4QLRA

Llama nanobody n02 raised against eaec t6ss tssm
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
130
structure length
130
Chain Sequence
DVQLVESGGGLVHPGGSLRLSCAASGRTFSDYALGWFRQAPGKDREFVAAISWSGGSTYYADSVQGRFTISRDNDKNSVYLQMNSLKPEDTAVYYCAADKYYTGPGGESVYDYWGRGTQVTVSSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Llama nanobody n02 VH domain
publication title Inhibition of Type VI Secretion by an Anti-TssM Llama Nanobody.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
total genus 28
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qlrA00
3TT1H 1KPVB 1AHWC 3MLUH 4HG4K 2VRAA 1MFAL 1AGFA 3QQ9D 4RNRB 5EFIB 1IKNC 4S1DD 3ULVE 2FECL 2BVQB 4OFPA 5BZDB 3SDYH 3OKEB 3CLFH 1D9KC 4BZ2H 3MBEA 3F5WA 1OAKL 3RZCC 2GHWB 3E0GA 1GGIH 1AJ7L 5DUPH 2CMRH 1QFHA 4L4TB 3KG5A 4DVBB 2J4WL 5DEGB 3SOBL 4QTHA 4WFFE 1I1YB 1O7VA 3VXUD 4R0LB 2HMID 2BDNL 1P1ZB 3MXWL 1WBZB 1BIHA 3IETB 4MSWB 1K2DA 4JFHE 3D1MC 3X11B 3S36L 4G5ZL 1T0MB 4PBWD 5HYSB 1LO4H 3JWNC 4K7PY 2EDXA 4BM7A 4UNVA 4OJFL 5ID0B 4ODBD 1S9WB 1LDPH 2WUCH 5CUSL 1X5LA 1X5JA 1WT5A 4M43H 3F8UB 4ORGB 4C4KO 1KGCD 2O5XL 1T1ZB 4NKQB 3EDFA 5FGCB 1Y0LB 4GG6F 1HXMA 3JBG7 2YUXA 1GZQA 2IQ9H 3SGDH 2BY2A 3IJSA 2IPKA 1KCVH 3QIBD 4QXUH 1DQQA 1QBAA 4UBDC 5IMMA 4F80A 1KCUL 4GXVL 3P40A 2GSIA 3ARED 2XOTA 1KG0A 3U9PL 1PW3A 1QSEB 4WUKH 5BW7C 5DEFA 4JM2F 3AAZB 2R4RL 2IGFL 2VERN 5K9JL 4HIIA 4CU7A 3GM8A 3ES6A 2HFFB 4L1DA 3W2DL 4XWOD 5FGBA 1P7KA 5EIQA 3F7VB 3KPRA 5CGTA 1J0ZA 3N85L 2F53D 5IV2A 1N26A 4XMLL 2CDGB 1WEJL 4MJ5A 3QEHA 4U1KB 2Q6WA 3BT2L 4RA3A 2X6MA 3WE6A 2C1OB 2IALA 3CVHB 4M62L 2GJ6B 3Q5TA 3RUGB 2HLFC 3QDJB 5SX4H 3IGAA 4XWGH 2RIKA 2WBJA 2OK0L 5CJXA 1B0WA 4YAQB 3MV8D 5ANMA 4ELMA 4YIQB 3EYUH 2V5RA 3U48A 4ODUA 5DVNA 4MD5B 3VI3E 2COQA 4WI5A 1MCSA 3PGDB 5C92A 3ARDB 3RL2A 4XNZC 4OLWH 3RGVB 1EBPA 2J8UF 1U3HC 3SDAC 3U36A 1VB9A 5ITBL 3NZ8A 4DEPB 43C9B 5DO2C 3ROLB 2QR0B 1YYML 2W9DL 2HKHH 4KK8D 3VCLA 4P46A 1ITBB 2VKXA 2ADGB 2R0WH 4JKPL 4JHZA 2P4AB 3C8HA 1LQSR 2BSSA 4YHNB 3MLYL 3SCMD 5MEOA 3OKLA 1NDMB 3QQ4B 2EXWD 5JORB 3RWCB 3RY5A 1NCBL 3G6DH 4KROD 3S96B 3BH8B 2WWMD 5I1HH 3IJHA 4LCCB 5I15L 4LSVH 5EA0L 3HZVB 5CP3H 2FD6H 5EBLA 1BQHG 3HMXL 2VABB 1IVLA 5DVLA 2IBZX 5GRUL 1JN6A 4HBQA 4JRYE 1ZTXL 5J57B 4J2XA 1B88A 4JM4H 1IGTA 3MRCA 4XVTH 1BZ9A 1FDLH 4LL9A 4GKSA 3SKOA 2ZG1A 3ARGC 3EOBA 4WW2B 5FM5O 5K33A 5DQDH 2VLKB 3H42H 1U8NA 2GCYA 3FQUA 3MBED 1GPOL 4NZJA 5I71B 5IB5A 3TYGL 1R3LA 6FABL 2R1WB 1QRNB 2VDRL 2VXQH 1ZV5A 3GK8H 4OI9A 3SHSA 5I16A 3BJLA 2EDEA 3RWFA 5FO9B 2BNUA 4OCYH 4XP6H 3TH4T 3MRJB 1KCRL 1FL6A 4ZTOH 4RWHA 1J05A 1R3KA 2HFTA 1H3XA 1G9MC 1YQVH 1XGRB 3SE3A 4HPOH 3TIDB 3THML 2XYCA 2VLLA 1YQ2A 3QUYA 3CDFA 3U6RA 2ITDB 3EJYC 1NCAH 1DBBH 3NCBB 2GITB 2BHUA 4OLUH 4YHIA 1RIHL 1OGAE 4TRPH 1DP0A 4X5LA 1JYXA 4N1HB 4QRTA 3LS5L 5DJDA 5L2KA 2NLJA 1FNHA 2NYYD 1HILB 1EGJH 1BQLH 3OR6B 3OKKB 3RKDC 3VE0B 1BBJB 4NZUL 4E42A 1CD0A 3MCG1 3FT3B 4XNXL 5LGJB 1EJ6A 2Q8AH 2ZSWB 4OM0H 2B4CC 4L8SC 2HT4C 4EOWH 2HJLA 4OT1L 4Z7UE 3L3DB 5ALBH 3ARFC 4DFHA 2H8PB 4NZTL 4LLDB 3DXAA 2MKLC 4ZO9A 2I5YH 5M94B 3HMWL 3LKPB 5IFAL 5D2NC 3L5WB 1I9RL 3KAAA 3UBXI 1J88A 1LO0L 4LLVA 4PB0H 1EERB 1KV3A 35C8L 3U7YL 2OBGA 3KPRD 3LB6D 5KS9A 4OCWH 4U1JA 4OFYA 3RVXC 1YEHL 2F58H 1ACYH 5IW1B 5JMOC 3VXOB 2I07A 2AV1A 4K7PH 3BEVA 2RR3A 4Y4HA 1A6PA 2APXA 3SE4C 2HT2D 1EEZB 2IC2A 4O51B 4RMSA 1AXTL 3GJFH 4DN4H 5JW3H 4RA0C 2OXHA 5LGKA 3ARWA 4WFGD 2D7PA 4Z7VE 2EECA 1RUQL 2WBJD 3H2WA 4HCRH 4V1DE 1RIVL 1K6QH 4KGLA 5AAWA 5I8CB 4Q6IB 2UWEA 5EU5A 5T1DH 3FT4B 3DVIA 2OP4L 1U58B 4PJ5B 1UWXH 2ESVA 1MFDL 5CLWA 1XF3B 4HKZB 1C16B 5KVDH 3AUVA 1FL3B 2CLRA 2X70B 2BJML 3MNVB 2X1PA 5KANG 1OAZL 4LLUB 3QDGB 1CD8A 1XGPB 4F33B 3FTGA 4HFUH 1T66C 1JRHI 3P4MB 4TQEH 4P46D 4N8VG 2CGRL 1W0YT 2VZOA 3GI8L 4X7SL 4JAMB 1KULA 3X3FL 1BBDH 3QXVA 1TJIH 2HWZL 1MRCH 1FHGA 4LNRA 4GS7B 1DQLL 1MLCA 3EO0A 3OPZH 4CU6A 1QD0A 4K94L 5F7KC 5MEQA 1OTUD 2X1WL 2ITCB 3BFOA 3IKCB 4RRPG 4Y89A 4B7IA 5HYQA 5FYJU 1F13A 2A0LC 3X14B 1AJ7H 4UIKL 3BZDA 4LKXB 4MQXC 2J4WH 3OAUH 4R2GD 5JO5A 3SOBH 2VQ1A 3MXWH 4NQCA 2AJYL 1BREA 3TJHD 3S36H 4APQB 4EUPH 4WY7H 3OAYK 4OQTH 5DJZB 4HJJH 4ZXBC 3TN0B 2ICEB 1YMHB 2CRIA 1EAPA 4I0CC 4L4VA 4K3HA 1HE7A 2WQ8A 3QIUC 4P23A 3K1KC 2OTWA 2O5XH 3K80A 4HH8A 3WLWC 1LK2A 4HC1A 5FFLA 4YNYB 1KB5A 5MEPA 3LDBB 4M1DH 4IRJA 3JVGA 2JB6A 