4AZ8B

Crystal structure of the complex of the caf1m:caf1 chaperone:subunit preassembly complex carrying the kdkdtn insertion at the f1g1 loop region
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
134
structure length
126
Chain Sequence
b'EPARITLTYKEGAPITINIDTELLVGTLTLGGYKTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHAPERONE PROTEIN CAF1M
publication title Allosteric Mechanism Controls Traffic in the Chaperone/Usher Pathway.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Chaperone/immune system
total genus 25
structure length 126
sequence length 134
ec nomenclature
pdb deposition date 2012-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09255 Antig_Caf1 Caf1 Capsule antigen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4az8B00
1P5UB 1Z9SB 3DPBB 4AYFB 3DSNB 1P5VB 3DOSB 1P5UC 4AZ8B 4B0MB
chains in the Genus database with same CATH superfamily
1G9NH 4LNRB 2QHLA 1H8LA 4KJWD 2JKNA 2YBRB 1O5DT 2VJ0A 1WD8A 4HULB 1FFTB 5I1DB 2WQSA 4HP5A 4LO9A 4NKOA 2HKHL 2QJDA 2WW8A 3U79A 2D9QB 1XGYH 4RWYH 1CE1H 2AJXL 1IAKB 1WHOA 3FT2B 3QFJA 3SJVD 3H4FA 4UOW0 3U0WL 4HMDA 4DUVA 3GI8H 3V8OA 1NBCA 3SGEI 1SFHA 2DYRB 5DFAA 1ZT7A 1KIPB 2OMTA 4ZK8A 1A21A 5BJTA 3KBFA 5I73B 2X6CA 4RFOL 2B39A 1AHKA 2HLAB 4AMXA 3G08A 4OKVB 3TH2T 1MVUA 1G7PB 4L0PB 5D96B 2CPCA 5KS9B 5TDNB 3TGXA 4PS4L 5DD3L 1R3JA 3IGAA 1BAFL 1GMEA 3LS5L 2WGXA 3LPGA 2NUTA 5J7CC 3DJRA 2QZQA 3V6OC 3UJIH 3FB6B 1KGWA 1INEH 3FN3A 3QDGE 4ZMWA 2GTZB 2Y4SA 4Z7WE 4E9YA 1WCQA 5KN5B 5D70H 3DDFA 5GGTA 1G9HA 4YN3A 3E9TA 1ZK9A 2EE9A 2EUWA 2O5YL 2WZAA 1B9KA 1JGUH 2R4SL 4MQ7A 1T20B 3LRKA 4MA8L 1AE6L 5CP7A 2X28A 3B43A 3MU3A 1P6WA 1KJMA 1N8OE 1S7RA 4E9SA 1JPGB 3HG1E 4OIIH 2VLLA 4GAJL 3MV7E 4WEBH 4QPEA 4AJWA 4OF6A 3TT1L 4WW1B 1L5GB 2ICES 1AAJA 5DHEA 3I6KA 2VSKB 3NFNA 2GC7C 4G3YH 5DJDA 5HGHA 3CPLA 4D0DB 4FL4C 4RGOL 2H2SC 3SB3A 4Y4HD 4L8BB 5G4MA 3QC6X 2PLTA 5CLZA 1V7ML 2H7WA 5JLZA 4NJAL 1KJVA 2E0PA 4UYQA 3JWOH 3BUBA 3P40A 1GY1A 1AKJA 3LPWA 5GPRA 2J71A 3Q0HA 5BVPL 2B08A 1ZGLM 3DWTA 4XN2A 4HGKC 1UXSA 3S97C 4B60A 5D1XC 1FNSL 1JTPA 3WTYA 1OCWL 3OB8A 5D2NA 5T1MB 3ARGB 3RUGA 2HKHH 2X09A 4LDCA 3TIEB 2WQVA 1YC7A 2D3JA 3PWPE 4Y0GA 4HOXA 1HYRC 2AJXH 1I53A 3U0WH 4JE0A 4XCYB 4D0CA 4GG6B 4G6AC 3O6FC 3MNVA 1U8MA 4IKLA 1UT2A 1ERNA 3NOIA 4RFOH 2ZXDA 4WW2F 1FL3A 2JQAA 3U9UA 4ZSOA 3VFMA 4QXTA 2QVIA 5T1DL 3PRZA 1VFBB 3QDMD 4LAQL 4PS4H 5DD3H 5FGCB 1RH8A 5D72L 1HNYA 3GBNL 4PJ8B 4NKDA 1P7KA 2X1QA 5KYXB 3KPSD 4YDJA 1BAFH 3LS5H 1MCOL 1OB1B 5ESQA 2APXA 4KHTL 3L7EB 4NM8L 1KXTB 4PRIA 2XVGA 5KSAC 2R1YA 2HFTA 3FSVA 3HC3L 5E2VL 1SJMA 3HR6A 4HIHB 3B5GA 3WFHB 5IJVA 3ZO0A 3IKCA 4S1QL 3T0EC 2YD5A 1X5IA 3NJHA 4JPWL 4GI6A 4UAOC 1AHWB 1GMIA 2O5YH 2R4SH 3BZ4B 4W9JC 5J4MA 1H5BB 5KSBA 4A7VA 4MA8H 3VXUB 3MRLA 1AE6H 3ALWA 2R69L 4ZX5A 3D85A 3TH3T 3V0VB 1TJIL 1JSYA 4AQEB 3E7JA 1JK9A 3ABLB 1X9LA 5FKAA 1DBBH 3TT1H 4QOKA 3SE6A 1SBBA 3NZSA 2QGBA 2ATAA 3QJUB 2EUZA 3IU3A 4L05A 4RGOH 4P5TA 4PJ7A 2Q5BA 2V7NB 2V9UA 1ZJBA 3NCFB 1FSKC 1V7MH 5EO0A 1BXXA 1PCXA 4NJAH 5F7YC 1CD9B 4X50A 3ZXAC 2FO1A 3ESVF 1D7DA 2I85A 4KXZI 2EECA 3QCTL 4QRPE 3VRLE 4N2NA 4OCRL 5BVPH 3OHXC 2R2CA 2Y07L 1EVUA 2YPLD 2B4CL 5B39A 4Z7IA 3L3DB 4QHKJ 4KI5C 5JXED 5FV1L 4IOFC 1FNSH 3KAAA 3AABA 5D1QC 1OCWH 3ZBMA 4JJHA 2FJGA 4OSUL 2R1WB 3WAJA 4Z7NB 1T22A 2LGNA 4NQCB 3RHWF 3VGDA 2JLLA 2XPGA 3LEXA 3NACL 3QXAA 2Y7QA 4G42B 1UH4A 3QG7L 4PY7B 3SDDA 3UAJC 5I8EB 1RZIB 1T3FB 1IVLA 3BPOB 4L4TE 5AWNL 5IQ7L 1IE5A 3NCMA 5DD6A 4LHUD 2X3CA 4DK5A 2WUCL 2ADFH 3HBPA 2UUDK 2FX8L 1IAIM 1Z3GL 2GUOB 4H1LH 1HXKA 5T1DH 2BSSA 1ZS8B 1F90L 3BUYB 4YSUA 4Z3TA 4LAQH 1K2DA 4BZYA 4D3CH 5D72H 3GBNH 4ZUSA 1N26A 1RJCA 1NMCB 4X7SL 1MCOH 1O0VA 3SYAA 4KHTH 3B2VH 1OD7A 4KQ4L 1F13A 5JHMA 1RUAL 3S48A 5SWSA 3HC3H 4QMEA 5E2VH 4YXKL 4DN4L 4S1QH 1PCSA 3BWUF 3D18A 3RGHA 4P46A 1T83C 1YN7A 1ITCA 1CICB 2IAMC 1J9TA 4I0PA 4XBPB 5IJKA 2XVBA 4KZ0A 4PCYA 5F7DB 2R69H 4X5XB 4O2FA 2WNGA 4KKBD 1TJIH 5I76A 1W9XA 3Q8AA 3NJXA 5MP6L 4GQRA 2Z8WC 4XVOA 2CO4A 4ATWA 4HS3B 1OSZB 2WXHA 4UQIM 2Y3NA 2YKKA 4Y9BA 2DIAA 4M8QA 5TK4A 4DP8X 5DJ6A 4NNXA 2OTWA 3OKLB 5AAMC 2HVBA 5C0RL 4UCFA 1QI5A 2NYYD 4FDWA 3RPKA 1GHFL 4J4PA 2IDFA 1AP2A 1ED3A 3QGVA 1AGFB 5E51A 3QCTH 1CDGA 5H37H 4J8QA 4OCRH 2XWTA 4ODUA 2Y07H 1DVQA 3WJLC 1KXHA 2B4CH 2X9XA 5I5IA 4PJCF 3VI4A 2LTQB 5CD3A 1JYWA 3VD0A 4AZUA 4OSUH 5KVEE 1TVHB 3SCMB 1CDJA 2HVKA 3FQTA 3OR7A 3NACH 4U3XA 3QG7H 5G5DA 2YXMA 1F1DA 5AWNH 5IQ7H 4Q58C 3M45A 4WEMB 3VXOB 1JFQL 3EOTL 3QZWA 2WUCH 5E00B 1LNUA 2ZWSA 4ZYKA 2XWJA 1IBYA 2OSLB 5GS1A 1P7QD 3BIKB 1XTMA 2GW5A 2CLVA 4X6DE 2FX8H 1MY5A 2GBAA 2UWEF 1Z3GH 2WQWA 3RPBA 1R19A 1VGKA 3IE4A 4PP2B 3UIYA 1XCWA 1F90H 5EO9B 4H25B 1DO6A 2BS71 2G3XA 3ISWA 1Z9MA 3MOQA 3S3PA 1GGYA 4X7SH 1VFOA 2J56A 2OXHA 4XMXA 5L4FA 2XWBA 5JNYA 3H54A 1A6PA 4KQ4H 4M43L 3ARFD 2E7DA 3I9IA 1RUAH 2NTSP 4NRXB 3AY2A 4KXBA 4YDZA 3REWB 4YXKH 4AGOA 4BCXA 4BH8A 4LKXB 3QIWB 1QA9B 2X89D 3U4EB 4DN4H 1N2RB 1LMIA 1UVQA 3MRGA 1JI1A 2FEEL 4HJTA 1XF2A 2XQ0A 1VFMA 3ZL1A 2R39A 4BQ9A 4I48B 5SWZB 4JZJA 5GGRB 2AK4B 3BCFA 2QGEA 5L4JA 1G1YA 3F83A 1P7HL 3UYRL 3QXWA 