EB 3T65B 2Y6SD 1MJJB 4EZMA 4PYHA 4LCCB 4LNVA 4YDLB 4RNRA 1XGPB 3VXTA 2P24B 4PLOB 5IW6B 4Y2DC 2HT3C 2NW2A 3TO2A 4Y4FB 3FQXB 4DN4L 3PV7A 4MJIE 4P4RA 2R0ZH 3B2VH 4HWUA 4Q0XH 4NZTH 2I5YH 1KLGB 3NZ8B 2AJYH 2BNRA 4JZJA 1SEQH 1QFHA 2X89D 4UBDD 5J11C 4XC3L 2EO1A 5A40E 1U8HB 1EK3A 5EA0H 3WFHA 4Y5VA 2H2SD 4YUEH 4LGPB 3DSFL 1LP9A 4HXAH 2OK0H 3IU3B 2EDYA 2CLRA 3VGGA 4KKNA 1H8OA 5SWSD 5JIPA 2HJFB 2ZNXA 5I9QC 3MUGA 4KAQL 4D94A 1YQVL 4Y88A 2X4QB 4N1CA 5FDYA 5F70A 2E27H 5GIRA 4IS6B 3ULVD 3QB7C 2OR9H 4EVNB 5DWUL 4FQCH 1G6RB 1IILE 1OGAE 2IQ9H 4F7PB 1AIFB 1R3JB 4MXQD 2APXA 4PJGA 2J8UA 1NC4B 5E2TL 2Y23A 2WLZA 1UWGH 1J1XH 2CLVB 4PJIB 1B2WL 2EECA 4HS3B 1U95A 1T2JA 1V7ML 4OF7A 4P3CH 3CVHH 1WZLA 1UQSA 3WIIH 4P3WA 2EIEA 5L2KA 3BP4B 3OJ2C 1CVSC 2R4SL 3L9RA 4NKIH 4FQ1L 3D85D 1ZA6B 4NCDA 3O2DL 2Q3AA 5FYKL 43C9B 4JM2B 1GC1C 3G5ZB 4I0PA 4YDJB 1HNGA 3ILQD 5HI3D 1IEBA 4RSVA 1CDHA 2EDTA 4J3UA 4PJ7B 1FFPB 4MA8L 1RUPL 4ZUUA 4F2MA 3HMXL 5I66B 5D70L 1FLRH 1II4E 5FGCB 2VZ1A 5DS8A 3MRMB 4BSVA 4ZXBC 2FHBA 1LILA 2OZ4H 1VENA 2UVEA 4D9QE 1K3ZA 2CDFA 1BWWA 3DUUA 5GZND 2QSCL 3OAYK 3BPOB 3D3VA 3GRWL 3EW3B 2JE8A 3MZGB 3MYZA 1I1AB 4PRIE 2H3NA 4MNGB 1CS6A 2VLRA 3W39A 4K71C 5CLWA 4K7FA 2P8MB 1T66D 3GMNA 4DGYL 4WW2C 4X99A 4JVPA 2NY4D 2HH0L 1H8NA 1YMMA 3BO8B 5IW3A 3CPLB 5D6DC 1T3FA 4Y16C 1YJDC 1C12A 5EU7C 3QDMD 1JGVL 3X14B 3NIGE 4MAYB 3VH8G 1S5HA 2ITDB 3VXQB 4OFDA 3UC0H 4X0KB 4OI8A 4K8RL 2BDNL 1IQWH 1CFQB 5I17B 4JR9L 4U1IA 3VFOA 4EBQL 1PDKA 5GRWA 3VFVA 3PWLB 1LNUA 2P5ED 2XKNA 5FKPB 1ZTXL 2B5IC 2QBWA 2FX9H 4JFFA 4P2OB 2KZ1B 3G6JB 3ARPA 3ARVA 3I2CL 4G8EB 3DGGA 3FT3B 5K93A 2MNUA 3FB7B 4XPBH 4CW1B 4P23C 2LV4A 4PJ5E 4RX4A 1T22A 1FL6A 3PXHA 1ZHKB 4QRUB 1FZKA 1KEGH 2B1HH 4EOWH 3SJVB 4M3KB 1U8JA 2ATPA 4WTWA 3HFML 4QRRE 3S35H 1P6AB 4Y8DC 4TTDD 1K5NB 3RX5A 5I1DA 1OM3H 1YYLH 1VERA 2J5LC 1HHKA 1MJ8L 4OT1H 4POUB 4Y0GA 4XPFL 4BELD 5KG9A 4TNWF 4AEIL 5DEGA 3ALPA 2AJXL 4G8GA 3H7LA 2Z31A 4H0GA 3CSBA 1MEXH 3H2WA 4M1GH 2FH6A 3O2WL 1XZ0A 5CJOH 4L3AA 2XQBH 4HEPG 1CDUA 3HZKB 3N50A 4CAGA 3U9UA 1RQ5A 4JDTH 4NC1C 4AIZB 5E7BA 5IGXL 4OB5H 1OCWL 1A7NL 4QXUH 3IXAB 1LO0L 4AM0B 4JKWA 1UB6B 1NMCC 2FGZA 3SE4A 2IBGA 2HJKB 3RWJA 1LGVA 2G9HB 1G6RH 1J8KA 1FGNL 1U8KA 4U6HA 4R26L 5K9OA 3IFNL 4LMQE 3FFCA 4OM0L 5HDBF 1XGUB 4K7PL 1RULL 3MFFA 2ATKB 1NAMH 2NY0D 3QJHB 4NRYA 5D7JB 4DGIH 1LE5A 1ZGLM 1A6ZA 4XGZB 4LLWA 1HE7A 4NKQB 3NCBB 3T0WA 2WV3A 1OARH 3MREB 1F90L 1PG7W 2RR3A 1H3XA 1MFBL 3H7BA 3KPOA 2VQ1B 2AP2A 3QQ4B 4TSAL 5HHOE 3WLWD 4J1UB 1KIQB 3TJEL 4LGSB 3T0XA 3VFWA 5T33H 3MOBL 4L3EA 1I9RH 1MFAL 1X4XA 4O5LL 4XXCA 3MJ9L 5J8OA 5I9QB 2C3HA 5LCVH 1ORQA 2VDKH 1B0WA 4DGVL 3GHBH 2A83B 5BRZA 1PLGL 4HV8B 3EFFA 4ZFOB 1QQDA 1A64A 4XI5D 1WGOA 5DD0H 3MJ7A 1A3RH 4E0RB 1HCVA 2C1PA 2HMID 3O6LH 3RWCB 4KKCD 3KR3L 5J06A 5CEXA 3VCLA 2Z4QB 4G6KL 4PJHF 1I1YB 4CU8A 4ZUWB 4JO1H 4D9LL 3PQYA 2FYYA 4R7NB 3VI4F 3UTSD 5FYKE 2ESVB 3KPRB 1MWAB 5E03A 4Z77B 4OD2A 4ODSL 1BZQK 2E6PA 3MCG1 4FFZH 3EDJA 3TV3L 1TETH 4ZOCA 4ZTPH 4HZLB 3QJFA 3T3PE 5L7XH 4R90H 3KPNA 1IGIH 4Z7WF 1T0MB 1WLHA 4D0DB 3MQIA 3VG9C 3TVMA 4LHUA 4XH2A 1Q94B 4ZXBB 2BZDA 4YDVA 1YNLL 3L3DA 5LGJA 2NXYC 1N5YL 1PX3A 4L1DA 4AENB 2VJXA 2V9RA 3CFJA 1E6JH 4HGWB 4KMQA 1KB5B 5DD5L 4MQ7B 3BW9A 2ZSVB 1OW0C 3B2UC 2WM0A 3QQ9D 5GRYA 4YHNB 4K71B 2AEQL 2OTUA 3H3PH 4WW2B 5C0AB 4DKEH 2VERN 1VESA 2IAMC 3ELAT 4MXVE 5ICZA 2W65A 3QFJA 4XBPB 4ZFFA 1E28B 1KCUH 1RZGB 4Y16B 2VLJE 1CD1A 2NQCA 5C2BH 5EO9A 1INQB 3CLEH 3HC4L 4LASL 5DMKB 5T3XD 5D7LD 4LLUA 4XHJC 4ELME 4O9HH 3SGEI 3IB4A 1YUHA 3QZWB 1DE4B 2XA8H 2PXYD 3GB7B 3MV9B 4UINH 5AUMB 2B5IB 3PABB 2OM5A 4FMKA 4LDEB 3STBA 4KDTC 1RUQL 2J8OA 4HJGA 4YE4L 4P23B 1EO8L 2VXQH 1AO7B 1B4JH 3UJTH 4OBRA 5D2NB 4ZUVA 1G7HB 3MBXH 3EYFA 5C0EA 4M93C 2DLGA 2VLMD 4GAYA 2DL9A 1WZKA 2QEJA 1WV7T 1S7QA 4BZ1H 2YPKB 1QNZL 4QHLA 3TZVD 1IEHA 4OF6A 1MCNA 2J5LB 1IGYA 4X6DE 3KJ6H 2GCYA 1EVTC 1ZEAH 4PJCE 4YHOL 2OQJB 5C0BE 3DVNA 2EIZB 4U7KA 2J8HA 2ZKHL 2VXSH 2HFGL 5IMMA 1NFDB 3L1OH 1HKLL 4LSQH 1IGJA 3IKCB 4CN4A 3TF7C 3MA9L 3VXOA 1UXSB 3TEUA 1DQLL 2DQHL 3KLSA 5I15H 4HSQA 5F3HA 1AKJA 5E0QA 3NCJL 1GHFL 2YMXL 2W60B 3P9LB 4Z7UE 4B50A 5EO0B 2CUMA 1U3YA 4XNYL 4U3XA 3OAUL 4NNXB 