4QLRA

Llama nanobody n02 raised against eaec t6ss tssm
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
130
structure length
130
Chain Sequence
DVQLVESGGGLVHPGGSLRLSCAASGRTFSDYALGWFRQAPGKDREFVAAISWSGGSTYYADSVQGRFTISRDNDKNSVYLQMNSLKPEDTAVYYCAADKYYTGPGGESVYDYWGRGTQVTVSSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of Type VI Secretion by an Anti-TssM Llama Nanobody.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
molecule keywords Llama nanobody n02 VH domain
total genus 28
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qlrA00
5LWYH 4ZFFB 4FMKA 3WS3B 2MNUA 1DTUA 4D0BB 1YZZA 5FF6A 2AJ3A 4PJHF 4KUZH 4I8DA 4S1DD 1T0NB 3DNKA 4M6AA 5ALCL 4MA3B 2E9BA 4OFYA 2V2TB 1YNTB 1Q9KB 2FWOB 2R0ZH 1OAKH 3AB0B 4IOFC 5HHQA 2XN9D 1HSAA 2X4TB 1W0VB 2IAMD 3U83A 1EEYA 5K9JL 4P9HL 1OAZH 4UOW1 3DYMA 4L9DA 5IT2L 3I6LE 1KTKE 5C0AA 3MGAA 2GEEA 1CGUA 2BVQB 1Q38A 2FJFB 4NRXA 1KJVA 2HYMA 3HS0B 4EUPA 1QLRA 5F6IC 2K7QA 5DMJB 5HYSB 4HDIB 2ARJA 2HG5A 2APFA 4M48H 2DLFL 4LHUA 2Z0BA 3NGBC 3JWDH 3D18B 3IGAA 2VLRB 1A6WH 1QFPA 3QUML 4D8PA 5JOPE 4F7MB 4PY7B 4PB9H 1OQXA 5EN2B 1OPGH 2G60H 5DJAB 2P46B 5FYLD 1KPUB 2LFGA 5D6CB 4HZAA 2YEZA 2FIRT 4MA1B 3DYPA 4JRYE 1G7HA 1RY7B 4ALAH 1YPZF 3G6AA 5GPRA 2XTJB 3CSGA 4BQBA 1NC2B 4GKNB 4R90H 4Y19B 5SV4A 4Y7MA 1Q0XH 3MV7D 5CSZA 5EO9B 1J8HE 5HVWA 3DURB 5CBEB 3TJHC 5C9KA 3INUL 3SE3A 2E6JA 4KC3B 5D7JD 1A22B 1INQB 5DQ9A 1A5FL 4IRSC 1RZJC 3L9RB 4KJYA 4HIEA 3T0EB 3IDMA 3EOTL 2BY3A 4F37K 3GI8H 1S8DA 3P11L 4LCWE 2RJMA 4TOYL 5IIEB 2ADIA 4NUGL 4NJ9L 5CHNA 5EORH 4NCDA 2P45B 1BQUA 3O2DL 2WUBH 4MZ2A 1F4XL 3JTSB 2YA2A 4K8RC 1L6XA 1DQLH 3LVEA 4OJFL 5E0QA 2XPGA 2AXHA 1RIVL 1ACZA 2LQRA 3K81A 4JVWA 3H9ZA 2P5EB 1B6UA 3GSRB 3TV3L 1JYNA 1LO0L 3DPBA 4EDWH 4LSVH 3SKNB 1XT5A 2QV2A 5B39B 3KDMA 4P48A 4PFEA 5DD5L 1K8IA 2IALA 1EEZB 4WEBL 4JFZL 2ZNWA 2D31A 1E4WH 5FKPB 2HLFD 1SQ2N 5D2LF 2FL5B 3S3SA 3WNLA 3VXRA 2UYLB 5JDJA 5DTFA 4JY6B 3WNMA 4TSAH 5ILTH 2MJWA 3QO0B 5IB3B 5HYSG 1PY9A 5IQ9B 4OCSH 2NXZC 4R0LA 3NPSB 4WY7L 1CFTA 3HE7A 3NGBB 4QXWA 4OZHA 3QQ9D 3PWUA 2FECL 3D48R 3IDIB 5I1DB 1DUZB 3PWJB 3IDXH 1DL7H 2IG2H 3T0EE 4DOHE 2NY3B 3S3JA 5INDB 3MRRB 1JN6B 5JW4M 4IRJB 2BMKB 4QRRD 2BOCB 1JYVA 4LCWB 5HDLA 1QFWL 3UTQA 2LVCA 3KPSB 1U3JA 3TJHD 5A16B 3BD3A 1EHLH 5FO9B 2VLLA 5CEZD 2VDLH 2XQBH 4IRSD 4OAWA 2DKUA 3T0VA 4OQ1A 5FYLE 3UO1L 1CFVH 3G5VB 4BZ1L 3IDNB 4K7PY 3UTTD 4O2EB 5CUSL 4EN3C 4M7LL 1X5GA 4NQXB 2A83B 3FKUS 2F5BL 3O6MH 1NMCC 3FRUB 3HB3D 1EHLL 4IRSB 3PDOB 3MR9B 4BQCA 1QA9B 3T0EC 3G04B 4YXKL 3B5GA 3VG0L 2JB5H 3SKOB 4N0RA 5J6HB 1ZA6A 4FQXD 5JA8B 3DX7B 2F5BH 3OAZK 5F7MC 3EJYD 4KTEL 3ILQD 2DMKA 2OP4L 3BQUC 4LP4A 1LE5A 4DUWA 3QO0A 4KQ3L 4OBSA 5E1AB 1SJXA 5FHBH 5BZWB 5LGJB 3B5HA 2WINA 1HH6B 1NCCL 3MRIA 3U36B 2HLFC 1L6ZA 4JR9H 2AKRB 2GY5A 1P7KA 1ZGLP 1Z3GH 4HCRL 1NANI 3VXQA 4QHNB 4CVXA 3ET9F 1FIEA 1A4KB 1CG9A 4LVHC 5SWSE 3DX6B 4KK8D 3G6DL 1F4AA 5E2VL 4U6VH 3U79A 5KVDL 2FX8H 3IB4A 3R8QA 4IRZL 1RJZB 1KIQA 3WHE0 3OAYH 1A9BB 3TLRA 5I1KH 3EW3B 3DRTA 4Y5YA 5FYKE 1MNUL 2GFBB 4OT1L 4R0LB 2N1KA 3DLQR 1ZAGA 2Z8SA 3IF1B 5I8KL 2NY2C 4HUMB 4KHXL 4ORGB 5IW6A 4MJ5B 4YEEA 2JJUA 5GGSB 4NSKB 1I9JL 3NPSC 3S37H 4OJFH 4DGIH 3DSFL 3NIDF 5C0ND 3QXDA 4L8CA 2GK0A 2QL1A 1OAXL 1EXUB 2OMBA 2RAMA 1DBKL 1U92B 1EO7A 3CFCH 4KDTC 4IMLB 3VH8A 4JY4A 4OLYL 1J9CT 2VQ1A 3O45A 1T6VN 4HGWB 4M6NL 3RJDA 3IAGC 1CLZH 4QGYA 5ESAB 1INQA 2FYYB 3QB7C 4PGEB 3SDAC 2EDXA 1E27B 5I73B 3F7VB 3F7YA 3P9LB 2R8SH 2QSCL 2P7TA 1IAII 4U4BA 5KAQG 1TETH 4GG6A 3MRDB 4RFEB 1OT2A 2BNUA 5GGTL 2L4OA 2HVJA 1FPTL 5J6GB 3HG1D 3RVWC 4G42B 1BJ1H 1VFBA 3GMOB 4X8JB 1TQBB 4FTVE 1IGTA 4U1HA 4GKSA 3V4UL 1LE9B 5F97E 3EJYC 3GI8L 4WIQA 2D7QA 4O02L 3MLXL 3L7FB 4S2SA 3UTOA 4M1CC 1NCWH 1OGTA 2N7BA 3CFDB 2AJUH 5H37G 4WV1C 3CSYA 4BJLA 1IGIH 2X89A 5EH1A 3ZKXB 4BELD 3L3KA 4GRWE 3MYZA 3L9RA 4JDTL 1KJMB 3D39B 1A7PL 1CDBA 5IF0B 1HDMB 1F3DJ 3G6JF 1A7RH 4EUPB 1MHPL 3RL1B 3SDXF 4KUCF 3FB7A 5GS0L 3VGDA 4XPTL 3U4AA 3B9KD 3U0PA 5I66B 4IIQA 4NKMA 3U9UB 1EJOH 5C0JA 5KVGL 1MFNA 2ORBH 3QUYD 4B7IA 2P1YA 5DRXB 3TVMA 1T1WA 1PKQB 3DVFA 2ZNXA 3VXUD 4JFED 4PJCA 3QUZA 4R7DA 2WUCL 2LTQB 4GFTB 3P9MA 4ZFOA 4HUWA 1OP3H 5FF6B 3OR7A 1A6TA 3WS3A 1LEKB 4DFHA 2F5AH 4OCXH 4S1DC 1Q0YH 3GK8H 3C5ZA 1P5UA 3O2VH 5IFJB 5EZJA 2DMCA 2PYEE 2Z91A 1S7SB 2MFNA 3FQNA 3ARZA 2I9LB 1ZGLB 4DVRH 4PRPE 1D5IL 4H8WL 4LGPB 1ETZA 1IBGL 1C5DB 3AXLA 3H9YA 1Y18A 1KCUH 1QFHA 3BWUC 3F7QA 3QXUA 5GS1A 3F58L 5I1GL 3TZVB 2FEEL 1FZMA 4P5TA 3QHZL 1F6AA 1A9EA 3QDMA 1P6FA 1UYWL 1WC7B 4OB5L 5E8DL 3FFCE 3SDAB 1MFDL 3ARXA 1I7UA 5DJDB 5I73C 2DLHA 5FA3A 3OAUH 3PHOA 2NTFB 5ICXA 3EDKA 4N0YL 4C56B 4Q97A 1H3TA 2OLDA 1T20A 3HFMH 5EO1B 1NC4B 1YN7A 5CBAA 4EXPX 4PP2A 1FV1B 1LO3H 5J06A 5IVXA 1NBVL 1UB6A 4LLQB 3SO3C 5CILL 4HBQA 4LNVA 1AD9B 1RUAH 4Y5YC 4GAYB 3DRQB 1MCKA 2E5EA 2HKHL 4PJ7A 1YDPB 5DVNA 3DVGA 4P2YA 4DK3A 2R2BA 3CFEB 2ITDA 3PNWB 4RGMB 1KLGA 4Y19E 2UUDH 2NY6B 5KVGH 3SE4C 4NO5A 4BZ2H 5IKCB 4RRPG 1HHHB 5HDBF 3MLXH 2SEBB 2AQ2A 5I1KL 1HCFX 1F3JA 4XPBH 3W0WA 1HI6A 4G43B 3TNNA 3EYOA 5JQ6H 1QO3B 4PRPB 4J23A 1U91B 