4AZ8B

Crystal structure of the complex of the caf1m:caf1 chaperone:subunit preassembly complex carrying the kdkdtn insertion at the f1g1 loop region
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
134
structure length
126
Chain Sequence
EPARITLTYKEGAPITINIDTELLVGTLTLGGYKTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Mechanism Controls Traffic in the Chaperone/Usher Pathway.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Chaperone/immune system
molecule keywords CHAPERONE PROTEIN CAF1M
total genus 25
structure length 126
sequence length 134
ec nomenclature
pdb deposition date 2012-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09255 Antig_Caf1 Caf1 Capsule antigen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4az8B00
4AYFB 3DSNB 1P5UB 1Z9SB 1P5VB 3DPBB 3DOSB 4B0MB 1P5UC 4AZ8B
chains in the Genus database with same CATH superfamily
3ZSSA 2GJ6A 1FGVH 1V54B 4M5TA 2YK1L 4WI2A 3I75A 3K5RA 3MLYL 4GBXD 1NWPA 3MV7E 2CH8A 4JM4H 3FUNA 4MKMA 4J12A 1BAFL 3CSYB 4EEEA 3O3UN 5F9AC 1DVFD 2K9UA 3QI9A 2BSEA 3WJMA 3SE6A 1A9BA 1B0GB 1XGPB 2EE0A 2Y23A 3LPWA 2CU9A 3FT3A 4PVNA 4U6TA 3QEQD 2H8PB 1GA2A 2W1NA 2Q1EA 3QG7L 2UWEE 5ILTL 1XF2A 4LL1A 2WLZA 4RFEB 4TS6A 4U1HB 4P5KA 2WSPA 3S35H 1NOFA 2C5DC 4HK3N 1GC1C 5E4EB 4ZFZB 1A8ZA 3G5YA 3MOBH 1KCRH 3UZEA 1TFPA 1KZYA 1Q8MA 1NCJA 5AYTA 4Z77B 1V8HA 2XX0A 4D0BB 2X2HA 1A7NL 2BY1A 3FQNA 4F27A 3TPUA 1D5XB 5LAXB 5BRZB 2IDCA 3EDJA 1VFBA 3G5VA 4NAQA 4PRAB 5B21A 3NFPB 3QJHB 1J1OL 5GGUB 1ORQB 3PV6B 4GG8A 4A7QA 2EEXA 2IOOA 1BD2E 3VGDA 2O30A 3LMJL 4LSQL 3C60A 5LGKA 4X2UA 3U6RB 4FXLA 2EDWA 1IGJA 3OG4B 5EBLB 2B59A 3CVBA 4JG5A 4NQSA 1OOAA 5BVPL 5K9OB 1AZNA 4JRYA 2ZOKA 4DUWA 5E8NA 3LCYA 1NC4A 3UABA 4YHOL 4Y2DC 7PCYA 2CLRA 1N0XH 4KROD 4NKDB 3RJOA 3BDXA 3R4RA 1MJ7H 5EOCH 3NRFA 2PO6D 2YN3A 5T5NF 3K3QA 5IBLC 3RWIA 3SBQA 3MCKA 3H6AA 1HEZA 3JTBA 3BAXA 3VTMA 1MZZA 5DRZA 3LH9A 3HG1B 2WLHA 3ZE1E 1KJVA 1LD9A 5ESQA 4RA0C 3T09A 1K5NA 3BI9X 3TVMC 4PRPE 1VFOA 4M8QB 1ZJAA 1HCZA 2CGRH 3PQYA 2ENPA 1FH2A 3LRSB 4JFPB 4P2RE 3LIZL 4KJWC 4HIEA 4AE0A 2EO7A 5HYSB 5KN5A 4FQCL 3VXTB 1BFOA 4Z3EA 3CN2A 5CGYD 1T1XA 3FT2A 4Y88A 3AG4B 1S5HB 4FP8L 4PJ7E 4JHBA 4MD5B 2BLFA 2MNJB 2Y1YA 1FZOA 3EUUA 4RMRA 2D3LA 5FUZH 3LNFA 1KCUH 1F58L 1PIFA 3ARBD 4JQXA 4YQXH 4PJBE 1DBBL 5CZRA 2XFXB 5DUPL 1NBQA 1U93B 4PJ5E 4O2EA 2Y3NA 3MREB 1WFNA 3B9KD 4JFFE 4N8UA 5KANG 1GAFL 3N0AA 2A6DA 4AYSA 2J1KA 3LVEA 3IU3B 1L3NA 2R29H 4B3VA 1EXHA 1G7HB 3ZYOA 5MERA 1QUNA 4GI8A 5GRWA 3T1FA 4MRCA 4PAZA 1MIMH 3BP5A 4WEMB 2X05A 4NLAA 2DL2A 1J0IA 1IEBB 2HAZA 3SOBL 3AAZB 4BZ2L 3T1WA 1A7OH 4J4PA 5KBLA 1VHPA 2AABH 4OQ1A 5FYJE 5C0RL 1QACA 5F7DA 4HQQL 3QUHA 3OMZA 4DKDC 4XN4A 1N8ZB 4GYBA 3MACL 1JDAA 1HH6B 3T77B 1QLEH 3GSVB 2BRRL 4HIIB 3SQBB 4I0PA 4RAUB 2VISA 3VGAC 1NCGA 3ZMEA 2GFBA 3SY0A 1NMAL 3RUGF 1PCSA 3UTTB 1SRDA 5J11C 3KM1A 4QHMB 3N1GC 5I24A 1L7IL 3RIKA 2J5LC 4X80H 2R23B 3UGEA 4YN3A 3REWB 1I8AA 5BMFH 2YD5A 5BS0B 5LWYH 4TXVB 2FNWA 5SX5H 4WW1B 1DQVA 3BGFC 3JUZA 4N0FB 1RH8A 1ZA6B 3DYMA 1TTRA 5CIPA 3AGVA 4ZPVA 2CDEA 2WZPA 2H26B 2ORBL 3AREA 4L4VA 5CFAA 4APQD 3S88L 3NA9H 2G2NA 5DD6B 4XBGB 3RTQA 1NIFA 5B4MC 3CDZB 4ATTA 1NUDA 2YQGA 1GYCA 1R1CA 2IH8A 3P11H 4Z7NF 4MJJA 5LUMA 4JG1L 2ZWNA 1KN2H 3ABGA 3GRBA 1HVXA 2X2IA 3QDMA 3S8GB 2CO7B 2HLAB 2QDWA 5EA0H 1UA6L 3VGHA 1NFDA 5BV7C 3QQ3B 1KTBA 2L7QA 4HIHB 4XGZB 4MB1A 2A9MH 2VXTH 1JF6A 4NQQA 2CKBL 3NCEB 5HTSA 1AS7A 2DEYX 4RRPA 4N0CC 3KD4A 4BFGA 3KBPA 5F6IB 3WN5B 1UG9A 1IBYA 3KYNB 1PLAA 3QNXB 2XDHA 2I9LA 2C7FA 4OD2B 1KJMB 5AKSA 2W9LA 3JUYA 2YRPA 4H1LB 4YNYA 1AD9A 4JB9H 4ANWA 5DXWA 5ADOH 4XPAH 5DT1L 3BGAA 5E6ID 3CFCL 1SYSA 3N1PC 3LQMA 4RIRA 4DGYL 2ZCHL 1OP4A 3PWUA 1TNMA 4Z5RA 1I8MB 4NUPA 4CW1A 5TQ0H 3U7YH 2APVA 1SOSA 2OULB 1UGKA 1MHEA 1Q9WA 2VDOL 2X1OA 2CKBH 3MGOA 5GGTA 4OZGB 1PEZA 1GIGH 3ISRA 4UOW1 3B2UC 5HGDB 3QXWA 4NQEA 1ETZA 2YHGA 1U2HA 3RX9A 3HG2A 4WDIA 4EI5A 1NCIA 2A9ML 5GXBB 5EG6C 1NC4D 4M6ML 2KPNA 5F3HA 1DVFC 5M94B 4U6XA 4Y5VA 4ZUVB 3LQZB 3H3BC 3F6JA 4K94H 4PS7A 5C0BE 1GRWA 3F04A 4WNSA 2B9BA 3QEHB 4PGDA 2VAJA 3JYBA 4Q0XL 4WW2C 1T7WA 4ZUWA 3N9GL 1GGUA 3OSKA 3LKQB 2BOBB 4GI9A 1THAA 1J86A 1SEBB 5KSUB 3JWNE 4HFUL 1AQMA 2OJZH 3IB4A 3QQDA 2F19L 4GBXA 4HS3A 2WY3B 3M88A 2NR6C 4GQZA 3IT8D 3BDYH 4U1JA 5CWSB 3VFGL 1AKJA 4ZOEA 3SJVB 4NPYB 1P1ZA 1OCOB 5KVMC 1AGEB 2IEPA 3ARDA 4HZ1A 5JIIA 4HYTB 4AEIL 5AOKA 2FEDC 5AW1B 4QXTA 3W56A 1RULL 5HJ3B 4KTDH 3GBEA 3APDA 1W6WA 4R8WH 3FUFA 3GXPA 3VFNB 3PCYA 4X6EB 5GJTL 1BXAA 3GXUB 4I9XA 1MW0A 3HI5H 3QPXL 3P4NA 1JZ8A 3QJXA 4JHWL 2QTVA 4WUUB 1XGRA 5TD4A 1MNUL 4MJ4A 5FA4B 4JM0A 4Q56A 1UD4A 4MASA 1ZGLA 4V1DA 1KIRB 2ED8A 4G6FB 4OLVL 5FWRA 3IJYA 2EUXA 2X3BA 1HI6B 3NSCA 1EO5A 3D0VB 1O6SA 4PJHB 3BEVB 1SJMA 4MMZC 1MCJA 2BNRE 5EDXA 2OMTB 4L1TA 5EO1A 3RPKA 3QEUA 4HS6B 2VL5B 1UXSA 4YFLF 1XAUA 4HUKB 3PU7A 2VRKA 4J39A 3BSZL 3OR7A 2PXYB 3V0DA 2ZWLT 1TVHA 4ZDHB 1O7DC 3MJ8B 3LNGA 1JNHA 3JVGC 4OCNC 1NIDA 3HMXH 2IFFL 2DQIH 2ADGB 2DQUH 1WCQA 3US9A 4BFOA 3CVIH 4JPVH 5HGBB 3T4AC 1QEWA 3H8NA 1AGBA 3VG9B 1D5IL 4I1RA 3W39A 1MCCA 4BFRA 4YDLB 2N1TE 2PPDA 4YGVB 