4JQVA 3QUKB 1KTLA 3CCHA 1MHPL 3MJ6A 4LSUH 2VDQL 4ZUSA 3MJ8B 1R3IL 2AJ3A 3CFCH 2WUCL 4NBYB 1FN4B 2X2YA 4EEEA 5HHNB 3SDXE 3SOBL 5F7MC 2AI0H 3HC3H 4IRJD 1JZ4A 1NCTA 5FF6A 1DQDH 4NGHH 1DQJA 3T1FA 2X42A 3RFZC 3BXNB 4HPYL 1Q9LA 3ES6B 2BVQB 4O02H 4ZUTA 2OTWA 5E2VL 4OLWH 3S3PA 2DQIH 3WS3A 1JNHB 5ANME 2YPLA 4FQLH 5ISZA 3LN4A 3ULUL 3PL6D 5CZXD 5FV1L 4S0SD 1GC1H 5IMOA 2OBGA 4PJ9B 3I6GA 3TH2T 4N90D 4YO0B 4F9PC 4BFGA 1U6AL 1JHTA 2IQAA 3CC5B 2EXWD 2GY5A 4JDVB 1N59A 4R8WH 1I1RA 3QWOA 2AK4A 1C5DA 1EHNA 4Y1AE 5FK9B 5IQ9B 4OCXH 5TF0A 3NIDE 1W0WA 1Z9LA 2XFXA 1UWXK 1W0VB 3RZCC 1TITA 4YBQC 1NL0L 5AYQA 3FKUS 1TJIL 4YHZH 3IDNB 5CCKL 3LH2L 1UT9A 2QQNL 2YSSA 5J6GB 4GKNB 4TN9A 4X8XA 1KB5H 1M7DA 5KVGH 3V5HB 2A9NL 4EDXB 2X4TB 3GI8H 2VR4A 4ZPVA 4P2RB 1A1MA 1QD0A 1FNHA 4GO6B 4PV9B 5HVGB 4PLKC 4OTXH 5MEND 3HNTL 2ZPKH 1YJDH 3QG7H 4M62L 3U9PL 5C0CA 3WV0A 3S97C 1U8NA 1RZKL 3EOAB 4JFYB 5BOZG 1VADB 3WXVH 3V7AG 4FFWD 3L5XL 5GJSL 5HYQA 4GG6F 1HHHA 2GQHA 2EZ0C 1R5VA 2AXGA 2DD8H 3DRTB 5IVNA 4KMTL 4XCNA 1RZFH 3VWKC 4DWHA 2FECI 5ITBL 4LDLB 15C8L 1A6TB 4Z18A 5DC0A 1WFUA 1RFDH 2ZOLA 3VG9B 4UNTA 1X9QA 1FORH 1MIMH 3QCVH 1YNKL 3EJZD 1KBGL 3H0TB 4YHPA 5DHYB 5E99H 2HTLC 5B39B 3FMGL 5J3HC 4YGAB 3HE7C 3VE0A 1QA9A 2IPKB 3OKEA 2NXYB 1P7QA 3W5NA 3JWDC 1H5BA 1NC2D 1PY4A 3WUZA 2MQ0A 3RWFB 5C2UB 3KYMA 1QRNE 5HYJD 1KB9J 1ZS8B 4QTHA 5IF0A 4G42B 2F5AL 4E41B 2IAMB 1H15B 1PZ5B 3SCMA 4OCWL 4TRPH 1K4CA 3DIFA 5MERB 3O2VL 4FQ2L 4WI3A 5I76B 3VD3A 2VLKD 3MV8B 5TGBA 4OZHB 5IFJA 1I85C 3G9AB 3ZE0E 1M1SA 1CLZL 4NOFA 4L3CB 3WXWH 4KK9C 1INEL 4HLZG 3SKNA 4HS8H 4X9FA 3O4OC 4OF8A 5IUSA 1HI6A 2F8XC 4F3FA 5CAYB 3GSNB 5FV2A 1JN6B 3GKWH 5JPNA 4R7DA 1U93A 4TQEH 5T1LA 3EGSA 4NHCH 2OLDA 2EYSB 35C8L 1MCSA 2ICEB 1NMBL 4RFOL 3X3FL 4Z7WA 4P2QA 2VL5A 5TDOB 1F02I 1GGTA 1W2KT 4M93B 2HLFD 2FX8L 5I8CA 4OGYL 4FABH 1MQKL 2JCCE 1ACZA 4R4NC 12E8L 1QSFB 2KKQA 4K2UH 5FB8A 3VI3F 3MRJB 1T1WB 3TJHD 3PWNA 4KDVA 3SDDC 2DM2A 3CSPA 5T5FL 5MEOB 4OI9A 2EDKA 3MLPA 2X70B 4ZG1A 3SHSA 3HI1A 3PDGA 4HFUL 1BZ9A 5FAAA 5JMOC 1YPZA 2P5WB 3QNXB 3D6GA 4OAWB 4NQDD 2H32B 3ZT7A 3OKKB 2H45A 2YRZA 1KCVL 2BCKB 3BJ91 3B83A 3NABH 4OLXL 5BW7A 4XC1H 4Q6IC 3EDFA 3MXWL 5HBBA 1PQZA 3MYJA 5GSVA 2NY3C 2Q87A 3HS0A 5I1GL 1FVDA 5TDPA 2DAVA 5DK3A 3VXRA 3QXAB 1UFUA 3X11A 3IDGB 5TQ0L 3CSYB 4HC1A 3VGAC 3WJJA 2R56L 1PW3A 2GJZA 4L4TA 5A2LH 2UV3A 3E6FB 4TVPL 4PLNC 1DUZA 1ZXQA 2BMKB 5IBTH 4KPHL 3BHBA 3MLVL 4YXHH 3SDCD 4BZYA 2QR0B 4X6BB 1F3JA 5DJ2A 5GGRB 2A6KB 2VDOL 3WIFA 3BZ4A 4LCIH 3U4EA 4NOBA 3ZTJH 1EFXB 5BXFB 5SWZD 4FHBD 3UPCA 3W0WA 5F88B 5FUOH 3RIAF 4XB8A 4YH6A 3UTOA 3DYMA 3AMKA 4KH2A 2A6JA 3E8UL 3VXSB 2DQFA 4HH9B 5ADPL 1A9EB 3RZCB 4U1HA 4HWNA 4LU5L 5EBLA 3QCTH 4Z0BH 4QLRA 3EHBC 1J86A 4G7YL 4J12A 5I18H 2FO1A 3QUMH 4F7EA 1FH5H 2E7LC 1SYSA 3ARFD 4O2EA 4F7TA 2PF6A 5ECJE 5B38A 4J8RA 4N0RA 5IIEB 1VCAA 1CFTB 5E2JA 4PGCB 4YR6A 1IJ9A 5B21A 3OPZL 3VXNA 5B8CB 3MLRL 4G8IB 3INUH 4PJXE 2AEPL 1TJHL 3QO1B 2H26A 3S96B 1BFVL 3NMEA 2C3WA 5DRNB 1T2XA 3BAEL 3BEWB 1P9MA 3FFDB 4P59H 2F58L 4F7MA 4HK3N 1FG2B 4RFEB 3ARGD 4M7KH 5L88L 3NACL 5HJ3A 1NDMB 2BJML 5EORH 2HFEB 4OLZL 2NY1C 3VWKB 5JW4M 2QQKL 3HG1A 4FOMA 3VU2A 3SBWA 4OV5B 4KK8D 1TXKA 4XCYA 4LFHG 2DLIA 5A16A 3GSNH 1MCFA 3FTGB 3V79C 1C16A 4YWGH 4CADA 4JPVL 3HE7B 3R8BB 2QQLL 2GJJA 3KS0J 3QQ3B 5KJRH 2NY2D 4K3EH 4ZQKA 5IBLD 1KENL 4P99A 5KSUA 1GGUA 4JRXE 2KDGA 5FHAH 1NGZA 1EGJA 4Y8AA 4TNWK 3T0ED 4Q9RH 3VH8B 4E9LA 3EYVB 2WBJC 1G1YA 1H0DA 1AGCA 5MEPB 3RPIB 3EJJX 4LRIC 4CVZB 3RKDD 1T1XA 4K8RC 1EHLL 3O6FC 3L3IA 5DI8B 4Y4FD 5JOEA 1OTTD 2WP3T 5T1DH 2EH8H 2HG5A 5IJVB 3OBAA 4TPRL 2YA2A 4Z78B 1KG0B 5BVJB 3FT2A 1U8QB 4R0LC 4ZTOH 5ERWA 3UYRL 2VXTH 2Z35B 3DMMA 1X5XA 2D31B 1MCQA 4BZ2H 4C54A 3PIQA 1T5XB 5C0IB 2C26A 4MB3A 3CZJA 4HX1A 4OFYD 3QDJA 3TIEB 3O4OB 1JF6A 3FB5B 1I7RA 3ZYJA 5DVLA 5F7EL 3MRNB 4MDJB 4ZS7L 1J88A 2NZ9C 3DX6A 5CFHA 4G6MH 4GG6A 3IFOA 3QWQB 4HPOL 1V7NL 4FQHA 3OGCB 1EAPA 1SJXA 5TDNA 2J88H 4KJPD 1D5IH 2X4NB 4O00A 4QRRB 5HHPB 3C9NB 5D5MF 3A67L 3L5JA 4HBQA 4HLJA 2G75A 4MJ5A 2NLJB 4LKCB 1DQMH 3Q1SH 4JY6B 4Y5XA 3VRJB 1L7TL 3FQWA 4MD5B 3QISA 2VLLB 3CXDL 2IFFH 5KN5B 3FQUB 4LQFH 5EZJB 4L8CB 4WI9A 4X98A 3ZL4L 5JDJA 