2C3GA 4TSBL 3MA9L 3S35H 5T33L 5DT1H 3V7AE 1IFHH 5FHBH 3O4OB 2X05A 3U9UA 2NY4D 3QUYD 1INQB 4GXVH 3VFNA 3C60C 5GS1B 4PRHE 2W38A 4P5TA 1UB5B 4TOYL 4U3XA 1I1AB 2CLVB 1M71A 2R4RH 2EIZB 2NW3A 4LHQB 5L2KD 4E5XB 3W2DH 4JO4L 4H25B 3VXUB 3BDYH 4JFDA 1LO3H 4NQDA 2IADA 3EFDH 2D7QA 3GSXA 4PGJA 1QKZL 5KSBE 1HQRB 3NN8B 2VUYA 5DJ8A 4W81A 3N85H 1YNTA 1UVQA 4X4YA 2Y9RT 3CSBA 2X4QA 4L9DA 3Q1SL 3QAZC 4XMLH 1BMGA 3BO8A 2H9GB 4MAUL 1QTYT 3BT2H 2PNDA 3DXAD 4OLZH 3IDIA 3EO9L 2ZOLA 2APVA 3MRDB 1S3KL 4MA1B 5IQ7L 3P30H 8FABB 1F4HA 1DUYB 3WJJA 3BIBX 2XRAL 1OW0A 3BPCA 5DQJB 1SEBA 3ULUD 3RHWK 3TBYB 3M1BA 1RZKC 4C56A 4WV1A 2EDRA 3QXUA 3GGWA 3HUJA 4QOKE 4Y4HD 3BP5A 3IDGB 4KKAD 3OXSA 1T83A 1NGYA 2H2PD 4GW5B 5D2NE 1S5HA 3AREB 1TJGL 4J8RA 4K2UL 3V8OA 4OZGE 4PYGA 3VXPA 5ITBH 5JQHC 3QNYB 1JVKA 4F15C 1OP9A 1AI1L 1NFDF 1YYMH 4LARL 3KJ4C 2CR6A 4X4MA 5BV7L 5C0AA 5DD3L 4Q9QL 1R6VA 2CLZA 2XI9A 4XNYL 5C08E 2AP2A 5J7CC 2W9LA 2SEBB 2F53B 2ESVD 3UJTH 2XG4A 1TPXB 5J13C 1NCBH 2AJ3A 4K55A 4RAHA 1I7RB 1YEKH 5I1JL 2DWDB 4I4WB 5I15H 1FH5H 5EA0H 3X3GL 4TVPH 4UDUB 1RHHB 3OG6B 3O6FA 5GRUH 2DQDL 2AXFB 2A9NL 3HPLB 3G04A 4A2MA 1CXLA 2R1YB 4HWZA 4XZUB 3R1GL 1MQ8A 3MV8B 4WHCA 1NC4A 3PWJA 5EBWB 2NXYD 4LRIA 2E7BA 5CEXB 4HH9A 1Z9LA 1HSBB 4JY4A 3PL6B 1BVKB 4ELKA 3OAZH 1P69B 1OSPL 4HW6A 4KRMB 3B6SB 3GKWH 1CDYA 5SWQB 4FQ1L 2HKFL 4HUKB 1R3IL 1YEJL 3KLAB 4MD0A 5D9SA 3TYGH 5BXFB 5DFVC 4XPHL 3UDWA 4NM8L 4S2SA 3B9KA 5CAYB 3UXFA 4K3DL 2AS5M 3PP4H 4H0IA 4NQCD 3VWKA 3RTQC 4WW1A 3AS2A 1NH6A 3TA3C 1J1OH 4NQUA 1B4JL 3VFTB 1L7IL 1Z6JT 4PJXA 3V79C 4WGWB 1MAML 2QTEA 3SCMB 3THMH 4GFTB 1UXSA 3JWOH 2AKRB 2D2OA 2X4SA 4L4VD 5ESAB 4KROB 4Q58C 1C5DB 3PHQB 4CVUA 4PJ9C 1RIHH 1X5HA 1BQSA 4P23D 4F7EA 3FOMA 5C0FA 4H1LB 4NCC1 1NDGB 3REWB 3WN5C 1BM3H 5DQ9B 5E94A 3G6AA 4HS6A 4KTDL 3BKMH 4IRJD 4N0FA 3HNSL 5DHXB 4Y4FA 4NZUH 3I6LE 4XNXH 3T2QA 3IU4H 4DGVH 4PJIE 1AGFB 2VOTA 1NGZB 5JOFA 5D96B 4OT1H 1WWWX 3VXTA 3V4VL 4JM2C 5GJTH 1ES0A 3MBEB 4P5TD 3F5WB 4UAOC 4XX1G 1JMZA 3HCVA 4FQQB 1JNLL 4LU5H 1FZJA 1I9RH 1AHWB 2FJGA 1LO0H 2IG2H 3CZFB 1FQ9C 5DTFA 1T3FB 1Q0YH 3MJ7B 4JFDD 4NQDD 4RZCB 5I8EA 3CDGA 2IAMA 1D9KB 1K2DB 3B9EA 2P49B 4FFVD 4ZUSA 2YA2A 4LPTA 5F7EH 1LE5A 4LSQL 1JWMA 4JZJC 3V0WL 4U6HA 5FIEA 2E9BA 2APFA 4U6XA 1ZSDA 2AV7A 3EOAA 4POYA 2R8SH 5CIPA 1S78C 1YYLL 1RIVH 3BIAX 1HXMB 5E8PA 1GZQB 2OR8A 2ERJC 4M6OH 4C56D 2IPKB 2OP4H 2YD1A 4WFHD 2NY5H 1DQQB 2BCKB 2DJ4A 2FB4L 2ATKB 4JQIL 5IHUL 5IMMB 3FB8A 1MIEH 4HKXA 1KG0B 3O0RH 5I30L 4DKAA 1OAZH 3K74B 3UBXG 5DEFB 1CFSA 2V5SA 4HIIB 1DANT 4OUUA 1VACA 1JYWA 3ES6B 2VITB 2CGRH 3LMJH 4HK3N 2HTLD 3TVMC 5C0AD 5C0BA 4NC2B 1P7KB 3GSNB 4P3DA 2HWZH 3KPRB 4Y16A 5HYEA 1CT8A 1H5BA 3C87A 3I3DA 5IV2B 4IS6A 2BK8A 5GGSA 4K94H 1D5BB 1T2JA 4MJ5B 3I2CL 3QEHB 2Q6WB 1F4XL 3U4EA 5EBMB 3WE6B 1FGNH 2IALB 1C5BH 2AXGA 5EZIL 1LVEA 4M5ZH 4Z7OF 3O6FD 3IGAB 1BGXH 3SPVA 5F3BA 1F4WH 3VXME 2WBJB 4JFZL 3UZVB 3SKNA 5EZLA 5ANMB 3CK0L 4ELMB 1NC4D 4UT7L 2CIIA 5LVEA 4ODUB 4XXCC 2AGJL 1M7IA 1RV6X 2E7LA 3RL2B 5GISH 3KVQA 5E99L 2DS4A 2B1AL 1II4E 1MFNA 3KLHD 2FIKA 4WHDA 2VUOA 5D7LA 3VI4F 3FT2A 3U83A 4KY1H 3B9KD 1BVZA 3MRHB 2ARJA 5F9OL 4P46B 5CD5D 4RFOH 3VD3A 1CZ8H 3VWKD 4NHUA 2MMXA 3MA9H 4HS3A 1OP5H 3L9RA 4U6VH 2ZG2A 2BSSB 5EUOA 1EO7A 5MEOB 2R4SL 3OKLB 4O58L 1JNHA 3ESVF 4NJAL 4MB3A 5A43C 3UPAA 4PS4L 4FQ2H 3IJHB 3TFKD 2B1HL 5D7JB 3QUMA 5SV3A 1JN6B 4R2GB 3RPKA 1FNLA 1G7JA 5FYKH 1JRHL 3D87B 4Y4FD 4XNUL 1BZ9B 4GKSB 1QKZH 3DPBA 2J6EH 4X7FC 3OJ2C 1RMFL 1RUKL 1YEFL 3KS0J 3EOBB 4CN4A 1IBGL 2X9YA 4GG6E 5TF0A 4ONFL 5FA3A 4IJ3C 1U8NB 3FQUB 4OBRA 1CK0H 2BRQA 3EO9H 1CDIA 1H8SA 5IB5B 1R3LB 4M00A 5E56A 1S5IL 5IQ7H 4GMTH 3QUZA 4I0KA 1HHKA 5I16B 4M6MH 5HHVH 3WFZA 1CWVA 5TFSH 3RWFB 3AGVA 2BNUB 3O9WC 4I77L 4D9RD 4IEFB 3W11D 1TNMA 3BPLC 4OIAA 2IAMD 1R3KB 4JHAL 3MFGB 1MAKA 4YHKH 4LDLB 2BX5A 3U30C 1BD2A 2VLLB 5AG9A 3QUYB 2ORBH 3LRHA 5L88L 4WEBL 2CRMA 3NA4A 3DBXA 4IOIA 3P4NA 4AIZB 3QIWA 1AI1H 4EVNA 4RGOL 4LARH 5DJDB 3RL1A 4LP5A 5L2KB 2NLJB 2ZUUA 5BV7H 4NN5B 5DD3H 4E42B 4XNYH 5EZJB 4K7FA 3BUTA 3T8XA 3BKJL 4ZS7L 1TITA 1ZA3A 2HJLB 5I8OH 4G80A 2X9XA 3P3YA 3DXAB 4UB0L 4JY5L 3ALWA 2WK2A 5CJOH 4YFDB 2ENYA 2R9HD 1L0XA 2J8UE 2JJSA 5T5NG 5FUOH 5C0BD 3GM0A 4PR5A 5H2BA 4Y16D 5KS9B 1FYTA 1S7WA 2XN9E 4U1JB 4F9LA 5FYJD 4HJ0C 3WKML 2I07B 2VQUA 2AV1B 5GZOC 3BEVB 4Y4HB 2VTFA 5DD1L 1TMCB 1YEJH 