4AZ8B

Crystal structure of the complex of the caf1m:caf1 chaperone:subunit preassembly complex carrying the kdkdtn insertion at the f1g1 loop region
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
134
structure length
126
Chain Sequence
EPARITLTYKEGAPITINIDTELLVGTLTLGGYKTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHAPERONE PROTEIN CAF1M
publication title Allosteric Mechanism Controls Traffic in the Chaperone/Usher Pathway.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Chaperone/immune system
total genus 25
structure length 126
sequence length 134
ec nomenclature
pdb deposition date 2012-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09255 Antig_Caf1 Caf1 Capsule antigen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4az8B00
4B0MB 4AYFB 3DOSB 1P5UC 1P5UB 3DPBB 3DSNB 4AZ8B 1P5VB 1Z9SB
chains in the Genus database with same CATH superfamily
2J6EL 4K7PL 4U1NB 2WB7A 4URKA 1EZUA 1EVUA 2BERA 4XR8C 3MJ8A 3EF4A 1YMHB 2UY6A 1EHLL 4ELDA 1Z2KA 2XTLA 4ZODA 1E28A 3C87A 1ZGLP 5A16B 3ABLB 5GJTH 3QORC 2ZYIA 3GSQB 1AZUA 4AKOA 5FDWA 1TFPA 1CFSB 2C4FT 2JQMA 5FF6B 3C8DA 1RD6A 2UYLB 4HS6A 5A2IH 1FVEA 4NN6B 3AZUA 3ZYZA 5J12B 3Q8CA 2WXPA 3OG6B 4PM1A 4N87A 1ROWA 1R3HB 1IC7L 2NUPB 4PJBA 3C2AL 3BSZA 3PXLA 1E27A 4BSWA 2VXSL 1PZ5B 4TNVK 2LGNA 2SODB 1MI5E 3HG3A 5DHVH 4DGYL 3W0WB 4QRUA 4MZ3A 4XPAL 5DMJB 1IAKA 1HL5A 4LCWA 4Y16A 5T1JA 2ZTBA 2VDRH 1HCZA 5JXEC 4XVTH 1O7VA 2ADGB 2CO7A 5MEQB 4WF7A 4ZQKB 5TE6L 4XPBL 4P46C 1ITCA 2ZWKA 3OAYK 2Y22A 3LDBC 4Z7IA 5EDXA 3RA7H 2BSSA 3BUDA 5I1HL 4IBVA 5I73B 1WWBX 3CX5J 3T65A 3UBFA 1NGXA 3ZPDA 5TQ2L 2B77A 5JW4M 4PJGF 4V11A 5I1KL 2ATKB 3DIFB 1M56B 1RV6X 3SE3A 1T5WA 3CMOH 4AM0A 2X3CA 8FABB 3KM1A 1S7RA 1DDHB 2N0MA 3P9LB 1PG7L 3FMGL 3HC2A 4L9DA 2XA8L 4PJ7E 4DW2H 3SQBA 3P0YH 4YX2L 4XP6H 2EYRB 2VUKA 4JFXB 2FWSA 2NY0C 1E65A 2VSMB 4F37F 3DYMA 1ICTA 3OJMB 4XO5A 4NN5C 3V0JA 4FXTA 1W8OA 5DD1H 1AE6L 1L9QA 2AQNA 1U6AH 5LBSL 3QISA 1NLDH 4JPWH 4L0ZA 3Q1EA 2EABA 3WJLC 3UDWC 1P4BH 1H3TA 1U0QA 2N59A 3V55A 1H9VA 4OD1H 3VI4A 1NL0H 4NQSB 4RGOL 3AT8A 4HCIA 2ZG1A 3DX8A 4AKQA 3DO4A 3L95A 3GMRA 3Q8BA 5BV7H 3B6SA 1G7PB 2L7UA 2M8XA 5T1DL 3O4LE 3B43A 4LCVA 4U7MA 3H7BB 4M1DL 2GTWA 1EXUB 1XF1A 4JFZL 4QHMA 1PL3A 3NTCL 4A66A 2F54E 3BESR 4PP2B 4KKAD 3QRBA 4TOYH 3V0VA 2PN5A 5HPMB 3QNZA 4FFZL 4G8FB 4ZMYA 2EE3A 3F7QA 1RULL 3FT0A 4MJIE 5DQDL 4BWTA 1A0QH 1I1AD 3T3PE 1HOCA 2AXFB 2QKSA 4Z7AA 4ZUTA 1BWMA 5CEZE 4XP1L 3SBWC 3S3CB 3DRTA 2FT6A 3BPNB 2X4PA 1XH2A 3NZ8B 3QUYC 5CSZB 1J5DA 4JFEE 4IRJB 5JORA 4AMKH 1BVLB 3O0RH 1JGLL 2R0KL 4K3EH 3ELQA 5FGRA 3CFKB 1JTTA 1QMUA 4L3FA 4N2LA 1U92A 3MV8D 3ZKSD 3GSUA 5IB3B 5CLYA 2G9HB 2B3RA 3ARBD 1MN4A 4MAYC 5CEZH 4M7LH 1MW2A 4XNAA 3G6JA 4OD3H 2CWRA 2OMUB 3IF1A 5IBUB 1ZVNA 5LNEA 3TIEA 2KLTA 3MRHA 1AD9A 1LD9A 3OZ9L 2F5BL 3SPHA 4U3XA 4DTGH 4OFVA 1HN1A 1LJMA 3KL5A 4FZ8L 2PP9A 1U3ZA 4MZIA 1T89A 3U0PB 1WS8A 5CZVH 1DO5A 3IN0A 4AGQA 1T2QH 3BO8A 2NY3D 4DN3L 1ED3A 1MHEB 3VFGH 3FB6A 2NT1A 3OWRA 1HQRA 1HNFA 3ZHLA 5KSVB 1KN4L 1S7UA 3DROA 3WN5C 3S2CA 4HQQL 1CT8A 2UZYA 3GIVA 3RGVC 3VXPA 4D94A 3GNML 3BAWA 4N6RA 3GB7B 5KBMA 3VFVA 3MLWL 1WAEA 1Y1UA 2O1AA 4MQTB 1DE4B 3KGRA 4ERSL 3L3OC 2X88A 3IGAA 2J88H 2JKTM 1NAKL 3NIDE 5JZ7C 5DS2A 4A2FA 3ZR6A 1P9MA 4UTAH 2KZ1B 3PWPB 4P3DA 1YPZA 4ONFL 3KLQA 3MA9H 4YZFF 1UACH 4FQCL 1TR7A 3ESOA 2ZQKA 4RESB 2CU9A 1BSIA 5BRPA 1JPGB 2VT0A 5E8EB 2GUOA 1DBJL 3H3PL 4OGAC 5EC1B 4C58B 4OSUL 4M93C 3ZUCA 4I3GA 2DQJL 2ICEA 3D2UD 3HN5A 3K8MA 5KAQF 4LPTA 3VH8A 1H0DA 4E2OA 3K80A 5LNDA 4AV5A 5EOCJ 1AI1H 2R0WL 3ILPB 2YUVA 3OXRA 1XFPA 3KHOA 5E2UL 3HS0A 4XPGH 4UZSA 1CDHA 4OCSL 3RWJB 3HKZA 3KBPA 5C3LD 8PAZA 4IDLA 2DQHL 2F15A 3S34L 2EUVA 2PCPA 3C6LC 4R7LA 2V7HB 3UERA 4GMSL 5F1OB 2I9LA 4PJEB 2DMHA 4YZWA 1RPUA 1XDTT 2DBJA 5IQOA 3EJSA 2UZPA 3BWUF 3G9AB 1OE1A 3SKJL 2I7OA 3STZB 4F2MA 5HDOA 3ARQA 1CE1H 2OW7A 4MMYB 4ZUUB 2VISA 5FGBA 4MJ4A 4G82A 1GYWA 2YQ2A 4OLUL 4YSOA 2VR6A 2CIIB 1JPSL 4P4RA 1A1NA 1OT4A 5KS9B 2WW8A 3WN6A 2YRLA 5KVEE 1FYTA 5LDUA 2G75B 1UB5A 4AUJA 4HWNA 3QQNA 5EBGA 1BQHB 1GZHA 3NIFB 4K94H 3UIZA 4YXLL 3T4YA 3L5WB 2IAND 1QHOA 4QR7A 4Z18A 5MENA 1M71A 3QEUA 4RMUA 1NGPH 1UH4A 4IQHA 3SDAA 4H8VA 1J86A 3NABH 2ITFA 2PKDA 3V6FA 5BS0B 1YY9D 5IWLA 5ECJE 1L9RA 3PF2A 4YSPA 2JJUA 4G6JH 5KTEL 1G9NL 1QHQA 3FFCE 3X1BA 1ZEAL 2BRRL 3ULVC 1PZ2A 2R2CA 2MQGA 2A5UA 3HNTL 3BXNB 4NQCD 1CICB 4P3WA 5KUMA 1N4XL 3FT3A 3WE6B 1KBVA 1XF3A 3FRPB 4W4OA 1TQWA 2GSGA 4BFNA 1JSYA 4WHDA 1PMYA 4CMMB 5ESQA 5F96L 1KEGH 1EHNA 4U7SA 1UXSA 1TVBB 1CR9L 4O02H 4WTWA 3IPFA 5C6WH 4OJDH 1JZHA 1S7TB 2HKFL 5HVGB 4XZ4A 4YDKH 1FE8H 2FBRA 4L5FE 2CQVA 1F4YL 4PTUB 3QIWC 4FXGA 1BM3H 4XP5H 5DRWA 2XPZA 3MRIA 4OFDA 5E95B 1BQSA 1UKQA 1RURL 4PVNA 2LAAA 1YNKL 2PXYC 2HKHL 2WO4A 5F3HA 4KZDL 2Y5EA 4B5ZA 5FYJL 4PJ6A 1MWOA 2C8NA 4G7RB 2LU3A 3TBBA 4UT7L 1P6WA 1ZA6A 2A1WL 4PJDB 4R26L 3AS1A 5T3ZH 2IDUA 4HUXA 5AFAA 4KITB 2IFFL 1G7MA 1N0XL 3DK0A 2E9JA 3FB8B 3TBWA 3TJHD 5DRXB 4DEWA 4XBGA 5LB1A 1DSFH 1OB1A 4JN1H 5D4IA 1ADQL 3F58H 4QY8B 3OL2A 1I8MB 5CJQH 1OOWA 4IGBC 3WLWC 2F9BT 4IJ3B 3RUGA 4BH8A 2MNJB 2ZIDA 