4AZ8B

Crystal structure of the complex of the caf1m:caf1 chaperone:subunit preassembly complex carrying the kdkdtn insertion at the f1g1 loop region
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
134
structure length
126
Chain Sequence
EPARITLTYKEGAPITINIDTELLVGTLTLGGYKTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Mechanism Controls Traffic in the Chaperone/Usher Pathway.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Chaperone/immune system
molecule keywords CHAPERONE PROTEIN CAF1M
total genus 25
structure length 126
sequence length 134
ec nomenclature
pdb deposition date 2012-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09255 Antig_Caf1 Caf1 Capsule antigen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4az8B00
4AYFB 1Z9SB 3DOSB 3DSNB 4B0MB 1P5UB 1P5VB 3DPBB 1P5UC 4AZ8B
chains in the Genus database with same CATH superfamily
1PD0A 5DUMH 4X5WB 3D48R 4P5KA 4YK4B 1RZJC 1RZGA 1OSZA 3VI3A 3RWHA 1QSFE 5EO1A 1UJ3C 4EUPA 4Y89A 1R3JB 3BH9A 3L08A 4IBQA 3VI3F 3N43F 2EIJB 2YQ2A 4GPVA 2VITB 3HB3B 3PQYE 4DFHA 3FTYA 1BM7A 5F7LB 4HA1A 3MKKA 2IGLA 2ZNWA 1XGTB 2H1LM 2R0WL 2Z31A 2WIIA 4I3RL 5DD3L 1KBVA 5E1AA 1QUPA 5CHNB 4UNTA 3UTTA 4LMQE 1RIHH 4HJ0D 1PZCA 1QABA 2ADIB 2DQGH 3IJYA 4MJIE 3R1GH 3S2CA 1TOXA 4FNLL 5J06A 4G7VL 2Z93B 1KV3A 4K15A 1D5MB 1L9NA 1O6VA 4CBZA 3LMJH 1BQHB 1V7ML 3LXUX 2JI2A 1ZHLA 2C9PA 3BVTA 4HC1H 5FW8A 5LWYL 3FQWB 4JY6B 3KPNA 4LFHG 4XMWA 5I15H 3G5VA 2HX8A 4QRFA 2EDBA 1TNMA 2B20A 2CIIB 2ICWA 3BUYB 3DPDA 3TNNA 4AYGA 2J8OA 1FC1A 3UZQA 4FERA 5JQ6L 4IIQA 1A2YB 1HWWA 3RWCA 3TVMB 4OR1A 5J5EA 5LKNA 3IWUA 4XR8C 3TJEL 4BZ2A 2DEXX 1FFPB 2IPTH 3DHPA 1WYJA 1YNLL 2G75B 1RFDL 3WIIL 1UFUA 3BP5A 3WUWG 2VSDA 5JPMC 2OM5A 1TVBB 3BMWA 3EYQD 2HLAB 4OQTL 4YO0B 4NIKB 2OMUB 4YFDB 3V7AE 3FT4A 1V5JA 2F7RA 1HHJA 1FAIL 3BSZL 5JOFB 4ZFZA 5C08A 1G87A 3DVNB 3QJTB 4X8JB 2WB7A 4NC0B 2YBRB 4PJHE 1KTKE 2HKFL 2C7UB 4F20A 3WSQL 3LNEA 3OKLA 1RZ8B 1A1NA 2GJZB 4P5SA 3VE0B 1H19A 1XZ0B 3GB7B 3CXHJ 5I6MA 2ED6A 3T2PA 5CJ5A 1J8HB 2E9IA 4J8RA 4JQVC 3CH1A 1GGTA 1TIUA 4NXSA 5F3FA 3QAQA 1D5RA 2E6JA 1GZQB 3ZYIA 3DETD 3K2IA 4YVNA 5AG8A 1U91A 1KIQB 4WI5A 3RWJB 3ELAT 1UWXK 4I18C 4GBXA 2DWEB 4I5BB 4N6RA 2GIMA 3D85B 2IOIA 4OCSH 4NO0D 3QDME 1TCMA 4QHLA 5E8NB 1OP3K 3VGAC 1DQQA 4PQXA 2CO1A 3NJLA 1I85A 3IDGA 4HMDA 5EUKB 3VFRA 1MCSA 5LAXA 1P7BA 4DESA 2Z35A 3OAZK 4LSTL 2CKNA 3SQRA 2VSKB 3U9WA 2YR3A 4MJHA 1RZKH 2R83A 2IBZY 3QRLA 4PJEA 3IAGC 4BRVA 1P4BL 2IAMA 4PB0L 5CILH 5H94B 2O61A 1TSHA 2ITFA 4TRPL 1JCVA 3HFML 4FG4A 5CSBA 1KB5A 4R4FH 2JCCE 5D4HA 5SWSB 2E6PA 3B5TA 4G72B 2WXQA 4AKPA 2K8MA 1L0QA 1NMAH 3AUWB 3UPRB 4HX1B 1S7VB 2KZ1B 2YD3A 5KSBB 4PJDA 4GSXA 1WS8A 2VLLB 4AM0A 3NZSA 1H15B 3FN3A 1RD6A 3DHJA 3IXTB 4NBXB 3WEXB 1FYTD 3PWPE 4UI2A 4XPGL 2WSKA 3HG5A 3WHXA 5CJ8A 5EEYA 3Q6FA 2HTKD 4PJHA 4GO6B 4X5XA 4UMSA 5ICZB 5DU7A 2AJSH 3LKSA 1W8NA 1HFUA 2DQCH 1XIWB 4PJEB 1L3NA 5FDWB 4DP9X 4HWBL 4ANWA 4WUKH 5LDUA 3QDMA 3QIBB 2XG4A 2OYLA 1IEBB 3KL5A 3SD2A 5MEQA 4FADA 5E4OA 1S3RA 3G04B 4OGYH 2B5IB 4WW2F 3ZK0A 3W81A 2HJLB 4LCWE 4GYBA 5FKAA 5TE4L 3SSGA 1JFQH 1YEEH 2FVNA 4Y4KA 5SX4I 3RE0A 1EHXA 3BT2H 5EIIG 3RNQA 1KBGH 2UXGA 1BVZA 1FLRL 1HIMH 1SM3H 3K4DA 3O9WA 3RWJA 5C0RL 3WTVA 5JZ7D 4WSKA 1L9SA 2W60A 1CFNA 3CFEB 1HSBB 2OW6A 5HVHB 2B39A 3AQYA 3KYOA 3PWVA 4AG4H 3LQAC 3IE4A 2XETA 3QEQA 3ZOAA 5CJBA 3KBHE 4Z7AA 1CICB 2DWSA 4NNYB 3NQIA 3ZVVA 1TLMA 3OKLB 1D5ZA 2P80D 3VFUA 4IBVA 3RX8A 3P3RA 1IBDA 3TT1H 5F7AA 4PSRA 2MOGA 4OD2B 1U21A 3NA4A 1N6QL 1L9MA 1T0MB 1DLFH 1FLTX 1YEJL 2IO5A 3DVNA 1F18A 4YAQA 5E95B 2OMUA 1BQUA 4MA3A 2OZ4A 3PWUB 2ZAHA 1WGOA 1BECA 4E9SA 2B1AL 3S36X 5AVYB 1NCAH 1YUHB 3GKWL 5HHOA 3BMVA 2EDTA 2OSWA 3KPPB 5DUBB 3VWJB 2ZOWA 1FJ1B 3VW3L 1C8PA 1FVDA 1V10A 3ARDD 5IVXB 3NACL 4G9DA 4H1LG 4PYGA 1GJUA 1TO5A 3W9EB 4DIXA 1DFBH 1JFQL 4WNSA 2FECL 2YD4A 4G80A 4NKDB 2P48B 1IAKA 3QDJB 1NMCC 2O5XH 4TKWA 3E80A 5ETUB 3WG7B 1FLRH 1HIML 4Z7VE 5F3BB 5JO5A 3NJMA 2GI0A 3CXDL 1E30A 1U2YA 5FA3B 4HUCA 1CFSB 2FZ3B 4V1DB 2UWEB 1MWAL 5FECB 3Q2VA 3M1BA 1D9KC 3IB4A 1B0RB 4B6ZA 5JHLA 4Z0BL 3DO3A 1AGCB 4P49A 2QQNH 4OZIB 1ZJAA 4Y5YB 4AL8C 2YEVB 2FATL 4GS7B 4R26L 2H6UA 1A4BA 3B56A 4JO2L 1RLBA 2BZCA 2VITA 1I3GH 2Y24A 2F53A 3VFPA 1M7DA 4JE4B 2LHAA 2VXTH 4BD4A 4K9EL 4ZUUA 5FYKE 2Z92B 1F41A 3TWCL 1IC1A 2G3ZA 1SUJA 4RMUA 4MJID 1QTYT 1IFGA 1ZY9A 3GSVB 2Z1PA 2OULB 4ADGA 3O2DH 4W6XB 1EPFA 2C9SA 3IMUA 5ES4B 2P4AB 4I7ZC 4ZTOL 2C4FU 1T0OA 1Q38A 1R33A 4Z8FH 3L3DA 5H37H 4KX9A 1B4JL 3S34L 3ARFA 3IN0A 2CJUL 3QUML 4RFEA 3VFOB 4F8QA 1QA9A 3R4RA 2E4FA 4XBGA 3RGVC 4F9PA 4ZFGL 2BSED 12E8H 4IRJC 4V1DE 3QHTC 1ZEAH 3VFOA 4OIIL 2VIRB 5MENE 4GBXD 1HI6B 3WJLC 2GG1A 3PNWB 4BFOA 4R4ND 1TVHB 1LP9F 1HDMB 4KK8C 1M05B 1QAWA 4MAUH 1O7SA 4U1HA 3DBXA 2QPDB 2FE0A 1PW3A 4QXGL 2ZCHH 4PJEE 3UCRA 2Y1YA 3ALXA 5KTEH 4ZUUB 3T2QA 1UTDA 1SN5A 4AYEC 1KJ2H 3R0MA 4LNVA 3C09B 3M86A 2NY0B 3H9HA 3LSOB 3L8QA 3LNDA 4QAMB 3LNFA 4AQEB 2XWDA 1YEEL 5C0ND 1EAPA 2G60H 1S9XB 2P45B 2YXVA 4DSYA 4YSQA 2WM0A 3MOBL 3QQ4A 2VN6A 1OAZL 1XCWA 3S35H 3TEYA 4JDZA 3HKFA 1EK3A 1MCLA 1QFHA 3GO1L 3ZKXB 