3NG5A 1BEXA 1Q90A 3EDFA 2X9YA 5C08D 1U6AH 4JO1L 3E6FB 4JY4B 5DD1L 4C55A 2WWOA 3BKJH 4XO5A 2NCMA 3V7AE 1E4WL 2V3FA 2Y06L 1FPTH 5LWYL 1DDHB 4AIEA 5DRXA 2LTQB 4F1ZA 2XVLA 5JMRA 1V55B 5I75C 4IBSA 3M1OA 2AHIA 1M6OA 3NCJH 4M5YL 4EIBA 1R3HB 5IVXF 3CIQA 1C8QA 1CLZH 4NJAH 2XYBA 2IBZY 2ZF8A 2C3GA 5K69A 2A38A 3VFWA 3WU1A 1I9JL 4WUKL 5FYJU 4P23C 4JQVA 2RR3A 3LSOA 5ID0B 2X70A 1RJLA 1N8OE 2YSSB 1OCRB 2AABL 4LLUB 1J8SA 4MQXD 1MJ7L 3D34A 4G7QB 1JVLA 2WLLA 1YC8A 1COBA 3QZNA 1DO6A 1IBGL 4P2RA 4YHOH 3TO4A 1WC7B 2JQAA 2WUBH 2YC1B 4HWBH 3DHMA 4WFGE 4YJZL 1AE6L 1M71B 2PO6C 1HHJA 4I9WD 4N90D 2CBTA 4PG9B 2DRUA 4WK0B 1A7QL 4LPXA 1HCFX 5MENB 1R3LB 5CMAB 4FOMA 3BE1L 3T3ME 1B4JH 5AAMA 4K7FB 3VDBA 3PWPE 1YQVL 3P30L 4HPYH 4DGWC 4F7KA 1QPKA 4BWWA 1WZKA 5J6HA 2GJ6E 1OT1A 4X6CB 3IPFA 3QXVA 4IGBA 1YYMH 2CGZA 4KJYA 3BPOC 3MLVL 5C09B 3V4VH 1NGQH 5HHQB 4PYHA 4LARH 2DQFA 3UZQB 5AZ2H 3SKUD 4ELME 7TAAA 3E7JA 3QA3B 2ZSWB 3FC8A 3PJSA 4HC1A 5KYWB 1P5UA 2HFTA 2DBLH 3SY6A 2H6OA 3M17A 3HLKA 1L5GB 5I2IB 3ARZA 3L9YA 3LIZH 3HPJB 2NY0B 4NQUA 1KPRB 4PGCA 1IEHA 4OGXH 1UOWA 3VFTB 1GY1A 4Y16D 1JFHA 2DQDH 5B8CC 1UM5L 3KLAB 1XCTA 2CO1A 5ERWA 1GW0A 4QTIH 2H32A 1KGIA 3IU4L 4RMUA 2C34A 1BZ9B 1E3ZA 1P4IH 2X1QA 1PZSA 2V3EA 1YC7A 3LZRA 4Y9EA 2EVIA 1JPGA 2HUHA 5GS0L 3NH7H 3LV3A 5LGYA 1LEKA 1N3NA 2Y6SD 3KNBA 1MREL 4TL5A 2CQVA 4HJ0C 1MAJA 1G0YR 4E9SA 2PCYA 3B37A 1IB5A 3TO2A 5IW6A 1BQ5A 2HRPH 2BRQA 1BF2A 3N1MC 5G2NA 5DQJB 3QEQB 1ACYH 3RFRA 1LP9B 4YK4C 5F7HA 2ITCA 1IAII 1IQDA 2WAQA 3CDGA 3ECBA 3OWEA 4I2XE 4DP1X 4ZFZA 3TV3L 4LOUC 3D85A 4B5EA 4URKA 1J9RA 1CK0H 1AXTL 3HG0A 2XX1A 3TV8A 1JGLL 2BHZA 4AL8L 5L8LB 4NS0A 3T5WA 2C9SA 2PP8A 3DX8B 2LT9A 2YRZA 3NEEA 3C6LD 2FX9H 3NUKA 4XN5A 4K8RH 4QO1A 3SODB 5EPMA 1YPZF 4IRSA 1MJUL 4O02L 4O58H 4B0MM 3RIFK 4JS7A 3VXOB 5SWQB 1WBYA 1WG3A 1PIGA 4PLNC 5GGRB 1ACXA 1K6QH 3FU7B 3WS6A 1GHFL 4YWGL 5BPPA 2FR4B 3T0BA 4B60A 1AC6A 3WFBL 3UACA 1HNYA 1MFEL 3MBEA 4W6WB 4Q6IC 4JGUA 4JRYB 3LB6C 4JL1A 5DEJA 4OKDA 5J89A 3QJRB 2APXA 4FG4A 3OQRA 4ZPTA 3MRHB 3BWAB 4QY8A 2Z35A 4ZBJA 4ZXBD 3RZCD 1M7IB 4QAWA 4AMXA 4YHML 2UY7A 3UPCA 1OB1B 4BKSC 5I5IA 4B9CA 1R0AL 2XA8H 4NQED 3N85H 1TIUA 4PSRA 4JM4L 2R4RH 3BFWA 1OALA 3FF8A 4NM4H 1U8KB 5FW6A 5C97A 5I0DA 4MLSA 3H9SB 5JOPE 4B0MB 2EUZA 4HV8B 1FE8H 2XG4B 1K8DA 4QAMB 4AK2A 2EKSB 4CMHC 1MFUA 2PTUA 3MRLB 4IOIA 1ET8A 4FGMA 2LTQC 5J13C 3GB7A 3FPXA 1BFOB 1EGJH 4LAQH 1I9IL 5K1NA 1WEJL 1MAML 3BWZA 1EANA 3QIUC 1MRFH 3RUGE 3BH9B 3O2VL 3B7YA 3BMWA 2CM6A 5I5MA 1TVBB 3K1DA 4FLHA 1JL8A 1ZT4A 3NZ8B 5A43C 5LDUA 5KYYA 1BGXH 2NT1A 3M86A 1IU1A 4UV7H 4XBEL 3KMDA 2WQSA 1Y0LA 4O02A 2VQ4A 5LN4A 2BJMH 4YAQA 1JHKH 1WA2X 2RAMA 3NP3A 2CO4A 5D2LE 3ZE0B 1VEMA 5CEYB 1GHFH 1XBRA 3ZL1A 1LEGB 3KEHA 2VMCA 3ZYIA 5AVRB 3V5HB 1ORSA 5FFGA 4DOHE 1KJ3H 4OFYD 4ODXB 4F2MB 1YEHH 1PQZA 1IC1A 2ITDB 3P2BA 4CL7A 3NFNB 4HWZB 1JGDB 1PSKL 2GAZA 5F7DB 5A6IA 1JV5B 1QBAA 1TLKA 2AVGA 3A22A 4I3SL 5D7LB 4AZUA 3QXAB 1D2PA 4LKXB 4G72B 1JGLH 5I1GL 3EBIA 3ETTA 3PFQA 5FEBA 2RA1A 1J0YA 3C8HA 1UD6A 2CCVA 4Y5XA 4PP1D 3BKMH 3EYFB 3CGTA 1I1CA 1NMCB 4OZIE 3RWCB 1IGFH 5FCUH 2K3TA 4F8QA 4WW1A 4JBSA 3C09C 3MLTA 4HKJA 3ARDC 1USZA 4IK6A 1CFVL 1GVIA 3DUSB 3PS6A 4PR5A 5B1JC 4TUOA 5EU5B 4D7PA 3VRIA 4JR9H 5AALA 1VGKA 1YN6B 5A40E 2J6EH 1MCDA 1TDQA 3QXDB 4H8PA 5E6YA 3RTQB 4ZQKA 4EVNA 2EDTA 3NJIA 4BD4A 5FUOL 2RJMA 4Z0BL 2X1XR 4XC1L 1NC2D 4HJGA 3PABB 1MH5A 4KAQH 4Y5XC 4G2AA 5BZWA 3LY6A 4RISL 4ABVA 3WUWG 1N59A 2ZKXA 1H3VA 3DSNA 1CGSL 2HLAA 3KE0A 4FQHB 3LHPL 3O9WC 3N91A 4ENED 4KH2A 3GTTA 5DVMA 3RAJL 3MFFA 1R33A 2CJTA 1CJYA 2IAAC 4HFWA 3U0TB 1CLYL 4ZI8A 5SX4H 2OQJA 5K39A 4KJPD 4HH9A 3ZIYA 4EAEA 1RZ8B 3EH2A 1RUMH 1ZVHA 4FFYA 2A6KB 4UAOB 4JFHD 1KWGA 3CFDA 5T5FH 4IKLA 4WWPA 4XZ4A 3QNXA 3VWKD 2Y22A 4KC3B 4NKIL 3QZLA 4PJDE 2OMUB 1XGUA 2Z31C 3T4AA 1IC0A 1FNSL 2IH1B 3KPLA 1RJYB 1HZHL 3FUEA 5JXED 4H8QA 4M4RA 4BCZA 4NHUB 2JQMA 4LCUA 3I6GB 2QKSA 1HNFA 4H8VA 3F7PC 4Z0XA 4LVOC 2GK0A 4IOSA 5C6WH 1C12A 1T7VA 2G30A 4QCIB 4U1MB 3T4YB 4CW1B 2VLME 1DUZA 1PLCA 1W16A 2WWKT 1TJIH 4L8SB 5AOZA 2EIEA 4HUMB 1AZBA 1DN0B 2DD8L 5E5MB 2H1PL 1IAOA 4LCWD 4ZAKC 3ZKNC 3DX6A 5CJXA 4WUKH 3VM7A 1I3GL 3LQZA 2QSQA 3MJWA 4U33A 4ZW7A 15C8L 3PWPA 3V4PA 5M95B 1XFPA 2YPVA 1CLZL 4NJAL 3SDYL 3QRBA 5EO9B 5KG9A 4NCC2 2DB8A 4MQSB 3RL2A 3W82A 3L8QA 1UWYA 3MRFA 2WKLA 2XNAA 1EO8H 2Y1VA 5D4JA 1OLZA 2BDNL 3BKJL 3NP4A 1E6JL 3U6XS 4BZ1L 1A1OA 1J18A 3C5XA 2ADJB 4ZXBB 4JFVA 4PLOB 1S7XB 4LOVA 4QRPE 3S37L 1NM4A 5AW9B 4X4XB 3O4LD 2BNQB 5JYLA 1HQRB 2DQIL 2VUKA 3L3GB 3SDAC 3VQ1C 1JRHI 4Z7QB 1T5XA 3MRPA 1RFDH 1VRSA 4PVMA 4XWGL 1QNIA 3L1EA 2NMSA 4AGNA 1NBVL 3KL0A 3S2AA 2X53A 3FQRB 4OT1H 2ZKYA 3KLHC 1E8XA 3KYMA 4KZ0A 5I6LA 4Q52A 1WLHA 4FABL 4WV1C 1FN4A 2YOCA 4R26H 5AW4B 1E40A 4V1DB 4TRPH 1LL1A 2ERJB 4CU8A 4JN1L 1FFOA 4TQEL 1SF3A 3FN3A 5BRZA 5LAXA 3IRPX 5I9QB 5HYEA 4OZFA 3D2TA 3D0VA 5EBMA 5DHXB 4LGPB 4MBRA 5I0YA 2X4UB 2HJLA 3R1GL 4NRZB 2BM3A 2V3DA 3AXIA 5GJSH 3MKKA 4LU5L 5L0QB 4Z7WF 4XAKD 5CEZL 4OH2A 5GJTH 4RETB 3EH4B 3B5TA 4ALAL 5B39G 2J44A 3OR7B 3S5LA 1BOGB 4DETA 1M57B 3GBNL 2YMXH 4UB0L 3THML 4RNRB 3RDTC 4BK8A 5EOCJ 