3HZMB 5IW6A 4IEFA 3T3PF 1NJ9A 2AQ1A 1NEUA 1O6SB 2GSIB 4GIOA 3FO1A 2WWKO 3OZLA 1LMKA 2CIKB 4IIQA 4HWZB 5DS1A 1B4RA 4P2QA 3ZE0E 4LLQA 1OPOA 1IKNC 5C0RL 5C0CE 1OTSC 3P1VA 4MB1A 3AQXA 1MFMA 4ZDHB 1F42A 1GGYA 2P8MB 3QS2A 2IDFA 1KY6A 3UYRL 1MIML 1G7LB 4ZZKA 3QZWG 4JFDB 1IM3A 4MDJB 5JHLH 1MRCL 4JRWA 4PGBA 3VD4A 3CD4A 3U4BH 3OR6A 1AQDB 2QBWA 2ZOWA 3F7VA 1KDJA 3VFOA 2OW6A 5GRUL 4Y19D 2R4SL 1HH9B 4ZX3A 4X0KA 3KLLA 3KYKL 4OQTH 5IY5B 1SEQH 2JCCA 3DI2B 4HV8B 1QFWM 4GUPB 4AITA 1QTPA 1Z5LB 1NCCL 4G9DA 5E70A 2XX0A 3FUFA 3JZYA 1WUNT 3F2LA 1NANI 3KPNB 4MS8D 5FHAL 2QTVA 2WINB 4HYTB 1JAEA 3HUJE 4Z9KB 1GS8A 4K7FB 2JKRM 2YSSB 3KEDA 2P5WE 2H1PH 1JPFB 2NY5C 1CXIA 2D7TH 3VSTA 5D4JA 2XUWA 3S5ZA 5LAXA 4X8CA 2XDHA 1NDMB 5D93B 1CG9B 4M6OL 3TASA 1KIPB 2HJLB 3KWWB 1ZDQA 3SD2A 4KAQH 1KF9B 1WIUA 1B4JH 3WFBL 2C3VB 2CO2A 2WXGA 3QGVA 3FQXA 3MOAL 2VKXA 5F2FA 3AS0A 3B9DA 4GKOA 1RZJL 5JLZA 4BHUI 4Y4HD 1AO7D 3MV9E 1RK7A 2A99A 2AP2A 4AIEA 1MCSA 3IMUA 2WPGA 4WV1C 1WEJH 3NACL 3NIDF 3DYPA 3FHAA 1E4HA 4GKLA 3DA0A 5J6SA 5D7JA 1DVFD 1ZLUK 3D4GA 1BV8A 2WIIB 3TXAA 2IH8A 4KFZC 1JWUB 4O51A 1KXVA 1TO5A 3HB3B 3PIQA 2Q7YB 1BGXL 4AGPA 5E2WH 5D1ZB 1U91B 1YMMD 4PP1C 2C3HA 4RMTA 3GHEL 4WNJA 4PD4J 2AK4D 3B9VA 3U9UA 3IXTB 3L1GA 5KYXA 1BFOB 4IOFC 1A3LL 5DC2A 3J7HA 1SJEB 3FRUB 3V0FA 4DGIL 4NC1C 5C9JA 3DNKA 4XBMA 4GOSA 5H94B 1GJUA 1WE5A 2OTWB 4PJ5D 4YH6A 5GRJL 4LOVA 1PCXA 4OZIB 4X83A 4BZ1A 3X14B 4X7FC 1OTUD 4LCUB 3T4AB 2GEQA 1SNRA 4MXVE 3LN5A 5G5DA 2WTRB 4A2LA 5E9DD 4NQDA 4EDWH 4PRPB 2MCAA 4DKFL 4ZUSA 4F7MB 2CCLA 4U2ZA 2QV2A 4NERA 2IWFA 1UOLA 3MN8A 3UAFA 4KJWD 4XPHL 2PP7A 2XWDA 3REVA 1XO8A 4D0DB 5GIRB 5K9OA 3TNMA 2Z92B 1D5RA 3A6CL 2ZAHA 2DIJA 1W8NA 4LSSH 4HJGA 4QNPF 2QQLH 4ODUB 5JHMA 4L29A 5AUMB 3FTXA 2EDNA 5ENWA 4ZSOA 2OR7A 4KRPB 4KHTL 3HBGA 4D3CH 3WJMB 4XX1G 2Z8WC 3CXHK 3ARDB 4XVUC 3U79A 4P5KA 4QF1A 1I7RB 4FQIH 4FNQA 4U31A 5AYUH 1OANA 4OV6F 3TCXA 4Z7NB 4N8VA 5JW4N 5EO0B 4PS4H 1IC0A 4FDWA 4XCFL 5IB2B 5GS3A 3RVTD 2CALA 4QYOA 1UTDA 3H8NA 3D4YA 4BQ8A 4FCAA 3JWOH 1QUPA 3KPOA 3EYUH 1NA8A 4LU5L 3HG1E 3RL2A 1Z9SB 3V5KB 5B1JC 4B9CA 4FYQA 1RJLA 4F7CA 5GRYA 2A9BA 2EKSB 2CDEB 2Q76A 3S9DB 5FDYA 1L5GA 4ELMB 1WAPA 4A7GA 2O93L 3LNGA 3D0LA 3F7YB 2P8LB 2EIZA 2BXYA 1ND0A 4TYUA 3IRPX 2W0FA 1AOHA 4FABL 1X44A 3P9MB 3KPRA 1PDKA 2DQIH 2EXYD 2X28A 3MV7D 3MV01 1TEGA 2DL9A 2IXQB 3O4OB 3S88L 3C9NB 3MBED 3IJHA 4TUKL 4B3VA 1TQBB 1BG1A 2N7SA 5K33A 1P1VA 1FNEB 3OGCB 3MRJA 4XMXA 1XGQB 5E00B 1KFAL 4XODA 2QR0B 5SX5K 1IGFL 3I74A 1V7MH 4RGNE 5F88B 5FC9A 1JPTL 1LWRA 2FZ3A 2VDPB 2VJ0A 4IDJL 4JFWA 3PJSB 1HWWA 1VPOL 1R5IA 1NMCC 3DSNB 3BP6B 3IWUA 4B53A 2EDMA 1ZV9A 2ITCA 2WZPD 3QR0A 1FZKA 1HCYA 1OSEA 3STBA 1TCRB 3T2LA 2UV3A 2H6PA 4AZ8B 5D6CB 4J2QA 5J57B 2W60A 1F00I 4AIXA 5CN3A 5IOPA 3H9SE 4NNXB 4GEIA 4KUCF 3ZKND 4MQ7A 3AAZA 1X5ZA 3INUL 2Y9RT 1PF3A 3O2DA 4UILL 3NRQA 1JJUA 4QT5B 5AL8A 5BOPA 1G6RB 5J8OA 3DJ9A 1CFNB 1V8HA 2XSKA 4KUZH 5BQDA 1IX2A 1U8HB 4GAGH 4BFKA 1UM6H 2VDQH 2KPNA 3R4RA 5C71A 2XWCA 1NC2B 4NENB 4XMVA 4HIXL 5AOJA 3GM0A 1IFHL 4KJYA 3TT3L 2P5EA 3PL6C 3B8YA 1C16B 1OAKL 3FTVA 3ZW3A 3BAEH 3L4WA 5LGKA 3N44F 3RJDA 5DT1H 2A6KA 5J89A 4N0CC 3QARA 3D3VB 2DLHA 1L9OA 2V2XA 3SDCB 3VXRA 3BDBA 3K74B 3SDXE 3SY6A 3SYAA 3KWXA 3VTMA 3PWUB 2K7QA 1A8JH 4TQEH 2R8SH 2EQDA 2I69A 3HG5A 5EOTA 1EFXB 3AS2A 2XQ0A 2IPKA 2FX9L 4K3GA 3SOBL 1K4DA 4X99B 3OGOE 3PWVB 4TVPL 2FIKA 4L05A 4GG6B 2OULB 2XQYA 4GQRA 5D9SB 1XCQB 3AGWA 4R7DA 5C0AD 5JNYB 1OCZB 4KWUA 1I8KA 4CSSA 3Q2WA 4KMLB 4MD0B 4CAGA 3CN1A 1CQKA 1E0OB 5A2FA 2WN3A 4LDOB 3G5VA 2VERA 4MB3A 4XN9A 3S36X 3V6ZA 1T4WA 1RZGB 3TM6A 3VG9B 5E6IA 2WY3B 5L6YH 4IHOB 3K1DA 1S6NA 4WENB 4YHPB 2XV0A 3QUXA 4PJ9B 4W9ZA 1OB0A 4QAMB 2A73B 5DVOA 5T5FA 1ZE3C 2F18A 1P4UA 4UM8A 5DS8A 2GT9A 4LPXA 4MBOA 1YQVH 4R5TA 1Q4NX 5CCGE 3F00A 3F65A 5C07D 2OCJA 2R51A 4FXKB 3NBNA 4OZHF 2BIMA 2EXSA 1BBJA 4JZJB 1CYXA 3F7LA 4Z1PA 4LMQI 4B6ZA 1WBZA 5EF3A 3TBYA 1LDPH 4PJIA 5TE7H 4DZ8B 2FWLB 5I2IA 1OAZH 2N0KA 4B96A 4YSSA 3WS6A 1JNHA 3HPJB 3HRZA 2ITDB 2G3NA 4WGVB 5HJ3B 1QD0A 5DYOA 5I1IH 3MDJA 2GY7B 2X4QB 1JVOA 3F64A 1UCBL 3S36L 4F27A 1AFVH 3UTTD 4PWIA 1DFBL 1QP1A 2E56A 4G3YH 2QELA 4MQXD 4NB7A 1JGEB 3ECQA 1S8DA 2XVLA 4UDUA 2AJZB 1R46A 1S9YA 2CLZA 4MXVF 1OHQA 5A7EA 3WTSA 5KBLA 4WUUD 3V5DA 5J0BA 2H26A 3B34A 3PGFL 3ZL4L 4NEHB 1MJ7H 2F58L 3HE7B 2GC4C 1BMZA 2LLNA 1GOHA 5FOJA 3TPUA 5I6OA 2B16A 2VDKH 5F7YC 1UB6A 2VQ1B 4WQOA 4QRSB 3DARA 5IFJB 3HG4A 1E8YA 1LO0L 4X6DE 2AEPL 3ATBA 2VR3A 3FKUS 5INCA 5LN4A 4AEHH 4WJG3 1S9KC 2OTPA 4Q4IA 3NJLA 1AHWC 3ZYJA 3C5SB 4JAMA 3MUHL 1CZ8H 1SN0A 3C5ZD 3G5YA 5HHME 4BFJA 2HRLA 4QHKJ 4Y5VA 2ZCLH 1S7XB 1XF5B 4KI5C 3P4OB 4BZ1L 4CC1A 4D9RD 5FO2A 1DZ0A 1CLVA 5TH2A 2IMMA 1R3KB 3IU3B 1SVCP 3L3KB 3EYOA 5C0BA 3WTUA 1OVZA 3CFBB 4JCLA 4LHJB 1KJVB 5SWZE 3FFDA 3U1QA 3UTSA 5I66A 2YEQA 4B7LA 2CO1A 3QCVL 3L08A 1KYOK 1KJMA 4J3OH 1TJIL 1T0MA 4X50A 1CJYA 2WQUA 3GBML 3NJMA 5D7IA 4AJ0A 2IPUK 1EQWA 5T1KD 5CSBA 5E6RB 3CN3A 1MOEA 2OMNA 2XBDA 5FYKU 3CSPA 4WNQA 1X4YA 3BUQA 4BQBA 4G2AA 3TJEH 2XX1A 4NHCH 1T7WA 2BNUB 3CCHA 1URLA 4N3TA 1OCWH 4NIYE 4WIQA 2FR4B 2NW3B 1TZGL 1BX2A 3GMPB 