5MP6H 1JZ8A 3WN5B 2VDQB 4G9FD 1E9QA 2V8LA 4TQPA 1ZLWK 3RX5A 3DPBA 3ZDXF 3SO3C 2RA1A 3VWJD 3UTQB 1K5WA 3K6NA 5LGHL 1V7NL 2SEBB 4DP6X 4FJZA 4HZAA 1QLEL 1EO5A 4KOCA 2J73A 4HSQA 3AACA 1I31A 2DTSA 3HRZA 2QQLL 4GP8B 4MASA 5C0RH 1TUPA 1GHFH 4U7SA 3CIQA 4JFEA 1SDDA 1FZKB 1ZD6A 4P3WA 2HPOA 1FF5A 3V4PL 4HUXB 1NL0L 1U8HB 5DHDA 4YGAB 5DMKA 4PRBB 2CRMA 5LN8A 1YYLL 5KS9E 3DJTA 2ZX8A 4IOIB 2ZNXA 5ISZA 2P8PB 4ZPVB 1HSBB 1A7NL 1WISA 3UBXG 3DBXA 2C1PA 1Z9NA 4M93C 4P23B 5EMYA 2B1OA 5DF0A 1NOLA 4XODA 1DSYA 1IGJA 2J4WL 3G04A 1RERA 2DJ4A 4KY1L 5TDOB 2IANB 3N2JA 3DUUA 2QGDA 3KL0A 4FFZA 3NA4A 5E9DB 1JFQH 3EOTH 4HK3J 4HK3N 3MC0A 5KAQF 3UDWA 3QFGA 3TA3B 3V0HA 2DYPB 2H47C 2ZSWA 2YUWA 3DKHA 1UQSA 3HKZA 4F3FB 2OR9L 2Z0UA 1EEZA 1MWAL 3KXFD 2A74B 3UG5A 1T7ZA 1KTBA 3D30A 5EOTA 5I17B 2XETA 2ESVD 3C5JA 3R18A 2APBA 5JDSA 3UTSB 4AQ8A 4U1JA 1BD2D 4AQ1B 4LRIA 4M43H 1CGXA 4PRPA 2VR8A 5FYLD 3AQDA 2P80D 5CEYB 5JMRA 2GFBA 3V0EA 4M8VA 3PP4L 5K9QI 4GJTB 3DURA 1QW9A 3U2IA 1XCTB 4UUJA 3T4AA 3QEGL 3T8MA 1T4KA 1N0XH 1XF5B 2HX9A 4KI1A 2VDRB 3LZRA 1SHWA 4Q2ZB 3ZKXB 2N7BA 4ZODA 3NIGB 4BKTC 5IVZA 2CRYA 4HEPA 3UYRH 1UFGA 3INUL 4XCNB 5E4EC 4IBVA 2BDNL 5JXEC 3IXAB 1R5IA 1OM3L 4FLRA 3O3BB 2X70A 1NCAL 4HT1L 4HWUA 5FYLL 1FG2B 3Q1EA 4X6CA 4BFOA 3C5ZA 3NSJA 1E2WA 3B5HA 3L08A 2VITB 3QO0B 3PWJB 4GAAA 5LGHH 1V7NH 1Q9LA 3GUTA 1QLEH 1N4XL 1YNTF 1KGCD 4GOSA 2QQLH 4CGUB 2YPVL 1SYSB 4HUMB 3WNJA 1KBWA 4WKXA 3JUZA 4G8IB 3V4PH 2EKSA 1NL0H 3BVXA 3EFOB 1JHLL 4DGVL 1YYLH 2NW3A 3B2XA 3OMNB 4NENA 5FGCE 1X6LA 2QEJA 3MV9E 3P9MB 2OA9A 4MJHA 5ITFB 1A7NH 1LHZA 1PZSA 1KXVA 4IRZL 4W9DC 3ZJAA 4NKOB 1HWGB 3WIHA 4FF9A 4J3OD 2CLRA 4Z7QB 3P9LB 4Q9RL 5F7FA 3QFJB 1B2YA 3QPQD 4GBXD 4KY1H 3ATFA 1VAHA 2R1XA 3ROLA 4OAWA 4Y5YA 3US1A 1GYVA 3TYFA 3LH9A 1IL1B 3BQUB 3BWZA 5BJTB 2MNJB 4PYGA 1VB9A 1PIFA 3VXUE 1ASOA 3UMNA 1GAFL 1MVUB 2AXFB 3M46A 4P2YA 5E6ZA 5E99L 4NUJB 2OR9H 4OM1L 1MWAH 2XN9D 1R3JB 3B1TA 3QDHA 1Q1JL 4IDJL 3SDCC 1EMTL 3UAAA 2I27N 3IGAB 3OKMB 1S9XA 3RWFA 2C34A 3CX5K 1JDDA 4AXWA 5JIIA 2P5EA 3DIVA 3GBDA 1GGUA 1XGPB 2F7OA 2K3TA 3ENEA 2PMZA 4PJIB 4AW7A 2Z1PA 2EYTB 4XX1E 1KPRA 1RZPA 3OAYK 3CN2A 1ZHKA 1A4AA 3PP4H 3D3VA 2LLLA 2LLGA 3LV3A 3QEGH 4WVRA 3FU8A 3IJHA 2VMJA 3AB0B 3U7AA 5CP7B 2HN7A 1BF8A 3MLTB 4UQ3A 1MFCL 3ZZSA 2J21A 2I9TB 4XNQA 2E74C 3A4AA 3H0TA 3DC0A 5I0VA 2YD2A 5DRZB 3GXTA 4GKSA 4R5TA 4EUPA 4TTGA 3INUH 2BDNH 1XH2A 2H6PA 4JFFD 3DDGA 3NFNB 5GZND 1OM3H 5DJDB 5C0JB 4L8SA 5FYLH 1NCAH 4HT1H 5C0BA 2Y0SA 1XF1A 5DK0B 3TU6A 1GW6A 2FWLB 2BRQA 3CIAA 3L3JA 1HHHB 3LAFA 4JPIA 1MCWW 4NPYA 5HGAA 4Z7NE 1INQB 4G9DA 5M94B 1N4XH 1AZVA 5JLZB 3MUY1 1NFAA 2BM3A 2Q7YA 4FADA 4JGJA 1YEWA 3ZR5A 3WEMA 2QDVA 4Q8BA 1MUJA 4IKJA 1R3LB 2VRQA 2RB8A 3ETSA 1ULVA 4ZMNA 1JHLH 1DZ0A 1GVIA 4B9YA 4DGVH 1ZGLP 2F54A 1XAUA 3FU0A 4IRZH 3RTQA 3ARFC 3IMRA 4X5RA 3RUGB 3ULAB 1PZAA 1DE4A 2FVNA 2IDSA 3DGDA 4W9CC 2VXTL 4L4VA 2CO1A 4Q9RH 3RBGA 5JOPD 2XRAL 3CVHB 3OKNA 4WNSA 2APVA 1K5NB 2BZCA 2C3WA 3QUML 3MJ9A 3MNVB 2QKIC 4AE1A 4ANVA 5JW5A 1YEFL 1FL3B 4ZSOB 5HJ3B 1YG9A 1GAFH 4FFWC 3VFMB 1LEGA 4QXTB 5E99H 2JKLA 4EMZA 3ZT6A 3CK0L 4OM1H 1QMUA 3HA0A 4G8FA 1G7QA 1Q1JH 4IDJH 1EMTH 4NKDB 4YR6A 4R5VA 1WT5A 2GKIA 3LIZA 5CN2A 4YDJB 2WKOF 4J3OH 4MX7B 3VWJC 1A3QA 3QUYA 3LH8A 5JTWA 4PRIB 1A2YA 2ZAIA 3GPEA 4PGDB 2R1YB 4TS6A 1G7MB 3OTTA 2MCG1 3FO1B 4LPUA 35C8L 4N1HB 1JFHA 2OM5A 3MHZA 1QO3B 1TQWA 3ILEA 5HBBA 3D34A 1KV3A 3IWVA 3AY4C 2TSAA 3PJSA 4TUOA 5DTFA 4AIZB 2AXHA 2C9AA 2Q2LA 5IOPA 2AQRA 4W4NA 5KSBB 3N1PC 2VB5A 3T8VA 2XJLA 5IT2L 1JRHL 7CGTA 1F0LA 3D85B 1MFCH 5ITBL 2E5EA 3BSZA 1N6VA 1ZE3C 2G3ZA 4BH7A 3CXHJ 1U4EA 3IJYB 4HS6A 2XQBL 3DYPA 4ZPTB 4A2LA 1I8IB 4TL5A 3TBVB 2F1EA 2ICEB 2YN3A 2Z64C 4P57A 3IU3B 5IBTL 3HE7D 5EDSA 2G5BA 1YMHA 2FBJL 1T04A 3G3LA 4P5TB 3ZE1B 1DJHA 2F7RA 4RGNB 3HZMA 2PYFA 2YRZA 5IHLB 2FWOA 1UD4A 4C59B 4PSRA 5DUML 3F5WB 1D7CA 3TC9A 3B7SA 4DH2A 3PABA 1GSKA 2PNDA 3W5NA 5IW1A 1NKOA 3MBED 2OLDA 5DYFA 1QSFD 1DVFD 3UZQA 2HRPL 1U8OB 2CUHA 2HA1A 2VDML 5J3HD 3NCJL 3WD5L 2E7CA 5IM7A 3BSHA 4GRLD 4F7TB 2RAMA 4IEFA 4WI0A 5B39B 5J6GA 3ILPB 4L1HA 4KJPD 1UWYA 4QHNB 1ZT1A 2HVJA 4YSSA 1T22B 3BZ5A 2VXTH 1ZAGA 2XPGB 3QXAB 5I1IL 2Y7QB 3SDDB 5HYQA 2OJEB 2ZAHA 2XRAH 5FCSH 4CBZA 4BHUI 2CO6B 5DHVA 2UY6A 3QUMH 1ZK5A 3P4OA 2Y06L 4JRXA 4Y8AA 2ZSVA 1YEFH 1WRFA 5FM4A 2LFEA 5SWZE 5LQBL 2AK4E 2XG5A 4OUOA 1NCJA 3ZTDC 4XX1G 3CSGA 3QYNA 3ZHDA 2HMID 2BSSB 2J43A 4RA3A 4Y4FD 3CK0H 3N1QC 1U4FA 1K2DB 2F68X 3C5SB 5CP3A 4HBCL 2R7EB 5KSUA 3RNQB 2P4AB 5FUCC 2NY0B 3P02A 3VD7A 2IADA 5SWSB 5DUBA 5AW7B 1Q0YL 3DRQA 4EEEA 1DBKL 2E4FA 35C8H 1I3RB 5KYYB 3P11L 2ZAGA 4P46B 1NIFA 2O1AA 1JTOA 1NCHA 3DO3A 3FCBA 4GO9A 2QPUA 4MB4A 3QJVB 1H15A 4I0PB 5KBPA 4JRLA 2AGJL 4PJBB 4F8NA 5IT2H 3P3SA 3T0DA 5DGRA 5DMGD 4UWQB 5BOPA 4LFHG 2H1PL 5ITBH 1VKXA 4KROD 1NIAA 3O6LL 2X4SA 4HG4K 2XQBH 3IRZA 5HYJA 5IJBC 3T3MB 3U46A 3WO4B 1JJUA 3BEWA 4MA3B 5C08A 4GIPD 2FEDC 4M8QB 4FA7B 5J13B 3HIZA 5IBTH 2FBJH 4GBXC 4NNXB 3UMTA 1IGTA 1NLBL 2IANE 3IFOA 3CXDL 1H6EA 4WRLA 5IB3A 1UB6A 5DUMH 4D94A 5E9DE 3U0TA 2GB2A 3BESR 1ED3B 4OTXL 5JA8B 4YL4A 2NX5B 1RUQL 3BT0A 3H9HA 3GZQA 3C09C 