5L88L 2X4UB 3GO1L 4HJJH 4YHPA 5KSBF 2P42B 4AMKH 4P9MH 3TNMA 1MCLA 1BZ9A 4QRPE 1OVZA 4JKLA 4JFDE 4F57L 5JOFB 2DM7A 5C71A 3RPKA 1T1WB 3FN9A 1DLFL 4KI5E 1UEMA 3WO4C 1T1XA 3ZTJH 3BKML 3BW9B 1I8IB 5DT1H 3VFNA 2WMPA 4R3SB 5C0JB 2C4FU 1EUTA 4N9GB 1UJ3B 1N2RA 3V6ZA 4Z78A 3SKMB 2Y1VA 1G7PB 3BP6A 3T4AA 2E3VA 1FAKT 2AJSH 3B6SB 1I1YA 3RY4A 1ZLSH 3VFNB 2C4FT 5CMAB 4WRLA 1MRCH 5E6IA 1ZT4B 1IAOA 4LRIC 4Y2DC 5IEKA 5K9JH 5C07E 4WJ5A 2DMBA 4POZD 2P8LA 3GBLA 3SY0A 5HHPA 1J05B 2QSVA 4IHOB 3CCHA 3REVB 4ELMA 4MJID 4X6DF 2CR6A 2XNAA 2X89D 5F7UA 2NXYB 1S7QB 1Q0YL 1QO3A 4PRPA 3TVMC 3QIUA 5DJ0B 4MSWA 3RWGB 4M1GH 5HI4D 5JXAL 5E7FA 2XZQH 2GI7A 5EC1B 3TJEL 2ESVE 3ARBB 4AM0A 3MCLL 2VOTA 2YOCA 3GSQA 1G7PA 4KK6C 3T08A 2R0KH 3S98A 5JHLH 2ZSVA 5F7KC 2XWBB 4FFZH 4DOHB 4N9GA 1EH9A 3QEQA 3LKSB 4I0PC 2XG4A 2OZ4A 3VXOA 3BJ91 5GISH 4HS8L 3H0TB 4ZS6D 4LF3B 4OFIA 5EUKA 4QRPB 1JTOA 4I4WA 4DUVA 3GUTA 3CNKA 1LGVA 3RGVC 1AD9A 3GBML 2X4OA 1OARL 3B9KA 2KZWA 2DD8L 1W72B 3CMOL 2V7HA 5GGSA 2CIIB 2FH6A 2BCKA 1PG7H 3QFDB 5DEGB 1J0KA 3GKWH 4HKXB 3VA6A 5I19H 1JJUA 4JM2A 1C08A 1DQQA 1JPST 1VACA 4UINH 2D9CA 1MRFL 4YUEH 4NWTH 5I0DA 1U3ZA 4OLXH 4OLUH 1CGSH 1KLGB 1LO5B 3U7YL 5E8OA 5DMGC 1YNLL 3WO4B 1N4XH 3LKOA 1KB5A 3DROA 3QYCA 5C0BA 4F7TB 4FS0A 3E8UH 2EKSB 3GHBL 3UTTA 3C6SB 2B5IB 5LGJA 2XV6B 3GDBA 3OPZL 4LLQA 6CGTA 2GJJA 4JN1L 2IAMA 3D69A 4KKCC 4Y2DD 3HRPA 2FJHB 3JVGA 2ESVB 3VD4A 5SWSD 1S78C 1G7JA 5IMMA 2YN3A 4E42A 4FQQB 3OBAA 5A2FA 4Y2DB 3VDCA 3CZFA 1PQZB 4U6XA 3OR7B 5CJ5A 1K6QL 4IOIB 3C6LB 3O6FD 3UBXA 3BRDA 3W81A 3TVMB 2R2EB 4N8VG 4WDIB 1MCNA 4NN5C 2YSSB 2VN7A 2R29H 3X17A 2EXYC 2IFFL 1MCOH 2OTUB 1F11B 4BSJA 1Q9WB 1VENA 5I76B 3PDGA 4K8RL 3MCKB 4DUXA 2EDHA 5B8CA 2AV1B 3D6GA 3KPLA 2H3NB 1WBYA 1J1OH 3PP3K 1N0XL 3TBSA 1KUMA 4DN4H 1C7TA 5CEXB 4TUJA 3QDJD 4XCCH 4YAQA 3KAAA 1I4FB 2P24B 4G7YL 4DAGL 2YPVH 1UQSA 3QEHA 4P49A 2B20A 2LU7A 1KELL 5I8CB 4YZFE 4P2RD 1II4E 3RL2B 3ALXA 4G42A 4XI5C 3BX7C 5E08H 4P2RA 1IC4H 4M61B 3EFDL 1NJ9A 1C12B 2E8ZA 3RDTD 4APQC 3VFUB 1FFOA 1AXTH 1I1FA 2PO6C 2FL5A 3F7YB 3P9LA 5FECB 3L3IA 2X1QA 3EO0B 4Z7QF 4QXGL 1TCRB 1OT1A 3CVHH 4AENB 2VDQH 5KS9B 3D39E 3G08B 15C8L 3WL9A 1S3KL 4PRPD 3OPZH 1ZHBB 4XVUC 3L6FB 5MEOB 3PP4H 3BKYL 1AQDB 2IBGA 4EVNB 5ISZA 2XKUA 2F9BT 1WBYB 2IEPA 5CINL 1CVSC 1MCIA 4MVBD 1RU9H 1F2QA 4KRLB 4Z7OF 1RU9L 4GMSH 4AJ0A 3VFVA 4WWKC 1PKQE 1CGSL 5C08D 5IW6B 3O6KL 1SJHB 1LEIB 2BNUB 3EO1B 3HCVB 1NMBH 3BOVA 3QXAB 1QR1B 3RTQA 5T1DH 3S88H 15C8H 4LCIH 1IKNC 3K7UA 2PW2B 4KRPD 5EUOF 4LARL 4FFZL 3ZT5A 1NCNA 3QFJD 5ESVA 3ZKNC 5ADPH 1U8OB 5KOVC 1ZTXL 2DQCL 4OGYL 4ZTPH 1RZKC 5EC2B 1JGVH 4HKBB 4O51A 4ZO7A 4DEPC 4JM2C 3FT4A 4WW2C 3RWHB 1NEUA 2PNDA 1T1YB 1Y6KR 5C9JB 3MV9E 4ZO9A 5E70A 5AEAA 4GKNA 5BW7C 2DICA 5JUEL 1H3PL 3QXTA 3QUZD 4L3CA 5J11B 4LLMA 2IAMB 3D69B 4C4KT 1WQVT 5EZIH 1U41A 5TQ0L 1T7WA 4ZPVB 3FFCB 4MLSA 4Y5YB 1NCDL 5FB8B 5CLWA 2R1WB 2A6IB 5D1QD 4MMXC 3SKJL 3BWAA 3I75B 3LKPB 5J6HA 2HVKA 1DBJH 4NQEB 4BK4A 5LKNA 4IDJL 5ANMA 1NFDF 4S1SL 3RNKA 3FAWA 4MAUH 4N1EA 7FABL 2ARJB 3X11A 1EERB 4N9OB 4AT6B 2P8PA 1KTDB 1WVZA 3BSZH 4JFFD 4QHNA 4AH2A 1ZA3B 3LCYA 4LOUC 4XCFH 3JV6A 3QAZB 3HI6L 2BK8A 4NNXB 3WJJA 1FIGL 5LAXB 3ZKQD 1U3HD 3MODL 3FN0H 2Z35A 2PO6B 4LLDA 2VDNL 4QHMB 3JSSA 4RA3A 3LN5B 1QYGH 4PPTA 4HWBH 2EECA 3QFDA 1CDJA 2VDOL 4K3JL 4Q6YA 1R5VB 3IDUA 4OZFB 1HE7A 1W72A 4KZDL 3HI6H 3QEGL 4K9EL 4PJGA 1DLHA 4PV8B 5ID1B 3K0WA 1RUQH 4OZIF 4UTBH 3WV0A 1G9ML 1RUQL 3MV7B 1NKRA 1DUZA 1WIPA 3CZFB 1CF8L 4PJFF 4Y4KC 3QBTB 6FABH 2OI9C 1T0PB 3H3PL 3RVUD 4PJGF 3ZT7A 1IC1A 1WBXB 4AG4H 3X13A 2H41A 2DWEA 4Y0GA 3LKNA 4PJDB 1GZPA 3RZWA 4XP1H 2NY5H 5EU3A 3EOBB 1S5HB 2BNQD 1WFOA 2F15A 4LEXH 3G5VA 5GS0C 1N4XL 2AEPH 2EKSA 3UDWA 2V5YA 5J1AA 4ELKA 2DLFH 3IS1X 2RHEA 3WXVL 3D2UD 4WHDA 4ZO6A 1M05B 1GGCH 2YK1L 2NY5L 4QXUL 2EKJA 2QKIB 1GZQB 5JMRA 3NCYS 4EBQH 4QOKD 4KKAC 3QO1A 4YZFF 5DYOB 5IFHL 1O0VA 4FQHB 4TVPD 4Q7DA 3HI1B 5KN5B 1FRGL 2G2RA 2I60H 4FFWC 4POZC 1WZ1L 1OAZL 3FT2B 4MDJA 3H9HA 2VIRA 3NH7H 4F58H 2XTLA 2ZSWA 4R6UA 4RAHA 3OX8B 2ICEB 3BUYA 2VO5A 2HT2C 4WFGD 4M3JA 1YEEL 3LS5L 3F65A 3ES6B 2EDYA 2IPKA 3QWOA 3LSOB 4JLRA 2NR6C 3ARTA 4OD1H 3KLSA 3EO9H 2NW2B 3HNSH 1CFQB 4ISVA 1UM4L 2HRPL 3QG7H 3GFUA 3FN0L 4PJXB 2AJZB 5HGAB 3KPRB 4LQ1A 4IMKA 3MV7E 4L29A 1NAMA 1OAUH 2IPKB 1K85A 5FKAB 5TDPB 4C59B 4YNYB 4PD4J 4AEIH 4GAGL 2J1KA 4ZUSB 5CGYC 4M7KH 1CZ8L 1FVDA 2BSTB 1WGOA 4KXZI 4YGVB 4DQOL 3TNNB 3SGDH 4DK6A 2NZ9C 5BVPL 4QRRB 4DTGH 1DVFC 4OZIA 1FH5L 1CQKA 4FABL 1E6OH 4FFYL 3LB6C 4Y4KD 5FYLH 1AXTL 5T33H 4U7SA 1U9KA 3U6RA 1F6LL 3RVUC 4ODUB 3UC0L 3CCHB 4OZ4B 4KWUA 5B3JE 2X4SA 4HJGA 3IETA 2QKIA 1FZOB 2AK1H 3K1DA 3QJFA 4FXGA 2V2XB 4GQPH 3V4VH 3CFEA 5DR5H 3B9DA 4MHHI 5DD1L 3OXSB 3U9PH 4KU1A 1IAOB 3D3VA 1A1MA 2F8XC 4UMGA 2AJVL 4L3EE 4CGTA 1KJVB 2IMMA 4K94H 4ODTH 4FFVD 5CSGA 2NNAB 1F4HA 5J1SC 4HK0B 1BZQK 1K4DA 1RULL 3QIWC 3H7BB 3OMZA 1MCCA 2EIZA 4KKAD 2CK0H 2DYPD 3MRCA 4YE4L 1EFXA 1X44A 3ZDYF 4LPYA 2CIKA 3ARBD 2MHAB 1B6DA 1CDCA 3QDMD 1BBDH 4OF8A 3U7WH 3Q5TA 4KJPD 2Y6SC 3ETBF 5T3XL 4K7PH 5DFVC 5DJDA 5A2KH 4PJ5E 3G6JA 4BH8B 