1OB1A 2HG5A 3BGFC 3C2SA 1ZTXE 1NCDL 3SIKA 3S8GB 4OB5H 2UWEA 4J5VA 4RWHA 3HRZB 4XMKL 4XGZA 3OXSB 1X9QA 5C0CD 2X4RA 1XH1A 2EABA 4PVMA 3EH1A 4JMXA 1G9EA 2XIIA 3WLBA 3WJMB 2A83A 3PHQB 5D7LE 2EDLA 4L2YA 5JO5B 1EXHA 3CMGA 3DECA 4KV5F 1CXKA 2DPKA 2EEXA 1CC3A 1XXDC 4LP5A 1JZHA 5GZNC 2ZT9C 2NY1B 5C6TH 4KO5A 3RY5A 5AOZA 3P54A 4XC3L 4ZMWA 3MXWH 3VJ6B 1KIPA 2DTSA 3KR3H 1EXUB 1RHHB 1JNLH 3NCJH 4G9DB 4JRXD 3N41B 3UADA 4NAMA 1MREH 1NCAL 3GYRA 4KVPA 5INCB 4W1TA 4ZI8A 2F58H 5EUOB 4M3KB 1TYEB 5JIDA 1PMYA 5D1QB 5T33L 2FJGB 4S1QL 5J4MA 1OHZA 1F4AA 1UA7A 4G7SB 5AEAA 5AOMA 3W2DL 3NSJA 2J6EA 4JKLA 4OCYH 1SVCP 4OD2A 5D70H 4PJ9B 4X9IA 5L8LB 1MCKA 3O2DA 4MHHI 4HP5A 4V2CB 1UWYA 3B7RL 1MDTA 3PWPA 2R9HC 2WSPA 3HBZA 5D2LB 1G9MH 1HCYA 4NO3B 3QEQD 3DSFL 1WVZA 1CICA 1INEL 3RX5A 1S9YA 1L9QA 4G1EB 4H2AA 3SB3A 3GJFA 2GI7A 5JQ6H 1HSBA 1ZJBA 4OM0L 3T9WA 3VH8G 2AV1B 4WV1C 5D7JB 1KJ3L 1YMMB 4BFGA 5DWUL 2P42B 2IANB 1W72L 1YEGL 1B4RA 1J1OL 3O9WB 5BZXA 4EI6A 2D4DA 2CDFB 5F3HA 5GRVL 5HP5A 4X7CC 1ZE3H 2WC7A 3TFKD 5EZLB 2DL2A 4XZUB 4K3JH 5SX4H 4NAQA 4DUVA 2HJLA 1U8QB 3H3PL 4AEHH 1GXEA 4J3SA 1BZOA 2NY2B 2V5RA 4NHCH 5AZ2L 4F7TB 5CGTA 4NPYA 1A4JB 2BWQA 2IFFH 3F62A 4U6TA 3GDCA 1IEBA 1L0XA 3IJ7A 4UT6L 5MEQB 2XG4B 3DROB 4NCDA 1XR8A 1AS6A 2NR6D 1YAIA 3NFSH 4NQEE 5AZUA 3F7PC 3F7VA 1C16A 5EOTA 5IQ9A 1BV8A 1GGUA 3LKSB 1AQDB 1OAQH 4I87A 3FL7A 3IGFA 4K3HA 4FABH 3LY6A 4QI3A 2P5EB 4ZX4A 2DMKA 1XGRB 4K71C 1E27B 5DK2A 1BQKA 3HTLX 2XFGB 2ZSVA 4C56E 3QJVB 3L2LA 4OTXH 4HUVB 5AFAA 1KXQA 2VLLA 4S1DD 4ZFGH 3ESVF 1CDYA 2JTYA 1T83C 3GS7A 3BP6A 1AHKA 3F7YA 1XMEB 3QJFB 4PGEB 4PJDB 5LGYA 4O2EA 4JVUA 4XMXA 1T20B 2DEWX 2IWGA 2WQVA 3EYUH 4MZ3A 5F93C 2EO9A 5EBGA 3TBVB 2YUWA 2BS8A 4MASA 3BC9A 2Y2WA 1TEYA 3FO2B 3GBMH 2FYVA 1J5IA 2FRGP 4UAHA 5ESQA 4DTGL 4WTZG 4YHNB 1E5BA 5I6XC 1G7PA 2XWBB 4BK8A 3ULSA 1RAMA 2F54D 1BJMA 3QI9B 2F53D 4HFUL 4X0KB 4UT9L 1ULVA 3GM8A 2JKNA 4EXPX 3VXOB 4JKKA 4M5TA 1UT2A 2BRRL 1AGDA 3TYGL 3UYRL 5FK9B 5EUKA 3EF7A 1BF8A 1ES0A 3TJPA 5EU5A 5GS2D 3R0NA 4KZDL 4UNIA 1FG9C 2QSVA 4CSSA 2HRPH 1A64A 2C3HA 1W0WA 3MOBH 2W9EL 5I30L 1XF3B 5DUPH 4LOVA 3ZE1F 2A4ZA 5H2BB 1NCWH 3LDBB 2D7OA 2PUQT 2JJTA 2FUTA 5D7EA 1SJVA 4MD4A 2IBGA 2WXMA 1U91B 3E8VA 5HJ3B 5EZJB 4GQRA 3SGEI 1D3CA 2GJ6B 2ENYA 4MCYB 3QQXA 4TF4A 3TO4D 1IKOP 4HS8L 3U7YL 3CH1B 1OV8A 4J8RB 1ETZB 3S5ZA 3JVGA 3BKYL 1F4WL 1XZ0A 3GB7A 4ZW7A 2VM9A 5FV1L 1A1NB 1CDUA 1N18A 2GJZA 3L4UA 3VE0A 4ELMF 1RK1A 1S6NA 4F8NA 4LKXB 4TUOA 4ZJ9A 4HIHB 2DQHH 4ELMA 1P2CB 4ZFZB 2WQXA 1Z9OA 1V3JA 1NM9A 2L7UA 3FT4B 4M43L 4PLJD 1OGTA 3AB0B 4XODA 4YO0A 3SQBA 3TCLA 1LO3H 3GEWB 4CNIA 3MV9B 5FF6B 1LP9E 2RFXB 1WUNT 3L4ZA 4KXDA 4WHYG 2H9GA 1KB9K 1BIHA 2G75A 3TFBA 3MJ8B 2BHYA 1MFBL 2GSIB 1PZDA 4FZ8H 5EUOE 2NSXA 2VDMB 3BRDA 1IGMH 3NFPA 4L29A 4IIQB 3U1PA 1WK0A 4RFOH 5CP3A 1YN7A 1G0DA 2V9RA 1G84A 4NQQA 4MDIB 1W6LA 5D7SH 2A6KA 4LDEB 3O81A 3G5VB 3K71B 3WFBL 3DIDA 1BQHA 1T89A 2ZX5A 1KENH 2MMXA 4R84A 2ISDA 1UB5A 4AG4L 1WD8A 4HJIA 2WLLB 3QNXA 2CJSA 4HK3N 1CS6A 4W9FC 1XD1A 3DX8A 5T1DL 4ZX3A 4XP1H 2ADIA 5JW3L 4GRWE 2IFGA 1WA2X 3HHSB 2MCPL 4B0MB 5J1SC 3NPZB 1C12B 2JJUA 2PPAA 3NACH 4PMFA 4B27A 4JR9L 1F8TL 1EMTH 1HX0A 2X4NB 3D0AA 2DMCA 4Q0XL 3O0RH 2XWJA 4MSWB 1ZANH 1AACA 1HXMB 5CEZH 1ZHBB 5HPMB 5KOMC 5LBSL 2YPVL 5FM4A 4EUPB 3T0XA 4IRZL 1T83A 4BZYA 1ZWIA 3TGXA 2OZNA 2R2BB 1X4YA 2Q76A 2YKLH 1CDBA 3MR9A 5FO9A 1A6AB 1MFBH 4U1JA 3VI4B 4PRBA 5IB5A 4KJWC 3KNBB 1G6RB 3EF4A 1MWAB 4LSRL 3QXDB 4RZKA 2OMXA 5IBTH 4BSVA 5DMKA 4LPYA 3U0WL 3GUTB 3SDYH 5D7HA 2ENQA 3EO0A 4CSZA 1LILA 2QVMA 4OFVA 5GIRB 1CICD 4HMEA 1QLEH 4ZNEE 3IGAA 3L3OA 4OGAD 2BVOA 5AB9A 2E7MA 3T65B 1KGJA 4TLTA 1SVZA 2WAQA 3GSNL 4MD0B 1E42A 3RGVA 1WAAE 3OD3A 1BM3L 1MFCL 4JRXE 4DUWA 1BJ1H 1Y6KR 3TYFA 1QFPA 1DJWA 1BEXA 1CLVA 1M1XA 3MLYH 4AQOA 5I19L 1H9VA 1NJ9A 1I1YB 1X4XA 1N4XH 4EVNB 4HCRA 4I18B 1NSNL 5GGRA 1Q72H 3GC3A 4F2FA 3CFNA 3V4PH 4MNQB 4RESB 1FNAA 5C3LD 1J1OH 2HFFA 3II1A 3VFGL 2W9EH 3LH8A 3NCBB 3HUJB 3ME0A 5I30H 3MGOA 1VADB 2GCYA 2KDGA 4NUMA 2V7HB 5E2VH 4F2EA 3VVVA 1LQSR 5C71A 2PXYD 1F4HA 4FXKA 1WCBA 1YA5A 1N6VA 1KLFB 2X6VA 4PWEA 4WEBL 5T3XE 1R24B 3ZGHA 1I7ZA 2DICA 4KVNL 2UYLA 2PPEA 4R0LC 4YDKH 2IH9A 1MFNA 1XF4B 2GJ6E 2Q9OA 1S7TB 3I6LD 5E6ID 4KY1L 1EEZB 2PCFA 4DAGH 3N9GH 4N0UA 5CKAA 1AZRA 1MPAL 2HLFD 3LXAA 3O4LA 3RG1C 1CGSH 3GIVB 3KXFE 3EYQC 3SJVD 1K4CA 1JS4A 2G4GA 1ZEAL 1G9NC 3EO1B 5ENWA 1S7XB 4B9JA 3FN9A 1K4DB 1CJYA 3GSNB 3ZO9A 1EQWA 3SDDC 4FNRA 2A6IA 1Q8MA 2XWXA 4PJXF 3KLLA 4Y5VA 3LKRA 5EIQA 3UAJD 2IOMA 3UMTA 4N3TA 5LXVA 4F7CB 2XWRA 3KYNB 4HIXH 1M2OA 4JLRB 2BWDA 1H0DB 4WK2B 1S5IL 3D8MA 1DUYA 1LP9B 4RQQB 1A6VL 3PHAA 4BCYA 1JPGB 1T80A 1AR1B 3TC9A 1IBYA 4D94A 3UXFA 3LKOB 4YS4A 4Y4HA 3BSHA 1NL0L 2YLKA 5HYQB 4N68A 4XVOA 1ZV5A 5AB1A 2PW1A 4XP6H 3T3PE 2AQQA 3QORB 3QXAA 4APQB 2G2RB 4ZFOL 3VFWB 3JTSA 4U1KA 4B60A 3GWJA 3GO1H 3D69A 5JA9A 1KG0B 1DCEA 2X4OA 4BSWA 5A2CA 4KXAA 5HY9A 2CUMA 3LRHA 3QA3B 4UTBH 5D2NB 1GHFL 2DI8A 3UTSD 2Q6WB 3NJFA 2Q7YB 3LS5H 3LJ3A 1NGQL 5I0YA 1EV2E 5DHXB 3T4AA 3N42F 1LDPH 2Y22A 4Y4HC 2KZKA 1RSFA 4IOFC 2DOCA 4Z7VA 2F5AH 4BKLB 1BFSA 3NRPA 4MNGB 4YZFF 