4B97A 5F7DA 5EZLA 4YBLB 3VI3B 4NSKA 1E2WA 1EO5A 2WVUA 4WWKD 4YDNA 4BQCA 5CJXC 4E9XA 5TGBB 3O6FC 2WQRA 1K4CA 3QEQA 4G6ML 4NX0A 3RTQA 3NDYE 2CPCA 4G6FB 2CKBA 1RHHA 4IRSC 2WOYA 3T6XA 1KSRA 2JLPA 4WKZB 1KB9J 2DEWX 3IJEB 1ROCA 3KLSA 5KSAD 3SD5A 5ELIA 5I19L 3EUDA 3DV6A 4G8IA 1SHSA 2Z8VC 1ECZA 1MCLA 1MQKH 3D4ZA 4OJEH 5L2KB 4WK2B 1U21A 3MA7B 4N25A 1X7QA 3LEYH 5IMOA 5IQ7H 2Z35A 2NLJB 2NYKA 2VXVH 3IU4H 4MZ2A 5EU4B 4HBCH 3LVTA 4Z0XA 4ZK8A 1ETJA 3DTXA 4HJTA 1W80A 2WQ8A 2Z7WA 4OB5H 3SJVD 3HMWH 2ZKHL 3UZQA 3NCMA 2ENPA 4OT1H 1XF2B 4ABQA 2Z7UA 1P5VB 1R47A 3I2CH 3WS3B 1AQHA 2QQKL 2GJ6D 3BT2L 4H8HA 4P9HL 1PSKL 3CU1A 3G6AA 3SPVB 4ENZA 2HWZH 4OJCA 4JM2A 2E76C 1FV1A 1KT2B 2WUCL 3NCXA 4BBWA 5TE4H 4PWHA 1XR9B 3T8MA 4CVZA 4MMZB 5CEYB 2R0ZL 4WO0A 1UM5H 3MRFB 4OVVA 5JIPA 2X89A 2XVKA 1BW8A 2Z93B 3AM8A 4IOIA 4PQXA 3VFMA 4WI0B 1QBLL 2EDXA 1M05A 2ZWYA 3WJJC 1JNLH 4PS8A 1OF2B 2EDRA 1E4KA 1SM3L 4XRCB 3RDTD 4QNPE 3RGHA 4LAQL 1A9BA 4UB0L 3ARVA 1G0XA 4FEMA 4UM9A 3B1TA 5A2AA 4DEPB 3O3UN 4P5MA 5CHNA 5HVHC 3Q6FB 3T0EA 4J5VA 4JZNA 4MCYB 4E5XB 2ZWZA 3RIFK 4G1EB 4LCYA 4ZFFB 1O7DC 5C92A 1R24A 5FW8A 2GJRA 1OTTC 1S7WB 3EOBB 4IU2B 4JJHA 5HYSA 5T1MA 4JUSA 1RIVL 3ZL1A 3I75A 2ZUQB 3OB0K 4ZMQA 1VCAA 4M9PA 1B2WL 4QO1B 3BUYA 4HEMA 1CN4A 4LEOA 1J0JA 4P5TC 3V0EA 5E08L 1NC4A 2WXKA 4FULA 3UTZA 3ZHDA 4GUOA 4Q7DA 4XNMB 3S6CA 3QWNA 4CGUB 3TGXA 5IJKC 3KAAA 1IKFL 1EEZB 1QLEL 3HRPA 3UO1H 5FO9B 1H19A 1O5DT 2VM3A 5JO5B 3MRKB 1YC8A 3IN2A 4LLVB 1HXYA 4FMVA 3VDBA 1RZIA 4FNPA 4PJ8A 2VUOA 2HMID 4N0FB 4Q0XL 1WZ1L 4NQCB 4IMKC 4Y5XB 1T4KA 4HAFA 3CSGA 4K3DL 4XNDA 2VLRA 3D2TA 3N0PB 3GEWB 4RGMB 5K1JA 4P2RA 3ZKQD 4YSCA 4ORGA 1TVDA 4YDVB 5AENA 2RMNA 4PY7A 1CB4A 3VW3L 2GI0A 3MYJB 3UL4A 3WXWH 4U4BA 3V4LA 1FNSH 1ZWIB 3L5IA 3NAAL 4MNGB 2V8MA 3V52L 4BXSV 4QRBA 5J06A 1PIGA 2BFGA 1U8LB 4J6IA 4DVRH 3MX0A 3LJ3A 2WLLB 3D50A 2K6ZA 3QIBD 4YAQB 5E8NA 3TZVB 3U6RA 5SWSA 2VM9A 3PP3K 4OJFH 5D72L 1WD8A 3MNVA 1R5VA 43C9A 4I2XB 4F8PA 1H5BC 1YEDA 1Z1WA 3K6OA 5D2NA 5MHSD 1OIOA 2I60H 1NBZB 4K15A 1IM9B 5DK2B 4XNZB 4UMGA 1FNAA 3MRMB 2FO4B 4Q14A 1IGCL 4FLOA 2XWJA 5FO8B 3SPCA 3LPFA 4Y9BA 3T0XA 4EI5A 1I3RA 5EU6A 2NR6C 4XCCL 4ZNEA 4H25A 3AQDA 5JW3H 5FX3A 1D7BA 4XWOC 3Q01A 1EA9C 1F11B 5DJ2B 1ZVSA 4KVNH 3O8XB 3OHXA 1HEJC 3QCUL 4PVBA 4XOBA 3DMMB 4GSXA 4X6DF 4LOEA 3PHQA 5DFVC 3OM3B 3TNNB 1XEDA 2WXIA 4OI9A 1N68A 1TLKA 4E0RA 1IEBB 2EACA 4OZ4A 3AWGA 5DRZA 4XN5A 2IBGA 4Y16C 1QSED 4BZ2H 1JF1B 4XC1H 4ZUVB 3FFOA 4K9EH 3DRQB 3WDJA 5HGGS 1VAHA 4L1LA 5I16B 3ROLA 3N43B 1RK0B 4G71B 4OGYL 4OZFB 3GJFK 5CKGA 3PWPE 4QKTA 3FQUB 3BPOC 1WH0A 2HVKA 1VADB 4G72B 1L9NA 4P4KA 4PYGA 4XMLH 2BSTA 4ANVA 4DGVL 2VE6A 5L7XL 1BXAA 2UY7A 1Y7VA 3SE3C 1I7TA 2E6JA 5AVWB 5FXCH 3TA3D 1F3RB 2VN6A 4FA6A 1CK0L 1BDYA 3POHA 4HXAH 4L8SC 1FAKT 1SGKA 3BH4A 3BUTA 3VVWA 4PY8I 1AXTH 4X6EB 1J5CA 4CBPA 1MHHA 5DC4B 5KVDL 5DLMH 4CNIA 4JB9L 3F85A 2WNXA 3ZDZF 2ID5A 2J3SA 4G43A 4DP9X 4NKOA 3P4NA 4OH2A 4PRNB 4TLKA 1CTMA 3O41A 3BVNB 3LKRA 1C5BH 2RB8A 1A5FH 3BKYL 1F58L 1J8HE 3L3DB 2HPOA 3UBXI 4GG8B 3TCTA 5DZOA 1D5MB 1OARL 3QNFA 4P2OD 3WHE1 2O4EA 2Q0ZX 4C83B 4LQ1A 3V4VB 1CL7H 5AAMC 4PJEE 1PY0A 2FE0A 2IH1B 4Y4HB 1EERB 1KGUA 1AO7B 1QTSA 2ZXWB 4PRID 3QNYB 2AEOA 5BRZD 1P7KA 3FQ1A 3VD0A 4R4ND 2AQTA 4YHOH 4ALAH 2CO3A 2H8PB 1ZHLB 1NFDB 4LCIH 3SO5A 3QFJB 2AJSL 2HN7A 2XPGB 2JK5B 4BJLA 1DSWA 5KS9E 1JRHH 4WU5A 4OIFA 2XWTA 3GPSA 4M6NH 3ZZSA 2H1XA 3NIFE 1UENA 1IVLA 5JHDD 3LKNB 1G7QA 2A6DA 3T3MB 1TETH 4ODTL 5AWNH 5DC9B 4K2UL 1HZHH 3T04D 3RPIA 2CKBL 4Y7OC 2HFFA 3F7PC 5E4IA 1B6UA 2Z6FA 5BS0E 1NCGA 2ADJB 2O6EA 4L4VB 1GPOH 4TXVB 5E4EB 3WIFA 2EO1A 2FJFB 3JZ7A 1ZMYA 2ZXDA 4PJ5B 1NMBH 1MFBL 1MREL 2RBLA 2XBZA 3IMBA 2VLLA 1JRHI 2WNKA 4NKDA 4U1JB 4OFKA 5LWYH 4Y2LA 2NX5B 2XG5B 4PUBL 2QV4A 1UADC 1U9KA 1NGZA 2BVOB 3TA4D 1LL1A 2NY6C 4YDLB 3E38A 4EUPA 1XZWA 1JN6B 2OMYA 4P3CL 2VABB 3BYYA 2R59A 4FLRA 4LHUB 2H9GB 2V9TA 4FNRA 1IU1A 2KERA 1HIMH 3EJQA 2PYEB 3PFUA 1PJ9A 2UX7A 1J9TA 3AY2A 2EINB 2Q20A 1KIQB 2ORBL 2RFXA 5FV2A 4HCFA 3FU7A 2NY4D 1R3LA 5F0JB 1VB9A 4KI1A 4YS4A 1A4JB 3MBWB 4JRXD 1XGZA 1T89C 3ALWA 2OZ4A 3VFNB 1HINL 3SGJC 4PJDE 3W5NA 5DJXB 3CN2A 1KLUA 5FWRA 4F9PA 5CD5D 1P84K 4TRPH 2R7EA 4PJHB 3DX0A 2OX5A 3APFA 4GSRA 1NWPA 2Z31C 4NZRL 2OMZA 2F1AA 4DF9A 1YUHB 1F2QA 4V1DD 2JV6A 1JFQH 4GI9A 3VFTB 5IM7B 3RJOA 1R5WA 5I8KL 5BVJA 2JJSC 4XPTL 1UH3A 5ISZD 3GBDA 3II1A 4A2DA 4F8OA 4BA8A 3GSRB 1FNLA 3U30B 4R6UA 2ZX8A 5FM4A 1QRNA 1I82A 1CLCA 1RUML 5GRVL 1F90L 1KCVL 4L8DB 2WBKA 3X11B 4ABWA 5HYJD 5DZNA 5DD0L 5KEZA 2VXQH 5DD3H 3ZTNH 1QFUH 3PDGA 3GXDA 3L4XA 2OJ1A 2LFGA 4UIKH 4XXCC 1YJDC 5EZOH 4Y4FD 1TDQA 2HJKB 3B37A 5EN2B 5T33H 2CJUH 3DIDA 5IT2L 4K07A 2GFBB 2JQAA 4MDIB 5KYYA 4FQHB 4LCCA 4UQEA 4I0PB 4ZOCA 4FQ1L 4XCYB 4HETA 4QRRB 3BP7B 3HBPA 4HJUA 4MRBA 2X4RB 3C08L 4GBXC 1NFKA 3VB8A 2ICEC 2AXGA 1I9RH 1TTUA 2AV7A 4NI6A 4Y4KA 3WE1A 3AREB 4WI8A 1IO4C 4N2CA 2AJ3B 3N6YA 3BZFA 4W6YB 5ACZB 3VWKB 1QSFA 1IBBA 2X6VA 3MOQA 3NJNA 3HS0C 4APQB 5SV4A 3GZOA 3ARXA 1D6VL 1NEZA 3CH8A 3ALXA 1J0KA 3OTTA 4GMTH 3LN4A 1CGWA 3HI6L 1FO0A 1A4AA 3GMMA 1DVQA 4N2MA 4PCYA 1MFCH 4RFNC 5E4AA 4LGSB 4FE9A 