5A1AA 4OCXH 5B8CC 1FGVL 5K59F 3KWWA 3TV3L 4OFIA 1H3PH 3RWIA 4W70A 2I24N 2G5BA 3D9AL 4YBHA 1GYAA 4P57A 4G42A 1CXEA 1UKTA 4GQPH 1KXQE 2R0KL 4G6JH 4WUUA 3C5ZC 2NY7L 4WO4C 1G9NL 5EU5B 5F9WB 1B4JH 1L7IH 1U95A 1WBYB 1IT9L 1XCQA 1MAMH 5F96H 1HINH 4MB5A 5E2TL 5D1ZA 3HC4H 3WO3B 1XGQA 3T0EC 2CLRB 2YPVL 4IDJL 1NUGA 4MLSA 5C07E 4AZ8A 3QI9C 4GRLA 5D7LD 4YHOL 3BYYA 3FTGB 3TP4A 2P5WA 3OB0K 4KTDH 3BD3A 4LVEA 4PBXA 3ZL4H 3MO1A 5D5MF 5C2BL 5GS2D 2NXYB 2DAVA 5CZXD 1CYGA 2HAZA 1MLCB 3EO0B 1CLOL 4FABL 3EJZC 3V4VH 5ISZE 5MEQB 1T21A 3GDBA 3QJFA 1LP9A 2FJHA 2NNAA 3UAJD 2I25N 5HYQB 2AK4A 4Y88A 5IQ9B 2E7MA 4KXZH 3SEPA 5JO5B 4LPCA 2VQ1B 5ADPL 5EULV 4NQCB 4F7PA 2K3TA 2A6JA 4R26L 5D1XC 1AO7A 4X6CE 2EE2A 5FYLH 4MVBC 1ZEAL 3OXRA 3V0WH 2YA1A 2PO6A 4LHUG 4YDIL 2V2TA 4P23B 2OTWB 4GAJH 1A7PL 1YMMA 3KGRA 1VGEL 1LK2B 5C0GB 1FLTX 2W0LA 3QUZD 4ALAH 1AH1A 4DFIA 1KB5B 1FJ1A 2GK2A 5MEPB 1BJ1J 1YYLH 4QKXB 3S34H 4IRJB 5LAXA 5C70A 3ZE0F 2JB6B 4GQ9L 4ZXBB 1JJUA 2VJXA 2FBJH 3Q0HA 3U9UB 5I9QB 3HN3A 4J4PA 1BD2D 2W0PA 2FB4H 4JQIH 1LWRA 4K9EH 3VFNB 3CAFA 1X5XA 4KVNL 3R0MA 3QWOB 5I30H 4P5TB 5EWIL 4XVUC 4G3YH 1M71B 5BO1H 3VGEA 5FGSA 5LXGH 3QIWD 2ICCA 1OAYL 2NW3B 2FHCA 4P49A 1RK1A 1TTGA 4JFDB 2IADB 1QOKA 2X10A 1I8LC 4OF8A 3GSXB 2V17L 1ZGLP 1TNNA 2D0FA 2GY7B 1YNTB 2MQ0A 1UVQB 2G60L 4X4YB 3RY6C 2IWGA 1YDPA 2X4QB 3GSOA 4ONGH 4PJFA 4EKXA 9CGTA 3HC0A 5HVFB 3BO8B 4P2RA 2CDEA 3UZEA 3D25B 2Y23A 3IDIB 2ZOLB 3PDOA 1A7NL 5DC0A 3V4PL 5EZIH 3HZYA 1KFAL 2FX8H 2J8OA 3C6LC 3HAEG 1DBKL 2DI9A 1XGTA 3R4DA 1RVFH 1FNAA 3BP7A 4KI5D 3NCCB 4YXLH 3FB6A 4YK4C 5E2UH 1SEBB 1OSZA 3QUKA 4G7YL 3CK0H 4UT7H 3BD4A 3BSZL 3L3HA 3M1BB 1FYTD 4C56B 4WV1B 2AGJH 3QYCA 5SV4A 1GOHA 3HUJB 1AQDA 4KPHH 4A6YA 3FAWA 4JDZA 2ZUXA 1NGYB 2KUTA 1BAFL 1S5HB 4L3CA 3TO2B 3W0WB 4J8RB 1T2XA 4QO1A 2OQJA 1VSCA 1P4IL 2VDQH 4KKLD 4F9PA 4JKMA 4ZD3L 3FQRA 1H15A 4WUUD 3H9SA 5C0AB 2CLZB 2R29L 5FCSH 5GS0C 1DQDL 3MLRL 3RGHA 4QTIL 3C9NA 2V6HA 5KW9H 5D1ZD 5GGUA 4O58H 2GTWA 2AJ3B 4NJAH 1N7MH 4RMQA 4OIIL 4HEPG 2B1HH 4Y5XA 4GRLD 5I6XC 1CFVH 3LKSA 2QKIA 1DQJB 1FLRH 3HI5L 2XQBH 3O6FB 5D1QC 1JNJA 4DGYL 2P5WD 4HS8L 4LVHB 5F6IC 4NN7B 3U0WL 3G04B 2YXFA 1JRHH 4HWZB 4XNUH 4GJTB 4AM0A 2DYPA 3PWJB 5C7XH 5C09E 4HH9B 5A2KH 1KLFA 4JY4B 4MA7H 3T0EE 4ELKB 2H6PA 1S7XB 3C08L 3HR6A 3SDDA 4N90D 3WNPA 3HG1E 1W0WA 1IBGH 4Y8AA 5HI4C 1ZANH 1SEQL 4ONFH 4LFHG 1AGCA 3CIQA 1MCCA 1TTUA 1A6VH 1IGCL 1UH2A 1KLUA 1U8QA 3V9FA 3GSUA 3RZCA 4MD0B 5D9SB 1EO5A 2AK4D 1S5IH 2R15A 4LSPL 4S2SB 1BFOA 3B9KB 4TUOA 2XQYG 2LAAA 4WU5A 3VWKB 1NFIA 4WW1B 2EKSA 4U1SB 1AR1C 3IFOA 4JHAH 5DRNA 4HK0A 4RGNC 3T09A 5C0CA 3L5HA 4PJXB 3O41A 1AO7D 4YGVA 1UXSB 2X4SB 5JHDE 4RWYH 2ZJSH 4U0RC 1K8DB 1PAMA 4F7EB 1YMMD 5C0FB 1G1YA 4HDIA 3RTQB 5L2JB 1FO0H 2V9TA 3MYJA 4XP9H 5E94B 1NBQA 5JOPE 1JI2A 2UVFA 4HIXL 5K9OA 3KPTA 1CGSH 4N0FB 1BPVA 3W9EB 4Y4FB 5J11C 3BQUC 4WCYL 4DZBA 4WTZA 1QSFA 3BKJH 1U8KA 4I9WD 5JOFB 4U1HA 3VXTB 4J4PD 1DSFL 1JV5A 3EDDA 2ZNXA 4GRMA 3JTTB 2VC2H 3S37L 3ULSA 3HCVB 4POZD 1QRKA 5HHOA 3B2UD 1FZJB 2HN7A 2FJGB 4FQIH 3MCLH 2VDLL 5HPOA 5DTFB 1KUMA 2RFXA 4QGYA 1KTLB 1Y6MR 3V7MA 4L8CA 4PRIE 5I8EB 3MRLA 2P5EE 4FQXC 4HZAA 4YBLC 4WWKB 3CDGB 2LV4A 5CWSA 3D85A 2IAMB 2UY7A 4LCWE 2UY6A 4HBCL 4ZUSB 3WKMH 4M7LL 1NFDE 1LE5B 1I7TA 5IB1A 3DTXA 2YPLA 1JWMB 5IVNA 1ZXQA 4OUOA 4PGDA 5DD1H 3S3SA 4U6HB 1FGVH 3LVEA 1YJDL 5CZVL 2DBLH 1YEGH 3HE7C 4M4PA 4U6XB 1ZSDB 3TV3H 4M93C 2EDTA 3LKQB 4DK3A 3ESUF 4LSRH 1DQMH 3EOAB 5J0BA 2GFBA 3KPOB 4I48B 1ZHBA 5CIPB 1CI5A 3QXWA 5I1DA 4JO2L 5DK3A 4PUBL 2R0KH 1FIGL 4OD3L 2A77H 1XF5A 1CE6B 4NPYB 2NY7H 4KKBD 1YN6A 3W39A 4HEME 4U2YA 3AM8C 4XCYA 4XPFL 5CEZL 1JZ4A 3FB8B 1Y6KR 3TH3T 4HKXB 2DQTL 4KWUA 5I1LA 1U8JA 1LE9B 2Z35A 3LY6A 1CFSB 1MF2H 3D2UA 1N8ZA 2ZCHH 2J8UB 4JN1H 4OUUB 1VACB 4LPWA 4AIOA 4K3GA 3H9SD 3O4LA 1AKJA 5C0BB 4P3DB 4Y16B 2XN9B 5T3ZE 1CT8B 1H5BB 5D8JH 5CILH 1S9VA 4IS6B 1CLOH 4X80L 5GGSB 4FABH 4PB9H 3RY4A 1WCBA 4LOUC 3U4EB 3R8QA 1L0QA 5GJSH 1EV2E 1FE8L 3WUWA 3ZE2F 2N1KA 3SPVB 1T22B 4ENEC 5F3BB 3BDXA 4XAWL 3U0PA 1FC2D 3SKNB 4S1SL 1IGFH 5EZLB 2DYPD 1H8OA 2CIIB 1RFDL 4NT6A 3T2NH 1M7IB 3SDDD 2H32A 1ETZA 1NLDL 3I85A 4I8DA 4ISVA 4L5FL 5C07B 3RZCD 4YDIH 3HKFA 1UC6A 2FIKB 3IAPA 5D7LB 2CXGA 3FT2B 1HHGB 5HYJE 2VISA 3MRNA 3EKCA 2QLVB 4AEFA 5LWYL 2ARJB 5E8EA 1UZ8A 1FC1A 1T20A 5EN2A 4GQ9H 4NHUB 3NABH 2Z93B 3WBDA 5KN5A 