3KPRE 2JCCA 4MQ7A 5TE6L 1UT9A 2DBLL 4ONFL 1JWSB 2OYPA 2ZKHH 4EI6A 4LEXL 5F9OL 3HNTL 4NN5B 3IFNH 4LSRL 1KPRA 3LPWA 4X80L 5D1XB 1C5DA 1JI2A 4OZHF 4P23C 5JR1L 3MJ8A 1HXMB 2UY6A 4NM8L 5CWSB 4QRRE 4WTXA 4PY8I 3CDCA 4XBPA 4ERSL 3R8BB 3O3EA 4PTUB 4TRPL 3L5HA 4N5ED 3W9DA 2AK4B 1QFWM 1D9KD 1Q9LB 4ZYKA 3SDCB 2RQ8A 3TYGL 2YD9A 3V5KB 2D0GA 2ZG2A 5CFHA 3K3QA 4PJFE 4LASH 2DF3A 2AW2A 4ESKA 4X5XB 3MA7B 5F9OH 1ES0A 2HJLB 4PJGB 3S4SG 4M3KB 4F7PB 5KVFL 2C1PB 4D9QE 1Q0XL 4NQED 3MV01 3BPLC 2J4WH 4L3EB 4Z7WB 4PREA 4APQB 5IVXE 3SE9L 3FOMA 4N0YH 4NKOA 4NWTL 2EZ0C 4LLDB 5BRZE 2XQYK 5TGBB 3QWRD 3BPNC 4EI5D 4XX1E 1RUMH 5E2TL 4EI5A 4APQD 5IQ7H 3QP3A 3NFSL 1JMZA 4Y8AA 3DUUA 4QCIB 1OAQH 1A1MB 1NSNH 5DEFB 5DK2B 3PQYA 2GYSA 1UADC 1Y0LB 3L3KB 2P4AB 1F6AB 3NIGE 3KXFE 4FOMA 3WYRA 5I2IB 2V5RA 4MXVE 3QJFB 2V7NB 4FXGB 4RAVA 3WUWA 2QQLH 4HAGA 3LEXB 1NUDA 1H5BA 4RBPK 3EOAA 4WWKB 3BGAA 5EBLA 1PZ5A 2MOVA 4DZ8B 5ICYB 2JB6B 3ZSSA 5GGRB 4ODVH 2A2QT 3WKNA 5KS9E 4HT1H 5C2BH 4H5SA 5EWIL 4U1IB 4YPGA 3NAAL 1CLOL 3GSXA 3LQZA 4NKDA 3EDDA 2VDML 4YNYA 4F8TA 3MLZL 4OTXH 3QCVH 3ZE0E 2FYYA 3RVXD 4LCIL 1YUHA 4L29B 4E5XB 1PYWB 5BCAA 1RK0B 4ODSH 4K71B 3VWKB 2PW2A 3ZKND 4I2XA 2VZ3A 2DQIL 4G5ZH 1JHTA 4JM4L 5SX5H 4OFYD 5B3NA 5F3BA 5I1LA 4JLRB 5MENE 5GGUA 1HKLL 2FO4B 4QOKB 5J11C 2CMRL 1IEBA 2FJGA 3QUYB 1HKLH 2D7OA 3BZDA 4P2RB 2H8PB 2ICWA 3C5SA 1ZLSL 5K93A 3SDDC 2D7TL 4O4YH 1RK1B 3RIFK 1EFXD 1JNJA 1YEEH 2FDBP 3LS5H 1JRHI 1WBZB 3QEHB 5IV2A 3SCMB 3AFLA 3KJ6H 1TTUA 4QRSA 2EDNA 2APWA 3E6FA 5GQBA 2NTSP 1QVOB 1YEHL 4JAMA 4F58L 3MRPB 3QO1B 5J13B 4HHAB 2I9TB 3GB7A 1BBJA 2YUWA 4EI5C 5KS9A 5EA0L 5C8JB 1A3LL 1LP9B 2ZCHL 3BPLB 3MMEB 4AIZB 5EUOB 4WCYL 4OBRA 4GKOA 4LSRH 4LKXA 3WD5H 2J88H 1MIEL 3BPOB 2AV7A 4LLVA 3ULVE 1NJ9B 4J8RB 2BC4A 1U42A 2F54A 2QQKH 5JO5B 3UXFA 2CJUL 3OJ2C 5DZOA 5JMOC 4PR5A 5IB4B 1HOCB 5EO0A 3CLFL 5BS0E 3RWFA 4FHBD 2A9MH 3X13B 1HIML 4YHZL 4OCMC 4ELMF 5F7DB 3B9KC 1OGAD 2NY0B 1AO7B 1IGYA 2FATH 1EZVY 4LQFH 4ZS7H 1TVBA 4YDIL 4RQQB 4BFIB 5GJSL 3VXMB 4PV8A 4LFHG 1B0WA 5IG7A 4X7SL 1ONQB 2NY0D 3UBXI 5EOTA 3IJYB 4NPYA 1DE4B 4NJ9H 4LSVL 1R5VA 4FQLL 3GIVA 2MWCA 3ZZ1A 1EHAA 4OIBA 5DXWA 5DD1H 5DJ2B 3LY6A 1RHFA 3LZFL 1KTLA 1JTPA 2HA1A 5KAQF 1WWAX 2J5LB 4G6JH 5K9KB 2JELL 3U1SL 1FYTB 2J8UA 5C92A 2WP3T 3ZYOA 4U6XB 5ANMB 1ZK9A 4HS6B 2DQDL 3M1BA 4XGZA 1MEXL 3KYOB 1LP9E 2O5ZL 1ZSDB 4L4TB 3ZHKA 1FNEB 5FUZH 3KR3H 4G9FB 2B1AH 3S34L 3C60C 4LVNB 5E1AA 4Y4HB 2CO6B 2R23A 3ABZA 3CDFA 3CFBA 1HEZA 4AQOA 1T2XA 4URTB 2HT2D 3MV8E 3GMQA 1T3FA 1EMTH 3FB5B 2C4XA 2GQHA 5BS0B 4RGOL 4JHBA 1NFKA 3L3GB 4HD9A 3X12A 3ZL4H 5J13C 1BQHB 4P2QB 5EIQA 5E7BA 2D31B 3ZO0A 3BPCA 3OR6A 4L1HA 5E8OB 2B7DT 1AO7E 2OJEB 5F1KC 3G04A 3FO9B 2X44D 1IJ9A 2GITA 2Y06H 1B0RB 3SDCD 3AU1B 1VCAA 1HHIB 4UTAH 3RWFB 2R2HB 2RCSH 4L9LB 5D2NE 2A6JA 4E0RA 3SGKC 5DQDL 5JW4R 3MRJA 3T65A 3QIBC 4JZOA 3O2WL 4PUBL 2A6DA 3JWDL 5F7EL 4Q9BA 4X6BA 4K3DL 5CEZE 1U8PB 3FMGL 2Y25A 5DK3A 5EUOA 3QUXA 3TO2A 2XNAB 4K7FB 1FL6A 1ONQA 2NZ9D 1I8KB 3HTLX 1TVHA 4HMEA 3T0DA 2NY0C 2NLJA 1LD9A 3LB6D 1LO2L 3SGJC 5D9SB 1ZVSB 3SGDI 3WJLA 1EAPB 1XR9A 3D0LB 3IDIA 4JFEB 2FIKB 1KC5H 3UC0H 3S5LB 2YC1B 5LCVL 2XA8H 3QWRA 5SWZB 3ULUF 1GC1H 5ANME 2BHUA 3VWJC 4AENA 1N59A 4MNHA 4HKZA 4JG1H 4NO3B 3WKML 5HPMA 4M43H 4FG6C 2HLAA 3QCTH 4X7FC 5D2LA 4JRYA 5I16B 4P2OD 3FQUB 3KG5A 3LN9A 4MNQE 1JUFA 2EDTA 4NQDD 3STLB 2FLRT 5TQ2H 4WEBH 1BFTA 1YEDA 3KWWA 4M6OL 4XNZC 2J5LC 4P3CH 4JFHD 1KG0A 1TETL 3HE6C 3QDME 5IMLB 5DVKA 3LRHA 4JPWH 4OUUB 3TNMB 4HIXH 1UG9A 5T1KD 4MLIA 1KCVL 4G6KL 2LAAA 4OIIL 5EU5B 4BYHA 5GJTL 1DR9A 1FFQA 2W07A 2E27H 3O4OC 4LVNC 2EDBA 4JFPB 4LVEA 1FG2B 4NDMA 4UNTA 4XMPL 2BVQA 3D85B 5BV7B 4PJDF 1R3JA 1A21A 2QADB 4HIJB 1N2RB 4AIXA 4GBXB 3SDCC 3S36L 3O11A 1IGCH 2G75B 5I1JL 4RAVB 3U0TB 3N9GL 1CFSA 2WLZA 1UCBH 3QIBD 1UH3A 3VWKA 2FWOA 1P53A 2FSEB 4PLKC 1BVKA 3VXTB 4GAYA 5J4MA 4OLYH 4KFZC 1AJ7L 4KVNL 1MVFA 4X98B 5DK0B 4D9LH 5EZLA 5LGHH 4FQXA 4I0PD 3ARYA 3RWIA 1YPZB 3QIBB 3O6LL 1WAAF 2CKBH 4GAJL 2A77H 4QHUA 4OKDA 1Z2KA 4B5EA 5CILH 4Y2OA 2ESVD 4LLAA 4U1IA 4K23L 3DO7A 3BPNB 3PV6A 2A74A 1IC7L 4Y4FA 3O6FB 3DHMA 4XCEB 2H2SD 1N5YL 2DQHL 3G6AB 5C0CE 2CXKA 4MA8H 3MTRA 3VA2C 1IC5L 4C56A 2GT9A 4Q0XL 4KK5D 1VFUA 1G6RB 2A9NL 2EZ0D 1CU4H 1M1SA 5FHBL 3HG1E 5D6CA 4DZBA 1ES0B 4LSUH 4P4KC 1PLGH 4PJHB 4KJWC 4MWFA 5FGCE 1A9EB 3QDMB 3ZKMD 3V0WL 1T03L 1FG9C 3PL6A 4HW6A 1UB5A 2JJWA 4ONGH 4TQEL 4WFED 5DGRA 3E8UL 3SDCA 2PXYC 1AC6A 4ZQKB 3EKCA 4EEEA 4YDVA 1ORSA 3AXLB 3HS0A 1I3RB 3X14A 3ROLB 2F53E 1OAYH 4GH7B 5DJCB 1XEDA 2WM0A 1S9YA 3IXAB 3VGBA 2PCPA 4UDTB 1L0YA 4OCWL 5D1XD 2VXSL 5BRZD 1KPRB 4KTDL 2PCPB 4XAWL 9CGTA 4ZUWB 4KUZL 4KV5E 1YMMB 3HE6B 5KG9B 5FOBB 1JWSA 4KKCD 3DSFH 3VG9C 2DJUA 4MA3A 4IS6A 1MF2L 1A7OH 3SGEH 4JG1L 4J3WA 2X4OB 1H8NA 5I8EB 1S78D 3NCJH 1H5BC 4I1NB 5HYQA 5IJVB 2ERJB 2CH8A 5D72L 4L4VA 4BKLA 4U7MA 4JE4B 2XA8L 1SYSA 5DUMH 4PJBF 3RDTB 3U0PB 3BDYL 4HFWB 1T2QH 1CN4A 1ZLVH 3TPUB 5ACZA 1PSKH 1ZWIA 5K9OB 1YEKL 4MJ2A 4G3YH 5JIHA 2WLYA 4EN3A 3BN9D 3H6JA 5T5NF 3O4LD 1CLYL 1YJDL 5IF0A 1Z0NA 4EN3D 3ZYZA 3SDDD 4PJIE 3HG1B 3D25B 