1NCBH 3QQXA 1FP5A 4MD4B 3WXVH 3CZLA 1IKOP 2EDLA 2AITA 4N8PA 4GIPD 3T6VA 1ZLVH 4GW4A 2WQSA 5FW7A 3EYQD 2FO1A 2QEJA 1PY9A 1J1OH 3IVKA 3JWDH 3NIGB 3V10A 2VC2B 3BEWB 4YWGL 2HX9A 4KDWA 3ESPA 2ADIA 4AV0A 4BH7B 1GAFL 3QDJB 4ZX5A 1CF8H 4R4BA 2CUIA 3CPLA 3S48A 1GZHC 4NO0A 5GISH 4KOBA 4NZJA 1MJ8L 5JPNA 1EFQA 4XNBA 3FXIC 3VFSA 1T6BX 3EW3B 3VGDA 5KYWA 4TNEA 2FEEI 2VL5B 1OGPA 4UTBA 1CFTB 3WFCL 2Y1VA 3TWCL 4RAVB 4M5TA 1XMEB 3SDAC 4BKTC 1BEYH 4Y5YC 3VFUA 1AAJA 3BQUA 3OKDA 1GSKA 2OMVA 4HG4J 1QZ1A 1EBPA 2K8QA 4WW1B 3JTTB 3OX8A 3WKML 2JKNA 2WVSA 1JUFB 1ES0A 2E8ZA 1EX0A 4O00A 4AYFA 3NH7H 4GO9A 4UUJB 5CJOL 2C3WA 2VR8A 6FABL 4W4OC 3O6MH 3B7RL 5C0AB 2UZIL 1IARB 2G3XA 1QWNA 4OZIE 1PD6A 4J27A 1DR9A 4OV5A 4J23A 1RUAL 4RBPH 2PF6A 5HHOA 5J3HD 4BK4A 1G7IA 4PRPE 5ITBH 4Q9RH 4BRJA 2VDNB 4FTVA 4WW2B 4OBSA 4YSDA 1NDGB 2XXMB 4G7VL 4A7UA 3O6LL 2X9ZA 3MNMA 3QT2A 1MZZA 1CD0A 4PJXA 2C9PA 5FPIA 2OR9L 2DPKA 5C09A 4XE0A 3KGUA 5I1LA 2XIDA 3LKSA 2YPLD 5F9WC 3ZHNA 1MPAH 3K1KC 1DANT 1Z66A 1O75A 1YDPB 1UD6A 3NRPA 4XAKE 3TCLB 3EJTA 4N5UA 3EOAB 3P0VL 4KK9C 3EZ8A 4MX7B 4GY4A 3MNZA 5KS9F 2HFGL 4YUEH 1A9EB 4WO4B 4Z7NE 4RFOL 2F74B 1BQKA 3DTDA 2YD6A 2DLTA 3QH3B 3NIFF 5CINH 4PPTA 1OGAD 2YQ3A 4RSVA 5DRNB 3P73A 2J20A 5HGHB 4BDVA 3D39A 4PR5A 2NXYD 2JVUA 1YN7B 1IL1A 3UTTB 2XVGA 1E4XH 4TTDC 4NKIL 3ULUL 3A67L 2XJLA 4HGWA 3FU0A 3RZCC 2XZQH 1L3NA 1T2JA 1WISA 3MBXH 4ELME 3WTYA 1MFVA 1Y6KR 3MV11 3QORB 3QXAB 4X8JA 1THAA 3VE0B 2DQTH 4ZG1A 3HFFA 4OQ1A 4XXWA 2ARWA 5DJ8B 5I17B 5I1CL 3MO1A 4AXWA 5DHMC 5K69A 1QUNA 4WUUB 3CFJB 5IJCC 3CH1B 4LRIA 4M4RA 1VFBB 3IDXH 4NHUA 4QOKA 2G5BB 4X4XB 5LCVH 5C7ZA 3EGDA 1QZNA 4TMPA 4ZMWA 1ZT1B 2QADD 3D34A 3KYNA 2QHLA 4LKXB 3I50H 1DANU 3GUTA 2FEJA 1BZEA 5FV1L 3EHBC 5ICZB 3C5JA 3OKMA 5J9PA 1KTCA 2DQUH 2APVA 3CHSA 5CZRA 1SYVB 1UWFA 1X7TA 4RISL 5F3BB 5H37A 1NWOA 3BWAA 4OFYD 5DMGC 4P0DA 1U3HD 1U8KA 4FQJL 5JQIB 1SJVA 1UA3A 5D8JH 4OLZL 2GITB 4A7QA 5DJCB 4PB9L 3DGCR 25C8L 3GGWA 3KS0J 3W39B 1LO3L 4TSBH 3BZ5A 4GO6B 2O5YL 2ZP8A 4XCNA 3CK0L 4PJDF 3MRQA 4TNWF 1WLHA 2WUBL 1QQDA 3MKKA 5IG7A 4N22A 5C0ND 4GQ9H 3KYMA 1CI3M 4UNVA 4PWEA 4RZCB 2YA2A 4Y1TA 5DHVA 3JV4B 5ACMA 3ILEA 1MZYA 2F5AL 3B56A 1AYRA 1CLOL 1BZ9B 3H53A 4OCYL 1KGXA 3H9HA 3QW9A 3CDYA 1JGUL 1YEIL 3LEXA 1WHPA 2C9SA 3MRCA 2W94A 4L8BB 4R90L 4H5SB 3QUMH 3C8KA 2W9DH 3EJZC 5D7JC 1SHMA 1SLXA 2QVTA 2NY0B 3ULSA 2GJZA 1T1ZB 4W6XB 3II3A 2K9FB 1F4WL 2ZUYA 2ZT9C 1KXVC 4MVBC 3VCLA 1KDIA 1T04A 4B7IA 1DQKA 2FL5A 3N1MC 2MEJB 1TVHA 1S3RA 3MRBB 4HPOH 4X5WB 2MOGA 4Z7OB 3J8F7 1F4XL 3RPBA 1XMWA 2HT2D 2QPFA 3E7JA 5F7NC 4I5BA 2ZOUA 4M8QB 4H8QA 3K6SA 3FHQA 4LL9A 3E6HB 4JRFA 3D3VE 3NA9H 5LN8A 1MCPL 3RZWA 2NCMA 3D85D 5EU3B 3L4TA 5KSAB 3CFEA 5C08E 4JY5H 2YMTA 3LKPB 2FGWL 1BVNT 3U0TB 3L3JB 2VLJD 2CE6A 4XP9L 3RX9A 4X7DC 5B3SB 2PO6D 3DUHA 3W81A 4GG6E 3LY6A 2P7TB 3MLRH 2V3FA 2WBJB 5TDPA 3K71A 5GGUB 2R2HB 5GZND 4KKLD 2ZUUA 5C2BH 1DUZA 2VOTA 5E99H 1SDAB 4BRVA 4MXWH 3RVUD 3FAWA 1CFVH 4UIMA 3A6OA 3VGAB 3ZX1A 2DJMA 3L5XL 4P23D 4HEPA 1K3IA 3QJZA 1Y0LA 3BEVA 2PW2B 2WMPA 1W6WA 3M86A 4L1SA 1K2DB 5HSFA 4WK4B 3FT4B 1PS3A 3W2DH 3FO9B 3G5WA 3GF8A 3QUYB 5CN2A 3OC8A 5J4MA 1DCLA 1DBKH 2HRPH 3B7YA 4MAUL 4Z77B 4JDVB 3UTQA 3IS1X 3B83A 1U8NA 3TIDA 3WLBA 3M1CA 1R3IL 4PCKA 1Q94A 5HI4C 3SE8H 1R0AL 2YD0A 1PZUB 4Z23A 2HTKC 3DX6A 1AOZA 4XAWL 4URTB 1FO0L 1CF1A 4LLUB 1N5YH 1SUJA 4MAYB 4PRHA 1QHPA 2Z8SA 2JIXB 2X6UA 3QG6B 4QGTA 1AXSB 4POZC 1KXQE 1EK3A 4YL4A 1ZOXA 4OI7A 2X41A 1HT6A 3I9GL 1BYNA 1U8IA 3MROA 4ENEC 3U4AA 4D9LH 3SGEH 4F57L 3R8QA 4X6FB 5DK0A 5HYEA 2ZSVB 4NQQA 4ANUA 3O3EB 1U58A 2CMRH 3MRGB 5GRXG 2BW4A 4G9FA 4HPHA 5DQJB 4DEUA 4M7LT 3T0VA 4OZIF 4NQTA 4JFEA 3IM1A 5E1AB 3WN5B 1FNGA 2H3XC 3SIKA 4BCZA 2X5PA 3RGVB 5HGAB 1S9VA 4IYKA 1HL4A 1X5GA 5I15L 4I4WA 3A4FA 2WZAA 2RCSL 2G30A 1HHJA 2CA4A 2YPKB 3E8VA 1AIZA 2O5NA 1YNTB 3IFPA 4U1LB 4JFQA 3FSVA 3L3OB 3FO2A 3SGEI 4HUKB 3IEAA 4ONOA 1AP2B 2VDOL 5E94A 4K5MA 3S35H 1NICA 2AAAA 1BJ1J 3DK2A 2P44B 1C8PA 3EDEA 2X4OB 4F5CA 3AB0C 4Q97A 2VSDA 3OPUA 3Q0HA 5DGRA 2YKKA 4X7TB 2R69A 2AMGA 4S11A 1YEGL 4GKZB 4XVSL 2J1YA 1HL8A 5DXWA 1JDDA 2AKRB 2H1LM 5FAAA 5KYUA 5KG9A 1KBGL 4Z7NF 3PWNB 4F7TB 1N5AB 4E68A 4AUUA 2ADFH 1OF0A 3EO1A 4H8WL 1K5NB 4U1HA 4FQLL 2Y2YA 4ES8A 2DI8A 4UTAA 4M93B 5D96C 2BP3A 1L6PA 2VN4A 2X4UB 2ZCHH 4RVBA 4O2FA 5AZ2H 2HFEA 4N0UB 3LV3B 4ZTPL 2VIRA 3AC0A 3IE4A 2R4RH 1EUTA 3MCLH 3FQRB 1HEHC 3S97C 4ISVA 2K0RA 3GK8H 4MD5B 1PKOA 4N8CH 3W5MA 3EJJX 4XMKL 5IFAL 4G80A 3WEOA 3PCYA 3AG4B 4ZQTA 5DR5H 3C6LB 1JK8B 1EVTC 5SX4H 4J3UA 5AZEL 3M07A 5DFAA 5IMKB 5GGRB 3VI3E 1EAPB 5HYQB 3QAQA 3BP5B 5EIIA 1KCBA 2ZSWB 3S37L 1A6VL 1SN5A 4L4TA 5ALCL 5TDOA 3AROA 1V10A 4I87A 1IBZA 2SEBB 3UX9B 5HGBA 3RL1B 5C7XH 2UUDK 2NUTB 3SKUD 3K46A 4NI3A 4H8UA 5LGYA 1AZBA 2XVBA 3R7QA 4NKMB 5L2KE 5SX4I 3EYSH 1J1XL 3TFKC 4DP5X 4PB0H 5FOBA 5JYMA 1EIBA 4HKZB 3QUXC 5EO9B 3LRHA 3Q5OA 4PJAB 1LK3H 5E0FA 4ELKB 1A7RH 2ALAA 4WUKH 5GJTL 5IESH 4ZMXA 4L9LA 2DY2A 4NZFA 1H3WM 1ZHBA 2EYSA 5HY9A 3B3IB 1KC5H 5BZDA 4JJ5A 4Q89A 5C0EA 2OXHA 1C1EH 2YPVH 4AL8C 3I6GB 3U46A 1AHKA 4RGNC 2I85A 1I1AA 1OQXA 4HLJA 4U7KA 2DOCA 3IDGA 3IDIA 