4AZ8B

Crystal structure of the complex of the caf1m:caf1 chaperone:subunit preassembly complex carrying the kdkdtn insertion at the f1g1 loop region
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
134
structure length
126
Chain Sequence
EPARITLTYKEGAPITINIDTELLVGTLTLGGYKTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/immune system
molecule keywords CHAPERONE PROTEIN CAF1M
publication title Allosteric Mechanism Controls Traffic in the Chaperone/Usher Pathway.
pubmed doi rcsb
source organism Yersinia pestis
total genus 25
structure length 126
sequence length 134
ec nomenclature
pdb deposition date 2012-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09255 Antig_Caf1 Caf1 Capsule antigen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4az8B00
1P5VB 1P5UC 1Z9SB 3DSNB 3DPBB 1P5UB 4B0MB 3DOSB 4AYFB 4AZ8B
chains in the Genus database with same CATH superfamily
2CUIA 2NX5D 2VTFA 3E6HA 4NYLA 1CDHA 3P02A 4YFDB 1LD9A 1F90H 2ODIA 1JCKA 4EIGB 1ID5I 1Q72H 1XH3B 3LPWA 2QTVA 2HLFD 4Y5XB 1PLGH 2YGVA 4IEFB 4X4ME 1BZEA 2BFVL 3QCTL 5CZRA 1WD9A 3RILA 4HWEH 2O5XL 3I9GL 3KPPA 4NZUH 1RZ7L 3MRDB 1HHHB 5DD3H 3BH9B 5DFAA 2CGZA 1ZT1A 4X5XB 2PO6C 2CBQA 1PD1A 4ZW6A 1K3IA 2ZNXA 1NMBL 1PKOA 3ILDA 2UZXB 3QQXA 5CF3A 4L3EA 5KN5B 2WTRA 4Y9GA 3IKCB 2A9NH 4PJHF 2MPAH 4GW1B 1B9KA 4I13B 3MRNA 2C3VA 2X4UB 3NEEA 5I1HL 4G6AC 4P9ML 3UZVB 1UXMA 4CC4A 2D03L 4JFUA 3ARFB 4PJ9B 3RP1A 5L9DL 5GS1B 1C9SA 1J5OL 1AGDA 4NQVB 4U6HB 4P2OD 4Z78A 3K81A 4JQXC 2PCXA 4GQ9H 4ZPTB 2RB8A 1M4KA 5G4NA 1KPVB 3EF7A 3AZUA 3G5VA 3SDCA 2WZ6A 5HI3C 4ATTA 1R3HB 2OX5A 5C07A 2WLYA 1HSBA 3DOIA 1A7BA 1CD1B 1MWAH 2ZYIA 2IDSA 3OJVC 4H8QA 4NJ9H 1FCCA 4TLKA 5C70A 3UJIL 2DH2A 5KSAB 4DP4X 2BNRB 2RTTA 5H35B 3UG5A 2YEZB 4RAVB 4KITB 2D73A 4MGXA 1ZIBA 5IUCA 1BVLB 4PI2A 2ZX6A 2Q3XA 5E5LA 1HIML 1EO8L 4J8RA 5HHQA 1FZJB 1NIBA 1SXBA 3ZHFA 5JA8B 1IKFH 1G94A 1J8HE 4MASA 5EEYA 1NAKL 1ZV2A 3K72A 4S2SB 4C56B 1JK8B 3GBEA 4W4NA 4Z5RA 3H9ZA 4FG0A 4WGWB 1BFOB 1YMMA 3NFNA 4P57A 4XPGL 4ALAL 5JW3H 1HAWA 4PV1C 5ANME 5DZVA 5EH1A 1XVSA 5CN1A 3AT0A 5JHDA 5ABZA 4QNPF 4S1DD 5EU3B 2DZEA 3VFRB 2R0ZH 1AD0A 5DQ9A 5BZDA 3Q6GL 3DVGB 2YD9A 4Z7VA 4Z95H 1MVFA 2H32B 3B83A 3SHSA 5GGSA 4PB0H 1AZVA 2VKWA 2YBRA 4B9ZA 2MNWA 4FP8H 4AGQA 4J3SA 2CKNA 2RALA 4CVZB 1L6ZA 1ASPA 4K3HA 5SWSA 2WIIB 1IAKA 3HB3D 4Z7UB 3F7PC 1CD9B 5DJDA 1DVYA 2ZF8A 3DYPA 3UMTA 2GK0B 4LB8A 3GI9L 4JKPH 5IB5A 4DKDC 2AQ3A 1XBDA 4L2YA 3TNMA 1C7SA 4K7FB 1XF3B 2IBZX 3A4DA 3OKMA 2ZWNA 5HHOA 3MAWA 2Z92B 4O00A 2E7HA 4DKEH 3JQOB 3TIEB 1G43A 5HDLA 2O4EA 4DP1X 4WFFD 1UQSA 3SGDH 4KROD 4A6YH 1JHLH 1GA2A 3TEWA 1JAEA 5SX4I 1T03L 5CZXC 3SDDD 3BUPA 2X89A 1DCEA 3NPSC 4LEXH 1VESA 1XIWC 2HJKA 2PXYC 3MRIB 2JV6A 1WZKA 4ZMYA 4HFWB 3BP4A 3QBTB 4HKZA 1GJIA 4RSYA 1AQKH 2BSTB 4I9XA 1ODAA 3NEOA 3JVGC 1KLUA 2YD4A 4L4VD 1SEBB 3TYGL 3GMMA 2XRAH 1H0DB 5TQ2L 4P59L 3LX9A 3EDJA 3AWFA 4CVWA 5JUEH 1YHPA 3L8QA 2VXSH 4P23C 2Z31C 3VI3A 2HRLA 2I32A 3STBA 5CKAA 3D85A 2GJPA 5E9DA 3BP5A 1USZA 3TTYA 2VH5L 4L1BA 4X4YA 2WC7A 1ZHKA 3BFQG 1AGFA 4N2GA 5DEFB 2F53D 1WP6A 3IETB 4PJEE 1GC1C 2P43B 5LN4A 1AIZA 1N0LB 1RZQA 2X9XA 1TNNA 3MV7B 4IK7A 4O2CB 3BFWA 4P06A 4R5TA 3C8DA 2B15A 5HGAA 1P5VB 2VN6A 3LXUX 4OV5A 5DCCA 1OE3A 4GG8A 3P73A 1U2HA 4N0YL 2ZWSA 2D7MA 4MBRA 4U7KA 4KX9A 2IH8A 3GSNB 1Y07A 2FEEI 5D7KE 2UWEA 3ATEA 3I6LE 3EGSB 3OV6A 1R24A 4QWWC 2VMEA 1MH5A 1DQMH 3FSWA 5DA0B 1FO0H 3IFOB 5J1AA 5BRQA 4L3AA 1W0YT 4X7SH 5AKVA 4L9LC 2VXVL 4L23A 1T20B 3KLKA 5E0FA 2J8HA 12E8L 3I6KB 5I28A 2D4FA 5I1EL 5JIMA 4XVJL 3OKEB 5D7JA 5FX3A 3MCG1 3JWDL 1TTUA 3FFOA 2C4XA 2VDQB 4MJIA 4YNYA 3QUYB 3SPGA 1YEIL 3IJHB 1YC7A 2CDEA 4ZMOA 3ZBMA 3B7TA 3DX9A 4C55A 3CXDL 5IESH 3FUHA 4IIQA 3U0TB 4ZZKA 4UOW0 2HAZA 5I0WA 3QIUD 4DQOL 1RP8A 2CGRH 2OL3L 1W15A 3V6ZA 3CPLB 1T5XB 1VFMA 5F3HB 3TZVC 1WBZB 4X8GA 5EIIB 2OR7A 3VFPB 5IVNA 5I74B 2EEAA 3T6QC 5T5FL 4PJCA 4HWUA 4UQ9A 5F9WC 1KJ2B 2JVUA 4LKXB 4NERA 4Y1SA 3TEUA 2WUCH 4Z8FL 1A3ZA 2Y2YA 5JLZA 1VLXA 5I8KL 1ZCRA 2ZXAA 5IB3B 3F85A 2Y69B 4PJXF 3I85A 4XCEA 4FADA 1G7IB 4YUEH 3LQAC 4K8RC 3KLDA 3EYUH 5LDSA 3ILQD 1BBJA 1VACA 2KC0A 1DQKA 4MMZC 3U4AA 1HNFA 4PJ5D 4HJTA 2QZ5A 2WBJA 3N6YA 5E70A 2BJML 5E8OB 1KB5H 1P7BA 2V17H 4G6AD 3R4DA 1BM7A 4D9LL 2X6VA 1E2ZA 3A67L 1T7WA 2P1YA 1C8PA 2E47A 1B0IA 3FZUC 2WNKA 2HJFB 2HB0A 3HFMH 3K6DA 4KXZH 1KIPB 4RNRB 3ZDYB 3P4LA 4PUBL 5B39G 4AYID 3VX1A 1O9WA 2CIIA 4FFYH 4ZUUA 3N42F 3FTYA 3IFPB 3FN3A 3H9YA 5E6RB 4YSAA 3BEVB 5FUOL 4AE0A 5F44A 1NFIB 1EMTH 1YAZA 3QJFA 1BD2E 1WPCA 3BD3A 1WD8A 4KQ3L 5DK2B 3VUAA 2NY1C 5EOQL 3LY6A 4AIXA 3IDMA 5D1QA 1INEL 2DLTA 1INQA 2P5EA 4HHAB 1QA9B 3NCYP 4MXQC 2FRGP 2GJ6B 4ALAC 1CCZA 1IC0A 5D7LB 3ATFA 1EIBA 4JY6B 3CVIH 5I71B 2E0PA 3CHQA 1QBAA 2XVGA 1QVOB 4WFEE 4HS6B 1ECYA 1RMFL 4IBZA 5EPMB 1H3WM 3RY4A 2PP9A 3TPUA 4L5FH 5A2BA 4PV9A 2YC1B 5INDA 1X44A 5EO9A 1PKQB 5EA0L 2YGQA 4ZMNA 1UKQA 3APNA 5HYJB 2CSPA 5DURD 2G4EA 1SHMA 4Y88A 4KMQA 1FVDA 1H8SA 2J2ZA 2WV3A 3FKUS 3FAWA 3QSKB 3PDOA 5MP6H 5FDWB 3US9A 5DF0A 1AR1C 2IANE 2ZJSH 4AE1A 5HHVL 2P26A 5DQDH 5B7MA 1QUNB 4U0QB 1U2YA 1EGJA 3GTTA 1EQWA 3O3AB 