5ICXB 4K7PH 4U1NA 1OEZW 2I26N 4NKOB 3UJIL 1HZLA 5DI8B 5GZOA 3P77B 1UWXK 1AACA 4NM8L 4ZNEA 1NIEA 3L4CA 4PRPB 1SDYA 3C87A 4DN4L 3WDHA 4MCMA 4D2NA 2AJYL 3TT1L 2EIBA 3V5DA 3AFLA 5H37H 4BZ1A 3ETSA 2UXFA 1KCBA 1ZY9A 4DKFH 4JPIB 4KK6D 4XVJH 2WBJD 2QEJA 3VXSE 1M05A 4B95C 1E5CA 1XSOA 5IQ9B 3H2WA 4JFDA 4HXBH 4BH8A 1H6FA 1KJ2H 5H2BB 1T0OA 2KYIA 2D31A 5F96L 2FT6A 5I1AB 2COVD 2P8PB 1G87A 3G5WA 4M7LT 2F2HA 1BQHG 2PCPB 4QMEA 3AGWA 4GT7A 2OMZB 4PJBB 2CHDA 4XP5L 3VXTA 4DKFL 3QPQC 1Q72H 2C1PA 2VDNH 2OYPA 4GMSL 4MXQC 2Q8BL 3UJJL 4PRHA 3UJTH 5IW3A 1J88A 4EI6A 3MNMA 4DN4H 3GZPA 3TBVA 1IE4A 2ARJQ 3MRRB 3P9LB 4HULB 2YC1A 4E9QA 4K7PY 4XODA 1U93A 2DM4A 4MRBA 4ELMA 4DUVA 4PG9A 4AJVA 2QQLL 4X8JA 2IALB 2NQCA 1NFKA 1V7NL 3VFMA 5C7XL 1D5RA 1O7SA 1Y07A 4N2OA 4Y16C 4N0UB 2XPGB 3MLUH 2AGJL 2OMNA 4JO3L 4S2SA 3SDAD 1T0NA 2A83A 2IANA 3IAQA 3QWOB 3S35X 3FUMA 3QUKB 5C09A 2E56A 3WY4A 1OF0A 4CNIB 3QXUA 3BQUB 2X12A 3ZZSA 4AQZA 3O3AA 2Y0SA 4WK2B 2X88A 1QFWI 4OTXL 5FOJA 4P9HC 1MRCL 5D2LA 5ID1B 1OTUC 2Z34A 4YR6A 1PDKA 3RWDB 4AIZB 2E7HA 4OVVA 2EDQA 3CH1A 3N40P 4FQXD 2BS71 3M17B 3KW7A 5EOQH 2R1XB 5I2IA 1EEZA 4QJ4B 1KCWA 2GK2A 3AQDA 3K6DA 2F8XC 3CZFB 3W9EA 5D7HA 2OP4L 3FRPA 5KBMA 5AZEH 2QLVB 3NPZB 4NNPL 1NPJA 1RFDL 2C1OA 5CJQL 2DIAA 1VA9A 4X5WB 3EUDA 5BW7A 5DVPA 2KC0A 2H0JA 2IADA 4EOWL 5DJZB 4CC1A 3V6ZB 1YNLL 2UXGA 1F2QA 3ATFA 5D2NE 1N4XL 1N7MH 4KRNA 3NZUA 4OUOA 4N85A 1D6VL 1G1YA 1FVCB 3CJJA 5CBAB 5AAPA 1K85A 1LO3L 5J11B 5KVFH 3GMRB 2Q6WA 2BSSA 3CVDA 3H54A 5FWQA 3SDYH 1MOEA 3C2AL 2V8LA 4IK7A 1UWGL 4PJ5A 1NUFA 4QD2E 4GAAA 3E8UL 1U2YA 4PI2A 4QRSA 2EAEA 2WTRA 2R1WB 1ZLVK 4HUNB 1KTDA 1BLNB 3V0GA 2DD8H 2YPKB 1AIZA 5T1KB 4GUOA 5EPMB 2GT9B 2WLMA 3KPNB 4XP1H 2UVEA 2PCXA 5D4HA 3V6OE 3IMTA 1MIML 4LEBA 2MCPH 5GIRA 1WQVT 2W9EL 4MCYB 4OLEA 1DBKH 2FJFB 2P8MA 3FU7A 1S3RA 3GQFA 2B5IC 4PJ6A 3IE4A 3G9AB 3LZLA 1ZLSL 3QIUB 4XPBH 2O61A 1OANA 4GFTB 4ZTOH 3MUJA 3I85A 4HPHA 5GGVH 3O8XD 2O6PA 4HOZA 5C0ND 1CFNA 2YPVH 1DBJH 3OMAB 1AIFA 3H3PH 4AG4L 5F88A 1M7IA 3F5WB 4LFHD 2XICA 4W4NA 4NRYA 3EDEA 4N25A 3HHSB 1DZ0A 2J1YA 1Q9WB 1I7UA 3QR1A 1QBLL 1QRKA 1CFSA 1U3YA 1UQSA 1WV7T 1LO4H 5EORH 1CLYH 3H55A 4PV8A 4C57C 3ZKXB 5JPMA 2VJXA 4U6XB 4PBXA 2EVHA 1JK9B 2O5ZH 3K6OA 3PHOB 5F6IC 1K8DB 1YMME 3TJEH 3W2DH 4YHZH 2E59A 3LKOA 1KFAH 5TE6H 1OOWA 1N10A 2EH8L 2MHAA 5BO1L 3V4VA 3GSRB 4GKLA 1FA4A 3PGCB 3OLEA 3MV7D 3AQZA 4XH2B 3LKQA 3DIDA 1DSYA 3OKLB 5AG8A 4Y5YC 5JXEC 4BWUA 4WTQA 2E9IA 3GSUA 3EKCA 5CILL 3L95B 4OLUH 5EEYA 5D96C 1RZKH 2V37A 4WI6A 5T5FA 1KSRA 2Y1AA 3FB5B 2IG2L 3CD4A 3GMQA 4G3YL 5CWSA 2MTPA 1HE8A 3HUJA 3RA7L 2WXGA 4B96A 1WAAE 5AOMA 1TMCB 5BZXA 4CGUB 1LNUB 1XGZA 2IVFC 3D39E 3U6XA 1RL1A 1SBSH 5ICZB 3FFDA 4KY2A 2WO4A 4HJJL 4XNUH 1XF2B 4NRXB 4X6EA 2A73A 1TZHB 5CJXC 1LE5B 4O2CB 3P4NB 4PWGA 3NAAL 2YD6A 2QHRL 5E2UL 2YAOA 2K6YA 3BZDA 2F08A 2ZX9A 1SQMA 5HDQL 2HH0L 2AW2A 2UZIL 4MS6A 4OF5A 3K72B 3QXAA 4D0BA 3DECA 3IJYB 5D72H 4D0CA 4M9OA 4KK5C 4EZJA 1VFBB 2HJFB 1X4ZA 3B1UA 3PDOB 1SHSA 4KV5E 4ES9A 4IBVA 1E8YA 4EZKA 5DZVA 5DZOA 3PL6D 4FTVA 4JGMA 1DLFH 4XB8A 1I8LC 4HHAB 3IDGA 1JHKL 3Q8BA 3QG7H 1IGJB 1S3KL 3V6FA 3MJ8A 4NQSB 4MNGE 3SYPA 1C8PA 4TUOB 1N0LA 3GRWH 4QUOA 1VGKB 3QXDA 3FB6B 5KSBF 4UUJB 1XMEB 2QGCA 2ZXCA 4IGBD 1W72H 4XCNB 2CLRB 2OZNA 1KIUB 3WO4B 3LS5L 4GSRA 2W92A 1SLWA 4UNIA 5HVHC 4U2YA 3ARVA 3O2DL 3KPSB 2FSDA 5D1QA 1V5JA 3SKMB 5BZWB 3MLSH 4IKIA 1UXWA 3FSZA 3TBTB 3C6SA 3NIDB 2JH2A 1SZNA 2OJ1A 2M8XA 5ALBH 2DJMA 4ZNEE 1F2XK 4HF5H 1U8HB 2P5WD 1EO7A 3UOAB 5EO0A 4JKKA 4XTRD 3PQYB 2CIKA 1F3DH 1T83C 4XMKL 2AV7A 2FB4H 5JHBA 1OAZL 2AK4A 1TQBC 2R4RL 2FWOB 4ERSH 4G11A 1HXYB 4YXKL 3HW7A 3LDBB 4M8VA 1C5DA 4F58H 3B2DC 4JY6A 4RDQF 4NIYE 3IFLL 1EFXB 2PR4L 5A16A 1XR8B 4DW2H 2AQQA 1T20A 1IBZA 4JX0A 1HHJB 3WFBH 4J3OH 5EFIB 2DWDB 4FZEH 3MO1A 5JW5B 2WLIB 5IR1B 3GKZA 4QRPD 3GSNH 3ZDXE 1MRDL 1HL5A 2Y24A 4HG4K 3DWTA 3FO2B 3IMWA 3SO5A 3TX4A 5IUSA 4L3FA 3TT3H 1EZSA 2V5YA 3Q2WA 2WXOA 2VJ8A 4N8CL 2YFNA 5KVGL 1UM4H 3BKYH 3DJ9A 3FUIA 3ZJAA 2YUZA 4B5ZA 3WEXA 4ZD3H 3OJ2C 1E28A 2Y36H 1LQSR 5F7FA 3UAJC 3KJ4C 3JTTA 4DPRA 1KEGH 2B4CC 1DFBL 1WGVA 2VDMH 4KQ4L 1B6UA 1CK0L 2NYZA 3JTSA 3UC0H 2FGZA 1BECA 1NA8A 2WAHA 4ENZA 3EOYG 1WCBB 1HH6A 2VJ0A 3UFIA 3HPJA 1OP3K 1M1XA 1KPRA 3ABZA 4JDTH 2HTLD 1JF1A 2GFBB 1JIBA 4X8XA 1ZLWH 5LQBL 2RCSH 3TPKA 1QWHA 1NDMA 1JGVH 2R4SH 3WTWA 4E2OA 5D1ZI 3AM8C 2J55A 4TULH 1A3RH 5EIIA 2GUYA 2ZOTA 1RZ7L 5BRZE 3O41B 4PWKA 1ZK9A 3MUGA 4LBEB 2OW6A 4JMNA 4LVHC 5EZPA 5JOFB 4GXUM 2CDEB 4I2XB 3LEVH 3A6OA 2EQDA 4XBGA 3MRPB 4TTDD 4K94C 1CN4A 4R0LC 1H3PL 5I26A 3IN2A 4NQXB 1UKSA 5L0QC 1S7RB 3QIBD 1JZ5A 2QR0A 1U0QA 4ZFOB 2XTJB 1KGCE 5I17A 2WCGA 4B9PA 2JCWA 2FIRT 3EHBD 4PJ8C 3OR6B 5TE4H 3DUHA 4TSCH 5AZ2L 1NFDB 2X4OA 5D71L 1KELH 3EXJA 1MHHA 2CDFA 2VE6A 2IXQB 5LG1A 5G4OA 3TH4T 2XXMB 4PY7A 3R7RA 3HB3C 2AKRA 3ERXA 3NGBC 1C08B 4P46C 1OGAB 3KR3H 2BSCA 3FCTA 1A3ZA 5H35A 3VXSA 2VZUA 4K9JA 4YNYB 3NMEA 4QGYA 2XPYA 4I3RL 3MBEB 5CIPH 4U1KB 2ZUSA 4NO3B 1S7VA 2XN0A 4NWTL 5D6DC 1X4XA 2FLBT 5D8JL 4BUGA 4ORGB 4PGBB 3TASA 2HFGL 1D5ZA 3MRGA 3MRNA 4LSTL 4IBQA 1JPST 4I85A 2VWEC 2EIMB 1OB1A 1OARL 