4QLRA

Llama nanobody n02 raised against eaec t6ss tssm
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
130
structure length
130
Chain Sequence
b'DVQLVESGGGLVHPGGSLRLSCAASGRTFSDYALGWFRQAPGKDREFVAAISWSGGSTYYADSVQGRFTISRDNDKNSVYLQMNSLKPEDTAVYYCAADKYYTGPGGESVYDYWGRGTQVTVSSHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Llama nanobody n02 VH domain
publication title Inhibition of Type VI Secretion by an Anti-TssM Llama Nanobody.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
total genus 28
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qlrA00
2VLLB 1X5IA 1MOEA 2NY1B 3QPXL 4HJJH 5CEZD 3QSKB 3ZKNC 5CKAA 3JWNC 3EOTL 5BS0A 1AXSB 1RIVL 1JUFB 3RWDB 3K2UL 3LCYA 2AEPL 1J0HA 1Q9WA 1JGUL 3QWRD 3IKCB 3WL9B 4NO5B 2DD8L 4P2RA 1T1YB 5F6IB 2HYMA 3KLHD 3FN9A 1OSPH 1IAIH 2GAZA 1JWMA 4PTTA 4YDIH 4XNZB 3MUJA 5FF6B 5GRZA 4DUWA 1YPZB 4HWEH 4MJIE 3U9UB 1CR9L 2YD2A 3QEUB 3VFRB 1ZHNB 1EHXA 3TYFB 3DRTB 1DQDH 1S7QB 4JFPA 1MJ7H 5FM5M 3VXRA 4LHUD 3U2SB 2VE6A 4WI9A 5L8KB 3DUHA 3BKJL 1KLUA 5EIVA 2JCCA 2WK2A 4PGDA 3VXPA 4YHNB 4KV5F 5D6CA 1I9JH 2H2SC 4EXPX 3B9KC 5JNYB 3C9NB 2D31A 2EKJA 3BKCL 3UYRL 4I8DA 3RBGA 1VERA 1A5FL 3DGCR 3MRFA 2M2DA 3DSFH 1MWAH 3MRQA 1FJ1A 3S6CA 3DUUA 4YXLH 3S4SA 2DOCA 3ULUD 1F02I 4XPTL 2DMKA 3WIFA 1NAMB 5HVGB 3FQWB 3C5ZD 4MB3A 5JIKA 3O6FB 1JHLL 5K9KA 1J12A 5MEQB 4BFIA 3W9EA 4CRPA 3TN0C 3DYMA 3WIHH 1MREH 1FVEB 2A6IA 2VLKD 1FPTH 4X8JB 2Q7YA 1F4AA 4RMTA 4CMHB 3ZSSA 1U91A 4BH7B 5IGXL 5IHZB 5A43C 1AE6H 3HB3D 3BDYH 5DZNA 3RUGB 1YYLL 1U3HB 3GSQA 4A2MA 2OR9L 2B0SH 1UT9A 5I1HL 2ZUWA 1JPTL 2VDRH 3WUWA 2GTWB 4RMRA 5IJVA 1P4LA 4U3HA 2WANA 3K74B 2J8HA 2W0LA 4GAGL 3GNMH 5E1AB 2XPGB 3CK0L 3HTLX 2XKNB 2WSKA 1QD0A 4GAJH 3SDCA 1P53A 4I0PC 3VFVB 3BQUB 3CC5A 2IANB 3TVMD 3CCHB 5D2LE 5FA4A 3VD3A 3MREB 2LAAA 1LO0H 5A2IH 3MLZH 3QDMD 4XP1L 1CVRA 2E9JA 4MCYB 5TJWK 3OB8A 4UAOB 1IVLA 1CG9A 4QNPF 4PJ9C 3OPZL 2J8UB 3ZKND 1OP9A 2WP3T 3SE4C 3CFJB 1S5IH 4R0LB 4XH2B 1BQSA 4LVHB 3CPLB 5ACLA 3KPQB 4UBDD 3QXUA 4WO4D 3DX6B 3IDIA 5IMOB 1ZHKA 4UIMA 3CVIL 1K5NB 4ZUUA 3WFEH 5EO9A 2MPAH 5DLMH 4LSQL 3VWKB 3CSGA 3RUGE 3OXSA 3WJJA 3P4LA 1CK0L 2FH6A 4BK5A 3C5SA 3PABA 1DBKH 1S9XB 1AJ7L 1YY8A 3K1DA 2Q8BL 3T0VA 2BDNH 4MLSA 2ZKHL 2MKWA 3VFMB 3SE8L 1KB5B 3ZDZE 5EU5A 3VXUB 1WISA 2V7NA 5EU6A 2H2SD 3DUSB 4HUKB 4I77H 4X7CC 3B9KD 1CDIA 3RWFB 4OFPA 4ZQKA 3OB0K 2V17L 3UPCA 2NLJB 4LGRB 4AM0A 4X98B 3UPRA 4Z7UB 1G7MA 2DQJL 3CJJA 1FC1A 5FKPA 4ONFL 4FP8L 1EIBA 2ITCB 1FGVL 3KPLA 2XY2A 3OQ3B 2WW8A 2J8UE 4PJ7B 4DKEL 1MVUA 4P2OA 3BZDA 1SM3H 3X3FL 3T2PA 1U95B 1NUFA 5LGJB 4XNUL 3ARPA 1FL3A 3T0WA 5DQ9B 3RQ3A 5B3JF 3LB6D 5DRWA 1I1AC 5DC4B 2AVGA 3TN0D 4OGZA 1VGEH 1Y6MR 1EAJA 1ACYL 4ORGB 1FO0L 4OT1H 5F1IB 4WEMB 3SY0A 1OGAD 3JVGC 3LZFH 4UOJA 1ZSDB 1B6DA 3HAEH 4HC1A 4NDMB 1S7TB 5I8CA 1QSFE 1G84A 1WK0A 5EU3B 1SVCP 4KKAC 3FOLA 1R0AH 3QIUB 1ZLWH 5D1XC 1RUAL 5HYQB 3SDDB 3VXUE 3CDYA 4Z7VA 5GRYA 1G1CA 3KYAA 4NGHL 1FCCA 3REWB 5DQJB 5DMKA 1D5IL 4Y1AB 3FOMB 4HXBH 3MRMA 3HPLA 3Q6FB 3SDXE 4EN3D 1LE9A 5KJRL 2Q3AA 3LKNB 4GKZA 4Z7UE 5DK0A 1S7XB 4F3FA 1N0XH 1A6AA 4HUMB 4I0PD 3LS4L 2PYED 1MPAH 4MNQD 5KVEL 4PJ7E 2XKSA 3V5DA 1L7IH 4P99A 2MTPA 5F21B 1AFVH 2SEBA 3NCYP 4GG8B 2CDGB 1MNUH 5C07E 3G6JA 4PJ9D 1I1FA 1E0OB 2IBZX 2CK2A 5I71B 2EDQA 2HJFB 1CDYA 2YRZA 1FZJB 1F4XH 3ISWA 1KNOB 5D7LB 3KPNA 1D5ZB 1XR8A 5CBAA 3S88H 1HQRB 3LKSB 1MCPL 3BKYL 1HHGB 5DVLA 2VKWA 4OFYA 1K2DB 1TETL 1S5HB 3I50H 3IJSA 5GRJL 4LASL 3H9SD 2UVEA 3MACH 4BQ8A 3MCKA 1I8MA 3ALXA 4ZS7H 1M1SA 4ZFZB 4KI5C 5ICXB 5GS0H 5J11B 3GI8H 4KUCF 3F12A 4Z95L 4PJHA 1FNGA 2DQHL 4JFOA 4Y4HA 1DL7L 2VQUA 4N0CC 5DEFA 5IR1A 4DWHA 4Y1AE 1KBGL 1AKJD 5D1ZC 2DYPA 4NQEA 4NM4H 1FLRH 1JGVH 1HHHB 5IQ7H 1ZLSL 3ARTA 2OR8A 1NMAH 5D9SB 3T8XA 5J12C 3U30B 4ODXB 5GS2D 1T2QH 3SEPA 1Q9LB 2EO1A 4JAMA 5I15L 1JZ4A 1T3FA 2ZCKH 4PY8I 3RVWC 1KF9B 1XF4A 2CH8A 4MVBC 4X80H 4E5XB 1FVCA 5JQHC 5DK2A 4B0MM 2GJ6A 5F9AC 2ADJA 2DMBA 5EOCJ 5GZOD 3V0VA 3RFZC 3GRWH 5B8CC 4IM8A 2OTPA 5J8OA 1NCDL 4AEIH 2HVKA 5FYJE 5B4MC 4F57L 1YMMB 3U0TA 5ICYB 1GH7A 5JMRA 1L9MA 5D7LE 4S1DC 3VDAA 1RJZB 4XPHL 1OP3H 4ZUSB 1UWXH 3FO0H 2DLHA 2X4OA 1CD1B 5C0JA 1I1AD 3MRGB 4YWGL 5F7DB 3LVEA 2NW3A 1P5VA 1RIHH 5FDWB 3D0VB 4NCDA 5DD1H 4NWUH 3SJVB 3KNBA 3VA6A 1SEBA 2VDOL 4WGVB 1H3GA 4LKXB 1OL0A 4W6XB 4X5XB 1AHWC 5F8QC 5DYOB 1EO5A 1JF6A 4QLRA 5F3HA 3FRPA 3RWGA 3MFFA 1A6WL 3QPQD 1BZ9B 4KKAD 2GK0B 1J05A 3WE6A 5ENWA 5D1XD 3ALPA 1A1MA 3BWAA 1MFCL 1KN4L 1NAKH 4PV8B 2D9QB 2E27H 3T2QA 1OAXH 4NKOB 3ZL4L 4FQIH 4KQ3L 4JRXD 3O4LD 4GW4B 4YHKH 4WW2B 3LD8C 1CFVL 4FZEH 1NCBL 3IJHA 4ELMB 1TJIH 3B9DA 3OBAA 1NC4B 3BPLB 4IOSD 1QFWL 4FQJL 4K55A 4LRNH 5E2VL 2ED8A 2NYYC 1TVDA 4HF5L 2BVTA 4G9FB 1DP0A 4GRLB 1E6JL 4NQXB 3QIBB 4MA7H 4HHAA 1A9BB 3MROA 3JXAA 3SJVE 1JI1A 2ICEB 3O2DA 5JHDA 2AXJA 1QFWM 2F8VA 4YHPA 5EC1A 5GQBA 4Z7OE 3FCTB 4QRRB 3D6GA 4JFDA 4HDIA 4YE4L 5CFHA 4KI5D 4QXUL 3PHQB 1UWGH 1WZLA 4Z7WB 3C09B 5JO5B 3KXFD 3MRJA 4N0CD 5FYLH 1FIGH 2ZOLB 3S34L 5D1ZD 4KHTH 4X99A 5L9DL 5F7EL 1DZBA 1RUQL 2CUMA 1ETZA 4ELME 5LGHL 1P7KA 3RVWD 5E2WH 1IM3B 2X4TB 5CP3A 