1FFNA 3GBNL 3IMWA 1Y18B 4FQQA 1JNNH 1MCHA 3D09A 2F7PA 3OB8A 3DV4A 3B9EA 3WS6C 2X4SA 1ZDSA 3AMLA 3PAYA 5B8CC 2KC0A 2VDRL 3EAKA 2H2PC 2YEZA 3WY2A 4XVTL 1J0HA 1DLFL 1IE4A 4PRIB 2Y23A 5FUCC 3V6OE 5BRZB 1WBYA 4XO4A 3CFQA 2Y5TA 3LRSB 2AABH 4HF5L 1D7DA 3BH8A 3RA7L 3VFRB 3VVVA 5CBEA 3FU5A 4GG6F 5F9DC 2WVTA 3MUGA 3MV8A 5CLZA 3SGKA 4DAGL 2EEBA 4G1MA 2ZJSH 3ARBA 2OP4H 4IGBB 4N8VG 4F8QA 4B41A 5C8JB 1UXLA 3CMOL 2X6AA 5F9JA 2HT4C 3UAAA 3BOVA 2AQRA 5EWIH 2BP0B 4UU9B 1IGJB 1L6XA 2KLRA 4JPQA 5LBVA 3S5YA 3D25A 3OLDA 4DW2L 5DTFA 3P0YL 3RHWK 1E4WH 4H26B 1VACA 4OKVA 2HCZX 3DPBA 3CZFB 1N64H 4O2CA 5DDHA 3T0BA 2VN3A 3ELAT 3IKCA 4MMXC 1HXMB 4OF6A 5DJZA 3HAEB 3QEGL 5DD1L 5GZOA 1BVOA 2WP3O 3KL0A 4DGUA 1NLDL 4JPWL 1UD5A 1UD4A 3BUIA 1P4BL 1WGOA 4JFSA 5HPOA 4JFOB 4PV9B 4OD1L 1NL0L 4WI3A 5K9KB 3WO4C 3QJHA 4FG6C 3WDIA 5BV7L 1CVRA 3MQIA 4HD5A 4Z7VF 4ZW6A 3UYPA 4KZEH 2AJVH 1FFOB 1ACXA 5F7HA 4MNGE 1K8IB 4IMLB 3SYCA 2H3NB 4Z7UB 4NBXB 3H3KA 3MREA 4TOYL 5AVXB 5I0ZA 1BJ8A 1ZK9A 3WUWA 3CVDA 1UUSA 3FCSA 4QPEA 5JHLA 2KMWA 2F1EA 5T1LA 4I2XE 2NZIA 3GTNA 1OKEA 5EHFA 5C0DB 3QXTA 5JW5B 5EF2A 1A0QL 1DLHB 3PWJB 2YMOA 1LLAA 4OQTA 1KEMH 2YAPA 4ILDA 4U1KB 3TBSA 2B5IC 3UFIA 3K6FA 3CHXA 3LEVH 3ARRA 3IGUA 4YPGA 3H42H 2HVBA 1EMTH 5AOLA 5E9AA 4ES9A 2IFGA 4HJ0D 5HHVL 2P24B 1RZKC 3AG2B 5FGCB 3UGUA 4BHUA 3P02A 1A7PH 5C0CA 1RP9A 1ASPA 5AYQA 1VEPA 3D2UA 4AMKL 4BE5A 5I1AB 3QYNA 3FTUA 1HHKA 2B2XH 5EEYA 4K3EL 5CILH 3S4SA 4WV1B 1GY1A 3IPBA 4HLZG 2V2WB 1LE5B 4ONGH 4HUCA 5TK4A 1TIUA 4AENB 3VXQA 1JD7A 4G8EB 2X6MA 4PBWD 1XB8A 3NJGA 2X2YA 2XETA 4O9HH 5CEZL 4M7LL 5T3XE 5GGQH 2CLVB 4ONHA 4XO3A 4OD3L 1UJTA 1SXSA 3L7FA 4WDIB 5GGVH 3D30A 5F7WC 5SV3A 2ZWSA 4EZJA 3CC5A 1AZRA 1CVSC 1XZ0A 4XP4H 2P5WA 2ZCKL 4RRPG 2AS5M 1HJCA 1L4IA 1MJUH 5DUJA 2FBJH 4GAYB 1Q0XH 1WF5A 5GS0H 5CZVL 3D0VB 1H9DA 3VGHA 3UBGA 3LD8C 3OKYA 1OGTB 3PABB 4XX5A 1DDTA 2HLFD 4JM2C 1RU9H 4ZFOA 1IILE 4DP7X 2GPZA 1CBVH 1QOKA 1TT6A 5T3XH 1Z3RA 3OAWA 5IBTH 1KWKA 5IKCB 2IANA 1MY5A 3AM8C 3PHOB 1XCTA 2R69L 2JE8A 3NFSH 1XAUA 2QVMA 1E4KC 4OZFH 2YGQA 2KPWA 5IMMB 1MW1A 2OV0A 3R4DA 4MCNA 3H9YA 2C1OB 2J88L 2ZP9A 4OZHA 4UTAL 1T6VN 1PZAA 2ATPA 2ZF8A 3C60A 5IHZB 2HZHA 1H6FA 3MA9L 3TH4T 1UACL 4JFHD 1MUJA 1HC1A 3RNQB 5FYLE 1WG3A 1AO7E 2IAMC 3MFGB 1XAKA 1IGIH 1T03H 5JOPD 4QHKI 3SKMB 1W16A 1U2YA 2Q9OA 1A7QH 5D7LD 1NFDE 2BCKB 4Z3HA 3QFJE 5C0GA 3ILQC 2N1TE 1QYGL 2NNRA 1LDSA 2V4LA 5D1XD 5JTWA 1QFHA 1NCTA 2Q5BA 3N5AA 3P2DA 3R0NA 4TLUA 2FTAA 1AI1L 2ZKWA 2CBOA 3QHZH 1G5AA 5AKVA 5HHPA 3T3ME 4D2NA 3FTGA 4XPGL 4C56A 3V4VH 2IJ0C 2JKSA 5FYLH 3RG1C 2XTJD 1FIGH 5AAPA 2DW5A 2PPFA 1NIFA 1XGUA 1ZLSL 2C7UA 4JHAH 4L4VE 1AR1D 1K5WA 3SZKC 3MCKA 4JG0H 1B3JA 1ZTMA 2BVPA 4NN6C 4PJ5E 3M17B 4JKPH 4PAZA 1M2VB 4GAJH 2XV2A 1CE1L 2HA1A 2NX5E 3EFOA 2Q6WB 3T6WA 1I1FA 5MI0C 3B7SA 4LT7A 2DH3A 1KGCD 2A7BA 1B4LA 3NJVA 1I8IB 5C0JB 2G60H 2GBUA 2APBA 5ICXB 5IEHA 4FZEH 4OLWH 2JNZA 3BDXA 1FH5H 4ZOEA 5DEFB 5D2NC 4LLYB 1NMCB 2PYEE 1IIIA 3N06B 1D5IH 4TSAH 4K0OA 4KK8D 3LB6C 3VXUB 1NGPL 1U8QA 3MMEB 1F3JA 1UGKA 5IGXL 5KUKA 3NABL 2MPAH 4PBDA 4YDIH 4J1UA 1PZBA 2OL3B 4OD2B 4P06A 3KLDA 2F8XC 5I1JH 2CR0A 3WMQA 1MVUA 4X4YB 3RU8H 1M1XA 4Y19A 3VYNA 5EEUA 3VM7A 1D5BB 3FS9A 3ZYOA 1JI1A 3FZUC 4C4KO 3VXNB 1BAWA 4KKCC 3QYMA 4PJHE 5C2UB 1OGAB 3OHXC 3FUDA 4FLQA 4UMSA 1PZDA 4XNXH 3CZEA 2D7NA 3LZFH 1NGWB 1XIWA 2PYFB 4B9ZA 3LX9A 4X9FA 1NCDL 3L4YA 5DJ0B 3VD5A 5E5UB 1PYWA 4EF3A 2FAUA 3H2QA 3EGSB 4KY2A 1QKZH 3ARUA 4IU3A 1FYTD 3AS3A 4O02L 1N7MH 4QHUB 4UBDC 4YJZL 3RPKA 1GIGH 3PL6B 3CLEH 5EOQH 5E5LA 3C09C 4YDKL 3QUZB 3RY4A 4DK6A 4PREA 4U6HA 1BM3L 2FWUA 4RX4D 1A3ZA 3U82B 4JFFD 1I85A 3GKWH 2ARJQ 3T08A 5JOFB 3WFEL 2Y7MA 5J1AB 3L3IA 5T3ZL 2RQEA 3LRMA 2R1WA 2ED9A 1DFXA 5PAZA 1OAYH 3KXFB 3QHFH 3HJEA 4A2MA 1SJMA 1M3IA 1UWGH 3OR7A 4NDMB 4GW1A 1DSFL 1DVFA 3GLDA 3CG8A 2IH9A 4JN1L 4QRRE 3SYOA 4PSPA 1BAGA 2BVQB 4M1CC 5CJQL 1H15A 2JCWA 3NEEA 2BNRB 4K8RC 4PRDA 4TNGA 3QJUB 4HK0A 5E5RB 2FSEB 2R1XA 3MNDA 4FYRA 3BPLC 1BP3B 1YMMA 3VXSD 4OLXH 1K9TA 5D7SH 2WV3A 4AYDC 1JYWA 1FZMA 2WBXA 2ESVD 4FFTA 1GCFA 5HGDA 4HDIA 3VU1A 4J6RH 4WY7L 1MCOH 3WKNA 4PJFF 4RWYH 5AW6B 2VZ1A 1V7NH 3ULUC 1IGYA 3JTSB 1T1YA 2BS71 3MRLB 5CZXD 3BGAA 2EYTB 3D69A 3T77B 2E6PA 2RJMA 4JY6A 3FF7A 1LMIA 5JHLL 5E9DA 4TUOA 3U4BL 5E23A 1E50A 2QGEA 4LDEB 2Z0UA 1BXUA 5I1EH 2PTVA 3NIGE 1AY1H 3G6DH 4OQTL 1SEQL 4EBQL 2W1NA 3QDJE 3W57A 1XF4B 1JIBA 3CXHJ 3HC0B 2ERJC 2W81C 3MLYH 4TVPD 2J73A 5FHBL 1OV8A 4LB8A 4R0LA 3L3HB 1CPUA 4POUB 3PDDA 2H1PL 2HT3C 2IEPA 4KK5D 1U95A 2Y5QA 4P2QD 2X0UA 3KZ8A 3PWLB 1SDYA 5E1GA 3FUEA 1MCFA 2PO6B 3WTWA 3LZLA 3R06A 3WHXA 2G2PA 1L9TA 4KAQL 5JPMA 4I18A 3S3JA 3OQRA 4UQ3B 2WBWB 3GIZH 1IM3D 3W9EB 3L8QA 4HT1H 5CNHA 3JV5A 5C0AE 1UQSB 2ZXCA 1YO4A 1R33A 4AV4A 3BFQG 4ZNCD 3ARGA 4RDBA 3HZYA 1JXFA 1U3JA 4HD9A 1WEJL 4MASA 4F92B 5FIEA 1FNHA 4H1LG 3NN8B 5BJTB 1ASOA 1M3JA 3RDJA 1Q9WB 3QXDA 4YHNB 3G08A 4RQQB 3NPSC 3MV7A 1PAMA 2PWGA 2A83B 5E2WL 3WBDA 4ZFOL 3MBEA 4HAKA 2JXMA 2ARJA 1OSPH 2Y06H 3OJVC 3CVHH 2AW2A 3B9KD 3POCA 3UAJD 5FWQA 4EIGB 2CJSA 1NFDF 3TYGH 3DJRA 5E6SB 5IHLB 3P11H 2WO2B 3VXMB 1BOYA 3VYOA 5DHYB 1YEHL 