3AZUA 2HRPH 2VDMH 1AO7D 3NCJH 2XWTB 3S4SG 3WD5H 2FQEA 4ODUB 3T2LA 2LHAA 4IRSC 1WWBX 3KLAA 5HHOA 2F0CA 3ET9F 4X8CA 5J06A 3F85A 5AYTA 3UTSE 1G0YR 1IVTA 4BKLB 4IMLA 2HVKB 4A7GA 1XL6A 3OR7B 4U31A 5KBDA 1OARL 5I1IH 4QNPE 4YLQT 5BW7C 1P4BL 4QRRA 4X5WA 3K5RA 5EBLA 2JTYA 2Y06H 1M4KA 1RJYA 4ZYKB 2XWJB 2NXYB 1XMWA 5LQBH 2HT2C 2X4OB 3L4TA 3B2PA 3NIGE 4GFXA 4JQIL 1VGKB 2VLJD 1CLYL 1RPQA 2DJSA 5IQNA 4ZFZA 2WP3O 1WEJL 2ICWJ 4HBCH 3HBQA 1C5DA 1R1CA 4NQEA 5GZNC 1VDGA 4AKQA 3AG2B 2YR3A 5FECA 4WFFD 4ZG1A 2BWQA 1FNLA 3CFDB 2YD8A 5F70A 3GSXA 4CMMA 2XWBB 4L5FL 2P5WD 2X38A 5GZOC 2BCKA 3QUXD 5AENA 4GO8A 1Q0YH 3QP3A 3CH8A 4FQLL 4UTBL 2H3XC 1XB6A 2QSCL 4BH8B 1DBKH 1PX4A 1DBAL 2FAUA 3JT2A 4LK4A 1CL7H 3VXRA 3P11H 1UVQB 2UZXB 3MRGB 2ITFA 5K59F 2XTJE 2DICA 3W57A 4DPBX 3CQQA 2H0FA 1EAOA 2CA4A 4N2DA 1UA3A 5ANHA 2AGJH 1EGJA 3RWIB 2B9AA 4G5AA 2YWZA 2WD0A 1K3IA 2IFFL 1OGTA 1Z9PA 3MJ7A 5HDWA 2H1PH 3GF8A 4KNUA 4M4PA 1QZ1A 5FUZL 3I74A 2W38A 1XIWA 4QHKI 1K8IA 1BMWA 1WAAA 4BE6A 1LO0L 3DVGB 3TESA 1GYCA 1A6TB 2Z34A 1QFWL 1MCIA 1XCXA 3KW8A 5IFHL 1UA7A 5KYUB 3LKPA 1H3VA 3QFJE 1KPVA 3E6HB 2DH3A 4C56D 4Z7AA 1QBLL 3HRZB 1NLBH 4NWUL 3CXDH 3J2PA 1RFDL 5JHDA 2L4OA 1SDDB 5AKTA 4X9FA 4OTXH 4X9GA 1RUQH 4LLMB 1PG7X 4GW1A 5EDXA 3OGOE 1X4XA 1EBAA 3EO0A 2Y23A 4PRHA 4EAEA 4MXVE 4Q97A 4W4OC 4P2QD 4ANXA 3DBXB 3PXHA 1I9IL 1CUOA 1S5IL 5E1IA 2CLZA 3GNML 4TUUA 1LE9A 4PJ9A 1LE5B 1AHMA 4PJIE 2JWYA 2EADA 4YK4B 4BQ6A 1IGJB 3KYOA 3G04B 2C1OA 3BH9A 3N6YA 1U92A 2B0SL 1AZZC 2MCMA 3B7UX 1OARH 1RUPL 4C4UA 5DVKA 1P4BH 2KMWA 4KXAA 4JM2D 3GSWB 1FVDA 1DLHA 3KS0J 2UZIL 4UT9L 1NCOA 4OF0A 4HGMA 1UWXK 2ZSWB 1SYVA 3WEAA 3OZKA 1ONQA 1UQSB 4PJAB 1TZAA 2JJTC 4IKNA 4JQIH 2VZOA 4JRYB 4NBYB 1CLYH 3C2SA 1DN2A 1UOLA 2VR3A 5EOTB 1WEJH 3C5JB 5JDSB 2DWTA 2GHWB 1FAIL 4L5FH 2VQTA 3HE7C 4N26A 3ZN6A 2YEZB 3U36A 1ZKAA 1BZDA 4LL1A 4PJFA 4FQLH 1OM9A 2ROYA 4UTBH 5BRZE 2QSCH 3MMEB 1DBAH 1KGIA 4QTHA 3F6IA 5DD5L 4E9TA 5I1LA 5F7MC 3MBEC 2H26B 3UYPA 1SOSA 3W9EB 3SOTA 1MCDA 2PR4L 1B3IA 1MCWM 1DVFC 5J3HC 3UTPD 1HHGA 5D2LA 5IVZB 2FBRA 1GYWA 2IFFH 1H9DA 4GRLC 3NK3A 5FUZH 3ABKB 4IMKA 4KQ0A 3ARED 4KJPC 5LG1A 3TEZA 5CJOL 1LO0H 1QBML 3VG9B 1A8ZA 3TO2A 1QFWH 4AY0A 5IFHH 4M7ZB 3RUGE 4BA8A 2UVEA 1Q9LB 3GUTB 1IAIL 1JIBA 2BW5A 1OLZA 2BMKB 1QBLH 1F6AA 3KPRA 5AOMA 4NWUH 3GS4A 3F7KA 3RWHA 1DVSA 3LIUA 1RFDH 3RWGA 4HUNB 4P2OD 4ZOBA 3GMLB 4TV3A 4Y5XA 1KBKA 3QE5A 4JW3A 1FFPB 3S3JA 2F53B 3LH2L 2OXGA 2HMIC 4H20L 5B1JC 4Y4FC 4MDJA 3NDZE 2BOLA 4NENB 3C8HA 3K4AA 2EC8A 1QSVA 1YPZF 3MREA 4H8UA 5CLTA 4K5MA 3QUZD 5LLIC 3MZGB 5EIIB 5IF0B 1I9IH 1X5LA 1S5IH 3GNMH 5SX5H 4ZRGA 2IALB 2CLRB 5D5MA 4L3EA 2NQCA 1VJSA 2R1XB 3ROLB 2XPZA 2B0SH 3CZEA 4K7PX 3AQYA 4DJMA 5AOIA 4JY6A 3MRJB 3IWUA 1RUPH 1ET5A 5LXGL 3RWJA 1WP6A 3GTTA 3WTTA 3ZRCC 3HAEH 4FKHA 2YD7A 5TH2A 2LR4A 1PZ2A 2E9JA 2UZIH 4UT9H 1YO4A 2I25N 4GLRH 5E7BA 5EZOL 5I23A 4KROC 2H1LM 3EUUA 4LCIL 4PV8A 2OZ4A 5IMMA 1SFDA 1S9XB 4G43A 3WYRA 1OO2A 1MJ8L 3WEXA 4AXWB 3L3HA 4F5CA 2P5EB 4X42A 1FAIH 3WS6A 4N1EA 3OLDA 3WEOA 1WBZB 1YYML 1ET8A 1KPRB 3EUDA 4I5BA 3S96A 3QAQA 4RGNE 1CDIA 1TYRA 4L4JA 2ZTBA 3ABMB 3BD4A 3CU1A 2MPAL 3D3VB 4ZAKB 2Y2YA 1CGTA 3LV3B 5DD5H 3KGRA 5JOEA 3BEVA 2E7LA 5IMKB 2N0KA 2PR4H 3E6FB 1YCSA 4UNVA 3PQYD 3STLA 1R9FA 5EU6D 4MJJA 4CSPA 1BZQK 4XNQB 5K69A 3I50L 1E4HA 5EOCJ 5DSCA 4EUPB 1KENL 4Z8FL 2H6PB 3UP6A 5CJOH 3WUZA 1QBMH 2VDLL 5C0BB 4HIEB 2IV8A 3CG8A 4QAWA 4BZ1L 3NN8A 1GZPA 3L3JB 4JPIB 4NPYB 1KLFB 5HGAB 5A6MA 1NAML 3Q8FA 4NGHL 3TN0D 1IAIH 2EIKB 4OCWL 1RHFA 1ZA3B 2Q7YB 3D69A 3BN9D 3QQ3B 3GB7A 1QVOB 3KL5A 1MUJB 3ME0A 4MBOA 1CBVL 3LH2H 1SHMA 1NEZA 5JW4M 4H20H 1PPIA 15C8L 2BNQE 4F8LA 3FRUA 4X7EC 2WXKA 4GMTL 2F54B 3MCLL 4NZTL 4JN1L 1T03L 2M8XA 1CS6A 2X2UA 3PL6B 1SJHA 3MACL 1NTDA 3RPIB 3RTQB 3RNKA 3V5DA 4UQBA 5F3BA 1KCWA 3WU1A 1NGYA 3QUXC 3ZZLA 1DE4B 3QEHB 3ZOAA 1ZHNB 4CN4A 3UTTD 5I6PA 4TTDD 5GSRA 3OKNB 4YSAA 4ZXBA 3TF4A 3IDIA 5LXGH 4AJ0A 1NEUA 3K8MA 3WCYA 1KYUA 1NUDA 2UXVA 2A2QT 3KDPB 4U6YB 3ZT5A 4BSWB 4PJBE 5L2KB 2CQVA 1X9UA 5EZOH 1R46A 3VXMD 3BGFC 5ICZA 1OAYL 2YA1A 4OFDA 4G8FB 3HBZA 4FG4A 4LCIH 5EIQA 1E67A 4YR6B 5D6DC 4D8PA 5F6IC 4OGQC 1QQDA 5CKAA 1MJ8H 4OQ1A 3T3ME 1UYWL 4RVBA 3QUYB 1U42A 4PWKA 1E7UA 4X5PA 5TQ0L 5F1NA 3PHOB 5T3ZL 1YYMH 3KPMA 4M3KB 2J5LC 3H1ZA 3TFKC 3ZO9A 1OAKL 5F6HJ 4E41B 5AQ0A 5ID1B 1TSHA 3R0NA 1UUNA 2MPAH 1V10A 3CZNA 3L13A 4PV9B 2OK0L 3IXTA 3T2PA 2ADGB 2VISA 4N2OA 1TJGL 4HIJA 5B1KA 4O2EB 5AUMA 1NBZB 1A8JH 2NX5E 5CU9A 3IT8D 4F24A 5C6WH 4O5LL 4LPWA 2CK2A 4JRWA 3MRKA 5DZOA 4CU6A 4QWWD 3I50H 5IMOB 2AMGA 1KENH 1PZ5A 4YXHL 1LD9B 4Z8FH 3UZVB 5AW3B 2LW3A 2B59A 2OTPA 5F88A 3FNKA 2VDLH 3BPCA 2WCSA 2V3FA 1S8DA 2PWEA 4BZ1H 1PLCA 3FF7A 4HFWA 2BY3A 2EIBA 4PJGB 1XL4A 3VH8A 1NAMH 4NGHH 2EYSB 3ZUCA 2NXZB 3GK8L 3HMXA 2MSPA 3GMPA 3O8XA 2F2HA 3VG0L 4OCWH 3B2MA 1BBDH 3PCYA 4JM2C 4GS7C 4AMWA 4R2GB 5EZLA 1HEZA 4QO1A 5H8DA 5TK2A 4Q6YA 4PRDA 1CBVH 2JKRM 1R34A 4CAGA 15C8H 4XMZA 5TDPA 4GMTH 3MCLH 4NZTH 4JN1H 1T03H 4PQXA 1JN6B 1FYTA 4WI0B 5J6GB 3SKMA 4UAHA 4YSTA 3BRFA 3MACH 1Q90A 3WBDA 2R29L 3ZR6A 2HVJB 5EBGA 3ARTA 3C9NA 1XAKA 1ND0A 4XCCL 4CUCA 3MI6A 