5C6TL 3SDDB 3NFNA 4J3WA 3RWGB 4G9FB 5IVXF 4GG8A 3D39B 2AXHA 1F42A 3SEPA 1Q8MA 3RU8H 1GVIA 3KNBB 4HIJB 3AC0A 5E24E 3AM8C 4DK6A 3VXPB 4PRHA 4UQ2B 5EUOB 2HVKB 5JTWA 4JM2D 2EDBA 3KXFB 1N6VA 4UILL 3C8KA 5CIPB 5EBMA 2AEWA 1J7VR 1S7VB 3JBG7 3QXDA 1CZ8H 2GEEA 3QRGH 4PD4J 1CLYL 2EH7H 3DUSA 2DI9A 1OOAA 1DSFL 1EPFA 5GGRY 3C5JA 1N0LA 1MREH 5DQDH 3ALXA 3LCYA 4H26B 4Q6IB 4QHNB 1KJ3H 1QHPA 2FEDD 4MS8D 2GJ6A 2P8PB 3OGOE 2NY3B 3MV7B 5C09A 5T1KA 3EYSH 5JR1L 1JTTA 5EUKB 3MLTB 1T5WB 1QSEA 3UXFA 2PYEA 2X4RA 1TCRB 4GH7B 4TVPE 3VGAB 4HCRH 3O8XA 3WE6A 1ZHBB 4GQPH 1S3KL 4JFQB 5CINL 5DRZA 2JJSC 4GMTL 3IDJB 1I1AD 3HUJE 2O93L 4JPIA 1RK1A 4I3SH 3QHFH 3RVTC 5AZEH 1NANH 3TIDA 5GSRA 5HHOB 1OPGH 6FABL 3QIWA 5JORA 1I3RA 3WUWG 5C7XH 1QPPA 1KUMA 1WBZB 3TBVB 1NGYA 1DLFH 4ZYKB 3TNNB 4MAYD 5IOPB 4HUWA 2R1YB 2BHYA 2PYFA 3IF1B 1CGVA 4MZ3A 1OT2A 1CXIA 1YA5A 4U1NA 3I3DA 5E9DA 4NFDA 4HIEB 1G7LA 5D9SA 5DJ6B 2Q86B 2WWKT 1BGXL 1T7VA 1DBKH 5E4IA 1S8DB 4P2OD 2BNRE 2PW2B 5GS0D 3BJLA 4MD0B 4PRDA 4CVXB 1T89C 3WFBH 4BH7B 5BZWB 4QRSB 5F7YC 3JWDH 3MGOB 4U31A 4N5ED 1FZOA 4J4PC 1LP9E 4L4VE 4ODTH 3ZDYE 1ZVSB 1GIGL 4UIKH 4KI5D 4ORGA 1DCLA 4JKKA 3MRHA 2ZOKA 4GUPA 3BN9C 3SJVD 4OIAA 4HGMA 2YA1A 3G08B 3PJSB 1JFQL 4NZUL 5GISL 3V6OA 3LKNA 4D9RE 1DN0A 1JGDA 4P48A 4JFDB 1YYML 5EULV 4M6ML 4PJGE 1BBDH 3J8F7 1RPQA 1S7WB 4KTEL 1J8HA 2J8UE 1AY1L 1MAKA 5KVDH 3TFKD 4JY4B 4M8VA 2FLRT 3TO4C 1UKQA 4YHKH 1K8IB 3IDMB 1KNOA 3CXHJ 1SY6H 4IRSA 2YHGA 1F00I 1VACA 4LLAA 4FA8A 3ULVF 1N3NA 1GPOL 2B0SH 3FN3A 4XZUB 4JPWL 2FATH 5H94A 1T0NB 4DUWA 5L2KE 4UNUA 1HZHH 5F44A 3G04B 5ETUB 5F9JA 5D7IF 1RK0A 1ZLUK 1SJEB 2P43B 3OXSA 3T0AA 1UCBL 5SX4H 3ULSB 6CGTA 4QO1A 3O3AA 2YK1L 3V6FB 4QTIH 1R5IA 5D2LA 2YRLA 4U0RC 1WVZA 4P5MB 1HK6A 1N64H 2JIXB 2WBJB 5D7JD 1DQQB 3V4PL 3NGBC 3V2AR 3I75A 4APQB 2XN9A 3O6FB 3DECA 3KG5A 3PHOA 4NJ9L 2DN7A 1VFOA 2RJMA 4OSUH 3H42H 1NDGA 3TPUB 3BP6A 1Q9KB 5FFLA 3P4OA 3D3VE 3FQRA 5FGBC 4NP4H 1LEKA 4WHYG 2FR4B 1BQLH 1MHHB 1OLZA 4BFIB 3TA3C 4CRPA 3BPCB 2VLRE 4HT1H 1S9WB 4K3HA 1A1NB 1Q72H 1K2DA 4NFCA 5ESQA 1IM9D 1EEZA 1QLFB 4XX1E 1QTYT 5J56B 1YMME 2R69L 4FQJL 5AZ2L 1UACL 4UV7L 4AQ1B 7FABL 3MO1B 5M95B 3UPAA 5JMRA 5CBEB 2X4OA 1NCWL 1GZQB 5D71L 1X5GA 4DN4H 3QNZB 3VGDA 5FA3B 5SV4A 4Y2OA 4XWOC 3ZYIA 3FB6B 4JFFE 3NOIA 8CGTA 3MRRB 2R8SL 3SDAC 4XC3H 4UT7L 1RHHB 5C0BB 1XF5B 4AMKL 3L7FB 3FO9A 3DSFH 1PFCA 3EBAA 4HJ0C 4R97C 5GS2H 4JO4L 2V17L 3RNQA 1QYGL 4ELKA 3QUYC 1RZIB 2PETA 3CFEA 5K9KA 4A6YA 4OBSA 1FFQA 2ESVD 4KAQH 1YQVH 3KPRD 3O3BB 1BOGB 4PJFF 3H9SD 2XKSA 5KS9A 4C56B 5DWUH 4Z0XB 3TWCL 3OHXA 4DOHE 2VXVL 1ZT1A 1U8IA 3J7HA 5J6HB 2Z8VC 4WO4A 3OV6A 2W1NA 5C07A 1BREA 4JLRA 1VGEL 3U7AA 5E2TH 3OQ3B 4FG6D 4G8GE 3B3IA 3UJJL 1D5ZB 5DUML 1B2WH 2A74A 3AXLA 4MQSB 2JF1A 4ZXBD 1V7MH 4RAVA 2GSIB 3MA7B 1FNSL 2AXJA 5BS0B 2ENYA 5JNYA 1FV1A 3GK8L 1D5MA 2CUHA 1CDGA 5DUBB 5L9DL 2R4SH 5KSBF 4FQ1H 4XNQA 5HGBB 3VXMB 3O2DH 1F45A 1CWVA 5FYKH 3ULUC 2PW1B 4LSRL 3RWIB 3JV0A 4H1LG 5D5MA 5C0RL 5DDHA 5C0AD 2Z9TA 5E6IC 4MA8H 1RUPH 2X4SA 3F7QA 3QUZB 4UI2A 2DIJA 2IC2A 3HMXH 3S36X 5D70H 2I27N 3FFCE 5D1XC 4P5TA 1QR1B 2YEZA 3LIZL 4AT6B 2JB5L 3MMEB 3DX7B 5ICXB 1ERNA 1MH5B 3DBXB 4B0MM 2VITA 3GSWB 1FL3B 1XIWC 4EUPA 3KPPB 1J11A 5IVXA 4PG9A 5GJTL 3LQMA 2XRAL 4IHOA 1NCAL 4QCIA 1NFIA 4PJ8A 2QSCH 3MV9D 2HWZL 2UWEF 1HHJA 3GRWH 2R2HA 2GITB 2EEAA 2UUDH 1I7TB 5I74C 3CZFB 4BKLB 2VAAA 4P23D 8FABA 4DGYH 1CI5A 4NRXB 3JTSB 5FO9A 4HFWA 1LO3L 2HH0H 4QNPF 1AO7D 2Y06L 1KIUA 3GDBA 4L3EE 1J9CT 3OR7A 1QUNA 1JGVH 3BZFB 3FO1A 2XICA 3QXUA 3I85A 5I71C 1RZKC 4HDIA 5B4MC 2HJLB 4NM4L 1J0KA 2D7NA 4OZFH 3FB8A 4K8RH 2BDNH 2XY1A 4JR9H 4EBQH 4U7MA 5IB3B 5HGDA 2NYYC 5IVZB 3QEQA 3GSOB 5B3JF 1ZTXH 2ZCKL 1U92B 3Q2CA 3Q5TA 3I2CH 2FBJH 3V6BR 1FYTA 3D0VA 3TO4B 2JKXA 1AGDB 2VABA 1OT1A 2VN7A 1CFSB 4PTUB 1OY3B 1UGNA 4LKXA 4JY5L 3WFEL 1AQDB 5LWYL 1YEEL 1XH3B 4WUUA 2AV1A 2HFFA 4PP1D 4WU5B 3HFMH 1FC2D 5IMKA 1OB1A 3GGWB 3MRBB 3QDGA 3G5YA 1KACB 3F5WB 4GAFB 1QRNB 3CH1B 2E3VA 5JXEC 1MJ8H 4EI6A 2ICWB 4XPFH 5IKCB 1U8PB 2NTFB 5I1AB 3IFPA 3LQZA 4U0RB 5FYJU 4AEIH 1IC5L 2AJXH 3HAEG 3QAZC 3NGBB 3VFTB 3SE8L 1WWBX 1FAKT 4QYOB 1XF3B 3O2WH 4Y4HA 4F37F 4LHUG 3THMH 3VD5A 4NUJB 3RVWC 