1AY1L 1CZ8L 1KTDB 1MQKH 2WYHA 2XBDA 2J5LB 2BOBB 5LNGA 1TQSA 4FZEL 1OAQH 2CR6A 3DARA 2E8YA 4JN2A 1AOZA 4BZ1A 3LQZB 5GS0C 1R5IA 4HIHA 1MREH 1ZE3C 3BC9A 1KGJA 1EFXA 3UAFA 1BV8A 3X1GA 4BFEA 5F3BB 1BIHA 5JIHA 2MRYA 3B37A 1E8WA 3U7YH 2CK2A 2IWGA 4AJ0A 3WEMA 4ONHA 4HK0A 3WUZA 1MI5E 1CLYL 3QI9A 2PTTB 4Q9QL 3LS4H 2CA3A 4OBSA 2VIRB 1AZZC 1T21A 5AVZB 2E7BA 3AG4B 1FPTL 4JY5H 2CO7A 3L3OC 5FYKE 1K4CA 1CI5A 4OLWL 3Q2NA 4LFHD 3Q01A 1IGFL 1JZ3A 2J1KA 1T2JA 5EWIH 2J57A 1A8JH 2MCG1 2EE9A 4RMSA 2LABA 4G8GE 1MCBA 5ECGA 3QQDA 3ZTCC 1V8HA 1TEGA 1A6PA 2DYPB 1Q0YH 1XSIA 4LLDB 5KVFL 3AY4A 1A5FH 1T0MB 3C6SB 3QIBC 4OCMC 1TO5A 2DKUA 2B59B 5ES4B 1X9LA 2VLLB 2AV1B 1YN7B 3HG2A 2Z31D 1ZGLB 4AI7A 4UT9H 5LB1A 2MOGA 2EKJA 1KJ3L 1PLAA 1BZDA 2XG4B 1UWXK 1G9NH 4AXWB 1A6TB 2F0CA 1YYML 3K6IA 1CFMA 1XR8B 4ZFOA 3GRWL 4JVWA 3BAEH 3HOGA 1YNLH 3O9WB 3NH7H 5JPNC 2VLJA 2ZOKB 3CFDA 5C0CE 4G6FB 4M43L 5DJCA 5A7BA 3RVTD 3PHOA 5GZOC 4FTVA 1G5AA 2CLZA 1FYTB 1JXFA 1KCLA 4Z77B 1CYGA 4P9HL 4UU9B 5I9QB 2EO9A 1JNJA 1XF5B 4ZUWB 2GJZB 3QJUB 3U9PH 4UAHA 1JFQH 1SUJA 2X2JA 4X6FB 3KWTA 5IMKA 3GJFA 1I1RA 3DURA 4BFKA 4OGAD 3G3LA 4UV4L 4QUOA 3FSAA 5EOCJ 1Q4NX 2OXGB 4R84A 4KK6C 4DN4L 3FXIC 2EDXA 3STZB 4F57L 1S9KC 4O02B 5C09A 5IV2B 1AQDA 2ZOLB 5HYSA 1IAMA 1JS4A 1PG7L 2OTPA 4U3CA 5E2TL 5F0JB 4YMPA 5KSVA 1KLGA 1SJHA 1DEDA 2OSLB 3QUKB 4Z7NF 1YJDH 5D96B 5T1KA 3F8UB 4HG4K 3DRTB 2R1XB 3ARQA 2OMZB 1CFTB 1MFVA 2OMUB 5IW1A 5FB8A 2DLIA 3UAJD 4X7TA 3TZVD 3BIAX 1MW2A 4Q2ZA 3AREC 4OQTH 4JGUA 4ORGB 2QGCA 3DKHA 1V5JA 4HLZG 4NRZB 4PRHD 4QRPE 2BSSB 3ESPA 3J8F7 4FQXC 3MGOB 3IJ8A 4R7NA 4JGNA 3R0MA 4DKTA 1E8ZA 1VEOA 3DO7A 1NCDL 4Y4HB 3HKZA 4DP2X 2TRHA 5HDQL 5HYQA 3HI5H 2VQTA 4QXTB 3OX8B 4Y1AB 3NIDF 3X3GL 1I4FA 5F1NB 2BK8A 1NPUA 3GLAA 3OXSA 1HHIB 4AH2A 4XE5B 5L88H 4K3DH 1A14H 1XEDA 2DQEL 1UB6A 2A3TA 5DC2A 4M4RB 1DLHA 4X2UA 1QSFD 3F00A 3RY6A 3GXIA 2RFXA 4PIRF 4AJVA 1GW0A 5EU5A 1IAIM 1U8JA 1DVFA 3CSGA 1F11A 1PTZA 1LO0H 1VPOH 5EU7C 3WBDA 3TVMA 1XF4A 3DX8B 3WYRA 1JNNH 3QAQA 5B8CC 3WUWB 5IP4A 1DSFH 5I6MA 4QY8A 2XQBH 1Q9KB 2W9EL 5C0GB 3FO2A 3MNVB 9PCYA 5CHNA 5T1JA 1BREA 4U1LA 3D0VA 5KBLA 1OF0A 5AEAA 3IDXH 3MKKA 4N22A 1V27A 4RFOL 2AV7A 4JPQA 1SBSH 1K9TA 1MAJA 1P4LB 2APSA 3HUJA 5JQIB 2XV6B 3P0YH 4G43B 3U83A 3SE9L 4LPXA 3FRUB 2JKTM 3NUKA 2TSBA 4MCZB 1AD9A 2KKQA 2C5DC 5I6NA 4CVXA 2YXWA 4MXQD 4WCYL 5I8CB 3BVTA 1MJ7H 4PEEA 2ZKHH 4O5LL 3ARDA 1OE2A 3DXAB 3N41F 3CFJB 2X9WA 4V11A 2EXYC 4ILDA 3TV3L 3VXUD 4YDLC 4U7SA 2QGBA 3BIKB 5F89A 4S0HA 2NOYA 5CBAB 5D2LF 4U1SA 1GTFA 2DS4A 4YHMH 4L8DB 5E2UH 1BQHG 3QQ9D 4N2BA 4J3UA 2KL6A 4QTIH 1MJUH 2ED8A 2ZF9A 2D0HA 1KXVC 3L7FB 2P8PA 5DHVB 4BFOA 2LR4A 1GS8A 3SO3C 3RDTB 3PFQA 1E4KC 3SDYH 1OCWL 1U93A 3RHWK 2HG0A 1Z2KA 4E9LA 1WAAF 1OK8A 3UTTE 4JHUA 4PRDA 5T1MB 3MRJA 5C97A 2VC2B 4JE0A 2O5YH 4TS6A 3T2LA 1G7QB 4X8CA 4WW1A 4ADGA 4DSYA 4YHNB 1JWUA 4GRLC 1RZFH 1TJGH 4I3GA 5AWNL 1R3IL 2MHAB 3LH2L 1SN5A 4J7RA 4Y16C 4X6DB 1OANA 4G1MB 2NPLX 1IBDA 1KIRB 4DT2A 3AS0A 3T1FB 4A37A 1ZANH 2UX7A 4UQIM 5EU4A 2ITDA 4MNQD 1A7QL 4FFVD 3WS3A 3EBHA 1T83C 3U4BL 1BAFL 2AJZB 4NRXB 4X7FC 1HINH 4FXGA 4GP8B 5EBLB 4PI0A 2ADJA 1XX9C 4YLBA 1BQHA 1W72H 5EU6D 4JL2A 4IU3A 1D9KB 4E42A 1XD0A 4QKTA 1ZD6A 4UM9A 2V7NB 4CU7A 4P5TC 3D87B 1DP0A 3O6MH 5F7BA 2Z4QB 4C4BA 1TZGH 4PVBA 1WGOA 5L4MA 1F8TH 2CLRB 2ICEC 2DTML 5D1ZB 3L4TA 1J12A 2VDPH 3OGCA 4C8XA 3C60C 4UB0L 2QT6A 3I50H 4KRPC 1SMOA 1MWOA 1TG8A 2WMPB 4N90D 3NFPA 15C8L 1YNKH 4WU7B 3SKMB 2IAMD 4QGYA 1KDIA 4TLUA 3GS0A 2WLLB 2WK2A 2LW3A 5IMMB 4EXKA 1G7JB 2V2TA 3BPOB 1HXKA 2Y72A 4PWEA 4XXCC 1BQUA 3V4LA 2Y5TA 4NZTL 4QXUL 1I9JH 1URZA 2DEXX 2F54D 1LQSR 3HG1E 1GZPA 5KSBB 1MCFA 4P5KB 1KGXA 4HJ1A 4ZX3A 3H6AA 1IZJA 4LP8A 1NLDL 3VU1A 4N28A 3VFTB 4WWID 4R7VA 2GBUA 5KVEH 1OOAA 1OD7A 5K33A 1MF2H 5L0QB 2FX7H 4MMYB 4JE4B 1RSYA 1Y18B 2E7DA 3SKJH 1MHHB 1MFMA 5EN2B 3REWA 4HIIA 3WLBA 3B9KB 3IJEB 3LKQA 4HHGA 1OEZW 4HC1L 2DM7A 2R29L 4AG4H 2OTUB 1QP1A 2VR7A 2EINB 3MREA 5C08D 5KW9L 1L3NA 3RTQA 3PWVB 1B4LA 3LV3A 3Q2WA 4NEHB 4ISVB 3A6BL 4GRWH 3NIGF 4ELMA 3E9TA 3WFZA 2GI0A 1TETL 4G6JL 2H0PA 1X4YA 3CX5J 1ZLVK 5JW5A 1TYEB 2V2WA 4O2FB 5BCAA 4XXDB 5DVLA 4NM4L 3WY2A 2HH0L 4NBZB 4PGBB 4HCIA 3L5WA 3VI4B 2AITA 4V1DD 5T5NF 1NAMB 3IBEA 3GINA 4XP4H 2MQ3A 1EPFA 4KK6D 3OMAB 3CIQA 1EEQA 2XKUA 3OAZH 1T89A 1T5KA 1TCMA 2IXQA 1KPRB 5TFSH 3O45B 4HXAL 3S3JA 1Z9LA 4M00A 4HIJA 4XCFL 4DCQA 4KPHH 5K39A 3ZLQC 1Q0XH 2J21A 3DX6A 3L3DA 1MFDL 3WIHL 2YIHA 5FO8B 1S7TA 4DEPB 4I89A 1ZA6B 3EFFA 1KGWA 1LHZA 3EOAA 4XTRD 5EZPA 4TUOB 1R47A 1PL3A 1JXJA 1W8NA 4QOKA 3V5KB 4DIXA 4FEMA 1J0JA 1Y0LB 3UZQB 2Y5QA 4NOBA 2DQHL 2FEEL 3WIIL 5EHFA 1IGCH 3AM8C 2VQ1A 4PG9B 2FO8A 2BNQE 4KO7A 3AS2A 3PXJA 1DZ0A 1KGYE 1A7RH 2ZKMX 4NUJA 8FABB 2CO6B 4P2QD 5JQ6L 3LN4A 2NSXA 2XXGA 3DIFA 2F74A 4NO5A 1R9FA 4NUPA 4YDIL 3BE1L 4XX1E 1MPAL 1TJMA 4GBXA 1OD9A 2BW5A 2FD6L 2YMXL 4O51B 4P46C 1LO4L 3BZEA 1E9QB 1U3HD 4LCVA 1WGVA 1P7KB 4APQD 2ZP8A 4F2MB 1CVRA 4CNIA 2PTUA 4OAWB 3VXRD 5AFAA 1KCRL 2LGNA 3K8KA 4JRYA 3IF1A 4ZAKC 3RWJB 3WFEL 5I1GH 1G4MA 4G9FA 1JZFA 3WHXB 5EEWA 1R4XA 1CLVA 2Y06L 3GMOB 5ACLA 5FF6B 5FO9A 3MV11 4BQ8A 