3OKLB 2YWYA 3EAKA 5C6WH 3FQWB 2DAVA 5HGHA 5FGCB 4YPJA 5CEZL 1LNUB 1OGTB 4TUKL 1FRGH 3P9MB 3RVTC 1FGNH 5E6ZA 2O5YH 2AJUL 3GRWA 4TUOB 5CJOH 2JKXA 4C83B 2MHAA 3LEYH 2F53B 5IMKB 4R8WH 2G75A 3BQUD 4NZUL 3H7BA 3C2AL 1FFPB 5GGVL 1B4JH 3FB7B 1UXSA 4NC0B 3UTPE 4HUVA 4KRPB 5FM4A 1DEDA 3VD3A 4X7CC 4LASL 4M5ZL 2VZOA 1RUML 5J3HC 3NACH 2Z31B 1KJMA 4Z7UE 2Z9TA 1S3KH 1WCBA 3PWLB 1G0YR 2WWMD 5EORL 2WBJC 4UQ3B 5EUOE 4HCRA 2PXYB 1UVQA 3BGMB 2ADJA 5FM8A 1CD8A 5B38A 4NC1E 4RMRA 4HBCH 2VH5H 2X4PA 4U7KA 2GSGA 2GTZB 4XP6L 4HWEH 1JF1A 4XVUD 1U8PA 1I1CA 4G80A 4LPXA 2GSIA 1F4XH 2VDOH 4JFFB 5GIRB 2IQ9H 2H26A 3VFOB 1YNKL 5MHSD 4R4FL 4Y5VB 4OLWL 4QLRA 5GRWA 3IKCA 3P11H 4LSSH 4RISH 4PJIB 1B0RA 3VXME 3VU2A 1A3QA 3DX6A 3MOQA 4XMLL 2DM3A 3CU7A 4Z8FH 2YC1A 3UTSD 1J5OL 2GKIA 1FBIH 3CJJA 3VH8B 1OY3B 5L9DH 1UXWA 1KT2A 1RULH 2M8XA 4GS7B 4C4KO 5IMOB 2V5SA 3F8UB 5J0BA 3C60B 4FQIL 4Y19D 2W38A 5HVGB 5BZWA 4CRPA 1PJ9A 3QFJE 4XWOD 4XMLH 1T4KA 3UP1A 4NSKA 1HZHL 4P57A 4UV7H 5JPMA 1C8PA 2AJVH 4EIZC 1OF2A 3VXRE 1GGTA 2ENYA 5T3XH 1Z9LA 4QHLA 1FYTE 1NGWA 1QSFE 1YEKH 4PGBA 3O4LA 4I3SL 4BSWA 4JZOB 1NC4D 2O5YL 3LMJL 1A9BA 3FT2A 4XC3L 3MRJB 1L9NA 2OR9H 3QA3A 3E1F1 5FUCC 3CX2A 1SBBA 4L4TE 2X7LA 4QRQB 1DUYB 1NAML 3KPNA 4L9LC 1FDLL 2ENSA 2WQ8A 3QDJB 1BGXL 1DEEA 3LRGA 4OF3A 3ARFD 5SV3A 5LWYL 4YHMH 2WWMC 2PUQT 4RMUA 2NCMA 5GRXG 1W72L 2WBJD 4NJAH 4ENED 3CAFA 5F9DC 4TTDC 3PF2A 2DQTH 1J8HD 2DQFA 5DHVA 5EOTB 3INUH 4JFFE 3B2UD 1I9EA 2QHRL 1IAIM 4MXQD 4J4PD 5DVLA 3UJIL 4GLRH 1L4IA 4HH9B 5D2NB 5DMKA 1E6JL 1J88A 2CD0A 3KPTA 4HT1L 4MD5B 4NQEA 5I1DA 1JMXA 3TCLB 3BMVA 4OZHB 4NNYB 2BY2A 1TLKA 1DLHB 4UINL 4AEIL 2CDEB 2EDJA 3V0VB 1IAIL 1RJLB 3BEVA 3RNQA 1NCAL 5E94A 1MY7A 4FQCH 5INCB 2AERT 3GMMA 1U8KB 4MMZC 3O41B 1VFAA 3MOAH 4XNZB 4K3EH 3MCLH 4NNXA 4OD2B 3EO9L 2CLZA 4JVUA 1Z0MA 1OM3H 4JFEE 4LL9A 3MV11 4RWYH 3VH8G 1UKSA 3SQBA 3C09B 3RY6C 3O3DA 35C8L 3RVVC 1DUYA 4MNQD 3VXRD 3DTXA 1HHKA 4LRIA 4GUPB 2P5EA 4PRHD 5BXFA 3RTQB 3PWUB 4N8CL 2EIBA 4XPAH 3QZWA 4MNQB 2XPGB 2XZAL 1OWWA 2J12B 4P4KA 1OCWH 3O8XB 4X8JA 3N1FC 2EDLA 2YN5A 1UM5L 1V7NH 5JO5A 4Y1AE 4N8VA 2AV7B 1VB9A 2NX5B 2P48B 4XP9H 3L3DB 3T2NL 1OLLA 1RK0A 4NT6B 3PABA 3V5DA 1CT8B 1EEZA 1AHWB 3TF7C 4KPHH 3TESA 1S7XB 1QSFD 4ENEC 1RI8A 5EOCJ 4JPVH 1AHWA 1QD0A 4MX7A 4NNPH 2PTVA 1MPAL 4NNPL 3BD4A 4UIMA 2AJSL 4NUJA 3L3IB 4WW1A 5H2BB 3V7AG 2ZOKA 3WIHL 4M6MH 5D7IF 5IUSA 2QBWA 1IAKB 5HHMD 3UX9B 4V1DB 4L4VD 5I75B 3HLAB 7FABH 4BUGA 3OKNB 4K7PL 1KCVH 2BERA 4G6KH 5TF0A 4MA8L 3RZCC 4OKVA 1TFHA 1P7QD 3EYUH 4XNQA 1YPZE 5HXMA 1AFVL 3RWCA 3CUPA 1JP5A 4RRPA 1MFAH 1JPSL 2I5YL 3O3BB 3P0YH 4HWNA 3FRPG 3P30L 4HQQH 5LGHL 1KXQE 5C0CB 2R0WL 2EC9U 3TBYB 4S0SD 4JZJA 1KOAA 2VL5B 1HH6A 2EIDA 1RD6A 1JPTH 2A0LC 1D9KB 5I1CL 5J1TC 2DI7A 4PGJA 4L3EA 5E94B 3T0ED 1INEL 2ITCB 4PRBA 2AI0L 5K9QI 3TT1H 3BEVB 3Q5OA 1XGUB 4LPTA 1TZGH 2J8OA 3GSNB 4LDOB 4MNQA 4JGJA 2RIKA 4NC1C 4H25B 4YFEA 1KV3A 1UQSB 4FABH 3EDFA 3H3KA 4MD5A 5I2IA 5IW1B 4NM4H 4KTEH 3RIFF 3GHEL 2FR4A 3NN8A 2IPUK 1G7IA 1G9NH 2C3GA 2Y6SD 3EDEA 3D0VB 5C3TA 4W4NA 5DK2A 4WI6A 2CSPA 2ZCKL 1DN0B 1SJEB 2FJFA 3EYSH 3QSKB 4LVOB 3SGEI 1X5JA 3RY6A 4XCNB 4N0FA 1SHMA 5DUML 2H45A 3ARQA 3ORJA 3VGAB 2YS4A 3SEPA 2HMID 4LSTL 5IHBA 2ZJSH 5AUMB 2EIEA 3NFNA 1U8QB 3PP4L 2ICES 2HTLD 4I3RH 5I8OL 2EDKA 1AH1A 4A6YB 3S34H 5DO2D 3LOWA 3N1PC 2APXA 4P23D 3UTQB 4WI5A 3GK8L 8FABA 1MEXH 4J2XA 4DW2L 5JXEC 4J4PA 2JK5B 2X9YA 3HMWL 4OCRH 4KDTA 1JGUL 5IVNA 5DMKB 1BIIB 1S7VA 2NY2D 4I77L 5E4IA 3VDAA 4KJQC 5HYJD 5TE4L 1NGWB 2J8UE 4PB0H 5DUBB 4PG2C 5DEGA 1XF1A 3KR3L 4GRMA 2APBA 4ODWB 5C86A 4YK4B 1FZKA 4G7YH 2Z31C 3OKKA 4KZEL 1EFQA 4JZNB 4NQVA 3QH3A 1KJ3H 4ZQKA 2Q87A 3T2NH 4HQQL 5EUKB 4FA8A 1KN2L 4PTTB 3NIFE 1IT9L 4G6ML 5EZOL 4PJ9A 5E08L 1H3XA 3R1GL 2HFEA 2F74B 5DA4A 4G6FB 4NZRH 4YHOH 2C9AA 4OZ4A 2BRQA 1IFHH 2FEDC 3S36X 3L3HA 3IKCB 1J0IA 3U6RB 4QXUH 1O7VA 3EYVB 3JBG7 3RKDD 1JNNH 1IGFH 2V5TA 3QZWG 4XPAL 1QSEA 4M8QB 1EFXB 4XCCL 1LDPL 3HZVB 2KQMA 3WFCH 1MHPH 1X3DA 4WI9A 2BCKB 3NZHH 1YPZA 5DSCA 5ITBL 1CIUA 3FO2B 1T4KB 3TM6A 4TSCL 1TIUA 3MFFA 3MJ7A 4ZUUA 2X4PB 5F89B 4Y16B 5EU6A 3STZA 4XP6H 4KAQL 4PJAF 3NOIA 3LKQB 3S36H 3M8OL 3UYRH 4NUGH 2V6HA 3H3PH 4LSSL 4RISL 4OI9A 4P5TC 1U0QA 1OP5K 3FCTB 3MREA 3SPVA 1A1NB 3LEVL 3RIAF 1A4JA 3RVXC 4M9PA 3P77A 4HKJA 3NACL 2H26B 4UILL 3VFOA 3GJFB 2H6PB 2VISB 1F4WL 3MJ9A 5F9WB 2DIAA 5GRYA 1RPQA 5ITBH 1UM5H 4G6AD 4RMQA 3QNZB 3MLRH 4ZFOL 1N6QL 2DBLH 4ONFH 3BW9A 4JPVL 1OSZB 2A6KA 4O9HL 1JWMB 1G0DA 1FO0H 4OZGE 4U1LB 5AYUL 5D1QA 2F74A 1KB9K 5HDQH 1U6AL 2PKDA 1HH9B 3DJ9A 3U46A 5EIIA 4N90D 3NPZB 5F3HB 2I27N 4D8PB 1A14L 4X6FB 1CFQA 3EYFA 5ICZA 3KPPB 1QSFB 3CK0L 1TMCB 4JZNA 5HI5C 3F58H 4CKVX 3GMRA 5I1GH 5DLMH 3KYKL 2FECI 5GSVB 5BV7L 1TVDA 1UXSB 5GRZA 2NQCA 1MWAA 2PTTA 1BFOB 1WT5A 3RDTA 1ZEAL 4N0CC 4L1DA 3D87B 1BJMA 5E2VH 4Y4HD 1WTLA 3QR2A 1G9NC 1BIIA 1YDPA 1MCPH 4RWHA 1ZV5A 4L4VB 4BK5A 5DYOA 3BH8B 3BYTA 3MACH 4RGNB 2VLJA 4KMTH 4OM0H 1P4BL 1ZHKB 2O61B 2UWEA 1T1ZB 4YXKH 3GM0A 1A7OL 5I1IH 4S0TD 3S7GA 1MVUB 4JDVB 5EO1A 4HH8A 4RGND 2O26U 4G43A 3VXNB 2W60B 5D7JB 4JRXD 