3T08A 3MNVA 3IAGC 1EXUB 3BUTA 3QIBC 3RUGB 2J6EA 5IGXH 1SBBA 3NFSL 4X6CF 1OCWH 1A7NH 3TA3B 1LO0H 3ETBF 2O61B 4LRNL 4PJ9D 3O11A 2AKRA 2IANB 1FGNH 5JHDB 1JHLL 2VKWA 4R26H 3WNOA 3LN5A 3QFJE 1BWMA 4MDIB 3IFNH 5I1JL 4U6XB 1JUFA 4OM0H 2D9CA 4K7PH 3QUXA 4JJ5A 3EO0B 1RULH 1BEYL 3RL2B 3VFUA 2WK2A 2F53A 5E8DL 5ACZB 1JF5A 1HDMB 3OKLB 4O2FB 5JZ7C 1F90H 4YFDB 1RU9L 5E08L 4XPGL 2ZWLT 1MFBH 3SDAB 1UEYA 1OP9A 5D7IA 4TSAH 3T8XA 3TJEH 3ARDB 5IMLA 4HKJB 4DKAA 4P2RD 1FC1A 4KKAC 3MOBH 3ZO0A 1AH1A 1MFAH 4R97B 4O5LH 3MJ9H 2M26A 3QUYB 3IDUA 2DMBA 4PJDF 2V7NB 3IJYA 3QDHA 1OAZL 2XZQL 4MSWA 3SGDH 1IQDA 3D85A 3Q6FA 2YBRA 1NBQA 1MLBB 4MJ4A 4DGVH 1KIRA 1AFVL 2IADA 1PLGH 4LAQL 4LAJH 4M7LT 1RZJL 4OV6F 5KANG 3PXJA 2JELL 4JFXA 1Z5LA 5LQBL 4KY1L 3RL1A 1HINL 3KR3H 5CZVL 4G6KH 5E1HB 2EC8A 1WWCA 2AQ3A 4D9LH 3OR6A 3QG6B 3BIKB 4CJ0A 2CIIB 1VEOA 5DQJB 5EU5B 2FECL 3D48R 3IRPX 5EDXA 1G9ML 2ED9A 3QH3A 1A2YB 3UTZB 4JN2B 4ODSH 3RJQB 3BH9A 1L6ZA 1YEDA 5JOFA 3TV3H 4E41D 3FN0L 2IAMD 3Q6GL 1KC5L 4N0UA 5E6IB 1PYWA 1QVOA 4HJJL 1NBYB 5HVHC 5D1XB 3QDMA 4LCYA 1HYRC 3I6LD 1XIWB 4YK4C 3MV8D 1EZVX 3MUHL 5BJTA 4XHJD 3MRGB 4JZNA 1YNLH 2W07A 4GAJL 3WIHA 4HC1L 4JZJC 2DTMH 1M05A 1CK0H 1N5YH 1UYWL 4NC2B 2P5EA 4PP2A 3LD8C 3QHZL 2I9LB 2A6IA 5DD5H 4PJFA 4Y5VC 4NO5B 1OAQL 5I74B 2YPLE 5IB5A 4UOW1 5ISZE 2C3VB 5INCA 2AEQH 3GMQA 1WTLA 1UZ6F 1G7IA 1DLHB 2R23B 1G7QA 4OM1L 2Q8AL 3BX7C 2JK5A 2VWEC 5IJKA 3OKNA 2FSEA 4R2GC 3UEZA 4PBWD 4PJXB 3HC4H 5J9PB 2A38A 5I71B 2FWOB 4XNXL 2AK4E 1PVHA 4HWZB 1E4KC 3VXUA 1BD2B 4CVWA 1IM3B 4IMLA 1FFOA 4DCQB 1YEJL 5DVKA 4WRLA 5FGRA 1QSFD 4GRWF 2ICCA 2VXUL 5F7UA 1WEJL 1A8JH 1Z6JT 5GGTA 3ESUF 4Z5RB 4ETYA 2HP4A 1RIVL 1MJ7L 3I84A 1RUQH 2OCFD 4ZSOB 5C6WH 5HDOA 1ND0A 4YE4H 1LD9A 1UJ3A 4PJEF 1LK3L 4C57C 1EO8H 4QRPD 1I7ZA 2YC1A 5DRWA 1RJZA 3OJDB 3Q5YA 4JG1L 4HUVB 3AS1A 3LMJL 4HXBL 5E8OA 2BOCA 4GBXA 1XAUA 1A4JA 4HH8A 1CE6A 3C5ZD 5L2JA 5HDBE 3GMLB 3K8KA 2BSRB 2RB8A 1I3GL 4I0PC 3N85L 4OFPA 5C0CE 2NZIA 1QLEL 4U1MB 1IAOA 1QNZH 1CT8A 2EYTB 1MFEL 4Y5YB 5GHWL 2UWEA 1BMGA 1SEBA 2XTLA 5I1LA 5KOMC 4YNYB 2VSDA 5CILL 3QEUA 4YHOH 5E1AB 3SO3B 3S8WA 4QEGA 3FO2B 2ZKHH 3QAZB 2HFGH 1OSZB 2C4XA 1HKLH 2MKLC 2HKFL 1TZHA 2RBLA 1K4DB 1WWWX 2IEPA 1TDQA 3MA9H 4NQXB 2LFGA 4XMKL 1DQLH 3T4AA 4TYUA 4WHTA 2ZSWA 2DQHH 1JZ7A 4L9LA 4OUUA 3NCJH 1GHFH 1MI5E 3D69B 3QIBB 4LNRB 3BQUA 4XNYH 3QRFM 3OAUH 4KDWA 2IALB 1HHIB 3S88L 1EGJL 4GW4A 3CX5K 1VFMA 1EFXD 4LLQA 3ISWA 3DWTA 4WFFD 1HEZB 5F9OL 1BPVA 4CL7A 1MHPH 2VDQH 5CWSB 2X1XR 3CX2A 4PB0L 4WI7A 3S5LG 1R3IH 4GW1A 2WUCH 5HDQL 3SOBH 5FM5O 2FJHB 1MHCB 2B7DT 5FIEA 3VXSD 4PJHE 3RZCD 3BT2L 4YBQD 2GT9A 4KTDH 3VI4E 4HPYH 1KGCD 2UY7A 3MLXL 5E2VH 4MNQA 3O3EB 1HXMA 5FYJL 1E27A 1XR8B 3ULUH 1C5BL 2G2RA 3UZQA 4OGAC 4Q2ZA 1A6AA 1KTDA 2YWYA 4WU7B 5DR5L 1U6AH 4Z7WE 4PLKD 4XNUL 1HSBB 4HF5L 3TBTA 4P2QE 3RDTC 3NIFF 3UTSA 1MELA 3E2HC 5JIIA 3G6AA 3WHXA 3CDGA 5L0QC 3W9EB 1NL0H 1TJIH 3JSSA 5TQ2L 3K1DA 5CCKH 3LH2H 2PTTB 3QFDB 2QQNH 2EZ0D 3JV4B 2R29L 3KYNA 4WDIB 2Z31C 3VWKD 3MRCB 1ZGLB 5F1IA 5H35B 4X6CA 3BZDA 3U0PA 1S9XA 2A9NH 3K46A 5DJAA 3BSZL 2HTLD 3LKOB 2BSED 1G1CA 1WBYB 3HE7D 3U46B 5F72S 4PRAA 2BHZA 3H3KA 1XEDA 3QSKB 2P48B 3HNTH 5DVNA 3SE9L 3HUJB 1L0YA 3EOBB 2Q8BL 4M62H 4KJWD 3WUWB 3MLYL 3U9PH 4LK4A 1RZKH 3SE4C 2ADJA 4FQXD 2CRYA 2K7PA 5E94A 3L5XH 1WIUA 5GJSH 3VJ6A 2XWJA 3EDDA 3DV4A 4KMTH 4RGNC 5ITBH 3VXTB 15C8H 3FN9A 1X5KA 5HVHB 3VXRE 1YNTA 2E7MA 3KPSE 3TO2B 1P53A 1YNKH 1KBGH 3FMGH 3HTLX 5DRXA 4UIMA 4L4TE 3LZFL 2BNRB 4JZJB 2VYRE 4XP1L 1AR1C 1LE9B 4PJDA 3DHJA 5EOCL 4XP9L 3EJYC 3LD8B 1A9BA 5HYSA 3CIQA 2F15A 3BI9X 5EOTA 4Y5VB 2EE9A 5I1EH 1LP9B 5C08B 4L8SC 3G9VA 2F5AH 2C9AA 5I2IA 3BZEA 5JOPE 4XXCC 4NQEA 3M07A 4RMRA 1U58B 3HC0B 5BZDB 2UYLA 3MUGB 3VGHA 4R2GB 4OCWH 2BSTB 4QRRD 2KH2B 3QQNA 4YLQT 3O2VH 4FQ2H 4DZBB 3UAJC 4R4ND 5I1CL 1WUNT 2YN5A 5BO1L 2QKIB 1CLZH 4PJGB 3TZVA 4BQCA 3E6HA 1T04A 2J8UB 1INEH 1MVUB 3IT8D 1Y6NR 1Y6MR 3SDDD 1Q1JL 1HNFA 3P73A 3PWVA 4G9FD 3QI9A 4JANA 3D39D 4NHUB 3FO0L 3AS3A 4HZAA 4LHQB 2ITCA 5A2IH 3WCYA 1UQSB 3GSRA 3C87A 1KIPB 35C8H 5B38G 4RFOH 1NMBH 4QKXB 3X3FH 1CDYA 2R1WB 3HN3A 3MRLA 3U36B 1M7IA 2W91A 3KXFD 5DK2A 3EO1A 2FX8H 3BD3A 4OGYH 5D1QD 