1FAKT 2G5UA 1NC2B 2XPYA 2Z3FA 1CMOA 4PGEA 4RAHA 2VDOL 3PWPE 4GO8A 2Q6WA 2A6DA 3DO4A 1U91A 1T2QH 4HLEA 4WSKA 1Z5LB 3HMWH 4JMXA 5FHBL 1FVCB 4PQXA 5AAWA 3B4NA 5HJ3B 4HKJB 1M56B 4XBPB 4GMSL 2X9ZA 5C0BD 3B2DC 2EKSA 4K9EL 4PRBB 5KBNC 3C6LB 2ENSA 3FQTA 2X7LB 4GQQA 4JFXA 2ZPKL 3CLFH 1DLFL 1XGRA 5KJRH 1BZ9A 4DO4A 4XR8C 1JDCA 3GMQA 2ZUVA 4MXWH 2EXYD 1J1PH 3ZIMA 5IFAL 4UI2A 4KK8C 3NCBB 4OGXH 4TRPH 4U0RB 1T5WB 2RGSA 5MEQB 3RWFA 1I8AA 2AABL 4LCWE 1I1YA 3IS0X 4JHWH 5AB1A 3NCEB 2WXNA 1FGNL 1KYFA 4QHKJ 2H9GA 4QEGA 4PRIE 1W8OA 5DJ2B 3F7KA 2BPBA 5I24A 5EOTA 4M93B 1TCRA 2QHRL 3FT4A 4LPWA 4QHPA 5J3HC 2H45A 5DYOA 4ESKA 5DWUL 4QDGA 4X6EA 3V95A 3L1EA 3DSFL 4FC3E 4N0FA 4X5PA 1OT1A 1QRNE 1WBYA 4D9RD 4JN1H 2F5BL 5TE4H 4L0PB 1ZMYA 3FUJA 3KXFB 1DQIA 1WCBA 3EHBB 3N40F 5J56B 5K9JH 1GCYA 3IXTA 5DC9B 1XGZA 2YKKA 3IDIB 4GW4B 3WD5H 4R2GD 3BAKA 2OZ4A 5IQ7H 1B3JA 1JDAA 1QEWB 5JXAH 3WTTA 1D6VL 3BPNC 4JY4A 3V9CA 5AAPA 4JKNA 4LBEA 5CJQH 1B0GA 4KZCA 4M5SA 2HFGL 2XXFA 2W65A 3MRKA 4FLQA 1ZAGA 4N9GA 4DGVL 4N4YB 4P5TD 4N3TA 1AMYA 3MROA 2AGJH 1DR9A 1RUKL 3VA6A 3ZDZF 4WSGA 1OW0C 3QH3B 1RJYB 3N1PC 4R8WH 3UTSB 4K23L 2IQAB 4L4TD 5D7SH 4G7RB 4EJ1C 1MCSA 1QNZL 2V33A 4KRPD 3E6HB 1HQRA 2EDOA 4NYLB 4KHXL 1LD9B 3AW5A 3E8VA 4FEIA 1G1CA 5IHLB 1F18A 1S4IA 4WEUD 3M1CA 5ISZD 3F2LA 3MJ9H 2QSQA 3TF7C 1KEGH 4AMKH 1YLBB 2PF6A 1J9CT 2AK1H 3GZOA 3K8MA 3KPPB 1EHLH 3ZHLA 5F3FA 3GSQA 2CCLA 1ECZA 3RUGF 3MJGX 1ZT1B 3L81A 4GH7B 5EUOF 3K1KC 4H8VA 3QNYA 2CRZA 5I19L 4PGCA 3FQNA 2AJSL 3QDMD 1TZ8A 2ZX5A 3B5GA 4OZHE 4L3EB 4XT1C 5E1GA 2WTRB 2R9HC 3WSQL 1JZ5A 1EJ6A 4QTHA 2ZCZA 3W39A 5JTWA 2VZ3A 1N6UA 5J4MA 5I6OA 2C3VB 3NIFB 1HI6B 4QCIB 4AEIH 4Z7QE 5IHBA 2G4GA 4G42A 1M05A 2OYKA 3G08A 1AGDB 4TQPA 5FFOA 4DGWC 3GBMH 3KYAA 4PW9A 3IWVA 3SPHA 3C75A 1CLCA 2E4FA 1YEJH 5JDJA 4Z78B 4IDJL 3B2MA 3QFJD 3OKNA 4PJAE 4BYHA 1R1CA 3NRPA 5DUPL 2OTWA 3PQYA 5C6WH 2I69A 4NI6A 4M5ZH 3G5VB 2VISA 3SDCB 4WO4A 5D7HA 2OX5B 5C07B 1HSBB 4YLCA 4WUKH 1WS7A 1HSAA 4MCMA 2DQJL 1IGJA 4TNWK 2A6IA 2J6EA 5CFAA 4F37K 4UNVA 1UKTA 3BPCA 4HH9A 3GUTA 2EO7A 3BQVA 4L1DA 5AYUH 4DO6A 3RI5K 2YRLA 3B9EA 1BGXL 3DTXA 4J8RB 3ZTNH 3ZKSD 5HHQB 5MENE 3K72B 2GSIA 2QKIA 2H1LM 4UT7L 1GC1H 4Z5RB 5FUCE 2JIXA 3BN9D 3AXLA 3S36L 1S5IH 1YMMB 3NFNB 4KKBD 4P57B 4HSAC 4LSRL 4Y2DD 5EDXA 4GO9A 2BO0A 4FQ1H 1NFDF 3ZU8A 5JHDB 3FTWA 4FCHA 1MRFH 2CXKA 3GXDA 1OSEA 4I3RL 3D4CA 1AD0B 5DQ9B 5BZDB 1V7NL 2NX5A 4Z7VB 2I7SA 2XA8H 3I9PA 3IWUA 1AHMA 2JTDA 5GGSB 3IDJA 3TTSA 3KNBA 2AJUH 1EHKB 1OWWA 2V5YA 4P2RE 3RLSA 1BFSA 3UTZA 5SWSB 5T3XE 1P7QA 3ATBA 1IAKB 5E4AA 1KBGH 5A16A 5IB2A 2NW2A 2UZPA 4QLRA 1MSPA 2MTAA 2R69A 5DJDB 4PWGA 4QJ3B 1LJMA 1WT5C 5DMYA 5IB5B 4OF6A 1NCAH 4S1SH 5LAXA 3TNMB 4AYGA 4ZTOL 4KWUA 5C0AD 2F58L 1ZXKA 3OKMB 4UIKL 3RURA 5HHOB 4ZO8A 2E5EA 5IHUL 1WIPA 4M6NH 4N2MA 4HAFA 4AQ1C 3BEWA 2JNZA 4WFHE 1UQSB 1E0OB 2F7PA 3HC2A 2YUVA 4NUQA 1J11A 4JO4H 4TKWA 4DJMA 2HJKB 4AKQA 3NESA 3Q1EA 4P2AA 2W0PA 4DP5X 4F91B 3GO1L 3P2TA 2JCCE 2DKMA 4P2OA 2N7BA 4JJHA 4Q6YA 4BE5A 3BP4B 2O72A 4HKZB 3M46A 5EC2A 5KUKA 4UAOB 1X5GA 4HMDA 1I3GH 3RX9A 4XBMA 4K94H 2HVBA 4XBEL 1MAMH 2JJTA 1LEGA 1KLUB 3II3A 35C8L 3GMMB 1CK0H 1Y1UA 1ED3A 1YEFH 2AANA 1VENA 2VR6A 3DYOA 1BP3B 3PL6C 4KTDL 2JLLA 3UX9B 2G60L 1DBMH 2F08A 2JKNA 3LQAH 3VI3B 4RBPK 1TQVA 3MOBL 4K8RH 3D85B 2YKLH 4FQ2L 1Z7JA 5E9DB 3BP5B 3FQWA 4X4YB 2NY5C 3CSTA 2JF1A 1ZHKB 1AGFB 2X3AA 4NFCA 2Y1VA 4P5MA 1JRHH 4AGMA 3HKFA 4APXA 1WAAA 2FIRT 2BVUA 5D5ME 2Q9OA 4M6ML 4MMXA 3I6SA 2QQKH 3N91A 2R4RH 3CMOL 5HGAB 1NEZA 2A9ML 2AHIA 4OV5B 4NHCH 3QPXL 1UUSA 4GG8B 3P73B 4JQVC 1INDL 2XZCH 3WV0A 3EDFA 4F5CA 5GGRA 3U7WL 5D55A 3L48A 1PZBA 5EOCH 5ID0A 2UWEB 4LHUA 3UJTL 3H0TA 4YBHA 1R24B 2Y4SA 5E8NA 3JYCA 1MH5B 4I0PD 5FR3A 4LU5H 3V4VA 4ANKA 5EZOH 1T4KA 5LKNA 5J1AB 4GIAA 3JWNE 1FNHA 3HN5A 3P4NA 4UTAL 3QW9A 4U1GC 1E9OA 1N7MH 2QQLH 5FA3A 3EBGA 5KANI 4FXKA 5LBSH 2QPFA 3EFOA 5D7JB 5C0IA 4EQ2A 3EJYD 4P4KC 4CN4A 4Y4KC 1AH1A 3KGUA 3OAYK 3DBSA 4MJIB 4YNYB 4XRCA 4XN7A 3MRLA 2CDEB 2F1AA 3NJJA 3DX9B 4DZBA 2C9QA 3V8CA 4BZ1H 2E7CA 2QEJA 3QG7L 1HOCA 4IIQB 1S9VA 1P6AB 2EDDA 1H8LA 3B5HA 3K2KA 2CKBA 4FNLH 2WKOF 1PD0A 3PGDA 3V6ZB 2B14A 1XL6A 3ZVVA 2WTOA 1F97A 4G7QB 1WVZA 5MEPA 4F1SA 5HHPA 5CBEA 3SDDA 3S8FB 1P5UC 4RWYH 2KZKA 4KUCD 4NIYE 3MLXL 1X7SA 5F0PB 4ENED 2NY0B 3NDZE 4OD3L 3ZE1F 5IF0A 4XO4A 3S7GA 3P3UA 3EOTH 4HEPG 5JLZB 3NMEA 4PU2A 2QSCH 3ZUNC 4L4VA 3V4PL 2Y9RT 4FLHA 5GS0H 4R26L 4XCEB 2VQ4A 1L9PA 2D7TH 2F7IA 4XC3H 1BBJB 1VACB 1CFNA 4JRLA 2E6PA 3U2IA 3K6SA 5EG6C 1M71A 2WBJB 2XSKA 3VXSD 1VDGA 4KZ0A 1QW8A 4PJ7F 3U36B 5HYIA 5HHMB 3EYFA 3TNNA 5JHLH 1H3XA 2ZX8A 2EP6A 5CCJA 2F53A 3SE8H 3N9GL 4UOQA 3D34A 1IRAY 3L16A 1FIGH 3MBXL 2DWSA 1JPEA 2XUWA 3H9SD 3N85L 4JMNA 5GJSH 2MOQA 3ABKB 1N4XL 2CIIB 2VDLB 4ZUUB 4Z6AT 1CFQA 3JTSA 4IGBC 3E80A 4YXLH 4LPCA 1WJ3A 1G87A 4HEPA 2BRRH 4JS7A 3QJFB 3RRQA 5BS0D 2ZKYA 3LSOA 5E03A 4I9WE 3K2MC 3IDMB 5D1QB 1XAKA 1CTOA 1INQB 2YD6A 1TKWA 2P5EB 3VE0A 1U6AH 3Q6FA 1G6RH 3UAAA 2D31A 2EIJB 1NCIA 4OCSL 5BNXD 1KV3A 1OCRB 1EAJA 4CA4A 2IALA 3SYCA 3LYRA 2DDQL 5IT2H 4EI5C 1WE5A 1OTSC 3QXWA 4PV9B 5BRPA 3ESVF 5INDB 5ALCL 