3PXJA 3IXAA 2R4SH 2X70A 3D5OF 1X4XA 3C09C 4L9LA 4XPTH 5JHLL 3BP4A 4F33A 4LNRB 4AT6A 2JB5L 5D72H 4OZGB 4U0QB 4PRAA 1NSNL 4PG9B 4ELME 5E6YA 4XVTH 3RTQC 1P7HL 4P5TB 1NL0H 3EFDH 4I9WD 1KJ2H 3FO1B 1U8JB 3PJSB 4LMQE 5FB8A 4PJHA 3H8NA 1MLCB 3B2VH 1CICB 1VGEH 4H0HB 4IS6B 1I8LC 3HZYA 4Q6IC 3WMSA 5GHWH 1I85A 1NEZB 5F9WC 3CVHL 2EDWA 4ZO8A 3BJLA 1BOGB 4L3CB 1FO0L 5AYUH 4OM1L 1B4RA 3LRSB 3IDJB 1KIRA 4J1UA 1G6VK 5DZLA 1FNEA 1FLRL 5DMIL 2OTWB 1H8SA 4LDLB 1V3LA 1NAMH 1X6NA 4E41E 1IILE 3VFMA 5HGBA 4MA7L 4X80H 4KI5D 1ZANH 4Z77A 3RAJH 1FGVL 2C3VB 2EYRB 4ODVL 2R1YA 3QT2A 4WTZG 3HNVL 4PJ8B 5JW4N 4ZXBA 4O00A 1U2CA 5L9DL 2OR9L 4G8IB 3TA3A 5EDXA 4NHUA 4A2LA 1UB5B 2HT4D 5ESQA 4OZGF 4P9HC 2R0LL 4OKVB 2H32A 1GHFH 4QXTA 4P59L 4PJ5A 4GW4B 4U2YA 4M7ZC 1JPGA 5F6HJ 2I9LA 3FQTB 1AY1L 4ZSOB 3P4NA 4HMCA 2Z91B 5CEZH 3HMXL 4JFPA 3MC0A 3W9EA 2EDOA 1AGBB 3ULVL 4XP4L 5TDOB 5IJKC 4JY5L 5I8KH 4GMTH 2FHBA 1LEGA 3PWPB 4NN6B 4QO1A 3QDGE 4JN2A 2ATPB 4MAYB 4KQ4H 4FQ1H 4M00A 4RGNC 2QADD 1A6TB 2ZOLB 2ID5A 1YEIH 2CUMA 2CLVA 2YMXH 1KB5H 4WO4C 1RUPL 3GSNA 2WSKA 4PJCB 2B4CL 3PABB 1XGUA 5AZEL 2Q6WB 4I0CC 1EUUA 1KXTB 3PL6D 4V1DE 5CJXA 2YPLA 3DGGA 2J88L 1DDHB 5D7JC 5DDHA 4WCYH 4OCNC 3WFHA 4XWGH 3QEQD 4H26A 4UT9L 4M61A 1ZLWK 5EA0H 4ZUVB 2CRZA 3HUJA 3P73B 5D1ZA 2VE6B 5I9QB 3RL2A 4AY0A 4NFDA 3O8XA 2LU4A 3ALPA 4ERSH 3OZ9H 1FFNB 3ARGC 1CGYA 3QZWB 4HGMA 4GAGH 1R3LA 2F19H 1HZHH 3EZJB 5E8PA 5DI8A 3SKJH 3MRLA 5D2LE 3UPAA 3PWNB 3VGHA 4TUJB 1ZVSA 5D7SL 1EGJL 2J6EA 3G08A 4Y16D 1FFNA 3L95A 4MZ3A 3VG0H 3U7YH 5KW9H 1WWBX 4ZUTA 1XF4A 3MBEB 4R9HA 5JQHC 3HUJB 4OD2A 3HZKA 1RJYA 1A6VH 2CUIA 4YUEL 5DFTA 4KKBD 3SDXA 5ESQB 3L3OB 5DJZB 2YBRA 4DJMA 5HHMB 4KROD 5TDNB 2VDLL 2VC2L 3MJ6A 1V8HA 2R2HA 1MCQA 1P2CA 2WWKO 1TZGL 4IOIA 2P5WA 3FQRA 4K94L 4ODTL 5DO2C 3EDJA 2ZUVA 2FBJH 3AROA 1JK8B 1M7XA 5JXED 4WV1A 4PJCE 3A6CH 3B9AA 3O9WD 1I3VA 1NLDH 3QG6A 1JZ6A 3RUGE 3TO2B 1T5WA 1I9RL 4NZTL 4ORGA 4O58H 1PAMA 5IFAH 4Z76A 1XGRA 3VFSA 4XVSL 5JTWA 1I9IH 2R0ZL 5JIIA 1G7QB 3SBWA 2AQ1A 1TTGA 1YQ2A 2DKSA 3PL6C 4P2OA 2XWJB 3MBXL 4ZFZB 5T1MB 4GLRI 3V7AE 2ZP0T 3LKOB 3E3QE 1EBPA 2YRZA 4NYLB 4YXLL 3BDXA 3KLHC 3CLEH 3C6LA 3MA9H 2P8MA 2BHZA 4PJ8A 3OF6A 3WNNA 5DQJA 3PP3H 3WNKA 4J6RH 2VABA 4JVPA 4C55A 5EOCH 1VACB 2XWJA 4AEHL 3TEUA 1VPOL 2CPCA 2X05A 3I3DA 3CFIC 4MD4A 2BRRL 1P4IL 4HS3A 1IC5H 4FFVC 3IDJA 3EYUL 3HUJE 3IU4L 5E99H 5JPNA 2F19L 3GI9H 2FRGP 3IU4H 5EULV 5KVFH 2F8OA 2QQQA 5IW3A 2O5ZH 3IJYA 3MLVH 4NPYB 4JKWA 2XOTA 4RBPH 4DAGH 4Y16C 1CF8H 1E4XL 4PLOB 1A7NH 5F8RC 1ZSDA 1SM3L 3ZDXF 3DX7A 3BH8A 4XC1H 4KI1A 1J1OL 5JQ6L 4XWGL 4HS6A 4AL8H 4JQVA 3HC0B 4S1SH 4KKBC 1W2KT 2FATL 4YX2H 2YPKA 4ZAKB 3FRPA 5D1ZC 1XCTB 4V2BA 1A5FH 3DARA 4P5TD 4PJEE 1HIMH 3RBSA 4XCFL 3RUGB 2VRAA 1GGUA 4JY6A 4X7DC 5FUOH 4P4RB 5L88H 4LCUB 4JDZB 2HH0H 3BT2H 1BJ8A 2BDNH 3TO4B 1S7QA 5F8QC 4G80B 3MBEA 3IVKA 1NKOA 5B22A 3OAZH 3BIKA 4KV5F 1NMAL 3FTGB 1P1ZB 5FO7A 1IARB 3BO8A 5EIIB 3O9WC 4HWUA 1IRAY 4RIRB 2X7LB 3EGSB 3OKYA 1OTSD 4PRDB 2VMFA 2VXVL 3NCEB 3RWEA 3PWLA 5C0NC 1H15B 5CZVH 1CFTB 3HE7B 1QKZL 5LGKA 5FHAL 1A6UH 4U6VL 1R24A 4G8FB 3TN0A 1MCJA 3MZGB 1EZVX 5IB3A 1OW0A 4P46A 3TCXA 3FONB 4U6HA 2VLKA 1U93A 1LP9F 3TWCL 4OV5A 4D3CH 1A1NA 1UJ3A 4UV4H 3R0MA 3SN6N 2AVGA 1MUJB 2D7TH 5H94B 1MWAH 3T3MF 5BW7A 3UMTA 1RHHB 3MNVA 3TYFB 3MMEA 1LP9A 2UZYB 1WEJL 5ETUA 3WIIH 1YUHB 3LPFA 1JZ2A 5IM7B 3BHBB 1JZ8A 3GB7B 3LQMA 4MCYA 5IESL 2OSLA 3SQOL 5JOPD 3QQ3A 3MUZ1 3RBGA 2DL2A 4M1CD 1E6JH 1WBZA 3MLWH 2BSTA 2SEBA 4JO1H 4PJ7E 1JF1B 2X40A 1HN1A 4WHTB 1BQLL 1SVZA 2BFVH 5TDPA 4MJIE 5CHNB 4M7LH 4RGNE 4W81A 1K2DB 2R4SL 1DN2A 5IIEA 2OCFD 3BGMA 1IQDA 3LN4A 2VXUL 1J1XH 1QR4A 1EO8H 2UZIH 5IJVA 1BWMA 4LHUB 2QEJA 1T7ZA 2BFVL 2OR7A 1CDUA 1HYRC 2Z8RA 2R1YB 1FZKB 2HFFB 4ODBD 3X3FL 1RIUH 3PGCB 3KXFA 3ECBA 2VXQL 4Q9QL 1XCQB 1FFPA 5I18H 2AI0H 1BVZA 4DCQB 4NKIL 4R97C 3TO4C 2XICA 3H9HB 2GUOB 2VJXA 2WK2A 4MB5A 1S9XA 4R96A 3ZE1F 2XACC 1VGKB 4CN6A 4NO5B 2AGJL 4TUOA 5A2JH 5CD5C 2YEZB 2YRLA 3X14B 2W59A 3ARSA 4LSPL 2HTKC 1GZQA 1JZ5A 4HAFA 3FB6B 2MSPA 2HFEB 3MRKB 2V7NA 2AJ3B 5L2KE 4EKXA 3JWOL 1LNUA 5DJXA 1KBGH 5GRUL 4I0PA 4P2QD 4BQ9A 4A6YA 3HG1A 4HXBL 3HE7C 3KNBA 1FN4B 2W9EL 3TWCH 1DP0A 4UT7L 1QRNB 1BEYL 3MV9A 4LIQL 1NBYB 4JCLA 5IROC 5FUZL 4E41B 1A6UL 1GHFL 2DI9A 3LH2H 1MFCL 4OLZH 1MFCH 1EHNA 1TJHL 5FYKL 3S35L 4PLNC 3BN3B 4WI7A 1RIVH 4MJIB 1W0VA 4I18C 1SEBB 1OAXH 2XN9B 1D6VL 1SY6H 4MQXC 5ICXB 5C0AE 4XRCA 3SKUD 3V8OA 3GRWH 3DUSA 1YJDC 4EOWL 5HYQB 3GRWL 3ARPA 4YHKH 2IQAB 4U1NA 5DK0A 5C0GA 3B2UC 5HYFA 2BNQE 3I6KB 5J57B 5LBSH 4AIOA 1DCLA 3IRPX 4GRWF 3C5JA 1MLBB 1FZMB 4IMKC 2BSSB 3K2MC 3OTTA 4R8WL 2OQJB 2VDKH 4KK9D 5I71C 1P6AB 1U8QA 5IBUG 3O11B 3CFCL 3BSZL 4XXCC 1MWAB 3WHXA 4XP9L 1PY4A 3QDGB 3MJ8B 3GEWB 1QNZH 3ARGB 4HV8A 5HI3C 4ETQB 2C3WA 2Q8BL 1IT9H 1DBJL 1E28B 2Y07H 3AS2A 2NXZB 1CK0H 4X7EC 3SJVA 1T0MA 2CK2A 3JZ7A 1CCZA 3ARGD 5EZIL 3GBMH 1JNNL 3WNPA 3IAQA 4ZFOB 1L0QA 1J1XL 1T22A 3FZUC 1CTOA 3RVVD 2NY3C 4U1LA 3MBEC 4IRJC 4LLMB 2GT9B 4AZ8A 4PRBB 2QQLL 3CD4A 3JXAA 2UVFA 1MQ8A 4MA7H 1D9KA 4UB0L 4NKMB 2KH2B 4A2MA 5JW3L 4XZUA 4OQTH 