3L9RB 5C0CD 3MUHL 2BP3A 3CSYA 5EUOB 2R2CA 2DLHA 3H0TA 4PLJC 4DCQA 1KC5L 2Z8RA 3MRGA 2BHZA 5T1MA 1J1PL 2HVJA 5HVHB 1J5OL 3D5OF 2DJSA 2ZUQC 2OXGA 3ARSA 1I7UA 1GL4B 2AEQL 5DK2A 3QUMB 1MLBB 1WAAA 3W9DA 4RGNE 3T1FA 4J3SA 3BN9C 2XA3A 2V17H 2UZIL 1NUDA 1FNGA 4D0BA 1QSFD 3WYRA 2G60H 4X6CB 1TZGL 2QSTA 3B2VH 1OTTC 4XAKE 5J56B 4CGTA 4OFDA 3ARFA 1QBLL 3O2VL 5KVGH 2CK2A 3ZYZA 4J3VA 3LN4A 2MJWA 4XBEH 5DJ6A 3V4PH 4Z7WA 5HHOD 1MCPL 2L4OA 3QUZB 1HHKB 4TYUA 1K8IA 1XFPA 1F58L 4P3CL 1XZ0A 5ICZA 3UTOA 4A2LA 1JWSB 4G7YH 1KJ2L 3UTZA 4WNQB 2L7UA 3BSZH 4O5LH 1JZ3A 4JFEE 3D85D 1ZT4A 1F02I 2F74A 1RUML 2A6IA 4OI7A 4YQXH 1KXTB 1BD2B 1DVFA 2W07A 2YPLD 4N8PA 4BA8A 1DTUA 2IQAB 3BPNC 2DM3A 3L3JA 4LDOB 2HLFD 5JA9A 3O9WB 3DBXB 4P2QA 5J4MA 1P4IH 3QIWB 1A7OH 2OL3B 4EVNB 3RL1B 2NY1C 4OI8A 1NL0H 4YXKL 1N0XL 3VXSE 3U30B 2JE8A 1J10A 4K7FB 3T8XB 4Z7OE 1KB9K 3IDYB 1MCQA 1DLHA 3L3KA 1ZA3B 4N8CL 4IMKA 4ETYA 1YY9D 1DR9A 3O81A 4G80B 2AXHA 1I1RA 3DGGA 5IHZA 3O6KH 1MFBL 3C5SB 1H3TA 1OAXH 4I3RH 4DGYH 1Z3GL 4JREC 3D2UD 1KCLA 4DN3L 4CBPA 4P48A 4ETQA 2ZUSA 3U0WH 3C2AL 1UM5L 3T3PF 1EMTL 3FZUD 3O4LD 1AKJD 4ZUVA 2B0SL 1ZVSA 4PR5B 5H2BB 5I73B 4S10A 5JXEA 5BOZG 2NY2D 1FYTB 1S7WB 1YY8B 3VI4E 2XTJB 1UEYA 3DSNA 1VFAA 2KPNA 4QNPF 1SEQH 2DIAA 4LASH 3QCUL 4WI9A 3HS0A 2AJVL 3KWWB 4RFNC 3RWIB 3BE1L 2G5BB 1MH5A 4OZHA 4P57B 4G42B 2EC8A 3WNKA 4HXBL 4WUUB 4YDJA 2CKBH 2R2BA 1KT2A 1U95B 3FMGH 4NUGL 3HLAA 5HHXL 4HAFA 3GSQA 1TQCB 3LH2H 1JTTA 2WP3O 3VGGA 3HFMH 5I0DA 4P9MH 3RX5A 1XGQB 1HOCA 1G0DA 4I5BA 2AERT 4GRLB 2NCMA 2LTQB 3ARBC 2FJFA 4MNGE 1XF1A 2Z8VC 1RY7B 1G7HA 1FSKB 4O00A 4CJ0A 4NNPH 4WO4B 4X0KA 5I76A 4XBPA 5C0RL 2O61A 3MO1B 4X6DE 2EDJA 4H88H 1NJ9A 4IRSA 4ZS6C 3Q48A 3ULUH 1DSFH 1IAII 3GKZA 3C60A 3EJYD 4YBQC 1UWEH 4NIKB 2R2EA 2GTZA 4UU9B 3S37H 2QSCL 3QJFB 1HI6A 1LP9B 1CCZA 2NNAB 1K3IA 2DKSA 2AK4B 2BY0A 5F93C 2PF6A 3MFFA 4BELD 4JANA 2NX5A 2YKLL 1GH7A 4KV5F 3WJLA 4F7PB 1FNEA 5INDA 2EIBA 2XXMB 4HBCH 4JPKH 4M7LH 1AO7B 4S1QL 2VLRE 4PJCF 4JGMA 3VFRA 3ARFD 5JIIA 4XGZA 3OXRB 2VXTL 1MCLA 1YJDH 2VXVH 3IDMA 5CZVH 2PO6B 1WISA 3QDHA 5T3XL 2V2TB 4U1IA 1YMMB 5I74B 4Z18A 1KF9B 5TE4H 4S1RL 4FQCH 3L5JA 3QHZL 4EDWL 4X83A 1FJ1B 4AYFA 4HLZG 1KLGB 4DGIH 1OARH 5LAXB 1WK0A 4M7KH 3QPQC 4R4NC 5J12B 3TO4B 4Y1AA 1YC7A 5C6TL 1DVFD 2NY0D 3BZFA 1PLGH 4CNIA 5I8KL 1ZT7A 2JLLA 5IG7A 5FO7A 5C0JB 3N9GL 1QR1A 4P2QD 5TQ2H 4ZG1A 1MHPL 2BSTA 1RK1B 1BZQK 4W6WB 2P5EB 5E6IA 3LQAC 5K59E 2ZCLH 4ZTPH 1A4JA 2QADC 4OZIF 2E9JA 4Q9CA 2JB5L 3CFCL 3F58L 1YDPB 3GSOB 4PJFB 3HC0B 4P2RB 4JO3H 2CDEB 3RJQB 2HG5A 4OV6F 3PDGA 2VDPH 4RCAA 2DD8H 3PDOB 4KTYA 3QEQE 1P7HL 3HZYB 4BFGA 1BEYL 2VKWA 1XGTB 1QFPA 3DVNA 2PYFA 5DR5L 2RJMA 3WNLA 3CMGA 3FB6B 3IXTA 3E8UL 4YDLB 1OSZB 3AMLA 1I9IH 3B3IA 4X98A 3MLPA 3ZYOA 1GIGL 3L3HB 1CTOA 3WIIL 5DJXA 5JXED 1TQBB 4D9QE 1AQDB 4Y19E 4A6YB 2DM4A 1YECH 2MOVA 4JDZB 3OJDA 1OCWL 1NLDH 3UC0H 5D5ME 3ZTNL 4L5FH 5E0QA 4L3CB 3F12B 3OTTA 4J12A 4R6UA 2DTMH 4U3HA 5GRVK 2OQJB 2A0LD 1FL5B 4TTDD 4MQXD 4FFWC 2UYLA 4MDIA 1GJIA 5JPMA 5SWZE 1H15B 3H9SB 4R8WL 5DF0A 2XZQL 1MOEA 2UZXB 1I1FA 1LMKA 2DL9A 5F88A 5JW4M 4AQOA 2CQVA 4N0UE 3KR3L 5IBLD 2BSRA 3C9NB 4CN1A 1A1NA 5GGUB 1KC5H 2GTWB 4OCSL 2Y72A 5GGSY 3K2UL 3KXFE 5JUEL 5ID1A 2HVKB 4Y5XB 4WEUD 2FHBA 3LKSB 4GBXC 4HKJA 1P9MA 3AS1A 4Y4KC 3KPPA 3SQOH 4FXGA 4N5ED 3CH1A 4AM0B 2DYPB 1HIML 5IGXL 3MRBA 4IRSD 3UPRA 2ZG3A 5KOVC 5GHWH 2H6PB 3AS0A 3SDDB 1W0WB 3TCXA 3TH2T 4EI5A 3C60D 1B4RA 1AGCB 3PQYE 5EC1B 1U8QB 3GSUB 3VD5A 5HYJB 1MCPH 3IXAB 3VGAB 1BFOB 4TUOB 4X9BA 1B6DA 4BUHA 3SGJA 2NX5D 3JSSA 4WU5B 4OCNC 1NFIB 2EKSB 2OTPA 3IFOB 5DRNB 4HK0B 5C0CB 5HSFA 4OLVL 3O41B 4O2FA 4BFBD 2Q76A 3BI9X 2ZOKB 3HZKA 3DV6A 1EDQA 5J6GB 2GW5A 3V4UL 1XIWA 1QR4A 3F6LA 4J3TA 4P5KA 3R0NA 3RUGF 4LQFH 4HDIB 4U49A 5BJTA 3MYJB 3KYNB 4X5XA 4EDXA 5AYUL 1HXYA 4J1UA 5C0IA 5EB9A 4DZBB 5ICYB 3UJIL 3FFCA 5TE7L 1EGJA 1QSFB 3B5HA 4F37K 1U8KB 3DIFA 4WDIB 4U1HB 4Y1AD 4NZDA 4LCIH 2Z4QA 1X5AA 4PJGA 1JV5B 1LEGA 2J1KA 3RNQB 1DN2A 4R4FL 1W8NA 1OQXA 4GRMB 1QBBA 3DURA 1ZA6A 1MFBH 5C9JB 2AEPH 3JWDH 2A1WH 5HHOB 5HD8D 4KUZL 1B6UA 1Z3GH 4DN3H 1F8TL 2RFXB 4IIQA 3NACH 3TVMA 4V2BA 2BRRL 1F00I 4L8CB 2Z8WC 2B0SH 3D39E 4G9FA 5E6ID 1P5VA 3VXMD 3MRLB 5DI8A 1CLYH 5CWSB 3L7FA 4N68A 3D85B 4HF5L 4XP1H 3WO4C 5LKNA 4K3EH 1NMCB 5JW4Q 4UILL 4EQ3A 1I7TB 3DECA 5CINL 3SKUD 3GBNH 5IB1B 1FG2A 