4U6XB 1TJIH 4ZZKA 5CGYC 5IJCC 4LQFL 3OZ9H 2X7LA 1PLBA 3MTXA 1OCCB 4Y2OA 4XXDA 5BRZB 3NZHL 1AHWC 1IGFL 3VFNA 1KGCE 3PDOA 1B0GA 2CO6B 4TNEA 3TJEH 3IE9A 4AT6A 2G5BA 1C5BL 2E3VA 3OKNA 2VXQH 1UM4H 5DC0A 1QRNE 2WBJA 2WKGA 1JGEA 3VWJD 3T71A 3ASOB 5IQOA 3SDYL 2H45A 4EIZC 4G8IA 5T3ZL 2B1AH 4XTRD 2C3VA 3EFDH 3AU1A 4P23D 2A77H 3OMNB 4KK8D 1J48A 3X17A 1KEMH 2HKFH 3IWVA 4AV5A 1JNHA 3L3KA 1FFOA 1SJEB 3FULA 4JPWH 4CJ1A 4HJGB 4FNPA 4LBEA 4NC2B 3MRNA 2ILLA 4YL4A 4OLVH 2CQVA 4AQAB 2VGLM 1NAMB 1AY1H 3HI1B 3K0WA 5D96B 4PLNC 2HYMA 1ZA6B 3QIWA 3FT2A 4N2AA 1LLAA 3ZN6A 2J5WA 3HC0B 1VFAA 1ZE3C 3EJJX 4LARL 3NIDF 2HFEA 4ACPA 3FUNA 4HHWA 3UFIA 3FB7A 1GTNA 1W15A 2V37A 2F2HA 4K3DH 5T1DH 4LLMB 4Q4EA 3NFNB 1XGQB 1ZLSH 2EIEA 1JNJA 3RU8L 2E9WA 1GH7A 3FTWA 2FYYB 1LEGB 2ATPA 2JIXA 4LEXH 2CMRL 3P3TA 4JY5L 2X70A 3HVNA 4KK9D 5DLML 3QQ3A 1D5IH 4ZO9A 5D96C 1PLCA 1U42A 3QSKB 3SODB 2VJ0A 3X14B 4OIAA 1SMOA 1T3FB 1VENA 2CALA 2WQAA 3DI2B 3FN0L 4S0TD 3BDXA 5CP7B 2VB5A 3PS6A 3R8QA 5ALCL 3ZZ1A 1VIWA 4IW4C 3VXUE 3MRDB 3MRKA 4JKPH 4CGTA 3VRJB 4H20L 3T0BA 3UERA 5CD3B 3HI5H 4XMPL 2VR9A 3K1DA 3NIFE 1NMBL 5KVEE 1UA6H 1PJ9A 3ARDC 4HCGA 1XMWA 3L95B 4UQAA 3BWAB 3SYQA 4LSVH 2ZYSA 1IVLA 1RPQA 2VDNB 1PY9A 1HXYB 3GSWB 5IB1B 1TFHA 2ITCA 1E6JL 4KAQH 2WO4A 1NCWL 1O9ZA 2ZXGA 2OXGA 3W5MA 3NGBC 3SKMB 3L5WA 4HLJA 1NCNA 3DVFA 4I0PD 5GS2H 2BOCB 4CU6A 2Y6TE 4OGQC 1N4XL 2A73B 3LQAL 4XCNB 5LBVA 1F42A 2VJ8A 3VRIA 3ZDXE 4NIYE 5B38B 5K93A 2VRKA 4F8OA 4PJ5E 3A4AA 4BCZA 1COBA 5DDHA 5I5MA 1UXLA 3GMPB 4XVTL 3VXUA 1PEWA 4JFTA 5IIEB 4LBEB 3PJNA 1YLBB 2Q8BH 1GHFH 2RB8A 3L3KB 3H7BB 1I82A 2BVQB 1RZPA 2OX5A 4NKOA 2XZAL 1UD5A 2H0FA 4JREB 2C3VB 2VM4A 3H9ZA 4NFDA 3GXDA 3NCEB 5I1CH 1JGEB 2AJUL 4LPTA 4KKAD 1OCOB 3B9AA 3BVNA 2AJXL 4I77L 1AZZC 4F33B 2WWMD 4X7DC 1Z3RA 4WW2C 3L6FB 3I50H 5IFJB 3S8WA 3TL5A 4IMLB 4YHIA 3T2NH 3VXSB 3WL9B 3CCHA 5CZXD 4A2FA 5EDXA 4YSDA 2OCFD 3U36B 2WTRB 4YBHA 1EX0A 1A7QH 2NNFA 5I0WA 3BD4A 3O3AA 2QV2A 2WXOA 5D9SA 2A0LC 4XO4A 2VXQL 3L1EA 5BV7B 3LRKA 3MSPA 1RIVH 2NNRA 4IYKA 2AV7A 2ZF8A 4FQJH 1NEZA 2EDOA 4FLQA 4UILH 4A2LA 4X7TA 1AP2A 4LKCB 4H25A 1F2XK 3FHEA 4A7UA 3OF6D 1T1ZA 3DVGB 3GXMA 3MFGB 3BPLC 3U0PA 2FIRT 5ITBL 3B7SA 1NWPA 3MRPA 5BJTB 1J12A 2CHXA 2GFBA 4NLAA 4NNPH 4GQPH 5AW9B 3QORA 2OS7A 1JNNL 2D7QA 5I23A 4HD5A 4XWOD 2OJZH 4G8GA 4A6YA 4IGBC 1ZHKB 3BH8A 1DQML 4RCAA 4QRQB 4YHZH 2H7WA 3V6FA 3LKOA 4JJHA 5LXGH 3QNFA 5I16A 4G3YL 3D4YA 4UTBL 4UV4L 2JCWA 1TJHL 5FOBA 4JJ5A 1KYAA 4P3CH 5LN8A 1VGKA 2CDGB 4OD3H 3C60A 2VDPH 1KJ3H 1GCFA 4U6HA 3KYNA 4PJ9C 2BNQA 3T77B 3LKRB 1D6EB 1OXYA 5E2TH 3VG0H 4LSUL 1TKWA 5DJ2A 2PR4L 4IKJA 5F21B 3GSNA 4LEXL 3BPNB 3BUQA 5F9DC 1ZT7A 4XPTH 5IROC 1DVSA 3EO1A 3UTPD 5I1AB 1EDQA 1K4CB 5DRWA 1E7VA 1KF9B 3K5SA 3D39A 4HEME 4HPOL 5JIPA 3HAEH 2WXFA 2LQRA 5EF2A 3C12A 5AWNL 3WBDA 4P2RB 3VB9A 1IFHH 2B0SH 1XF4A 4UV7L 1P9MA 5F70A 5CN1A 4IBZA 1KGYE 3NZ8B 4KZEL 1H3WM 1KBPA 2I32A 2D0GA 1KLFA 2BNRE 1FL3B 5G4MA 1OGAA 1U8OB 3WFEL 1MJ8L 4WI0B 2UZIH 5CNHA 4GP4B 1W0VB 4FFTA 4WHDA 5MENB 3KLAB 4WUUA 2E8ZA 1X9LA 4UT9A 5AYTA 1OT2A 4HQQL 5I1EL 1LO5B 1SN2A 3ZDZB 4IS6A 4HZLA 3MGOB 2DV6A 4ODSH 4I2XB 3RIAF 3T8VA 3S36H 3HE6B 4ADIA 4FP8H 4RMWA 4S1RL 4BFNA 5KS9E 1GSMA 2B4CH 1R3LB 5DVMA 3CJJA 3VA2C 3H3KA 2E7LA 4TTGA 3VFGH 4IU3A 2EDEA 3H9SB 5KEZA 2MRYA 2BY1A 3TYFB 1FNLA 2QQKL 4N0UE 1F3JB 5F71A 1RH8A 2RGSA 3I9GL 4M1CC 2OL3H 5GRVK 1RZIB 3ZTDC 4WW2A 3EYSL 4BQBA 1RI8A 3B7TA 3FQNB 5DJXB 5AVZB 4BQ6A 1KZYA 1SYSB 3TO2A 4CC1A 3L3OB 1JZ6A 3T0WA 4Z5RB 1HZHH 1M71B 3BEWA 3D6GA 3MRCA 1DVQA 4HGKC 4KRPD 4PRIE 3JXAA 4M8UA 5JHLH 2VO5A 3QRGL 3WYRA 4NC1C 3QG7H 3KNBA 4W6WB 3TURA 2I7SA 4P5TC 3CFJB 3G5YA 3FJTA 3PGCA 2EVIA 2ICEB 4PRPA 5K1JA 3MLTA 5IFHH 2Q2EB 5C07D 1AQHA 1L0PA 2PPFA 2X2YA 4X6BA 5GS0H 1CDGA 3O6LL 3MRFA 3IAPA 5BQ7B 4I0PA 4J3OF 3K7UA 4PVLA 4XPAL 5TDNA 3VI4E 4Z0XB 1C12A 4ANVA 1SFHA 5AVUB 1S9VA 1CLYL 3I3DA 5K39A 4PJIE 2G9KA 2I60H 2YMTA 1HVXA 3MV8E 3VXUD 3VQ1C 1WBXB 2L7EA 3S6CA 1DQIA 2EKJA 3B83A 5GGUA 2X28A 3SOBH 1MVYA 3SY0B 2ALWA 4PJEF 4HHGA 2VLKE 2GEQA 1B9ZA 3T3ME 3UTTE 5T3XH 5DJAA 3S35X 4BKSC 3O45A 4UINL 5K9KB 3NN8A 3ECVA 1U8KA 3FPYA 3NVQA 4ISVB 2X3BA 4AIXA 2CRZA 4MDIA 4XVTH 1BZQK 4MAYC 3SDCC 3DURA 1G7IB 4JFEB 5EC2B 3ARRA 1NFKA 4XCCL 4UV4H 4FJ6A 4G7QB 1E8YA 2AEPL 4FQQA 1KENL 3SGJA 4Z7IA 2FSEA 5IVZB 4RFNC 1MIEH 4W9ZA 4HDIB 2WP3O 2BS71 4LDOB 3M46A 1CF1A 1RULH 4WEUD 5FM8A 2EYTA 3TO4B 5FB8B 3FONA 3BGMA 2KERA 3H2WA 1WEJH 2HKHH 5CLZA 2HRLA 4ZG1A 2XYBA 5IFAH 4S1SH 4B9GA 3C5SB 1P2CA 2B8OT 5GGQL 1R4XA 1FORL 2ESVE 1BOGA 3VDCA 1DSFL 1E8ZA 2W59A 4OFKA 4Y1AB 3C5JB 2MH4A 5JR1H 2P8PB 2WK2A 4OLUH 2EEAA 2Y5TA 4RMRA 3VXSD 1T7XA 3N0AA 2I26N 3PFQA 4EOWH 4JFYA 2GTZA 2PTUA 2ALAA 3MA9L 1ETZA 1SF5A 2AJVH 3ULVL 3PL6D 1BIIB 3WFDH 1KACB 3G6AA 2AMUA 4AVKA 1N26A 2GJ6A 4E41E 3DX1A 2WXKA 1A7PH 2XV3A 3DGGA 4G8GD 5EZJA 2WXPA 1NLBL 3B34A 2XKNB 4YPJA 2EZ0C 5H2BA 4X6CF 4HAKA 4BFRA 3UTSE 4UB0L 1WCQA 2QT6A 4PJCB 1UJ3B 5IJBC 3H8NA 2J5LB 4IDJH 3DA0A 3BGFB 3WNKA 4RNRA 5CSZA 5DK0B 1UD3A 2ITEA 4KI1A 3AG2B 1CTMA 1SLVA 3TP4A 4TUJA 4G71B 3CZNA 1Y1UA 3C75A 5KS9B 3LHAA 1TJHH 4IU2A 2DI9A 4OCXL 1G7PB 