3UTPE 4W6WB 1MQKH 3NAAL 5DD6A 4H0HB 1IEBB 5IB2A 2XOTA 5MEQA 12E8H 1T80A 4I5BA 1UZ8A 2VE6A 4ZUUB 1RIHL 4LBEA 3JZ7A 3H9ZA 4FTVB 3UC0L 3TVMC 2NY3D 5T5FH 3MV7D 3HG1E 4MJIA 2ARJA 5DS8B 2Q6WA 3RIFK 3L3JA 4WWKA 4BSVB 3IDIA 1CLCA 5FKAB 1ES0A 5KSVA 4HFUH 3W11C 4ODVL 4IRJA 1NUGA 3HNVL 3D3VB 1J87A 1YDPB 4W4OC 1QBML 5MP6L 2H3NB 4PREA 2VLRB 5D7KD 4PGBB 4K7FB 1I1FA 5GS2D 4U1JA 4X99B 1KCVH 2BP3A 3VFSA 5T5NF 5FO8A 1YMMB 3L7EA 3QDAA 1BVLA 4OLXH 4WY7L 3MXWH 2Q76A 1C12B 1KJ2B 2PN5A 4QHMA 3VFPB 5I1GH 5EH1A 1S5HB 2QL1A 4DK3A 1FLTX 1OGAA 4IDJL 2ZUQB 1RZ8A 3VFNA 2VRAA 4PJEA 5TQ0H 4OT1L 1PSKL 5FM8A 1OD7A 4U1IB 1JMZA 1LDPL 2R56H 3VFOB 3VFVB 3A6OA 1AJ7L 1LNUB 5E4EC 2XKNB 4NPYA 4YFLI 4TVPH 2WINA 2BX5A 4JFFB 3L3OA 3EHBD 5FYJE 4KPHH 3HLAA 2VISA 3MLVH 3DGGB 5DF0A 1ZV5A 3LRGA 1CIDA 1ED3B 4HEME 4BJLA 2FLBT 5EC2A 5D93B 2VDOH 1T22B 2DBLH 2XQBL 5F7WC 1FL6B 2MPAL 2DQUL 1E4JA 2XIDA 2VZ3A 2FX7L 4GG6E 2R39A 2R4RL 3WO3B 1FZKB 1YY8A 1H3WM 1B3JA 2XPGA 1NJ9A 3DXAB 4KHTL 2ATPB 3OKDB 4JFDD 5MENA 3RDTB 3BMWA 3E2HB 4DOHB 4U6VL 3DYOA 3SGKA 3E8UH 5ADPH 2CH8A 1X5JA 5DD1L 5L0QB 1HHKB 3NN8B 4S10A 4LU5H 1R5WA 4EN3C 1MIEL 1IAMA 4G7YH 5KG9B 4N0FA 4TNVF 3RBSA 3HR5A 3RVXC 2BK8A 4GKSA 2NXZC 5IROA 3HZYB 4V1DB 2Z31B 5HGGS 3V7MA 1BLNB 4JFOA 4DVBA 2B2XL 3GMPA 3ESVF 4WI8A 3PP3K 2Z92A 4H25A 1XZ0B 1XGTA 3BP7A 3OPZH 1NSNL 3MLRH 4PRIA 3I3BA 3DETC 4PRHE 3RX7A 1YC7A 5A2KH 2AEPH 1HHGA 4H1LB 3U9UB 1CXFA 1TJHH 4A6YL 3F8UB 1VKXA 1BFVH 1NCUA 1N2RA 3UBXA 4DEPC 4PJIF 3BAEH 4YEFA 2F58H 2PKDA 3NBNA 3BD5A 4QGTA 4D8PA 4JQVC 1CE1L 1ZA3A 1KPRA 1U8KB 2BY0A 4U6HB 5L88H 3NACH 3WMSA 1IGCL 5K9OB 2WBJD 2JIXD 4Z7UF 3PV6A 2BJMH 3DNKA 3FFCB 4OLZH 5HD8C 4APQD 4K8RD 3E0GA 3O6FD 4RGNB 2QQKH 2EDJA 4CNIA 3MFFB 4HUNB 4NRYB 1ZVYA 5C09E 1QO3B 5HGAB 1YC8A 1N8ZA 4JM2F 5FO7B 1A6ZB 1D3CA 5JIHA 4LLWB 4N8VG 1QSEE 4X6EA 2PYEE 4DFHA 1SM3L 2VLKA 4JPVH 1MCWW 5EBWA 1OF2A 2QHLA 2O26U 2QQLH 3B43A 4NO2A 2QSQA 4QT5A 1KENH 1KN4L 2A9ML 3H7BB 4X7CC 3U30C 5EIIA 3KVQA 4S2SA 2QADC 3QYCA 2NZ9D 2DQCL 3D2UD 4L3EB 4L8SB 5EO1A 1BFSA 1OAKL 2HVJB 4K3GA 4PJAB 1R0AL 4MCZA 3MJGX 4JE4B 3VI3E 1EHLH 4F37K 2J12B 2DLFL 5E9DE 4S1SL 1ORQB 2XTJE 4GQ9L 4LSSL 4KI1A 2DQTL 4TPRH 1KYOJ 4XNMB 5BRZB 1QQDB 4G43B 4W6YB 3UYRH 4HG4J 1IAII 3MJ7B 4YGVA 4HUXA 5C0BD 5F7FA 2C1PB 1FNLA 1MCWM 1X7QB 1FHGA 4MZ2A 5F7EH 3MFGB 3MRKA 5CEXB 3VCLB 4ZS7H 1KXQE 3PQYB 2PNDA 5HSFA 4HPOH 1V7NH 2JTDA 3F7YA 3GEWB 3G6JF 1Q9WB 1BZ7B 3LS5L 4O58L 5E6YA 4C56D 5F3BB 3A67H 4OD2B 2ZCLL 1DQTA 3B5GA 5E8NA 1LEGA 1L7TH 1ZOXA 3HAEB 2EDRA 1YY9C 3RHWK 4HWBA 4JFPA 1J8HE 2GK0A 4KI5F 3CLEL 5AAMA 2ZJSL 3KPNB 3CXDH 4Q6YA 3DI2B 2EDDA 3ZL4H 5F9DC 3WYRA 5C6TH 2H8PB 3TVMB 1SYVA 4LHUB 4Y19D 4XH2B 5BS0D 3AREA 4YDVB 2FHCA 1FVCB 1BJ1J 2KBGA 3H3BC 5LGJB 2IMMA 2XNAB 3GJFH 1H5BC 3VXMD 5CEZD 1KPUA 2BRQA 4KXZH 1F4HA 5DC9B 4NO0D 3GBNL 3RVTD 4UILH 1CGSL 1E4XI 3BW9B 4OCRL 1T7YA 3ZE2F 1U8MA 2IJ0C 1CLYH 1DSFH 3QUZD 5F7KC 5ICZB 2W65B 5IESL 4ZS6D 3SCMC 3VDBA 5EO9B 3ARBA 2K3TA 5JR1H 1Q0YL 3DRQB 4X8JA 4LLUB 3MNWA 5GGUA 5GXBB 1U3JA 1TNMA 4G9DA 1ROWA 1MUJA 4S0TD 1S3KH 4RDQG 1EEUA 1VGKA 5CINH 5E4EB 4GMTH 2OXHA 4MA3B 1AGBA 4IIQA 5FYLD 5ITFB 1OL0A 5GS1A 4X9GA 2DIBA 2J6EL 3T77A 1JWSA 1CGWA 3V8OA 2GTWB 3LRHA 1K85A 1KLUA 1MAML 1DEEB 4ONHA 3BN9D 5I6XC 1X5HA 5CD3B 4X7TA 5C0EB 3CFIC 5C1MB 4ZAKC 5JO5A 1H8SA 4GAYB 1OWWA 3KS0H 1L9NA 1ULVA 3HMXA 1JNLL 3TP4A 1S7QB 1RZJC 1S9YA 1BGXH 2F54A 4KK5C 4QHLB 2Z91A 3ULVL 3CK0L 5AYUL 1IGYB 4LSUL 5A2FA 3ARGA 4EN3B 2I9TA 2GCYB 4U7SA 3TO4D 3AU1B 2AI0L 3LEVL 1EHXA 2NXZB 4PRPD 4WEUD 3KLHC 4XPAL 1CYGA 4NDMB 1IGJB 1GIGH 4TSCH 5DD3L 4KQ3L 1G9MC 1JE6A 1UWEH 2VUOA 1AKJB 3SE3A 3S36L 1JFQH 4NZUH 2WBKA 5GISH 4MD4A 5EZIL 1WITA 1S5IL 1QRND 4UT6L 5F1NA 4DEPB 1YYMH 1Z3GL 3KLDA 4M6MH 3T0EA 2VLJA 5BW7C 5C07E 2DWDB 4KTEH 5IVOA 1KTLB 1MJJA 1HOCA 3CCHB 1AY1H 2Y5EA 4LCCA 2H1PL 4OQ1A 4ZUSB 2P24A 4ELMA 2AJ3B 5IW6A 3VFMA 4Z7VF 1YZZA 4KKBC 3TM6A 4F57L 3FQXA 1GPOH 3WJJC 3DO3A 2XT1B 4JPWH 5FF6B 4HUUA 4KJYA 5HVFB 4Z7NF 5F96L 1DQJB 4YDIL 1WISA 3T1FB 3DOSA 2Y9RT 4ALAL 1Q9LB 3ARXA 1U41A 2OTWB 3P77A 4HMDA 3TA3D 1U8HA 2AERT 3AS2A 3WS3B 2YPLB 5D5ME 2IAND 3U30B 5JHDD 2X1OA 5IMOB 2E9IA 3I6GB 4YAQA 2YK1H 3IU3A 4NQVB 