1G5AA 5J11B 5GS3A 5SX4I 5L8JB 2CHDA 2MIZA 3AXLA 4GY4A 5HYQB 1CTNA 3VGEA 4ODWA 3MFGB 1KY6A 1RVFL 4AEIL 4LLVA 2ZSVB 2VW6A 2Y22A 1Y6NR 5E8PB 3SGJC 1HVXA 1CN4A 1QAWA 2W1NA 2XG5B 4UDTB 1IKNA 1L3NA 5D7LA 3U2JA 3DXAA 3NZHL 1E8WA 5AOJA 5IEHB 2AEQL 3QDGD 4J7RA 1OAYH 1GC1L 2A73A 2P45B 1M7IB 3HNTL 4H2AA 1NA8A 3AREC 2HLFC 3NGBC 1ODUA 1XR9A 3FQRA 1F3RB 1HILA 4G7QB 4JKLA 5I1CL 3M6DA 4XN9A 1UYWH 2J12B 2IADB 2Q76A 3FONA 5DUBB 5TQ0H 4J6RL 1KTCA 2YUZA 1DUZA 1FO0L 3DRQB 4S1RH 5T3ZH 3CDZA 1QR1A 5M7QA 3GS7A 1OAKH 2GTWB 3HG1D 4B41A 3LKQA 3MV7D 2OK0H 3D2UA 1S2EA 3V7MA 4S2SA 2X44D 3LNEA 4NO0B 3T8XA 2ZUTA 1TJGH 1GOGA 3PS6A 2F18A 4JN2B 1U8IA 2PW2B 3N1FC 4O5LH 1CLVA 5CEZL 1VKXB 4U1LA 5EN2B 4YBHA 1YVLA 5I24A 3QUZC 3FFCB 3KHOA 4I4WA 5HYSA 1TEFA 3KPQB 4YXHH 3U46B 1TMQA 2IBZY 4BFEA 5JPNA 4I13B 2EP6A 1NIBA 2FZ3A 2WQRA 5ID0A 1BJ1H 2K9UA 3BAXA 4MJIB 3C87A 4HVBA 3MNDA 4YEFA 4KKLD 2EDWA 1T0OA 2G2RB 3WTUA 3N40P 1YYCA 4DKAA 1Y1DA 2F6AA 3GK8H 1UWGL 4JFTA 1OT1A 1IC0A 1B4TA 1MHEA 3NIDB 2EXWD 3VG0H 1MDTA 5C07B 3U0TB 3S8FB 3KYNA 2EC9T 4JR9L 5GRVK 4PJAE 1V5JA 4ONHA 3PLYA 4JRYE 5J6HB 3AG4B 1S3KL 1Z9LA 3PWPD 4HGWA 4M7LT 5DJYA 4C4BA 4ZX3A 3KLAB 3HI5L 3RGVA 4EKXA 1EHKB 4A2HA 2R29H 2BSTB 1OGSA 5IHWA 2HJKA 2WTOA 1W8NA 3RY6A 2I5YL 1YC8A 4XCCH 1G94A 2A6KB 4IMLB 1HHIA 3DUSA 4JHZA 5HD8D 3UTOA 4HETA 3SPIA 4ZUUB 4W9IC 3EYQD 4X5WB 2WTPA 3SDAC 1RVFH 1SXNA 4MNQA 4N8VG 4NOFA 5EBLB 5EU3B 4AEIH 2EO9A 5DVPA 2FGZA 2ZKMX 3EZ8A 3UC2A 3KWVA 1JXDA 3NZHH 3QI9A 4YHKL 2J1ZA 2QR0A 5D7IB 2JTDA 1GC1H 4U0QB 3U48A 4AZ8B 3HNTH 4NQEB 3F04A 1XV8A 5FECB 2ZCHL 1ITBB 2JIXA 4CMMB 5I1CH 2B1AL 2YIHA 1I7UA 1JZ5A 2BCKB 3E8VA 1WFUA 4J6RH 2PPEA 1FO0H 2ZOWA 2YSSA 1TKWA 4AV5A 2AABL 2N4IA 43CAB 2FECL 1HL4A 3VE0A 4R84A 1KTLB 3VGGA 3D06A 3BFWA 1EEUA 4A38A 2LT9A 1AMXA 3TTYA 2F53E 3T0WA 2FBOJ 3F7LA 1OGTB 3K6SA 5CEZH 1D2PA 2OULB 4WHYH 1XIWB 3NCYS 5CCKL 5BV7B 2HYMA 4U4BA 1CFNA 4J2QA 2N56A 4XXWA 3L1OL 1JV2A 1OALA 5FEBA 3O4LB 1SXAA 3IRCA 1D6EA 3IM1A 5TE6L 4EXPX 1U58A 2A9AA 3OLIA 4IBZA 3LKPB 1KPVB 4TTDC 5E1GA 1EDYA 3IMUA 4QRPD 5EUOA 4WY7L 1QABA 3OQ3B 2EQDA 2BERA 5JHDB 1ZSDA 2D2OA 2NY5C 1A1NA 3ETBJ 3MO1A 1KT2A 1Z5LA 4FP8L 4JR9H 4GW1B 4JFWA 5DZ9A 3HEIB 2ZPKL 1N8ZB 5AW2B 4PRHB 5DHMC 2DMGA 1S3KH 5DJ0A 4RSVA 2WINB 1J18A 1GZQB 1E28B 3F8UB 3HI5H 3KCWA 4TULL 5TFSL 1C12A 1WICA 4L4TD 2CLZB 2P5EE 1LE9B 2MQGA 2Z92A 3TVMA 3MYJA 2AFNA 2QMKA 2VE6A 5AAWC 2I5YH 2J8HA 5BMFL 3BH9B 3ORJA 5JPMC 5FLVA 2H2PD 4Z7VA 2ZUVA 4GRWE 3D3VE 3KYMA 3X11A 2X2IA 1DLHB 3VQMA 4QRQA 3IJEA 4O51A 4FFVD 4N8UA 1F2XK 4HAFA 1ONQB 3MRRA 2AQNA 5KWYC 3MTXA 4QWWC 4U7MA 4YHKH 4GFTB 4RSYA 4Q9QL 4EXKA 4XN8A 1ZLVH 2ZCHH 4KVNL 4RFNB 3WG7B 1TZHA 3V4VL 2B1AH 2IF7A 3M17A 1UZ6F 1TTRA 4N4YB 4F37K 4RMSA 1I9JL 3PDOA 1BXAA 4XZ4A 3GSNL 2FRGP 2V17L 3ZY7A 2AABH 4EN3D 4APQC 5K9JL 1Q94A 3MXVL 4ZTPL 4QXWA 2PTVA 3T65A 4P0DA 3WO3B 4B7LA 1TQCB 3MRDA 5BO1L 1BZ9A 1HHGB 2WBXA 2Z35A 5E1HB 1USQA 3SE4C 1WA1X 3LN5B 4KFMA 1BQSA 5F7BA 3FH5A 4YHIA 5CCKH 3B9DA 3ELAT 4LLWB 2Q86B 3L1OH 5ETUB 1P6FA 1BVLB 2FHBA 3TO2B 3ZU8A 4UBDD 5E6YA 4QYAA 5F0JB 5TE6H 2DRUA 4NAMA 5IV2A 5M95B 4X6DF 5J9PB 2K4WA 4K7FA 3MBXL 1F6AB 4JFDA 4WY7H 2DIEA 1BVNP 4HXAL 1U8LB 3RWHB 5I75C 1CZ8L 3OJ2C 1TLMA 2JCCB 4KTDL 3M1CA 4WO4C 4Y5XB 2W9LA 1ZVHA 3LXCA 5L2KE 4RMTA 2PYEB 4FP8H 1KG0A 3H56A 2XACC 4WU7A 5A2AA 4XH2A 2ZPKH 5T5NF 3QORD 2G0LA 2N59A 2ICWI 5AVSB 4K4KA 2XZQL 5I74B 1TTAA 4TULH 4I7ZC 5TFSH 3CHQA 4E5XB 1MCLA 3CVIL 4DEPC 5F7HA 2BO0A 5AW4B 4POZD 1ZRUA 3UTZB 5D5MB 4GW4B 2NNAB 1UCTA 3IETB 3KBPA 5BMFH 4N5UA 4ZOEA 1I1YA 4E41E 3PAYA 1F8TL 4G7VL 4DGIL 5CCHE 3RDJA 1YHPA 4IRJC 1AG6A 4AYGA 2YFNA 1U8PA 3TOPA 4ELMB 1B2WL 2Y3AA 3VU2A 2Q8AL 2GT9A 5FO9A 5KVEL 2Z65C 1RZ7L 1CD0A 3LEVL 5MEQA 2E7MA 2ZJSL 1T5XA 1MFDH 2BWDA 4OBRA 5IMMB 2H9GA 3WEXB 1PEWA 1DDHA 4Q9QH 5F1KC 2OJ1A 4LZKA 4KVNH 5CKGA 1PD0A 3WKQA 2WO3B 3V4VH 3HS0C 4KKLC 4LP5A 2ODIA 2KUTA 4PJGE 1I9JH 4XOBA 3TO4C 2Z93B 3S96B 2DLGA 3ROOA 3GSNH 2V17H 5GRWA 1M42A 1VGEL 3CZGA 2EXWC 3D07A 4N2MA 3MXVH 3B9VA 4ZTPH 3VFPA 4KMTL 4YDLC 5I8KL 5EH1A 1DVYA 3NIFB 4A7QA 4Y2DB 1U8KA 2CIKA 5BO1H 3QJSB 4MMXB 4AQAA 3FXIC 4BELD 3AWFA 1A22B 1BEXA 5DSCB 3D39A 1F3JA 2AAAA 4Z95L 4IGBA 3D4YA 1IAOA 3VFRB 3MFFA 1B4RA 5A43C 1IC4L 3G5XB 3NRPA 4JPSA 4U1KB 4M03A 2V33A 4PU2A 5HD8C 3BKYH 4DOHB 4H2CA 2EKJA 5DRXB 3MBXH 4N22A 5EPMA 5F96L 2R27A 2A9NL 3EYQC 3IJSA 5A40E 4HXAH 4ZMOA 1CZ8H 5JIKA 1S4IA 4KTDH 5CIPH 4ENZA 2ATPA 4H8WL 4YBQD 3ME0B 1AYRA 1NEZB 3VGAB 1M7XA 4WI6A 1P2CA 3GYRA 1P7BA 2E56A 4LCWA 4NT6A 5FO2A 4TQIA 2FNBA 3RURA 4HJ0D 3BT2L 4PLNC 5ADPL 1ZWIA 2XZQH 2OYMA 1ES0B 2EDTA 4U49A 3BRDA 3OAWA 3RNKB 4TMPA 4K3DL 4Y16A 3CVIH 4WK4B 2ZUUA 2E8ZA 4FQXA 1FDLL 3FSWA 1CDBA 2A9BA 2UXFA 3CZFA 4OIAA 4MA1C 4IU2B 1F8TH 4XB7A 4G7VH 4DGIH 3IDIB 1B0GB 2WCGA 4GINA 1YUKB 5FFOA 4XCFL 1GH7A 1HQRA 1L9QA 4AYID 4AVKA 1B2WH 1IEHA 3RWCA 2Q8AH 4IBYA 3F58L 2A4ZA 1PZBA 1NKRA 4WNQA 5ICZB 1RZ7H 4NZRL 3LEVH 3UBXI 4Y19A 2ZJSH 2JI2A 3FFCE 2UVFA 4JO1L 4GW5A 1F6LL 4GG6F 1T7WA 4MXWH 4LCUA 1HWHB 2ATKB 2XV2A 4IBTA 4MJIE 5F1NB 3TNMA 3QQDA 4JANA 3WEBA 3KPMB 4F20A 3MUZ1 1HN1A 4XPHL 4HHAA 5E70A 1VGEH 4OI7A 