1HSAB 2XN9B 5F89A 1IMHC 1N0LB 3ARFD 2VDNH 2OI9C 4G42A 2GKIA 3TBVA 2XNAA 5EUOB 5B39B 2CAKA 4N0YH 4JGMA 3U7WH 4EDWL 1TNNA 3L6FB 2A74B 5ICYB 4HBQA 3MNWA 2NNAA 4N2FA 5DMYA 2CXGA 3SN6N 3DVNA 3UTTE 3S0PA 3NSCA 5CMAB 1TKWA 1AGDB 4MCZB 3HS9A 4LSSL 3DI3B 5MEPB 5BPPA 1QO3B 2QQLL 3MLXH 2WZ0A 2V5SA 2QTEA 32C2A 3E0GA 5ANMA 5GGSB 3QUKB 4QXGH 4JDZB 4MSWB 4LCCC 4AGLA 4IIZA 5DFTA 4ZMTA 4D3CL 4IRSB 4RMQA 5IOKA 1KZQA 1X5LA 5CCKH 2IQAA 4JO1H 1E90A 4FQIL 5AYUL 3OLGA 3IDNA 3D18B 4CMHB 3O6KH 1FVCB 4I1PA 2XLLA 4PS4L 3I9IA 2J1XA 4Y4KC 1VENA 4GW5B 1YNLH 2D8KA 1MAML 3DSFH 1WAAE 3DUUB 5ETUA 3ZT6A 1KYAA 3GSNH 1MEXH 2HVJA 4LPUA 1ZA3A 3JWOL 4X6CB 5IW3A 2X3AA 3ZKMC 3EYUL 4KGLA 1WA2X 4XNUH 4IBLT 3QJFB 1QPKA 2EDQA 2YWZA 3FSZA 1R3JA 1VGEH 3RB7A 4D9RE 3CDGB 1I3GL 4ZD3H 1P4LB 4K5PA 1M57B 2BIHA 4AT6B 3C8HA 1HESA 1CICC 4UDTB 2DQIL 2VXTH 4HP5A 1KIUB 4OGZA 5BZWA 3BZEB 3QCTH 3QJTB 4KTGA 2EEAA 5BOZG 3OWEA 4LLWB 2P8PB 3KWTA 1DN0A 5E8OB 5GGVY 5JPNC 3IJYA 5FGSA 1KN2H 3DOIA 5KSBB 2F53D 1AJ7H 1R3HA 5D5MB 4FA8A 1V7ML 1KB5A 2YAOA 5IVNA 4NO3B 5KZCD 3B2DC 3N2JA 1OPGH 1S78C 3BQUC 3DVGA 2OSLB 3EBGA 3OAUH 4Z7OE 4W9IC 1GYUA 1QX1A 1KTLA 4UQBA 5HVHB 4JN2B 3ZTEA 2WLNA 1XTLA 2DQDH 1D7FA 1IC4L 2MKLC 3BD3A 5C07A 2IIJA 1A14H 4V33A 3Q8EA 5MEQA 4ZQKA 1CDGA 1FG2B 1II4E 3OMAB 2HFTA 3TWYA 1JYXA 5DUBA 3KPRD 2V5RA 4QJ5B 4P5TB 5ES4B 5J6GB 2CBTA 2VZOA 4J12A 2BFVH 4LKCB 4IOSD 5DUML 1HU8A 3V0WH 1WFOA 5IQ9B 5I8CB 4KUZL 4U1IA 4GAGL 1ORQB 5HDWA 3S5LG 3EXLA 3CX2A 3GRBA 1UM6L 1NBVH 2VDQL 2R29H 1Z9MA 1W0VB 2UWEB 5AB1A 2WB1A 3TO2B 1XH3B 3UJIL 4MNQD 4BFIB 4NUQA 2BSDA 4I13B 3IPEA 3ZY7A 2JKXA 1RLWA 1VHPA 1BD2E 1DVTA 2K6WA 1T3FA 5DT1L 4G7QB 3MLUH 1PX3A 5F93C 4LSDA 5CZKA 4HK3N 5AW2B 1KCRH 1D9KD 1BQ5A 1GYVA 2KL6A 1EJ8A 4UT9A 4RMVA 5H8DA 1KENH 3CDZB 1V54B 3NIGF 1SY6H 3MR9B 1FSKB 3J2PA 3P3RA 1XGTB 1JXGA 5EFIA 3HHRB 5EORL 2LVEA 3IJSB 4D9QD 4PFEA 3IFLH 4MWFB 3OJDB 3VNZA 1URIA 3W9DA 4CW1B 4LAJH 1G7PA 3HE6D 3N1QC 2AXWA 4XB8A 5BW7A 1EHKB 2GK2A 1I7UA 1YG9A 3MJ8B 1CU4L 2UY6B 4MA1B 2BNQD 3WNOA 2A4ZA 3V7AE 2QT6A 3O3BA 4OF0A 1KYOJ 1MAJA 1E28B 5CLWA 3B5HA 3NESA 3QZBA 5HDQH 3P69A 4Y0GA 2WZ6A 1WTGT 2K4WA 2YN5A 5FDWB 5IW1A 2WLIA 1T66C 3WNKA 5L6YL 4HS6B 3L2LA 1VGKA 2GG1A 2OFQA 4LOUC 1AC0A 1SLUA 4LRIC 1FVEB 2AQQA 3CVCA 4FLHA 1HYSC 4NCC2 2B0SH 2HB0A 1TEFA 1CO1A 2BHYA 5CSZA 3UYOD 4EXKA 2AF2A 4QUOA 1OP5H 5T1KA 4GQPH 4A55A 3I6KB 4HKJA 2WLKA 2W92A 4PJBB 4E9RA 1E27B 1AANA 1LEKA 4BSWB 1YQ2A 5M94B 2FWOA 3L1OH 1XVSA 2DWDA 4OAWA 4JLRA 4WW2F 4LARH 1U8JB 1VFUA 3DETD 2G2RA 4OF5A 2OSYA 2Y36L 1IAKB 4LCWB 4Y16B 4Q6IC 3HB3C 1LDPL 1AIFA 5TE7L 4WWKA 1KYDA 2BP8A 1U36A 5D1ZC 1OAZL 2CO7B 5LXVA 1RI8A 2G9HA 3OG4B 4HWEH 5AVZB 2P26A 2L04A 1A22B 3HZ3A 3NUKA 1Q9LA 5HI5D 5I1IL 4YN3A 3BPOB 5CLXA 2BSSB 5E6ID 3VD1A 2ZNWA 1AFVL 5DJAB 5CGYC 4BV1A 1NGXB 4FAAB 2XXGA 4G3YL 1AZNA 1U4FA 2XBTA 5DUPH 4BZ2A 1T5WB 2EO7A 3B2VH 2EDDA 2R2BA 4MJ5A 1FHNA 2QHRH 4I89A 5HHNA 5JHAA 1OL0A 4KXAA 4MKTA 3NQKA 1FL5A 3SQBB 4P49A 1MJ7L 3BWUC 4DFIA 1NLBH 3KM2A 5FFOA 2PCFA 4N0UE 3D1MC 1YEFL 2VDKL 5I26A 4W9HC 3UBXA 4TL4A 3SJVA 5A3ID 1MVYA 1SMDA 3FCBA 1NEZG 3RQ3A 4MB4A 1NAMA 3TESA 3WGUB 2GJ6A 3GS7A 5LHDA 1ZHKA 2ZOLA 3VI4B 2GK0B 3PNWA 1PW3A 4YHZL 5I1DA 3DX8B 1Q1PA 3VX0A 3L95B 4XVJH 3KPSD 5IMLA 1EJOH 4U0RB 1A1MA 4WEEA 1I7ZA 4Q2ZA 2V5MA 4AQ8A 4AG4H 2E9BA 1BLIA 1WAAF 2AFNA 4QHMB 4XN2A 4JBSA 3H4HA 3AJ7A 1W72A 1Y1DA 1QG3A 3V4UL 3V0VB 3VRLE 3I84A 3QNZB 4Q9CA 4ZAKC 3EJYC 5EC1A 1YYML 3RDTA 1YEKL 4BM7A 4Y7MA 4IKKA 4OCLC 5A2LH 2XY1A 1HOCB 2Y25A 2NY2D 2XHNA 3TJEL 3QPQC 4NHCL 4ZUTB 1HX0A 3ULVE 1OCWL 1XGYH 3DRTB 4HJ1A 1UXWA 2X4PB 5GSVA 1WYJA 4ZTEA 3D0AA 1ZVYA 1J8HA 5JORB 4PJAE 1PJWA 1AKJA 4Z95L 4XZUA 1JFHA 2OZNA 2XFXA 4X80L 3O4OC 4YHIA 4AVKA 2KQNA 2P9RA 4FERA 4POYA 4QDGA 4WVRA 3WO3B 3JUZA 4ZMLA 1AMYA 1BEXA 2NRDA 3MLSH 1IAMA 3M1BA 4K9JA 2NY6B 3VJ6A 1U92B 3KS0H 4MMYA 3WNJA 2FYYA 3FU3A 3GSUB 4M3KB 4PMFA 1AH1A 2I26N 3G6JB 1MQKL 2FATH 1CFQA 5TDNB 3IF1B 5KS9A 5CU9A 4I0KA 3LPWA 3TIEB 4OCWH 1S4IA 4EKJA 3LEYL 5IQ7L 3ULVH 3IU4L 3MRHB 2VXVL 1LD9B 4HLZH 4HBCL 2IALA 4J8RA 4JPKH 5IVZA 3L5WA 4JRYD 4OB5L 1PVHA 5H4YA 4PRIE 3HMWL 3KPMA 4HWBA 4DERA 2J71A 3BO8B 3BJ91 5BRZE 4OT1L 5T8IA 3T2QA 3I2CL 4WZ9A 3FB6B 4J3VA 1HQRB 1IGMH 1QAWA 4FJZA 3RTQD 3QEQD 4NO5A 1OW0A 2Y2WA 3QIBA 2YBRA 3VXPB 1CT8B 2UZYB 3GIVB 3RWHB 2X6BA 3ZGHA 4KY1H 2HWZL 3QE5A 3BXNA 4N6RB 2IDTA 3FH5A 3VFVB 4O5LL 5TE4L 5B38G 3CBJB 1K6QH 3DBSA 2CSPA 2GCYA 3WHE0 3KPTA 2K70A 1FRGH 1UM5L 3IGAB 1ASQA 4HJIA 1GGBL 3GWJA 1KGWA 1NBYA 5FUZH 1EV2E 4R3SA 1KCLA 3AGVA 4E41A 1JNLL 4F58H 4MA7H 5D7KD 1AR1B 4R7NA 1QLFA 4P3DB 4MA8H 1EXGA 3MPCA 4UOW0 3DOSA 3WNLA 3WY3A 3B7TA 3LHAA 1NPUA 3DPDA 4H0IA 4ZRGA 1COBA 2XKNA 1MLCA 5JUEH 2GUOB 4ZYKA 2W88A 4KQ4H 1AC6A 4EJ1C 4AYSA 2ICEB 3RFZA 3VH8B 1H0DB 4AEEA 3MLZH 3QPKA 3OXRB 5B3NA 4KH9A 2BS8A 4Z7UE 1EO7A 1MG2C 2YAFA 3HS0B 2X1WL 3HAEH 4C47A 4WLCA 1A7BA 3NSYA 4B9YA 4FOMA 4UT9L 2Q3AA 2PCPB 2GSIA 2L7EA 4M3HA 3AY4A 1PKQB 2BVTA 2VWEC 1XR8A 3ML8A 4GEJA 4JR9H 3V7MA 1YN6A 4YHLH 2I9LB 3ABMB 1JF6A 2C9UA 1C08A 5FYKE 5KVGE 3TA3A 4B5EA 1J9QA 4UM9D 3H9ZA 4Z7QB 4NQEB 2BVYA 3Q1SH 3T0ED 3ZMNA 