5EO9B 1FBIL 3VD1A 2XLLA 3GSWA 3WXVL 3BDBA 5IQOA 2D9QB 2NY7L 2LOEA 2PMZA 1FVDB 2J2ZB 3PDOB 1YEEL 1WFNA 4Z3IA 3QIUA 2WQWA 5TPWH 1K8DB 1Z0MA 5EEXA 1MVYA 2VUOA 2GHZA 2LHAA 3FS9A 3MNZA 4X7EC 1G0XA 1MFEL 3LXBA 1HWGB 4Y2NA 3T8MA 3T3PE 1BF8A 1JDDA 5H4ZA 1PNDA 4YDMA 3ARBC 1XF2A 2OPCA 2CR3A 2DOCA 3EH2A 3ZZQA 2JQZA 4QRRA 4HUCA 4NZJA 3IJYA 1G7HA 3K6NA 4IKNA 4A55A 1UASA 1D2OA 2VZVA 4JN2B 4Y1TA 4EN3D 4CDGC 4N2LA 2R2EA 3WMSA 1U42A 4OJEH 3QEQD 3QJXA 4HHWA 1R5IB 2X88A 4HIHB 2AEIT 5T3ZH 3QR1A 4NP9A 4KXDA 1HCZA 3C8KA 4LCYA 4LHQB 3P9LA 4WI0A 4M62L 4WU5A 3T2QA 2X1XR 2XN1A 4XN4A 2X53A 3SKUD 1B2YA 4ONHB 4PJ5A 4HK0B 3O2WL 3CX2A 4YO0A 3QI9B 4K7PH 1T21B 3QPQC 4UM8A 1N6VA 2VL4A 3JWOL 3TONA 3B7UX 2CO7B 3RL1A 2P28B 3D51A 1JD9A 3ISYA 1BECA 2YOCA 4DPAX 4LVNC 3D3VE 3SE4C 3S88L 4OD1L 2VDKB 1X5HA 3QQDB 1SM3L 3C09B 1QI5A 1VA9A 1J8SA 3T9WA 1MFBH 5JOFA 1VHPA 4FNQA 2KUTA 5FWQA 3PL6D 4PJDE 1D7FA 1NMCB 2A7BA 4FNTA 1B90A 1LE5A 3EJPA 4LSQL 4OU3A 3BGFB 3JT0A 1IGYA 1DVZA 3VGHA 2ZOWA 3QAZC 4N8CL 1UJ3A 4OCWH 2DQTH 3V7MA 3EO9L 5HYJE 4EPSA 4IU2A 5JZ7C 3DVNB 3GHEL 3QXTA 4OKVA 4BRJA 1HXMA 3KPRE 4X9GA 1AE6H 1ZK5A 2H0FA 5CO1A 5FYKL 4ZFOB 4RGMB 4HG4J 1PCXA 1XGQA 1Z32X 2VLJB 3CU1A 3CFDB 5CIPA 1BJ1J 3GEFA 4M56A 1QO3A 5DJCB 3PHOB 1CXKA 1UWGL 5J11B 4FTVB 2CLZB 3TH4T 1UOWA 2ILLA 1ONQA 1J1OL 1JYNA 2YO3A 3QDHA 3PIQA 4LFHG 4XOCA 1A6ZA 2EC8A 4HPYH 3KDMA 3SPIA 4CAGA 1PJ9A 2R15A 1QPPA 3GJFB 5FOJA 5IMKB 1PSKL 3DURB 5F7WC 1HXYA 1T1WB 1NCJA 1EX0A 4IRSC 4R4BA 3RAJH 4XN5A 5C09B 2BINA 1AQDB 5MI0C 5HYSB 4ZMWA 4XNQA 5HI5C 5KSVB 2VXQH 1X6NA 1KLGB 1SJHB 3SOBL 2XICA 3GSOA 1SMAA 1KGIA 2VO8A 4PJBF 5JORA 3VWJC 5T1KB 4M8UA 4R0LA 3OPUA 4B60A 5HD8C 3TYFA 2XTJD 3D39E 2OMXA 5IW1B 1NCWL 1T04A 2IEPA 2PPCA 3DNKA 4F7CA 5FB8B 1F4WL 4X7TB 2CZNA 3MNMA 4QRTB 5DHYA 3MI6A 5HBBA 5I18L 1ZHBA 4JW3A 4Q2ZB 4LIQH 4X6CF 4OIIL 4RMRA 2WXPA 4KXBA 3LNFA 5MHSE 1E4XH 4HWNA 1DBJH 4IBYA 3ZMNA 4R7NB 1FI8C 4WI9A 2GB2A 4D0BA 3DO7B 1ZV9A 3RUGA 1MCJA 2BY2A 1GSKA 2X1PA 4V2CB 5EUOA 4C4KO 5HYQB 3O6LH 1BXXA 3B2VH 3FCSB 2VLKD 2KZ1B 4NWUH 4TUKH 2XQYG 4UT6L 1I4FB 4ODHL 3VSTA 3OXSB 4AH2B 4XPFH 3D1MC 4GXUN 4KOCA 3BKML 4AUJA 4JZJA 1QAWA 3WE6A 1IC5H 3TCXA 1ZGLM 3ARGD 1UB6B 4JDZA 3EJZC 2RCSH 2GJJA 1DLHB 4E36A 3DUSA 2V5TA 4X50A 3QRFM 1CG9A 3MRMA 3NCWA 1B4JL 2D4DA 4CC0A 2RFXB 1ZHLA 2VRKA 5EU5B 1QASA 1U8JB 1AXTH 2HKFH 4JPWH 1DVFB 1KN4H 5LBVA 5DJAA 5ITBL 4HD5A 1F11B 3WGVB 1L9SA 3SGJA 4OLZH 5FXCH 4L1HA 1T1ZB 3TVMB 1FYTE 1XF4B 4QY8B 3H7BA 2XWZA 4HWBH 5IOPA 4IBTA 4BRVA 2OYPA 3FO2B 2DWXA 1IBBA 2DJ4A 2XCMC 5CHNB 3V0JA 3IDNA 4U1LB 2Y7OA 3D0VB 3QDAA 4IGBD 1VIWA 5D71H 3SGKA 2AV7B 4L5FE 4Q52A 2JQMA 4JUTA 4B7LA 2FZ3A 1EV2E 3HUJB 4KNSA 2A38A 1HZHL 1NEPA 2AW2A 1EANA 3UCQA 5I16A 3US1A 2ODHA 1KDJA 3AQXA 5I6XC 1KB9K 1AD9B 2BSRA 1UT2A 1DHKA 3H2QA 4CVXB 2JKXA 4BFIA 1OARL 1RK1A 2DJMA 5AW6B 1ZXQA 3A4FA 3ARDB 3VRJA 2XACC 4JO3H 5LLIC 4XP5H 5F89B 3S37H 1MCPH 3HG3A 4MA7H 4ZS6C 2XWDA 4ELDA 4U1SB 3WN5A 3ZKMC 1NJ9A 3QJSB 1UUNA 4M7KL 1PG7W 3BFOA 3CH8A 1NFDA 4Z7WE 4XP1L 5DDHA 5DJ8A 5HYFA 4N2CA 6PCYA 4FXLA 4NNPH 1S9XA 1OY3B 2P8PB 1ACYL 1QABA 2NZ1A 3EYQC 3U1PA 2F5AL 1HCFX 4GJTB 1T0PB 1BG9A 4RDQF 3VTTA 1U93B 1F58L 3UAJA 4XVSL 1EJFA 4PRDB 3MRJB 2XT1B 4EZKA 4NKQB 1KCSL 1J8HD 4NT6A 4WW1B 1UXWA 3W57A 4JDVA 3T2PA 3H3KA 4OLEA 2UZIL 2C3GA 3S34L 2XWEA 4JBSA 2MCPL 3VGBA 3KLLA 5B7FA 4MQXC 3T77A 2WM0A 1RI8A 2E6JA 4WGKA 1V55B 3BVXA 5EU4B 2ITDB 2LFGA 3WS3B 1QSEA 2FX9L 4YGVA 4C47A 4FXGB 4BDVA 2V2XA 5FM5M 2ADJB 4HMEA 4MAYC 1QYGH 1BQHB 1QQDA 4U3XA 3O81A 4IU3B 1B4TA 4W9ZA 4E42B 5FECA 2FJHA 1V7MH 1S3KL 2GEEA 3QORC 4P07A 4G5AA 4UM9B 1ZT4A 4BQ6A 1CICC 3ZE0F 3RZCC 4Z7IA 3P9MA 3CFBA 1QSFA 4N2KA 4WUUE 3T3MF 2FO1A 1FH5H 4EDWL 1BF5A 2MJWA 3KS0J 2WWMD 3NQIA 1PPIA 3ZL4H 3OGCB 2H5UA 2CG9X 4HPOH 1UWEL 4G6KH 1KXHA 5E8DH 5I75B 3KGTA 5GHWH 5I0VA 3Q1SL 1AZBA 3NFPB 3FW6A 4J3OF 1A7NL 2CPCA 4XBGA 1H5BA 4GSUA 3GNMH 1JHTA 3WIFA 4CMMA 3D25A 5E1HB 3BKYL 3DXAE 2V2TB 2WN2A 3SY0A 1UKSA 2B5IC 3MRHA 2Y5TB 1U36A 1I1AD 4U6YA 2GJRA 5EBGA 1GZPB 2BIHA 2UUDK 4F7PA 5IJCC 2ERJC 4YL4A 5ENWA 1KFAL 2R1WA 3VXUA 5TDOA 1OAKL 4KJQC 2W0KA 2E74C 1JL8A 4HFUL 4YZFE 2VMCA 4QPEA 3WKYA 2WO4A 4BFFA 5EF3A 1JGLL 2LLGA 2AJVL 1UD6A 4JFPA 3SJVE 4QHUA 3REWB 3W56A 4CW1A 2H47C 4HIIB 3WLBB 4LSPL 2I25N 3DGDA 2Y1AA 1SY6H 3B7RL 3LKQB 4N8PA 4L18A 1T1YA 1Q1JH 4OLVH 3MREB 1E2WA 3QJOA 1U58A 2YA1A 3A21A 4P0DA 5FGRA 3RTQB 3LV3B 4S0SD 4ELMB 3QRGH 4HZAA 3D9AH 2NNFA 3NSDA 3ULAB 1CE1L 4BQBA 2I9TA 5JW5B 3B9VA 4CKQA 1G5GA 1XFPA 5C0NC 2XWRA 1UD8A 3AMKA 3L5WB 3DVIA 3VGFA 4A2HA 5DRZA 1NCNA 5TD4A 4MNQA 1FDLH 2ZX9A 5D7KD 2NY2C 1XGUA 3N44F 2L04A 4H1LG 4GPVA 3LMJH 2QQNL 1BLIA 5GJTH 4HIJB 4BH7A 1J0IA 4DCQB 5K39B 3BQUD 5EU6A 4FABH 3DX6B 3L3DB 3PAZA 4RFEA 4ZUTA 2WKOA 4AITA 2DF3A 4HCFA 4GAJL 3THML 3CTTA 2OZ4H 4CC1A 4ZD3H 3EIFA 4K3EL 2K7PA 5DJYA 5GGVH 4TSAL 5LQBH 2DQUL 1S7TB 3KZ8A 2P45B 5HP5A 4Z0XA 3RL2A 2IOOA 3BX7C 3SE3A 1NCCH 3EFFB 3LRGA 3EOAB 1HNGA 3JSSA 1AGEA 4GMTL 4QOKB 3UP1A 1NZRA 1QW9A 3CG8A 1NOFA 2EDLA 4TV3A 5CGYD 1EBPA 4OM0H 3PJLA 3EGXA 4F80A 1ZHNA 3T0BA 3EKCA 3T4AA 2VQ1B 2CBTA 4HK3N 3FBKA 4JQIL 5KYNA 3K2UL 