5CBAA 2A1WL 3NIDE 3ZYOA 2H5UA 4L9DA 5C07E 5I8KH 3EZJB 1Q9WA 3QIBA 2IPKA 1GZHA 4FRWA 2DQDL 1RZFL 1LJMA 5D71L 3GMMA 4NRYA 1CFQB 1FBIL 1I1AB 4HSAC 1CF1A 2HTLD 3MRKB 1TEYA 3X14B 1OPGL 2H3KA 2VJXA 2XA8L 4ZFQA 3SDXA 3UOAB 4J3SA 3V95A 1PZ5B 2BP3A 4YSOA 3NJFA 4Z95H 3NJGA 2VM4A 4E2OA 3VMPA 5F88B 1IC4H 4R4BA 3SYPA 2CBMA 3LD8B 5KVDE 3A21A 3O8XB 3S3SA 2NNRA 5F96H 2A9NH 2UUDH 4WW2B 3QEQA 1NC4A 4GQZA 2BSED 3MV9D 4PJ8D 4QYOA 5CSGA 4Q52A 5GS2H 2AJYL 5EZLB 1ZIBA 3SKJL 4FFVC 2YKLL 4H8WH 2DQCL 4PH8A 4R26L 2ED9A 2YEVB 1E3FA 5C0IA 3QR0A 1O6SA 1WLHA 2BFGA 2G9HA 5B21A 2COQA 3HZYA 5D7IE 2WKOA 3P0VL 2R2HA 1I1FA 3BT2H 3SKMB 1F2QA 5ADPH 1TVDA 5JOFA 3NZ8B 5GGSY 4K3DH 3W0WA 3FO9B 1YEIL 3C9NB 3LZQA 1ND0B 2CHZA 5B1BB 3KLKA 3VXUD 1FDLH 3I3DA 3AXLB 1A65A 2OR7A 2ZOLA 3R1GL 2ZOKA 4NZ8A 3X1GA 4LCYB 5INDB 2VYRE 4IJTA 4PP1D 3L3IA 3NPSC 2CM5A 4QI3A 4XCFH 1Y18A 2BY2A 2F7PA 4Y2LA 4FYSA 3F58H 4OZGE 4A37A 2WZPA 1HE8A 2G30A 3STBA 3ZPDA 4NZRH 1OP9A 4R7LA 1UOWA 4X6EA 1LO2L 2YQ2A 1XR9B 2HAZA 3EJCA 4HKXA 4YZFE 4DP9X 2DMCA 4U1IA 4JO1H 3VSVA 1CPUA 5DR5L 4OFKA 3HZKA 2ZXAA 4UBDC 3O4LE 5IG7A 3INOA 3FONB 5IB4B 1QR1B 3GTNA 1N0LA 2X4NB 3CDZB 1QPKA 1U2YA 2AKRA 3WY1A 1O5PA 4XPHH 4LLDA 5AZUA 4DZ8A 5E7FA 2A1WH 3LKQB 3QR2A 3UJTL 5JHDE 4A2MA 3FU9A 3T8XB 3NFPB 4X7TA 2V2TA 2DPKA 2DQIL 3D0AA 2DQDH 1RZFH 3QXVA 5D71H 5KTEH 5FUOL 5DVOA 1U3NA 3I2CL 1FBIH 3ZX1A 3VD4A 4U1LB 1UZGA 4UOZA 1OPGH 2PPFA 2XA8H 4TNGA 1X5ZA 4WUUA 3SQRA 5HYSB 4E9XA 5TF1L 3TASA 2JXMA 5FCUL 5JIHA 1Q38A 2FZ3B 4POZC 5ID0B 5IGXL 3C8KA 1FNGA 2WN2A 2WLLB 4NCDA 1EAPA 4MWFB 5FA4B 4P4KA 2P46B 3JWNH 2ZWYA 4QLWA 3VAEA 1QNZL 1MHEB 3OG6B 4N1CA 3VXSE 2VXQA 1BOYA 2DW5A 3MRNB 2CKBA 1ZTMA 5AOKA 1BZEA 1L6XA 3UROR 2AJYH 3SKJH 1KBPA 2YKLH 3KYNB 2DQCH 4R26H 4NPJA 4ONHB 2GUYA 4HCRA 5LUMA 1L4IA 3AS3A 2IH3A 4MCYA 5DZPA 1S7SA 3P0VH 2KYIA 2P8LB 4HGWB 4Y2OA 3TZVB 1VZGA 2QQQA 4XAWL 1TENA 2XTLA 3TBBA 3AWGA 2HJKB 2IWGA 1YEIH 1CICD 4Q6IC 2OQJA 1E5YA 3DUSB 1K4CA 5DA4A 3R1GH 2H8PB 5F6HI 3CFJA 3PPSA 1F11A 2NY1D 2DMKA 3PDDA 1QFPA 4AVHA 3H4HA 4HJSA 3FTGA 3DHMA 1JF1B 4MNQB 3E9UA 4OLXL 1E5AA 5K9KA 5AB0A 2V37A 2IWEA 4L8CA 5I1EL 4F8TA 3U25A 2K8MA 3QUGA 1ZLWH 1SQ2N 2P47B 2YOCA 2JLPA 1KF9B 2FJUB 5I16A 2B5IC 5FW8A 5AD0A 2EC9U 1N5YH 5HHQA 1AGCA 5DR5H 3MLPA 4TUJA 4KRMB 2IQAA 1REIA 3GSVA 2X4QA 5TGBB 5TD4A 5D96C 1TKWB 2WQ8A 4WDIA 3X1FA 1EERB 2NY6B 3D25A 1ZGLA 3SE3C 3AM8C 2FD6L 3AMLA 3P4NB 3QRBA 3UJTH 3BH8A 2JCCE 4L37A 3VNZA 1KACB 4YBQC 2K3HA 2XJKA 4O02A 2QHRL 2DQIH 2CALA 4FFYL 4R3SB 2PYEE 4PS8A 5CGTA 2VIRA 5FUOH 3K6SB 3I2CH 4PJCB 4HJ0C 5EU4A 4WHDA 3SCMD 5E4AA 1DN0A 3BP6A 1CFNB 1AY1L 2CK0L 3ILQC 5TF1H 5FCUH 1D5XB 5IGXH 1JZ3A 1MLBB 1Y7VA 1U58B 5D5ME 1PQZA 1QLEB 5E1QA 3K6OA 3SBRA 3UACA 5EUOB 1DLFL 5ABZA 1YUHB 4QHPA 1QNZH 5E6ID 3SPVA 4EO5A 4M6OL 1KJ2A 1ZSDB 3X1NA 2LE9A 4P99A 3MLWL 4ELME 1A1NB 5JDJA 3MO1B 3U30B 3V4PB 3NCEB 3MV01 3PWNB 1P4LA 2WY3B 3DYOA 3SZKC 5IHZA 2F5BL 3FTXA 1P5UB 3X12B 5LNGA 4ISVB 5DJ0B 2AJZA 4N24A 3QIWD 4XAWH 2MQCA 1GGIL 2JSFA 4PD4J 2WB7A 3AGWA 4H5SA 2Z92B 3APNA 2D31A 5DEGA 3TVMB 1NFKA 4ZMQA 1YY9C 2VE6B 1AR1D 1NFDA 3DX7A 3HOGA 3N44F 2ISDA 2ZT9C 3EW3B 5SWZD 5F7UA 2AK4D 1MCBA 1WWWX 4Z7VB 3UPRA 1NUGA 4OZIF 4AYDC 2R56L 1HH9A 3ABGA 5E8OA 4KJYA 4Q7DA 3LEYH 3X11B 3NIFE 4OLXH 3BLPX 5BOJA 4NQTA 4IOSA 4GSXA 2OSYA 5I1EH 4BYHA 2HTLC 4HWBL 5H35A 5AW5B 1VCAA 3FQXB 4RH4A 2NT1A 3ZDXB 4MD4B 1WWCA 5E23A 5JHLL 1Y6MR 2DEYX 1G43A 1JTTA 5D8JL 4ONFL 3M17B 2ADJA 5G4NA 3MLVH 3PDOB 4D0BA 2OCJA 1Q94B 2VDQL 3DECA 2FD6H 4PJ8C 1ZVSB 1TCRB 3DX3A 3B34A 4XN5A 4DVBA 3T65B 2OCFD 3L4UA 3MRDB 4ZO7A 4LU5H 2GY7B 2QHRH 4FFYH 3V0GA 1BZ9B 4GAYA 4OZFA 4P23D 5HI5D 5JA9A 3KLHD 1AH1A 1F4AA 2CNZA 2Z35B 4H8QA 4JHWL 4PLOB 4EDXA 1C5BL 2A6DA 2WVUA 1I7ZA 4AC2A 1E30A 2IAND 3MR9B 2N7SA 1AY1H 2CK0H 1AHWC 3E1ZA 1QLFB 4G59C 3P3TA 2H32A 2D3LA 4KNQA 1H5BC 1HL8A 5E9DD 1WTLA 1KBBA 3RVUD 3B7RL 3CFBB 1HS6A 3C6SA 3HB3B 3DLQR 1CDUA 5IV2B 1TTUA 4XB8A 1JPFA 2DYPD 4K7FB 3ULVE 5TPWL 3L95A 3OXSB 4JFDB 1DLFH 3QFDB 3T04D 7TAAA 4PG9B 2X88A 1NM9A 4GSDL 4GKZB 2MNWA 3KLDA 4M6OH 1D9KB 3EYVA 5E8NB 5DCCA 3HC0A 4BRVA 2VW7A 3UTSD 1KG0B 5HTSA 2Z4QA 3G6AB 1MG2C 4XH2B 2F5BH 2KDYA 4AYFA 3VFOA 3IMWA 4L18A 3W39B 3SODB 3KNBA 4K0OA 1MHCA 5I26A 1GGIH 3OAYH 3QA3B 4J1UA 5DRNA 4CRPA 2NPLX 1OE1A 3U2SA 2DWEA 2ZG1A 1D5BA 1JD9A 2AJUL 5F9WB 1I1YB 3ERXA 5TJWK 5E6SB 1QSEB 3V6OA 1XBRA 5JIQA 3MV11 4HH9A 3ZMNA 3M7FB 4OLYL 2R56H 2I24N 4E9WA 4UV7L 4WK0B 2R23B 3FU5A 2G75A 3FOMB 1MZYA 4ZO6A 4WV1C 2GT9B 2JE8A 2V5MA 3JV4A 4JDVA 4QCIB 5FYJL 4HWBH 5JIPA 5MEQB 3KLQA 3NMEA 1ANUA 4MKTA 4RMRA 2R2BA 4Z7QF 1IMHC 4RESB 2DL9A 3N9GL 5JHLH 2ZP9A 1NDMA 3K72A 2VDRL 5D8JH 1UEMA 1PG7W 2WP3T 4ONFH 2NNFA 5HYIA 4FEIA 2XTJD 3V0AC 4ATTA 1NUNB 2XTSA 4Q74A 5CJ5A 3BVNB 4ODXA 3PP3K 3NDYE 3GQFA 2NOYA 2VDQH 3F7QA 1S9KC 4LHQB 1RY7B 2E3VA 3KLSA 1MXDA 3D0LB 1NMCC 1A1MA 1BFOA 2GSIA 1PDKB 4BZ2A 2UY7A 1IJ9A 5DEZA 1VFUA 4AQAB 4X4XA 4HCFA 1AS6A 4JHWH 3GSRA 1C5BH 3MRHA 3QFJD 3KWWA 1MFNA 4PS7A 1FFNA 3RWEA 1GL4B 2YD9A 4NC2B 3QJHA 4Y1AB 4I1NB 5KYWB 3ARPA 1IAOB 4TNEA 3PWUA 2EEFA 4G5ZL 3UEZA 3BQUD 5AG9A 3H9YA 1NC2A 4NZFA 3L4WA 2A5UA 