4E42A 2QADB 4XRCA 3PP4L 1NLBL 4OF5A 1OTSC 2IQAB 3V4PH 3UROR 2OR8A 2X4QA 1N59B 4NJ9H 3L3KA 2DQEL 3SKUD 4XXDA 1W0WB 5IVXE 2XFXB 4HIXL 1S78C 3ZYZA 4X6DA 1BVZA 4KJQD 4EUPG 4XWOD 1AIFA 3LPFA 1TMCB 3WIHL 1FP5A 2AV7A 3SDAD 3OG4B 4XVUC 1FYHB 3R0NA 1CTOA 2E7BA 2NW3A 1M7DB 3MLUL 3ARDD 1M4KA 4PJIA 4HS3A 1Z9MA 2R69H 5DGQA 4FQJH 4HJ0D 1WZMA 5AZ2H 1IL1B 1UACH 1A1MB 1Q0XL 4K23L 4UV7H 5EZOL 7FABH 4Z7UA 1D6VL 1FL5B 1NCWH 2MHAA 1ZA6A 5D71H 5DT1L 1D5XA 4JFEE 1NKOA 43C9A 1P9MC 1U8NB 3H6JA 3VGEA 3U6RA 1FRGL 2ILLA 3QEQE 3X13A 5HYQB 4NT6A 1MRDL 1FFPA 2R8SH 5F9AC 1R5VB 2AXGB 5I66A 4XCNB 2I25N 3SDXA 3SBWC 5GGTL 4AYFA 4AMKH 3NVQA 3OJMB 4OJFL 5HYIA 5BVPL 3CD4A 4JO4H 2V17H 3VA2C 5KVMC 1IZJA 1QYGH 2X9XA 1R6VA 5FECB 3OKEB 1P7QB 4NCC2 4WUUE 5ANMA 2APVA 5FUCE 4PJBB 3ZKNC 1H5BB 4IM8A 2HYMA 3ULUD 4KMLB 1AD9A 3JUYA 3QDGE 3PGCA 4FP8L 3TWCH 5TE6L 1U3HA 2VXVH 2P8MA 4M7LL 2YD5A 5HY9A 3RJDA 1NFDF 2X4UB 5E6ID 3P0VL 3S5LB 3CPLA 4M61A 1VGEH 4J6RL 3G5XA 1QFWM 2E9WA 4MVBC 3C8HA 5D1XD 5IK3A 4Y1AA 3SCMB 3UJJH 2XXCB 5DUMH 1T7XA 5FHBL 4WFHD 1K4CB 2LVEA 3DIFB 4MJ6A 1ADQA 1FNSH 1YEKL 2ADGB 5IFJB 3GK8H 3DMMC 5FKPA 5L9DH 2D0FA 3MRFA 3SKNB 2NNAA 4LSRH 1Y6KR 1RMFL 3FB7A 2EE6A 4F3FB 1BM3L 5C0RH 3DX8A 4WHCA 4YHYC 1SJHA 5EBGA 1U93B 5T1LB 2HKHL 4D0CA 1A6UL 1RUAL 4RMVA 4A2MA 5C6PB 3LIZH 2JB5H 4P2QB 5B4MD 5I6XB 4N5UA 4JHAL 1QRKA 4ZAKB 5I8CB 1BD2D 1K5NA 3RY5A 3ZYOA 3ULVE 2WLYA 5GJTH 2XRAH 4Y5XC 1NCAH 5IB4B 4BM7A 2NYYD 2HWZH 3U0TA 5FB8B 3BPLC 4LFHD 4WW1A 3NH7L 3VRLF 4G8FA 3MXVL 3PWNB 5HI5D 5D7IE 4FXKA 1U8OA 4NNPL 1IC7L 1OVZA 5AWNL 4BFBD 1LO3H 1IAIM 2Y06H 3MPCA 5JDSA 2Y1VA 5CSZB 1BZ9B 2O5ZL 1N6QH 3HZKA 2WAHA 1QP1A 4X4ZA 1YPZB 3D9AL 4P49A 3UX9B 2XG5A 4NM4H 3GNML 5HHVL 4UU9A 2R0WL 1CFNB 4R9HA 2FZ3A 1CGXA 4Z8FL 4J3XA 5JXED 1ETZA 1OQXA 2ZCKH 2XKUA 1TTFA 1AD0A 2Q7NA 3LKRA 1PQZB 3MYJB 5GSVB 3DI3B 1XGUA 3HS0B 1FVDB 3KPLA 5TDPB 5D7JA 3QJHA 5A2JH 3VXRB 3HA0A 3OKMA 3O8XC 3QCTL 4JY5H 1HH9B 3WFEH 2GJZB 4L4TB 5LWYH 1MCPL 1UXWA 1YEEH 2OX5A 1JWUA 4XBGA 5TE4L 1DUZB 3QIBD 5IW1B 1JGEA 3C6LA 3BHBB 5JQ6L 5K59F 3OSKA 1FBIL 4PR5B 1F3JB 2DTSA 2VQ1A 3QIWC 3TC9A 4J1UA 4OIBA 5M7QA 1QBLL 3BZ4B 1IM9A 3U4EB 2NY5L 1B88A 1IC5H 2X1PA 1ONQB 2Y4SA 3W0WB 2CLZA 2JCCA 2LVCA 3QDME 5DYOB 3UZEA 2XTJC 2X1WL 3SE8H 5LVEA 1GGBL 1MCOL 2ICES 1AI1L 4NKDB 1X6LA 3HB3C 2A6JB 1I8KB 4U3CA 2DQFB 5DHVH 2DKMA 4U1HB 1WSST 1NFKA 4ZFOA 5JZ7D 3FRUA 2P5EE 5EBLB 3U7WL 1U36A 4E0RA 3NFSH 5GGVY 4PJFE 4F7EB 1ZLSL 4LRNH 2MFNA 2HFTA 5B38B 2YXFA 3MR9B 1JHLH 1I1YA 4KKAD 4OZHF 4YR6B 2E8ZA 4RISL 5DJ0B 1F2QA 3VXNB 5I1JH 3ME0A 2KPNA 3V6OC 2H26B 1G0DA 3ZDYF 1MWAA 1FO0B 3H9SA 4Z7VA 3VXUE 4HUMB 5E8DH 4F7MB 3HZVB 4Q97A 4PY8I 5ID1B 5E70A 5DJCA 1RU9H 4HZLA 5E08H 5HJ3B 4XPGH 4U3HA 5KSBE 4P46A 4JGMA 5JW3L 4PBVC 2IWGA 1PD6A 4IRSC 3PDOA 3HG1B 1AP2A 4RIRB 3ARTA 2GSGA 4XCYB 4UNVA 5A16B 1P69B 4I13B 32C2B 4TVPD 4HMCA 1UM6L 5HI4D 1OAZH 1NEZA 2XZQH 2GKIA 1ZGLP 5KSUB 4HGWA 1AFVH 2QQQA 2C1OA 5C3LD 4LAQH 2X5PA 1IEAB 4JRYB 1HILA 2XWTA 3TCLA 3BDYL 1MCRA 1JPTL 1NUDA 2UWEE 1KTRL 1H0DB 5F7HA 2JELH 5I16A 5LQBH 4KY1H 1HINH 1T1XB 2MCPL 1INQA 2QTEA 5CZVH 3LEXA 4NO3A 1TVHB 4X7SL 2HG5B 1HXYA 4QNPE 5FYKU 2VQTA 1MQ8A 3FT2B 5C0FB 3QZWA 5ERWB 1G9MH 3F65A 2DDQL 5AUMA 3PIQB 2CMRL 3PABA 4HKXA 4HX1B 3QDJB 4BH8B 1I7RB 5C08D 4LARL 3KYOB 3FN0H 2IPUK 5EZLB 3Q6GH 4YHYB 5B3JE 1KC5H 3DX6B 1MFDL 3IFOB 3RP1A 4HJJH 4R2GD 5D2NA 1EAPB 1EIBA 3L5HA 1WJ3A 4X5XA 1FNGA 4OLEA 3TT1L 5FOJA 3W81A 4MJ5B 2YD1A 2G75B 4IRZL 4GAJH 2YPKA 3TYGL 4JFZL 4HC1H 4Y5XB 2LABA 3FQWB 1UYWH 4AY0A 3QHZH 4XHQA 3BPLB 2EKJA 4L5FL 2FJFB 2D7OA 1OAQH 2OL3A 2OQJA 3VGFA 3NFNB 3NA9L 1NFDA 4KVNL 4OM1H 2Q8AH 3ZT6A 1LO2L 2HN7B 4JRXA 4YC2C 5FGSA 2OSLA 4IOFC 2O5XL 3UTSE 1GOFA 4XNXH 1ZWIA 3P9LA 1FAIL 3QXVA 3IVKB 5EBMB 2ARWA 4NNXA 1YEJH 3SKJL 2ZZUT 4WO4C 4RCAA 3DUSB 3ZTJG 1E6OL 2VXUH 3NZHL 4LGRB 1WEJH 3QUKA 3C5JB 3T0VA 4FTVD 5I0DA 1WFNA 3O6ML 4N8VB 1RIVH 2GJ6B 4X6CE 1BFTA 3UDWA 1LK3H 1FN4A 1Z9OA 5DZLA 1DBKL 3MOQA 2X4RB 3ARYA 5AD0A 1IKFL 1G0XA 3P4MA 5T1MA 3LMJH 4HXBH 3O8XB 4UOJA 3TH4T 2W9DL 3CUPA 3BXNA 2P8LA 4FFVD 2DWEB 4JPIB 1RK1B 2VLRD 3N85H 1QLEH 3TIDB 3I02A 5GSRB 4NN5C 2GAZA 2EE2A 3QIWB 5JORB 3GHEL 3VDCA 1YMMD 1I3RB 