4JFTA 4ORZC 2CBMA 4LVHC 5FGCE 3C75A 5JQ6H 1BOGB 4S2SA 4FXKC 4J3BA 4OW6A 5EMYA 1J10A 2Y72A 2YGPA 2F7QA 3LS5L 5A40E 1A1NB 3EDKA 3WXWL 4JZJC 4ETQA 1FNSL 1YNTF 3ZO0A 1UB5B 3WFDH 1NC4D 3E2HB 3VSQA 1AQDA 2V3DA 4ZUWB 5AKTA 4DVRL 1ZLWH 4YHMH 3T4YB 2NY5H 1TLMA 1JV5A 2OS7A 3D4CA 5MENB 3L2MA 1CE6A 3QEUB 4OJFL 5FYKH 4JG1L 5KVGH 1MDTA 3SDAB 4P2OA 3U1SH 43CAB 3V6FB 4Y5YB 3IKKA 2X12A 2I60L 2JKWA 3BVDB 2R23A 4K23H 4EAEA 4Z76A 5EZIH 5K93A 4PJ8D 5L2JA 2DL2A 3ALPA 3QXWA 3SPIA 3QUHA 4ZXBA 5E2JA 1AHMA 3RVVD 2F8VA 5K59E 1Z9NA 3FT3B 2EXWD 2IC2A 4KKAC 4NC1E 3LIZH 4LSRH 1XF3B 1NGYA 2GSGB 1S7QA 5JW3L 4P2RD 2R2EB 2G3MA 2E4TA 1IAII 2AXHA 1BJ1H 2BOCA 1B88A 3G5ZA 1UXSB 3GT6A 3ZZLA 4F9LA 5JHDA 2FD6H 1I8AA 3CV5A 5BMFH 4AJYV 4DP6X 3ORJA 1I1YA 4FXGB 5DF0A 2X4TA 4J28A 1UZ6E 3F7KA 5DRWB 3TF7C 5ID1A 3MRIB 2UZXA 5MERB 4BZ2L 4XC1L 4L8CA 1Q1JH 3MRNA 5F3HB 4K9EL 2KLSA 2JMRA 2WIIA 3U7YH 1KIRB 4KQ3L 1ZA6B 3EGXA 3L17A 5F9WB 3PGCA 4P05A 3UEZA 4HUXB 3NJXA 1G7MB 1MVFA 1DSYA 5KSUA 2JI2A 5KBNC 2BIQA 2PTUA 3OAYH 3TBWB 4N24A 4XBGB 3OKNA 1MCWM 1OB1B 4XMLL 6PCYA 5LGJA 3VRLF 3SGKC 4HIIA 4EI5D 3EOTH 3L3GA 3GSOA 2Q1EA 2H2SD 3OMNB 1BFOA 1ZJBA 3RUGB 3NCEB 4BH8B 1A6TA 1OT2A 4UV7L 3SE9H 2DYPD 5IW6B 4YSEA 1EJFA 2VMFA 4IEFB 1NJ9B 2WGXA 3U2JA 2AJXH 4QRQB 1AXTL 3P77B 4H88L 5B3JF 2ZX5A 3FO1B 5BVPH 3QZPA 1HL9A 5DLML 2ZOKA 5GGTA 4OZIA 4IIQB 1P84J 5IQMA 3OSKA 5HI3D 4W9EC 4JRXA 4P2QB 2WTRA 5DA4A 3RZCB 4LLQB 3ULVF 2VZUA 1JE6A 2NY3C 3MU3A 4PEEA 1CGSH 4I3RH 2GTZA 3UC2A 3DHPA 4M1GH 4PRAA 4PWJA 4Z5RA 4D0DA 1SMOA 2GIXA 4AJVA 4XNYH 3MUY1 2IOOA 1IM3B 3Q7JA 1CL7L 4PGBB 5LUMA 4V1DA 3OR6B 4ODUA 5B7FA 2CXKA 3F7VB 5BXFA 4P4KD 3VFOB 2UXGA 3FUIA 4JL1A 3EFFA 4X0KB 3QDMD 3R8BB 4CVWA 2JCCB 3EHBB 3MLTB 4YHOL 5ISZA 3S3DB 3U36A 3WJMA 3QIUD 4Q4EA 1Q9OA 4LCIL 3F04A 4JKKA 4NLAA 5JIDA 2V2TB 4AVHA 4G9DB 5LKNA 3ROOA 1O9ZA 4CDGC 2E0PA 2GIYA 5HYJA 1KTBA 2DWSA 1JRHL 5DVMA 3QJQB 3V2AR 4B50A 4M6NL 3M46A 1RPKA 2ZWLT 1HFUA 5C0FB 4Y4FA 1TETL 5AWNL 4BA0A 1GYCA 4QKXB 1JHTA 4FC3E 5G4MA 3VXUE 1S5IH 4IBWA 3E8UH 4OZGA 2CGRH 1CDBA 2RACA 2ZICA 4NFBA 4NOFA 1GPOL 4KX9A 3FQXB 3F7YA 3MXVH 2W91A 3O81A 2P28B 4HZAA 4LQFL 4PLJC 3PV6A 5AB2A 1NMBL 4XXDB 4L3EA 5JLZB 1XSJA 5L4JA 3W56A 4AJWA 1GHFH 2NY1D 2Q3ZA 4AUYA 2YZ8A 1FORH 5EUKB 5LWYL 1OGAE 4XMPH 3QAZC 3K0WA 4MMZC 4GPVA 3WEXA 1NCAH 2P45B 4R97B 5D7JB 5F9OH 4YFDB 3DYOA 5E2VL 1I4FA 3ZHFA 4AIZA 2DYRB 4U6YA 4KHXH 7PCYA 3D8MA 3N9GL 2YUXA 4HWBL 3PIQB 4O51B 3ZE1B 1HIML 3VD7A 2OL3H 3ECUA 3OVUB 5E00A 1LNUA 1W6LA 2V17H 1AACA 5KANG 1FCCA 3QUMA 4XHJD 3U9UB 1JZJA 4S1QL 4FJ6A 3VX1A 2FX8H 5KYXB 1HDMA 4XT1C 2E5EA 5C9JB 1J5OH 1G1CA 1K8DA 3K7UA 3L1EA 1YECH 3MRDA 1RSFA 5D6CA 2LVCA 4JO3H 1IEAA 3KXFE 3BIBX 4TRPL 4A39A 4V2CB 2X05A 4PW9A 3LN5B 3AADB 4L23A 1IJ9A 3BX7C 4NQDB 3LVEA 4ZUSB 2YC1A 3HHSA 2BWDA 1JFQL 2BNRE 1A7OH 1BZDA 1YY9C 4OBRA 4PV8A 5DD5H 3TNMB 1AG6A 5EIVA 2MHAA 1B0RA 2EECA 4HJGB 4Y1AD 1UA6H 4WHTA 2FJSA 4L29B 2ICWJ 1T21B 2NT0A 1LTXA 5ENWB 4ZSOB 2AI0H 5DD3L 1G9MC 3GSWA 3ZDYB 1QFUL 4UIKL 5HHXH 2A4EA 1L0PA 3U6XA 4QF1B 2EH7H 3PRZA 4JFVA 4TULH 2BWQA 5EZOL 1UHVA 1HZKA 2CJUL 1U93A 4N8VB 1KPVA 2HYMA 4YXHH 2VNCA 4ODSH 5C08A 1DJSA 3IRCA 4QYOB 4GKSA 4XCEB 3TZVC 2X7LB 3WFZA 5HDBF 3NQIA 5D70H 3KPOB 5DWUH 4Q9QH 3TURA 2ZKXA 3O2WH 2CBQA 5AAWA 5FM5O 3FQYA 5KJ7E 4NN7B 4F7CB 1RJLB 2EIBA 1XCQA 5AVUB 2J6EH 1FGVH 5LGHH 2Q76B 4TNVF 3DGDA 2YPLA 3D6GA 1DQVA 1DQLH 3D0LB 1ZE3H 2EIZB 2ENYA 1ND0B 2BZCA 2YEVB 5GS1A 3TJHC 4L3CB 3U9PH 2GB2A 2W0FB 3GMOB 1MFCL 4PGDA 2LLLA 1PDKB 2DWTA 3WENA 3BP4A 2FT7A 1RZGA 5IF0A 2FEEL 1WT5A 4FHJA 3OAZK 1C7TA 3L5HA 1MELA 2PPCA 3WXVL 5IB1A 1UA7A 1KXHA 3JWNC 3UH8A 4U1SA 3CBRA 3UMTA 5BUPA 3UBHA 3MRJB 1M1SA 4X4KA 3L7EA 3IXAA 3JWDL 3DVFA 4BQ6A 4EIUA 2BHUA 1ID5I 4PS7A 1OTTD 4HIHA 3TL5A 2FZ3B 2IPTL 4HUVA 1R5IB 3ML9A 5L8JB 4KO6A 2ITCB 1VKXB 4Z7VA 4IBYA 1FZKB 1QSFD 3AB0B 4KJPD 5IHHA 4BEIA 1KXQA 3U1PA 1VERA 2DM7A 2WKGA 2RGSA 4J3WA 2W60B 2O61B 2Z7YA 3GBEA 1BEYL 1XD0A 2HTLD 4FNTA 4LLMA 5TD4A 2VRQA 1ONQB 3QS3A 3IMVA 4MQ7B 5A2CA 3AAZB 2ITDA 5BQ7A 3PQYD 1DUYA 2DMBA 3HNVH 1LE9A 3BKJH 4WAFA 3EG9A 3MJWA 3FTWA 4RDQG 3NH7L 4F3FA 1JGEA 2PW1A 3WTVA 1TQVA 1P69B 4TF4A 35C8H 5FLUA 3VXME 4OFYA 1U3HA 2B15A 2OMTA 3MGOA 4MS8C 3X13A 2XN9E 3WL9A 3EYFA 5AVTB 2OK0H 3FMGH 5AZUA 3ZQXA 4NT6A 5EUOE 4KJYB 2DQFB 2P5EB 4NIKB 5GS2D 4HIQA 3HE7A 2F08A 2DRUA 1UUNA 3GD1C 2A6KB 3AXLA 5ITBL 4Q9RL 1A64A 2VQ1A 2WNGA 4ICWA 1E2ZA 3DECA 3QNXB 2HPTA 2V2XB 1QR1A 3VXRB 1A6ZA 1HEZA 4JDTH 3BN3B 3CWGA 1XV8A 4Y4HC 2EADA 5EOTB 1BZ7A 1MPAL 2AK1H 2IPKB 1PCSA 2VAAB 5IEKA 1K4DB 4NQVA 2FIKB 4H0LC 2D3LA 2MJWA 4AQEA 2WKLA 1DVFC 1KTDA 5EOCL 4LSTH 5AB9A 4YUEL 3NJHA 2H41A 3ZL2A 5ADPL 4ZOAA 2YXFA 5CINL 3RY5A 1E3FA 3E80A 1WFNA 2NR6D 2Q8BL 1F2XK 3KVPA 5FKPA 3QI9A 3V6ZB 4GINA 4U6VH 1YUKB 1R4XA 4X6CE 5D2LA 5E6IB 5A2BA 3CQQA 1E4XL 1S7SA 5J11C 3D85A 2JJTC 3QUXB 1BIHA 5E4EC 2XZQL 3TOPA 2VLJA 5DS8B 1LQSR 1H6TA 2DQTL 2GT9B 4UM8B 2QMJA 3BISA 3SYPA 3FL7A 5LXGH 3BVVA 3UG4A 3ZHKA 3TN0D 3W3BA 2DAVA 1J9CT 3IDXL 4HIEA 1AR2A 3U2IA 2AGJH 2JI1A 6TAAA 4KV5E 1JGLH 5IVOA 4OFQA 2VERN 1BBJB 3LNFA 2DLIA 3I50L 1WBZB 4KJWC 4X7SH 4P23A 