3LQAL 5TH2A 1QYGH 4LKCA 1RY7B 3CZJA 4L29B 2EVFA 2Z9TA 5I73C 1DANT 4WW2A 1F5WA 3ES6B 5CSZA 5IROA 1I9JH 3VFVB 1AMXA 5IHLB 3IETA 4HZLB 5LB1A 4MA3A 3NACL 2P8PA 2DMBA 2OMBA 5EB9A 1ID5I 4JGNA 1CT8B 2J7LA 3HMWL 2WC7A 4ANXA 4HG4J 3KXFA 2WQWA 3H9HA 1K2DB 3KDMB 1NUNB 3V5KB 5KJRL 3R18A 4Z76A 1IARB 1ZS8A 4PP2A 5I6MA 1X7SA 4GKNB 4GBXB 4C8XA 1DLHB 5CZKA 2VXVL 3TURA 1BCIA 3TYFB 2X1WL 2VSCA 5F7EH 2V9UA 1TJGL 2VN6A 4YIQA 3VFSB 4KKZA 2OXGB 4GIAA 1SN5A 3UL4A 3S8WA 5L9DH 4OCXH 5DFTA 1Y0LB 4NSKA 4J5VA 1I75A 4NQVA 2ZPKH 4XPHL 5HHVL 4PRDB 4Y4FD 1GS7A 1X5AA 4XXWA 3BN9D 1AI1L 1KMGA 1YO4A 1A4JB 4MJHA 3OXRB 4AJ0A 1PCXA 4UNUA 3HI1B 1OF2B 3L9RB 3HUJE 5I76B 3B1TA 3ILDA 4AC2A 1DBAH 3NIGB 3ARFA 2ZUUA 3VD1A 4DTGH 3VH8A 4C54A 4WEEA 1TETL 1AOZA 2EYSB 1ACCA 1PLGH 1ZE3H 3RWDA 2NX5D 4BKLB 3DX9B 5D7LA 3LEYL 1IEAB 3CH1B 3KJ6H 4K2UH 2R2BA 4YSUA 3HN5A 2HT4C 1A4AA 2Y2YA 2I7SA 3PL6A 1FNFA 1Y6MR 2W0FB 3ARWA 4IIQA 3EYUH 2FT8A 2G9KA 3Q2LA 1A6WL 2OTWB 3FRPB 2XV3A 1MPAH 2R0ZL 1P7KB 1UEMA 1OM3H 4KTDL 3HZMB 2YO3A 5DMKB 4G8GB 1KIPA 1S7WA 4PJ9A 1LO2H 3HZ3A 5L88L 3UO1L 4TNFA 4KZCA 3DVGA 2X4TA 3LRMA 2GG1A 5E08L 3SO3C 4IQHA 3FO9A 4Y19A 1S8DB 4JM2B 2P5EB 3HNSH 3VI4F 1J5OH 2YD3A 1EVUA 3PL6C 3BIKB 5IFHL 2EVGA 1JMZA 2G5BB 4GG6A 4HJUA 4OAWA 2ZJSH 1ZHNB 4HCGA 4HAFA 4LVHB 4IDJH 2NQ3A 4HXAL 3N2JA 1PYWB 2J12B 3U2SB 1WBZB 5D6CA 1IFHL 4XMZA 2H2SC 3LVTA 4LAJH 4NNYA 5FCSH 1S9WB 4LP5A 2C3VB 1BLNA 3MOQA 2BZDA 3UG4A 2D4FA 3H53A 2A6KA 4B9GA 3EOAA 1FG2B 5HYQA 3SBWC 3AUWB 3BLBA 4G6AC 1HHHA 3P9WB 2DMKA 4PYGA 1SDDB 1Z32X 3UIYA 1S78D 3WKQA 1UJ3C 2GW5A 4J8RB 3J2PA 3KPMA 1NGXB 2AK4E 4LPVA 4ZMLA 3HNVH 1CGUA 2CUMA 2VR5A 2VSKB 1D7CA 1I7RB 4PV1C 1A2YA 1C5CL 2VXQA 3SOTA 4GXVL 1IX2A 2AQPA 3MV9B 4HAGA 2YPLD 3EW3B 2HRHA 4KFZC 2XTLA 4QDGA 3O9WB 1KFGA 4JFFD 4G9FD 4Z0XB 1RAMA 4P46B 3ISWA 1YEKL 3LZPA 3HHSA 3S3PA 5L4MA 5T3XL 1HQ4A 4OD3L 1NC2A 1DEEB 4G6FD 3HN3A 3QDGE 4UWQB 4EN3A 2JWYA 1F97A 3VMOA 3QCTL 4MD0B 4HIXH 5DUBA 3NOIA 3S4SG 3PHOA 4I3GA 2AFNA 3W11C 3F3HA 4YSAA 4XMPH 2PR9A 4E5XG 1KN2L 2APBA 4CJ1A 3RPBA 2Y6SC 3IBOA 2JJTA 4E9RA 3U1SH 4CSPA 4P3WA 1CPUA 4HLZH 5F7MC 3ZE2B 4ANUA 5IEKB 5F9DC 3ZU8A 1TZOA 4J2XA 5ERWB 5IVOA 3N04A 4HMEA 4RMBA 1UZ6E 4MHHI 4PRID 2P7TB 3EYQC 3CHRA 4TTDC 3DIVA 2ORBH 4PJXB 3LV3B 4CADB 2ZOLB 3EDKA 3FAWA 3RWGB 3TCLA 5C6TH 3GKWL 4LVOB 2SODB 3L3GA 5F9WC 2NY6B 1OPOA 1JGEA 4CUCA 2Q9OA 3BPLB 4AXWB 3KL3A 1MHCA 4GRWF 5EOTA 2DF3A 5FO2A 3TNMB 4MD4B 4S0HA 3QI9C 5F6HI 5A6MA 1Q1PA 3HR6A 2X6AA 1VGEH 3G6JE 2XRAH 4TQPA 4Y2OA 2Y07H 2R69L 2ADIB 1MKFA 5DO2C 1CUOA 1WPCA 2BRRH 5I1HH 4HVBA 1IVTA 4IMLB 1CQKA 4W6XB 2BSRA 2JKLA 3E0GA 2BC4A 3B9VA 4L0YA 3D0LB 3GIZL 3FHQA 2J71A 1DVZA 2RBLA 1L6XA 1AXSA 3K72A 1KEML 4I1PA 1CI5A 2ZP8A 4YEEA 4JUSA 5EU4B 4AQAB 2X10A 3ZTNH 1QA9A 5AKTA 4J3OC 4E41D 4D94A 1AR1B 4M62H 3OC8A 1OAUL 3P2DA 3TO4C 3ZHNA 4EBQL 1KXTB 3P0YH 4WU5B 4ZRGA 5HHXH 3O2WH 1KPUB 3KPRB 2EINB 2DLTA 2CHXA 4BH7A 1UFUA 3D4CA 4A63A 5IVNA 3GBLA 2OCJA 3FRPG 2WGXA 4PRNA 3HNTL 5CHNB 3PGFL 1U8PB 3QO0A 4KNSA 5BRPA 3FT4A 1XH0A 4LSDA 4M56A 4XXDB 1NPUA 4XCNA 4YZFF 1PZUB 1WUNT 2QMKA 1SXNA 4DP9X 5IWLC 4TSAL 2ZUQB 2XWDA 1CZ8L 1S9YA 2NZ1A 3GMNB 4TUKH 1OE1A 3PWLB 4OJFH 3ZT7A 1KNOA 2XJKA 3PUUA 3K6FA 4NUJB 4JPIA 1E3XA 1YDPA 2YXVA 1HH9A 2L7JA 3BSHA 1YEIL 1WD9A 1G7IB 5C0FA 4JO2L 4H26B 3BCDA 3TN0A 5FECB 2D31B 3B5HA 2XG4A 4M93C 1GOGA 1QQDB 3NZHH 5CU5A 3KL5A 5E8EB 1TCRB 2QPDB 1DJWA 3K1KC 4KNTA 4PV9A 3QRGH 4PVBA 5IFAH 1GXEA 5IB4B 1LDPL 1BM3L 4JLRB 1YY9D 4PRHB 1T2QH 2E0PA 2A9DA 1ROWA 2W91A 1DQJB 3UBFA 4ZMNA 3GSOA 1Z3GL 4PRIE 2ZSVB 2O5NA 1U8MB 2VT0A 2L7EA 2GBAA 3B56A 3VE0A 1ZT4B 3AWEA 4UBDC 1P7HL 4O9HH 3SDCA 4LZKA 1EJOH 5EFIA 3MO1B 3SPCA 4WRLA 2ZG1A 4P2CG 3CPLB 3HAEB 1QASA 1LLAA 3E1ZA 3EGDA 3UGUA 2PXYC 4V33A 5DD5H 5A2LH 2XPGA 1L9OA 5EZJB 4EUPG 4MCNA 4OFDA 1YYCA 1QFWH 3EIFA 3GSWB 1OT2A 1QI5A 2WD0A 3GWJA 4CVZA 5K5YA 2CDGA 4B3EA 4CNIA 3BQUA 3QQ9D 2KUTA 3FCGA 3QORD 4UQ3B 4BFNA 1JV5A 2CE6A 3OGCA 4JFUA 3FUKA 2Q3ZA 2H3NB 5B1KA 2MNUA 4JHVA 4KK6C 2VN7A 4X6FB 4ZSOE 2W95A 3MJ9L 1PTZA 2H45A 4LCYB 1KBGL 4XNDA 1EAPB 4KXZI 1OP3H 4J1UA 3TONA 1ZLWK 3UG5A 3VXUE 3SBPA 5FHAL 1EERB 5DFVC 1R47A 3IWUA 4X5WA 2J8UB 4XO9A 4UTAH 4MDJB 4M7JL 5LAPA 1VSCA 1GZQA 2PTVA 3MC0A 3QQ4A 4FQ1L 4WFFD 4S1DD 4P5TC 5EU5A 4NLHA 4W9KC 4FNRA 3QNFA 3CFTA 1XTLA 3P69A 4NZRL 3L3KB 4MMYA 2XETA 1NLBH 4P3CH 5I75B 4YDIL 1T03H 3BKCL 3K80A 1KYDA 4FFYH 1FDLH 3EHBC 4PJ8D 4TYUA 3TIDA 3VFPB 3QUYC 3G5ZB 3ZDYF 4DP7X 2VWEE 1TTCA 4JRXB 4F7EB 4N2EA 4G6KH 4IRJB 1S7RA 1ONQA 1PZ2A 3EYOA 3NGBB 3GMRA 5I0ZA 4W68A 2WP3O 1FNAA 1WZLA 3M1CA 3VX0A 2EP6A 5I66A 1A7RH 2EH7H 1KZQA 1MLBB 2ZICA 5I5JA 2NDGA 3MZGB 5HDRA 3VXMA 3TU6A 4A38A 1A65A 2FD6L 3VDCA 3D4ZA 1QMUA 2FHFA 1ZLUK 2HKAA 1U41A 2PO6B 3VI3A 2YPKA 1MCQA 4LMQE 1RZ8A 1G6RH 1D2OA 2P48B 3IJSA 5CGMA 2HX9A 3WAKA 3GEWB 1T7YA 2BVEA 2HLEB 5FV2A 1KBPA 3LN4A 1A5FH 1DANU 2EE3A 3BPCB 5HPMA 1CYGA 4LHJB 1QRNB 4PJGF 5F0MB 1JPTH 4CAGA 4ZUSA 2OJEA 4XHJD 4FNSA 5ALCH 5CD3B 1N64H 2J57A 3KM2A 4AW4A 4PW4A 4HWBA 5G5DB 1MCWM 5FOBB 3CC1A 5IJKA 2P46B 2NLJA 3BUQA 4DZBB 4LP8A 1M7DB 1MCBA 3WY1A 4DKEL 3D25A 1IBHA 5GGQH 3HS9A 2ZXGA 