2ZWKA 4KBPA 2KMWA 2CO3A 2HRPH 5AZEL 1JN6A 5B1JC 4NUJB 3UO1H 3SGDI 4Z23A 3WNIA 2IAMA 3FMGL 2IADA 2M83A 3LN4B 1J5HA 3DIFB 1SEQL 4KUCF 5LGHL 2ETWA 2F74B 4NO5B 5CILL 1DJZA 4D8OA 4GBXB 4H1LA 5F6HI 3WHE0 3CN0A 3CZGA 1BMGA 2NT0A 3VGAB 4PJ7A 1SDAB 3KWUA 3BZEB 2JK5A 4X42A 3ARZA 3CVBA 3N1FC 3NP4A 4XWOC 2LU5A 4M6OH 4WWPA 5T1DH 4OH2A 4CNIB 1GGBH 3LD8C 3MV8E 5I17A 4JRYB 3IF1B 1A4AA 3S3CB 2WLMA 4G9FB 4H44C 4HLJA 2DMBA 3RVWC 3N42B 2LU3A 5FO9B 3ZR6A 4MXVE 4WDIA 5FYKU 4PGEB 1IGIH 2Q6WB 2A6DB 1SYSA 4HZLA 1I53A 1U91B 5EO1A 5F7YC 2C34A 4HJJH 5C08A 5FV2A 4E2OA 4KZDH 1Z9SA 1UGNA 3B2PA 4M5YH 3P11L 2Z35A 1CDIA 1J0HA 3ROLA 1ROCA 1J1XL 1TMQA 5AVYB 1GCFA 2E56A 3FF8A 2EKSB 3X3FH 3FQTB 1CT8A 4JFXB 1BVNT 2YPLA 1S7UA 1XGRB 1BZ9B 3LKPA 4PJGE 5CCKL 4JM2C 1ZLWK 4V1DA 3GMQB 3E3QE 1A4KA 5D7IF 2OL3A 3QWRD 4NUGH 2A99A 1BD2D 3ARXA 3UBHA 3ZKMD 1HH6A 3ALPA 3RWFB 2D7NA 5GRWA 1HT6A 1NMAH 3Q8FA 5IW3A 5T5FA 1NTDA 3QPKA 2C7UA 5TF1L 1I1YB 3OG6B 4WIQA 3VQ2C 1G9EA 2BY1A 2EH8L 3EYQD 1AQMA 2H9GB 2CDFA 2WOBA 4AV4A 1AO7E 3ABGA 1HKLH 1EDQA 1TOXA 2Z1KA 3VD0A 3P0VL 1U9KA 4WFED 4KTYA 1AG6A 3FRPG 3N1GC 5EOTB 1TCRB 1SLVA 3FT4B 1N3NA 3IJ9A 5L4JA 1KYOK 5DYOB 2OJZL 3FO0H 1XQ4A 2OKMA 4X6EB 4Z3FA 4N0FB 4KU1A 1WBYB 5D70H 4AIZA 5IZ7A 4MQXD 4KKLD 4AQAA 1WCBB 4P2QA 1I3VA 3TA3A 3IDUA 3IXTB 1VFBA 4PRPE 5E00A 2IAND 4F2ME 2EIZA 1CGWA 2DLHA 3VFNA 4OCXL 2Y7MA 1E4WH 3S35H 4JY4B 2XIDA 4LBEB 4NQQA 3GDCA 1B0GB 3MODH 3UYPA 4P2CG 2HX9A 3QUHA 5DVPA 2NXZB 2W65B 3L3IA 5DT1L 3MRKB 4Z7OF 4NO0D 1U3HA 4N9GB 2D2OA 2IOMA 3W0WD 1N5YH 2D0GA 4APQA 4L8CA 3RNQA 3MROB 3DUUA 2B8OT 2PR4H 4YSRA 4OFKA 1OAYH 3VXRA 4NJAL 4AQ8A 2V3DA 3WTVA 3TS8A 3FRPA 2K6ZA 2G5RA 1E5ZA 1GYUA 1CYXA 4R7LA 4H0LC 2CIKA 3KVDD 2ZUUA 2NY4D 1OPOA 2GTQA 1Q9WA 3HZVA 1HQRB 3J7HA 3NAAL 5F7EL 4ZFQA 4ZZFA 3WFCL 1MI5D 5IHZA 1CL7L 4HX1A 3HJ0A 3VD7A 3BSZH 1JTPA 4KFZC 4H13C 4KC3B 1KEML 1TTBA 3JUZA 3CFUA 5FYKD 2VWEE 4KXZI 4S11A 1Q9LA 2AJXH 3GSQB 3OWEA 5H4YA 5C0BA 3FT1A 2CM5A 5E1IA 3HS0C 2A9DA 3QNYB 4PGCB 3FQNB 5B3JE 4GRWE 2GUYA 4G8GD 2Q2LA 5GGTH 3WXWH 4KJQD 3UACA 4QTHB 1RZKC 2H0EA 2J43A 1GHFH 3K5SA 4XAKE 4N2NA 3W39B 3QUMH 3L9YA 3O2VL 3ZHDA 2GY7B 4HQQH 1HCVA 3ZMEA 4XB7A 2YD7A 5E4EC 4YFLI 1IBFA 5DZJA 3AADB 1TJHL 1RULH 4G42B 3ALWA 1M05B 4RWHA 3G08B 4RMVA 4EOWL 5BV7B 3HRZA 4OLUL 4OM1L 2FGWL 3OKNB 2ZWLT 1DQLL 4NN7B 2OTWB 3PQYB 1IC7H 4ODVL 2K8QA 3IMVA 2VISB 3UGEA 4ODBD 4WO4B 4JG1L 4P2YA 5FV1L 4ZFGH 4IBWA 5C0CD 3F5WA 1V05A 1YN6A 3DMMC 3WNJA 1HSAB 3P1VA 4KJWC 1TZAA 4ZQKA 1IGJB 3U7AA 1I85A 2A6IB 4U4IA 3HZ3A 4GG6F 2X4SA 1V3MA 4PJBA 3BPCB 4HH9B 3VFGL 1FNSH 4K3JH 4Z7NB 3GUTB 3PNWB 3V4VH 1IE4A 4WK4B 3PCYA 3DTXB 3NK4A 2DQGH 5AW2B 1XH1A 4R7XA 2WKLA 4CU6A 3V0HA 1UZ6F 2WLJA 2GSIB 2QKIB 4U1JA 3O0RH 3VQLA 3NFSH 2JIXB 3QZMA 3AXLB 3KPSE 3W1ZA 3ETTA 1BZOA 1QHOA 3EO0A 5IHHA 1C8QA 3GB7A 4ACTA 4OCRL 1MJ8H 3WKQA 4Y5VC 3RWEA 3NJLA 4L4TA 5G4OA 3WDIA 2J1XA 3UBGA 4NZ8A 2OMYA 5HDOA 4NQEB 2NX5B 1RJZA 3NSXA 2I27N 2EH7H 2FEDD 4Y4FD 1Z1WA 4WWKA 2VSKB 4E68A 5E0QA 2X6UA 3IDJB 3KNBB 1MHEB 2HYMA 5ISZA 2R2HA 3UTZB 1P7QB 3LPOA 5A16B 4N0RA 4BUQA 4JFFE 4DPCX 4KV5F 3BAYA 5IB2B 3M1OA 4L3EE 1GZQA 1UWXH 1OO2A 3GRWA 4MQ7A 5I30L 2C8NA 1IFGA 2R23A 3DSNA 4KK5C 3CZKA 9CGTA 2Y6SC 2B2XL 3FQ2A 4XWOD 5LAXB 1KBVA 2ZAIA 4LARL 5AKSA 5DGQA 2BY0A 1I9IL 3QDMA 1YPZE 3FULA 4NPJA 1Z9MA 3L95A 4F2EA 5I5JA 3MV9E 4O58H 3BEWB 4F58H 3RVWD 3ZTDC 4UQAA 1A6UH 2L7UA 4RX4D 5AW1B 4K71B 2YPVA 1MCWM 3LCYA 1AR2A 1KCWA 4OUOA 3GMLA 3L7EA 4P2OB 5T3XL 2FT6A 3QFJA 4FL4B 1TTRA 4L8SC 4S1QH 5EC2B 5JR1L 5D93C 3LHPL 3O6FC 4TNVF 3MCLL 3A4EA 4OB5H 3VXPA 3CLEL 1LEGB 3K74B 1AXIB 4O2EA 1TPXB 2V5MA 1ED3B 4JM2D 1T7XA 1TT6A 1RVFL 2EYSA 1K5WA 4KTEL 4N2FA 5K1NA 1QUPA 3GGWB 4AQEA 5CWSA 2Y3AA 2E7LC 3QJQB 4A7UA 4YSQA 3RGVC 3FQWB 2ESVD 1HDMA 1BJ1H 4U1IA 1CGUA 3KLSA 5IKCA 2Y23A 3IS1X 3QUXC 3PG2A 1JTTA 4P5MB 4APXB 4YC2B 4B9PA 3L17A 1AGCA 1JE6A 2DWEA 4F3FA 3ORJA 3ECUA 4TSCH 4MMXB 4LVEA 1ORQA 1XGTA 1PW3A 2MFNA 4QRAA 1NEZB 4Y2DA 3VO0A 1NCHA 2YUWA 5GGRB 3QDJE 1A6VL 2XTSA 3A6CL 5ID0B 1ETZA 3MLUH 4LHUB 1I8LA 3H0TB 4FERA 1N2RA 3KJ4C 4PCTA 4RISL 5J12C 3UBXI 3HZYA 4YSDA 3V4VB 4GKNA 5HHNA 2A77H 1T4KB 1A1OA 2X1WL 1RFDL 3ZKXB 4J3OC 4JZNA 4WAFA 3C5XA 3P4NB 2HWZL 1MG3C 1WS8A 1E9OB 3UTTD 5FA3B 5ILTL 3MLSL 3HB3B 1NINA 4FXKB 2LV4A 5HHOE 4F8PA 1IJ9A 1AHWB 1RIVL 5C0IB 3F58L 4OFIA 2HMIC 1UM4H 3QZPA 2EDYA 4MB4A 5D1ZI 4YK4B 1DCLA 4B9YA 3MRLB 4G8EA 4IS6A 3IAGC 2FBRA 4HCRL 3TN0C 4WW2F 1QMUA 4DZBB 1GGIL 2B4CC 5FK9A 1JK9A 3ARRA 1HOCB 1S9VB 5ICXA 1KYDA 1PY9A 2CKBB 3HIZA 2C9SA 3DBXA 3PGDB 5KYUA 4KROB 5BO0D 3ES6A 1DVQA 3WJJC 5MEPB 4XNXH 4EBQH 5HHPB 4DP6X 3SDDB 5CBEB 3CN2A 1LWRA 1MXDA 2W9DH 3KWWA 5E6UB 3TO4C 1QFUH 5CJXA 1T6VN 4UZUA 1FV1A 5IF0B 4BXVA 5EBWA 4W9IC 5DC4B 2OMVA 4NC0B 2WBXA 5C2BL 2VRAA 5CNHA 5CINH 2WB1A 5FLUA 4PTTA 2QHLA 4ENZA 4BELD 3VI3E 5K1VA 2VMFA 3VM7A 1F90L 3OG4B 4L4VB 5I6PA 1Q72L 3DRQA 2M1KA 1XB6A 3CFIC 1TQCC 1X5IA 3QULA 1PLGL 4P48A 4U2ZA 3GEWB 2BXZA 1ORSA 2W1NA 5EULV 3O8XA 4G1EA 3HVNA 1CURA 4HWEL 4JR9H 2BOLA 4NZUL 3D09A 1CFNB 4N0UA 5DD3L 3G9AB 3BPLB 1Y1DA 4F8TA 3Q44A 1PYWA 5A6MA 3TNNB 3EYFB 3QDGA 3X11A 5I6LA 