3JTSA 2ZJSL 5TFSL 1FFPB 2CLRA 4ODHH 1KFAL 4DW2L 3BGFB 4WVRA 5JIIA 2X42A 3NZHH 3TIEA 1MLCB 3NZ8B 1MQ8A 2H6PB 1WBYA 2Q20A 4OLWH 5SV3A 4G9FE 1RSFA 3MYJB 4GMSH 2FEDC 3FMGL 3TYGL 4KJPC 5I76B 4HMCA 2GCYB 2W9LA 1KJ2L 4UNVA 3O4LE 1ZV5A 1LNUA 5MI0C 1EUUA 4S1DD 1M6OA 3CXDL 3Q1SL 1TQCB 2FJGB 1MCRA 4JO4L 2YD1A 4PLNC 1NGPH 2ZG2A 1QNZH 4QRPE 4H26A 1KPVA 2NY6B 1A6TA 3EJJX 3PHSA 3GK8L 5TE4H 1B4RA 1C5CH 3JWOH 3S7GA 4Z8FL 3GBML 4IOFD 3WLBB 1JMZA 3B3IB 1YEJL 2AXFA 4LU5H 2WIMA 3ZT7A 1AHWA 2X89A 3ZKMC 3RL2B 4LLQA 4M61B 5HYIA 2OJZL 4YHYC 4LHJB 4UT9L 2B4CL 3F58L 4WEBL 4L3CB 1JP5A 5EFIB 3SKJL 2IBGA 1S8DB 5I1JL 3ULSB 2EKSA 2UWEE 4M5ZH 3TZVC 5ALCH 4X6EA 5MP6L 4NQDA 3L3DA 3RAJH 3DVGB 4DFHA 1YNLL 1B9ZA 4JHWH 5DRZA 4K71C 2XZCH 3T09A 1A0QL 2ZG3A 1JHTB 2JJTC 5I1AB 3QHFH 1JPSL 1L7TL 4OZHE 1RHFA 5F9OL 1P4BH 4JKPH 4OBSA 4Y19B 2HAZA 1EJOH 3DRQB 1RUPH 2NYYD 4F37K 3QZWB 3B2VH 2R2HA 4Z7QF 1I8LC 4OF3A 4X6CB 4X6BB 5D70L 1OAYL 3MBEA 1KC5H 5DJCA 3QI9B 4F8TA 2F19H 4LFHD 4ZTPH 3FB6B 2XQBL 1MSPA 4M62L 4FQLL 4NHCH 5T1KB 5DJXA 5C6PB 4G6KH 1IBGL 4F33A 5FGRA 4UU9B 3HNVH 3SBWC 3WNNA 4BSJA 1A7BA 4NKIL 1HIML 1KLGA 3HMXH 3UBXA 1U36A 4JFZL 4HWBA 2FGWL 2J88L 3MRNB 1N5AA 4FQQB 4NZTH 3QWQB 1DQJA 3QJHA 5FFLA 3CH1B 3QB7C 4WY7L 5I73C 2FSEB 4DVRL 1YYMH 4MD5A 1A1NA 1NUDA 4HJGB 4ZD3L 5ELIA 3D0LA 4LNVA 2F5AL 4FZ8L 2ZSVA 3OX8B 3GMQA 2FDBP 3VMNA 4YDJB 3Q2CA 3VXQB 1RUKH 3PWVB 3DBXB 4X0KA 4NCC2 4XXCC 4NZDA 2BY0A 1HSBB 2JK5B 3ZKSD 1HHIB 4PJAF 5F9JA 3EYUL 5ISZB 3N85L 3WCYA 2DL9A 4IRJB 3NPSB 4L3EE 5AWNL 3L5WA 2FEDD 3EZJB 3SE9L 4LKCA 4WJ5A 3C08H 1CGSL 2FIKA 4MA1C 3QNXB 1TFHA 3D5OF 3TPKA 1EO8H 4JGMA 5EG6C 3MLXH 4U6HA 3ROLA 4Z76B 1RMFH 1T1ZA 3B5GA 1FL6A 2D7TH 3BDXA 4LIQH 3SGEI 3PHOA 4CJ1A 4M6MH 3SGEH 1NEUA 2DLFH 2QSCL 1TLKA 2VABB 3MA7A 4ZTOH 4OGXL 1DBBH 1GHFL 1KN2L 4E41E 1E4KA 5L7XH 4PD4K 2AQ2A 1G9NL 3QUZA 4JFXA 5SWSE 3VFSA 4KTDL 4ERSH 1YNTB 3GI9L 1D7FA 2VAJA 4ZOAA 1ONQB 1I7RB 5J1AA 4WU5A 1B0RB 2BMKA 5EZLB 1RUMH 4LCYA 1CFSB 4Z78B 1EMTL 1JGDB 3KPRD 4NFBA 1KIPB 2YPLA 5T3XL 4D8PB 2E7LC 2DS4A 4ODUA 3TGXA 1U9KA 3RU8H 5E6ZA 2OM5A 3UJIH 2AV7B 1G6RL 1Q9KB 2IPTH 1VEPA 5JORB 4G3YL 5BQ7A 3D69B 3JV0A 3EO1B 3TO4A 3HPJB 4WCYL 4P59H 5I1CH 1U8MB 5INCA 1SJEB 3R0NA 4R97B 5D71H 4UB0L 1DEEA 2EYTA 4RMWA 5DURD 1W72H 2W0FB 4FABL 2BSSB 5EPMA 4R2GC 1M7DA 1NCWH 1Q0YL 3ECBB 2L4OA 3QH3A 4OBRA 4FFZL 3NCFB 3T4AB 5F1NA 4GRMA 2AEWA 1Z2KA 1EEYB 3GMOB 3HE7B 1A1OA 3BO8B 1Z3GL 4RAVB 3H0TA 1G7JA 1CICC 1BBJB 4D0BA 1B88A 1VKXA 3TH2T 1INEH 4UTBH 4P23B 4BFEA 4KPHH 1AGBB 1NBQA 4YK4B 4HBQA 5C0AA 1IARB 3IGAB 4OZFH 1YEGH 4XCYA 2GQHA 2A6JA 1YC8A 4I48B 4KJQC 5EOCH 5CEXB 4D9RE 3DARA 1BM3L 5I1DB 2LTQB 4LF3B 3UJJL 4Q6IB 1AXIB 4ZXBB 1AC0A 2L0DA 3SCMB 5FHAL 2YPVL 5F88B 2VQTA 3MRDA 4RMQA 3O2VL 2FJHB 3L9RB 3UEZA 5IVZB 1WWWX 4XXCA 4U3CA 3HHRB 5EU4B 4JCMA 4D0CB 3EO0B 4KWUA 4JO1L 5FUZH 1CE6A 3T3ME 1QSED 1WAAE 3G5XB 4K8RD 1G7PB 5D5MF 3FO9B 1RZIA 1CDBA 4AL8H 3WO3B 3MYZA 3GDBA 3EAKA 4HZLA 2B4CC 5I2IA 4PJ8A 1CXKA 3QQNA 3GHBL 4QHMA 5L2KB 1KXVC 4HWZB 4O58L 1CE1L 1HNFA 4JG0H 5A40E 5IB1B 4JFEB 1XCQA 3KYMB 4BUHA 3KYKL 3MRCA 4IIQC 3I6GB 1MAML 4LBEA 5H94B 4S1RH 1UYWH 1GPOH 1UVQA 5KG9A 4PJDB 5EOQL 4JM2F 4NN7B 1E4XI 3FL7A 1GIGL 4FFYL 4X4XA 4TULL 3RDTB 5IBTH 5HXMA 4JN2A 1QHPA 5IW1A 4JJHA 3UTTA 5EWIL 1IILE 2BVOA 2GSGB 2PN5A 5C3LD 4AIOA 3L7EA 2E7LA 5DUBA 3AREC 5GS1C 4TQEL 3E0GA 1OF2A 1KV3A 2C3VB 3STZB 3QO0A 4HAGA 5DD6A 1MFEH 4AH2B 3R06B 3L3GA 3N50A 2FX7L 1OSZB 4X9FA 4MJ5A 5TDPA 5DJDA 4J7RA 3N9GL 3EYOB 5L2KE 3CDGA 4G8GE 5TDNA 3OAZH 3UTSB 1VACB 4JPIA 1FV1B 1PW3A 3MLVL 4JFEE 4W6WB 2C1OB 4J2XA 1J7VR 1T1WA 4OF0A 5FYKE 1CICD 2CXKA 3QA3A 4HH9B 2EIBA 4JGUA 4PB0L 1QR1A 3MXWH 4PJDE 4PJEF 3SDYL 2WQ8A 2CK0H 1BFTA 1KCUH 4PGJA 3L3KB 2AERT 4P5TB 3S36X 4KJQD 5I8OL 3EYSH 5F89B 1EFXA 3IRZA 3IXAB 3UYPA 3MLTB 3QHZH 1F8TL 1MCWM 3QUMB 1GOHA 1CFQA 4DCQB 1KCSH 1C1EL 5D7KD 1WT5C 4D9QD 4HIHA 5ABDE 4V1DD 3MNVB 3PXJA 2VSDA 4RWYL 2FBJL 4JEGB 4NRXB 3RNQB 4Z18A 4U0RB 3DURB 2GKIA 1EEZB 1V8HA 3VE0B 3IRPX 5HY9A 5IB5A 1J1PH 4YXHH 5J9PA 3VG9B 5DC0A 3V95A 2OP4L 4R7NB 1O7VA 3HE6C 3MCLL 2OTWA 3FB5A 4OD2A 1RK0B 4OQTL 1G9NC 1DJSA 1UG9A 3NA9H 2RCSH 1FAIH 3AFLA 3BP7A 1ACZA 2CJUH 3RX8A 1SEQH 2GUOA 5KSVA 4BUGA 4JHAH 4GXUN 4Y2OA 4NHUB 3VJ6A 3ULVL 5I9QB 4Q9RH 2WBWB 3KHQA 3M45A 5IMMB 4WFED 1U93B 1C8PA 3O6LH 3NFNB 4CADB 3QFJA 4Y5XA 2APFA 2H32H 1K3ZA 3BSZH 4I9WD 2FH8A 5ALBH 3HCVB 5IVXA 5E6IC 3VXOA 2O61A 1XF5B 2O5ZL 2B8OT 4GBXB 3EOBB 1XCTB 2G75B 1HQ4B 3ARZA 3JV4B 5E8PA 1X5ZA 2DQCH 4RGNC 5T1LD 2CDFB 3H2WA 4I5BB 4LEOB 1NBVL 3BUYB 2EDTA 3JZ7A 1NUNB 4UV7H 2O5YH 2R8SL 1HH6A 3KJ4B 3QEGL 3O6MH 2NY2D 4PY7B 3RVXC 3BIKA 1GSMA 3ARED 1GGBH 1EBPA 3TBYA 3SQOL 2VXTH 3VI3E 1ZWIB 4PJCF 5E2UH 1F6AA 3T0XA 5DHYB 4AEFA 5E1HB 1MCKA 1A7RH 2VIRB 5F9DC 2GY5A 3BKML 4DKFH 5TF0A 2BNUA 5E9DB 3VXMA 2AI0L 3HRPA 3VG0L 3TO2A 5D7IA 1L4IA 4U1SA 3W9DA 2N7BA 2F54D 5E4EC 1CDCA 2BSTB 3OKMB 1NQBA 2EO9A 1QA9A 1T20A 4ODTL 4XTRC 6CGTA 1T83C 4LLDB 1ZLWK 4PG9B 5D1QC 2PETA 1H3XA 5DUPH 2VLJD 1T4KA 3VDBA 1QEWB 1K6QH 4X7TA 5CSGA 4L9LC 3T65A 1S9VA 5BZDA 3QXVA 4K7FA 4YFLI 1P2CA 