1MFEH 3T09A 4PJ9A 1J05A 5GHWH 3LS4L 4YX2L 2BOBA 2VAJA 2W0KA 4P5TC 3OX8B 4HUWB 3WS6A 2YUVA 5MHSD 3BE1L 4U1NB 3HCVA 1FSKC 5D9SB 2YR3A 3QIUA 5T3XE 2HKFH 5D7LE 2NTSP 4XMKH 5L8KB 5IEHA 1YEGL 4NKMA 1BVKA 3IDNA 5I1HL 2DS4A 4YHKL 5TF1L 4PJDE 4C83A 1MAJA 2BY3A 1U9KA 4PGEB 4K55A 4GKNA 5DJZA 3KGRA 1FZOB 1KXTB 3S88H 1EGJH 3OG6B 4U05A 4YPGA 4OGAD 1OHQA 2X4TA 4W6XB 1EEYA 3DX9A 4P5KA 4P2RA 5F9OH 5J57B 1CQYA 3RZWA 2ZOKB 3DXAD 5BV7H 3F7VB 2DJSA 4PB0H 4JKLA 3RDTD 5E5MA 5HDQH 1LK2B 1MCHA 3GMOA 1DN0B 1I8IA 2VLME 5INDB 5IHUL 3KHQA 3NCFB 3JWNC 2WQ8A 1F2XK 3BT2H 4M1CC 1VADA 1MPAL 3ZSSA 3VMNA 4F8QA 3QBTB 1J8HB 4KROC 3MLXH 3NCEB 4V1DD 2Z31D 5DQ9A 5J1TC 5FYJH 1QHOA 1A6TA 1GZPA 3RPKA 1VACB 1UADC 3TBSB 1X5IA 1N3NB 1IBGL 2P1YA 3EOTL 4LLYA 1CTNA 4YEEA 1NLDL 4ORZC 5H94B 5DR5H 2IBBA 3STZA 4XNUH 4HF5H 2X40A 1Q72L 5F9JB 2YUZA 4MHHG 1XGRB 1RK0B 2GUOA 1IC4L 3OXSB 5TQ2H 2CJUL 3HR6A 1ZS8A 2J4WL 5D2LB 2Y6SC 2R29H 4NJAL 1QFWL 3SGJA 2Q7YB 1H15A 4HWBL 4RGND 2BY2A 5EUOF 3LPGA 3U0WL 3I75B 2XN9B 5I19L 4RA0C 4LSVL 5A3IC 3M17A 3BSZH 4Y4HC 4XAWL 1UZ6E 3MV8A 1NDGB 4S1DC 3BP6B 3MBED 3FQRB 4L3CA 2V5TA 3DVGA 4LCWB 3SE9H 2FD6L 3EJYD 1HYSC 2Q8BH 4WCYL 3MLYH 4L4VA 4RMUA 2IMNA 2Z93A 2CIKA 3FHQA 1E4WL 3GSXA 2X9WA 1CLOL 1K2DB 3B8SA 2ADFL 1BQHA 4GRWE 2ZP0T 4PIRF 2PUQT 2HT4D 3MRPA 5C0DA 4NQCA 1JP5A 1Q9OA 3QUXC 4N90E 5B22A 4UDTA 4RRPA 4M7ZC 3VG0L 4N8CH 3ULVC 4PJEE 5BRZD 1I9EA 2VZOA 2COQA 3LZFH 1NAMB 2L7UA 4MXQC 4XP1H 1PAMA 3OXRA 2E5EA 4B5EA 1QSFA 2PCPA 4S1QL 4XP9H 5EOCH 1CFBA 2CK2A 4F8TA 4X4ME 3P9MB 3IDYC 5DEFA 5MEOA 5CJQL 2VO5A 2X70A 5DHXB 1D7FA 5E6ZA 1W72A 1IAIL 3PQYD 4GRLA 5IHBA 4QRPA 3RA7L 3RNQB 1QACA 1NANI 3NPZB 5K9KB 4A6YB 3GIVB 1JRHL 3IFLL 1G9NH 4YC2B 2H32A 3U82B 5MENE 3C5ZA 1FGVL 4X6FA 5KS9B 1A6PA 4JREC 4NIKB 5EWIL 5I1CH 3OHXB 5BO1H 1ZT1B 1U8IB 2AXFA 3GSVA 1BBJA 1NKRA 4WO4B 2BCKA 4ODXA 1I4FA 4P3DA 4JLRB 5HPOA 2MOVA 4LHUD 1Q1JH 1ODAA 4DAGL 2A74B 1XFPA 3AXLB 3FO0H 4RAVB 4ZDHA 2K9UA 3W11D 5JNYB 1FDLL 4FXLA 2XZCL 1FV1B 1QSZA 3E6FA 3DSNA 2CK0L 4XNQB 4QRTB 3KPQA 3LKPA 3NAAH 5D5MB 3F58L 4JHWL 4KGLA 1ZANL 4K9EH 3UBXG 2X4SB 1RIHH 1E4XL 2YEZB 2FIKA 2VITB 5DVMA 4EUPB 4GRMA 1FSKB 1UG9A 3HHRB 4CN1A 3D18A 4IHOB 1NFIB 2FBJL 4HK0B 2VLKE 2FHFA 4ODVH 4PRBA 5F1OB 2EDNA 3HNVH 2CKBA 4EXKA 1HHJB 5GPRA 3C2AL 1QBMH 2DYPA 5MP6H 1WC7A 4RZCA 3NIFE 2OYPA 5JQHC 1UJTA 2VAAB 8FABB 2Z8SA 3T2OA 5K9QG 3BKYL 3QEHA 3GJFA 5FO9B 5F1SA 5IJKC 3EZ8A 4WY7H 1CFTA 5CKAA 1T4KA 3LRSA 3RGHA 3ZKQD 2BSSA 3B5HA 5B8CA 3FO1B 1BP3B 5SX4I 1P4BL 3BUYA 4HDIB 3OKOB 3KLAB 4FFYH 2XACC 4IDJH 1N4XL 1B0RA 1WQVT 1IFHL 4FRWA 1PSKH 3T4YB 3BWUC 5I75C 1S7UA 1LDPH 3BEWA 3EAKA 3V9FA 1AJ7H 5HGDB 1MCCA 1ZLVH 1FG2A 3LQAL 1R3LA 4EN3D 4CJ1A 4FQQA 1FYTB 3DROA 4KROB 3D0VB 1V8HA 2WWKO 2NXZD 1UJ3C 2VABB 4P9ML 2YKLH 3THML 2MPAH 3B9VA 2DQUH 1XGYL 2FX7H 4LKXB 2R4RH 4GBXC 1XF2A 1KULA 3DETD 4KHTH 3UTTB 1ZHLB 2D3VA 5IMKB 1YEIL 1VEPA 1OB1B 4NQDE 3G5YB 4HHAA 4RAUA 4P9HL 4U6VH 4QRQA 5DD1H 4LMQI 3RTQA 4FQXA 4I2XA 3O3UN 3TBYB 4EI6B 3VH8A 4LVOC 1MIEH 3F12B 3IFPB 1L7IL 4Y2DB 4I9WD 4OKVA 3K4DA 2AK1L 1KT2A 2LU7A 5LXGL 3VD7A 5LGKA 2B2XH 2BXYA 1JK8B 5IJVA 4BYHA 4Y4HB 4OZ4A 5J11B 1NSNH 2D7MA 5BVJA 2ED8A 3KPMB 4L9LC 3V5KA 1I9IL 4A6YH 1I9JL 1T5XA 3BQUC 5C0IA 1JBJA 1DL7L 2HA1A 2AKRB 3O11B 1CE1H 1F3DJ 2QADD 4MDJA 1IGCH 4DN3L 3LN5B 1CIUA 1GCFA 1I8LA 2Y72A 3C60C 4MWFA 1UVQA 2MJWA 5SWZE 1JUFB 3LKSB 3QUXB 4JJ5B 43CAA 1F4XL 3PWJA 2ZUSA 5HHPA 4TOYH 4M7ZB 1MRCL 2J3SA 4U33A 3WLBA 4OCYL 5CP7A 2F53B 3FOLA 1SM3H 4LKCA 4JY6A 4XAKE 5IFAL 1ADQL 4HKZB 4XP5L 1KN4H 4XWGL 3NTCL 2A9MH 3DVIA 5GS0L 3FQUA 3T8XB 1CGYA 3IDYB 1NGQL 3D39A 4K94L 2DQCH 4UT9L 3EOYG 1IARB 1OAKH 4U1LB 1R0AH 5B3NA 2DM7A 3UPRA 4NNYA 1A1OA 2Y7QA 4UQ2A 3T1WA 2KUTA 2HVKA 4N0YL 2DLFH 4S1SH 4GQ9H 4LSSH 3D85B 3Q6FB 4EUPH 2DQTH 5D1QA 4JREB 5DK0A 2F54E 3K2MC 1F4AA 3O0RL 5F1KC 1YY9D 2P45B 1OWRM 1NMAL 3OTTA 4NN7C 3CAFA 1KB9K 1DBJL 4JFXB 4J3OC 4WFED 4OI7A 5D1ZD 3RL1B 3O4LB 3H8NA 1EDQA 3MV7A 4KKLD 3VRIA 1P1ZA 2DTML 1CK0L 3P2TA 1JHKL 2FO4A 2Z8RA 1P7QD 5F89A 1A6WL 2XWBB 3LS5H 2AVGA 2DI7A 4O58H 4JPKL 3QH3B 2V2XA 2OXGA 2ZCLH 2NY5C 3BH9B 1R3KA 1YEDB 1Y0LA 4ODHL 2P47B 3T0EE 5JOFB 3BH8B 3HPLB 4N0UB 1PYWB 2ZJSH 1QVOB 