4PGDB 5GRXG 3TESA 3KYOA 3QCUH 1ZLUK 2E8ZA 4L3AA 2AJVH 2Y36L 3HB3D 1T1XA 4AMKH 4GRWH 2VDKL 3ULVL 4YBLB 3QA3B 1ZHBB 3SKMA 3SO5A 3ZKXC 5I1DB 3JV6A 3S4SG 5I17B 4HXBH 1WF5A 1ZLVK 1A7RL 1XF5B 4QWWD 2E6JA 3DMMA 1RURH 1YN6B 4XXCA 3W39B 4HCRA 3T0VA 4BFIA 4NUGH 1N3NA 1ZLWH 4XCYB 4KFZC 1EZVY 3S5LG 1BJMA 4WW2F 3TIEA 2NZ9D 3O3UN 1KENL 4K23L 5CCKH 4NHCL 5I1LB 1U8JB 2Z35B 3QCTL 3VFGL 3RVWC 4Q97A 1ZLSL 1MJJA 2VLMD 3PWPE 5DJCA 3D2UB 1N8ZB 3KPQA 1FNSH 1MCBA 1T4KB 4MMXC 4GG8A 3WIFB 1AKJB 4PG2A 3IF1A 3H9ZA 3HI6H 4MCYA 3S7GA 4MHHI 2CO7B 2NY2B 4M48L 2YD6A 4ZO6A 4IDLA 1NAMB 2H41A 2Q8BL 3N0PB 4DVRL 1WCBB 2LVCA 2R56L 2AW2A 1PYWA 4MNQA 1J8HA 2YD9A 3NOIA 5HYFA 3KPSE 1U41A 2PW1A 2RCSH 3U0PB 1TJHH 3DX9A 3PHSA 5I1EH 2YKLH 5CIPH 4M3KB 4NT6B 3BESR 1UQSA 3QXTA 4UOW1 2VH5L 4DUVA 2ARJQ 4EI5D 3MUY1 4ODSL 5FV2A 4EUPA 1T6VN 1WFOA 3HRZA 3VRJA 3AXLB 4OD1L 5FKAA 1HYRC 1INEL 4I18A 1T7XA 2J2ZA 5JZ7C 2QL1A 3QHZH 2VISB 3MRNB 3VMPA 3BGFC 1UZ8B 1CLCA 4X6DB 1T20B 2G75B 5EN2B 4JPIA 5KN5B 1UZ6F 1SMOA 4M7JH 3I9GL 1NCNA 3CSYB 4ZPTA 3LZFH 3U7WL 3U4AA 4DCQB 1HYSC 3B8YA 5I8KH 3JZ7A 3MRGB 4DQOL 1XIWD 3MYZA 5T1MB 2EDKA 3HI1A 4XCCL 3UTTE 2ZPKL 1Z0NA 4TUKH 5B39B 2DQGL 5AZEH 3OR7A 1CBVL 1I7UB 5DK2B 5E4EB 5MENA 3EYQC 3W9DB 4YPGA 3SY0B 3T1FB 1FNGB 3FFCD 1U42A 1TZIA 3QXAB 4NN6B 4D0BB 4PP1D 1HDMA 1SBSL 4HLZH 1EUTA 4QRSA 2AABL 3HNVL 4GKZB 4LSSL 1MCEA 2VB5A 4DUXA 5GRZA 1UM6L 3GI9L 1JGLL 5DJ6B 1IAIL 5FYKU 5KJRL 4KAQH 1K8IB 5A2FA 1KIQA 4KRPD 1JPTL 4FS0A 3TVMD 1XZ0B 5FK9B 5ICZB 5DA0B 3E8UH 4G9FD 3UTZB 5IK3A 1ZT4B 2F74B 2YMXH 2HLAA 4JQXA 4C54A 2A6IB 5ALCL 4QF1A 1BP3B 1DVFB 1OAQL 2AXJA 2NY0B 4M5YH 4XB7A 3ZTNH 4P4KC 3ETBF 4I3SH 3B43A 3WNNA 3L3JB 3E6HA 3D18B 2AAVA 4JB9L 3VDAA 4P2QB 1E4XI 3F6IA 3ZDZF 3OKDA 1L6XA 5HJ3A 4R97B 3DMMD 5EU6A 4AQ1B 3QUMH 1DLFH 3FN3A 3H3PH 2N4IA 3HHRB 1E0OB 4G7VL 3RBSA 1F6AA 3LSOA 3ZE2E 1DLHB 3L3KB 5J1SC 2DQUL 1NC2A 4JG1L 1JZ5A 5F7HA 3D3VA 4JRWA 3FO2A 1J0KA 3K2UH 1UA6H 4R96A 5IHZB 3QEQB 3UTSE 2WIMA 2DQJH 1F90L 5BRZA 3LS4L 4ETQB 2EIEA 3PNWB 3HMXA 1QBML 4ZUVB 1P4BL 4HWEH 4IRZL 3RU8H 1HIMH 4YHYC 2B2XL 1QG3A 1IZJA 5E7BA 3GHBH 4MMZC 1CDUA 1CLZH 4Y19B 4KHXL 1VFAB 3IJYA 3N1GC 2WP3T 5DHYA 2A6KA 2R0LL 1I3GH 1UYWH 3HE6C 3B8SA 4MNQD 5CSZB 3GO1L 1J8HD 4LAQL 1CIDA 5FHAL 2BNRA 5DGQA 5F72S 2EDWA 3G08A 1MCNA 4JN2A 3JWOC 2AJZA 4OZHB 1MJ8H 5F9AC 3RVUC 1MJUL 3IFPA 1G7MA 3MV11 2F5BL 4YDJB 1C08A 2R2BB 4FA8A 1KT2B 4O4YH 1MRFH 2VMFA 4PJHA 3HLAB 5JR1H 4L9LC 3O8XA 4NQXA 5DYOA 3VG0L 3GSQB 2X4PA 1BQHA 4OB5H 3VFOA 2J5LC 5DFWH 1YNLH 4RFNB 3RWEA 1HOCB 4M1CC 3GSNL 4I5BB 3V4UH 3WUZA 1PFCA 4ZSOA 5DJYA 4MJ6A 1NGWA 2FJFB 5I19H 1G7HB 2Z0BA 2VNCA 4X0KB 5I76B 4XBPB 3VFWA 3DARA 2O61B 5GGTH 4FTVE 1NJ9B 3CLEH 4IRSB 1J0YA 4XB8A 1I8KA 2EE9A 5IFHH 3DRTA 2FATL 1N5AA 3MBXL 1EFXA 4ZQKA 4MDJA 4QRRE 5IHLB 5ADOH 2R2EB 2GTZB 3MRPA 4XMPL 2Y5TA 3NPSB 1HI6B 3RVVC 3SGEH 3EOTL 4G8GA 5CMAB 5B38G 5MEND 4G43A 3NFSH 3SDCA 3EYVB 5C86A 4NYLA 1JPSL 2BRRH 4JANB 5DMGD 2NX5B 3OKOB 3WFHB 3GMNA 4E0RA 3D0VA 4HF5H 5INDB 4YHML 1QSVA 4GT7A 4PLKC 4Y5VA 2LQRA 3WEXA 1OAUL 4XGZB 3DX6A 5TQ0H 3IDMB 3WUWG 1E4WH 4XMKH 1T03L 5IJKA 2Y36H 1JGVH 3ULVH 1FVDA 2JJTA 1PBYA 1CFNA 2ZCKH 2MCPH 1IC5H 1UGNA 4FP8H 4KJWD 5J9PA 3QR2A 5T1LB 1B3JA 2D9CA 2HFGL 3BRGC 3MLSL 1E27A 4G9DA 4HJ0D 3V7AG 1U8PA 4Y1AB 4CNIB 4J3OC 3T3PE 3UTQA 1BF2A 3VXQA 1ZT7B 4DKFL 1CL7H 5IG7B 4KJPD 1S7RA 5FO7B 3QCTH 3VFGH 1QR1B 1ZLSH 1X5YA 2X44D 4QNPE 2AJSH 2BSTB 4ZNEA 1URLA 3D39B 5EU6D 1N59A 1R5VB 1A4JB 4ZFFA 2AK1L 4M48H 3DVGA 2OZ4L 2EYTA 4JZOA 4X7TB 2EDOA 1NC2D 3QFJE 4LLQA 3AY4A 3D3VD 4YPJA 2X5PA 2Q8BH 4NNYA 1IL1A 2X89D 5AAMA 2HG5B 5H37G 4PYHA 4DVRH 2ADIB 2R56H 3MR9B 4E9LA 1A3LH 1A6TA 2XZAH 4TVSa 1S8DA 3UO1L 5BRZD 3IDJB 4KTEL 3FQXA 5CP7A 3DVNB 2PYFB 5GPRA 1KN4H 3IXTB 3KDMB 3FRUA 1JF1A 4X98B 2YD7A 3B3IB 4IMLA 1A6AB 2CXKA 3MUJA 2E6PA 4WI2A 5DJXB 5BCAA 1GAFL 3H7LA 2P7TA 3OJDB 1QVOA 1G9ML 2YZ8A 1KN2L 4HWBL 4N8VA 4JG0H 3A0OA 4YWGH 5B3NA 2BNRD 3BKYH 2UYLB 3FQWA 4BQBA 2J88L 4MDIB 1RIUH 1EEQA 1MI5A 5JPMB 4O02H 1R3HA 4MHHG 2VR9A 1I1FB 5FF6A 1W8OA 1WZ1L 5F88B 3O8XD 4PREA 2BSRB 3DV4B 4ZFGL 1A1NB 4I2XE 5IB4A 5JIKA 3UYPA 1Q8MA 1F11A 1HNFA 4KV5E 5ID1B 1LHZA 4AH2B 3D69A 4W4NA 5DZLA 5CHNB 3AMKA 1N4XH 3CFKA 5I2IA 4HKJB 5E70A 2Y6SD 4PJCE 5KSAA 3WDIA 3KPPB 4JPWH 1WFNA 2IJ0C 2EDLA 2P8PB 4FXGB 1A3QA 3J8F7 4M7ZB 3CH1B 3FO0L 4QLRA 3RGVC 