1NGPH 1O7DE 1CVSC 2ESVB 3DX9B 1RIUH 4RMBA 1IM3B 4Y9FA 2Y23A 2AANA 3DOSB 2QQKH 4X7EC 4EI5D 5KBKA 2WVVA 4LPXA 3A6BH 1HYSC 4LVEA 3QPXH 1T20A 2JH2A 3EGDB 4E9VA 1AQKL 1DJHA 2EDQA 2JTDA 3JWNG 1SLXA 2KKQA 4ZOEA 4HUVA 3QZLA 4XPFH 1GPOL 1AD0B 1IM9D 1VZIA 4MA1C 5DK2B 4GKZA 4WUUD 3AFLA 3RZWA 2X4SA 4X0NA 4KI5C 4N90D 2WLZA 4NWTL 2A3TA 4QCIB 1TZOA 2ROXA 3OKEB 3F7VB 3LEYL 5BRZE 1T21B 3BX7C 5I5JA 3Q6GH 5H35B 4NI3A 3VACA 1BFTA 2NUPA 1NUFA 2DYPA 4X2UA 3BIKA 2B1HL 3AUVA 3Q7JA 3QHFL 2RTTA 3GSOA 3I75B 1AKPA 5C09B 4ZS7H 1WTGT 1LO3L 2LGNA 4L8CB 4RIRB 2BMKA 2F7QA 3TT3H 1BZ9B 4DFIA 4NO5A 4HSAC 1EFXA 3QJHA 2FEEI 4NAJA 3P30H 2VABA 3RIFK 3DETC 4J3OH 5D7IB 3WDJA 5JMRA 5IK3A 4PGCA 5D7JA 5J89A 1WHOA 4PJ7F 1YYCA 3RUGB 4PY7A 1F1AA 1TUPA 3TZVB 4MYPA 4PGZA 4FF9A 5FLVA 4G1EA 2B3IA 1U3HB 3B3BA 1S9YB 3RWGA 3DRTA 1HL8A 4A7VA 4TSCL 2WCSA 3RBSA 4WWKB 2NY1D 2DWYA 4L9DA 4H44C 4X50A 5CJQL 4HKXB 2Y3AA 4YR6A 5CUSH 2VWEC 1RUMH 5A2LH 1KPRA 1R3HB 3HAEG 2YAMA 4NHUB 3US1A 5KANI 2VXVL 1IKNA 3NDZE 1MW0A 1R3KB 1M1SA 5EIIA 4DWHA 1U33A 2KZBA 2K45A 1OVZA 3SPVA 3L3OC 3RVWD 3V4PB 3JZ7A 4KWUA 1OAXL 3E6HB 1A14L 4KI5D 3OAZH 1FORH 2NW2B 4BWUA 1SVBA 4NZDA 1MCWM 3Q9PA 2AJSL 4H8VA 4N0FA 4FTVE 4OFDA 1IKNC 4PVBA 3NZHH 5KYWA 4QYOA 3MYJB 3PIQA 4S11A 5DSCA 2ZWSA 4JO4H 3FU3A 5AUMA 3KPSA 2FGWH 2I7OA 1BQSA 2Y6SD 4LSSL 4ONFL 5DEFB 5CMAA 1XBDA 2RIKA 3EFOA 4M7ZC 4BXVA 2W94A 1MCFA 1LMKA 3I02A 4ZXBC 5TK4A 3RTQB 1NFAA 3B6SA 4MS8D 4PBDA 3RHWF 5IJVB 3NDYE 3MLZL 4NM8L 4ZDHB 4HH8A 3PRZA 3DX4A 4DERA 4H5SA 4AGNA 4HJEA 1Z9MA 2M1KA 3Q9QA 2YEQA 1KT2A 3EUUA 1NH6A 5FYKL 1DZBA 4ZUSA 3MHZA 1PCSA 3U0TB 2ZUSA 1N5AA 3FQTB 1YEHH 3LHPL 3F00A 3H9HB 3KWVA 4Z7OB 1NC2A 3EDJA 4Y8AA 2P8LA 3MV8D 4IEFB 2CXKA 4E5XA 1Q72L 2HWZL 3B9VA 4MJ2A 4NX0A 4KITB 1XCTA 5F6HJ 4QHMA 1FFQA 3VQ2C 5IMKB 1HDMA 2PO6B 3QCTL 2NTFB 4AYMC 3OGOE 1V27A 2PTVA 2NY4D 4HUKB 3RVUC 4QHNA 2GK2A 4JRLA 5C9KA 2R1YB 5IB3A 3VXTA 5DEGA 3RL1B 3IGUA 3X12A 4HAGA 4KKAC 1TQSA 5ITFB 3WMSA 2NZIA 2GJ6D 2RH0A 4AK2A 4P9MH 5E1GA 4M7ZB 3ZZQA 1D7CA 3JSSA 1TG8A 3MNZA 1O6SA 1NBYA 4KMQA 5DF0A 5CGMA 3EH3B 3MJ9H 2AI0L 4P4RB 5DJ8A 3L3DB 4GIOA 4Q2ZA 4GAJL 4Z0BH 3UZVB 2YPLD 2J3SA 3NZUA 1UWEL 2JJSC 2DQCL 3KW8A 4LSQL 4PI0A 2R7EA 4FQXD 3MLSH 2DKMA 4MXVF 3IBOA 5DHVA 3CXDH 3VWJC 4NP4L 2Z92A 1FZOB 4O51B 4LLDB 4HD9A 1KXTA 1XO8A 1K6QH 1Y0LA 3TJHC 3KPMB 1M7DB 3VGFA 2PYEB 4PJXA 5CZRA 1YCSA 5LO7A 1CXEA 1SPDA 1C08A 3BN3B 5DS2A 3WHE0 1Y6MR 5A2IH 2IBBA 1MHHB 2CLRB 1KLGB 3FB5A 5T8IA 4NRYA 4FI8A 4EZJA 2DMHA 4M1GL 3G6JB 3D3VD 1UOWA 3E6FA 1EO8L 1WDAA 3HMXA 3MRJA 5FX3A 3TOPA 4E9XA 2NY6B 5T1KA 3QCUH 4G8GE 2DMGA 3T3PB 2FBOJ 2ZXWB 2ICCA 3O6FA 2P5WA 2NXYB 5FO8A 5JTWA 1KEGL 1NCJA 4R97B 1JPSL 3S48A 3ORJA 5EU7C 1ASQA 3BW9A 2IVFC 4HMCA 3MRGA 1ZLUH 2X3AA 1L7IL 2Z8VC 1IAKB 3QDJA 4JGJA 4L4VD 1UASA 1M3JA 3BWUC 4G80B 2BHFA 2EUXA 2BJMH 2AJ3A 3I2CH 5FUOL 4J3WA 3PV7A 5BZWA 3WKMH 2QQQA 4HCRH 1BVOA 4CN6A 3KPPA 1DVUA 1KYFA 2V5TA 5AENA 4MMXB 4GG6E 1QLRB 4IRSB 5A6LA 4N8CL 4OIIH 3HHRB 4QIRA 3FCBA 1F45A 1NEZG 4NM4H 2MHAB 5IHBA 4HIEA 2AZUA 5CFHA 2J20A 4MAUL 5IHUH 3UAJC 1E8XA 3G6JE 3O4LE 3VFUB 4POUB 32C2A 4P23B 2ZUUA 4DUXA 4J6RL 4GY4A 6CGTA 1SEQH 3APFA 2KPWA 2YK1L 5ID0B 4ATTA 1K2DA 1RZJH 1G6RH 1OTSC 3E1F1 3P2BA 3ZO0A 1FIGH 1ORQB 4DN4H 4RAVB 2CO3A 5GZOA 2W60B 3Q48A 4LLQB 1QHPA 4YUEH 4AMWA 1UOKA 1PG7W 5AB0A 4JO3L 1NCBH 5HYSG 5FYKH 3W39A 4U1NA 1OALA 1A3RH 5TFSL 1H8LA 1XEUA 2QADD 1MRCL 3ARTA 3IYLW 1UZGA 1A6TB 2FWUA 4U4BA 1KGCD 4OM1H 4BSJA 1G0YR 2OJZL 3CFMA 4ZTPL 4APXB 3P0VL 1MZZA 2Z91A 2GITA 3HA0A 4NFBA 2BCKB 3L5JA 2OJ1A 4PTUA 4XRCA 1NFDB 5D6CA 3WLWD 5FDWA 3GHBL 4PJFF 1OPOA 5DYFA 2WVSA 2AXFB 3M6DA 1PZUB 3KPRA 5DTFA 4QHUB 1SOXA 1HS6A 2XG5A 3S3BB 3E7JA 2Z6FA 4MD5B 4OZ4B 5DZ9A 4HJTA 4K5NA 2X87A 5IHUL 2PTTA 3FUEA 3AMKA 3KPSD 4Z7UA 5EU3B 1HHKA 4OFIA 3SHSA 3HZMA 4DP1X 2G3NA 4OFPA 1U36A 1GOGA 3FU6A 3AGWA 1UH2A 3RFRA 4HEPA 3QUZA 4BJLA 3WFDL 3L7EA 2CCLA 4JN1L 4OF8A 1FYTE 2C9UA 3QEGH 3GKZA 5IROA 4Z76B 5ID1B 2JMRA 1OM3H 3NK4A 3SDAA 2BVYA 2CK0L 5IGXL 1DO6A 1XV8A 2O72A 3HPLB 5I1LB 4ZFFB 5C08E 2WB1A 5IG7B 2IAMB 2J56A 4G83A 2I07B 1BAFH 4U1GC 1G5GA 3B4NA 4G7RB 4JPIB 1ADWA 4BZ2H 2CR0A 3VFRB 3U9PH 1MUJA 3MXVL 4JKWA 5EZOH 4N9GA 3NJJA 3IDIB 4UNUA 4PJIB 4H8WH 2UXFA 4PW4A 3KMDA 4N6RB 4MJ6A 4GBXB 4I5BA 3ZPDA 3CD4A 3H9YA 5ICXB 1Y18B 3FQ1A 2HUHA 3BQVA 4FP8L 4TQIA 5DO8A 5D1QC 5TF0A 1HHIA 4IRSD 1DQJB 3AS2A 2IG2H 5EG6C 3QPQC 5B1JA 3BGAA 4HJUA 1FPTH 1DUZA 5I71C 1DE4A 2FQFA 2R59A 3NH7L 2NT0A 4EE2A 2ZZUT 2YPLA 3G7TA 43C9B 4P07A 1H5BC 2KBGA 4UYQA 2AEOA 2VTFA 5FYLD 4BZ1H 4KOBA 5EIVA 5T3ZE 3SKUD 5IJKA 2BH0A 1AGEA 1J86A 5TQ2L 4EN3A 3EJYD 3QUKB 4WEEA 2X0UA 4K71B 1S7QA 1ZTXL 2V9UA 5JLZA 1A1MB 3MNWB 1T04A 2XY1A 2ZF9A 5DJ0A 3SE3A 2DWXA 4CMMA 3C5ZB 5KBMA 5JUEH 1EIBA 2XQBL 4EBQH 3LZRA 3I6KB 2OTUA 2TRYA 5EC1B 1A2YA 4YBQD 3TVMA 3ULUC 2MQCA 4ELDA 2YGOA 2BC4B 1HT6A 2KQNA 1ITBB 1GGCH 1KPVB 4MWFA 4W68A 2XQYK 5FFGA 2ADFH 4FMFA 1JWUB 1G4RA 4YHLL 2V5MA 1AZCA 5T1KD 2ICWB 2N1KA 2ODHA 3BI9X 3QP3A 4M7LT 4BIKA 3ARGD 3P4LA 3TPUA 3H42L 5ISZD 2PYED 4JY6A 5GS1C 2FX7L 4XZ4A 5MERA 2ZD0A 3K8KA 4GRWB 1D5MA 1S3KL 4NN5C 3TTYA 4PBVC 