2W65A 4XB3A 4L05A 4QCIA 1IGTB 1HIML 5C0BA 1PZDA 2ZYIA 5GRUH 5H94B 4L9LA 1PEWA 4PJBF 1BJ1H 2NXYB 3VB8A 1V3MA 2GCYA 3RL1A 2FIKB 4CN1A 3N55A 2WWMC 4QEGA 4QXGH 5KVEE 2ZUQC 1EHAA 4RAVB 1CT8A 4F1SA 1JZIA 5SWZB 4XNXH 1BZEA 2VDQL 3SPHA 4AUYA 3KXFB 1IZJA 3WDJA 2H5UA 5F44A 3OKLA 5F7NC 3CN3A 3C5ZC 4LCCB 1UJ3A 4GH7B 3X11A 2CUIA 3CNKA 3MNVA 4G42A 4MMXA 2J21A 1P0SE 5CN2A 4KOBA 3HFML 2B1HH 1A1OB 5DUMH 4MXWL 1E7UA 5PAZA 4M7KL 2XTJC 3O4LE 4NC1E 3LH2H 3WHXA 1AMYA 1FVDB 1F8TL 4AT6A 2WVTA 5BV7L 4D9LL 1NCBL 4XZUA 2WNXA 3E9TA 4Z7VE 2HFEB 1CD8A 1G1CA 2O4EA 4FN0A 1RIUH 3DMMB 2VSDA 3VTAA 3FFDB 2QBWA 4P9HH 2NY3C 1RUPH 2GTZB 1OZTG 2VR3A 3M1BA 5L7XH 2FATH 2X6UA 5JIPA 4OV6F 3SJVD 3WIIL 3VD3A 4AC4A 4NO2B 2A6JA 3TP4A 3H0TA 1EIBA 2FHCA 4X8GA 2GTWB 4KKPA 4XHQA 1KTRL 4LLYA 3GJFA 4YOKA 4HD5A 2ZF9A 2VN5A 2COQA 1TZ8A 1MFDL 3V79C 2YGOA 4WWKB 4E0RA 1JXGA 1TJHH 4I5BA 5JW4Q 1IM3B 3EJJX 1NSNL 3L5WB 3Q9PA 2F5AL 4FTVB 4EQ3A 4JQVC 5BUGA 4GRMA 1GGBL 4DAGL 2Q10A 1S5IH 5E8OA 4GUQA 1SHWA 1TT6A 5DSCA 5DRWA 1T6WA 2KLSA 1BVLB 4RH4A 3OJMB 4TN9A 5IHZA 2ILLA 4N2BA 1DSWA 1RMFH 5LBSA 1BJ1J 5B1BB 2NPLX 4FCHA 3NIDE 1GGIL 2VDRH 3IM1A 3PP3K 4AVHA 3K0WA 3U30B 1OO2A 3AC0A 3PP4L 4L4TE 4L3ED 4MNQB 3QDJA 4JW3A 2HKHH 1E5BA 4U1LA 4XMLH 4DZ8B 1ZTXH 3EDDA 3VU2A 5L8KB 1HHKB 1YNKH 4AMKL 4R5XA 1ASPA 5TDPA 2HG5B 4ZW5A 2OSWA 2YD9A 5BXFB 4Y1AE 5KBNC 1ZT7B 5T3ZH 3WO3B 3MBWA 3EZJB 4EIZC 4L1BA 3D39A 1QZ1A 2DWEA 4IIZA 1OAYH 2XWZA 5MENE 1NGPH 4XB7A 5IBTH 4I48A 3EOAB 1X9QA 1S4IA 3HVNA 4N2IA 3DPBB 2A0LD 4ZUTA 4KVPA 4U6VL 3WN5C 3GLEA 5AVUB 3TZVB 4ELKB 3K6IA 4PWJA 4FADA 4F8NA 2HMIC 5CINL 1LE9B 3CUPA 4YDJB 2GITA 1AS6A 1J9TA 5CLZA 4ELMB 5J5EA 1CL7L 5ANHA 2QSCL 4L2YA 5IB1B 1G5AA 3MJ6A 2DMHA 2FJHB 4X0NA 2WQXA 4ACTA 2VDNB 2MPAL 3VGGA 3SHSA 4P23D 4E41A 3FB7B 1PAMA 2UZYB 4QT5A 4UNVA 1DSFH 4XBMA 5FFOA 1E28B 4LEOA 3TCTA 1CDCA 3V0VB 2Z65C 3CQFA 4GRWH 3VQLA 4XCFH 5ACZB 1EXUA 5LCVA 4GAYB 3O3AB 3POCA 1A02N 5DGRA 4JFXA 4MJIA 3F84A 4U3HA 5A2AA 2CALA 3HB3B 3F83A 3MYJA 5CS7A 4PM1A 1KXQE 1UT1A 4JRWA 5GZNA 3WLBA 3BGFB 2W60B 1RPKA 1YY8B 4ZW6A 3C2SA 1AOHA 3QFJD 1ODUA 4C83B 5FV1L 4FLRA 3RWEB 3CK0L 1DUYA 5F1NB 3QEGL 2OLDA 2C1OB 1DJSA 1DQMH 4L8BA 4G1EA 3RX8A 1CE1H 1RKRA 2ZWZA 2OV0A 2AJVL 3MUGB 3B2VH 3N1QC 4GO8A 4PJGA 5HY9B 3RWGA 2F5BL 1L0YA 3TCLB 2IPKA 4YX2H 2Y1ZA 2I9TA 4MXVE 1ADWA 1SNRA 4Y4KA 5D5MA 3VGBA 5LGHH 5KW9L 3WDIA 3DMMC 1Q1JH 3QDGD 4PJ7B 3VNZA 4DGVL 1P7QB 4NQXA 2R56L 1HINH 5SX4I 3HPLB 4OI7A 3QORB 3SGDI 1TTBA 1WIUA 4R7NB 1WDAA 2R2HA 1OIOA 1KCVL 2YAEA 3ECWA 4NB7A 2CGYA 4KX9A 5EULV 2RQ8A 4MMZB 4OV5B 3O0RH 3D0LA 3QR0A 2HXAA 2WSKA 1EZVY 4QRSB 3QIBC 5EEUA 1OGAE 4TQIA 4A7VA 3MRBA 4H7VA 1FJ1A 4FYSA 1WWWX 4XCYB 5GRZA 5JXAH 1FNEB 1OW0C 3L5JA 4K23L 4N2MA 2GT9A 1X9RA 1PS3A 2P5WA 2Z91A 1ZHKB 4H4NA 3MNZB 2JQZA 3MBXL 5E94A 1JS4A 1NKRA 4WZ9A 3R0NA 1A0QL 43C9B 1IGYA 1VLXA 1JZGA 1OLLA 5AB2A 2EO9A 2XWEA 3VWKC 4PJ8B 3QIUA 5IBUG 2VQUA 3IF1B 3FOMB 2VXQL 1UWXH 1JXFA 3IMBA 4XNBA 5JYMA 2LVEA 3TTSA 1O75A 2HN7B 1K4CB 3ULUH 5HI5C 5JPMC 4NN7C 3ISYA 3Q06A 4RQQB 3ABMB 3ZYZA 1ZXKA 3OPZH 2ZXQA 3FK3A 3F5WA 5TH2B 1WS7A 2X9ZA 2DQHH 2HPOA 1XH1A 2X0UA 3ZVVA 1YDPB 3HS0C 2A7BA 3FO1B 3MZTA 4ZOAA 1YPZA 4ETQB 3MA7A 2B5IB 3DUUB 4K3DH 1DQIA 4S0TD 3A67H 3ESMA 3LN5B 5AWNH 5D96B 4XWOC 5GS0C 1QQDA 3QFJE 1T3FB 1VERA 2E27L 5J0BA 1HKLH 4JRFA 2WZAA 1ZDSA 2H0EA 2MHAB 4AQ1A 5IV2B 4R90H 5GRVK 3U4EB 2XKUA 1GZHA 2NY4C 2QJDA 1TU2B 3D08A 4GW5A 2PWHA 3ZE0E 2X4SA 3H9HB 5JO5A 1M6UA 2GY5A 3FO0H 5CZVL 1HAUA 4KTEH 1TLMA 5FDWA 3BW9B 4ILDA 3BIBX 4YHKH 4IBYA 4H8WH 4Q14A 4FE9A 2BOLA 4PLJC 1LK3H 2GJ6D 3T6XA 3G6JF 2VLJB 3DHUA 4UIMB 1KYUA 3I9GH 2NY0D 5G4NA 1OCWL 4KHXH 4NSKB 1OVZA 1LVEA 4NHCH 4AL8C 3ZBMA 2QQKL 1WIPA 5DURB 4PPTA 1P6FA 5JQIB 4H0HB 4G8FA 2K70A 2UXVA 4KVCL 2JB5H 4X83A 5I1KL 3SZKC 4I9WE 4YE4H 4YXHL 3SE8L 1QATA 2Z8VC 3FMGL 4N2CA 1L9PA 4L9LC 1DJGA 3SDDD 2WWMD 1FH5H 3E1F1 2AAAA 1TG8A 3P54A 1VADB 2N56A 1ZSDB 2CLZA 4OCLC 1W0VA 4CVZB 4BE5A 4I77H 2Y7QA 5IROD 2HT3C 2GIYA 1SOXA 3PGDA 5EF3A 3MODL 5DJDA 1WZAA 3ZDYB 3MRIA 3DXAE 5DEGB 3ULVD 5JHLL 4IKNA 4J3OG 4PJCB 3TIEB 3J7HA 3AWGA 4RGNE 3BZEA 4IIQB 2JK5A 3Q9QA 2A9CA 1CDBA 4Y1AD 2VZ1A 3GF8A 3QK0A 5DJ8B 3GEFA 2Y69B 4QYOA 3QHZL 3W1ZA 5ABZA 3T0ED 2AQ1A 4N9GB 3F6IA 2XUWA 4N2FA 3H1ZA 3L9EA 1UADC 3D18A 2VDLB 2WIIA 2ATKA 1IE5A 2WQUA 3D4YA 3OKMB 5JQ6H 4MB3A 1NAKH 4WKXA 5JR1L 3BFQG 1Z5YD 4E9YA 2BVQA 4JN2B 3ESNA 1AO7D 4IRJA 4TL4A 1FO0A 1OT4A 4TSBL 2UUDH 4AGMA 4PB9L 3ULVF 3SKMA 3V9CA 2A9AA 4HLZG 2AI0L 3NSJA 1XL4A 3T3PB 5FGSA 4GW4A 1ZHNA 4TNEA 1IT9H 4Z78A 1WFOA 3IDJB 4GSDH 4PJDB 5CO1A 5HI3D 4X98A 6FABH 4KUZH 2V4LA 3O81A 1KB9K 2JI1A 3JVGA 6PCYA 1XGYH 3HTLX 4NXKA 3RBGA 2P8LA 3EYSL 4CVXB 3RI5K 4ZK8A 2AEWA 3JWOH 2HFFB 4XRCA 3NSYA 4A04A 4M5SA 4GUPA 4HOXA 3MRQA 4OIIL 5E6IB 3RWFA 3V8OA 5TDNA 5I0WA 2YBRA 3D2UD 4TVPL 3QH3A 3GUFA 4H40A 1C5DB 3IDMB 1J8HD 1E4XL 2F53B 3ML8A 4NQCB 4BCYA 3S5LG 5B39A 3NVQA 1A64A 4WHYG 2P5PA 2EE2A 1M3JA 1XR8A 3ZT6A 1NDGB 1A6ZB 3DX1A 5IIEB 2F8IA 3QDGB 4UQDA 3KJ4B 3F6LA 2WJ5A 2FX7L 3VGFA 4XXCC 3MMEB 4FFTA 1H3GA 1KLFB 4DZBA 3EH1A 4FQ2L 1R3KA 4M1GL 4FKKA 1EEYB 1DZBA 2IAND 4FEMA 