5CLYA 4ETQA 2F53B 3HG1D 2FO4A 3IMBA 3NIGB 3C5ZC 2DD8H 2UWEE 4OJAA 4W9CC 2A9NL 3V0AC 4NLAA 2MPAL 1EHNA 4OIBA 1OSYA 2NZ9C 2CJTA 2OA9A 1CFQB 2W94A 3JTSB 5CU5A 3HR5A 3PJSA 5G5DA 5KZCD 2IFGA 3P30H 1BSIA 2X1OA 1N70A 3LSOB 2PLTA 4E9TA 4GUPA 5DU7A 4XMPH 1NLBH 3CXFA 4FMFA 4I0PA 3UC0H 4LRIC 1O6TA 2BHFA 1O7SA 4KJWD 1TKWB 3TH3T 3VE0B 7TAAA 5AOMA 3QWNA 3Q6FB 3QIWA 4GQ9L 1NGPH 2D31B 1OGTA 2J1ZA 1VFAB 2APBA 5GZNC 2IALB 2V7HA 4ZJ9A 2Q10A 3WFHA 1ZSDA 3J27A 3MRFA 1MWAL 1BPVA 4NJ9L 4M7JH 5CJBA 2WCPA 1F4XH 1ZS8A 3E38A 3GSWB 2Q87A 1DBBH 4S0TD 4LL9A 1AZCA 4PJCE 1AJ7H 4ZXBD 3ET9F 3QIUB 1QFWM 4A04A 5EFIA 3CZFA 4NAQA 1IKFL 4RGNC 5I1KH 1B2WH 3ETBF 1DQTA 4Q6IC 3MNZB 1IARB 1WC7A 4YXKH 4NBYB 5JW3L 5FUCC 3P54A 3CFCH 1ACCA 1XF2B 1LM8V 2Y1ZA 4RH4A 4QRRB 2R0ZL 3MO1A 3A6OA 1G7HB 1DQVA 3IJYB 4Y5XC 1A64A 5DZPA 4W4OC 1R34A 4M48H 4CSZA 4Z95L 1LGVA 2R2EB 1MCRA 1OP9A 1XL4A 5IROC 2BNQD 3WLWC 4PB0L 4H5SA 3KS0H 3PP4H 4FP8L 32C2A 1M3IA 1F1DA 3C8KB 4HC1A 3P9LB 2R29A 4LCYB 2WBWB 4WI0B 2VOTA 4WU5B 4EKJA 1RKRA 1U21A 2EVGA 3WU1A 2RHEA 1Z9OA 4PJ5B 4RCAA 3ESUF 3TBSB 2WNGA 1JF1A 4ZUVA 4JKPL 4YO0B 3VXSA 4Q9RH 2CE6A 5E23A 1UWYA 3TBCA 4HUMB 1S78D 4UM8B 5IQMA 3FYIB 1ZLVH 3DJ9A 4FFZH 4IHBA 1A9BA 4DKEL 3RL1B 3F7LA 2B9AA 1XSKA 4RDBA 1WH0A 3H9SA 3NSCA 3BDYL 4OGYH 2IDQA 3ARFC 4PJ9C 2V8MA 3CHOA 1JHLL 3O6FD 5GS1C 4A6YL 5EF2A 4Q14A 2ZONA 4KJPD 1GSMA 2DIEA 2KQNA 5CS7A 1TENA 2KZWA 5JOFB 3I6GA 4LEXL 4XCNA 2WW8A 5D7IA 5BS0A 1VJSA 2YQ3A 1WAEA 3PWPD 5K9QI 3WIHA 4ABQA 1JI1A 1LE5B 3L2LA 1XDTT 1IX2A 3G04A 4QXGH 3VRIA 5CFHA 3KBEA 2APTA 3L2MA 5E4IA 1AQKL 2DQFA 1O7VA 3LH9A 1IGYB 3ZRCC 1UJ3B 1WFIA 3EH5B 1OAJA 5KSAC 4IU2B 2XRAL 1HL8A 3ISRA 5CGBA 4OKVB 3W3BA 5JUEL 1HXMB 3L4XA 1EO5A 3TIDA 1RJCA 2QZQA 3H3BC 2VXSL 1XGQB 1E28A 5DURB 3BSGA 4ZYKA 4U4BA 1T6WA 5CIPB 1H3PH 1HOEA 1QO3B 4I88A 5J1TC 1AZNA 4PJIE 1ASOA 5I1JH 1ONQB 4J27A 4LCWD 2Y07H 3CBJB 3MOQA 4OVVA 3FTZA 2BP5M 5E6IC 3PIQB 4W9LC 4F92B 3CDFA 1A6ZB 3KDMB 4G2AA 3GSRA 4OFPA 1T80A 4WEBH 4HU2A 2WLHA 3VDBA 1HXYB 2XWXA 3GS4A 5TE6H 5IBLC 1PX3A 5MEOA 4WF7A 1I3RA 2EDTA 3IDGA 4R4BB 4EN3A 5B38G 2VRQA 5AZUA 1DQML 2R2BA 3VXOA 3D69A 3S2AA 3QEQA 1FO0L 1QRND 4XNQB 4X7SL 3ZDZB 5J13B 3OKKA 5L8JB 3GSOB 1XGYH 3TN0D 5JORB 5FYLE 1T66C 1ZPUA 2V9UA 4XXWA 4Y9FA 4R0LB 3V0DA 2VLME 3TYFB 1H6EA 2OMXB 3EYVA 4JFDD 1Q8MA 1T04B 4UUJA 3U1SH 4F7CB 5CLWA 2P8LA 5DHYB 3ELQA 3S5ZA 1ZHBB 4XPAH 4A68A 3EOBA 4I18A 4PBVC 3LDBB 2VM3A 3KYMA 5IESL 3EJJX 2PUQT 3CDYA 3SODB 2AXFA 1DFBH 3OAWA 2WWKT 5IQLA 3V8OA 4D0BB 1J88A 4AQOA 2CGRL 3RUGB 4J3VA 5EUOB 1JNLH 1REIA 3RBGA 2FUTA 2IF7A 5B38A 3VTAA 1SVZA 1KB9J 2GQHA 1XCTA 1IEAA 1NANH 2WO3B 2WYZA 3QCVH 4OFQA 4K0OA 3U0PA 3HE6D 3A5VA 3FFCA 4JZJB 3CC5A 3WE6B 1GYWA 4I5BB 4ZMVA 3JTBA 4JDZB 4FQCH 5D4HA 5DVOA 5GRZA 2DQCH 2D2CC 2P4AB 2WUCL 3DUSB 3OAZK 3RGHA 1CG9B 3S9DB 1CBVH 1NIDA 1RLBA 2HX8A 2GC4C 1ZHLB 1CDCA 1IE5A 3GRBA 1DSWA 1ULVA 2YPKA 5DJAB 3WJMB 4YUEL 3QT2A 2XX0A 3EYUL 2XY2A 5T8IA 4F15B 1BVZA 1FL3A 5D2NA 4A7SA 1OALA 3H7BB 2DBLH 1LK3H 2I5YH 2JQAA 4HFWA 4C83A 5IOPB 4YGAB 3DHUA 3PWLA 1KB5L 3IDNB 2IDTA 4MDRA 2V17L 4UBDD 3BT0A 2FZ3B 4YAQA 2MCMA 3X17A 3GQFA 4XNZB 5I16B 3HFML 4JPKH 4GG6A 4CBZA 3IGFA 3OBAA 2BSRB 1MHPH 1KCUH 3BLPX 2V4LA 4KKQA 4YHYB 4QTFA 1RK1B 4YHZH 4OZFH 2C1OA 5GZND 3VRJB 1EMTL 2BNUA 2RJMA 4LDLB 5E6YA 3K2IA 5AAMC 5EF1A 4XNAA 2APWA 3MTRA 2GIMA 4K7PX 3OKLA 3WN5B 3UH8A 1NJ9B 4TSBH 2CQVA 5DDHB 5DJ8B 1XWVA 3CVIL 4HIPA 1S9XB 4WK2B 4FJYA 4TNFA 3QUYC 3MRPB 5BXFA 1T03H 2NY3D 1JV5A 2WXIA 2IV9A 4L5FL 1U8QA 4ADJA 5MEND 5T3ZE 4N6RA 1NKRA 4LSVH 4NT6B 1UXWB 5E08H 4JDVB 3TBVB 4NZRH 3CNKA 3Q8AA 2GAZA 4A2MA 3IKKA 3FQRA 2PPAA 3BI9X 1QX1A 5MP6L 1QTSA 5I74C 1OP3K 3R06A 3R19A 4K3GA 4KO6A 3T77B 4PJHE 2DTSA 4GEIA 2ZJSL 2IFFH 5DQDL 2VLKA 3VI4F 1QSEB 1ZTXH 4YGVB 4BDVB 3UDWC 3I9IA 2V2XB 4B50A 3IPFA 2BS8A 5D6DA 3G5ZA 2HPTA 2CA4A 1QQDB 1MQKL 1H6FA 5FHAH 3NPZB 5FECB 3DGGA 4P2RD 2FJHB 3ARGA 4OJYA 4X4MA 2H3KA 4ZTPH 1OAQL 1ZT4B 5JDSA 5T3XD 3VMPA 5C0EA 1W91A 3CFBB 3P9MB 2H26A 1CS6A 1QSFB 5K93A 2E9IA 1XT5A 3EGDA 4MD5A 3TBWA 4AK1A 3RX7A 5HY9A 1MREL 2D7OA 2VW6A 4TLSA 4N1EA 3KH3A 4IHOA 1D2PA 3QC5X 3U7YL 3GTVA 4WTWA 4MNGE 4ZPVA 1N6QH 3BRFA 3LS4L 2AXHA 4AYDC 1I1FA 2VNCA 5IFHH 4ECNA 4XBGB 1H5BB 4UMSA 2UXGA 4WFHD 1DO6A 4JY5L 3CBRA 4NQDD 4NXKA 1JHTB 3WIFB 1VGKA 4CMMB 5IB3A 4ONOA 3D25B 3TESA 1TXKA 3AQYA 2MCAA 4LSTH 5ERWA 4KKAD 3SY0B 3CAFA 3MRHB 5EWIL 3F64A 3DA0A 4U6YB 2WLKA 5AL0A 2EUVA 4F7PB 4HA1A 2YGPA 5ENWB 2P48B 2R1WB 5KSAD 1Q0YL 3VXUB 4QNPE 5BO1H 5TDOB 1A5FL 4PS4H 2WAQA 5AB2A 1RUAH 4LASH 5DXWA 4FQPA 4EO5A 5I71C 3PHQA 3B9DA 4Z3EA 1HH9A 5BVJA 4U05A 1FFOA 4UT9L 3U4EB 4BZ2H 4JFPB 1NSNH 4QHUB 3B3IA 4RIRA 4CW1B 1IAIH 2B1AH 2NR6C 3DX0A 1T1YB 2HFFA 5CJOH 4JK0D 1WRFA 1FHGA 1G9NL 1NCBH 3WFDH 5IJKC 1U58B 5TTRA 1IU1A 5KBDA 4LSSH 2AF2A 2VDNH 3A24A 1R5VA 3BAEL 1YNLL 1BFTA 5DK2A 5E6ID 3NH7L 3EUDA 1E6JH 2X05A 2I9TB 5KS9E 2P24A 1IFRA 3FF7A 3U4KA 3CPUA 5DJXA 2P80A 3F6LA 3JZYA 1R6VA 5AVSB 5DRZB 5C3LD 4JY6A 1WG3A 4HJ0C 4WI6A 3LOWA 4MNQB 4LIQE 1KBKA 3P77A 3HAEH 5JXEC 1NDMA 1XGUB 1HYSC 2J5LC 4JO1H 4WW2A 4X7DC 5DSCA 3U9PL 5F88A 1QFWI 2FJFA 4F7MA 4WTQA 