5D1XA 4I2XB 1IZJA 1NOAA 1QTPA 4NKMB 5I8CA 2NY1C 5TPWH 1PLBA 3IJSB 1F4XL 1RL1A 2Y72A 4NQQA 4A04A 4GSDH 4BXSV 3L3OC 4OY9A 2ATPB 2NNXA 3AQXA 1FE8L 1K85A 4ONGL 4JJOA 3QVAA 4H44C 3O6FA 5D4QA 1OW0C 4V1DE 32C2B 5HHVL 1O7VA 1KCUL 4EKJA 2WWKO 2XWXA 2P24B 2G2NA 5DUPL 2EEDA 3O3EA 4Z77B 4YL9A 1R3KA 1FFOB 1FZOB 2NRDA 4Y16B 4AE0A 4JREB 4TUKL 1Y0LA 1IGMH 4PHXA 5HPMB 4FQXB 2AJUH 3VQLA 4AK1A 1JP5A 2HH0L 3WUWB 3RA7L 2DAVA 3GDBA 3L5WA 5KSAA 4IIQB 1RZJL 3QUMB 4OLYH 1I8LC 4KU1A 4UV7H 4XP1L 1HQRB 3T0EA 1JK8A 4PTUA 2LTQC 5GGTL 5FYJH 2RQ8A 2OMWA 4HUWA 3RUGF 3DHUA 5DJ2B 3QS3A 5BRZD 4KDTA 3N9GH 4Y5VB 5T5FA 4ELDA 3N1GC 4ZO8A 1SM3L 3LRLA 2VDRH 3DRTA 1BX2A 4OUUA 4OBSA 4JANB 1DHKA 3O3DA 1B88A 2YHGA 3HRPA 1CDCA 5E6IC 1YQVL 1EFQA 5CBAB 5CHNB 3V8CA 3U82B 3L45A 4PI0A 4R8WL 3UBFA 4B9CA 1HTYA 4UANA 3U6RA 1Q9WB 2IPKB 5J1AB 1HNGA 3IF1A 4F91B 12E8L 1A6VL 4PYHA 5C09B 1IT9L 3P3UA 3FH7A 3GMMB 4NRYB 5MERB 3S37X 1LDPH 4F1SA 2YSTA 4F93B 3EO1B 3AT8A 4HUUB 1J0ZA 2W0FA 4AV4A 2X53A 3QIWC 4AQZA 4XMWA 3H53A 3OHXA 2EACA 1T1ZA 3DX8B 4G5ZH 1W0VA 3SY6A 2XG4A 1CJYA 2BHZA 1BEYL 3IFPA 1AR1C 3OSVA 4R4BB 4XOAA 2JMRA 4H1LG 4XCEB 5KSBF 4RCAA 3T6VA 4JKKA 4NUGL 3AFLA 3MX0B 2Y2TA 5D1QA 3IDJA 4HK0A 1F4XH 2P49B 1NC4B 3QEQB 4RLDA 2AK1L 3WN5C 2VJ8A 4MNQE 4QYOB 5E03A 1WPCA 3UAJA 4NDMA 1NJ9B 4ONGH 5G55A 3EDEA 4RZCA 2IO5A 5C0IB 2VDMB 1J8HE 1CTMA 2DJMA 2G9HB 3U7WL 1M9SA 1PY9A 5HHVH 3HZYB 1KCUH 4N2KA 1HI6A 3ZE1F 1JGEB 1U3HC 4PJ7F 3ATAA 5DUPH 1MAML 4U3SA 4KVCL 1AFVL 5IBLC 3W0WB 2QSTA 2E9BA 3ZE2F 1OP3K 4TUKH 1UXWB 4F7MA 2WN3A 2GK0A 4Q4IA 2ZYHA 4YHPA 1AOZA 2ZOLB 3D85D 2ZOKB 2HH0H 4WGWB 4E0RA 1WFNA 1MI5A 2MOGA 2MFNA 3RA7H 3D33A 1MEXL 1WHPA 1RZJH 3QNYA 2Q20A 1Q9OB 5HHME 5F3FA 3L3IB 1Q9KA 4KRPB 4XP1H 3BAYA 3S34L 4HWZA 3RYMA 5HI5C 3NK4A 1SF5A 4FQCL 4EI6A 5HJDA 2F74B 3C60C 3KLHC 1T83A 1XH3A 5GGTH 2VAAA 2AQ1A 1DCLA 1H3PL 2FJFA 2IAMA 4LLYA 4PJCE 3GLAA 3QPKA 2A77L 3H9SE 1Z6JT 4X6EB 3B9KC 4HKXB 2F61A 4QRUB 4RGND 4U1IB 2XFXB 2KZWA 4HDIA 5DK2B 7FABL 4MTMA 3AVEA 3ZE0F 3RLSA 3FQUA 4G8GA 4Y2NA 3CVCA 5FA3A 5FFGA 5IG7B 3RVUC 1HJBC 2ARJQ 2IBBA 1N0LB 3A3YB 1ZMYA 3NTCL 4NCC2 3AU0A 3JTSA 5F7KC 5EUOE 5EZJA 3D51A 4LLDB 5E94A 4DZ8B 1YQVH 1FC1A 2PXYD 2A74C 4R8WH 1CXKA 4LPXA 2UWEE 1WIPA 1IKFL 3QYMA 1T1WB 2V2TB 1FVEB 3K7UA 5AAMA 12E8H 1A6VH 3RQ3A 4NN5B 2V9QA 3WFZA 1IT9H 3QUKA 1RIVL 4BUQA 2O4EA 4KKRA 4KX9A 4QR7A 2O26U 1DO5A 1G6VK 2B77A 3GFUA 4WUUB 5F7LB 3VFTA 5IIEA 3SDDD 1S9WA 4QHUA 2DKMA 4XOCA 3ELQA 2JXMB 2V0AA 3PG2A 3JV5A 5F9JA 4UQ9A 1MFBL 3C8KB 3WJLA 1FNGB 1ZPUA 1BEYH 1EAPB 2UZPA 4LVHB 4P4KB 3X1BA 1AC6A 3ZKXC 4NUGH 4GIAA 2WCPA 4I18C 3NT0A 4ORZC 2BNQD 3HVNA 3KGUA 3FSZA 4PJHA 4JE4B 1N9PA 2AK1H 2IWKA 5I28A 1BECA 1W91A 4ENED 1OWWA 1GR7A 3OX8A 4QRFA 1ZHBA 2XIDA 2HKAA 3CHPA 2NY0D 2XQYG 1J1OH 3IDUA 4KZDL 3DTXB 2DQFA 2FLMA 5SWQB 4JBSA 3E3QE 3U7WH 1BHGA 1F4HA 3BZEA 1ZTXE 3DVFA 1S7SB 2GJPA 5EF2A 1RZGA 3ZDXE 4Y2OB 4FZEL 4WF7A 4LBAA 2NCMA 5HVHB 3B2DC 1R3HA 1AQDA 4QJ3B 5K5YA 1J9CT 1MAMH 4KVCH 2XTJC 3TPUA 1AFVH 3BJLA 4UQEA 1OAXL 5I66A 5L0QB 2WBKA 5KBKA 5JZ7D 3BQVA 1K4CB 5LCVA 3DX0A 5EU7E 3CFJB 4ADJA 2NW2A 3Q5TA 4XHQA 1MEXH 4JO5A 3B6SA 3ATEA 4AYBA 3QG6A 5IKCA 5K9KB 2J57A 3S34H 2CHWA 4L8CB 2VNCA 1G1KA 3ESMA 4JY4A 5DK3A 3BUPA 3IPEA 4FQCH 3VI4F 4YHML 4K94L 4KXCA 3UH8A 1KGUA 2XA3A 3SO5A 1H3PH 4YVNA 1L9PA 3REVB 2G4GA 1IGFL 2YZ8A 3UXFA 2A77H 5AD0B 3QB7C 2DQEL 3GSOA 4X4MA 1XEUA 5HHQB 1AGCB 4LB8A 1A7PL 3BQUC 4JL2A 2IQAB 2VSDA 3GM8A 4HKBB 7FABH 2F8XC 1AANA 3RJQB 1OZUA 3GSVB 2X4QB 4RAVA 2GI7A 1NPUA 4D9LL 3NTCH 4U1MA 2NX5D 1KXQE 5J8OA 1CXFA 3NUKA 2YRPA 3D25B 2EH8L 1ZGLB 4JFDE 1IQWL 4X99B 3BH8B 3Q3GA 2OV0A 1CC3A 1IKFH 3LX9A 1JUFB 2V6HA 3DI3B 4O02B 1TNNA 4NNYA 3ARWA 4XWOC 1GOHA 2WSDA 1G87A 1RIVH 3WKML 2EEXA 2H3NA 5HP5A 2GBVA 3EOAA 3CQFA 2EDKA 1K4DA 3QDMA 4DO6A 3BXNA 1N70A 3MBWB 1CBJA 3GLDA 1MFBH 1RJLB 2QZ5A 4J28A 3KPSA 4U1SA 1PQZB 2LV4A 4NYLA 5IB2A 2FR4A 5JPNC 3QJFA 3SGDI 5IBUB 1EEYA 1OQOA 2FT8A 1LWJA 1QSEE 1DQJA 3VJ6A 4A39A 3SPVB 1UWXH 2DIBA 3HLAB 5FWQA 2VKWA 4XMKL 5GGVL 1NIDA 3C6LB 4X2UA 2C9VA 1MFAL 1P4LB 4KZDH 2GIMA 1U8NB 5IHZB 1J87A 3OMZA 1F58L 1LEKA 3VXPB 4PBDA 1M7UA 1YEJL 3NCBB 4K8RD 2O5XL 2C4XA 4FZEH 1LK3L 1ID2A 1UJ3B 5BZWA 4Z3HA 4QF1A 1R4XA 1SUJA 5E8DL 2BNRB 4JDEB 1OAXH 1IIIA 1TZOA 5E08L 3M86A 4B9KC 4AENB 2FCBA 2HT4D 1HH9B 1T1XA 1I75A 4KJYB 1YEDA 1UWEL 1LQBC 3OD3A 4XNMA 4IBUA 1EDQA 2EH7L 5CILL 2ZP8A 4Q89A 2FJHA 1KTDB 5K93A 1AYOA 4I89A 4XP6L 5H35B 3KL3A 4K94H 1JPEA 2E6QA 4YHMH 3HS9A 3D48R 1BIIB 1DANT 1IGFH 1EHXA 3OAZK 4JPQA 4PJEA 2DQEH 1ECYA 1IBZA 4Y1AE 4I88A 2YAPA 3PNWA 2FX9L 1RZKC 4LVOB 2L04A 2YPLA 1YDPA 2B8OT 3P4LA 3QIUD 3GSUA 1WA2X 4ZQKB 5JXEA 4ZFFA 1IE4A 2ENSA 1BJ8A 4D0BB 4I2XE 4QXUL 1N10A 5DHXB 4D9LH 3II1A 4ELKA 4P2AA 4OCXL 4CVZA 3T6QC 5EEXA 2EH8H 3A4FA 4JFPA 4JAMA 1C5CL 1IQWH 2EDXA 3KPNB 3KWTA 4BFIA 3QZPA 4DCQB 3BP5A 5EU5B 1AGEA 2X10A 4GXVL 3L7FB 3QYCA 4GAYB 4LHUA 1YNKL 4D7BA 4NEHB 3NPZB 3WKMH 2E6JA 1IV8A 3D0VA 1HFUA 2WLMA 4IDLA 3VMOA 1WH0A 1T6BX 4LF3A 4OQTA 3HCVA 3GM0A 5FKPA 2OMYA 3JBG7 1JBJA 1CYGA 3VRIB 1WDAA 2LAAA 2WAHA 3C6SB 1VSCA 1KDIA 3D87B 1RXLA 3Q9QA 1JPFB 4QRTB 