4D0CB 4ZOBA 1FVDB 2DD8H 3FT4B 3D85D 4QHKJ 1CGVA 3CK0H 1S9VB 3MUGA 4O51B 2G5RA 1VDGA 4JM4H 4ZDHB 4XPGH 4NQTA 2EO9A 4MD0A 3HRZA 4X6CA 3WJLC 3JTTB 2FIKA 3B2VL 4BZ1H 1WWWX 2W0LA 3VCLA 3ZE1E 4MAYD 4OCWH 4MNGE 3QPXL 3RA7L 5MENA 1RIHL 4ZD3H 1DBML 2EE3A 5BZDA 3CXHJ 3W39B 1MCHA 4MQXD 4X6DA 4MDIB 2QLVB 5HHME 3HPLA 3MLRL 4WEMB 4OLEA 1OSPL 1MCRA 1G6RH 5ENWA 3QPXH 2AXJA 4HWZB 3HZVA 3BD5A 2WIIB 2NPLX 1QACA 1HILA 4PJAA 4Z7WF 4X4MA 5ISZB 1FNLA 3WJJC 3BZEA 5CCKH 4WY7H 3QJHB 1YY8B 3Q1SL 1MFEL 4FZ8L 5GZOD 4POUB 2CKBB 4JPKL 4LCYB 3KLHD 4Z95L 3H42H 3U2SB 1I7TA 5I71B 5KZCD 5E9DB 3BE1L 4RSVA 3QUKA 3TA3D 3O81A 3OWEA 2M26A 5DRZB 5IHLB 5GISL 3CMGA 3QI9B 4KVCL 5JLZB 4YLQT 2VLKB 4OZIE 2RGSA 1S5IH 1JVKA 4D9LL 3EBAA 3IXTA 5HPMB 2NY2B 3HC4L 3ARUA 3KPRD 1XCTA 3V0VA 3H2WA 5DUBA 5BV7H 2CDEA 1OLZA 1HHJA 1H15A 2QQNH 5HPOA 2X4NB 5IBLD 5SWQA 4XBEH 3EIFA 2G9HA 3RWEB 1JPTL 1UM6L 2B1AL 3M1BB 1XR9B 4NWUH 5FV1L 5KOMC 5ERWB 1JIBA 6FABL 5IB1A 2OZ4L 5HYJB 1VESA 2R0WH 1CXLA 5FCUL 4PS4H 2HFGH 4WVRA 4XC1L 4PJ9D 3W5NA 1B88A 1N0LA 2X1XR 4UDUA 1P7KB 1XGPB 4FTVD 1AXIB 4YHIB 4HPOL 1JBJA 3LV3B 2R8SL 3LZFH 5AUMA 5DMGD 3KS0J 4XPHH 3RRQA 1WFNA 3NFPB 3OKDA 1DE4A 4PJDA 4Z7VE 2YXMA 1QBMH 5T5NG 2N4IA 5FCSH 1XF3A 4JRXA 5EOCL 5D93B 5INDA 5TPWH 2X4RB 1MHEA 1JYXA 4YFDB 5JHDB 2V9TA 3HMWH 1OB1B 3TH2T 1BQHA 1C5BL 4Z0BH 3QDHA 1CXKA 4KZDH 4FQQA 3BWAB 1QBML 2JTDA 5IB5A 1H0DA 3FFCA 4WI4A 1WLHA 5E9DE 1FYHB 1WSST 1ZHNA 3E2HB 2ESVA 1DBBH 2VDRL 3MV8A 4LIQH 1WAAA 4LSTH 5D5MA 1C5CL 2VLKE 5GZOC 4J8RA 1WISA 2AAVA 1B4JL 5IB5B 1OGAB 2VLME 4KK5C 2H1PL 3VI4F 1XGPA 3BXNB 3OG6B 3KPSA 5CSBA 5FOJA 4JKMA 1OP9A 2E7MA 5FKPA 1N26A 1WZLA 5TH2A 2AQ3A 4JRWA 4P4KD 3PGDB 4IRJA 4KJWD 4M43L 1BBJB 1ZANL 3VXMD 1N5AB 2EXYD 4GRLC 4NOFA 1LK3H 1VKXA 2ZCHH 1L7IH 4PRIE 3PWJA 2BVTA 5IT2H 1JGVL 5F44A 5F7EH 2L0DA 1AIFB 1KYOJ 3KPMB 1QZ1A 2CRMA 2BNRB 2F8VA 5IV2B 4PGBB 4HZLB 1KXVC 3CMOH 4Z76B 4LLWA 4UIKH 3CPLB 1L7IL 4GQ9H 1F58H 1NMBL 5T1KA 5A2IH 1X5XA 1MHHA 3QI9A 4I3GA 1FYTD 3RHWK 3SE4A 3C60A 3AM8A 2P5WD 1HKFA 1GPOL 3U4BH 4LCCB 1UXWB 2XQYG 2YD3A 3NMEA 5C0FB 5J9PB 1A7RL 1IGYB 4EVNA 1FAIL 5TFSH 4M5YL 3P0YL 3P0VH 1I1AC 3KDMB 1SYVA 2FB4L 2P5WB 2X1PA 3S88L 4OGAC 1AGFA 4F80A 2EC8A 4BH7B 4GAFB 2MPAH 4PR5B 5IB4A 5CSZB 4DQOH 3GSXB 3LQZB 3P73A 2NY4C 1HILB 1P7QA 4R97B 5EC1A 3VE0B 4N8VB 4NCC1 3D3VD 1KPVB 3DBXB 3V0AC 1SJHA 1LEIA 3TFKD 3I6GB 2Q20A 5GGRA 3WFZA 4O2FB 1HK6A 1IZKA 3CX5J 4JGUA 2GTZA 3U1SH 5D7SH 1OGAE 3NCYP 1OTUC 1J05A 2NY1B 4Q9RL 5D6DA 3MRGA 1CD0A 4XT1C 1IVLA 3SJVE 2A1WL 4XC3H 4G8GB 4WWKD 1BD2E 3REWB 4NO2B 4XPGL 4JN2B 3MRHA 4XNMB 3HAEB 4KROC 2HTKD 5DI8B 4GUPA 4TQEH 2Q3ZA 1F90H 3B83A 1X4ZA 5E4EB 2GAZB 1MFBH 2C7UB 3BKJL 3MLTB 1S9VA 2XZZA 3KJ4B 3HPLB 2GJZB 3VXUB 2WUCH 3SE8L 1MCWW 4LLUB 1WZMA 3HZMA 4PGCA 5EBWB 4YEFA 1V7NL 3O41A 2E9JA 4RFNC 4K07A 2BVEA 4Y1AD 4I3SH 2RFXA 3RNQB 3WSQL 1BLNB 2BJMH 3UYOD 5I8CA 5MEQB 5J3HD 3I6KA 2MQCA 4MD0B 1XF5B 2CKBL 5IOPB 3CXHK 3BESR 5ISZD 4YAQB 3TIDB 4NKDB 4JQXC 3VGGA 1NFDA 1I9JH 5HHOA 4D94A 3CXDH 4Z0XA 1AGBA 2APVA 4OGXL 1Z3GL 2JCCF 5DMYA 3LRSA 3OXRA 5JZ7C 4HV8B 4KH2A 2CLRB 1S9YB 3V6FB 2XN9E 2DQCH 4OLZL 5B39G 5CLTA 1D7FA 5EIVA 5JR1H 4X9GA 1G7MB 4F7TA 3G5YA 4M5ZH 3DXAE 1NUGA 3ZLQC 3T3PE 1X5HA 1BD2B 3VMOA 1Z5LB 4PLJC 1E28A 5C0GB 4PJBB 3SGJA 3DUUB 3FJTA 3S5LG 3VFRA 3V6BR 1HSBA 4Q2ZA 5E99L 2W9DH 5I1HH 2E7BA 5FYKH 2XTJC 1YECL 3VFMB 2VWEE 3FHAA 2C3HA 4X0KB 2QHRH 1FIGH 1X5AA 2BVYA 4ZFGH 1IGFL 2DB8A 2NXYC 1TPXC 5M95B 3MLYL 3ZE0F 3DO7B 5C07D 1SBSH 4WGWB 4NHCL 3I02B 2JJTC 5MHSE 4X7TA 3VMPA 2C1PA 3O3AA 5IR1A 4H88H 3HAEH 3SDAA 3L5JA 2NX5D 2FBOJ 3LQAH 3DUSB 2FSEA 4I0PB 3G5YB 5EWIH 1ORQA 1VA9A 1SEBA 4H1LB 1KCSH 4M8VA 3R06B 3G5XB 1Q1JH 3Q6FB 3WN5C 3BH9B 3RGVB 3QNXA 4KMQA 2ZSVB 4NKIH 35C8H 1XIWC 2NYYD 2AXFA 3X3FH 2GSIB 3WFEH 1IQWL 3MXWL 4LHQB 1S9WA 1NGYA 3KHOA 4UQ2B 4XVJL 4Y5XC 5ICZB 3V5HB 1OARH 4BUHA 5IVOA 3PGCA 3MLWL 2O61A 2IC2A 4OUOA 3UCRA 2E7HA 1JNHA 1OHQA 1NAMB 5JZ7D 4GW5A 4HEME 5AZ2H 3BKYH 4FN0A 2Y36H 3BAEL 1TZIB 3P4LA 4GO6B 1JWMA 4Y5XA 1VGKA 3VXOB 5D7LD 3HR6A 2QHLA 5HHVH 3NZ8B 3TV3H 2J7LA 5CMAA 3QI9C 3A67H 3G6JE 3H9SB 4OLWH 3TP4A 1K5NB 5FM5M 3T1WA 4LPWA 4BZYA 1I85C 1R5WA 4U3CA 5ISZE 5CZXC 1SMOA 5KSAA 5D7LB 1Q94A 1DQMH 1B2WH 2J6EH 4NDMB 3W2DH 1D5BB 2I25N 5BMFL 2J2ZA 2X09A 5HGGS 4S1QL 1MAML 3GMPA 3EYFB 1G1CA 1CFVL 3AREA 3OXSA 3OHXB 4XTRD 2NXYD 3WDIA 3U46B 1CU4L 3DMMD 1LD9B 4AQ1B 5AG9A 2IANB 1I8KA 5IFHH 4JFQA 4BFBD 1CS6A 5HGHB 2DLTA 4N1CA 2CDFA 3IDXL 1TPXB 3U48A 5J1AB 3CXDL 4JDZA 1S9WB 2X6MA 3A6OA 2Y23A 1T80A 4POYA 4GAJH 1X7QA 1PW3A 5JORB 4EN3B 4UZGA 3O0RL 2IFFH 3P30H 5ACLA 1X9QA 1NMCB 3ROOA 1HYSD 1HHHA 1AJ7H 2YPVL 4HKZB 2VXTL 4M6NH 3GBNL 4FQLH 1WBXA 3PV7A 5CS7A 1YYLL 1MRFH 43CAB 1FCCA 1XIWD 3FL7A 3IJSB 4DKFH 5BVJA 3D0LA 5GJSH 3MLSL 4XHJC 3GIZL 3GKWL 3NIDE 3WN5B 3GMQB 3K4DA 2F53D 3SHSA 3OKMA 1G9MC 4UAOB 3QUMH 5FO8A 1KEML 1BX2A 1P9MA 1XIWB 1XGYL 3CC5B 1XR8B 4P46B 5T1LA 4Z7VB 3QEGH 1WUNT 4K9EH 2AGJH 4JGMA 3LN5A 2X4QA 1V3MA 4OIIH 4XB7A 2W65B 4QTHB 4L4TA 4ZAKD 2D7MA 4DN3H 3DX8B 1QPXA 1J8HA 2G2RB 4P46D 3DX9B 1MCSA 1BVLB 5DD0H 3PHQB 