5B38G 1SJHB 5E03A 1H8OA 5E8EB 4LVOB 5I75B 5HGAA 3V4UL 3MV01 2ADFL 1EEQA 1MIEH 4FQPA 4K3DH 4QRUB 2P5WB 3C87A 5E8NB 4A6YL 5I8KH 1D6EA 2G60H 1JPFB 2V5MA 5IV2A 1JPGB 2FCBA 3H3KA 4UIKH 1BFVL 5HYFA 5INDA 1ZT4B 2EECA 3MJ9H 2NW2A 4ONGL 4L8SC 5CIPA 4PS4H 4HJ0D 2IG2L 5E9DE 5IHUH 3RWJA 3KPMA 3P0YH 4MQ7A 3BW9B 3AM8C 3VCLA 1O0VA 2YSSA 3V6OE 3E6HA 3CLFL 4P2RD 4M7LL 5K33A 2DQUH 2AABL 3CFCH 5T3XD 5DEGB 1QLEL 4FQ1H 1YUHA 1NLDH 4OZIB 3ETBF 3BPOC 3V8CA 3MRHB 3FFCA 5BV7C 3ZKXB 5D7JA 3V9FA 3EZ8A 5C7XH 4NQCE 1AR1C 3GM8A 2YWZA 4RGND 5BS0B 1E4JA 1KJ3H 3WNPA 3U0WL 2F54E 2HKHH 1I1YA 4ZFOL 5BOZG 2EDDA 3P11L 1LDPH 4S2SA 1G7LA 5KVGL 4BZ1H 3DVNA 5C08A 3TBTA 1YN7A 5D2NA 4RZCA 2GAZB 1JWMB 1NDMA 3ARVA 4PTTB 1MHPH 1IM9B 2PXYA 4P3CH 2ZUTA 43C9A 4AY0A 2YEZA 2CIIA 2VLJE 3RVTC 5I1KL 3MA9L 3S36H 5GSVB 4DN3L 4CN1A 4LLWB 4WWID 2IQ9H 4FHBD 1U3JA 3VXRB 1HXYA 35C8H 1JNJA 2DJSA 2Z8WC 1KLUB 3TFKD 1I7TA 1LK2A 2DN7A 4ONHA 4PGDB 3ZDYE 3VXPB 2ED9A 2I07A 3GUTA 3P9LB 2CO7B 1DANU 5KW9H 4WTZG 1OP3K 5D6CB 1UWXK 2HJKB 4L29B 3QCTL 3P40A 3VFPB 2BSRA 1MCLA 1OVZA 2D31B 2WMPA 4JO2L 4R8WL 4JDTH 5CJXA 2JIXD 2DLEA 3PWLA 2WM0A 3TBVA 2YXFA 4OZIE 3MLWH 3MRFB 4QHUA 1IAIL 4YDIL 3ARBC 1W8OA 4U3XA 2CIKB 2D03L 1FJ1B 3OL2A 4PFEA 5BS0E 1YEKH 3DUUB 3H6JA 4X5WA 1FCGA 3S4SB 3BT2H 1JYVA 1MJ7L 3BP5A 4U1NB 3WIFB 5I6XC 5E4IA 3FQRA 5D1QA 4JPKH 5K9KB 3HI5L 3O8XA 1FYTA 1XGRA 4BFIB 1TPXC 4LVNB 3W9EB 4QCIB 5JXAH 4L9LA 4YFLF 1ZANH 1I9JL 4XHJC 3HC3H 4XNYH 4BK4A 4ONOA 2OMBA 2LU4A 4FQXA 1MUJA 2Q7YB 1IAIM 1R5VB 3GSXA 5CEZH 1U91B 3O4OB 4PR5A 2NX5D 5JPNA 1LO3L 3E2HC 1RJLA 3VXRE 3VRJA 1J18A 4OAWA 5IWLA 1NJ9A 2HJLB 4N8VA 4FQCH 2VLRD 1ERNA 2JCCE 3DSFL 5IK3B 2N1KA 4KY1H 2ZPKL 3UDWC 5IJVB 1P4LB 4PB9H 1DE4A 2C9AA 5A3IC 3LRSA 1AD9A 3TT1L 4PGEA 3GSNH 1NC2A 3PL6C 4L8SA 1S78D 4EUPA 4P57B 2QQNH 3O2WL 3S5LB 4H8WH 2QADB 4S0SD 1MREL 1JTPA 2X1QA 3IDGA 3DROA 3SDCB 5GSRB 1UZ6E 4OLYH 3CC5B 3A0OA 1TIUA 2Z8RA 2YBRB 1AC6A 3AVEA 4ZPVB 5FA4B 1WC7B 2ZUYA 2Z8VC 4LAQH 1AE6L 2DF3A 1LEGA 2Z35A 5LCVH 5CD3A 4KRPB 2XYCA 3WYRA 1CG9B 5J89A 4Q74A 3BIBX 1AR1D 2FATH 3QRGH 3NH7L 3MGOB 5C6TL 2YZ1A 3BFOA 4I18C 3TM6A 5D96B 2DWEB 4Y4FA 1DVFA 3KPOA 3B2UD 1ZHKB 3GNML 4ZUUB 5D8JH 1U8JB 1EZVX 2HH0H 4OJFH 2EZ0C 1OD9A 3LSOB 5TGBB 3ULUH 1IC4H 4PLOB 12E8L 3OXSB 5ESVA 5H35A 1R3HA 4GAJL 3RVTD 5I30H 5C0RL 1BJ8A 1YY8B 4QT5A 1JYXA 3RZWA 5DQDL 4LDOB 3ARGA 1JF1B 1QYGL 3H8NA 4KDWA 3IDXH 1MCEA 5D6DC 2AKRA 1MJJB 5EU5B 2V7NB 4JKWA 4EI5D 1UEMA 4RNRA 1RULL 1S5IL 4WFFD 1DDHA 3DIFB 5BRZA 4F7PB 4R9HA 5DTFB 4F58L 2F53D 2X4SB 4AM0B 3UPRB 3D9AL 1G7MB 2IFFH 4QF1B 3BZ4B 5DLML 1FVDA 1JZ5A 3P30L 4N1HB 3TT3H 1MVUB 4XX1E 4DKDC 4PRHB 4P2OB 3ARBA 3CVHA 2BDNL 1PG7W 2MHAA 2ADIB 5CZVH 4HUVA 3TNNA 4MWFB 5DRWB 2VN7A 4JDVA 3UTPD 5D72H 1RPQA 1U8HA 4BQ6A 4DGVL 4XHJD 1R5IA 4I77L 5DWUH 2DM3A 1FFOA 2BNQA 2HT2C 3C60C 4M4RA 2VR4A 3CLEH 4ZUTA 1T89C 1ZHBB 3NACH 2IGFL 5J4MA 1KCRH 3QDGA 4I3SL 3SHSA 3SY0B 2VXUL 5E08H 3ULVD 1PKQA 2AJXH 3DMMA 3H3PH 4L4TD 4YBHA 5CSZA 5KZCB 3FOLB 3TC9A 2A73A 5B38A 4HXAH 2P46B 5EU6E 3K3QA 1S3KH 1CYGA 1SM3L 1CGTA 1XGYL 3WFDH 3PL6D 5DMKB 3U46A 3AU1B 4DOHB 3MRMB 1D5BB 2CLZA 5DK0B 4GKZB 1T7YA 4TSAL 1VGEL 4Q58C 1OAKH 1V7ML 4F3FB 5HI5C 1A6AB 4Z6AT 5HBBA 1TITA 3BHBA 3W81A 1UXSA 5D2LF 4ZNCD 3AB0C 4PRHE 4PRID 1DN0A 4I0PB 5EA0L 5AAMA 1IAOA 4M48H 1R0AL 4U1IB 2M8XA 1JZ3A 5MERB 3BH8A 4Y4HD 3A6CH 4HK0A 1YECH 2GTZB 4TTGA 3BXNA 3KPNB 5CBAB 1LK3L 3LKRA 2AK4A 5EN2A 3I6LD 4HXBL 3W5NA 2EZ0D 3IJSB 4F80A 1I3VA 3BD4A 2AJ3A 3ULUF 1N0XL 1FP5A 1GJIA 4LOUC 1BZ7A 2JJUA 2OZ4A 1RZKL 3V6ZA 3FO2A 4Z7VE 3P2TA 4OI9A 1TZIA 4PJHB 3ZSTA 3UTPE 1FNGB 2EH8H 4JFOB 4XNMA 4XMLH 1MNUL 2ICWI 4IRSC 3OTTA 1A6ZA 3T8XB 4D2NA 1F4XL 3T1FA 3B9VA 5CP7B 3UMTA 3P9MA 3MRPA 4PJ5A 3T2NH 3ZTJH 3O9WC 1XZ0A 3REVA 4FXKB 5I17A 1F58H 3I50L 3V0VB 2ITDA 3G6JE 2EH7H 2H26A 2IEPA 3MACL 3ZE1E 5IG7A 2EC9T 4ZS7L 2HVKB 1IJ9A 1LP9A 3BIAX 3QDJD 4WW1A 4KKLC 5GS0L 3U0TB 3GI8L 3T3PE 5HDQH 1UH3A 1TJGH 5DZLA 4ZMAT 2W38A 2X4OB 1QZ1A 4QYOA 5CILH 5GGUB 1KG0A 4X6DF 1LEKB 3W0WB 2C7UA 1FLRL 2NW3B 4FXLA 3CFBA 5CZXC 4GRWB 3KNBB 4XCEA 1SY6A 1T2QL 3QUKA 1MCDA 1PX3A 5F8RC 1IZJA 4Z5RA 1SEBB 1ZHLA 2Q76B 2ZCKL 3C60A 3UC0H 3ZT5A 4X80L 2XV6B 2XZAH 25C8H 4YDLC 4PJHE 5F3HB 3RWGB 3MFFB 4U7MA 3HS0A 4MAYA 4DGIH 5ENWB 5TE6L 2VDNL 3GRWL 1A1MB 3BWAB 4LCWD 3KAAA 5CJ5A 2RFXA 4NQEE 4AEIL 4OIIL 4UINL 2A0LD 4JY5H 2A2QT 5B39A 1VGKA 3FTGA 3SDXF 2Z4QA 3FO0L 4WIQA 2HMIC 4ELKA 4Z7UF 3AXLB 2GJ6E 4G42A 3HFMH 4NRYA 2RB8A 1RIHL 3CX5J 5KSBA 5M7QA 2Y06H 2HFGH 5DD1L 3CMGA 4NWUL 4Y5YC 1YEFL 3MZTA 4J4PC 3QG6B 5IFAH 5BO1L 5LXGH 2X1OA 4H88H 4HZAA 5GGSA 3QQ4A 5SWZA 1LO4L 2KQMA 3MXVH 3ZTNL 1NSNL 3W0WE 5DC9B 1NAKL 1T66C 3TJHC 3MROB 1XGQB 2E27L 3VD9A 5AD0A 4UV4L 4FQIL 5JHDB 3KGRA 3KPSA 3LN4A 5BVJA 3S98A 1LQSR 2R0LL 3DLQR 1ZKAA 4L1DA 2BNRA 3ZYJA 5EC1B 3GMNB 2XT1B 4K7PY 4H0IA 1MCBA 4KDTC 1ZVYA 4LLYA 1Z9MA 4HDIB 3U7WL 3TNMB 3LKOA 4KQ4L 1CF8H 1T2XA 5JLZB 3FO1B 2N4IA 1Z6JT 3M1BA 3NGBC 4KVCL 1T22B 4C56D 3MRJB 5CD5C 2FEEI 5ESQA 5C09A 3OJ2C 2MMXA 2KZWA 2XA8H 5JZ7D 4ESKA 4IRSD 4Y2DC 5FYJU 2VZ1A 4OCXH 3OKEA 4XBEH 5ERWA 