1JFQL 3UPCA 4BH7B 1MOEA 5BZWA 1T66D 5EU6B 1OTTC 1CJYA 4RFEB 4ZUTB 4RMBA 5LJYH 4Y9BA 5DJYB 3LB6C 3EYOA 2BVEA 3A67H 3MN8A 4Z0XB 3RL2B 2Q76A 1T22A 3II1A 3V0WH 1M9WA 1WWAX 1AGEB 5TJWK 4H4NA 5L2JA 3L3OB 3ZE1B 3EGXB 1YJDL 1ZHNB 1YEKL 5IBUB 1NBVH 4KDTC 3T4AB 2GITA 4HW6A 3L13A 4KY2A 4YLQT 1E5AA 3QG6A 3WNMA 3GMPA 2IAMB 4JRFA 2W9LA 4EQ3A 5DI8A 2IADB 4GAYA 4OQTL 2L3BA 4LSDA 5DEJA 4YH6A 4MJ5A 1MELA 4NP4H 4FA8A 4NQSA 3TV8A 1FG9C 1CVSC 3VW3H 4H1LB 5HDRA 5DMJB 2A1WH 2CD0A 1DBKH 2C9RA 1I1AA 3IN0A 3G7TA 3QHFH 4LLUA 4WFGD 3P69A 2F54B 1YVLA 4OZGE 2JK5B 4PJ7B 4BHUI 2P5PA 2OCFD 3HI5L 4RZCA 1GJUA 2ARJA 4GFTB 1M2VA 5GISH 3ECBA 3S97C 3ZTEA 5I17B 4CMHB 2BIMA 5L88L 4IKLA 4HF5H 4K3DL 1A14L 4S1RH 2DN7A 4WQOA 3B8YA 5EF0A 4IW4C 3WS6C 1L7IH 1P53A 4WDIB 1VEPA 1BQRA 2YK1H 4UTAA 3MFGB 1SYSB 4HZLB 5DD1H 5HVFB 5EO1B 3O9WC 5C08B 3ZYIA 1Z9SB 3S48A 1LO0L 1VPOL 2Z35B 4I1RA 2AQPA 3OGOE 3ROLB 3ZTJG 1JNNL 4TL4A 1DSFL 3U2SA 2XQBL 3JBG7 2ZX7A 3OAYH 1W8EA 1CT8B 4CVUA 4L48A 3IK2A 2YPLB 1S7UB 2CGYA 3IDXL 3LKPB 1Y6MR 3BAJA 3BUTA 4V1DB 4YPGA 1SBSL 3TJHD 1MRCH 1A4KB 1FZOA 1Z0NA 2ZKWA 4FX5A 3P0YL 2OL3B 2G30A 4JPVH 4KVNH 1DSYA 4GIPD 1CO1A 1JZIA 1O7DC 3FUDA 4GEJA 1HH6B 2EC9T 5DRWA 1RZKH 4I9WD 4MVBC 3Q9PA 1MJ7L 1OAUH 2C7UB 2ZKHL 3BQUA 4ABWA 4HOXA 2EIMB 2MMXA 5CD5D 2VDNB 4BFGA 3EJRA 2CDFB 1JZHA 5F0MB 5F1SA 4GAGH 4AL8C 3TC9A 3EUUA 3NIFF 4DK5A 2OMNA 3ZO9A 1IZKA 5D96C 2HVKA 1XMWA 3OXRB 3T8XA 4YHML 5E2UL 5A43C 3LVEA 1N3NB 3V4PA 4K9JA 3FDWA 4PJXE 4QTIL 1MJUL 2AXWA 3N0AA 4KKRA 1IIIA 2PPEA 2WQ8A 3LKNA 1YECH 1RUQH 1FHNA 2DM3A 2JJSA 4Y19D 5ICYA 3SDYL 2A5UA 4AIZB 4UTBH 3BGMA 5CU9A 4AQAB 3QQ3A 2WVSA 2VMJA 3ESNA 4P2QB 3TA3B 2O5YL 4DETA 1UD4A 3KLHC 1VFBB 5E00B 1RZFL 1TJGL 2EIZB 4DK6A 4E9SA 4TTDC 3VFNB 3WGUB 4WV1A 2BHYA 1J8RA 4Y4HC 5AQ0A 3UYPB 5A6LA 3ZPDA 4G11A 4JKMA 4BUHA 3L3IB 1JTOA 5KAQG 4NXSA 4BK4A 1ZANL 1KIQB 3DDGA 1U3HB 2O6FA 4APQB 2G0LA 4L8CB 5GRJH 2KZBA 3RNQB 3GKWH 2ZICA 3DUUB 1HINL 1L4IA 2ATAA 2GYSA 2OJEA 3VXRB 1P84K 1AS8A 3FRPB 4PSPA 1W72L 3FPXA 2PP8A 3D50A 3UZEA 2CIKB 4KXAA 3S0PA 4RMQA 1FIEA 4X9HA 1Q9WB 3HZVB 4PY7A 2VZ1A 4J4PC 5I0ZA 2UVEA 4ZW3A 3O6ML 4OGQC 1TZGL 3GXUB 1XAUA 2PETA 1F8TL 5IHZB 5J9PA 4YDJA 4IMKC 2VDPL 3FO1A 3NZHH 2HA1A 3DROA 1IEHA 1USQA 4JCMA 2YPVH 3BWUF 4FF9A 1UA7A 4U7MA 2VDRH 3DV4A 5E2JA 4YXHH 1HHIA 5C0BB 3I50L 1LDPH 1Q9LB 5LXGH 1WA2X 1YNKL 3MJ8A 2OAAA 2EAEA 2NCMA 3D3VD 4PYGA 5D1XA 2WXRA 3QS2A 5DFWH 5SV4A 3QWRA 2X1QA 3ZT6A 2XWJA 3PU7A 2AQNA 1F0LA 1OAXH 1SYVA 2W92A 3EFDH 3SSGA 1I9JL 3ZL1A 2BVQA 2YGNA 5FM5O 5HHXH 2NR6D 2FSDA 5C86A 2H2SC 4PMFA 4I0KA 2OMWA 4IRJA 4WO0A 1VGEH 5HYJD 1DQQA 4PS7A 3HRZB 5KVEL 2DQMA 1MF2L 2FX7L 5C7ZA 1N0XH 2F8XC 3SZ6A 3WFBH 3RDTC 3BZ5A 3KPRD 4XNMA 5FCSH 3SKJL 4L9DA 3WKNA 1EERB 3VXQA 2DIBA 3DDFA 3PP3K 4UILH 3L3KA 2VW7A 1AZUA 2BVPA 1TTFA 3F5WB 2A83A 1F2XK 1YN6B 2X70A 2JKRM 2XTLA 4ZQKB 3B2UC 2VUKA 1M3JA 5E4OA 1EVTC 2X4SB 2ZG3A 4PJBB 5FPIA 4OCYH 4R2GB 1GIGH 2FQFA 4C54A 5CBAA 4JL1A 2WUBH 4NKIH 1EZVY 1EHXA 3L9RA 1OTTD 1CGSH 3BGAA 5CP3A 4MJ6A 2Q7YA 4XP4L 2AJ3A 5GGSY 4KHTH 4NO0A 4U1JB 3W0WA 4WHYG 1FFRA 1JPGA 4XNUH 1EVUA 5TFSL 5DMGC 3EO0B 4G5ZH 5I82A 4UYQA 2SEBA 3CSYA 1G9HA 3OC8A 3UABA 4UF7C 5CCGE 1D7DA 4KPHL 3RWEB 1Q0XL 4L4TB 2OMYB 1RJZB 3V52H 5D1ZC 2Z8SA 4WWKB 3D39D 2PCPA 1VZIA 4FG6C 5ISZB 4A39A 2R2HB 2YQGA 4J3OH 1JCVA 1GZHA 1DN0A 1RK7A 2P42B 1ZEAH 1IGCL 3B6SA 1GZQB 5MHSD 1AYOA 5F8QC 4MQ7B 2R23B 3DSNB 1OTUC 2HUEA 1A7RL 3R4RA 3BPOC 3LNDA 4HP5A 1ILUA 2BY3A 2AVFA 3QDMB 2OMBA 1RSFA 3ARWA 4KKCD 4G8GA 1BBDH 5ADOH 3L95B 1BM3H 4D7BA 3RDJA 4FMKA 3VQ1C 2B4CH 3BESR 1PZ2A 3GJFK 4XWGH 2QLYA 2ROYA 3WN6A 2K7QA 1TJIH 3PQYE 1ZWIA 5L0QC 2VDRB 2XWTA 3FU7A 1KY7A 3D0LA 5C7XH 3GMLB 5I1GL 5FO7A 3L7EB 2HT3C 3B9KC 1FH2A 3QFJB 3UCRA 3MACH 2ZUTA 5KBPA 5IMMA 3VXPB 5EBMA 4EI0A 4O2EB 3QUGA 1T2QL 1XTMA 2J1YA 3HMWL 4XVOA 5C0CA 2EYSB 4XN2A 3U0WH 4AQEB 4EDXA 5CWSB 3MNWA 4Z7QF 4JFEA 4M8RA 3VDAA 5BUPA 3CQFA 2AQ1A 5IJDC 2WXLA 3KVPA 2QLVB 2K3TA 1SJVA 1HDMB 4DUVA 1XF1A 3GHBH 4U1IB 5BZZA 5IKCB 3CLFL 3L3GA 1JI2A 2YAOA 3MKGA 1E90A 4HDIA 4KGLA 4PJAF 3CSPA 5KJRL 2YUXA 1AGCB 2DWEB 4MXWL 1EBAA 1F4AA 4Y8DC 1J1PL 3MFFA 1ORQB 1XGTB 3E3QC 4OGXL 2NX5E 4XB3A 3CXHK 1SVCP 1MCEA 1YG9A 2E9JA 4ODWA 4TRPL 4Y2DB 1Z5HA 3NIDE 1A9EA 1ZJAA 2PPFA 4UT6A 4DEPC 2JKSA 1KCVH 3SBWA 4JHWL 2AZUA 1KULA 2X87A 3CIAA 3FQ4A 4POUB 3DIVA 1ETZB 3QNFA 1NOAA 4ZOEA 1N2RB 3HZYB 4Y4FA 4GKNB 5HHNB 3X1FA 2QFRA 1A1OB 1YYLH 3DX2A 4JZNB 4Q74A 4LMQE 1QLEH 3KLHD 3MUZ1 1OPGH 4TTDD 4Y4HD 4FYTA 1ZPLA 1E4XI 1A65A 1RPQA 3APFA 3Q3GA 4GYBA 2EABA 3ZE0B 2PCFA 2OS7A 3L1OH 3D4ZA 3T3MB 1GS6X 1OM9A 4JN1L 2VW4A 5TE4L 1KJVA 4M7ZB 5K9JL 3CN3A 3G6JE 4I0CC 1TQUA 4G8EB 4IS6B 2AFNA 1JPSH 4NS0A 5FLVA 3WD5L 1ZRUA 3VRLF 1KNOA 1IBYA 4DGIH 2EUWA 5JXAL 5IQ7L 2FH8A 1L0QA 5FK9B 3NZ8A 1JK9B 1M57B 3UIZA 3KM2A 5ICXB 5CJQL 4WNQA 3AGVA 1U92A 3UIYA 5GRVL 5B3NA 1AP2A 3DBXB 5CEZH 5F6IB 3ASWA 3ES6B 3DTUB 4KRMB 4RX4A 4J4PD 3CX5K 3KPOA 2AVGA 4TNGA 2AGJL 3RTLA 5DC0A 2X2YA 3KWWB 4WUUD 3MLPA 1FV1B 1JF6A 3LRSA 4MYWB 4FCAA 4GXVH 4R8WL 5EBWB 2OMVB 5J8OA 1LL1A 5D7SL 5D2LE 2A74A 1DJIA 4FLRA 4JFZH 4PTTB 3TBBA 5A2CA 2VSMB 