5E8EA 7FABL 4FLRA 1RUML 1FPTL 2BZ7A 3L5HA 3VD7A 4BFJA 1NLDH 3O8XA 4KY2A 3WJJA 4F7KA 1IGYB 2OI9C 1UCBH 4FQHA 2Q2LA 4PJXE 3QJXA 3OKKB 1JDCA 1QFUH 3MX0A 5GISL 1J18A 4AQ1C 4I8DA 1NC4A 3O3DB 1NDGA 3SD5A 3PPSA 1C7SA 4S10A 1R3JA 1S9WA 3H4FA 3V79C 3U83A 2O4EA 3LN5A 3UYPA 3L3HB 3IU4L 3UJTL 4QYAA 3GI9L 1B88A 1JWMB 1KJVA 4LCVA 3LKNA 4F5CE 3DXAB 5DHEA 5C70A 5LVEA 1A14H 1PJWA 3K1KC 3TXAA 1WZLA 5D7LA 1A6VH 4N8VB 2Q1EA 1IKFL 3IF1A 5F7NC 4V33A 4JRXB 2HT3C 2TRHA 5J6SA 3BKCL 3UAEA 1ND0B 3P4OA 5JOEA 2ROYA 4FXTA 5D2LF 3ULVF 1U8HA 2UWEE 4PGBB 4Q4IA 5IHWA 5GZOD 4OF3A 3FSOA 3UO8B 4HUXB 2YXMA 2N4IA 3L5IA 4NQDD 4Z7NF 4PWKA 1MY7A 4AW7A 3B5GA 4M6MH 5L4JA 5CAYB 3MGTA 4Y5YC 4NZUH 4N2EA 5I1IL 2F08A 3KE0A 3DV6A 5KBLA 4PRDA 2CKBB 5I6KA 4LLYA 2J8UB 4G6KH 1KYOK 1Z1WA 2ICEC 3CLWA 1MCQA 5CBAB 1RXLA 2EILB 2R51A 4NYLA 4GW5A 3QCTH 3L3GB 3QDGA 2ZXBA 4CAGA 4G59C 4TNFA 5CWSB 3KPOB 4UUJA 4X8GA 1XTMA 1ZVYA 3PDDA 1CPUA 3U2IA 4JFWA 4E2OA 3QULA 4L3CB 4NUGL 4QXTB 2F5BL 3X11A 4CSTA 2OV0A 1AS7A 4BH8B 4D9QE 3OJDB 1EZVX 2OL3B 5EULV 5TE7H 4ZX5A 2R1XA 3EJZC 3PAYA 5E6RB 3FTZA 2GK0A 3GXFA 1OCWL 4I48B 4GMTL 3AW5A 4J28A 5BOPA 3DVIA 1MAJA 1W8OA 4DGUA 3VXRA 1LWRA 4NO0A 5IROD 2IC2A 2IQAA 4LGRB 5DJDA 2A77L 4G9FB 3BPLB 2B2XL 4K8RC 5AG9A 2WTPA 2LT9A 3C08L 2CUIA 4KTGA 5C0JA 4L8BA 2B14A 3GK8H 1JGLH 2H0JA 3OMAB 1CIUA 3HMXL 3F05A 4PB9H 2DQHL 3G5ZB 1P5UA 2UY7B 4NN6C 2QFPA 4XNZC 4IBLT 2FT8A 4YSAA 3WTSA 2QTEA 2VXSH 3T08A 1VFBB 2I5YL 5DRXB 1FZMB 4Y19B 1KIUB 1I7RB 1N64H 3EFFB 1T66C 4PD4K 1A6WL 4FOMA 1K6QL 2ZJSH 3W38A 1NAKH 2K0RA 2P8MA 2Z8SA 1UADC 5LCVL 3CDGA 4LB8A 5SX5K 1I7TA 4HWBH 2WLMA 2JNZA 3QFJA 4KUCF 4MQ7A 1X9UA 1NEPA 4R3SB 4LLWB 4PJAB 3KH4A 4ODXA 2K8QA 4GRMB 1OOAA 5A2FA 1NIAA 4LHJB 4KUZL 5CN2A 4BM7A 3Q5YA 1IAOB 2Z7WA 4CN1A 4I9WE 4XCYA 5AAWC 3MZGB 5FFOA 3UPCA 3WY1A 1Z5LB 2ITDA 1YNTA 3GSXA 1IZJA 3SOBL 1P0SE 2O5ZL 5B21A 1Q9WA 2WINA 1HJBC 3Q3GB 3MLWH 3CQFA 4YEFA 3NPSB 4L1HA 5I1DA 3IDNB 1WBZB 1RK0B 3DC0A 2XQYG 4GG8B 5I73B 2P52A 5GISH 4YJZL 3RFZA 1OTTC 2J12B 2D0HA 3TH2T 3QNYB 1J5OH 5EA0H 5I1KL 2W0FA 1MI5D 2AQ1A 4G8AC 3IMRA 5ESAB 1CBVL 4OKVA 3WNLA 1RUAH 1EJOH 2YKKA 5EU4A 4HIXL 3FQUB 2MCAA 2BY3A 4MDJB 5IMOB 3DJRA 4GW1A 1GJWA 2VNCA 1NFIA 4A2HA 4N8CH 4XVUC 5T33H 1LK2B 4HHAB 1FC2D 1WEJL 1AHWB 3ISWA 2D7TH 3HMWH 2HVKB 3N43B 3FQXB 3S7GA 3CFKA 1G1KA 1QVOB 3A3YB 3HS8A 2Y9RT 5B4MD 1ZSDA 4I88A 3S37H 4P2RD 3QUMA 4E5XG 2C9VA 2DQIH 1K72A 4OSUL 2AK4B 3VXNA 1BGXL 1IGIL 3VI4F 3DSNB 4FZEH 4NZUL 3ZE1E 3ARGB 2F54B 4TS6A 1AZBA 5TD4A 5TH2B 2D3JA 3UG3A 2XSKA 1R6VA 5J0BA 1URIA 3BAWA 3T8XB 3IDXL 1TQBB 3QQ9D 1YG9A 2YD6A 4P2QD 3SDDA 1CB4A 1UUSA 2FEEL 4WO4C 3UX9B 5KSUB 4OJFL 3TONA 3VD2A 4QO1B 4IBWA 1LO2L 5JHBA 4ICWA 3STZB 1IAMA 2M83A 1XX9C 2P24B 1J9RA 5DEJA 4AENA 1UXWA 5B39G 1LO4H 2X0VA 4OZGE 4NT6B 1GOHA 5SWZD 3CXFA 5BXFA 5IW3A 3NSDA 1JL8A 3TV8A 5HJDA 1YDPB 3FCTA 4O5LH 5EBWB 2NOYA 4PCYA 5EN3A 3HR6A 5B1AB 1N0LA 4AVHA 2VL5A 4HSQA 2VN4A 3QFDB 1BPLB 1XWVA 5LUMA 3VXMA 5LGJB 1GW0A 2DLFL 4P2OC 1VFMA 3LS4H 4PS4L 2RAMA 1U92A 5CR8A 3ZRCC 4CJ0A 5KYUB 3DRQB 3L9RB 1QZNA 1CURA 2EUZA 1QSEA 2VN7A 4FYRA 4U1SA 3GIZL 4WU5B 4HIQA 3ZT7A 5BNXD 3BRGC 4ODUB 4X4MA 1J5HA 2IH8A 2VLJB 2MCG1 4WWPA 1ZHNB 2E56A 2NY2D 3KWTA 1OP5K 1ROWA 2ZKXA 3NJNA 3CVHB 3QWOB 5ISZE 4PV8B 5BVPL 2F53E 3LRSB 1TTBA 2K78A 4UQCA 2VQ4A 1JUFB 4LNRB 4N0CC 4NENA 3BAYA 1HNYA 3LCYA 3L3JA 3ILPA 3QDGD 5L2JB 1R17A 1BX2A 4IQHA 3TFKC 2JJVA 4LRNL 4Y19E 1F58H 2H1PH 2EH8L 3CIQA 35C8L 2LTQB 4O2CA 4HULB 5KBDA 4JFDA 5I66A 4KTDH 3MN8A 2VW6A 2ZX6A 3CHXA 4H40A 1CFQB 3APNA 4NZJA 1X5HA 3OQRA 3KHQA 3ZHNA 4WF7A 3K72B 2IF7A 1WGVA 3FRUB 5IUCA 4R7VA 2PW2B 2B08A 2B59A 5D7KD 3CTTA 3TA3C 2XXMB 2MQGA 2OMVB 2XIDA 3CNKA 5DEZA 4XN4A 4NQDE 2QHRL 2WCGA 3FAWA 1DO5A 2WKLA 4OGXH 5I76B 1F13A 4GKSB 1XD0A 4RRPM 3SE9H 3KGUA 1ETJA 1JCKA 1RZKL 4QR7A 2JELL 2WCPA 2FX9H 3CSPA 5AVVB 4CRPA 1MOEA 3ZKNC 5KYXA 5E4IA 1LE5A 1EHNA 4P5TB 4G7YL 4N2MA 3SCMA 2BSRA 3H85A 4YLCA 1BYOA 2W80C 1XAKA 2YAPA 4FQCL 1Q9LB 1TTAA 2HSIA 4XB7A 1A4KA 4FFZA 5CBEB 3PWJA 1YVLA 2DQMA 3ZYOA 4H88H 3DJTA 3IDYB 3BSZH 1TFPA 1SXBA 1MJJB 1Z66A 2AF2A 5JHDB 4QRUB 3FFCD 2UZIL 4TNGA 1KJ2B 4OJDH 1JXFA 1I8MA 1EO7A 5CUSL 1OANA 1CL7H 2X4QA 5F9WC 2WO3B 4DETA 3T5WA 5CEXB 4UQ2B 1FH5H 4GKNA 1K5NA 4J2XA 1MHPL 5C0DA 1XR9A 2UX7A 4Q6IB 3GGWB 3ZTJG 5HI5D 3MRIA 2NY3D 1MN4A 2RQEA 3MUY1 1IEAB 5C0CA 1LM8V 4PLOB 4IRJB 1NCTA 4RGMC 1KJMA 3L4YA 1R5VA 4JDVB 3O3BB 4N2FA 2XDHA 2E7DA 2YJLA 4XXWA 3WTTA 2V2XB 1XCQA 2DQIL 3QHZH 3I74A 4MAYB 4QOKD 2WMPA 4P04A 4BXSV 1ZPLA 5D1ZB 3ISRA 4XNBA 5K59F 2W88A 5GRUH 3TJHD 4K2UH 2NPLX 4J7RA 1AGFB 5B3JE 4IKIA 4ZQKA 1WITA 2ADGB 1NANH 3AQXA 3K5RA 5ILTL 5JDSB 1MLCB 4UTCA 2DM3A 1EZSA 3MCLL 3MJ7B 3IPEA 4UQ9A 3SDAC 1MI5A 3TN0A 2CNZA 3EOTH 5JXAL 5DA4A 5FYJU 1M2VB 2VDOH 1H6TA 2EDKA 3F12B 1Q0YH 3EHBD 5EOCH 3LB6C 1TZIA 4PLJC 4BA0A 4WNQA 3KLQA 4DEUA 2V8LA 4PJIF 3O6MH 1SLUA 4KFMA 2YRPA 4X6CA 1JMZA 3DYPA 2ZG2A 3HB3C 2QMKA 3RHWK 1HAWA 5GSRB 1XSIA 3P73A 4K3JL 5T1MB 4Z77A 2VRQA 4DKEL 5J13C 2CO7B 1DBAH 5E70A 1FH2A 1QNIA 1X9RA 1DN0A 1T4WA 5J1AA 5FEBA 4MMZB 1U6AH 4MA8H 4Z7UE 2P7TA 5FW6A 5EWIL 1IL1B 1U58A 4RRPG 