2BVPA 2J4WH 2PCPA 4MA7L 5AG9A 1WWBX 1ETZB 5C0GA 1P7KB 4PLKC 1N2RA 3EOAB 2LVEA 5J12B 4RX4D 1CS6A 2J1KA 1BFSA 3JTSB 3HUJF 3O9WD 2LE9A 2R23A 1ED3A 4U6TA 1CT8A 4JG1L 4YQXH 2YKLH 4YR6B 5FA3A 5L0QC 1RIVH 1T1XA 4ZFFA 4KKLD 1EA9C 4NQVB 5B8CB 1UWGL 2NY5L 1JCKA 1LNUB 1JGUH 4XB8A 4OUOA 4XC3L 2DD8H 1QG3A 1FIGL 5JHDE 4PP1C 1MWAA 3OR7A 3QHTC 4O00A 4RFNC 4NO0D 3HC4L 4U31A 5CZXD 1W0VA 2Z0BA 4H26B 4JFDE 5JIPA 1CR9H 3H9HB 4NPYA 2FGZA 4HUXA 1WFOA 4WV1C 2AXFB 3WIHA 4YO0B 2VLLA 1AHWB 5C1MB 5I1IL 3NZHL 1KEMH 5ETUB 4OLWL 4HCRL 4LLQB 4HGWB 4RWHA 1NLBH 2EDJA 4EXKA 1JUFA 3RWDA 4GMSL 4M1DL 2VH5L 1UEYA 3IKCA 5CLWA 3WL9A 3UYRH 1C5DB 4X6EB 3OAZK 4NQDB 3L3DB 1A5FH 1YEIH 5DRZB 2F8XC 2GFBA 4MQXC 1NGPL 5DD3H 5FF6A 1X4YA 5GGVL 1JPST 1QNZL 1YPZA 1I9EA 3LD8B 2H1PH 1KTLB 3QEUA 4KU1A 4ZS6C 3FQXB 2Y23A 1C5CL 2HRPH 3JWOL 2XWTB 4Z77A 2EYRA 4Y5YA 3U2SA 1B2WH 2R2HB 4LU5L 1JHLH 4RGOH 1NCCH 5ANMB 3MRRA 2PO6C 3KYOA 1HHKB 1BD2D 4YHNA 3MBEB 4K2UL 3I75B 2AXGB 3RY5A 1T66D 2XIDA 3C9NA 4WUUD 3TJHD 3CAFA 2R39A 2VDML 2KKQA 3AUVA 5DJXB 3ALWA 3QULB 4KDVA 2WBKA 5IGXH 4M5ZL 1X5KA 4WI3A 4F33B 4TN9A 4OZ4A 3RAJL 2V2TB 4Z7OF 3P4NA 3A6OA 4EQ3A 5EBGA 1DLFH 3UBXB 4N0UB 3QHFL 4KDTA 3LMJH 1JPTH 2FX8H 3RA7L 1KENL 1YEHH 4JKPL 1DQJB 1NAMA 1RUPL 3FQWA 5CD5D 5HHMD 3FT2A 4KUCD 3IAGC 3B2VL 1DBAH 3CK0H 5GS0C 2LABA 1A1NB 4Y2DD 2VLMD 2D7MA 3MGAA 3H7BA 4NQDE 2VQ1A 2ZSVB 1KC5L 5LVEA 1ITCA 2FO4A 2F19L 4ZTPL 1FVEA 3LPWA 1G7HA 3QP3A 4NHCL 4PLKD 4ZFGL 4X8JA 2PTVA 4X0KB 5J6HA 4G6KL 3TA3C 2MOVA 4BH7A 5IHZA 1BECA 4XP1H 1ZTXH 4G6AD 3X14B 4ODWB 2ESVA 3HNVL 1E27B 5F9JB 5I66B 3RUGA 3OPZH 1U3HA 3WDHA 3ZDXE 5ANME 1SBSL 3GKWH 3VD5A 3L5WB 4LSRH 4K3GA 2GTWA 3QUZD 4LKCB 4U1MA 4HV8A 4NZTL 2FIKB 2K9UA 3CVIH 2X10A 2QHLA 5JIHA 4RAUB 2XPGA 4U6HB 5MI0B 1YYML 2CKBL 2ICCA 3ROLB 1FL6B 4FOMA 2H9GA 2KPNA 5FECA 4LSQH 4KKBD 3MA7B 5T5NF 1VESA 2P24B 5IOPB 2CUHA 3VFVA 5IMKA 4NWTL 2IANA 1NKOA 1W8NA 2NY4B 4LPWA 4X7FC 3UJTL 1I1RA 4XCCL 4JREB 3VFSB 4NUGL 2VL5B 4PRPD 2L7UA 3ZHLA 3FJTA 3CFJA 5J1AB 4Q97A 3O6KH 2BMKB 5EO1A 3HAEA 5FUCE 3CPLA 2D3VA 5CCKH 4YHYB 3WHXA 2UWEF 1EO8L 4ODUB 3MLXL 2XI9A 2DQJH 4NZJA 1RMFL 1S9WA 4LIQL 3VGGA 3KPRB 4KI5F 4MQXD 4XVSL 3TZVB 4GW5B 3NFSL 5DT1H 4ZTOL 3TO4B 1DBBL 3CFDB 4OLVH 4DKEH 3FHQA 4K71B 4U1HA 4ZS6D 3TBSA 3D3VA 4P2QD 3SPVA 4OZHF 5INCB 3LKQA 3OKLB 5HPOA 3I3EA 3EKCA 4RGMC 3VI4E 1DEEB 2EYTB 1KB5A 4R4NC 2PO6D 1NGWA 3MJ8A 1M7DB 4O2EB 3QH3B 4PBWD 1NL0L 2IPUG 1FO0H 2ICES 1ZGLM 3V4VL 4MNHB 2YN5A 1A1OB 4PIRF 4X98A 4C57C 4GO6B 3H0TB 1P7QA 1FZOA 1VADA 3O3DA 1VKXB 3IJYB 4WWKC 3HKFA 4BZYA 3GFUA 5I1CL 2A6JB 1YEEL 1D5IH 3ARDC 5D71L 1CGWA 4OZGA 5LGJA 4J3XA 5GS0D 1T0MA 5FM4A 2R4SL 2YPLE 2NY5C 3B6SA 4XAWH 1NCWL 1QFUL 5I73B 4ORGA 3EDFA 1OT1A 4PJ8D 4KVNL 3SKOB 3MRDB 5KVEH 3QEQA 3PWPA 3TA3D 4AIZB 1V7NL 1ZSDA 4NDMA 1S7TA 5EU3A 5BXFA 1CLYL 2W9EH 3QIUA 2VXQH 1INEL 1Z5LB 2EDOA 5HYQA 3SDDA 3OXRB 4KPHL 1JZ7A 4XWOC 1RZIB 5T33H 4B7LA 5IEHA 5H2BB 3REWA 4XC1L 3FOMA 3Q6FA 1QQDA 3EYVB 4MA1B 4W4OA 5DVNA 2MNUA 1S7XA 4QHMB 3PQYD 2EDWA 5GRJH 1QRND 4OUUA 3C5JB 4ZO7A 5EU7E 1OAUH 3RP1A 4Z95H 4OV5B 3MRCB 5C0AE 2DQHH 4CDGC 4GG8A 5T3ZE 3MV8D 4LBEB 4DFIA 3JWOC 2JELL 5KG9B 1IGML 4FN0A 1FLTX 1XGUB 3LQZA 4DZBB 3T0EA 4HIJA 3ZHDA 3UO1H 1AY1L 2A83B 4X4XB 5D7LA 3U7YL 3DX7A 1V3JA 4FFWC 3B9EA 4JN2B 3LKSA 5IW1B 5ILTH 32C2A 4Q0XH 3HG1D 1HHGA 2BVOB 1R5WB 5TF1H 3L7EB 1K2DA 3RGVC 5DUBB 2J2ZA 3NIGE 3PGDB 3QNYA 4FTVD 4ZFZA 4GKSA 4JG0L 5ICXA 4OF7A 2R1YB 3KLDA 1Q1JH 3QO0B 3QQ9C 4HUWA 3SGJA 4XPHH 4QOKD 2AJYH 3U6RA 4R4ND 1UYWL 1SJXA 5EULV 2FL5A 1IQDA 4RAHA 5KANI 1HHHA 5TDPB 5DJDB 5D9SA 5C86A 3CDGB 1AO7B 1U8IB 4ZAKC 4ZUWA 4R2GB 1B0GB 5DJ6A 4NM8H 2Y7QA 3CSPA 5IBTL 1OGTB 5HHOB 1WCBB 2VRAA 2Y72A 1T1WB 4E5XA 3QCUH 5DFWH 1X5GA 4K8RH 3RBSA 2EE9A 5C2BL 5TE7H 5DRXB 1ZXQA 3K2MC 1VENA 3BGMA 1YMMA 1VPOL 5K9JH 4WWKA 3WHE0 4UI2A 3KHOA 1MCFA 1MFEL 1XFPA 2I9LB 3ARDD 3ZL4H 3VWJC 5I1LA 4KQ3H 1RJZA 4XGZB 1EFXB 2ED7A 4ZUSA 3UTTE 3MRGA 2YWYA 1NCBH 1CFQB 2EDYA 4WFHD 1KJ2B 2C3HA 3SJVA 4X9BA 4HIHB 2QEJA 2BRQA 1JI2A 3MUHL 3IU4L 2B1AL 5E2VH 5DYOA 3RTQA 2DIJA 2AEIT 1TVBA 4HS8H 1T0NA 4NP4H 4M3JA 5F71A 1E6JH 2OTWB 3FB5B 4XWOD 3BDBA 2CK0L 5C0NC 4PJAA 2PW1A 3EYSL 1CFBA 5HHOE 5DO2C 3C6LA 3QHZL 4WW2A 1X5XA 3VJ6B 4ELMA 1NKRA 1NC4A 1QBBA 4QXUH 3QFJB 5IBUB 4Y5XB 1T03L 5IVXB 5ID0A 3VXOB 2OL3H 2O61B 2W65A 4JZOB 1J1PL 2NXZB 3S34H 2Y25A 5E8PB 1YQVL 3PJSA 5F7EH 4NQXA 1NGYB 3QIBA 1RUQH 3GIVA 5LGHH 1B0WA 4FFWD 2RCSL 1FAIL 4JM2C 2ICEA 3C2SA 2CJUL 3MFGB 4F9PC 5TFSH 2HFTA 5GIRB 1KFAH 3BOVA 2IQAA 4I3GA 4QRRA 3RGVD 3BIKB 5JUEH 4IMLB 3F62A 4Y8AA 3O6LL 2FBOJ 4LGSB 3FMGH 4YBQD 3TYGH 1NPUA 5FYKU 4YPGB 2DJ4A 5DZOA 4CL7A 4Z7WA 2DL2A 2W07A 3N1GC 1KTDA 2DQGH 1JL8A 3EFDH 4GAFB 3KPTA 2DQCL 4MCZB 4QRTA 5C0CD 2EIDA 2BNUB 5KAQG 3VXMB 1SQ2N 3B43A 4XXDA 4ZAKD 1OARH 1N26A 4G80A 4JRYD 4U1SB 4UV7L 3ZHKA 4Z8FH 5HDBE 3GBMH 3QFJE 1JJUA 1IM3A 1CGVA 5AZ2H 4K9EH 1YEJH 3O6ML 5IVXE 1F42A 4QTIL 2HTKC 1QA9B 5E24E 2ENYA 3D39A 2G5BB 2R9HC 2CLVB 3BN3B 2H6PA 2QQLH 1XF2A 3JWDH 1NEZB 4PJDF 2OJZH 1CD0A 4XP6L 3F58H 1CWVA 3ESVF 4WEBH 2VXTL 4X7TB 5CGMA 3T65B 