4U6HB 1HL4A 3B6SA 5HYIA 3VWKB 1NUGA 1GJUA 4NX0A 1YMHA 1IGTA 2D0FA 2DQEH 1OAXH 1DL7L 3PLYA 1CGVA 5LHDA 5EZIH 5H94A 2BNRD 4HKXB 5JDJA 4YDZA 5DQ9B 2G2RA 3G6AB 2DLFH 3QQXA 4GAGH 2WLYA 2VRAA 4MD0A 2WWNA 1BYOA 2I25N 3C6LC 5DUBB 4PGZA 4F24A 3CHOA 2PW1A 4ANKA 4MGXA 1B3JA 3JTSB 2Z31D 2XTSA 3LKPA 1BQHA 1ZVSB 3HG5A 4NUQA 1UM6H 1R24A 3P9MA 4HBCH 1JK8A 3D9AL 3FOLA 4Z7QE 2NZ9D 3WKML 4IHBA 2DYRB 2BXZA 3T6VA 5ISZB 4JQIL 1ECZA 2UWEA 3AROA 3I2CH 2ZTBA 2EABA 3I75B 3D69A 4C4KO 4G7YL 4WQOA 5CKAA 4S1SH 5FK9A 3WHXB 1DQLH 1ND0A 2EIZB 4M1CC 1R5IB 2BVTA 3CVHB 4PTUB 1AQKH 4OW6A 4NZTH 1FGNL 5JOFA 1KBWA 3F12B 4J3VA 1B0GA 4M6AA 4WUUE 5E1HB 2X7LB 4GKOA 4OCWL 3IS1X 5CR8A 3OAWA 3NCCB 3OAZH 1OM9A 3FQUA 4H25A 4RFEA 3LZFH 5GISL 4FQLH 5E1QA 3CLEH 4YPJA 3L4YA 1JPFA 4MX7B 2VC2L 3H0TB 2QGDA 4OSUL 3DJRA 3DK0A 4HUCA 1AANA 2NYYD 3KPRE 4IJ3B 1KENL 4Z77A 1CR9H 5EF2A 1D9KC 2FX8H 4FQIL 4OBSA 3DO3A 2UYLB 4EDXB 4F91B 2WXHA 2IXQA 1JRHL 4WWKA 4AENA 4D7BA 1AP2B 3CLFL 5E4IA 4MJ6A 4PY7B 3CFKB 2AEPL 3X14A 1HHIB 2GJ6B 4GG8B 4I88A 3MN8A 5EUOB 2Z7YA 3DYPA 3QQNA 4P2QB 3GI9L 1X5FA 4JZOB 2BIQA 1OGAA 1BZ8A 3VI4B 5I73B 3REVB 1JPSL 3G6DH 4ZFOL 2GBUA 3MV8A 2BSTB 1U21A 3BWUC 1ASOA 4LLMA 5T1JA 3QI9B 2XXGA 4PRNB 1A4KA 1A9EA 3RTQC 3D3VE 4J4PD 1L6ZA 4QRUB 4NO3A 3MLWL 2YMTA 1D9KA 1NC4B 5EHFA 3L1OH 1NOAA 1G9MH 5LG6A 2H8PA 4JFDE 2YA1A 2NQDA 3QDJB 3WNKA 2ZNXA 3CFNA 4LCIH 4U1HA 3U79A 4QRPA 2J2ZB 2Z1PA 4ZMWA 2ITFA 4WW2B 4R4NC 4HCFA 2BVPB 1HEZB 3GZQA 3OAYK 1QVOA 5CSZB 2Y6TE 1L9RA 5TDPB 4KZDH 2NUTB 4JZNA 5LBSH 3H85A 1YJDL 3ZHLA 1ZT7A 4HD9A 4PG2C 2FYVA 5I1CL 1H0DA 2PTTA 4ZX3A 5J12B 4Z7UE 5E56A 4OFVA 1VZGA 3LD8C 3OLGA 4I7ZC 4ANVA 1KT2A 2WXMA 4X5XB 1QHQA 4LPUA 4ODSL 3NFPA 5F7AA 3S5YA 4PJIB 1TOXA 3I02A 4I48B 5TK2A 5KYUA 4WI7A 2ED7A 3UXFA 3LZQA 4KRPC 5DURD 4M8UA 4UU9B 4YDKL 4F5CE 5K9JL 4R7XA 4ELKA 5AVVB 3DV6A 3DRTB 1N6VA 3KVQA 3VG0H 4UT9L 1CXFA 5E2VH 4H20H 5E6SB 5DHYB 3VW3L 4AIOA 3MLRH 4I0KA 3LZOA 1BEYH 4YZFE 4LSUH 6PAZA 3JZYA 2GUOB 3BOVA 3QUMH 1QSFB 4IBLT 4MKTA 2K7PA 3CSTA 1MHPL 1T4KB 3GO1L 1HOCB 1QRND 2F1AA 1LO5A 3IU3A 5CZXD 5GGTH 4OM0H 4N3UA 5IK3B 3BYYA 1TEYA 2CPUA 1WO2A 1IAIL 5EZJA 1RHHA 1KF9B 1RCYA 4ZW8A 1YA5A 1ZJBA 5DLMH 2F68X 3L9RA 1JP5A 3C12A 2V2XA 2WO2B 1I53A 3AAZA 4TPRL 4R5TA 2XT1B 3DTXB 1JJUA 4BA0A 1ZPUA 1OAQH 3BZFB 4MNHB 3NYKA 4N2HA 5FGCB 4PJ9C 3VAEA 1QR1A 1LMIA 1QW8A 3I50H 3W0WE 4S1QH 5I74C 2YPLB 3ROLB 3GSVA 3SQBA 4KZEL 1I9RH 2ADYA 3FRUB 2OTWA 3QORC 2NR6A 1A6VL 4PJDF 2CBMA 2AJUL 4Z95H 4YXLL 3D06A 3OHMB 4YUEL 4LEXH 4F7TA 2FGWH 4JRXE 3SKNA 3OV6A 5EC2B 4GRWE 1U92A 5C0GA 5IOPB 3RE0A 4DEPC 2WVUA 5FIEA 1YCSA 3A24A 3DVGB 1RZIA 3IJ9A 1SEQL 4Z18A 3X1GA 2VLKD 4YC2B 2D3JA 3FO9B 4Q9BA 4XE0A 4Y19B 2HVKB 3PJNA 5DJ6A 2L8AA 3VXRA 3FHEA 3UTPE 2XKNA 1E4HA 2HPTA 1LP9F 4DGIL 1TZIA 4PY8I 2WLJA 3ZXAC 5D7JB 2C9RA 3WFDL 5A6LA 3ZHFA 4L8DA 3KBHE 5EBWB 3DSFH 3BP5B 4L3CA 1ROCA 3AU1A 1I1AD 4IRSD 2DBJA 2Z93B 4MCZA 2Y25A 2O6CA 1OQOA 2Y7LA 2G4GA 1B4LA 5C0CE 2D73A 2L4OA 3O6FA 4TMPA 1TYJA 5E5UB 1N8ZA 4K0OA 3OD3A 4PRPD 3TEWA 5BJTB 1FJ1B 4XCYA 1XB8A 4FL4B 4BFIA 4LVNC 4UBDD 4AH2A 1AGDB 4N5ED 3L17A 4OIAA 5FM5M 4QHMA 1I8KA 5I30H 4G82A 1VF5C 3IRZA 3ULAB 4Z7IA 2R23A 2G3MA 1DVYA 1NCWH 1OAQL 4QXUL 4DOHB 5I6XC 3JXAA 3NTCH 4FS0A 1JNLL 2ARJA 3PNWB 4OD2A 1EFXD 1EQWA 4LIQL 1ZA6A 4KX8A 5CIPB 2K3HA 5IW1A 4MAYC 1SLUA 3BUDA 1CE6B 5INDA 3PNRB 3OKDB 1DHKA 1AKPA 5IVXB 4ZSOA 2PWEA 5CBEA 4HC1H 4UINH 2JFCA 2SEBA 3CDZA 3AJ7A 4NN6C 5CKGA 3HUJF 4CC4C 3INUH 3EJZD 3HZYB 4N0YH 1J05B 3BUPA 2LQRA 3X3FH 1DO5A 1I7TA 3JV4B 2YD2A 4HKZB 5IJBC 3L3HA 3P3UA 5AAWA 1D5MB 5IB2A 3GC3A 3FU6A 2CO7A 2DQGL 4L9LB 3VWJA 2XACC 4OZHA 4TLKA 4N1EA 4TNWK 3ASWA 2VDPH 3DUUA 1GS6X 3P3RA 3GBMH 5D7SH 5ETUB 4P59L 2GSGA 1W72A 4L3EB 1FL6A 3IGAA 4YDKH 1JZ7A 2FO8A 3FUDA 1JNNH 2Z31A 5EZOL 5HHNA 3FF7A 3GHBL 3GRWA 3U7AA 4ZYKB 1SYVB 1T22A 2W9DL 3SQRA 1TU2A 5DHDA 3FQ1A 1OB0A 2DDQH 1CICB 1ZGLM 1X44A 3L48A 3KYNA 1ETA1 3K8KA 4HGMA 4LCCA 3VGAB 1E9OB 2A77L 2AQSA 3HRPA 3KGSA 5HHMB 5DWUL 2PLTA 5AAWC 1XT5A 1JYVA 5J6SA 2ADFH 4EN3D 5DHVA 5F1OB 2B08A 2OSLA 1IBFA 4PJXA 4NGHH 1MF2L 4W9DC 3HKZA 3J8F7 3NJNA 5KVDE 7PAZA 1XF3A 2VXUL 1RK0A 4IEFB 3D6GA 4OJEH 4ZS7H 2XQ0A 3L1OL 4HDIB 4BFJA 2CBOA 3TNMA 2WXFA 5FYLD 2VLLA 3V2AR 3UBGA 2HP4A 4D9QD 1NGZA 3D2UA 4JHUA 4ZTPH 2ATAA 4JFZH 1SPDA 3LPPA 3P2TA 1UJTA 3G6DL 5KZCD 2IDSA 2WBJA 4ZUVA 4G59C 3OB8A 4WUUA 4P2QD 1E5ZA 2J1WA 2UX7A 2CJUH 1TTAA 1K3IA 1U8LB 2AEPH 2QV4A 2DM3A 5E4EC 2XBDA 1K9TA 2YQ2A 3FN0H 4H0IA 3TYGL 5I1EH 3O3EB 1QA9B 4ZMXA 1BZ7B 5CLTA 2APFA 5EMYA 2CRYA 3SDXF 3W9DB 5MHSD 3HBQA 1E50A 4CSTA 4PS3A 1KENH 3MCYA 4HS6A 1GGCH 4B9YA 3KPSE 5LKNA 3KPRA 3V0WL 4WHCA 1F42A 4OSUH 2IGFL 4OI8A 4J6RL 1AKJB 5E99H 4UT9A 3D09A 3MU3A 4AM0Q 4P46D 4G8IB 2ZCKH 3GXNA 1ZA3A 2G9HA 1A9BB 2VDKB 4ONFL 4HGWB 1YEEH 4QXTB 3OAYH 3E6HA 3O6LL 2CAKA 3P3SA 1GGTA 2VR8A 4QTHB 1AQHA 2IQAB 2XZQH 2EDBA 4YL4A 1VKXA 3O45A 1MCSA 1S9YB 1UZ8B 3JYCA 1XCWA 2YZ8A 1OAKL 1P2CB 2G60L 1KNOB 4E9WA 1WAAA 5E2TH 1FRGL 1MW2A 1CFQB 3Q6GL 1R17A 4F7CB 5CFHA 4F37F 3P73B 5B1CA 4Z78B 1WFTA 2I5YH 1FAIL 1G7IA 1I82A 3ARQA 4ODHH 5C0FB 1ZGLB 2DZEA 4ZO8A 1TQSA 