3MRBB 3UPRB 1SBSH 2F54E 5E08L 2V5TA 1AP2A 3I6KA 1MY5A 4DEPC 4EI5B 1EFXD 1QLFA 1FZMA 3GIVA 4HHAA 2J6EA 1JFQH 1UM6H 3GI9H 4A6YH 2R69L 1IAIH 5JXAL 4FQLH 1ZHNA 1VFMA 3A6BL 4G8GD 2LU3A 1LILA 3SDCD 1PSKL 3H9HA 1OOAA 4BH8A 4N0CD 4PRPE 3ARPA 2Q86A 4PG9A 1WBXB 4O2FB 2YPKA 2Q76B 1GHFH 4LCCC 1GC1H 7FABH 1JYVA 1BX2A 3HZKB 3DV6B 2AVGA 2DB8A 1XIWB 2VDML 4OZIE 3DRQA 1XEDA 5F7MC 5BJTB 1CD1B 1AIFA 1L7TL 4HXAL 3C5JA 1MPAL 4Z6AT 4X5XB 4EDXB 5T5FH 4J1UB 1GXEA 5C0IB 4WW2C 4XVJL 4ELMF 5IOPA 2ATPA 1KYOK 4ZFOA 3FFCB 1U6AL 2FEEI 3DIFB 5D4QA 2DQUH 3MODL 5I71C 2Z4QB 1NGQL 4PJGB 2CJUL 1LEGB 3SJVA 4Y0GA 3DURB 1MHEA 5CS7A 3P9MA 1CGYA 2XKUA 1F90H 2MSPA 3A6CL 43CAA 4Z0BH 3RFZC 3VXRA 4KRPB 4Q0XH 4IIQB 1X9QA 1LNUA 1QBMH 3F7YA 1P4BH 1G0XA 4G9FB 4MJ4A 3L7FB 4HC1L 1KB5L 1YPZA 5TH2A 4L4TE 3LN5A 3QEUA 1NCWL 2YS4A 2MPAH 1FG2B 2FZ3A 4M7LT 2VL4A 2R0LH 3KHQA 4LAQH 3O3AA 1T1XB 2VN7A 3ZTJG 3FB5A 3ZZ1A 1BZ7A 3SKMB 1JHLH 3MV9A 5IFJA 4NGHL 3U7AA 1MJUH 1V3KA 2UVEA 5FV1L 2MNUA 2YWYA 2GSGA 3DMMB 1QSZA 4KKCC 3FFDB 1ZGLB 1T04A 4BFIB 1T7VA 5DD5L 4LSUL 3VG0H 3VJ6A 5FGCE 3OWEA 4HIJB 2V2WA 1WIPA 1HWGB 3ET9F 2XZZA 2EO9A 3TZVA 1U3YA 4NQSA 2I9LA 1MJJB 1HEZA 5DJCB 1F3DJ 3KPQB 4R90L 1C5CH 1CU4L 2XKNB 4GG8B 1MI5D 1E4XL 3IF1B 4MCYB 4RGND 1QSEE 1ZE3C 1NKOA 3MBXH 4MX7A 3SBWA 5D6DC 5JW4R 3HR5A 1A0QL 1PYWB 3V52H 1QACA 4ODHH 3U46A 4LEOA 1RJLA 1RSFA 3EOTH 3X13A 1OT2A 3A67L 4NKDB 4Q6IC 2Z8SA 4MS8D 2CPCA 4OGYL 3ZT5A 3LPFA 3TBWA 5KSAD 3WS3A 5HGDA 3DX9B 2NY6D 4ZOCA 4W6YB 1F3DH 1V7ML 2GJ6E 4NBZB 4LF3A 3GRWH 5HDLA 3RUGE 1UQSB 1GCFA 3QDJE 5FYKE 3LEVL 3M07A 1RZKL 3GJFK 3WNMA 4EUPB 4ZAKB 1JGUH 3HRZB 4OKDA 2EO1A 4OFVA 4I18B 2BFVH 2EH7L 3DVFA 5A3ID 4AT6A 3BW9A 1V3JA 1J86A 4GS7C 2WWKO 3K81A 3MRQA 4K9EC 3MACL 1PEZA 1KTDA 1NBZA 3DHJA 4NKMB 4JPIB 1UWXK 1MNUL 5KS9F 2OS7A 2QQKL 3ZHDA 5FOJA 1AE6L 4ZPTB 4N0YL 3HNTL 5KSVA 1N0LA 5B4MC 2ADFH 3KYKL 4K8RC 4R7NA 1J11A 2HT3C 2DQHH 3V6BR 3HI1B 1KEML 1HSAA 3O2WH 4ODXA 3W81A 5MENB 2O93L 4K7PX 2E7HA 3GMQA 4YPGB 1D5ZB 1T5WA 3TN0C 5L9DL 1OGTA 2AK1H 1TZIB 3PHOA 1HDMB 5HDBF 3DETC 3GB7A 2BVEA 4QRSB 3SJVD 3CNKA 1NAKH 2H32H 3LDBC 4NQEA 1UFUA 4JFYA 1VADA 4KTEH 5D93C 3JUYA 1KIQB 3QQ9C 1YA5A 2QV2A 4EXKA 2VLKE 5E03A 4S1DC 2VLJA 4JO1L 3NH7H 3ALPA 4JFFE 5IK3B 1TETH 1QRNE 5GS1C 2HLAB 3UBXA 2X1QA 3ZT6A 1GAFH 4QF1B 5I18H 2Z92A 1I1AC 1VEOA 3FJTA 1G9MH 3B9VA 4HWBH 4KH2A 5HDQL 3U1SH 1EO8H 1LK3L 3E6HB 3ILQC 2HMIC 4ENED 2E27L 3FKUS 4G8EA 5H37H 3PE9A 3SO3B 3MV9D 2J88H 2I60L 1NGPL 3O45A 4PTTB 1QZ1A 1A14H 3Q6GL 5EU6B 1QLEL 4FZEL 1X5ZA 1T5XA 1F6AB 3LSOB 1JNNH 1WLHA 1P53A 4QRUA 4PJ7A 1NC2B 4MA1C 3D3VB 1MEXL 3D0LA 4U1LB 4DJMA 3SGKA 2B4CH 3FO2B 3QG6A 2FH6A 3JTSB 2X7LA 1CG9A 3PABA 4R96B 3TZVD 3BGAA 5IMOB 5DJ2B 4OCRL 5BRZB 4HWNA 5D71H 1H8NA 3MXVL 4JY6B 3GSWA 1CICA 4AG4L 5E6YA 5SX5H 2DKMA 1QFWI 1MUJA 2R0ZL 4MJIA 5F7WC 1RZFL 2WNGA 1Q9WB 4UV4L 2CRYA 1OM3L 3IYLW 3N06B 5ESVA 1PKQA 2NPLX 3AREC 5E08H 4JGUA 4LDEB 3WL9A 4EQ2A 1INDL 3IJYB 3IAQA 1UACL 4H26B 5BVJB 2A6KB 3K4ZA 1AGEA 1UZ6E 3S35X 5IUSA 4KK5D 2PR4L 4XWOC 2BNRB 3E2HB 4GSDH 5E95B 3G08B 1MHHA 4RMRA 5BVPH 4JN2B 4YHYB 5D70L 3H9YA 1E28A 3IFPB 3TJEL 3MC0A 5K93A 3BN9D 1G7MB 4EJ1C 3EDJA 1C08B 3NMEA 5AZ2H 1JZ8A 4P59H 2RB8A 1TPXC 4G6AD 2HRLA 4EN3A 4PJHB 4U7SA 4NQXB 3O8XB 5DYOB 2X4PB 1BQHB 4I2XB 5ESQA 4LPVA 3RWEB 4KRNA 5DFTA 1YN7A 3QH3A 5FYLD 3WFEL 1DE4A 4ZSOB 2VDMH 5DJYB 1JF5A 1GSMA 2BNQB 5FYJL 3WIHL 4MJ6B 1NGWB 1W72L 3UTPE 4PJ5E 1L7TH 1F2XK 4HXAH 1A9EA 1ORQA 4FMFA 4WU7A 3VFWB 4X7DC 3PL6C 1GGBL 3WFDH 1FO0A 3GMMA 3S88L 4WHYG 1U36A 3QDGE 4Z78A 4L4JA 5C6WH 4FQHA 5I0ZA 1VDGA 4XX1E 5TPWL 1I8KB 4GMSL 32C2A 3MREA 3HUJF 3DRTB 2CJUH 4OM1L 3NTCL 1N5AB 3P0YL 1EFXB 4ZQKB 4MDJB 3TLRA 1NFKA 5EIVA 4CW1A 4KK8C 3MRPB 2P8MA 4JKWA 2Z31A 4K3JH 4G8GB 4G43B 2YC1B 2FRGP 4QHUA 4XCEA 4NYLB 3T4YA 4F57L 2QQNH 2FH8A 4AEEA 1DL7L 2IBGA 3EO1B 3SCMC 3GMNB 3EZJB 3ECBA 3OAZK 2WUBL 5MHSD 2EXWC 3D0VB 4PLOB 4KROC 1YEIL 4QXGL 5HHPA 1JZ6A 2WWMC 2BMKA 2BOBA 5JDSA 3ZDZE 4Y5VB 3WEXB 3DX6B 1Q72H 3BKCL 5HI5D 2A83B 4NQED 5IEKA 1DBAH 1FVDB 2B7DT 1CFNB 1SVCP 4YUEL 1RU9L 2EXYD 5J9PB 4Q6YA 2AEWA 2VLJD 5D96C 1UB6A 5H8DA 3MUZ1 2E7CA 3O3DB 3L3OA 1E27B 4X6BA 4G9DB 5LJYH 1U8PB 3MBEC 4LSUH 2ZSVB 5J1AA 2H45A 3UTQB 4P5MB 3VXQB 5IVXA 2PETA 1S7RB 5IB3A 2NY3D 2DDQH 3D48R 4AEHL 3OGCA 5EOCJ 1JTPA 1H0DA 3PWVA 3VXNA 2CO6B 5E9DA 1UENA 2IPUG 4HPYL 