2IAMC 1S9VB 2O26U 2VB5A 3VWJD 2QHRL 5E2UL 3T0AA 1P2CB 2GIYA 3HMXA 5MP6H 2ZNXA 4N9GA 5HGAB 1DQMH 4DKFL 3VXNA 5DHVB 3DHJA 1U41A 4EQ2A 4G8FA 1L7TH 4DUVA 1D6EB 5IBLC 1A7PH 5IV2B 5E94A 1MQKH 4HKJB 3WLBA 4JFFB 3B3IA 4Y4KC 4GJTB 4JGJA 1UKTA 5IP4A 5INDB 2XN9A 3BN9C 1RHHB 2Y6SD 7CGTA 3FN3A 4RA0C 1KJVB 4M61A 4RISL 3SQBA 2R0KH 5F93C 2EE6A 1U92B 5DHXB 3RWJB 2VSCA 3VXME 5C0ND 3KPMB 4MQ7B 1J0IA 1K6QL 1AP2A 4L3CA 5FGCE 2MCPL 3HE6B 3ULSA 1QLRB 4QTHA 3SDAA 5F1OB 5DO2D 2UUDH 2YSSB 5IHLB 4M7LT 1DQLL 3E6HB 1LO5B 4MJ2A 4M7JH 1HIMH 2KL6A 3HR5A 2XZQH 1JHTA 4JFZH 3GGWB 4X5LA 5HGGS 5I1AA 4K3DL 1QO3A 4MS8C 1WWAX 1WWCA 4CMMA 1YUHB 7FABH 2PXYD 4JRWA 3RZCC 4Y19A 3DRQA 4DAGL 2X70A 2OTUA 5JDSA 4XMKH 1II4E 3QZWA 5D7JB 4WY7H 4X6CA 3D85D 5E6IB 3KPPB 4X6BA 4LSPH 2AJZB 2F5AH 4FZ8H 4NCC1 1UACL 3QI9A 4R4FH 5IROC 1J0YA 1AI1L 4PS4L 1I1YB 5IHUL 5AYQA 5T1KA 3P0YL 3WHE1 4S2SB 2NY0C 3E6FB 1MFDH 4K94L 4X9HA 4TVPL 4PD4J 3TBTB 1YN7B 4PJIB 5D2NB 1NDMB 2NXYC 3RHWF 3EYUH 43C9B 5EZJA 4F9PA 1JFQH 1MRFH 1CDGA 2CIIB 3CFCL 3N85H 4GG6B 15C8H 2EDRA 1JRHH 1RU9L 3EO9L 3WKML 1NLDL 3SE9H 2X1PA 1HXYB 3VFNA 1CXIA 3DXAA 4ONHB 1KULA 3CH1A 3QWOB 2I07B 5C7XL 3GUTB 1QBML 1K8IB 3KLSA 4ENED 1H3UA 2BSRB 3DVIA 1JV5B 3QJFB 4OGXH 2HKHL 2IBZY 4YDJA 3VXQA 1KN2H 1TXKA 4HFWA 2EC8A 2BOCA 3HRZA 5CWSB 1OW0A 1EGJL 4WTXA 4BZ1L 5IKCA 3U4AA 1W72A 2JK5A 1HHIA 2HTKD 3FFCE 2WP3O 1DFBH 4TSCL 1MHPL 1QFOA 4KTDH 2F8OA 1JNNL 3QG7L 5ISZA 1HXMA 1JK8B 3S36L 4X5WB 1F97A 3BP5B 3VMPA 2IQ9L 3VH8A 3BMWA 3FT4B 4CJ0A 2IAMD 1OM3L 5D1QB 1EMTH 4HULB 5E99L 4WI5A 3O8XB 3QNXA 1FYTB 4LGPB 5T3XH 3SE3A 3O3UN 2P5EB 4JQXC 5C08E 4L9LB 5DMIL 5D2NE 2DBLH 2B1HL 1G6RH 4P48A 5J7CC 3HI6H 5CEYB 4PUBL 3BPNC 4OZFA 4QHKI 4GG6E 2D0FA 1CLZL 2P48B 4OGAC 1HILA 5IBLD 2X6MA 3MLWL 3VRJB 4OAWB 1TZHA 1NJ9B 3RVVC 1ADQL 3RL1B 1X3DA 2FB4H 1D9KC 3TBWA 3NCJL 1YNTA 2I24N 1LEIB 1Q0YH 1EXUB 3DYPA 1BP3B 1YEKL 3I3DA 5DI8B 2MKLC 4TTDC 1AD9B 5JXEA 5EZLA 3FB7B 4L8SB 1KYOK 4EUPB 3LQMA 4Z78A 3BP6A 4I0KA 4JPKL 4R7DB 5CGTA 1J5OH 3OJMB 2B5IC 4UMGA 4Y4FD 1Z3GH 4D8PA 1X4ZA 3L95A 4HH8A 5JXAL 4H1LH 1ZANL 3IDGB 3HC3L 2BY2A 4AEHL 1MCCA 1Q9KA 5JR1L 5FK9A 5J1TC 3EO1A 4MS8D 3HPJA 3WFCH 1OAZH 5KN5B 3WN5C 3RZCD 1LEGB 1XIWC 1B6UA 1UCTA 2Z35B 5CD3B 1LGVA 4FQCL 2R0ZH 1J8KA 4JB9L 1FYTE 3BPOB 2W0FA 1WAAA 5CZKA 3V7AE 5BV7B 2BSSA 3ECBA 2A77L 4P4KC 1DUYB 5FHAH 3KPOB 3T4AA 3GSNL 2FO1A 1AIFA 2NY0D 4OIAA 5TQ0H 2ARJQ 3GMOA 3HE7A 2UY7A 2QQNL 3BO8A 3SO3B 4RAVA 4H8WL 1KIUA 2NXYD 1MRDH 1CD8A 1BBJA 1XF3A 4JO1H 1AR2A 5FGBA 1R3HB 1H0DA 1EEUA 1H3VA 4APQD 3BESR 3BI9X 1FORL 4QT5B 5I8EA 3ARGB 5KS9B 4QGYA 5L88L 5LCVL 2WLZA 3ZDYF 1I3GL 2FNBA 2AKRB 5CEXA 3U9PL 4KJYA 2FATL 3DOSA 3QXAA 4LF3A 2RGSA 3SGKA 1YC7A 4ZXBA 5JTWA 1DDHB 5KVFH 3SCMA 4YZFF 3V6FA 2BNQD 2FJHA 3BAEH 4OZIF 1OCWH 3MV9D 3KVQA 2HH0L 3LKPA 4PJBB 1MAMH 4D0CA 3EO0A 1IC4L 4LHQB 3PXHA 4NYLA 5EOQH 1FRGL 3ARBB 1ZEAH 4JZJA 1IT9H 1GOGA 3CVHB 3PP3H 4TULH 1KGCD 1BF8A 4NBXB 4HUVB 2O93L 4N5UA 5I6XB 1U8HB 3L6FA 5HHVH 1R5IB 4RA3A 3CGTA 4QY8A 1TPXB 5L2KA 4ZUTB 4I4WB 4O5LL 2R0WH 4WFGD 4HWZA 1PYWB 1UXWA 3QDGB 5IB1A 4OGAD 5ICZA 1AQDA 3KYMA 5KS9E 2IPUK 5CSZB 3O3BA 4F9LC 2JCCF 3I6GA 2RBLA 5JPMB 5H94A 3TWCH 4PG2C 1D9KD 3TT3L 2A9ML 2FX7H 2FLRT 5HYJD 3TJEH 4TTDD 1MI5A 4L5FH 5BRZE 3U46B 1K4CB 3FQNB 3OF6D 2CLZB 4ZO9A 4S10A 2XWJB 4B53A 1MLBA 3PL6B 3RI5K 5D72L 1NGQL 2C3WA 4IHOB 5DWUL 4PJBE 4LCCC 3CLEL 1UZ6F 1UXSB 4NZUH 1KCRL 1DN0B 3SDYH 5EBWA 4TVSa 4PJXF 4WGWB 2X4NA 4PRIB 1UB6A 5IT2H 4MXVE 4I1NB 1M4KA 3BH8B 1F8TH 3HMWH 3ARXA 3ABZA 1S3KL 1I8IA 4OSUL 4HK0B 3F7YA 3S4SG 4P4KD 3BXNB 2H32A 2BNQE 1C1EH 3I3BA 4P46C 1N7ML 3EYOA 4L4VB 3I02A 3WFDL 5I74B 4I18B 3UTSA 5EN2B 5EUKA 3QDGE 3IDYC 4HC1H 4RWYH 4D9LL 2FBJH 3S9DB 2C1OA 1PKQE 4JN1L 2J6EL 1Y6NR 1CVSC 2FWOA 3PV7A 4RDQF 1JWSA 1OAKL 4J8RA 1B3JA 2P8MB 1TMCB 2Y36L 4PJGF 4YHMH 3MV7D 3WDJA 2OP4H 1J8HA 3MCLH 5EORH 3F7QA 1TZIB 4OQTH 1A3QA 2R1XB 3DECA 4CU8A 4XNMB 5C92A 4P5TA 5HVHC 3RY6C 4RDQG 3V5HA 5DJYA 1P4IL 3VXSA 3ARFA 1IL1A 5KSAA 1A6ZB 4WFGE 2ZSWA 3QUMA 3ULVH 3EDEA 5GRUH 1I3UA 1BQHB 3P9MB 4IMKC 4D3CL 2PR4H 3OWEA 4CN4A 3MNVA 1XZ0B 3S5LG 2O5ZH 2RR3A 4NRXA 3RNQA 4E9LA 3DURA 1EEZA 3ARUA 1F13A 3QQ3A 4HW6A 2ITDB 3GJEA 2H26B 3MRBA 3I9GL 5E95B 5F7FA 3DTXA 4G9DA 1HI6A 3P0VH 1PX4A 1M71A 1YZZA 1NBVH 2NY1C 3DVFA 4DQOH 3V7MA 5SX5H 4XPGL 4L4VE 3AGVA 4QYOB 2R8SH 2AK4E 1KG0B 1JE6A 3QEGH 5FO7A 5C0IA 4XX1G 2PNDA 3CFBB 5JOPE 2AAVA 5IMMA 1ZHLB 1MCOL 3C60B 4M6NH 3SQOH 1Q9OA 4I0CC 1XF5A 2CO6B 3HS0B 4MAYB 3K1KC 3ZO0A 1F58L 1YJDH 4DUXA 3JV4A 4BKLA 1S7RA 2VZTA 1ZOXA 5FYJL 4DGYL 4YEFA 1WZ1L 1BMGA 2WBJD 3BRDA 2CDFA 5SWZD 3BKMH 4MMXC 3PDDA 3U4BL 3LEVH 4NUJB 2Z92A 5HDQL 3VG0H 3QUYA 5B39B 1VGKB 4PJ5E 2Z4QB 4ELKB 4GSDL 5L8JB 1FNEA 1UCBH 5HDOA 1N59A 3MJ9A 4NRYB 4I3RH 5SWQA 2YHGA 4OCSH 3ZYIA 4YH6A 4TVPD 4H8WC 1LP9E 3VXTB 1K8DA 3UC0L 1PKOA 4HD9A 1WIOA 1G6VK 3AB0B 3TPUA 2CD0A 2ZP0T 4FFVC 5DHYA 3QIWD 3CH8A 3GMRB 4NNPH 3VGAB 3O6FC 5C09D 2CXGA 4Q9CA 3KDMA 1FBIH 4P46D 3V4UH 4U1KA 2XFXA 4JY5L 1UM4H 5BVPH 4A6YH 3LN4B 3MRIB 2BNRB 4NNXB 4CMHC 3HFML 2PF6A 2V6HA 2HFGL 3LKOB 4GXVL 4ONGH 