4HJ0C 5JXED 4OFQA 3WEBA 1HKLL 5D5MF 1A7QL 4ZPVA 1ET8A 1X5XA 2WQWA 5BUPA 2FD6H 3ZDZE 1GCYA 1PDKB 2EAEA 4N20A 1GW6A 4G82A 5F8QC 1SNRA 2FJSA 3D0LB 1F4YL 2HA1A 4YDZA 3PGFL 1QWNA 2FO8A 4YBQC 4B53A 1AKJB 1L5GA 4M8QA 4G5AA 4P2QA 5MP6H 2XHNA 1TJMA 4WO4A 4DJMA 3UTTD 2CRYA 4JFXA 4OCWL 3IKKA 4FL4B 3TPKA 4NQSB 5FHAH 4K7FB 1QR1B 3K4ZA 3DJ9A 2MPVA 2GY5A 3GSUB 3SO5A 4GOSA 4DZ8B 1YJDL 2XVBA 4ZT1A 2FTAA 1YPZA 5SV3A 4M5YL 1ZLDA 1P7QD 3QG6B 2CLVA 2P47B 4M7LL 5CEYB 5CLWA 1D9KD 1I31A 4M29A 3B5HA 2FCBA 3FT3B 1ZS8A 2A6JB 2UY6A 2KLRA 3KXFD 1TU2A 1A0QL 2PLTA 4XX1E 1QEXA 1MCRA 5A16B 3GMRA 3P4NA 1MCBA 3D51A 3DMMD 2FX9L 3WN5A 3ZE0B 5K9OA 5F7BA 3KXFB 2R0ZL 3EBGA 3QJOA 1T7WA 3G9VA 1A4CA 1YYLL 3LXBA 4ZAKB 4TYUA 6PCYA 3IMWA 4P2YA 1XF5A 3U25A 2XYCA 2VDRH 2VR3A 3MRLA 4D0CB 5ALCH 4HH9B 5JXEC 5D72H 4TLUA 2APSA 2VDNL 5IEHA 3LN9A 3D25A 4QXWA 2R2HA 1T5WA 3BPCA 3QJQB 4X5LA 1VPOH 1P4IL 5HGAB 3CN4A 3HZVB 3OV6A 3TEUA 3BPNC 1HEHC 2VH5H 4URTB 3WKML 4XBEH 4NKMB 1UZ8A 1P4LA 4NRXA 3RB7A 1FUNA 1P6FA 2BXZA 1QRND 3V8CA 4HU8A 4XCEA 5FYKD 3G08A 3LXCA 1QFWI 3VCLB 2EE2A 4FTDA 4G9FD 2A2QT 4QRPB 3W11C 2R56L 5EUOF 2W5PA 4X83A 4LRNH 5K1VA 1KJ2L 1TQVA 3D4ZA 3FTGA 5AD0B 1FL6A 1Q0XL 2A9NL 4OI7A 3WUWB 2JB6A 3HNTL 3R06A 2JKXA 5JIKA 1E4KC 1LE9B 2XJKA 3EYSH 4ZOCA 3QI9C 3SCMD 3ZE0E 3LH2L 4O2FA 1ERNA 8CGTA 5JORB 3W0WA 4PJFB 1NINA 3ASWA 2WXNA 3U9UB 2IAMD 4AGPA 3FFCA 5ERWB 4X4YA 1TJIL 5TGBA 4U1MA 4PW9A 3ZKND 4U1IA 5DHVH 2D31A 4BFIB 1T7ZA 3JTBA 1UZ6F 3W3BA 2G0KA 4MNQD 3PP3H 1FHGA 1PZAA 3ZHKA 4F37K 1SF3A 3LEYH 3OX8B 3POCA 3MBWB 1I1AC 1U41A 5I8KH 1CT8B 2WSDA 1IX2A 4N90E 1YEWA 4XN1A 1ZTMA 1HNFA 1HOCA 3EW3B 1KTLB 4FFYL 2UWEF 2YMOA 2GB2A 4OGYL 2YQBA 3M1CA 4QF1A 5DVKA 3KM1A 1KNOA 2BP8B 4JFZL 3UJIH 1XF2B 1B3JA 1RCYA 1K8DB 4WUKL 4AC4A 2MKWA 1MEXL 1WBYA 5DD5L 1FNEA 4FS0A 4U0RC 3TEWA 3N5AA 1QWUA 1TZHA 1ETB1 2WQSA 3QDMD 4FFWC 5E8DH 4F2MB 4UIMA 4PJCE 4L3FA 1JK8A 1AIZA 1MJ8H 2J8UE 1FYTB 4K5PA 1IKFH 5GJTH 4OZHE 2WUCL 3GF8A 3EO9H 4IOFD 1PNDA 2XICA 4DGVH 2I27N 3O9WD 2VW7A 4NEHB 5CJQH 5AVWB 2WLIA 4GMSL 3N41F 3KJ4C 1ZMYA 4K3GA 5FGCB 1OKEA 4W9EC 4X6DF 2Y07L 4NZRL 2AJZB 2VR4A 4KXZI 1ZT1B 4M93C 2YHGA 5J6HA 3FCGA 3QIBD 1RMFL 3L9EA 3ZUCA 1FNEB 3NEOA 4G7VH 3P77A 4MAZA 5DR5L 1H5BA 2MPAH 3R7QA 1XSJA 3U9PL 3X1BA 1K8DA 3FRPB 4OLEA 3KPSE 2PABA 3SDCD 5T5NF 3S5LA 4RGOH 3ZKMD 4R4BA 2WAHA 3L4CA 3WLWC 2QADB 3V5KB 1AQ8A 3CLEL 2WWKT 1WE5A 5FV2A 4MGXA 1E9PA 4M48H 3KBFA 4FKEA 2DJSA 4KK6D 1NCOA 3SE8H 1BQHG 1B6UA 2VXTL 4UM9B 1PGRB 3A0OA 4RGNB 2VQUA 3TVMC 2BNUA 5I8CA 4U1IB 4U1MB 3VFSA 1CQYA 1Q4NX 3B43A 4OTXL 4Y2NA 4P8QA 1RZFL 4IBSA 2ZOTA 5E9DE 5HHQB 1YJDC 4JFFB 5I75C 4F9LC 4YNYB 5DUJA 3ECBB 1OP9A 4R2GD 2IXQA 1DBKL 4ZSOA 4JDEB 1ZLVK 1IQWL 1UACL 4KTEH 1AH1A 4EDXB 1P7QA 1BPVA 3T6XA 1D9KA 5FS5A 4OKDA 3WUWA 3OR6B 1OPGH 4M6NH 4QKTA 1DFXA 3JV6A 3RZCA 4MYWB 3UZEC 3JV5A 4I0CC 3NGBB 4QRPE 5E2JA 2WGXA 1DVYA 3GLZA 2YD5A 1GZHC 2ADFL 5KUMA 4KZDH 2GQHA 3C60C 1CD1B 1SHSA 2AK4E 3N0PB 3WIFA 1U0QA 1YEIL 3UP6A 1IBGH 1HCZA 1X5ZA 3HRZC 4NN6B 1FVEA 1VFUA 4U3XA 1T5XA 2V2TA 5HGAA 7TAAA 5ACZB 5AZ2H 2Y0SA 1PZSA 4RGNC 4MJIA 5HDOA 3QPQD 5SWZB 4Y2DC 1S8DA 1WZMA 5FO7B 1OZTG 1A1OA 1AMXA 4XH2B 3OAYK 1UWGL 1J05B 3MRLB 3FO0L 1XF5B 3IJEB 1U8IA 2CWRA 3OJ2C 5IV2B 5JHLL 1M53A 2ADYA 2V7NA 1MJUH 4M1CD 4TNWK 3RPIB 3QUXA 2RD0A 1OP3H 2I9TB 1T1XB 3FO9A 4HWBA 4TVPE 4DP5X 2XA8L 5I82A 4PP1D 2W8CA 1YEDB 5BRQA 3ARVA 5IMLA 1CGXA 3CBRA 1BSIA 2ZG3A 4TULL 1PLGL 3QE5A 1IGFH 5JNYA 3KYMA 2X10A 2WN2A 4FFYA 4U3SB 3ULUE 1NGXA 2K70A 2ZAIA 3INUL 2YD8A 4PYHA 2W9DH 5IF0A 4RISH 4KJQD 2IANE 4QXUH 4F15C 2L4OA 2EXYD 1IUZA 1LMIA 4KRPB 3IS1X 4N9OB 3CVIH 8FABB 4A2EA 4E9TA 4ELKA 4J39A 4JANB 1M6OB 1R46A 5C7ZA 4OD1L 4QNPF 4JFHD 4LCWA 2D03L 4U7SA 1G7JA 4O9HH 4HWEH 3F5WA 4ZXBB 1P1VA 4KOCA 4Q89A 1JD7A 4D0DB 4X99A 4E36A 2OA9A 5D8JH 1KCVL 2WWKO 3HFFA 4K73A 4P2CG 1N3NB 5BMFH 4N1HB 4TSCH 3LN4B 2F6AA 4XP1L 4RAHA 4ZAKC 3NIDE 4PJHF 5BUAA 2XKSA 4LCCB 2XN1A 5IW6A 5GJSH 2H6PB 3VQMA 3AG3B 3FF7A 2VC2H 5HDLA 1LEKA 1G94A 1IIKA 3SZKC 2Z4TA 2JQAA 4QT5B 3V52L 4OJFH 4CADA 4KQ4L 4QAWA 5JQIB 2YMXL 4D7PA 3WGVB 4ABUA 1HH6B 5I18H 5KN5B 4L18A 4YDJA 3QIWD 4HWZB 1RJZB 4PRAB 1DQKA 3MJGX 3OGCA 4X6CB 3VYPA 1N0XH 2E9BA 4FQIH 1L7TL 1E4XL 2HX7A 4KZ0A 1ADQH 4GXVH 4L5FE 2RQ8A 4U0QB 4PRID 3ZKQD 3T1FA 1HINH 1WWAX 3MLZH 4NM8H 4U2YA 5HHNB 2HT3D 1Q9OB 3QUHA 4CVUA 3C6LA 4I2XE 4AYFA 4AMKL 3HG1B 4WWKC 4XN5A 1ID2A 2D03H 1BCIA 3QWQB 1PSKH 3GK8L 2JIXD 1T03L 1BMWA 1E5YA 3MRHA 3VDAA 1HHGA 3ARPA 2ADGA 2BSTB 3T6ZA 5EF3A 4FD0A 1S46A 2C1OA 2O6EA 1CK0L 4OGAC 5EN2B 3KVQA 2WMPB 2CIKA 4AE1A 1HC1A 3U4EB 1HU8A 4JRYA 1C8QA 1LNUA 4WV1A 2FATH 4ZXBD 5E8PA 1JV2B 2OMWA 1F6AA 3LZQA 1U3NA 3MACH 1MLBA 3BQUA 4ZRGA 2ZUWA 4IRJA 3ZR6A 3TF7C 2N01B 5KSBF 3REVB 5KBPA 2LU4A 3V0EA 5HYEA 3B3IA 3HAEA 3PWLB 3S3PA 3WXWL 2J6WA 4AZUA 3GNMH 3H0TA 5EORL 1ONQA 4PTTB 2OCCB 3M1OA 4FFZL 1UB6B 5C0AB 5DK3A 4BQCA 1GYUA 3GUFA 2NR6A 5F88B 3PQYA 1I3GL 3RVXC 1U8CB 5TJWK 1KLUB 4PP2A 2AQ3A 2HT2C 2CPCA 4M61B 4H1LA 1CMOA 2M26A 2ZUTA 4XT1C 4BHUA 3MV9E 1PFOA 1OAUH 2DBLH 4JZOA 2DDQH 3IAQA 3PJSB 3D05A 1DN2A 3SCMB 2FR4B 2Z3FA 1ZVSA 2VQ1A 