4OGYH 4KUCD 3D05A 5KSAA 2CIIA 2Q87A 4PHZA 5DMIH 5IJCC 1IGML 3K91A 5HI4D 4ONHA 4HPOH 3B83A 5FYKD 3MRQB 4JG0L 2YRLA 3T8MA 1EH9A 3GI8H 3WS6C 4W6YB 3UTSB 1RU9H 3PE9A 4X6BA 5EBLA 1HAWA 2FLMA 2ZSVA 5I0VA 2VLRB 3I3EA 2CRIA 2FBJL 3PQYD 5CLXA 3HCVB 5AYUL 3WLWD 4YLCA 2Q8AL 2R1YB 2XN9E 3AM8A 4PCYA 3UTZA 5INCB 3F7LA 3DX2A 4LCVA 1NEZA 4NKDA 5LGJA 5LNGA 4HK3J 2JB6B 3HC3L 4CGTA 4NNXA 3B2UD 4K07A 4H13C 1KYAA 1YMHB 1MWAA 4FFWD 5E70A 3D4GA 3MCKB 4KXDA 1NCOA 4HCIA 4L1DA 2NZ9C 4PWIA 4R96A 3UP1A 1GC1H 4X6CA 2AJXL 4NAMA 5AEAA 5FYKU 5I8OL 2V5TA 3H7BA 3ILPB 3KYKL 4MFHA 3VD9A 5BOJA 1RIVL 1YAZA 3MOAH 4NXSA 3LRSA 4JFPA 2YS4A 1NH6A 4XI5C 1JK8B 3ALPA 1SJEA 4G7VL 1V3JA 4WKZA 2X4NB 3FT2B 4ZX4A 1J5DA 2F0CA 4LLUA 2ENJA 4JM2C 3FQTA 2FTAA 3RVUC 4J1UB 3STLA 2C9XA 1PFCA 2LVCA 3SDAB 2EACA 2WLLB 2N0MA 3FQXA 3QBTB 4LF3A 5SWSA 3RVTD 2YN5A 3BZEB 1CD1A 2FL5B 5J9PB 2YMOA 3F7VA 4G5ZL 3QDHA 2HT4D 4K4KA 4XVTL 4DT2A 4JPKH 4PJGB 3KNBB 4L23A 3MREA 5HY9A 5DHMC 5MENA 3ET9F 1GS8A 2UXTA 4ODVH 5TQ2H 2I9TB 5C9JB 1ITBB 1ERNA 3BVNB 4NCDA 5AB0A 2E4TA 1G7HA 3MYZA 5MERB 1P53A 5AB1A 3G5ZA 5AVYB 3QWRD 1P7QA 2EDYA 4GQ9L 4QWWC 4WU7B 2BIOA 5AVSB 1CXIA 3K2MC 1Z5LB 3W57A 3CDCA 3RZCB 1FORH 3D85B 1YEJL 1ZTXE 1J1XL 3LTVA 4LOUD 3RGVA 3VH8G 3EJTA 4FLQA 5FXCH 4G1MB 2AQTA 5KBKA 1CICD 1BIIA 2R0WL 4JPQA 1NGYA 3VXNA 2YAMA 1T6BX 4HIIA 1HT6A 2H1LM 3EJQA 5DHEA 3OC5A 3VFTA 3MOAL 2HSIA 1KLGB 2AQ3A 3VMPA 4E42B 1RZGA 3LIUA 3LN4B 3BPCA 4LRIC 5I18L 4HOMA 3MRDA 1M4KA 2P26A 2ZUWA 1NCDH 1QRNA 4XVSH 3V4UL 2YRBA 3OJDB 4WK4B 4XWOD 2BSTA 4OF6A 2LW3A 4LLMB 2BNUA 4ODUA 3UTTE 2H26A 3AREB 4GSXA 4L4VB 1KXQA 5JW3L 3WE1A 2LU7A 1U4EA 1JTPA 3SE8H 1K4CA 5IMOB 3NJFA 3ORJA 1KJ2A 2M26A 2H2PD 4LSRL 1I1AB 1CBVL 2OMXB 4JY5L 1MCRA 4HGKC 4N8PA 4TOYL 4YSSA 2IC2A 4KRPD 2V33A 1A8JH 1BX2A 4QR7A 1G7MB 4EKJA 3ULSA 1EJ8A 2N59A 4JG0H 1GOHA 2OTUA 4UTCA 4Y5YB 2OAAA 2ZCLL 5I19L 4AEHH 3ASNB 2HWZL 1FYTB 1F3RB 4DCQA 4YHYC 1B3IA 5D93B 5J12C 4LNVA 5AVXB 5IJDC 1Z2KA 2Q7NA 5I1IH 4RAVA 4DGVH 1J11A 3GSQB 4DFHA 1HYRC 4ZO9A 3DVNA 3GB7B 5CUSL 3MUY1 1E6OL 3VXOA 5IHWA 1JVKA 5JO5B 3QZWA 4I1NB 3MGAA 4G83A 1U3JA 2V2WB 4XN8A 3LKSA 3T0VA 4QLWA 1BFVL 4GKSA 3FCSB 3VSUA 2WQAA 5GS3A 1KJMA 3A67L 1USQA 3SGEH 4ISVA 4M02A 2ZOWA 4KRLB 1B2WL 4POUB 5KVGE 1AD9B 3RVUD 3NPSB 2CR0A 2QDVA 1WISA 3O0LA 3VXPA 4FCAA 4HP5A 4UIMA 3L7FA 3NZSA 4HKBB 1RUKL 4MQXC 5FO8B 2EEAA 3MQIA 3ARPA 4XVOA 1AHWB 4P5SA 3S36L 4N8VB 2FHBA 1WAEA 5E6UB 5F70A 1KC5L 3T0EE 2BK8A 3DXAB 5LXVA 3TJHD 4OCSH 2VR7A 1LEIB 4TVPE 1T1YA 5LXGH 4GP5B 3ARFD 4N1CA 1Q38A 5HGDA 3BRFA 4NQEB 3KVPA 1W0VB 3V5HA 3ARYA 1FFPB 2CHNA 4HX1B 1B6DA 3D30A 3DTXA 5HGGS 3BZ4A 1YLBB 4CU6A 2ITDA 2LV4A 3MLZL 2BWQA 1AYRA 4DEUA 3QEHA 4PGDB 3EOTL 3VXRE 4W81A 4HHWA 2EEFA 3RTLA 3Q7JA 1N9PA 3U7WH 4FEIA 3L5WA 1U8IA 3N40F 4Y2DA 3H6JA 4TNVF 4F8TA 4ZUUB 3MJ9A 2QFPA 4QRRE 3X12B 2EO1A 4GO9A 1XXDC 4PUBH 4BQ8A 1F4YH 1W80A 1P1ZB 4DQOH 4UQBA 4Z8FL 2CO6A 4O02B 4DEPB 2P9RA 2R56H 1QI4A 5TFSH 1IM9B 4AQEB 3RU8H 5DJ6B 3DDFA 3JWOC 4PB0L 4ZQKB 3B43A 2VXSH 2F58L 3SE9H 1V3LA 1BLIA 1RUQL 2BVQB 1QLEB 2FE0A 2ICEB 4FNTA 4P3DA 3VFNA 1SUJA 4Z7WB 2D2CC 2F54A 5C0AB 3QCVH 1MN4A 2DL9A 2YBGA 5FO7A 4JO8A 1N59B 4ODTL 2HG5A 3NFNA 3QEGH 4TTGA 4HWZA 4PJDA 3O8XB 1QSEE 5FW7A 1GL4B 3EFDH 3UYOD 2IWEA 3FFCA 4JREC 5E2WH 1NBYB 2VN3A 2RQEA 3C5ZA 3D39B 1FL3A 5KTEL 4PJHA 2OQJB 1JFQL 4PJFF 4XBPB 3QO1B 5HDBF 4OBRA 3STZA 4ACPA 4KI5C 1CXHA 1G7JA 1TJXA 4LL9A 2X3CA 4BHUI 5DC2A 12E8L 1RK1A 2F1EA 1TSRA 3WEAA 1CTNA 4DGUA 1F1GA 3C6EA 4Y4FA 4Y0GA 3F2LA 2F53A 2K6WA 2IH3A 2Y9RT 2ZD0A 3QULA 5F1KC 2WINA 4XAWH 5L6YH 1XB6A 4B9JA 3QDGA 5F3FA 2WUCH 1JYWA 4XMUA 5EC1A 4EVNB 4P23B 5B38B 1ZEAH 2CRZA 4O5LH 4OD1H 5I8KL 1AQDA 3NDYE 4ZMPA 4JY4A 3LNDA 3QP3A 3ZL4L 4QT5B 4A6YL 1FCGA 4L5FL 2JKJA 2VMEA 4LO9A 1XIWD 2DLHA 4OLWL 3VI3F 4QXUH 1KCSH 1BZOA 5FGRA 1JHTA 2WXPA 3U9PL 3WIHH 1Q9KA 2X4PB 4F57L 1A22B 2PXYD 1R3HA 3DX6B 5FYLE 2PYEA 1BSIA 4PJXE 4XP9L 2WSDA 3SBRA 4H88L 1NCAL 1GJWA 3OJVC 4YK4B 3QZBA 5IBTL 3DETD 1KV3A 4QRRD 1M2OA 1WTLA 3APNA 4Z7UF 3BVTA 5EIIG 4OM1L 2OK0H 3QZWG 1G94A 2JCCB 1YEFL 3SDXE 3HLAB 2K6ZA 2R59A 4OF7A 3STBA 4QHPA 3NN8A 2RFXB 2MPVA 3OSVA 3TVMD 1XGUB 2CK2A 3T4AB 5IQMA 1WZ1L 1QFUH 1MCHA 2ROXA 1HHGA 3KLKA 2DS4A 3FU0A 5HGAB 1ZIAA 2KH2B 3B8YA 4P2AA 5IHBA 1BJ8A 1GW6A 1TKWB 2GK0B 1C12B 2ITEA 3LNHA 4U1MA 4UOW0 1YUHA 3ZR6A 4UTBL 4LHUD 4N8VG 4YDLC 1OW0A 3DNKA 3WI9A 1FFNB 5EU3A 2WBJB 5BOZG 2AJZB 4G80B 1BBJB 4NT6B 2DQFB 3LS4H 3UZQA 3QPKA 4QF1B 4Q9QL 2ZSWA 4KZEH 3PJSB 1IRAY 3S96A 3A6CL 3NFSH 3PHQB 2I60H 4ETYA 3TA3D 4F57H 2UYLA 3I50L 4PGJA 2F7QA 4PBVC 3UROR 3BUYA 2UVFA 4RX4D 4UQAA 4P5RA 4YO0B 4A6YB 2J5LB 2CJ3A 3FFOA 5JNYA 2XNAB 4ZMAT 4R6UA 1R19A 2QT6A 4OFPA 1E0OB 4L5FH 2B39A 1U58B 4P4KA 3BAKA 4IOFD 4L1SA 3DRQA 1CFTA 3FH7A 1BOGA 3TO4D 1LEKB 3AMLA 2E8ZA 4LVEA 1ZTMA 4PJ8A 3I6KA 5I16A 2ENQA 4GOSA 1A4KB 1A9EB 2V8MA 4WTXA 2ZAHA 1GGYA 3L6FB 3L1FA 4U3SB 2KLRA 3U0WL 1OGPA 4NC2B 3EO1B 5JA8B 1OD7A 4KKQA 4H20L 2YWZA 3VW3H 1TZGH 3O45B 1EAOA 3BSZA 5ISZD 12E8H 3DOSA 4PRHE 3CH8A 1P2CA 4OCRL 4OF0A 4OKVA 3ZO0A 4WFED 4F8LA 5C08E 3MV7B 4F33A 1F6AB 1RVFL 5IQ7H 4IU2A 4KMQA 5E9NA 