4OD3L 4LLDA 3M1BB 4M4PA 4Z7VF 2P7TA 4MJID 3UP1A 4H88L 1QP1A 3P4MB 4PY8J 3U83A 2O5XH 3MXVL 3OKEB 5ERWB 1SJHA 5TPWH 4MDIA 2PCPB 3K81A 2AABH 1EK3A 4IRSB 5KSBE 4F7TB 3ULVF 1UWEL 1A4JA 1N2RB 2P5WA 3GBNL 1Q8MA 3INUH 1LE5A 2HLAA 1JPFA 4GT7A 3HB3C 2IH3B 2R23B 4Q9QH 2Z31C 1ED3B 3BQUC 1IFHH 5HHNA 2VDQL 4LQFL 3MBXL 3BEVA 5SWZE 4CVXA 1F3RB 3G6JF 3O9WB 1WF5A 1ZT4A 3STBA 1T1XB 4ZFFB 4Y89A 4LLAA 2ADGB 2NY1D 3T3PF 3U0WH 1HWGB 4HWNA 4U4BA 4Q7DA 3O2DH 5CS7A 4QNPE 4R0LC 4B7IA 3KPSE 1MWAB 3MLPA 3EW3B 2BNRE 1W0VB 1FG2A 4NPYB 2B20A 5JW4Q 4AIXA 4RBPH 1NCTA 3VWKC 4KK8D 4ZOBA 1GZPA 4PJHF 5C09E 1ORQA 4YDLB 3ZYOA 4YQXL 2YKLL 5K9OA 3QCTH 2RHEA 4N90E 4JO2H 4R8WH 4UBDC 4WO4C 1HDMA 2DMCA 5CP3H 1JZ6A 1MF2H 3QWRA 1IAII 4WNQB 4ZG1A 2GFBB 4C59B 1IM9A 1BJ1J 2NMSA 5IVOA 1PG7X 2D03H 2QJDA 2IH1B 3R1GL 5GSVA 1N6UA 4Z77B 5EH1A 1MCQA 2EYRB 4LLWA 2PTUA 4Y5YB 1H15A 3G5YA 4JPWL 4XCNA 1HNGA 3HI5H 4FFVD 4CVUA 1KEML 3IFPA 3KYOB 3MRRB 3P9LA 5GISH 1TENA 2DM2A 2HJKA 3O6FD 2DKSA 1NLBL 4L29A 1OLZA 4Y88A 2X44D 3VFPA 4KMTL 1OT2A 2V2XB 3OKKA 1L0QA 1AQKL 1RZJL 4MXQC 4ZO6A 4WUUB 5B3JE 2YD9A 1LO3H 4OZ4B 3P4NB 5DA4A 1YEIL 5DD3L 4TSBL 2CIKA 5HYSA 2H1PL 1NMCB 3MR9A 3IT8D 1VEMA 2COQA 2ZPKH 1CU4L 4BSVA 4CVWA 2HRPL 3MGTA 4U1NA 3TT1H 4EDWH 3NBNA 3FRPG 3FT2B 1HK6A 4HUNB 1B2WL 1CXLA 1JMXA 4I13B 4RGOL 1BVZA 1NCCL 2W91A 3O2WH 3H7BB 3LB6C 2VTFA 2VQ1B 3C5ZA 4QCIA 4M1GL 2FO4B 9CGTA 5EUOA 4EDXA 1G7HB 1YPZE 3OGCA 2KZ1B 1R5VA 1T7WA 5J6HB 3F7RA 1KUMA 5DR5H 3PP4H 2VLKA 1DEDA 2ESVB 1YA5A 2Z31D 3BQUD 2HJLA 5IEKA 3N1PC 4ODSL 1DLFL 2DQIL 5IK3A 3CZFB 3NH7H 5C6TH 1FIEA 2V5TA 4M6AA 4Q2ZB 2NTFA 3LMJL 2FX8L 4U1MB 4HV8B 1YEHL 4HS6A 5HI3C 4AG4L 1NGZA 2P8PA 5HHPA 1DBAL 2XWBB 4EN3C 4P57A 5HGDB 3NVQA 2H9GB 3B9AA 3S5LA 5FECB 2IJ0C 4P5KA 2G9HA 5A16B 3RHWK 12E8H 4HWBH 4U7SA 5IMKB 5GSRA 5C0RH 3N1MC 3VWKD 3TCLA 2EDBA 2YBRA 4ZPVA 1WC7A 3GHEH 4TNWF 4X6DA 4Y5VC 1JHKH 5DQDH 1UM5L 1N6QH 1HYRC 1NBZB 1ZTXL 2GSIA 5F6HI 2EDHA 3TVMA 1DTUA 1QYGH 5EC2A 2EDLA 2Y5TA 4CKVX 3QDMA 1QSFD 3IFOA 2EXWC 1QBAA 3MGOA 1RULH 3GKWL 3RWIB 4PV9A 2FHFA 4JE4B 4LSRL 5EO1B 3HAEB 3SOBL 3O81A 2DWEA 3VXUD 2GY7B 3WHXB 4F58H 1U0QA 4FMFA 3D9AH 1YN6A 5GRVL 1U8JA 1S9WB 4NKDA 2ESVE 1FNSL 1JNLH 4OM0H 2EYSB 1I1CA 3RWCB 3W11C 3P30H 3LSOA 5TGBA 3VFUA 4PYGA 5M94B 4U1HB 3TBSB 3D3VB 3SPVB 4KK6D 3LKQB 1X5JA 1JF1A 4AENA 1UH4A 4HX1A 4DKAA 1NGWB 1MJJA 3MJ8B 3QEHB 4DGVH 2YK1H 2QQQA 1ZVSA 5C07D 1QVOB 3DIFA 3O6KL 3SKNB 2IGFH 5JW5A 4F7PA 5CCKL 2KUTA 5DTFA 3B9KA 4I3SH 4MXQD 5FAAA 2IANE 3EFFA 2VXUH 1MAKA 2X4SA 1H3WM 1P7QB 5I16A 1FZOB 1VADB 4QF1A 3BZ4A 3O3DB 2D7OA 5GZOC 4IEFB 5DT1L 3HNTH 3LN9A 3OZ9H 2DTML 1A3LH 4OLVL 3HC0B 2MFNA 4PRHA 2DLTA 4RQQB 4GS7B 1XGYH 4X83A 4OZGB 1H8SA 2ADIA 1T0MB 2X1XR 2I5YH 4JHZA 1TNNA 4MWFA 3B6SB 3ILQC 1X5YA 4TSAH 1BF2A 4LPCA 2UUDK 4QRSA 3UTQA 4Y1AD 1V7MH 4K23H 3TN0A 1ZHBA 3QEQB 3PWUA 3PWPB 3EYQD 5GGTA 3UZQA 3D3VE 3DI2B 5EA0H 2OI9B 3TA3B 3QPQC 5BXFB 1OGAA 4NRZB 4J3VA 3HZKA 3D2UD 4C83B 5IEHB 1U8OB 5HI3D 5FYJD 3ZE2E 5DD0L 1LK3H 4JY4A 3AU1A 3MNZA 4GRLC 2QBWA 1QQDB 1D5BA 2D0HA 4M43L 1S9YB 5D7LD 1NGXA 3X12A 5HTSA 4XAWL 1NCUA 4OUUB 2R4RL 4NBZB 2E6JA 3T04D 3HNSH 5T5FL 1RZKH 1QRNB 3MODH 4C55A 4DZ8A 3DX8A 4I0PA 4XCFH 2PYEA 4MNQA 5T3ZH 1FNLA 4OFKA 4OZGE 4PLJC 3UBXG 2W9EL 4HQQL 4U1IA 1HOCA 2EXWD 2VXQL 5MERA 3LQZB 3RGHA 3RNKB 3C8KA 3T0EB 4HIJB 1OP5H 1WZMA 4PJ9A 2GTZA 5FB8A 3DX7B 5T33L 2UVFA 3SE4A 1QACA 3QEQE 3PWPE 32C2B 3VU2A 1PBYA 1VFMA 5F7HA 3GSVA 3W11D 3QYCA 5IMLA 1RZFH 4IJ3B 4YHZH 3RX5A 3QNYB 4IOIA 1JGLH 4GKSB 5HVWA 1OAUL 3H9SA 3BE1L 4HUWB 3SKMA 2ATKA 4LNRB 2VDKH 4MLIA 1AGCB 5E8OA 1YMMD 4EOWH 4YFEA 3U6RB 3GSUA 2OJEA 4NKMB 2FL5B 1IQDB 1P9MC 1KB9K 1B4JL 1UJ3C 3G6AB 4RGMB 3PNWA 3U0PA 1TQCC 5J3HC 3UO1L 1AKJA 4ZUWB 5DJ6B 4P9HH 2Y7QB 5CP7A 3DYOA 2Q3ZA 2LAGB 5ILTL 4Q0XL 1T6VN 4YC2C 2CGRH 3SJVD 2BRRL 4N0RA 5TF1L 1A7NH 4FXKA 5TE6H 2VDNH 2I9TA 3RIFF 5DDHA 4WDIB 3U82B 3VFTB 3BGMB 4OIIH 4UINH 3T0EE 4ZYKA 4WWKB 1Q1JL 4KHXL 1DUZA 5I1LB 2OXHA 4LEXH 1TTUA 5I0ZA 1ND0B 2AJYL 5GGUA 3WUZA 1MIMH 4JJ5A 1LEKA 3W0WA 3ILQD 2Y07H 5F9WC 4O02H 1I1AA 4KROC 1YEFH 3FRUA 4NM8L 1BAFL 4FRWA 5FDYA 2Q76A 4IOFC 5BO1H 1LO2L 5FYKL 3HN3A 3QCUL 5HVFB 1NC4D 4K8RL 1ZT1B 4HEME 3JVGA 1LO4H 3G6DH 3RTQB 4GKNB 3ZTNH 1TVBB 1NSNH 1T0NB 3PUCA 4JHBA 5TE7L 1AGFA 3FFDB 5K9JL 1X44A 5D1XA 3GMLA 5LJYH 4PJAB 2PW1B 4G9FD 2X41A 4UV4H 3PWNA 4Z7QE 4GRLD 3QIBD 2R0LH 3C6LB 4B50A 4C58B 1WEJL 3QISA 2EC9U 1WTLA 4WHYG 3AXLA 4PP2B 4JRXA 1IKNC 3U7WH 4KQ4H 3KS0H 5TQ2L 3IAPA 1FSKC 2ZCHL 3QG6A 1EHNA 1FE8H 4QRPD 4Z7NF 4KVCH 1D6VH 1YMME 3ARWA 5ID0B 4M00A 2W65B 4PLJD 2OR7A 1BJ1H 1YQ2A 2X4QB 4HS8L 3PJSB 4NP4L 1E4WL 2B39A 2P43B 4MX7B 1IEHA 2CR6A 3GIVB 1XGQA 2VZ3A 2NNAA 2E9IA 1GAFL 3T1WA 4IDJH 3V5KB 1V05A 5FYLE 2EXYD 5DVOA 3GMNA 2ENSA 2IQAB 2YZ8A 4M7KH 3DX9B 1I8KA 2R15A 4G5ZL 2W60A 5T1MB 1PQZB 2KDGA 3NIGF 5CSBA 4LDEB 4JG1H 1KCLA 1H3PH 3TNMA 3NAAL 5JLZA 3FO1A 3RGVB 4ZOCA 2HKFH 2NY5H 1T22A 4LLVA 2OL3L 4XNXH 4PJAE 1KTDB 4XC3H 3NPSC 3IDJA 4BH8B 3PP3K 4GMTH 1SYSB 3HZVB 3T77A 5E2TH 2DQEL 2APWA 3HC4H 3KXFA 4QRTB 6FABL 2UYLB 3OKDA 5J3HD 4XXDB 5CKGA 