1MFAH 2P1YA 1S7WB 3QFGA 5DO2C 2B16A 2X4UB 3BFQG 4D8OA 1TZ8A 4AV4A 1Z5HA 1JTTA 3CLFL 1F3RB 1PLGH 3JUYA 1I8LC 2XWTB 1NCIA 1VEPA 3DYMA 15C8H 1T66D 2NUTA 2ZX8A 4JN2B 2QV4A 3EJPA 1PVHA 3IDJA 1HH9A 5DD0H 3BAXA 4YXKL 2C3WA 4WCYH 1GZPA 4AQ8A 4P46C 2FQDA 3CFDA 2D4FA 2LAAA 5BV7C 4Q6IC 2CJ3A 1XFPA 4NRZB 4X5PA 2AQ2A 2ZXQA 1AO7A 4RLDA 1IARB 4FXGB 4FFZH 1P7KB 1V05A 4NENB 3IFOA 4G6JH 1DCLA 1S4IA 4WLCA 2BZDA 4JCMA 1I8KB 1OW0A 2DN7A 5KZCB 3RGBA 3FB8B 2WY3B 5AKVA 2VE6B 4HIPA 2NLJB 3HN5A 4HT1H 3RRQA 1MJ7H 5EOQL 3GDBA 4MQSB 2AEWA 3QEHB 2LU3A 3QUXD 4NCC2 4GW4B 4XE0A 5AB2A 1WTLA 4WU5A 5D71L 3OF6A 1QHOA 1PQZB 4L0ZA 1F11A 2ESVD 3LPOA 3QB7C 3DRQA 3L9RA 2ZOOA 3MV7B 3OC8A 4JPKL 4R7DB 2E76C 2VLRB 4UM8B 3CN3A 5EU7E 5T3ZD 5JW3H 3MROB 2J88L 3APDA 2IADA 3QQDA 5EOCL 4W9HC 1AHMA 1A66A 3RL2A 4TV3A 4UT7L 1DL7L 3MOQA 3CBKB 3IKCA 4ABQA 2EIMB 3MMEA 4M4RA 3ATAA 3H54A 1AG6A 2ICWJ 3V4UH 1MRFL 3OKMA 3F2LA 3SPHA 4KH9A 4TLKA 5JPNB 1U95B 3L16A 1EEYA 3GEFA 4OUUA 3GLEA 3OG4B 3T8XA 3GLAA 4KHXL 4AXWB 5C0GA 3V4VH 4RISL 3VWKB 4KK5D 1INEH 1GYWA 1RJYA 2J21A 3FU0A 1OOWA 2UZXB 1E28B 4ETYA 3CC5B 4JZJB 3EYFA 5HBBA 4FN0A 4N6QA 1SJXA 5L6YH 3VD4A 3RP1A 2KUTA 1DHKA 4N1CA 1OT1A 3BAIA 3QH3A 4OV5B 1ZSDB 3P9LB 3NMEA 1KPUB 3B2MA 4XE5B 2VLRE 1CVRA 2XN9A 5MEOA 3BDYL 3MI6A 3L2MA 1A4AA 1OGPA 1LDPL 1P53A 2IAMC 1EMTL 3HHMA 3I3EA 3TESA 1PNCA 2Y7OA 2GPZA 1JPSH 1J0YA 1JV5A 4M8VA 1O5PA 3CUPB 2HJFB 2IGFL 4H8UA 4IMKA 4IRZH 1NUNB 2CRIA 2DQUH 3NCCB 1SDYA 2EXSA 1RY7B 5SWQA 3WV0A 3VH8B 3OL2A 3T0EB 1E9OA 2CD0A 2NQ3A 3MRBA 5AVQB 3TM6A 5DRZB 2EVJA 4U4IA 5CSGA 4LIQH 4FA6A 2EO7A 4GRWF 5F7EH 3SJVB 3QNYA 1H3PL 3MLVL 2VT0A 1J0IA 1KN2H 1KWKA 4NNXA 3WS6A 1A7NH 3SQOL 4KK9C 2OSXA 4LCUA 4GIAA 3UL4A 4AYBA 3MA7B 4GH7B 4H20H 2A1WH 3FOLB 4Y1SA 4EIUA 1OPGL 1S7RA 4M6NL 2DY2A 3BIBX 3CFCL 4YXLH 5GGTH 2R23B 4P46A 1AFVL 1BBDH 1V7MH 4PAZA 3G5XB 2MCMA 3WEOA 4EZLA 1UACH 4KTEL 2DIBA 4U2ZA 3O11A 5HI4C 3TBWB 1YY8B 1UM6L 1M9WA 2GTWB 3O41B 4JVPA 3MBED 4A7SA 1SDDA 3QDHA 2XC8A 4GSUA 5DZNA 4U6YA 4JQIA 3UBXB 2DS4A 3EYUL 4LASL 5I2IB 3KCPB 4JDTL 2OSLB 3HN3A 4KAQL 4YSEA 2K3TA 4LLWA 2EECA 3JV0A 4WCYL 1M7IB 5M94B 3QXWA 1WC7B 3O9WC 1X6LA 3UIYA 4YPGA 4YDKL 1EO8H 3VAEA 3ECQA 5GS1B 4P05A 1U8JB 2FL5B 2PYFB 4K55A 4MA7L 4U31A 3BUDA 3KPLA 1PZ5B 4YC2C 2YC1A 2CR6A 1MJUL 3QPKA 1P5UB 2Y7QB 2XZCL 3EOYG 4LEOB 4PJGF 1FGNL 3VYNA 2Y1VA 4GKOA 3VFTB 1MJ7L 3VXPB 2HUEA 3AWFA 4LL4A 4ANXA 2E27H 4F24A 3FOMB 4ONGH 3FMGH 3AAZB 3GSQB 4NO0B 1WUZA 2AQNA 2CR3A 5E9DD 1QR4A 4FTVB 5DC9B 2CO4A 3CG8A 2VOTA 3V0WH 4OZIF 4JM4H 2GK0B 4R7LA 3O3UN 2FWOB 1SY6A 2SEBB 2X4PB 4PREA 2APFA 4U3CA 3VMOA 4PMEA 3MV7E 4YMPA 2VXUL 1EH9A 3O6KH 1Q94A 4KXCA 1Q9KA 1U8PA 2ZCHL 3RWDB 4QLWA 4H26B 5EO9A 3NIFF 2G2NA 2EIZA 3BEVA 3ROOB 5E9AA 2XQBH 3L9BA 4OD1H 4B97A 4HJSA 1JK9B 2GT9B 2F19L 4NDMA 1BFOA 4GFXA 2B5IC 4K5MA 4RAUA 3LKPA 2X5PA 1JPTH 1KFAL 4LF3B 1P5VB 1A9BA 1ZT4A 3BP4A 3MUGB 5I8OL 2HRGA 5BQDA 2A0LD 1P4BH 4PB0H 3IU3A 3QW9A 4UQDA 4Y4HD 5KBNC 1KYOJ 4HJJL 2OMZA 4NUJA 3RVTC 2F5AL 2W95A 4B9FA 3SPIA 3WFCL 1A9BB 3K81A 3V2AR 2J7LA 4GLRH 3GXNA 5KJRH 1E90A 1IZKA 4GNKB 1HHHA 2AGJL 5HHMB 1CFVL 1J0KA 4R8WL 3UTQA 3HC3L 3NRFA 5HDBF 3UTSA 5JYMA 4HKBB 5F89B 3AREA 4LVOC 4IMKC 3BEVB 3FRPG 3GI9H 2OR7A 4G8FA 1U8HB 3PREA 1U8PB 3RWDA 1YC8A 3CVCA 1FO0L 3GMLB 2R0KH 2VISB 4CVWA 2K9FB 4KKCC 3ROLA 2VDPL 1XF1A 4KNSA 1JVKA 1ASPA 3NJKA 4GB9A 1AD9A 4AIZB 3GHBH 1JN6B 4RGNE 2NXYD 2LVCA 4FTVA 5DLLA 3IJHB 1X5IA 2VDKH 3U2SB 4PJGB 1E40A 4YDVA 2FT6A 3HCVB 4AJYV 4KROD 4AWJC 2XTJE 1F1GA 4F3FB 1WFNA 4JPWL 4LEOA 1JHKL 4Z3EA 1NC4B 1G7LB 3NSFA 3FDWA 3ZY7A 5I8OH 1DQDH 2H2SC 3S4SG 2V9TA 4YZFE 5ABZA 3KPLB 4KH2A 3DSFH 1JZ4A 5CJXA 2K1MA 4N28A 5C9JA 5HVHC 1E9QB 4LZKA 1MF2L 1RVFL 3HR5B 1R5IA 4AOFA 3SPCA 2F74A 4R0LA 3ZTNL 1XH0A 4D7BA 3ESMA 2KC0A 3UBGA 1AC0A 2R27A 2WTOA 2EDRA 5L4FA 5IB4A 5ECJE 1E4WH 2X41A 2QR0A 5A3IC 4FCAA 3GRWH 2XCMC 4YEEA 4Z3IA 5IKCA 1IM9A 1QSZA 3UEQA 4J8QA 2NY6D 2WNKA 3TBWA 1SXNA 4XP5L 4POZC 3SZ6A 2XN0A 5I0XA 3ZL1A 1RZ7H 4G43A 2LLNA 4Z7WA 3TT3L 1ZGLB 4X4KA 1FVCB 3NJGA 2OXHB 2QKIA 2R23A 1AYRA 2DWDB 2XACC 4P46B 3WIHL 2HAZA 3FUDA 3LS4L 4Y5VC 2VLME 1HAUA 2O5NA 3N42B 4ZPTB 1V54B 3V5HA 3U2JA 2BIMA 2B2XH 3S88H 2DDQL 1BAGA 1IAIM 2CMRH 1NOLA 1U8MA 1FG2A 4C56D 4FABL 3KYAA 4JFDE 4AEEA 5E8OA 2Q3AA 2OJEB 5F1SA 1E5ZA 1HQ4B 5KUKA 5DFVD 1Q1JL 5DRZA 2VN5A 1OW0C 5IMMA 4DGYH 1MRDH 3ZLQC 4YSCA 2I9LA 4X98B 1DTUA 2KMWA 1LD9A 5DS8A 3NIDB 1WICA 3EZJB 1T4KA 1JSYA 3EJZD 3BD3A 1A3LH 1TCRB 4IOSD 2UZYB 3QUZC 4KDTC 1JV5B 3ARDB 1A9EA 3RIFF 1DUZB 4ZMOA 3HLKA 2XIBA 3FUFA 3EH4B 1TMQA 2G30A 5DD6A 4Y4FA 2VDLH 3KDPB 2XN9B 4LLAA 1KPUA 1YYMH 2E59A 4P5TD 3QH3B 1DLHA 3X2QB 2XRAH 3ML9A 3T0ED 3IDIA 4QJ3B 2IIJA 3EG9A 1GAFH 5BV7H 5EMYA 1EGJA 4FEIA 1I4FA 1JPTL 2WJ7A 5HHPB 3FT1A 3AS3A 1B2YA 3AWGA 1AXTL 4BHUI 1RJYB 3DIFB 4JO1H 2DM7A 1JFHA 4DVRH 1QW9A 4ODWB 1U93B 4GQZA 1U93A 1IBZA 2LOEA 1NPJA 5DQJB 3ES6A 4ZFFA 2VSCA 5I1LA 3WJJC 1IO4C 5DMIL 5E23A 1TNNA 1J1PL 1U95A 2J6EH 1J8HD 1QUNB 4G42A 4MNQE 3S34H 3CVIL 1NGQH 1A7RL 3Q2NA 4JZNB 4LIQE 5IR1A 4Z3FA 1F00I 2GHZA 3MODH 2V2WA 4GXUN 3L7EB 2BVPA 4K7PY 4TRPH 4R5VA 3QUZB 5AZEH 