4HIXH 1JPTH 4PPTA 3DRQB 2ZUSA 4NKOA 3IM1A 2F8OA 1HWHB 3QULB 4EIBA 5LVEA 1YQVH 4JM2A 2VDMH 3FC8A 3RVXC 3MJ9L 1ORSB 1P7KA 4XMLH 5KG9A 1KEGL 4AMKL 3C6LC 3O8XB 4YDVA 5GS2H 4G1EB 1UM6H 2AK1L 4QT5A 1EHLL 4RLDA 1K8IA 4N0UB 3T65A 2ZP9A 2VITA 1YRKA 3DXAD 2ESVA 1BFVH 1RIHH 1PYWB 2WYTA 2JCCF 3VB9A 3FU5A 3QDGB 3FH8A 1I8UA 3X11B 4D2NA 4ETQB 4HUNB 5IREA 1IC4H 5ALBH 4U0RC 2FO4B 1TEYA 4QHKI 1KTRL 3KHQA 4NKDA 5JYLA 2J25A 3C6EA 1HL9A 1I8IA 3CUPA 3HNTH 3ILPA 4A7TA 1OZUA 4PN6A 2GPZA 4RVBA 3HR5B 3PJSB 4PTUA 5JNYA 5FGCB 3V6OC 4EUPA 5F7AA 4M93C 3SJVD 3HR6A 5BQ7A 4GUPB 3GBML 3JV0A 3MYJA 4I0PB 3TEZA 1YEJL 3N44B 3BH8A 4P49A 4GT0A 1WIUA 2MWCA 3QIWB 4MRBA 3HBPA 2AERT 1OGTB 5D5MF 5A1AA 4NO3A 3UTTA 4M5ZL 2N3JA 4BGLA 4U31A 1EAOA 2Z93A 4C57C 1CFVH 3EHBC 2GFBA 2V7HB 1M1XA 4FQJH 1WZ1H 4U1NA 3WFHB 1ZSDB 3MRFB 4WUKL 4XVTH 1XMEB 2ISDA 2HT2C 4KQ4H 4MTMA 5IB1A 4UANA 2YSSA 4WFFE 3FTVA 4J2XA 1ZS8B 4N8VA 3Q05A 5HSFA 1OB1A 2M2DA 2ZXBA 2ZXCA 5AYUL 5DJ0A 2W0LA 1TIUA 2WCSA 3OAUH 2EVIA 4POYA 3M17A 3ZTNL 5EFIB 2YR3A 3CZFB 1A4JA 4F1ZA 4J12A 5B3SB 5LCVH 5CCHE 1NWOA 2WTPA 3BXNA 1GC1L 1WC7B 2Y2WA 1S5IL 4M1DH 4YBQD 1E50A 5CR8A 2YSTA 3VNZA 3FO9A 2BCKA 2ENJA 2UUDH 4FQ1L 4OFYD 4PP1C 3L1FA 4QXVA 4JFSA 4OI9A 1MRFL 4LO9A 4F33A 3MO1B 2H32H 4QYAA 3MRGA 1J5DA 2XA8L 5B4MC 3N3EA 3MUGA 4NIKB 3ULVC 5KYWA 2AJUL 4H5SB 4RRPG 4OLXH 5LDUA 1KV7A 3IGAA 32C2B 1ZLUK 1EEYA 2F53E 1KBGL 1UFGA 2WZAA 2HTLC 1E7VA 1U8IA 3HE7D 3NIGE 2X5PA 4ONGH 4PGDA 3QH3A 3HPJA 5IVXF 1JF1B 4ZUVB 3VXSB 1CB4A 1NCAL 4S1SL 1YMHA 3PS6A 2Q7NA 2ZAGA 2VUYA 3HG1A 1UT1A 3SDXF 4Q9BA 1ADQH 4P8QA 1F4HA 1B9ZA 1A9BB 2R8SH 1E3XA 2BIOA 2BS71 4M6NL 2OXHA 1DJXA 2LU4A 5E1AA 3CZSA 5F7LB 2HT3D 3B9KD 3MV8D 3H9SB 5GS3A 5KANG 3TJPA 3GRGA 4CC4C 1CD8A 2VDMB 3OWRA 3X14A 4M7LH 1GKOA 2WOYA 2AAAA 2R59A 3KCWA 2NMSA 3S36X 3SO5A 1UM5H 3BRGC 4RSVA 4NNYA 3BZFA 3I6GB 4JO4L 4XCNB 4JRXE 5D7IB 5BS0B 3DVFA 5KYYA 1BLNA 2EXSA 2FVNA 3C8HA 3KYOA 3IFLH 3SDCC 3VRIB 3G04B 2QL1A 5CZVH 2OW7A 1I3GL 2DQFB 4K94L 4R97B 1MAML 3BT2H 2C4FT 1N64L 4DGVH 3F62A 4AMXA 1YEFL 3OLIA 2J72A 3FSOA 5KBMA 4AEHH 4MB3A 1HI6A 3LEVL 4QCIA 1KPUA 4JQIA 4KGJA 4W1TA 3Q13A 1DBML 1DUYA 3TIDB 3S6CA 3S4SG 2VE6A 3LQAL 3CFQA 2FYVA 2EZ0D 5H37H 4K8RL 1E28B 4XI5D 4IRZH 2YKLL 4W6WB 4ZYKB 2F19H 4ZW8A 1LP9F 5IGXH 4YE0A 2HUHA 4E41D 4LOEA 5MERA 4ZXBA 4XX1G 4Y5VA 4PWJA 4I4WA 2XVLA 1JRHL 4I85A 2LE9A 4RFNC 1QG3A 1U3JA 3LNEA 5LXVA 4QRRE 1GH7A 4Z7AA 3MXVH 4LQFH 4X4KA 2QQKL 2R4RL 3FBQA 2AQ2A 1XO8A 5F8RC 1AO7D 1D5IH 1HJBC 3HUJF 4NHCL 2XN9D 1LDSA 5HI4D 1MLCA 3GSNH 4FGMA 2XZCL 5HGBA 3GSRB 1BVNP 4MJJA 5MEOB 4NC1E 3DETC 1S7XA 3IU4H 4L3CA 5EOCL 3WEXA 4IOSD 3WEBA 3RU8H 1I3RB 3IDGB 4Z7OB 4GAAA 4EN3B 2R2BB 4LU5L 4RAUA 1PLBA 2NT1A 2IWEA 2CWRA 2BOCA 3D69B 3QEQB 3QJHA 2BNQA 4JREB 4LCIH 5DFVC 1MRDH 1SLXA 3S5YA 1EUUA 2VDOB 1ML0A 3OKKB 3EYSH 4W81A 2ENQA 3CHPA 1PEWA 1N7ML 2QQLL 3GHPA 3MUJA 1RURH 1JMZA 3CJJA 1URLA 1VAHA 4PRPD 5LBSL 3EXLA 2BXYA 2IWKA 4H8WC 5AUMA 2L4OA 2J1WA 2VDQH 1YNTF 3EYVB 4GI8A 4UUJB 2P8LB 2BZ7A 1N19A 2RR3A 4PD4K 5IFJA 3EOBB 4I18B 4K7PY 5C6PB 5C3TA 3KYMB 3W9DA 4BZ1L 3V0IA 2DJSA 2F1BA 2AXFB 3BKJH 3D2UD 1ZLWH 4FNLL 2OI9B 3CH1A 3O6FA 4NB7A 3U25A 4WY7H 2J4WH 4J23A 2DKSA 3KW8A 1CTNA 2KQMA 2J44A 4BM7A 1XCTB 4RWYL 5B38B 1IEAB 4UAOC 2DWYA 1KJ2H 4IDLA 2MTPA 3PWPA 3U0PB 3ZDXE 1BEYH 4XMWA 1JGUH 3FFCB 3C6LD 3CC5B 4AW4A 4HT1H 3LTVA 1O5DT 2UXTA 5HJGA 4A67A 1A3LH 2DY2A 2X10A 3EOTL 3S2CA 3KBHE 1QBMH 4XHJC 3EH1A 3PDGA 2QSCL 5HGGS 2XVBA 2RH0A 2YPKB 1F45A 3KBPA 5GS0L 1PZSA 2D7TL 4LCCA 4NZDA 4N2EA 4XC3L 2WGNB 1FL3B 5D2NB 4GQPH 2CDGA 3W11D 4C83B 5F7HA 4I3SH 1XCQA 2EDEA 1CR9H 3HBZA 3PWLB 2HSIA 2I85A 5JW4N 4MS8C 5JHLL 2DQDH 5J5EA 3I9AA 3COOA 1ZVNA 4OLYH 2Z34A 3SE8L 2QVFB 4NBXB 4XVUC 1BWWA 1OGAE 4YAQB 5TF0A 3MLWH 4N5EC 4GG6B 1FIGL 3II2A 2V6HA 2LVCA 1WZAA 5EN3A 3ELAT 3HTLX 5GJSL 2NTFA 1JBJA 1N10A 1K3ZA 4PSRA 1WICA 3ZDZE 4YXLL 1H3TA 2C1OB 1EAQA 4J3WA 5H94A 1JNHA 1E3ZA 2BNUB 2BRRL 4ZTOH 3ZKQD 4L1TA 4BGDA 3ML8A 2ALWA 4XMVA 3ULSA 3MBEA 2N0KA 3OKLB 1U6AL 1QRNA 2DQIH 5D7JC 1G6RL 3D4GA 1TU2A 2EXWC 3ZE2E 5BXFB 5IT2L 2XTJB 1JV5B 2NSQA 4OJFH 1N8ZA 4JFDA 1O6VA 2IBBA 1YDPA 3RVUC 3QQNA 1U8QB 2L0DA 3RUGE 4IIQC 4AX3A 3HNVH 3UTQA 2BERA 1BVKA 4N6RB 5DMKA 3VX0A 1NA8A 3AXIA 4ELMF 2B20A 2GAZB 5CR1A 2X0UA 3KPSD 3FQRB 5HDBE 4LMQI 3R06B 4G7VH 5TPWL 4E9VA 1TO4A 2WKGA 2NY0C 2YWZA 4LRNH 3RWHA 5GSRA 2VLKB 5FFGA 4DOHE 5HPMA 4CL7A 3APCA 3G5ZB 3HE6A 2CMRH 5E2WH 2NNXA 3DGGB 3ARGB 1KBPA 5C0EB 5JDSB 2HCZX 5JPMA 2WZPD 2H26B 3HG0A 1J05A 4JFFD 3EGDB 2G3NA 2FBOJ 4MD5B 3ZQXA 4M6MH 3TBWB 2COVD 25C8H 5HY9B 3HI6H 4Y2OA 5T3ZL 3SDAA 3HVDA 4HJSA 1JIBA 4YEFA 1RZJH 2WBJC 1RLWA 1ZLSL 4IHOB 2BZDA 2VB5A 2EDFA 3TF4A 4ZPVB 1I7ZA 2FTAA 3ULUF 3PXHA 1IL1A 3LKRA 3QEHA 1I7TA 1Z5YD 4K7PL 2XY1A 3PF2A 2H2PC 1YZZA 1I1FB 3MV9D 4K94C 5EORH 1WUNT 3KJ6H 4Y7MA 3V9FA 1OWRM 3V0VA 4DF9A 2F7RA 4U3HA 1VGKB 2PO6D 1CLOH 2Z0UA 5ERWB 4KMTH 2Z0BA 1FVEA 2BP8A 1XB8A 1OF2A 2DL2A 2PR9A 3QEUA 3U30B 3T0WA 1AGBA 2H41A 2D7PA 1LVEA 2Y7SA 4PJAA 1YEHH 3RIAF 1JSYA 5D1QC 5E6ZA 1NFDE 1XXFC 5F0LB 1SHSA 3C12A 1MFBL 3U36A 4GKLA 2Z7ZA 3NCFB 3ZZ1A 1HQ4A 3RFRA 4JKLA