2EO7A 4JRYD 4CADA 3EYVB 4XMKH 3LKRA 5GGVH 4M29A 1NGXA 2QELA 4CBPA 3EBAA 1MFAH 3P3YA 1TCMA 2Z4QB 4X6CF 4BGLA 4GUPA 1PS3A 4I77L 2VDKL 1YEJH 3TJHC 4FFZL 2O5XH 2AEOA 1LK3H 3C08L 3KNBB 3OF6A 5KSVB 2NUPA 2XKSA 3LN9A 5ERWA 5E8DH 1FORL 3SDCA 2VOTA 5EEUA 5CXPA 2NY3B 5E08H 3IDNA 1XGTB 1BG9A 2M26A 2WYIA 4MZRA 3QHTC 5DEFA 1T21B 3APMA 5KANG 3WTWA 2PXYC 2WYTA 2BIHA 5HGDA 5DMYA 3CSYB 3MJ8A 1AQ8A 2HLEB 1JHTB 1UWEH 1EUUA 5ILTL 1G0DA 2EH7H 4ZNEA 5CILH 1MLCA 1MCRA 5C09E 2MHAA 4X0KA 4JDZA 4XP6H 3KBEA 3MYZA 4AVJA 1AD0A 3J07A 2R2BB 4HOMA 2W65A 5GHWL 2HRHA 2XWZA 5KAQG 3QW9A 1CWVA 1NDMB 1U0QA 3K72B 4EI0A 1QRKA 2FX9H 3QQXA 4MDIA 3FTVA 4OGAD 3O41B 1J05A 3L5XL 1JPSL 2F53D 3BN3B 4ODXB 4QXUH 2X0VA 3BHBA 3M1BA 4YAQB 4OCXH 1UD2A 3CE1A 3EOBA 1KB9J 4U6HB 1C5CH 3QEQE 4X8GA 4KPHH 2KLSA 1DQLH 5IK3A 1DP0A 4HCIA 1BFOB 1PX3A 2GSIB 4GXVH 2KQMA 1YPZB 1V3KA 5LXVA 1DEEA 1YNKH 3CDFA 4NLAA 4OD2A 3GSRB 1P7QA 2UX6A 3JWDL 3MRHB 2CUAA 2DL2A 4NQSA 1T7VA 5K39B 4GAGL 4MD0B 1S7XB 3AU1B 4XXCC 2EIJB 2Z6FA 4F33B 5A7BA 2V2WB 1CO1A 1F97A 1NC2B 1M71A 3S8WA 5FYKL 5JZ7C 3LSOA 1PX8A 1NAMB 3QCVL 2Y1AA 4X83A 3W82A 4M5TA 1OT4A 1DR9A 5I8CB 2XHNA 4IBQA 3ARFA 5DJZA 4A6YA 4W93A 2VDNB 2X6BA 3H3KA 1F45A 4IS6B 4J3OG 3F05A 1UKQA 2X89A 4M8UA 3WIHL 4K5PA 2VW4A 1LP9A 4CA4A 3VB9A 2QV4A 3O6FB 2P5ED 2RFXB 1I7TB 3MV8B 4NZJA 2QKIA 2QTEA 3LY6A 2FO8A 2FH6A 1KLUA 1BFTA 1U3JA 4I77H 2VDKH 2RMNA 2A3TA 1RZ8A 3Q6FB 3SGKC 4FFZH 3SBWC 3C08H 5EC1B 3JYBA 2BP5M 1R3KB 2NSQA 3D3VD 4ZAKD 4FQJH 1FORH 1DYZA 4BFJA 4ZZFA 3POCA 1BZ8A 4G1EA 4C83A 1MW1A 4DFHA 3VWJA 1G4MA 2WBWB 2QQKL 3BVUA 3FU6A 3KVPA 1G4RA 3L5WB 3ARSA 2OP4L 3T0EB 1EV2E 1JK8B 2VZSA 1T2XA 1DQML 4XPTL 5ILTH 4JG9A 3TT3L 4UAOB 3FCGA 3AY4A 2OMWB 4HUWB 1W16A 5SX5K 2Q10A 2D7TL 5GHWH 4WUUE 4B5EA 4QRBA 2YA0A 3OMIB 2ZF9A 4OUUB 3DRTB 1BX2B 2BIPA 4MD5B 4PJ5E 1A6ZA 5E1AA 2DTML 2F8IA 3L6FA 5JHAA 4JZNA 1QFUL 2EVHA 3L5XH 4OIFA 1CG9B 1JPSH 3A4EA 4W6YB 3GGWA 4N87A 5IVXA 4K5NA 5D1ZB 4DWHA 4BWTA 5GRVL 2F19L 1X7TA 3U6RB 5ADOH 3QZNA 3PL6D 3D50A 1PYWB 3IF1B 4I1RA 5IR1B 4TSBL 5KBMA 4I1PA 3A0OA 2XBZA 3C75A 4S0SD 1ZLUK 2EE0A 5GQBA 4K8RC 2W0FB 3WUWG 3JWDH 3EG9B 2I69A 4GAGH 3KXFA 1A9EA 3T2OA 1J0YA 1T1ZB 2X9WA 4HALA 3IFPB 1OV8A 4JVUA 5FYKH 5AB2A 1QKZL 2ESVA 4KX8A 5FIEA 3ZKSD 3QCVH 5L2KD 1BD2A 3UAEA 4F2EA 1HKFA 3IDJB 4P2RA 4FLSA 2BVPB 2HT4C 4HK0B 5B38B 2W07A 3AROA 5IFJB 2VQ1A 2P80A 1BF2A 3JV6A 4UI2A 1EO7A 1W80A 3WIHH 4NO3A 2GITA 1O9VA 3ZSSA 4Z1PA 1CXEA 2XXGA 3KH4A 2YMOA 4TRPL 1T6WA 1MAKA 4P9HC 4GRMB 4MAZA 4NUPA 2ITDA 2YPVA 3K3QA 4J6IA 3EHBC 3MJ9L 5LJYH 4E41D 2BP8A 4U3SB 2HJLB 2RQEA 4N9GB 4ONOA 3WDIA 3QIUC 4L5FE 4BGDA 5ALBL 4UDUA 1J8SA 1NMAL 3DI2B 4B27A 4F7MB 1H3WM 2GK0B 5ICUA 4E0RB 4YSDA 1MI5B 1X5XA 1EXGA 2QQKH 3LIZL 4G8AC 5C0AB 2YPKA 5IB1A 3SOBL 5KEZA 4L2YA 3ML9A 3EYOB 2OP4H 1MQ8A 2XZAL 2AQ2A 4HWZB 4XPTH 1DQMH 1HXMA 3TT3H 2XZCL 4KAQL 1S9YB 4KC3B 4FXGC 2FJFB 2IAMB 5FF6A 1NQBA 2D7TH 2P26A 1F86A 1E2VA 4G8GB 5FA3B 2DTMH 4LLQA 4R2GD 1AR2A 3WTSA 1QFUH 3BSZL 2NMSA 5HDRA 3JTSB 5HGBA 2XCMC 2CGZA 5EZJB 3VFNA 4FN0A 4JGNA 5E94B 4EUPH 1FL6B 2O6PA 3MRCA 3DX9A 2F19H 4LCCA 3B9EA 1U8JA 2EIMB 4GBXA 1Z5YD 2G2PA 4TSBH 3T6XA 4ZW5A 3MRPA 3QH3A 1SOQA 3H3PL 5GGUA 3ZL2A 4PVBA 3SKNB 2DZEA 4BUGA 5A1AA 2KBGA 2CJUL 1CGYA 1G6RA 1IO4C 2GCYA 5I1KL 3QXDB 4QHUB 1MRCL 2XN9A 4MJ4A 1NGZA 2A83B 5DUJA 2NY2B 2DV6A 2EDNA 5DI8A 2AV1B 2BNRE 5F9JB 3S5LA 4HKZA 3QRLA 4IRSA 1TTGA 2X2HA 3LPPA 1QKZH 1WIUA 5K59E 1ZDSA 4MB1A 4Y88A 5K9OA 1AZBA 3LJ3A 3V0FA 4BK8A 4QJ5B 2FQGA 2IOIA 3BKML 2AXGA 1HX0A 3MUGA 2Q7AA 3WS3B 1ZHBB 5BW7A 2YD0A 3VG9C 5IQMA 2HG0A 1S7WA 2PCXA 4M7ZC 4TRPH 2R0ZL 3BZEB 1AQMA 4CKVX 3B5TA 3KH3A 3SPHA 3NJIA 3SD2A 3IVKB 2MTAA 1YAZA 5TE4L 3MJ9H 5T1KB 3NJMA 4AL8C 1R3HB 1WC7A 1RP9A 4OGAC 4JRFA 5DHYA 2BP0A 2WOYA 3TPUB 5I66B 5ALBH 3ZMRA 4JFFA 4NO0D 1HYSD 2CXKA 5GZNA 3X3GL 2LLNA 2O61A 3FCTB 2EXYC 2AEIT 2PW1A 2IPTL 3LIZH 5EBWA 2WMPA 2XVKA 3SOBH 4CW1A 1GJUA 2DI7A 1YEEL 1EZLA 3FFCD 3QG6B 4DP7X 2XZAH 2VN7A 2KZ1B 4JY4B 3PAVA 1B0RA 2XZCH 4KAQH 4MJID 4URTB 1IBDA 4MNGE 5FO8A 4J12A 1QLRB 4YZWA 2X4RA 2N7AA 3VO0A 3GSOB 4Y7OC 5C0FA 1S7QA 2X4PA 4FMVA 2DQHL 4OFYA 1WITA 3LYRA 5C07D 1N12A 5AVRB 4OZHA 4RAVB 3ULUE 3UCQA 3W81A 5KJ7E 4XO8A 3RVTD 3BSZH 4J3BA 4G80B 2XT1B 3SO3B 4X4ZA 2CU9A 3IGKA 2FJSA 5JW3L 1XGRA 1EZVX 2HCZX 1VEMA 1JG9A 1NGWB 4IM8A 2W80C 1B6DA 1GTFA 3H3PH 1ZIAA 1M1XA 1QI3A 2CJUH 1KIUB 4U6TA 3QDJB 5C3TA 2H3NB 2JH2A 2IBGA 1P69B 4JFYB 3WHE1 4HC1A 5D6CA 5I1KH 4FTVA 4G6KL 1MRCH 4ZAKC 3QDMB 3BXNB 1M05A 3D52A 3FRPB 1RV6X 4W4OA 1KB9K 3GMNA 3KPSB 4U1SB 1X6NA 5ESAA 2VLRA 4ZUTB 5MHSE 2M2DA 3GMOA 3QJFB 1E3ZA 4HWNA 4M93B 5GS0D 4RGMB 1ZLSL 2AQTA 1DQJB 3MUJA 4PBWD 3VJ6B 2FYYB 5JQ6L 2K45A 2YUXA 3S8GB 3BKMH 2P42B 3S7GA 1JXFA 3BVTA 1THCA 1WAAF 3FU7A 3QJTB 4P07A 3GIZL 3N06B 3BYTA 2FIRT 2R0ZH 5B3NA 5LGJA 2ED8A 3ARRA 5HHXL 4X98B 3OKDA 1DJYA 2DQMA 1L6ZA 5DHVH 5TE4H 4PR5A 3UEQA 3NCXA 2W81C 2JJTA 1DJSA 2VZ3A 1W0YT 3EFFA 2D4FA 2OMZA 2D7NA 3M1OA 4TLUA 2P5PA 3N85L 3KD4A 1IILE 2O6FA 3P30L 2ZXBA 3X3GH 1HOEA 1U2CA 1H6TA 2B2XL 3EDJA 4ODBD 5CP3H 3EJJX 1VENA 3HE7A 3CNKA 2IPTH 1O6VA 3WLWD 2PO6C 4NIKB 1JVKA 