3VD5A 3WXVL 4AGQA 5L0QB 5K1NA 4E41A 3FUIA 2AEPH 4OBRA 1KY6A 1WH0A 3HZMB 4PJ5B 2F7PA 2Y07H 1JF1A 4FQ2L 4BDVA 3BH4A 4A38A 5DFAA 1MHEA 2CHDA 1FDLL 2RMNA 3BUPA 4EIBA 2E27L 5EB9A 1S7UB 2DZEA 3FO1A 4KPHH 1TJXA 3KDMB 4MD5A 4OZ4A 4TVSa 5D1XB 5AOIA 4F8LA 3BPOC 4QHUA 5JW4N 5IJKC 2CBMA 2FEDC 3ET9F 3QYCA 2AXFA 4YBLB 2QPSA 2QPUA 5E00A 4AQZA 5F1NA 2OMYB 1A9EB 5GJSL 1WLHA 2QDWA 1LO0H 4L05A 3UAFA 3F8UB 1TCRA 4K3EH 5C0AE 1G7MA 5KVGL 2GITB 2D7PA 1A21A 3EGSA 5HVFB 4APXA 4ZFQA 1F86A 4W70A 3QEHA 4X5QA 1BJ8A 4OLUL 4P2OB 1A6TA 4HXBL 5SV4A 4CBPA 5IMMB 3VD0A 4F7PB 3FB8A 3B2VL 4FQJL 1IJ9A 1HQ4A 4QD2E 5IHLB 4U1NB 1BVKB 1XH2A 5KSVB 1Q90A 2OZ4H 1OAZH 4DP4X 3PXLA 4LSPL 4AJWA 4N85A 1KBBA 3WMQA 3U7AA 1DBML 4YHZL 5TPWL 2AC0A 3MRQA 4M6ML 1H6EA 4OFYD 5JW5A 2QBWA 1OHQA 3MV7D 1TXKA 2VSMB 3MV01 1IGIH 2WNWA 4AK1A 2OXHA 1Z7JA 2J2ZA 3CFDB 5CCKH 2WQ8A 5CU5A 3RVTD 1YQVL 5AVXB 4HIJB 4L9LB 1AR1C 1WAAA 2HMID 2ENJA 2HB0A 1EJ8A 4F37F 3D39E 4HEMA 2NX5A 1XH3B 2C9QA 3HJEA 3E9TA 2HH0L 5IBLC 1BFVH 2J44A 2MHAA 3GJEB 1JNLL 3KPRE 3AB0C 1UWFA 5DJZB 1RUPL 2X4UA 1R5IB 3K3QA 1BLNA 2QSCL 5GGSA 2R0KL 4MXQC 1QLRA 5E5UB 4KKBD 2BNQD 4B9PA 2EDXA 2NNXA 4ZAKD 4K8RL 1F90H 4P4KC 2XTJC 4W4OA 1Y07A 3HBGA 4PW3A 3W2DH 5I1KH 4H8WC 1LEIA 4N24A 3RU8H 4F7EA 1QLEL 1BBDL 4XHJC 4PRNA 1F4XH 5C7XL 3WSQH 4FLSA 1KELH 4KROC 4B50A 2ZXAA 4A6YL 3BW9B 1LK3L 4WJKB 4GAYB 2WV3A 3O6FD 3T3PF 3PHSA 5DHDA 3E0GA 4GG6F 2JWYA 5FO8B 4K7PH 2ZUQB 1PG7H 1OGAD 1AD9B 1SZNA 2PXYB 3HNSL 4C56B 1U8NB 5T1KB 3OAWA 2PKDA 3E6FB 1JAEA 1F6AB 3GMLA 4WVRA 1BZ7A 4XOEA 5JHAA 2C34A 2UUDK 3G6JA 1T0NB 3NSCA 1U3JA 6FABL 1LNUB 4WI6A 2XXCB 4AUUA 2VLRD 1SOQA 1H3UA 4JPSA 2BNRB 4LL1A 3UTQB 2IFFL 4OLYH 3GBEA 4DOHB 1WISA 3D34A 2I69A 4ZSOE 4L4TE 3L4WA 1HHGB 2NY6C 2VUKA 5TDPB 2CGRH 4XVJL 5DHVB 1XGPB 1JDDA 3FMGL 4XC1L 2WLHA 4AYFB 2K4WA 2XPYA 5HGHA 2KYIA 2K9UA 1ZT4B 1ZK9A 1NCGA 3BP4B 3JWDL 3MUGA 4LCIL 4JJOA 3PP4H 4RRPA 4UTAH 2ZOLA 4M00A 4ADJA 5DJ8B 5AOLA 4IOSA 4UNVA 3KS0J 3WTUA 4NDMB 2HRHA 3STLB 1E3ZA 4HWZA 4PRAA 1NGZA 5KS9F 2RHEA 3HS0B 1VFOA 3JV4A 1HH6A 2Q8BL 2XWCA 3QT2A 4Z9KB 1MG3C 4JHWH 1G9NL 1GSKA 1KN4H 4Z3JA 3RY6A 2RCSH 3ULUD 5EOQH 4D3CL 5HPOA 4JFQB 1CLYH 1LEKB 2J73A 3BWZA 2VC2L 2WLNA 2PO6A 4RDBA 1BD2A 5IMKA 5KSAD 4QHMB 4DQOL 5F0PB 3QGVA 4K23L 3J27A 4L8DA 4PRIB 1MCEA 2CDEA 3RAJH 3FOMA 1ZLWK 5D4QA 3S8FB 1N3NA 3IDMB 3KLDA 5GRUL 4YSRA 1JHTA 3RY6C 3WFCH 3SBWA 2JB5H 3LH9A 3N85H 3FTVA 4P3DB 2YOAA 3SJVE 4AGLA 4D0DA 2D9CA 2OZ4L 4BUQA 1CO1A 2CLZA 4GO8A 4RZCA 4ZUSB 4DKDC 3HC3H 2YBGA 1HINL 4OVUA 5C0EB 5IHHA 1Z9SA 4M93B 3FSAA 4H5SB 5GS1A 1ZV2A 3T4YA 5E08H 2FIKA 4ZDHA 3L3IB 3L48A 4AZ8B 4UTAL 5DVOA 5HYFA 1X4ZA 3B6SB 4ODHL 4ORGB 4UILL 4HS8H 3CX5K 3UTZA 1QO3B 3KJ6L 3MV8B 5LGHL 1GY1A 4MS8C 2AXGA 2VZTA 4YGVB 5ADOH 4GUPB 1FFNA 3FUKA 4LP4A 4U6YB 1SDDB 5IESL 2BIIA 2H32B 4XN8A 4FFYH 4MXVE 3GBNL 3SDAD 3HIZA 3N50A 2NW2A 1FL5B 3FO9B 1JG9A 1DLFL 1YEJH 2HKHL 1KYUA 2PR4H 3PLYA 3QQ9C 3EYOA 3QUXB 3HE7D 4KNTA 4W9LC 4C58B 1NDTA 4JM0A 5C6TL 4XAKD 5IOPA 5B7MA 5IV2A 3RTQD 4OD3L 1JBJA 3MA7A 4IIQC 5HYJE 3K8MA 4KQ0A 1R5WB 5B7FA 2G3XA 2H47C 5HYSA 4XH2A 2FHFA 4P57B 3W57A 5KVDH 5HGDB 4Y4KC 2C9XA 5CU9A 4OFYA 1TVDA 4JHBA 4W9KC 1BQ5A 5EZIL 1EEUA 2GHWB 3TWYA 2V2TB 3S97C 2FWLB 3PL6A 1FVEB 3DHMA 3GPSA 5EHFA 4B9KC 3OBAA 1TQCC 4I3SH 4OJCA 4GMSH 5BO1L 3P3UA 5E0QA 5HGBA 3DYOA 3B1TA 2NX5E 5ESVB 2FGWL 4ONFH 1NAKL 2FH6A 3KWWB 4Z7QE 5HTSA 3Q2CA 1G9ML 4PSPA 5C0FA 3ZE2B 4CC4C 1OE3A 1B0IA 1NCHA 3RZCB 3LQZB 3UTOA 3ZRFC 2KHAA 4HGWB 5MEOB 4RBPK 2NT1A 1NBZA 4GUQA 1H8NA 1T1YB 2FGZA 5KW9L 4OV5A 3GJFK 2BMKB 4IGBB 2HJKB 4HK0A 4WAFA 2VMDA 3GI8H 15C8L 2WBXA 1UUNA 4HUWB 1JWSB 2XZQH 2YWYA 4GQ9H 5D7JC 5I6PA 5F6IB 3PF2A 4R96A 4LLVA 1IAIH 1N10A 4XPFL 3IGLA 3IEAA 1NDMA 3F83A 2IH3A 1QQDB 5C0GB 4XMKH 1IGCL 4OCRH 4UT6H 3AJ7A 3QPXL 1PY4A 4G6ML 4E0RB 1Q0YL 2YPLE 4YQXH 4DQAA 5FWRA 5HYJA 3V0FA 2Q20A 1I9IH 1HZHL 2VM3A 3R7RA 2F8IA 3D07A 3EUDA 3MMEB 4M4RB 4Y7OC 4NO2A 4NQEB 2OTWB 3CHQA 2OMTB 1RJCA 5JIQA 2OL3L 4XX5A 3RL2B 4Z7WF 4UOJA 3EGDA 4XHJD 1FZKA 1IC4H 4PLKD 3B1UA 4UQBA 3QZMA 3MLYL 5HVGB 5I19H 4HAFA 3GM0A 1IGJB 1KELL 5FC9A 5JR1L 4Y9BA 2ZCLL 4DF9A 1H5BB 5DO2D 2VLRA 1EBAA 3QCVL 4WTZA 4BUHA 4P2RE 1JZDC 3FSWA 4FYSA 3VFMB 2ZAGA 3T09A 1SYVB 4KXZH 1BYPA 5HI3C 4XPHL 5IVNA 4TPRH 4TUJB 5GS0C 3RWIB 1USQA 4L48A 5ADPL 5KTEL 1S7SA 2FJFA 1CXLA 4GO9A 2QJDA 1KDJA 1EFXD 1FQ9C 4YSTA 3DX2A 5MP6L 1QNZH 1UVQA 3EDEA 1SJMA 1MCWW 1VCAA 4P2QE 1RZJL 2ZUYA 3WKQA 1KY7A 3HNTH 3IFOB 5F1OB 2VAAB 2X1PA 4LL9A 5D7JD 3RDTA 3Q43A 3WD5L 3OHXB 4FXGA 2NCMA 4A7QA 2XZAH 2J6EL 5M7QA 5K5YA 2ZCKL 1FCGA 2JCCB 4EZKA 4LOEA 1GC1L 4AM0Q 2AKRA 3JWNE 4L4TA 4I85A 1OTSD 5DYOA 5I8KL 3QI9D 3SCMC 3ARYA 5I17A 2QMJA 3IDJB 4JFYB 2QQNL 3RUGE 2NUTB 3I84A 1XF2A 2KDYA 2Q87A 2YD2A 1MXGA 2PO6C 2BP8A 3UJIL 5F9WB 1FZKB 2BIPA 3C5JA 2IDUA 4WHYH 1CFTA 2XTJB 4X9GA 1IBBA 3QIUD 4HOXA 1ODAA 3D2UD 4NO2B 1O75A 4NQEA 5DFVC 3OX8A 1I3RB 4X4XA 1S7WA 1PZ3A 3UBHA 4W6YB 3PL6C 3ZDYF 2FAUA 3QDGE 4HETA 3BGMB 2Y2YA 4BFIA 2D31B 3RKPA 4E0RA 1WT5A 3HLAA 4AITA 2CKBH 1J8SA 5TQ0H 3T0EE 1B3IA 1AXSA 2YAEA 3GRBA 3BO8B 3OKYA 3Q1EA 4JG0H 4Z95H 3ZX1A 1NDMB 2AJVL <