5D1ZA 1OQXA 3ORJA 4G80B 1P9MA 3MX0A 1EAPA 3EOAA 1FZKB 4OCNC 4JRYB 3F6IA 1RIUL 5EZOH 1WCQA 5I1IH 1UGNA 3D39B 5KSUA 5EO0B 5JUEL 1KEGH 3ARSA 3PG2A 1XF2B 4HCRH 3A6BH 4U49A 4YR6A 2XNAA 3NFPB 1VEOA 1FNAA 4M1DH 1BLNB 4NQVA 5B8CA 4MAUH 2VH5H 1WUNT 5EBMB 2DQGL 2V5SA 3EFDL 5IM7B 1A6VL 1PZUB 4N9GB 1INDH 3VWJB 4KK9C 4Q6YA 4OD1H 5GGVH 3VXNB 4QRRE 3IDNA 2PTTB 4AYFA 4KROD 3H9HA 4MQTB 1YEDA 1OARL 4G8FB 5FCSH 2A6DB 3QFDB 4ZDHA 3RWEA 4F2MA 1V3KA 3RIAF 2BJML 5E94B 1IQWL 5AZ2L 2FYYB 4BM7A 4K9EL 4Z7WE 2XTJB 2FJFA 4YO0A 3EDKA 3L3HB 2DB8A 2XN9B 4JQVC 5ETUA 2QQLL 3JWDL 4K2UH 4Y16C 4HGWA 1OPGH 2DLIA 4LSUL 4O4YH 2C3GA 1JTTA 2VDMH 1AP2B 4KJWC 4U2ZA 2ZOKB 4L3ED 5BOPA 4FG6C 3QI9D 2GHWB 4QTHB 4G8EB 3SDAB 1RAMA 1C5DA 3S3SA 4MNGA 1A21A 4BQBA 1T5XA 4KZDL 1IE5A 1EH9A 2AQ1A 5D5MB 5IHBA 1DQML 3HR5B 3U4EB 3MRKB 3D39E 5JQ6H 1QO3B 3WS6C 1OY3B 2ARWA 1KTLA 2UZIL 4CMMB 3IYLW 3RA7H 3FQXA 1KENH 5J56B 2XWTA 1A7PL 2BK8A 1MQKL 2X70B 2OTUB 3THMH 4P23C 4OLEA 5JDSB 1CGUA 2F15A 4E41D 4BFBD 1G7IB 5ANMA 4YXKH 1HHKA 3QBTB 3I75A 2AXGA 3PF2A 5C2UB 2R0KL 3D85B 5SWSD 4ZFGH 3QULA 3L5IA 5GZND 3QO1A 3CFKA 3O41A 4JM2B 1CXFA 2V2TA 2G2RA 3Q5YA 2XTJE 1K4DB 4M7JL 5EZJB 5C0BB 3DPBA 2XZQL 4N0UA 2XN9E 2DM7A 1FDLH 2YR3A 1FH5H 1SBSH 5CIPH 3WNMA 2X4PB 7FABL 3MUGA 5GJSL 3VFNB 1MJ8H 5ISZD 4CNIB 1MY5A 3DXAB 1ZA3B 4IRJD 4XMKL 5SX5K 2D0GA 2CKBH 5E70A 4LSPL 1OTUD 1MY7A 4R4FL 5D5ME 4O2CB 5F3BA 3FKUS 1QPPA 4NWTH 4HFWB 2BOCB 3HRZB 2DIBA 5HDBF 3MSPA 5MENB 1A6UH 4CU6A 2WWMC 5IKCB 5DJ8B 4AZ8A 1RD6A 1MFDL 1W72B 5IVXF 4OB5L 3F7VA 3X14A 4Y19E 4ODWA 1MHCA 3UJTH 1E27A 5I66A 4XCCH 5DJ0A 4NUGH 1JFQL 1MRFL 1H5BC 4X6CE 1HXMB 1FO0A 15C8L 1TJHH 4L8BB 4MD0A 1JRHL 4K8RC 5IBUG 4JPVL 1HHJA 2VZUA 2APXA 3VH8B 2Q6WA 4OF6A 4PGZA 2ZUQC 4RAUA 5JXED 1U8KA 3MLRH 4XVSH 4KK9D 3SGDI 2AP2A 4D9RD 3NFSH 4D0DA 5C0BE 3SGDH 4K7PX 1GZQA 2P24A 4OZFB 3EJZD 5IOPA 5A2JH 5DMYA 1HILB 2ATPA 5IF0A 1TZHB 4N5EC 4WI6A 1BOGA 3DXAE 1DFBL 4W70A 5JOEA 4HK3J 4NN6C 4Y4KB 3TBWB 2VL5A 3U1SH 3QXDA 4Y16D 1NL0H 4JQVA 4EIGB 1EO7A 5L6YL 4HIIA 4KJWD 4FG6D 3ME0A 3G08A 5D7IF 3V4VH 2WIIB 3BP6B 3U7AA 3MLYL 3L95B 2JE8A 1RQ5A 3MLSH 3KPRA 2DBLL 1NBYA 3V0WH 3TZVA 3HE7D 3HI6L 4GW5A 2APBA 3CNKA 5FK9B 4CW1B 1FFNA 5ISZE 3CFDA 4O2FA 4YHOL 3ZT6A 4IRZH 1ZLVH 2JJTA 1XAUA 1YEEH 4P23D 4BQ9A 3OKLA 3ARYA 2DQFA 5C8JA 2R4SH 1KELH 1ZS8A 2FB4L 4HSQA 1DSFH 1GYAA 1LD9B 4O2EA 1QFUH 4G6JL 1I8LA 2VWEE 4S11A 4KVNH 1AIFB 3I85A 4MNHA 4ZXBD 1J5OL 3SCMD 1V7NH 3BWUC 5DFTA 5C70A 2NY0B 1XF3B 1CLYH 1S7UB 3GSRB 3IJYA 1H0DB 2JJSC 3SBWA 4QKXB 4TRPH 4U0RC 5I8EB 3WFCL 4MA8H 4ZUVA 1OAZL 1RY7B 4D94A 2KQNA 4HK3N 1QLFA 2XQYG 2E9WA 3IXTA 4XC1H 4MD4A 2R0ZL 2A6KA 1EUTA 4KJYB 3QXAB 1HEZB 1TQBC 2PUQT 4YJZL 1KT2B 1FHGA 4G7VH 4PJCB 4KC3B 3V6FB 3SKOA 4JR9L 1P69B 4N8CL 5TQ0L 2WWMD 5I9QC 5L2KD 4AIZA 4RBPK 2IALA 4G8GD 4TNWK 4XAKE 3LKPB 4AQOA 2ERJC 1HINL 1MRDL 1RFDL 4JFED 3MV9B 2LV4A 2JELH 4NYLB 1IGMH 2AV1B 3B83A 5FYKD 5IJKC 4K9EC 4OLUL 1Z5LA 8FABB 4JZJB 2YOCA 5HHXH 2DICA 3OXRA 2FR4A 1H5BA 1AY1H 3U7YH 1QSEA 3JWDC 5H2BA 2Z93A 1IC7H 3L6FB 3EYVA 2APTA 4OTXH 4KZEL 1DBMH 3RDTD 4QY8B 4LRIC 1P84J 4NJ9L 2YPKB 5KVFL 3R8BB 3AS2A 2VC2H 4F15C 1UXWB 5JW4M 3C5JA 5ICZB 2K3TA 3BPNB 4HKBA 4RMUA 1AQDB 1QKZH 3BAEL 1OCWL 4OV5A 4N5ED 2Q8AH 3L5XH 2VZOA 1GOFA 3O3BB 1BVLA 1IGJA 4UOW0 4XT1C 4IDLA 3QRFM 1XGUA 1ZEAL 4DZBA 5E00A 1DBJH 1WLHA 1MI5B 1IT9L 2A83A 5IIEA 5K93A 1WBZB 4M93C 1D3CA 1MLBB 2NY2C 5HHVL 1VHPA 1R5WA 3LEXA 2NR6C 3UTSD 5LWYL 4KI1A 2B5IB 2YA1A 3PGDA 4L8DB 5C2BH 2R0WL 3V6OC 4R3SB 1KLFA 2EE3A 1VPOH 1QRKA 5EBWB 2R1YA 3GBLA 3L1OH 5ID1A 2X4NB 3AS0A 4NQSA 1UB6B 4OCMC 1WZKA 5ITBL 1XIWB 3TWCL 2M26A 4XZUA 4HPYH 4P5TD 4PRNB 1I8IB 3F7YB 4JFHE 2DRUA 2H32B 3QUXC 3TJEL 1WSST 1S7SB 1AO7A 1U8IA 3W5MA 3I02B 4L5FL 4U1GC 1B0GA 1VSCA 1XR9A 5EUKB 4X4YA 4LVOC 1OGTA 5HHOA 5I75C 4X7DC 3IU4H 2B1AH 3BH9A 1WCBA 4JKKA 3V7AG 2Y4SA 3BJLA 2FWOB 3PDGA 3O0RH 4GAYB 1JWSB 3F6LA 4J8RB 1I9IH 2DQTH 4G6FB 5C9JA 1GC1H 2ZZUT 1A4KA 1CICA 4NZUL 4UDUA 1J8HB 5A2FA 5DRXA 3ET9F 5DEZA 4AJ0A 2H41A 1MI5E 5KOVC 4N8VG 4MZ3A 2I9LA 4S1QH 3V5HB 2XACC 5DJYB 4FA8A 4YHLL 4XGZA 4LPVA 3VXSB 5E6YA 5IT2L 3ARFB 1IL1B 5KSAB 1HWHB 4MHHG 3HMWL 4XP5L 1KCKA 2ZSWB 3RY4A 1KJ2A 5DMGC 4C54A 4EUPG 1T03H 4HC1L 2OX5A 1NANI 5I19H 5MEPB 1NANH 4V1DA 3QQ3B 3GJEB 2J5LC 4JLRB 3MRBB 3KLAB 3I2CL 3DTXB 4GH7B 1YQVH 4YHML 4G9DB 1HI6B 4GBXD 4MSWB 4MYWB 3AS3A 1M71B 4PYHA 5EORL 4XVJL 5D93C 5FHBL 4HJ0C 2KBGA 3BYYA 3NIDE 4YGVA 5GGRA 3ESUF 4G8IA 1FNFA 1UADC 3UTSE 5FO7B 4J6RH 5C0IB 1CL7I 5CGYC 3HI1A 1CL7H 1OB1A 1WTGT 4FS0A 1X5FA 1J10A 3K8MA 5GRUL 2NY3C 3Q5TA 4OFVA 2OZ4H 2VAAB 5DGRA 4DK6A 4LPUA 4OGYL 1A64A 2PR4L 1J8HE 2FZ3A 1IGIL 1Q9OB 1BVKB 2B2XH 1SHMA 4JZOA 1HH9B 4BKLB 1S7RB 1I7ZA 3VXSE 4IIQA 3ES6A 3RJDA 4X6FB 1H8NA 2JKXA 2BVQB 3P0VL 4DQOL 1NGYA 2Z92B 4LP5A 1WVZA 1QUNA 3QUYB 1PJ9A 3GMPB 4LLMB 5T1LA 3VFGL 5E9DD 1UZ8B 1FNEB 5GIRA 4QTIH 1N59B 4MB4A 2NR6D 5SWQB 3DV4B 4IMLA 3RIFK 1JNHA 1K8DB 2PW2B 43CAB 4M6NL 4XP6H 4M8VA 1T5WB 3OHXB 2XA3A 3AREA 5GS1A 4YPGA 3E3QE 2C1PA 4M3KB 3TPUB 3TFKC 5DVMA 2QHRH 3BZFA 3NTCH 1GVIA 4R90L 1YJDL 2XG5A 1MRCL 