4WFHE 2ZWNA 3LQAC 2DQUL 4BYHA 4PJIB 5I2IB 1DQDH 1T1XA 1TPXC 3Q3GB 1JNHB 5B8CB 3Q2NA 5KSBE 3BD5A 5D5ME 9PCYA 3ISRA 5DYOB 5D8JL 3G5XA 2MPVA 4PRBA 2A6JB 1SEBA 1K72A 2O6FA 3MA7A 4TSBL 2YPVA 5B1BB 4QXUH 4KDVA 1S8DB 3QQDB 4UDUB 5EU4A 5MP6H 3SKOA 1USZA 4GQ9L 2XXFA 3F5WA 1S9YB 1O7DE 2CLZB 3LPGA 4DUXA 3T0AA 4QRPA 4YSAA 5IBLD 3RVTC 2LHAA 3V5DB 2H26B 2M1KA 4HJSA 1P5VA 2YS4A 3UP6A 3TPUB 4HSQA 1RZQA 4IKJA 2V5TA 2VR9A 3UMNA 1UB6B 4HQQH 3GNMH 4QTHA 5I8OL 3QUML 5EU5A 3T2PA 2NY2B 3U30C 1GZPB 3FB5A 4DESA 2EVHA 2J8UF 4UQDA 1MH5A 1EAJA 4ERSH 1B6DA 4JAMB 4OM0H 3G5YB 4QCIA 2EXYC 3BAKA 4FFZA 4CDHA 4I9XA 1M7XA 4Y5VB 4KKRA 4C55A 1BPVA 5FKAB 3MBEC 5CGTA 1G7JA 5I6PA 4GAFB 3I85A 4XBEH 1C5DA 5TH2B 2DQMA 4LNRA 3EYOB 5C0BB 3ABGA 5I66B 4NPYA 3UTSB 3FFDB 4HPYL 5D1QA 2A0LD 3Q6FA 1KJMB 5B7MA 3SDYH 1T0MB 2EUZA 1O0VA 3RB5A 4JY5L 2ILLA 1J87A 4FQ2H 4QTIH 1MCJA 1S7WA 3AMKA 1ZPLA 5D7IB 1DBJH 1TZHB 3EJUA 2E59A 3BAXA 1SXCA 4QO1A 1M9SA 2CDFA 1B0IA 3MLRL 1QFOA 3MLPA 2D7PA 2D4FA 4W9DC 1OY3B 3CCHB 5E99L 3LMJH 4MXWL 1BQRA 3X2QB 4I1RA 1CFVL 4OJAA 3ZKNC 1BX2B 5C86A 3BLKA 4QHPA 4KRMB 4LLDA 5EZLB 5F7DB 1ACYH 3LNHA 4NSKB 2AXJA 2V37A 3NSFA 1MI5D 2CA3A 2QSVA 3SCMA 2AEIT 3W2DL 3MRKA 2FEDD 4HH9A 4JQIH 3RTQB 5B1KA 5K1NA 1DBKL 2HRPL 1LO4L 2CKBB 1RHHB 2ZUVA 4FGMA 3TTSA 4AYEC 1ZTXE 3UJTL 1FZJB 3BVTA 4EIZC 2YAEA 1MNUH 3PNRB 4Y5XA 3RE0A 3LZQA 1NFAA 3VACA 4G8IB 3DV6B 1QLRB 3MGTA 3SE8L 1JPSH 4PJBE 4DT2A 4Y9CA 1CFMA 2L7JA 4KZCA 3VO0A 4AI7A 3VRJA 4QHNB 1ZWIA 4ZOBA 4P07A 5CJBA 5IMOB 1N5YL 3P30H 1HHIA 2Z35B 3NGBC 5IREA 5JDSA 3OKKA 1L9PA 1LO2H 4LCWE 3PP4H 4Z0XB 2WLLA 4M5YH 4YAQA 3DTXB 3T0DA 4KI5F 1HHHA 4R8WH 4M29A 2MTAA 2CJTA 1OK8A 4H8PA 3BE1H 4W9LC 3UPRA 1ZTXH 4WFFE 5CUSL 4D9LL 2CR6A 1M53A 1NBZA 5I74C 5DK2A 3IJ9A 2CMRL 4FCHA 3G6AB 4NCC1 4UQAA 4PJCA 3BSZH 2NDFA 1N10A 5FO8A 4JM2B 1FV1B 2CM5A 4ANKA 1N4XH 5FYJE 4MTMA 2B1AH 3PE9A 5EUOF 5EZJA 1CCZA 4CVZB 4K7PX 3H1ZA 4TQHA 4PJFA 4IOIB 1DJHA 1ZPUA 1GRWA 3VFMB 2FT8A 4FYSA 1M05B 1YEEL 1U2HA 3TH3T 2NXZD 5EBLA 2VZVA 2F54D 4LGRB 2WLHA 3S35L 1A9BB 1F5WA 2NY7H 2YJQA 4UM9B 4P5MB 2R15A 5CHNB 2K9UA 4EMZA 5HVWA 1YNKH 2HKHH 4MJID 1R24B 5HYSB 4Y2DD 5FYJH 1BG9A 4L2YA 2AQSA 5T1MB 1LP9A 2A1WH 3I75B 2FQDA 4R26H 3VMPA 1YHPA 3ARSA 1EZVY 4LESA 4MJ2A 4PW3A 4LRNH 1N0XH 3BUYB 4LEOB 5CEZD 1BM7A 2VLME 2ADFL 1CDUA 4MHHI 4X5XA 3UTZB 5AG9A 5I0VA 1DQML 3IMTA 4JFED 2KUTA 2WK2A 3N0AA 1QBML 4W93A 5C70A 2ZCHL 4X6CF 2ZAGA 1DJIA 5AZ2L 3CSBA 1N8OE 1Z3GH 3G04A 4CBZA 2COVD 4YEFA 5HVFB 4F33A 2R4RL 2BMKB 2H6UA 3MCLL 4M43H 4MQXC 1HXYB 3K72A 3BIAX 3KJ4C 4FQXA 2LV4A 1JBJA 3GK8L 2DM4A 1DQTA 4N8CL 1BAFH 1DVSA 4WJ5A 1I31A 1J9SA 5DR5L 2VLRB 3WI9A 4JHWL 4QRFA 1R6VA 4FNSA 2NZ9D 4KV5F 1G1KA 4P2RB 4Z0BH 1N2RA 4ORGB 2XU9A 3FTZA 4GG8A 3FTSA 1OSYA 5GJSH 4Z3IA 1PG7X 1D5MA 2JB6A 2ICCA 3O0LA 3SBRA 3LXBA 2BCMA 1NCWL 1SLVA 2A77H 4ZZFA 3MX0B 4PBVC 5MI0B 3QNYA 4RFEA 5E8NB 1PPIA 2EDHA 4FRWA 3TVMD 4R2GD 5D5MF 2ZONA 5SWSB 2XKUA 3MNVB 1MWAH 1R5VB 1NFDA 4LASH 5DEGA 3C5ZC 1YEDB 43C9B 5AOKA 5ABDE 3UO8B 5D2NB 3G6JE 1MFUA 2XPGA 1N59A 3EYSL 4N2GA 4JO4L 1HSBA 1QEXA 1YEJH 2A38A 2QVFB 5IFHL 3MJ6A 4OM1H 2XWJB 2EEDA 3ARTA 1E5UI 1P5UA 3M7FB 1EJ6A 4PB0L 2DWYA 4W9JC 4X5LA 5F7LB 3T6QC 3H4FA 5ERWB 1EWHA 1I3RB 2BM3A 4EI5B 3NK3A 5EU6B 1LK3L 4M6OH 1RUPH 1A7RL 2CKNA 2H32B 3FUKA 4H25B 4WUKL 5IESL 1ZVSB 1GGTA 4JQXC 3WFBH 4L4VA 4L4TD 5IB5A 3OHXB 3QRFM 3LHPL 3PHQB 4GRLD 4YSQA 1H3GA 2QKIA 1KC5L 2ZOOA 1GC1C 4OZ4B 1P1ZB 4PS3A 5DRZB 1C1EL 2YPVL 1ADQA 4UNTA 4HUWA 2JELH 5ALBH 1E3XA 4WWKC 1H3UA 1UEMA 3C09B 1FAIH 1M7IB 3CZNA 4AYMC 1GZQA 3KCPA 2VITA 3ROLB 4J3OG 1TXKA 1TOXA 1BGXH 3FU8A 4WFEE 2HVKB 1L9SA 4G8GA 2XFGB 2W80C 2RH0A 4CC0A 2BSTB 3PJNA 2VE6B 1J5HA 2UY7B 5KSAC 2FCBA 1RJYA 1I7TB 4G5AA 2AABL 3SDDD 3X1GA 2R0LH 4ANWA 2WD0A 2H3KA 4YIQA 3CBKB 5EEXA 5AD0A 1RUKL 2ZJSL 2WBJC 1MHHB 2OP4L 3MLVH 4CNIB 4MA3A 2YXWA 4GRWB 1INDH 4G43B 4ZMOA 4NKOB 3P4NB 5EWIL 3SSGA 1PGRB 3BPLB 3O41B 2YRBA 3VGAC 1GW6A 4DKFH 3LKRB 4WWPA 2ZD0A 3A4AA 1E4WL 1YJDH 4M8VA 1G7HA 1SQMA 3RFRA 1GJIA 2E9WA 2RA1A 4KTDH 1RVFH 3DXAA 1N64L 4EZLA 1P7BA 1PKQE 1NIEA 5GRZA 5I5MA 4FN0A 4L8DA 2DKUA 1WZLA 2NY1B 2OPCA 3IGFA 4Z7QE 4NQEE 4RIRA 2ZX7A 2XV6B 3T2NL 5DQ9A 4UTCA 2JTYA 4DSYA 2HN7B 2VQTA 4MDIA 4KZEL 2AJVL 5EZPA 1KLFA 4WU5B 5I0DA 2WGNB 4XCYA 3RDTC 1J8KA 2E7MA 3GMLB 5T3ZD 2ERJB 1G7QB 2EDEA 3GSXA 4AQ1A 2VXUH 3WSQH 5MENE 4GSUA 5JQHC 1ZXQA 5ACZA 3VWKA 3HMXH 3GSVA 3NCYS 4UQIM 3BT0A 2BRQA 4PYHA 4DQAA 4UINL 1TYRA 2HXAA 3WIFB 1FL3A 1KEML 1FF5A 4L1DA 5GZOD 5IJDC 3LEVL 1W0WA 4PH8A 3H42L 2XG4A 4BINA 1EMTL 4DGWC 3TO4D 2VLLB 3H7LA 4NKDB 5D7LA 4FABH 3ATFA 3RY6A 3C6SA 4YNYA 4D0CA 4AK1A 1A7PL 1IZKA 1NGZB 4GNKB 5F8RC 1JWSA 5D1XA 4MJHA 4NRXA 5FS5A 1F6LL 4JQVA 4AQOA 1TZ8A 4EUPB 4ZMVA 4JKLA 2OMYB 3JT2A 4LSPH 5TF1L 2B2XL 3T8XA 4OJYA 2IV9A 3A23A 3B5TA 5CILL 2A4CA 4MYPA 1NCUA 4ONGL 4KUCD 4DO5A 2HMIC 5I24A 5F0PB 2OJEA 2RFXB 3QDJA 1QI3A 4MQSB 5DMKA 4O9HL 2EJ1A 3QYCA 1P6FA 1R3LB 1F56A 3NPSB 3MRPA 4UI2A 5T1LD 5INDA 2XIBA 1I8UA 5GGVL 1G0YR 4HU8A 4AGMA 3IGLA 4QMEA 3RILA 4NC2B 2OLDA 1BXXA 4XP4L 1SFDA 2R7EB 3VFPA 3QQ9D 5I6NA 2OX5B 1MJUL 1Q0XL 1OW0C 5GS0L