2YD5A 1HHIA 5IEHA 3IRZA 3OSKA 2LE9A 1EIBA 3EGSA 1QLEL 1LDSA 4P3DA 2OJEA 4JKKA 3N1QC 5CEYB 2DQUH 2IANE 3L5WA 2DQEL 2GJ6E 3NFNB 4OFKA 3RUGA 5DWUL 1ZT1A 3T3ME 1S5HA 2YZ1A 3BDYH 2OS7A 4FZEL 4PP2B 4U1JA 4GRMB 4XVSH 1WV7T 4FXLA 3VD9A 3OXRB 4O4YL 5FM5O 1S7WA 1SJEA 4LCCC 1JGUH 1FH5H 5HHOB 3RVTD 2VAJA 4OD1L 4CU8A 3A67L 1I1AB 1XGTA 5B3JF 1RJCA 4M7KL 5F7DA 5I1EH 5GRVK 3SQOH 4N1HB 4WO4A 3V0WH 1CFBA 3WHE1 5ESVB 5K9KA 1QQDA 3HA0A 2NY4B 3OB0H 2K1MA 1KNOB 2DWDA 1TJIH 4OTXL 4DEPB 1H3VA 4FZ8H 2C5DC 3L3OA 5DJZA 5DT1L 3K74B 1JF5A 3SDXB 2ADGB 5I66A 3HNSL 4UT6H 2RCSL 1MWAL 2ORBL 2AABL 1BQSA 3VFPB 4EQ3A 1S7SA 2P47B 3GSNL 1FO0B 4JPIB 2C7UA 2Y72A 5EZJB 2GCYB 1G7LA 1REIA 1T03H 4M62H 3QNYB 2B2XL 3WXWL 2KKQA 4WV1B 1R3KA 1ZKAA 4MQTB 4KROB 4ZNCD 2Y07L 1QVOA 3PWNA 5GS2D 1M71A 1BJ1J 3BFOA 5FV2A 4CL7A 3CFDA 1AQKH 3WDHA 4ZOAA 5IWLC 1TJIL 1RMFL 3MROA 3OJDA 1DQJA 3KJ4C 1IGIL 3OGOE 2PETA 4R7DB 5FGRA 1OW0C 1IC7H 4P46C 2Y5TA 1UACH 2VLRE 3D9AL 4V1DA 1GGYA 2ZPKH 5EU4B 5IBTH 1RFDL 1IEBB 4NZJA 4TNVF 3RHWF 5F96H 3QAZC 1FNGA 1FE8H 5T5FH 1QRKA 1X5IA 4ZOCA 1YC7A 4X99A 1F8TL 3MNZB 4H0GA 5HDQL 3F12B 4NFBA 4YR6A 2Q6WA 5C0CA 3S4SA 3VFTA 2XKNA 5HVFB 1NFDE 4NKQB 3L95B 1K8IB 2IALB 1IM3B 2CLVB 4IEFB 1MRCL 1M4KA 1DBBL 2ZUUA 4R4NC 3RQ3A 3A6BL 5IGXH 5AAWA 2ATPA 5TDNA 1VADB 3CSYB 3VXUE 5C0FA 2PYEB 5D9SA 5I30H 1R3LB 5E8PB 3PXHA 3QNYA 2EEBA 4YBQD 3K8MA 2OI9B 4HWZA 1NEZG 3MNWA 3O2DH 1RK1A 4JPIA 2DN7A 3RKDC 2IPTL 4FQIH 1PZ5B 3HMXH 3EZ8A 4WFFD 3FB8A 1FSKC 4X6BB 4ZTOL 1AY1H 1T04B 1MELA 4NQSA 1QSVA 1FL3A 3TZVC 3MBXH 2YD2A 3L7EA 3S96B 4QGTA 4J3XA 1G84A 1AQDA 4WW2A 4LGRB 4WI8A 4BSVA 2XWTA 4P59H 1Y0LA 4HX1A 1IBGH 4NO0B 2FGWH 2KUTA 4WU7B 2CJUH 5L8JB 2ZOLA 1FO0A 1TCRA 4NT6A 1J1PH 5HGDB 3H7LA 4BFEA 4JY4B 2P5EE 1JHLL 2AKRA 3K8LA 1BQHG 1MIEH 1OGAA 1UWEH 3BP5B 4TTDD 2XYCA 4X99B 4G9DA 5DEZA 1FNGB 1MHCA 2QQNL 5TE7H 4Z7WA 4MXQC 1QG3A 4UT6L 4CW1A 1RMFH 1JPGB 2G60L 1G7HB 3DXAB 2A9ML 3P0VL 1YEJH 2HP4A 4X9IA 2EC9T 2PN5A 1ZHNB 3VW3H 1BZ7A 1MJUL 4M9OA 2OL3A 1U8JA 1ZLUH 3NCBB 4M62L 5L7XL 2Y06L 2G5BA 1CVRA 1NBVH 4F2MB 3DWTA 4RWYL 5DS8B 3KPLB 5CD5D 1NL0L 1G7LB 1FORH 5FA4A 3VGEA 3VD7A 2C3VA 2HKFH 3EJJX 2Y5EA 4ORZC 5HSFA 1P69B 1RZJH 3DX9A 1X5LA 4V1DD 3NFPA 4QRPD 3OB0K 4EXKA 2VQTA 4X4YA 4OFPA 4NKOB 3LV3A 1DEEB 4UDUB 1HXYA 1DVFB 4PRHE 1VERA 4NHUB 4L3AA 1QQDB 3UBXB 5L2KD 2BOCA 3O6KH 5IG7B 3BP7B 3MRRA 4LKCA 1KIPB 3MA7A 3OKMB 4TULL 4ZXBB 4ETYA 2EYSA 3UZVB 3B8YA 1AGEB 4R26L 1AO7A 2F54D 4D3CL 4PRAB 1U58A 4HJ0D 3C8KB 3ILPB 43C9B 1Q9LA 4ZYKB 4D0DB 1NC2D 2WW8A 1MI5A 4F7EB 2GW5A 3WIFB 2Y36L 3BAEH 5KANG 3ZTNH 4GXVL 1F2XK 4HUNB 1J87A 1EJOL 4H20H 3UBXG 2F54B 5I6XB 3HZYB 3OAYK 2F5AL 4F37F 3OKEB 1O5DT 3VWJA 3OF6D 2BZDA 4J3VA 1CLOH 2JE8A 4M7JH 5E56A 5TF1L 1S9KC 5C07B 2Q76B 4I0KA 1U8IB 4PD4K 4UV7L 1JZ4A 1KENH 2R9HC 4ZODA 5E9DA 4PRNA 2XZQL 3MXVH 5SX4I 1J7VR 3DVIA 1GXEA 1UWEL 3S37L 2CKBA 3H9SE 1ZT7A 5HI3D 3NBNA 4HJGB 4CDHA 3PQYE 4WJ5B 5ABDE 1K4CB 4P5MB 1U6AH 5IESH 1LK3L 4K7PX 1F45A 5DJ6B 4H8WC 3QA3B 3VGFA 2JIXA 1J8HB 2R29L 4W68A 4KKLD 4CBPA 3MUY1 2CIKB 5MI0B 3QXVA 5SWSB 4TSAL 2W60A 5D7JA 3G5ZB 5ILTL 1YECH 1UFUA 1INDH 1XCQA 5LBSL 2XFXA 1AP2B 4ZUSA 1A7PH 3SKMA 1T89A 2HFFA 3V95A 3P4MB 1ND0B 4JO4L 1KCRH 5F70A 1ODAA 7CGTA 1FP5A 4OI7A 3U4EB 2VAAA 3EHBC 4I4WB 3WN5A 4RFOH 4FG6D 5EOQH 1JHTB 5DC9B 1JNLL 3ZDZE 5JNYB 4HBCL 1J10A 5IHUL 3V4UH 1UENA 5CKGA 4R4FH 1AD0B 2DIBA 5CIPB 4ZDHA 3SKNA 4KGLA 1U3HA 3ES6A 3UJJL 1UC6A 2JJTA 4KVCH 2KQNA 5TPWL 4YHPB 3HE6D 5GSVA 12E8L 1AP2A 3DECA 4TSCH 2Z93B 4GG8A 4PYHA 1OTTC 1HI6B 5DJ0A 2F54E 4GG8B 5KVMC 4XPFL 3QUXD 4ZG1A 2JIXB 4U3HA 4X6FA 2VR4A 2AJYH 1NDGB 4WHCA 1LDPH 1PEWA 2R15A 4HPOH 3MRMB 1Q72L 1JI1A 1A6AB 1DQDH 4ALAL 5IM7A 3ZYJA 1JNHB 5ALBL 2AP2A 4WU5B 4U6TA 5JDSA 2R2BB 4LCWD 4PJ9B 5C70A 1RHHA 1RVFL 2O93L 2W9EH 5C7XL 2Q76A 1CFNB 5EU6B 3STZB 3O3AB 5IR1B 5H8DA 2E8YA 3JWDC 2HMIC 4QRUB 1ZVHA 2HTLC 1RZGA 1B3JA 3TPUA 1R5WB 5ACZB 2PYED 4X6EB 1OP5H 3RA7H 1R24B 5D7KD 5KJRH 2BJML 4AK1A 3WIFA 3WSQH 2AEWA 2CXGA 1LO4H 3Q6FA 5C0IB 1FL5A 2DOCA 2E7LA 1T2QL 3I84A 4LPCA 1AGEA 2B1HL 1MLBA 2MQ3A 4K3HA 3HB3C 3KPSE 4YFLI 3CH8A 4YGAB 2E9WA 4FQHA 1TZIA 2BVOA 5ACMA 3VFRB 3MXVL 2Q8AL 3C6LC 5A43C 4OI8A 4OGZA 1HQRB 5DLML 4JKPL 4PTTA 4PRNB 2CR3A 4H88L 3TGXA 4P0DA 3VWKC 3ULUE 1ADQH 2E9IA 1RZ8B 4W4OA 5DUPL 2PO6A 2Z31D 3O3EB 3EOYG 4FQJH 3QUYC 3UO1H 2PXYD 3ROLA 1NGXB 4XI5D 5LCVH 2H2PC 1RUKH 2QSTA 4XXDA 4IOSD 1U58B 1EV2E 4JJ5A 1LEKA 1JGEA 2YD4A 1RZFH 1CZ8H 5IOPA 1V5JA 1T0NA 1YYMH 4KRMB 5DHVH 4LKCB 2MPAL 3B5TA 4JO2H 5KSVA 3QUZB 5EU6E 3QQ4B 1OAUL 1PD6A 3MLYH 3HE6A 3L5XL 4XNYH 1ZS8B 4X4YB 4WI3A 3C08L 3EYSL 5F6HI 1HINH 4NFCA 1S7VB 1K9TA 4C56E 2R56L 5HGDA 1IC4L 1X5KA 5J12B 1F4WH 2P8PB 3MLTA 5IWLA 1HDMA 1J0JA 1A02N 3IJHB 1JYWA 3D3VB 3LEVH 2ZUYA 1MRDH 4OLVL 1F97A 1PG7X 3F6IA 3QXAA 4MWFB 2VZVA 3M8OH 1LHZA 1FZOA 3CSBA 3N1MC 1K2DA 4D9RE 1U8LA 3RY5A 1L9MA 3FB8B 3HLAA 5I1CH 2AXGA 4MCZB 5CJBA 3DXAA 1R3JB 5KSBE 4G7VH 4XCNA 3MZTA 3V6FA 5ADOL 4YBQC 1JCKA 1RV6X 1FG2A 4PV9B 1OQOA 2DJ4A 3AS0A 3QIBA 4N8PA 4M93B 3REWA 4EUPG 1CR9H 1FGVH 3D39D 4X98A 5ESAA 1NFIB 2EXWC 