4OCWH 1J87A 1RZGB 4MCZA 4BSWB 3KDMB 3QUXD 1SY6H 4NQCD 3LEVL 4LVNC 2XFXB 4U1KB 5HSFA 4TUJB 1VA9A 1INQA 5MHSE 1Z9LA 2P4AB 1H3TA 4OI7A 1UCBL 2VUYA 2P5WD 3H9ZA 4TYUA 3HA0A 3GZKA 3IDYB 1Q94A 4I3RL 4OCSL 2G5BA 1RURH 2ICWJ 2CLVA 4HGKC 4OIBA 4RISH 5CLTA 1NEZA 2P7TB 3S3JA 3IKKA 3HLAA 4POZC 3P4OA 3P0GB 2MCPH 4UOW1 3MZGB 1DQLH 4NNPL 4EKXA 3HZMA 4MDIB 2MSPA 5A2KH 1FBIL 5DHVA 1A4JB 5DMGD 1OAQH 2QADC 1UM4L 4XPFH 3WO4B 5BVPL 1LE5B 2HLAB 1F3JA 3BISA 3SDCC 1WT5A 3GJFH 4U2YA 4DAGH 2D7NA 4HKJA 4JFFA 4QHLA 5HHNB 1KJMB 3BEVB 4CVXB 1R24A 2ID5A 1RHHA 3LS5H 1KJVA 2ZUSA 1UACH 4X9GA 4N1EA 5IQ9A 1AI1H 4M1CC 1U92A 4KRMB 1OP5K 4M7ZB 5BS0D 4NN5B 1S78C 3HE6A 1M05B 4JKLA 1QLRA 2X1WL 4K94H 3LH2H 4TVPH 5D96C 2MJWA 2O5XL 4XPBH 5CGYD 5TPWL 5DJAA 1LO5A 1FG2B 2NY3D 1YMHA 3GGWA 1KIRA 1JGEA 3G5VB 3J7HA 2AXHA 1RU9H 3EO9H 3WKMH 3INUL 1IM9D 1ROWA 1GZPB 2HWZL 2ZUVA 3WJJC 3LOWA 4Q9QL 1IFHL 3EJYD 1G6RA 1ORQB 3VXRD 5BMFH 1QBMH 5E6IA 5K9OB 1FZMA 3KPPA 2AJZA 2OSLA 1QHOA 4PJFA 5GGRY 3B2UC 3O2DL 1HDMB 3CDCA 2P5WE 1J86A 3G04B 1EGJH 2EICA 3E6FA 4XVTH 3L7FA 4FXGA 2ILLA 4PJIA 3FQTB 4TSCH 5J6GA 4YPJA 1JBJA 4EVNA 3WS3B 1JNNH 3QG7H 3MQIA 3GSNB 4GG6A 1BQHG 1CTOA 1F4WH 1LP9F 4RCAA 5I18L 1KYOJ 1CXEA 1H15B 3G5YB 1E6OL 1NFDF 1UENA 4XCNB 1OM3H 5J1SC 4H1LA 5E99H 4P2OC 5AEAA 3QWOA 4LHUB 3IFPB 3A67H 2RIKA 5D2LB 4EI5C 2XOTA 5DMIH 1K8IA 2B1HH 2G5RA 4PUBH 4KKCC 1BGXL 1JV5A 5K9QG 4JVPA 1XGTA 3QJFA 4PJXA 2BHYA 2CQVA 3OKKB 1CLZH 3RRQA 2DKUA 5CWSA 3RIAK 3PGFL 1JTOA 2UY6A 1MF2L 3WFBH 5BCAA 5E7FA 1ADQH 2JIXA 3RWHB 1T7ZA 5HYSB 3NCJH 3NABH 3MR9B 1U8QA 2APVA 1JK8A 4BSVB 4HG4J 4POZD 5CEZE 2MWCA 3MGTB 1XH3A 2AJSH 1R3LA 1T83A 1O5DT 2ORBH 5DD5H 3FT4A 4F7MA 4PJGA 2P5EA 3C5ZB 5GISL 4P3DA 1AXTL 4OKDA 3WD5L 5GRXG 4AEHH 4ISVA 1BZQK 5EUOB 4EDXB 5JR1H 2NZ9C 5CEYA 5KSBF 1EHLH 3OGCB 4NSKB 2QADD 2R69L 5B39G 5GGQH 5CAYB 2W59A 3Q3GB 3ULVC 2VLKB 3SDCD 3M07A 4QXTA 5FKAB 4RRPA 4YHIA 2NX5A 5IEKB 3RL1A 4JB9H 3IVKA 2Z31B 5IW6B 4LSTH 4O9HH 3TV3H 2VLRA 1LEIA 2NTFB 1EXUA 4K3JL 4KRPD 2A77H 1Y18A 4M1CD 5DI8A 3QDAA 1HKLH 4HS6B 4EDWL 1NGZB 2P8PB 3FB7A 1C12B 5HHPB 4R7DA 4OKVB 5E5MB 1BREA 4KGJA 3AM8A 4GLRI 1CZ8H 2G9HB 4OLZL 4P5KB 4GLRH 2QSVA 1A7QL 1NUGA 1LDSA 2DJUA 1RI8A 4CU7A 1LWRA 2GT9A 4LLUB 3EDDA 4YBLB 3TCLB 3KWWB 1FORH 2D7QA 1RJCA 4X6DB 5DR5L 3PP4L 1KTRL 1NAMH 2DWDB 5KN5A 2GSIB 5L88H 3TVMB 2V2WA 3MJGX 4NJAH 2NZIA 1I3GH 5EC2B 2Y5TB 4UQ3A 3ULUE 3QDMB 3U9PH 3IFOB 1BWMA 5F96H 4K3EH 4Y4HC 3OV6A 4PV9B 2GYSA 1QSFB 5EUOE 3AS1A 1YJDC 1DUYA 5EU6D 3F7PC 3JV5A 1YN6B 1J11A 2VLKE 4NKDB 4WO4B 5KBNC 1J0ZA 5ECJE 3BZEB 3VFUB 4FNLH 4WHCA 4HWBL 2EEAA 2WUBH 2NY7H 4NO3B 1FRGH 3SDXB 1EVUA 4X4MA 1PLGH 3GHEL 3IDMA 4UILH 3BUTA 1JHKL 1N6QL 5KS9A 1RZ7H 3ZYZA 4AENB 4PRHD 4P2OD 1WQVT 4HX1B 1IC5H 1ZVSB 4KTEL 5C0DB 4KKCD 4O5LH 4EI5A 5JW5B 3V6BR 5C07B 3B9KB 1MFBL 4AK1A 3EFFB 3LDBC 4X6DE 5H37H 1C16A 2X9WA 5I16B 1JNLL 2F53A 2IPKA 1Q0XH 4OM0L 4PJBA 2A9MH 4YLQT 3QDME 4QHNB 2A1WL 4ORZC 5KZCD 4NKQB 1A7OH 2L7JA 2Q86B 2FD6H 3B5HA 2Q87A 2YMXH 4V2BA 1NCAH 1X9QA 2VXVH 5FO9A 1NGQH 2DKMA 5KTEL 1JIBA 2EEBA 2YK1L 4NBYB 4QRSB 5CJ8A 3UTQB 3DGGB 1PFCA 2NZ9D 4OQTA 1YPZF 3TN0B 4I4WA 2DLGA 3PWUB 2DM4A 1PYWA 3MO1B 4KUZH 2GK2A 2RJMA 2ICWB 3EGSA 1ZGLP 1OGAB 1KB5H 5JPMA 3HZYA 1KSRA 3HNTL 3HZKB 3OZ9L 4L4TA 1A3LL 4OSUH 5I1GH 3QNZA 2IF7A 3HUJB 2A0LC 1N7MH 2ZUXA 3D2UB 5KVMC 4JY4B 4JVWA 5FOBB 3MNZB 5GRWA 3UDWA 4KFZC 1K4CA 1U42A 4D9LH 3FQNA 5EZIL 2I5YL 4UUJB 4NT6A 2XWJA 1NGXB 3OGOE 3X12B 4JN1H 3PL6A 1OTSC 2J6EH 4HT1L 5CUSL 1IGCH 4X9IA 5LAXA 4IHOA 2XQYK 4EN3B 1BX2B 3WMSA 3IF1A 2Y36H 2P44B 4K23L 4OFYD 1I4FA 4DZ8B 3DX8B 1Y0LA 2PYEB 4MNQB 2CPCA 5AUMB 3MLUH 2E6QA 1UKSA 4PRIA 4Y5VB 5JW4R 1P4IH 1AGEB 1HOCB 4Z0XA 3MPCA 3C8KB 3MOAH 1UA6H 1BPVA 2N56A 1MFAH 4PJ9B 2FECI 5FB8B 5JA9A 2DYPD 3KJ6L 4NQED 4D3CH 4L4VA 2BC4A 1L9NA 2NCMA 1OD7A 4I18A 1FFRA 4HS3A 4PGBB 1PG7L 3GSVB 2BCKB 1P6FA 3MNWB 5IMLB 3RUGF 3KYNB 1OGAE 3I9GH 2P8MA 4IOIB 1F6FB 3HNSL 2GJ6D 5FCUH 4OCLC 3AROA 4QRQB 2NTSP 3H9SB 1MCHA 1MH5B 3MODL 3SKMB 2ATKB 3HUJE 4XCFL 1D5XA 5DF0A 5IB4A 4XPGH 1CD9B 2R1XA 5T3ZL 5E8OB 1V3LA 3D25B 4WUKH 3GSUB 1R3IL 3ZDZF 4DOHE 2OJEB 5JZ7C 3K8LA 4NFCA 2GJZB 3PNWB 1BBDL 3U0PB 5D6DA 2CDEA 1AKJB 5CJQH 5FXCH 3W0WD 4HKZA 1A9EA 1BQHA 1MCOH 1S7WA 4P49A 4HBCH 2IFGA 2PYEE 4MNQE 5DS8B 1N5YL 4WHTB 5FM8A 4BJLA 2I9TB 1RZFL 4YHZL 5FYJH 2J8UF 3DI3B 5DDHB 1LHZA 1WZ1H 2YD6A 4M6OH 3OJDB 4DGYH 4EJ1C 1JGLL 4K07A 2RAMA 4A6YA 4ZYKB 3U4BH 1KTKE 2QV2A 5ITFB 5H37G 4DJMA 1DUZB 3QDJA 2VDKL 1Z0MA 3BVNA 3OR6A 3C2AL 4EOWL 4GSDH 4JJ5B 3S37X 1EBAA 3VRIA 4PRBA 1I1AB 3HAEG 2H3NA 4B5EA 3FRUB 4P9HL 1R6VA 3RPIB 1WFNA 3VGEA 4UQ2A 4EZMA 2EDXA 1T89A 3H9SE 2CGRL 3W39A 3TF7C 1ZMYA 1HZHH 1ZLVK 1Z0NA 1A7NL 1EPFA 2F5BH 3BGAA 1HYSC 3MMEA 1KIQA 1AGFB 3L3IA 4GQ9L 3UROR 5ADPL 5D1XB 4NUJA 3GMLB 5JDJA 2W92A 3CFEB 1JZ2A 4LCWA 1CBVL 3ZE2F 3MBEC 4A2LA 3ZMRA 3NMEA 3PWNB 4LEXL 2YA2A 1KPRA 4IS6B 1MIML 2CSPA 1OTSD 1HN1A 1T7XA 2Y07L 4JRXB 3O4LB 2FX9H 4J1UA 4O02L 3WKNA 3TIDB 5JHDD 1WICA 3O3AA 4ZFOA 4GXVH 4PJ7F 1IEBB 2NPLX 4OD3H 3H42L 2EDKA 5JW3L 4JFDD 3VXTA 3MJ7A 1DLHB 2BVYA 4MDJA