2VZTA 5FO8A 3O2DL 4LVOB 3JUZA 4F7MA 3KJ6L 2WBKA 1E4XH 3DOSA 4D9LH 1KJ3H 1N59B 2VE6A 5IMKA 3ZTJH 4XTRC 3MROA 3DVGB 4UQ3A 1E6JL 2EYTB 1WC7B 4PJXF 3L6FA 4HMCA 2YD8A 1WT5C 5E2WH 1CVSC 4YC2B 2OM5A 2KZ1B 4LLQB 4NNYB 1CGTA 1IL1B 3OZ9L 3Q5YA 3VXUE 2DWEB 3NCJH 2FEEL 1A0QH 5E00A 4ZYKB 1MFCH 1I9JL 3HRPA 1CFTA 2NYYC 4JPVL 4JVPA 3PQYD 3SDXA 3A67H 2LVEA 3NA9H 2PCPB 4UZGA 5CP7B 3FQXB 3WD5H 4Y4KA 3EGSA 1CICD 3H3KA 2DQEL 2CSPA 4MJID 3FRUB 1JF1B 4IMLB 1MCKA 1JIBA 4MJ2A 1V7MH 4UTAH 1KGCE 2IH1A 2OL3L 2WIIA 2B20A 3MOBH 4LRNL 3LEVH 5EU4A 1IGJA 1V5JA 4F58H 2P7TB 1QVOB 3CMOH 4CUCA 4H8WH 4N8VB 1A6UH 4HUWA 5DLML 4JJ5A 4JFXA 1I85A 1IGML 4Q9BA 5FGBC 3WFCH 4Y5YA 3LEYL 1F3RB 1KNOA 3GMLA 5IVZA 1WIOA 3FQWB 1TVBA 3MACH 5KAQF 3NFPA 2EYSA 1MI5B 1R0AL 3SE8L 4LIQL 5KTEH 3FQNA 4EN3D 5FF6B 2QQKH 5DDHA 2HT2C 3BZ4A 4CMMA 4MA8L 4PREB 4ERSL 4N0YH 2CUMA 1SJEA 5IB4B 5JA8B 1UXWA 3H6JA 1F11B 5TE6L 4X6FA 1ZGLM 1L4IA 4RMUA 2WBJC 2W0FA 5CJXC 4ZUUA 3D69B 5FB8A 1KEMH 2F53E 3CFKB 5F1IA 3C6SA 2ZKHH 1I9EA 2YRPA 1JTOA 5KSAB 1FCGA 2NY6B 1IAKA 4KKNA 4R4ND 4LHUA 4NRYA 2DLGA 3ZDYF 1AP2B 3I6KB 5MP6L 3IS0X 2Y06L 3MGOA 4BUGA 2DLEA 1QLFB 1S9XA 2GI7A 4X7CC 3EYFA 3GIVB 4HHAB 3QULA 2YEZA 4RAUA 3MV8E 4KVCL 3NBNA 3B83A 5IWLA 1WV7T 4P46C 2Z31D 3OKMA 1ZHNB 1KELL 2CK0H 3VA2C 2VSDA 3ZYJA 2CUIA 3H9HB 4BH8B 1G6VK 2Q86B 1QYGH 4JO1H 3LOWA 4D0DB 4UDTA 3X17A 1I8MA 5MERA 3P0VL 1OTUC 2D7TL 2CIKA 3MLXL 4S0TD 5HGGS 2YPKB 4BZ1L 1BX2B 1E4KA 5I1KL 2XPGA 1EJOL 3UYRL 4M9PA 2OR9L 3OMZA 3PXJA 5FUCC 2ICWI 5D7JC 5J8OA 1LK3H 4R2GC 1RUPH 4PD4K 2X1XR 3DRQB 4X9GA 1AIFB 3C5JB 3WXWL 5TF1H 2B8OT 4PJBA 1OP5K 3TJHC 1A64A 2I60H 2IH3A 3Q6GH 2P24A 1NMAH 4GKNA 4KUCD 1QLEH 4FZEH 5IOPB 1H9VA 3MUGA 4X6EA 4L3EA 4ZFOB 3TT3L 4NOFA 2JCCA 5BV7B 3BUYA 3LV3A 4MXWL 3HAEA 5EBGA 3SJVB 4XP4H 1IEAA 4GW4B 4AENA 2FYYA 1MHEB 3P9MB 1S9YA 4OCRH 5IESL 2D0HA 3LKNA 5E9DD 43CAB 1OB1A 3RDTA 4NC1C 5CLTA 3VXRB 1ZVHA 3WHE1 1MRDL 5FUZH 2R0ZH 3F7YB 4H5SA 4JFPA 5KZCD 3MLZL 2NY4C 4JFFB 3QUYC 2NW2A 5GGRA 1C8PA 1DEEA 5CEYA 5FECA 2YUZA 5TH2B 1YPZB 3PP3H 5EUOF 3QEUB 1INDH 2HH0L 2EC9T 1UACH 1KOAA 1XH3B 3RNKB 1BFVH 1WWCA 5GRVL 4F8TA 1NUFA 3O3AB 3P4LA 4NN5C 1FORH 1MREL 1ADQL 1NUNB 2C3HA 3I6GA 3FB5B 1G6RH 4OBSA 1BZ7B 4Y4KD 4YHZH 4O2EB 4G6KH 5IM7A 5IFJB 1X4YA 3P2TA 1UWGL 1ZWIB 2PXYA 2GSGB 3UZQA 4OTXL 5D7IA 2MWCA 1T04B 4EBQL 4X6CF 3VMOA 3VJ6B 2IEPA 2CKBA 2V2WB 3MRRA 2WLZA 5DRWA 3NZHL 1FAIH 5IJVA 1R3JA 3TZVB 1U91B 5DA4A 1SJXA 4NQSB 5GRWA 3L5XL 2I9LB 4TNWK 3ULUC 1HEZB 2OJZH 3DWTA 3J7HA 2O5ZH 4JQVA 4JR9L 2R23A 4EZMA 3UTTD 1SY6H 1ORSA 3O6ML 5L7XL 1GGBH 2DM7A 1C7SA 3T77A 3CC5A 1FRGL 3GSVA 4PIRF 2Q1EA 4Y4HC 2WZPD 4KKAC 4DWHA 2H2PC 1MJ7L 1S7QA 3MLVL 4KZDH 3QRFM 2X9WA 2J12B 5IW6A 1B0RA 4OM1H 4Y2DA 2C3WA 3NTCH 3PJSB 4MX7B 3MV01 4P4RA 3FN0L 3P77B 3JV5A 3HR5B 2QQLH 3KPRE 2QSVA 3U46B 4LEOB 1RJLB 1NQBA 4OF7A 3X13B 5ENWA 1KB9J 1GGTA 4UIMA 1RZ7H 1KCSL 4XC3H 4NFCA 5F9WC 3TBWB 3WS3B 4F57H 3M17A 3VRIA 1OT1A 5HHMD 2YZ1A 4OLEA 2FHFA 4TTGA 2JJVA 4MAYB 4LF3B 4LHUD 1J1XH 1YEIH 2A9ML 3MLWL 1A02N 4WFGE 1QFWL 4E41A 4KHTL 1OPGH 1IQDA 3G6JA 4QXTA 4WHYH 3MOAL 3G5XA 1ZK9A 5ANME 3DNKA 4ELME 2VXSH 5T3ZL 1DBJH 5EO1A 3INUL 4AT6B 3BW9B 1HKLL 2NXYC 3I02A 4KI5F 1RU9H 1V8HA 1EEYA 1KTDB 2VZVA 1NBZB 5F7LB 3G5YB 2O5YL 2XA8L 4OLXH 4XPBL 2DTSA 3QHTC 3TNNA 7CGTA 2EDQA 4Q9RL 5GS0L 5KSVB 5ETUA 3ARYA 1MCRA 1FV1B 2AQ1A 3VG9B 5KG9A 3U2SA 4YR6B 3IFLL 1MFAH 4UMGA 1XAUA 3MV7A 1HSAB 2JKXA 4ODXB 3DSFL 3W5MA 1FVEA 2OSLA 3ELAT 3GMQB 3O2DH 4FZ8L 1OAKH 1T5WB 1OGTB 4L3ED 3CU7A 4HT1L 1G7QA 3PHOB 3EFFA 3B5TA 5ICXA 5FUCE 4RDQF 1A6ZB 3GB7B 4P23C 4UT6L 3OKNA 2BDNH 2WMPA 1IC1A 3BHBA 3T0BA 3IDUA 4LLMB 4NQEB 4HKBA 4JFYB 2DQCL 4G5ZH 4IRJC 1VADB 3JVGC 1IEHA 4BK4A 4OAWA 4OJFH 3RDTD 1U3JA 4FNLL 3EYOB 3TPUA 1QEWA 1RULL 5EU3A 4HLJA 5CUSH 2V7NA 5I9QC 2VLJB 3UMTA 4X8XA 5CZKA 4OGXL 5CJ5A 1KXVC 3AFLA 3RWJA 3UBXB 4P5TC 1I1CA 4GAGL 4KJYA 5HHQB 1EHLL 5DUML 5DXWA 4Z95L 2DQIL 3VW3L 2MFNA 5D2LA 5D93B 2IPTL 3CX5J 4NC1E 2NY3B 1IGMH 1UT9A 1LP9F 4HX1A 4JRXA 5L6YL 2W59A 4PJEA 1KCUH 1WITA 4PRBA 5HGHA 1AQKL 1YC8A 3HPJA 4FFVC 5DUBA 3SE8H 2PXYD 1IC4L 3U9PH 2IGFH 5DMKA 5SX4I 4M02A 1HQ4A 5K9JH 2MTPA 3LPGA 3HC3L 4QRUB 4PJ7B 4Y2OA 5L2KE 3STBA 3BP4A 3D0LB 1HK6A 3QG6B 3WJJC 2X7LB 5TE6H 1KIRA 3PABB 5A2IH 1OW0C 4KQ3L 3NCFB 1KEGL 4WI3A 3L5IA 5A16A 1WEJH 1YEDA 3BIKA 4WV1C 3BAEL 3GSWB 