4XNDA 3IAPA 3PL6C 2C7FA 2WBJC 4PGCB 4XRCB 3IBOA 2CHXA 2FJHB 3RY4A 1YPZE 3O4LD 1I1CA 4KOBA 3MBEA 4U6VL 3ARDD 4B9JA 3VDBA 1WS7A 3ISYA 1YN6A 4PJEB 1DVFA 1P84J 5AAPA 1TQTA 4R0LB 2ZX6A 2YPLB 3AITA 1EGJL 1YDPB 2VERN 2DQHH 3DGCR 4GRLA 4RMVA 3GSUB 1EXUB 2X05A 4D8OA 4NC1E 1NBYB 4ZFFB 2VN3A 1USZA 2ZYIA 2JB6B 1FJ1A 1GGBL 1XSJA 3UPAA 4ELKB 3DSFL 6CGTA 5BV7L 1BYPA 2WLIA 1BGXL 3KCPA 5CZKA 4YQXL 5JW3H 4BFIB 2QL1A 3BP5B 3LRSB 5JQIB 1AGEB 4JO8A 4APXA 1FGVL 3MV8E 1IM9A 4DSYA 2QT6A 4DP1X 3POHA 3HI1B 3EGXA 3RJOA 4PJFF 3A23A 1EO8L 1KNOB 3HAEG 4Y4FA 5B1JA 1MREH 4G6KH 2V3DA 2XUWA 5FKPB 3RWDA 3VXSD 2W94A 4F7EA 5E9NA 1BZOA 2X9YA 3CZSA 1HDMB 3BWAA 3F6LA 5F1SA 4RQQB 2FB4L 3ULSA 3T9WA 1BBJB 3CFEA 1ZLSH 5D2LF 4PEEA 5JQ6H 1F18A 5ACLA 5CIPB 4FFTA 2DWSA 1QEWA 3T0EE 3IDYC 1LO5A 3N43B 4NQDA 1MVFA 4HPHA 2A0LD 2EE2A 1E5UI 5EF3A 3W11D 1CXIA 3GIZH 2QSQA 1KTRL 3N50A 1VLXA 3R8QA 1BWMA 1BWWA 4UV4L 5HHXH 3CCHA 2BSDA 4AGQA 2CNYA 2CDFB 2E76C 2NUPB 5L9DL 5B8CC 1LVEA 2PPCA 3SDCB 3ZQ9A 3N85H 5BZDA 1KC5L 3IDNB 4TVSa 5T3ZE 4BD4A 3P30H 4A7TA 3RZCD 3JT0A 3QQ9D 3HS8A 2B2XH 3G9VA 3MRFB 3T1WA 1WFOA 4V33A 2D0FA 5HGDB 1QPXA 3MJ8B 3OPUA 1JMZA 1GTNA 1NSNL 3BP7B 3QEUA 2TAAA 3QBTB 3N0PB 3DUHA 3K80A 3PV6A 5F2FA 3S98A 1KB5A 4NPKA 1NWPA 2MHAB 4X0KB 4JDZB 2W92A 4Y4KB 3NA9L 2J1YA 3QNZA 5J11C 4U6VH 5D5MF 2W65B 3PY9A 1NCCL 1MNUL 1JNNL 1AO7A 5DC0A 5C92A 2ZOOA 5AVTB 4B3VA 3Q06A 4MDIB 4Z7OB 1EGJH 3RL2A 1J05B 2J8UA 4BFBD 5HYFA 3VW3L 4M3HA 4JZOA 3AT0A 4TNWK 2PYED 4DAGL 1GGBH 3DSFH 3EOBB 1I8MB 2TRYA 5BV7H 2VRAA 1TXKA 3RFRA 5KG9B 1BGXH 2X12A 5IK3B 3GBEA 1OGAA 1WTGT 4YQXH 1BCIA 1U30A 3G6JA 1OF0A 2XXCB 2ID5A 2WYHA 3FN9A 3TV3L 3ZIMA 3VU1A 1FGVH 3W1ZA 1DEEB 5IROD 1ZA6B 5I6NA 4H0HB 3VGBA 1IBFA 4UQAA 2IGFL 1MRDH 4NN6C 1P4UA 3JWOL 4IJ3C 2Z7UA 2VLJA 2JK5A 1EO8H 4AJYV 4ICWA 2W59A 5D7JB 1CFTA 4TOYL 4ZUVB 1HYSC 4LEEA 3S6CA 2P5WA 2PTUA 2FB4H 3ARFB 4R96A 4U1GC 5DJZB 3QUXA 1MFMA 5C0AE 1GJIA 2ZP0T 2G4EA 3L9RA 4MGXA 4KH9A 2AJSL 4JY5L 1LP9B 2BH0A 2BSRB 4DGUA 4B7IA 2BPBA 3AT9A 4PIRF 1ACYL 1KLUB 4OLUL 4UV4H 1IU1A 4GB9A 3WGVB 5DRWB 1RZ8B 3ZRSA 2YQBA 3WFEL 2W9DL 1WBYB 4KRNA 5L9DH 4OD3L 4G8GE 3LQAC 5D6DA 2A6JB 1XCQB 1Z9SB 3EAKA 4C83B 1KC5H 3RVTC 1Y1UA 4GSQA 4Y2DD 2ARWA 5I6XB 4K9EC 2OZ4L 5HVGB 1HQ4B 2VWEC 4KUCD 1OL0A 3OJDA 5MEPA 4AV0A 4GG8B 2JKIS 3GMQA 4OU3A 2DJUA 3FJTA 4NRZA 2MTPA 4C56A 4L3FA 1NSNH 3VSTA 4URKA 1UH3A 5DFTA 1JD7A 1HOCA 4UM8B 4OLWL 3QWNA 4XWGL 1EUTA 1DL7L 1KIRA 5CEZE 4ESKA 3NA9H 5CSBA 4PG2C 2Q6WA 4K9JA 4CC4C 3PAZA 1NCCH 1I85C 1XQ4A 4OVUA 1MNUH 1SMOA 3DTDA 5ALCL 4Z9KB 3U9WA 1JNNH 3ULVF 2F7IA 3FO2A 4LEBA 4YO0A 1L9RA 2VL5B 5DYOA 2GJ6B 5E1AB 4PGEA 4UU9A 4H0LC 2GC4C 3L6FB 4P2QA 1Q72L 5HSFA 4LP8A 2CWRA 3VW3H 2Y2WA 1WZKA 5GS0C 3GGWB 5CM1A 3GHPA 5IVXB 3MRBA 1DBBL 1OOWA 2PPDA 2X1XR 5F44A 4DAGH 4UM9A 2ZUWA 4E36A 3TV3H 3DGGB 5L8LB 3JSSA 1CQYA 3N3EA 4M56A 4ALAC 3EH4B 4JM2A 1X5FA 5BPPA 2DD8L 4AJVA 3F7YA 4DK6A 2ZG3A 4FQIL 5CWSA 2IGFH 2NR6D 5AVUB 4Z18A 2HWZL 3ULVD 2FT6A 1A9EB 4AYEC 4OJFL 4PMEA 1N18A 3L2MA 4HPYL 4WIQA 3U6XA 3GMRA 1AXTL 1TNMA 3O3AB 4TOYH 3US9A 2ESVB 4EIGB 1A4KB 5BZXA 3RFZB 5HY9B 4TM9A 4P2RB 4F7PA 2WLYA 3WLWC 2W07B 4GEJA 4DPCX 1KYOJ 3VA6A 1AVAA 2VQ1B 1CFVL 4X5LA 3BGMA 4UIKL 4U2YA 1BQHG 1LWRA 2MQ0A 2AJSH 4JY5H 3NSYA 5TTRA 2GITB 2PCFB 2HG5A 1Q0EA 1T5WA 1QW8A 5FV2A 3ULVL 3ARDC 4I9WE 3KGSA 5BS0B 5HXMA 1ACYH 2VR7A 4LSPL 3SGJA 3CSTA 4OLUH 4BV1A 4U7KA 5ANME 5INCB 4MMZC 2ADFL 4X4ME 1SF3A 1TU2B 1IBBA 2Y5EA 3WFEH 2ZOUA 3PE9A 2W9DH 4HZLA 4FNTA 4OD3H 3V7AG 3VTMA 1YMMB 5DT1L 2OMVA 4IHOA 3AREA 2R4RL 2K7QA 2WXPA 4EIZC 2OZ4H 3FT4B 2V8MA 1NGPL 1GYUA 1I1AD 4FG2A 3GDCA 4NFCA 1PZUB 5IB1B 3FUNA 1MCJA 1G9NC 2YC1A 3B2VL 3V5HB 2JFCA 3CBKB 5E5RB 4OLWH 3FUEA 4XWGH 1WCBB 4OV5A 4XR8C 4L0ZA 4E9LA 1I8KA 1DL7H 3PUCA 5FF6B 5B3JF 2ZX7A 1SEBA 3QDJE 2VABA 5B38G 4BK4A 2VLME 3M7OA 4L1TA 5ALCH 3G5VB 1UGKA 4K55A 1JCKA 3QDME 1TJHL 4XPBL 4KDTC 3HG4A 3QUZA 1Q72H 3CH1A 3O3UN 1PU0A 5HGBB 2QADB 2EYRA 3WMQA 5I5RA 3FTWA 4MZ2A 3VFNB 4ACPA 1F4WL 4Q0XL 3DX9B 1HZLA 1WF5A 3E2HC 1U8JB 3BW9A 1URZA 4GBXB 5DO2D 3LZPA 2J44A 2L0DA 2PCYA 2A0LC 4J5VA 3AG1B 3QH3B 2WZ0A 4W6XB 5GGUB 4H13C 1OTUD 3HMXL 3GZOA 1QUNA 2DD8H 4NS0A 1BW8A 5C0CE 1G6RB 4FQIH 4KY2A 2GEEA 2Q3ZA 3MRMA 4DPAX 2GCYB 3C09B 5MEOA 2HWZH 2EDRA 5CBEA 1HCVA 3MA7A 3V9FA 3DO7A 4OJFH 1NGZB 5C0DB 5DI8B 2K9FB 1TJMA 4HPYH 5D93C 1RUKL 3S5LB 4HKZB 4JUTA 1AXTH 1Q4NX 1PG7H 1R3IL 4IRSB 1T2JA 1A6AA 1BFSA 3RZCC 4NO2B 3PWVA 5IW3A 1VFAA 1HINL 1PD1A 2XWEA 4V1DD 4ZOAA 2TRHA 1AXSB 1CFVH 2AXGB 4UIKH 1CMOA 2BVOA 3LTVA 3MUGB 3ZKMD 3GSQA 3MROA 4JLRB 3OAUL 4XPFL 4ZUWA 4QTIL 4YFEA 2X7LA 3EF7A 1S7WB 1FPTL 4K7PL 3SDAA 3ULVH 3D1MC 1GOFA 3FQ2A 1SDYA 2GPZA 3MNWA 4LSPH 1PAMA 3PQYA 4X0NA 3WJMB 2ARJB 1J0HA 5EU6A 1GCFA 3ECBB 1WC7B 5EIVA 3WE6B 5GRYA 3ALXA 1CT8A 5B7FA 3ZDWA 2BP0B 2WWKT 4GXUN 1MCSA 3P77A 5DT1H 2HRLA 4QGTA 3AAZA 2R4RH 1M57B 4NN7B 2O61B 1X7SA 1XSKA 3EJZD 5MENB 4WHYG 1NGPH 2VUKA 1ASPA 1E4XL 3A67L 3VMNA 3TCTA 1UXLA 2WAQA 5CZXD 4Z78B 3HN3A 3HN5A 2O72A 3VFWB 2E7HA 5IROC 3AJ7A 1QASA 3O4OB 1G9ML 3NBNA 2XIBA 3GS0A 2FX7L 1LYQA 4FOMA 1S7QB 2HX8A 1TJHH 3NAAL 5F7NC 1EJOL