4ZYKA 3SCMD 2O5YL 3GIZL 1MF2L 3QDMB 1XF1A 4LCYB 4MB4A 5C0NC 4OZFG 5K33A 4JZNB 3BWAA 4G3YL 4MMXC 4LCUA 4HBCH 1OLLA 1M05B 1S8DA 3ARQA 2PW2A 4TVSa 4WV1A 2VOTA 2A6IB 3IETB 2YA0A 3GBNH 3RI5K 2X9YA 1CGSH 4OCRH 4EIZC 3FOMA 4CMHC 5IB5B 3GMQB 2D4FA 5T1LD 3TYFA 2QSVA 1G7QB 1ZVSA 2JK5B 5IESH 3D87B 4G6AC 3OKNB 2FSEB 3RWHB 1IKNA 4P2QD 2P7TA 3E3QC 2A2QT 4PY8J 3QO0A 1DVFA 3FT4B 4ZAKD 3RUGF 3G08A 5I8OL 1Q0YH 3V0VA 5KSAA 4NQUA 1GAFL 4MLIA 5TFSL 3VXUB 3P0YL 4G80A 1UH2A 1FFOB 4IMLB 3W9DA 3C2SA 4HAFA 4KK5D 5I75B 1C8PA 4I8DA 3PHQA 3RRQA 3GSQA 4PFEA 5F9WC 2HT2C 4ZFOL 3QP3A 4ZFZB 1EMTL 5J12C 2DF3A 3QI9C 5FM4A 2J6EH 1LD9B 1UJ3B 4PJIE 4PTTA 1I7ZB 2YC1B 5DRWB 2LAGB 1FNEA 4XZUA 1MAMH 2BOCB 1T0NA 4GBXB 1A4JB 1CE6B 5L2JB 5JLZB 4ZPTA 1NMCB 4H20L 3UTQA 1A02N 3GBML 1JNLH 4POYA 1IAOB 1MWAL 2IPUG 2R0LH 3ULVH 1CT8B 3CK0H 5AYUH 1UEMA 4R4BA 3V6FA 4PJ7E 1SEBB 4LVOB 1I8MB 5I1LB 4P5MA 2RQ8A 2JIXA 1IAKB 5FGCE 3LEVH 1DQQA 1EERB 4WWKC 1G7MA 4APQA 1GGCL 1I3VA 5GGSY 3TESA 4XPAH 1P5VA 2XYCA 4KTDL 5DD3H 1AE6L 4KQ3H 2MQCA 4IRJC 4DKDC 3BOVA 3TPUA 3T4AB 4WHTB 2ZSWB 5ICYB 4G7VL 3GJFK 3S36H 1MHHA 4XT1C 5CZKA 3RWDA 5EZIH 3BQUB 2FL5A 1XGQA 2BFVL 1S5IH 4MNGE 4UT6H 4I3GA 5ESAA 1Z3GH 3EKCA 4XCEA 1U8LA 4GW4B 2P44B 5JOPD 4GXUN 4LLQB 3L3GA 3AAZA 4UUJA 4FZEL 3D2UA 4QOKB 1P84K 3W0WD 2H1PH 3C60B 2WUBL 1OTSD 3SPVA 2SEBB 5CBEA 3GJEA 4F57H 3ULUF 4LOUC 5TPWL 1S78D 1LO4L 2GT9B 1WIPA 5E00A 5F96H 5F8RC 4YDIH 1XR9A 3V4UL 4ALAH 3FB6A 5DFWH 4Z9KB 3G6JE 3S9DB 1MSPA 4XVUD 5IG7A 4MNQB 3DO7B 1RHHA 5KAQG 1HXMB 1YN6A 1E27B 1KCSL 2H2PD 2G2RB 4N9OB 4Q2ZB 1A6AB 1KTDB 3MRIA 3PP4H 1NLBH 1XF4A 4KI5E 2YD3A 4XVJL 1TPXC 2F5BL 2OP4L 5I8EB 1LMKA 2CDGB 1S7XB 3KJ4C 3VW3L 2DQEH 3G6AB 4ENED 4HIXH 3SGKC 1VFAB 4C56A 3WHXB 4ZD3L 4U49A 4JVUA 4LLDA 4WEBL 3V52L 3WIHH 5JIKA 2L0DA 3BEVB 4M48L 4FS0A 4NN7B 3KYNB 1JMXA 5IROC 1OTUD 5F1IB 3ALWA 5EU6D 4X6CB 5DHVA 4Z95L 3MLUH 2GTZB 3U0PB 1MOEA 3FAWA 1S9XB 1S7TA 2HTKC 3ZE2E 2OL3L 5DJAB 4Y19A 4YIQB 4RA3A 1BFOA 3A0OA 4XPHL 3PE9A 1Q0XH 3QUMB 4K23H 1MI5A 1NCNA 1X4ZA 5EC1B 5EZOH 4MMZC 4MNHA 4PRAB 3N1PC 5DUBA 1D6VH 2EDXA 4OCLC 1RV6X 2JJSA 3U48A 3VXMA 5I1EL 1HIML 2QSTA 5DT1H 1OAXL 3LSOB 3MNZA 2ICWI 2BNQD 4O51A 4NO0A 4GW5B 3RWIA 4M02A 1MRFL 2ADJB 1FRGH 2BVPA 4JRYD 3K0WA 5E94B 4BFEA 3VJ6B 1MRDH 1H3GA 2VDLL 2XWJB 1MCEA 4Q74A 1DTUA 3QUZA 2P49B 4MVBD 4XBEL 5D6CA 1DR9A 4AT6A 5GGTH 1F5WA 3RNKA 4PJHA 5ICXA 3DBXA 1YNTB 3GSWA 4M5YL 4OJFH 2IPTL 3KPPA 5BVPH 4ZFGL 4UIMB 3LAFA 1CFVL 4PJDB 1JIBA 2A77L 4HS6A 1A9BB 3QDJD 2KQMA 1I7TA 5T3ZD 3IXTA 4FP8H 1CBVL 5EOTB 4P4KD 5TE6H 4M7LH 3P40A 4HK3J 2W9LA 1CXKA 4O2CA 3P0VH 3BZEB 4JAMA 3C6SA 3ABZA 3SKOB 4NQEB 4J6RH 5C0GA 1PKQB 4L8BA 4XVSL 2UYLB 2Y25A 5FHBH 2EEDA 3BFOA 2CR6A 2DM3A 1YEKH 2EDLA 3UYPA 4WUKL 1RSFA 5IVZA 3V95A 3GSOA 3L5WA 2V5MA 1J1PL 3E6HB 1T04B 5F9WB 4PD4K 3S4SA 3P9WB 4OZIB 3PP3H 4G6FB 1FJ1A 2APTA 1RMFH 4U1KB 1BM3H 3K8LA 1AGDA 3QI9B 4JANB 4MJ2A 5J12B 1CL7L 1D9KA 2ITCB 4PRPA 1CFSA 2HKHH 3PWPB 1OGTB 1A6UH 1RUAH 3C5SA 2G5BA 3MRLB 1P4LA 1OAYL 2ESVE 1M7IB 4GKOA 5DK2B 3EO1B 4JHAH 3KPRE 5HHMB 3RQ3A 1MFNA 3H9SE 4Z7VE 5DD6B 3QA3B 5FCUL 1Y18B 1T1ZA 3PHSA 5MEQB 3G6DH 2LU3A 4I5BB 4Z7NE 1JJUA 1IC1A 1V3KA 1UZ8B 3FZUC 2VE6B 2H6PA 4B53A 1DBAL 5IKCA 2NTFA 3NH7H 4RMSA 4LBEB 1FFRA 3KPSA 2GJ6D 4POZC 3BKML 3MXVH 1B4RA 2CR3A 4MJIB 2DMKA 4NNPH 1SBSL 5JW5A 1IC7H 1UCTA 5AWNH 2X4PA 4DJMA 4I4WA 4WWKB 3IDIB 1JI1A 3AREC 3X17A 5KSVB 5DFVD 2WQRA 3ZLQC 4QYOA 1T0PB 1J0YA 3TT3H 1XF3A 1PY9A 4IRJB 2O5ZH 5IEKA 3D9AH 1BAFL 1X6NA 3GNMH 2VB5A 5HHVH 3LHPH 3RUGA 3M1BA 2R0WH 2DBLL 1ZHNB 5HYEA 1AXSA 1I1FB 2O61A 1JGLL 1NEZG 4Z8FH 5JHDA 3HE6A 1DDHA 4L9DA 5C0AE 5FO8B 3L7EB 1BVLB 3R1GL 4KV5F 2Q76B 4MDIA 4YPJA 3SY0A 5LAXB 3F7RA 1I1CA 3ARBC 5LGHL 4QHMB 1F58L 5EU7E 3BVNB 1CR9L 1OGAB 3FHAA 3VFNB 5HDLA 4PJEB 3P4LA 3W82A 4NM8L 4UDUA 5KVFL 3JV6A 2AJSL 2AABL 1HDMA 1MCPH 4HGKC 3UZVB 4NPYB 1EZVY 4ETQA 3PNWA 2WINB 5TE4H 3L3OB 2QHRL 3MV9E 4IIQC 1JCKA 3QNYA 3WEXA 3HLAB 2VISB 3IU4L 4KRPC 5CSGA 5GS1C 5JQ6H 1FBIH 4QY8B 2N7AA 2CPCA 4EI5A 4DZ8A 3ARDA 1QBLH 2ENSA 3CFKA 1TLKA 2NY5H 2E9BA 1AO7E 1YY8B 2FDBP 1T21A 3AY4A 5D2NE 4KZEL 3ARUA 1NJ9B 4OIIL 1WBXB 1TPXB 1GGBH 1MCOH 3KJ4B 5DEZA 4NQSA