1P4BH 4HT1L 5JIKA 1FN4B 1D5BA 4KPHH 2XN9A 2WPGA 3QEQE 3U46A 4M6NH 3G6JA 4Y4HD 2ZUTA 3FTZA 1KT2B 3FZUC 4NUGH 3AS1A 3BP6B 3RWHA 3I02B 4MQ7A 1FLTX 3MGTB 5D70L 1PPIA 1H6TA 4NPJA 4W93A 4A7GA 4KZDL 1QTSA 3ABKB 2MEJB 3V9EA 4XPTH 4XPFH 2CNZA 1RUQH 2WZ6A 2VXSL 2VLRA 1YNTF 4KKLC 3DV6B 1FV1A 1PZ5A 2WOYA 2BZCA 3BEWA 4XP6L 1IAKA 5KVDH 3N1FC 5D7KD 5DZNA 1XR9B 4DSYA 5K59F 4G6MH 2VR9A 4J3WA 2ALWA 4JUTA 1QBMH 4FA8A 2XBZA 1J5HA 4X8JB 4Z3GA 2IALA 3DVIA 1ESOA 3DGDA 3WFCL 3EXLA 2A9BA 1MJ8L 3EO0A 3PY9A 4OZFH 4FZ8H 5ESVA 4G8FB 1RERA 5CJOL 1JAEA 1KYOJ 4S2SB 1RHHB 2EDDA 1X5JA 1G9NL 3UBXA 1T6VN 2CG9X 3G9VA 3OMNB 3MROB 1Z9SB 3MV8E 3S9DB 1B2YA 2OX5B 5DS8A 5GRJL 4IRZL 1A25A 2J8UE 4I18A 1FNGA 2CKNA 5B7FA 3CLFH 4MNHA 5GSRB 4ZX5A 2EKSA 2VUYA 2W5PA 2OYKA 2P24B 2PWFA 2B0SL 4U0RB 1JCKA 3KHQA 4JFEE 2L0DA 1O7VA 4OGAD 5D1ZA 1IC4L 3SGKC 2GC7C 2YFOA 2VKWA 3K46A 2FVNA 4WEBL 3SN6N 2VERN 5E0QA 4XX1G 3GS4A 3W9EB 1CGWA 1UWEL 3EFDL 3STLB 3V0FA 1W0WB 1X6NA 5DJ8A 1S7TB 4QYOB 2Z7ZA 3NEXA 1EZUA 3L45A 1GCYA 3SKNB 4Z7UA 1IJ9A 5IMKA 2VQ1A 5ICYA 1BBDL 3MXVH 3VXMD 1A3LH 2JE8A 2X2UA 4YAQB 3HOGA 1KB5B 2W59A 2CUAA 3T2NH 4OIBA 4JVPA 1NL0L 4OJDH 3IDYC 5DR5H 3MJ7B 5CXPA 3RRQA 3D33A 3WUWB 1JTOA 1T0NB 2A83B 4F5CA 4X5PA 1MFCH 4G6JH 3V4PH 4IIQC 3UG3A 2Z8WC 2R2EA 1KTLB 1HWGB 3KW8A 2Q6WB 4EF3A 4L3CB 3VI3E 5JDSB 1KG0B 3IMUA 4BINA 2EDEA 1QRNE 2OMYB 3BHBA 2EDFA 4L8CB 3RGVB 3CXFA 1QLFA 1UA3A 3WSQL 4ZFGL 2X9XA 1P4LB 1UOKA 4AJYV 1KBGH 2WTRB 4LKXA 4L8SC 2EUWA 2LLGA 2R8SH 4N2AA 4E42A 4XRCB 2ATPB 3UAAA 3F00A 4KUCF 5IEHA 2AEOA 5C86A 2VQTA 4AYMC 5IVXE 5D1XA 3PHAA 5I1JH 1I9EA 4YDVB 2OMVB 1RK7A 2EYTB 1R3JB 1DVQA 4H5SB 4LSSL 3MLTB 5E9DE 2DYPA 2Q86B 4JNXA 1QNZH 5ES4B 1BZDA 2Y7NA 1BXVA 4BK5A 4XTRC 1WICA 4WW2F 4FQ2H 3OKDA 4NKMB 2E9WA 2R83A 3IJHA 5IQLA 5DRNB 1D9KD 4D8PA 4ICWA 1EEYA 3RDJA 3TC9A 1A9VA 4M3HA 5D1QC 1TMQA 4PJFB 5HDBB 1SFDA 4NRYB 1J05A 4UDUA 1RUKH 5HHPB 3CCHA 3HC0A 5EZLB 3U82B 4HKXA 3UDWA 5JIQA 1UQSB 3VWJB 4OZHB 4QHNA 3G6AA 5J8OA 5IFJA 3BAJA 2OTUB 3Q5TA 2MRYA 2GSGB 1IKFH 1IFRA 1W8NA 1XCQA 2W80C 3PDGA 3SDDA 3KPTA 4R0LB 1CIUA 2QQNH 5T1KA 3ZE1F 2P43B 5I8CA 1SYVA 1M53A 1T22B 3QRGL 3OLIA 3SQOH 1KB5H 1MCOH 1J5IA 3JV6A 3CFDB 3NZHL 2YA2A 4YLBA 3VXME 5FYJL 1QHOA 4NDMA 2ZCLH 3GLZA 1B9ZA 4TUJA 3GGWA 5C0CA 3RG1C 4XO8A 3VXPB 2ZAIA 3TWCL 5IT2H 3GMQB 3MXWH 4HA1A 1NMBL 1RJYA 1ML0A 4YHLL 1EJ6A 1ND0B 4PTUA 1NMCC 4TUKL 1RD6A 3HUJB 4NHUA 5FYJD 3F12A 1AIFB 2YOAA 2VH5H 4YFDB 5FYJH 5I6OA 3OZ9H 4OQTH 3PYCA 2EXYC 3GRGA 4OLXL 3MCG1 3VXUD 1DCLA 4C4BA 4ZG1A 3HNTH 1RLWA 1V7MH 3UAJA 5DJCA 4AV5A 4JKPH 4AOFA 3GYRA 1HESA 4MX7A 4OFIA 3V4UH 1OK0A 1JK9A 1M7UA 1EWHA 3E2HC 3VSVA 4XN2A 5GHWL 4OB5L 3TA3A 5AUMA 2XHNA 4HIJA 1XEUA 5J3HC 3VRJB 4BQBA 4NZFA 1CXKA 5I8OH 4K9EL 5B8CB 3LXAA 2HJFA 2Q5BA 2NY6D 3GMOB 2ICWB 1CXEA 2XZAL 1U8IB 1S7UA 2F7RA 4QHLA 4BSWA 5HYFA 5IHUH 4TLSA 2C3HA 2QADB 5AL8A 3KEDA 2DTML 2MNWA 3D85D 4HHAA 1F4WL 3H3KA 1MAKA 1XZ0A 2HKFH 3K8LA 4W9GC 4DVBA 2EIKB 3DYOA 2CMRL 5DK3A 5AAMC 4AV4A 4EUPB 2CO6B 2E6PA 5BRZD 2CBPA 4R4FL 1N0LB 5FGBA 2Q8AH 2NW2B 2QQKH 1NGWB 2XVGA 2NW3A 1CF8H 4OUUA 1EHXA 4OQTL 5BZZA 2R9HC 2IQAA 3UEQA 5DJAA 2BOCB 4DVRH 1G7LA 3CXHJ 1N68A 2FCBA 4W9IC 3QUXB 4EUPH 1NMBH 4PWHA 4F7CA 1AZCA 3ZTEA 2QADD 2W81C 3O6ML 2EXWD 2IBBA 3FAXA 5FHBH 3IAGC 4FQJL 1C9SA 5G4MA 3UTSE 1Q0XL 4JJ5B 1U8HA 2PPAA 5ICUA 5IGXH 2QQNL 5CSBA 1FL3B 3MUUA 4QRAA 1VB9A 1G6RA 4G9FB 3SQOL 4XBPA 3STZB 1D3CA 4DUXA 1YNTA 5AWNL 1UCTA 2X4UA 1PG7H 2AVFA 4LGSB 1ADQA 3EFOA 1YYLL 2VDOB 4G9DB 2WTPA 2JJWA 4GRLC 4HIXL 1J10A 3JWDL 1E9PB 1AY1H 4APXB 3QULB 3KH4A 1H6EA 1EFXA 2B1AL 3E3QC 3G3LA 3WXVL 5ESAA 4AWJC 3OAUH 3S3BB 4BCXA 3UTZB 4RAHA 5INCA 4Y4HC 4FI6A 1BD2A 3RJDA 5HDWA 1S7QB 1P1VA 1B90A 4QRBA 3FW6A 2B9AA 2X28A 3BD5A 3K2UH 4KMTH 3B7TA 2C3WA 5IK3A 4GEJA 1GGCL 3KPSA 3C08L 1IC4H 2X5PA 1I3RB 4FNLH 4UQ2A 1JWUB 4Y4KC 2FBJH 3MBXH 5AYUH 1U95A 1J12A 1TO5A 2NXZD 1CGXA 1EDQA 5FUCC 1QNZL 1CG9A 1F4XH 3PAVA 5I1EL 1OL0A 3C9NB 3H7BB 3ILPA 4H1LH 5AW6B 1JZ2A 2XWBA 2PYEB 3LPOA 4KXAA 5I1JL 1WITA 4HLEA 4MZ3A 4FHJA 4KY1H 2KHAA 2BNQE 3GIVB 1B0WA 2FWOA 2HT2C 5DC0A 4MDRA 2XWJA 4PJGE 4Y1AA 4U3CA 2OL3A 4S1RH 1MJ8H 3H4FA 1PD0A 3GM8A 1EHLH 3LKNA 3TBVB 2XG5B 4OGQC 3IJ7A 5SWSB 1QBML 2NY6C 2BMKA 3MRRA 2JXMB 1IIKA 4PLKD 5D5ME 4G6ML 5A2KH 1MFCL 2VXUH 3NN8B 4G6JL 3V4PL 4AQ8C 1N2RA 4NZUL 3ROOB 5E2TL 4H8HA 5J3HD 1U92B 2GABA 5IOPA 2JIXB 1HEHC 1IC5H 4L48A 4LBEA 5TPWH 5DQJA 4XPFL 4XMVA 4WF7A 1MELA 5D7IB 3GDBA 4NOBA 1KIQB 3M8OH 3O6LH 3FT0A 3U9UB 2WP3T 4YHPA 5DWUH 4Q9CA 1FNLA 4N0UA 2CBQA 3D87B 3EJRA 4X7DC 3MXVL 3PAUA 3R7QA 5B38G 4NYLA 5KOVC 2WWKO 3QWOA 2DI8A 5DZLA 2VDMB 4JZJC 3ZZQA 5EH1A 4PGEB 1BBDH 1FFNA 1PLBA 5EU3B 1N5YL 1G1KA 5DJXB 1F45A 3F85A 2H6UA 1PKQB 3QCUH 4KRMB 2IH9A 4G1MA 3SPJA 1MVYA 5IVZA 3S96B 2RH0A 5DYOA 4F15C 3QNYA 1HSBB 5D7SL 4TKWA 1EEZB 5FFLA 4NO0A 4HU2A 4MAYA 2WXJA 1ZRUA 4J27A 3R8QA 5JNYB 5CZXC 3QUYA 1RZGB 2C9AA 1F3JB 4O2FA 2PW2A 4P4KB 2JF1A 4F3FA 2PCFB 3WE6B 1CYXA 2WTOA 2ZWYA 1G9NH 5I1LB 5IM7A 2WZPD 3TEZA 1DBAL 1BQLH 3OJDA 3VXSB 3LDBC 4LK4A 3I6KB 4RMTA 4ODUB 3QAZC 1CE6A 2ETWA 4RMQA 5IMOA 2NDFA 3ZKSD 4ZSOB 5CBEB 1LHZA <