3VXTA 1D5XA 1BLNA 3A6BH 1IGCL 5IGXL 4WW2B 1J12A 4WTZA 1F6FB 2YBRB 2VDPL 4LCCA 2IH3A 2UV3A 1IL1B 3STLA 3ARDB 1T04A 3QWOB 4S1RL 3LDBB 1JHKH 3FFDB 4JFDB 4ZUTB 3VFVB 3D85A 4Y4HC 3TBTA 3MNWB 4LSQL 2J6EL 1F02I 4YHYB 4CAGA 4WUKH 4XH2A 1U8NA 3NABL 2A1WH 4LBEB 2VDNH 4NUJB 2ZZUT 4HUUB 4PBXA 5J9PA 3D3VE 3N06B 4LBEA 2IMNA 5TQ0H 2ATKA 1VKXB 1BQLH 5BRZA 4NZTH 1U8HA 2WANA 4PS4L 1KG0B 2KL6A 4R90L 3VFPA 1W0WB 2H32H 1YQVL 1UYWH 2ARJQ 4XX1G 4LCUA 1A6PA 5F88A 1GAFH 3GMMB 3CVHA 4K55A 4OZFG 5JIPA 2XTJE 2HJKA 4GKZB 4K3DH 1XZ0A 1JGDB 2C1OA 3C08H 5J12C 4UIMB 1KNOA 1UEYA 2DWDB 4JZJC 3EFFA 3HPJA 1E27A 3GMNA 3BKCH 3AU1A 1NPUA 4Q9QH 4GG6E 2AEQH 4MS8C 4I9WE 2IJ0C 3BPCB 3OR6B 5A40E 1GCFA 1PEZA 4Y4KB 2CKNA 2D0FA 2W91A 4RMWA 2MCG1 1A6VL 4LFHD 5KJRL 5T3XD 1EXUA 1EVTC 1KLFA 1G9EA 5C0EB 2DTML 4WENB 4GMSL 3LQAL 1FL6B 5HI4C 4CJ0A 4TNWK 3RI5K 3U0WH 3FQTA 5I6XC 5K59F 1MFEH 4PRHB 5HJ3A 4XNYL 3CPLA 4FFWD 2I60L 2ADFH 3AAZA 5DWUH 1DBAL 1BAFH 4TNWF 3M45A 3QDGD 1MF2H 1RJZA 3VRIB 1TJGH 3SGKA 5DQJB 1W8NA 1OOAA 1ADQL 4ZS6C 4WHYG 3S37X 3MRFB 1JN6A 5TJWK 4Z0BL 4HGKC 2NR6D 1WZKA 4S1RH 1ROWA 4P2QA 3OKDB 5MI0C 3ARDC 3MACL 2XIDA 5CZKA 3NCFB 2B1HH 3RX8A 1CBVH 4YH6A 5DUPH 3RFZC 5T1LB 1R0AL 2FJHA 3GNMH 3ZKSD 5BV7C 4YHYC 5C0EA 5DC4B 2QADC 2X42A 1H0DB 4GBXC 3BVNA 3KYOA 3B8SA 3RWHA 4HG4J 1DBKH 5DURB 3PIQB 1MIMH 3U2SA 3CVIH 3DV4B 3VRLE 2OXGA 4HKBA 2VR5A 1QNZL 3ULUC 3C9NB 4NWUL 1MI5E 3HC3L 3W0WD 1N5YH 1KJ2A 1J5OH 1P2CB 1NGXA 3VRIA 3IXTB 4KPHL 4Z6AT 3IS0X 4O2EA 1NCBH 4AEHH 1NMAH 5JORA 4LLYB 4R4BA 1UZ8B 3V6OC 1D6EB 1NGZA 1YMHA 1T83C 4XPBL 1T1ZA 3LHPH 3ZTJG 4LCWA 2GSGB 3W39A 2ZPKL 4O2CA 5FO8B 3W82A 4IDJH 3CVIL 1QEWB 4DKFL 3FN3A 4XBEL 1PBYA 5A1AA 3I2CH 1D5ZB 3D2UB 1BF8A 2VH5L 2VXTH 4HIEB 1ZHBA 4L3ED 3T0EA 4QRSB 4YDJB 4QT5B 4F7CB 5F93C 4UUJB 3LKSA 1UA6L 5DFVD 2CQVA 4KAQH 3KLAB 4UTBL 3MGOA 3L1OH 1BEYH 4TVPL 4MDIA 5ECJE 3FFDA 3WD5L 4QRUA 3CVHB 3B3IA 4LLVB 3HNTH 3VFUA 3F7PC 3SDYL 1CXIA 3K4AA 3KPPA 5CP7A 3MPCA 4YXHL 5GGQH 3UTZA 4CU6A 1TJHH 5C0AD 5IHZB 1RIHH 1F42A 2APTA 2DL9A 1PYWA 4F9PA 3MRQB 5CKAA 2CUHA 3SY0B 4N5EC 1CI5A 3VI4E 3MUGB 4OFVA 3K8KA 1VGEL 1D5MA 1W72H 4NJAL 4MAYA 1S7RB 4TPRL 5GRJL 4HUUA 1E4KA 3D18A 3HI5H 5F9AC 3GSWB 3K4ZA 3TBSB 4YXLH 1TITA 5CEXA 2NY3D 3EYOB 1JZ7A 3QPQC 2Y4SA 1QLRB 1FAIH 3ZHDA 1BECA 5L6YL 2Q7YA 1YNLH 1CXHA 1QFWH 4UU9B 2Y7QA 2EEAA 3Q6GL 1EK3A 1I9IL 4KMTL 4OM0L 4YWGL 4X4ME 4DZ8A 5ICYA 3V6ZB 1BF2A 4L8DA 4G3YL 2DQTL 3EOAB 3FCTA 5CIPA 1FC1A 1MSPA 5B38B 2BNQA 1S8DB 1KELH 2KDGA 1RZ7L 2VKXA 1JZ3A 2V2TA 4OCSL 2YZ8A 1NCTA 2VXQH 1T5XA 3FT3A 2MMXA 5ITFA 3MJ7B 4ZUUB 2OXHA 2HN7B 3OGCB 1T66D 4MYWB 4YBLB 4YDLC 3WDJA 5IVXB 3F5WB 4X9HA 5FGSA 3ARGA 5TE7L 4OCYL 1N0XH 4X7TB 1YMMA 5HY9A 2VL4A 2D3VA 1UKTA 3V5HA 2XFXB 5EU6D 3IFPB 4Y19A 1JHLH 1GOHA 2WP3O 2Z8WC 5F7LB 4UDTA 1KIRB 4J1UB 4K2UL 5D96B 1YEGH 5KSUB 4PREB 4APQA 2DI8A 2KZ1B 5ALBH 1LILA 1K4CA 3PE9A 4GXUN 4KQ4L 1HSBB 1I3RA 4KRPC 5KANI 1UWXH 3MV9B 2HJLA 3SDAD 1YNKH 4QTIH 3PJSA 5HDOA 3IT8D 5L2KA 3RP1A 4XRCB 1ORQB 3M17B 3SDYH 1IM9D 4QKXB 2EDFA 1MY5A 5DJXB 2X5PA 4JM2D 5C07A 3Q3GA 4HIHA 4S11A 1PX4A 2Z4QA 3NVQA 4NRXB 5CWSA 4NQEE 2VB5A 1M7IB 1T89C 4CN4A 3KLDA 5E2UH 2AJYL 4M7LT 4XXCA 3C8KA 4D0DA 2NMSA 1QPPA 5HY9B 3RU8L 3C5JB 3V9FA 4KJQD 4GSDL 5CP3H 1I3GL 2CRYA 3QPQD 4Y5VC 5EZLB 2QTEA 5I8EA 1BM3L 3QCUH 4IJ3C 1YC8A 1HHGB 3LIZL 2WUBL 4K71C 4X5XA 4HG4K 1AXSB 2BSRA 4OF0A 3JWOH 5KSBB 3C2AH 3GJEA 3G9VA 1KCLA 1CFSB 4QOKE 4ZUWA 2FX9H 4DZBB 1JNLH 1U8MB 3LDBC 3WIHA 1JL8A 4GBXA 4HK0A 3SDDB 1G6RA 2IBZY 3AY4C 3CDYA 4WHTA 1N64H 4JO4H 4HC1L 3MOBL 3ARBA 4AM0B 4TUKH 3O6FA 3SCMC 1YA5A 5D71L 1T66C 3D1MC 2ZUWA 5D1XA 3B9VA 3T1FB 3TN0C 2PTUA 2OL3L 4I5BB 3BDBA 1INDL 5DVOA 4KVNH 4WFHD 5TF1H 2DDQH 3LEYL 4YBHA 1E0OB 1WICA 5DJYA 5AYQA 5IBUB 4LHJB 3MLVL 2DLGA 1A6AA 3U7WL 4HS8H 4K2UH 1QYGL 5IEKB 5KBNC 4ODUA 5I19L 5K33A 2RFXB 2A73A 4NO0D 4MJ4A 5CCKL 2DS4A 3MLUH 4XMPH 2P7TB 1E6OL 3PDDA 4JZJB 1F8TH 4TSBL 3BEWA 2VITB 2FD6H 4OB5H 5E8DH 1EBAA 1EO8L 2UZIL 1MJJB 3OGCA 2NZIA 3GI9L 5DF0A 3HN3A 2R39A 4XNQB 1RUKL 1KCSL 5M94B 3THMH 1CE1L 1QLFA 2IADA 1ERNA 1C16A 3B9EA 3L7FA 5C3LD 4NQSB 4W6WB 1Q9OB 3OAUL 1ULVA 3NCJL 3TO4D 1NLDL 4K7FA 3ULUL 3CFJA 1ACYL 5F96L 1IAKA 4WTWA 2HVJB 2YD1A 3C8HA 2WIMA 1KACB 3G5ZA 4GG6B 2FD6L 4NM4L 5DJ8A 2DQJL 4K3EL 5CD3A 1A6ZB 4CJ1A 3HI1A 2JJSA 5KN5A 4IJ3B 4PGEA 1P84K 5E03A 3BKMH 3BMWA 2YD7A 5HI5D 1N5AA 2EH7H 5HHNB 3HC0A 4BM7A 1GRWA 5D4QA 3CFKA 3BZFA 1I1AD 3N85H 1YEDB 5B4MC 1BP3B 1FJ1B 3R0NA 5GS0H 3U36A 3QH3B 4P4RA 3T0WA 4ZXBD 3JV0A 2EE2A 2FBJL 2H1PH 3T4YA 3P4MA 5T1KB 5EU4A 4MJ5A 4HPYL 4WW2F 4ODHH 3MV8B 4G8FA 3TN0B 5JA9A 5F6IB 1YEJL 4W70A 2YPKB 3FOLA 4ZAKA 5FEBA 1UCBL 43C9A 1T20B 4WFFE 3QHTC 5E5UB 3T65B 4L4JA 1M71B 4OGXH 3S6CA 1FZJA 1OTUD 3MYJB 3MV8D 2JF1A 5GGVY 1HHKB 2JK5A 5H37H 3VFGL 2DDQL 2NLJB 4KTYA 1G1YA 3PDOA 4B0MM 1J1PL 4QY8A 3PGDA 1JHKL 1N6VA 4IDLA 1IAMA 5D71H 3RWJA 5DJ2A 3DO3A 4HS3B 1SY6A 1E4XI 2H9GA 2V9RA 3QIWD 2Q7NA 1LMKA 4HWBL 4E0RB 3ZDZF 3OZ9L 5E2UL 2DWEB 3QG6B 1NQBA 1F5WA 1MI5B 3W0WE 5IP4A 3X11B 1F3DH 1NGPH 1FPTH 4F2MA 3WEXB 5SWZE 3RNKB 3RZCB 4XGZB 4C54A