1CICB 4XHQA 1EVTC 3K7UA 1MUJB 3DXAE 4LFHD 4M9OA 4M62H 3VFPA 1T83C 1PKQB 2D0GA 2BXYA 3WL9B 2OK0H 5MP6H 1TCMA 1HYSD 4Y2DD 3KPNA 3IRPX 4OKVA 1B0GB 3ULUE 1JHTA 2W65A 4JDTL 2R2HA 4YEFA 5KS9E 1BWMA 3GMRA 1KELH 2HTLC 3QIBB 4GAYB 1GZPA 2H2SD 1IGIL 2WANA 4NO0A 1MHHB 3EYQD 1UH4A 1CGVA 3V6OA 1XF2A 3QQNA 5MI0B 3R8BB 1E28B 1MIML 5EOQL 3MJ8A 5E2VL 3P0VH 1QNZL 4NM4L 3MTRA 1KJ2A 2VXUL 3NGBB 4E41D 3MLXH 2W9DH 4PJFF 2Y1VA 5J89A 4JKPH 5LQBL 4HJGA 5ESQB 5E8NB 3O6FC 2OR9H 5DHVH 3QH3B 3STLA 1A7QL 2IBBA 4LVHC 2UWEE 2W60A 4NN7C 2OYPA 2LE9A 1CR9L 2IF7A 3MLYH 5HDBE 3CCHA 2NXZD 1NAML 4X7EC 4LRIC 3WXWH 1A9EB 1ORQB 1JMXA 4Q7DA 4WU7B 4RNRA 1LDSA 2BVQA 4M6NL 1FO0B 2BSED 1X7QA 1Z9OA 3JWDC 4Z78B 1C1EL 3HMXH 4FQHB 4OGZA 4MXWH 4PGBA 4F2MA 32C2B 1ZTXH 3UDWC 3KLHC 5I1CL 4LAJH 4CW1B 4BYHA 3B9KC 5C0EA 5CEZD 2IANA 2XNAA 1M6OA 1ZHKB 4R0LA 2Z31B 5CD5C 5E8OA 3MV7D 3VWKC 5F1KC 1UJ3A 5JPNA 4MSWA 3X11A 4QHUB 4XCEB 1MRDH 3T4YB 1GPOH 2AJUL 3S3JA 5DD0L 1MCDA 3ECBB 3JV0A 6FABH 5I1IL 4X8JB 1JPST 2VDRH 3LHPL 1U8IA 5IBTL 1JZ2A 5HHPB 2DKUA 2BMKB 1Q0XL 2BOBB 3MMEA 3QO0A 5JDSB 4KI1A 1T1ZA 1CTNA 2JTDA 1KCRH 4NQCE 1HWHB 4FXLA 4H20L 5EDXA 5IEKB 3O6LL 4F37F 4CDGC 3RWGA 2HJFA 4Y4FC 1RZ8A 3N1FC 5A2JH 1RAMA 2EC9U 3TPKA 3VD9A 4Y8DC 4L4VE 3RKPA 4KK9D 2R1XB 1UB6B 4OTXH 5HHNA 4XI5D 4PGEA 3LS5H 1J9CT 5L8LB 5F97E 5J1AB 3TF7C 3F65A 1AXSA 2HJKA 3ABZA 2AEIT 3QG7L 5IVXB 2BVYA 2MCG1 5IB3B 1J87A 1U3ZA 4ZODA 3I84A 1H0DB 4JRXD 2VDNL 2C26A 1FZKA 3W11C 4JR9H 5E9DB 2KQMA 4WWKC 3WCYA 5D7KE 2IAMC 5L7XH 5FO8B 1WWBX 4DZ8A 4NP4L 4NZTH 4F7MB 5KZCB 4OF3A 1TENA 2UV3A 5IMKB 2VE6B 3HMWH 5IFAH 1AFVL 1MJ7H 3T2PA 4C4KT 3MROB 4UQ3B 5GGQL 2ID5A 3L6FB 1SVZA 1FN4A 3REVA 35C8H 4QTHB 3U7YH 2PYEA 4JFDE 4NQDE 5E00B 4YDVA 1CFTB 3SDXB 4GUPA 1YEHH 5CKAA 2XY1A 3RZWA 3ZYIA 5ABDE 3UROR 3EGSB 3ARDA 1AXTH 4YXHL 1HH9A 1JF6A 1Z5LA 4OZFG 2A9MH 2ILLA 2IH1B 2WIIB 4KHTH 4QRPA 4D0CA 1RUQH 43C9A 1IGJB 4MQTB 5IR1A 4PP2A 3VD7A 4HIEA 4HUWB 2R9HC 3IJSB 4JJ5B 4C56E 4JFXB 1MFDH 4NO0D 3INUH 4WFHE 1N64L 3P9WB 3HUJE 1KNOB 4Y5YB 1HKLH 3VWJA 4Y16C 1QA9A 3GMLB 4NWUL 5IVZB 5C1MB 1H5BC 1MVFA 2GSIB 3NFPB 2BJMH 2EYSB 2O5YH 3W0WE 2XA8H 4XPBH 2JJUA 3BX7C 3FQNB 5TDOA 3S96A 2YD2A 5SWSA 5DDHB 5E8DL 3BZ4B 4ZOEA 4CMMB 4LCCA 1V3LA 3FO1A 5GS0H 3GI8H 1SJEB 4X7SH 4X4ME 1I3RA 1UXWB 2UUDH 5C0AE 1CDHA 1BHGA 3X3FH 1DDHA 2C9AA 3IFLH 2W0FB 3RI5F 4B50A 1DQLH 5FB8B 4LPXA 1AXIB 1B2WL 5F1IB 3T0WA 2CH8A 3C6SB 5KSUA 4PY8I 3TWCL 2X4UA 4U7KA 2E7LC 1IAKB 1P5UA 1RUAL 5HHMB 3DLQR 1S7SA 2VLKA 4LHUB 3ARXA 4UIKH 3I50L 4P2OA 3ZSTA 1RZJL 1S9XB 1LO2L 3EYFB 4RAUB 3QULB 2YEZB 2AJYH 2IAND 3MZTA 5IF0A 2DQCH 3OKMB 5LBSL 3LRSA 2C7UA 15C8L 2M2DA 1RULH 5CZXC 1XGRA 4HMDA 3TIDA 4KDTA 3U36B 3WDJA 4W4OA 1I8MB 3NZ8B 4UDTB 4XT1C 5MERB 1Q1JL 2B39A 2CIKB 5J3HD 3F62A 4TNVK 3VCLB 4PJAA 5HVHC 1JCKA 1SBBA 2M1KA 5C9KA 4WTXA 1JI1A 4FMKA 3VW3H 4TSBH 2DQFA 1D5XA 2IPTH 5T33H 1RHFA 5DMIL 4IOFC 4PJXE 3MLUL 2J3SA 4NCDA 1BBJA 3CFIC 4BH7A 4PJBB 3RP1A 2IH3B 4I0PA 2P24B 4GKNB 4TOYH 1IC4H 2CD0A 3SDYL 3L3DA 3MUGB 4X6EB 4L3EB 2H8PA 2JCCB 4BZ2L 5EBLB 3BUYB 3LV3B 1T0NA 1QSED 1OP3K 5GRJL 5C8JA 3HAEB 4JO4H 3V95A 1IGTB 1ZKAA 1GGIL 1IEAB 5DUPL 2CMRL 1ONQA 3MRCB 3QUZC 5DGRA 3PF2A 4WHTA 5BS0A 5EO0A 4AENB 5EPMA 3SKOB 2FYYB 3BYTA 4PJDA 2FBOJ 1S9YB 1FFNA 3LKNB 3Q1SH 1OB1B 3RDTB 4MAUH 4BSJA 2GCYB 4X6DF 1G7PA 5ACZA 1LO4L 4H5SB 1NBVL 4JFPB 2H26A 1S3KH 3EOYG 1EEZA 2NW2B 1DEEB 5FECB 1LDPL 2WUCL 2X4NA 2XRAH 4M43L 3CDCA 4QHLA 2PYED 3QIWC 4D9RE 1FL6B 4NBXB 1J05B 1KIUA 2IQ9L 3L1OL 3I6GB 2NY4B 2BY3A 3AB0B 1KCVL 1WAAF 1NBYA 3IDYC 5IM7B 3U6RB 2HRPL 3ARDD 1UEMA 4QXUL 3KS0H 1QHPA 1TJGH 2PXYB 3BPOB 4K2UH 4YHIB 2I27N 1FL3A 5D7IB 1QNZH 1EVUA 1CD9B 4QRTB 4QRPD 3QDGA 4WUKL 1KBGL 2CKBB 4OGAD 5CSGA 3MRRB 5ITFA 4Q9QH 3P4MA 3CFJA 5DRWB 4XPAL 4KI5C 5IJVB 1R3JB 2JJSC 4X4XA 4JAMA 2Y7QA 1ZT1A 3ZDYE 1T1WA 3VWJD 5I73C 2R23B 5T3XD 5AUMA 5HGAA 4WTWA 4F9LC 1ORSB 2EDDA 3QQ3A 2XTJC 5I1JH 4RBPH 3T77B 4U1MA 2F19L 3CC5B 3GSVB 3X3GH 5L8KB 3HZMA 4LGSB 5SWSD 2GIYA 1S7QB 3QT2A 4RGMB 4LK4A 5GGTA 2FX7L 3LQAL 2IMMA 2LABA 3ZLQC 5IW6B 1W2KT 2DQDH 1SM3L 2A9NH 4Y2DB 4LLVB 3X14A 1CXIA 4LKXA 3R1GH 4XWGL 5C0BE 4KKLC 5CGYC 1HNGA 1M7DA 4OD2A 1FG9C 5FYJE 1OSPH 5CD3A 5HYIA 5HVGB 4UIMB 4APQA 4FQ1H 2HKFH 1R3IH 2ED9A 3M17B 1TQCC 3VRIB 5DD0H 3QDMA 2FDBP 5I1IH 2WINA 4OLWL 4XPHH 2VLKD 4PGZA 4NM8H 4LSTL 4P2OD 2FEDD 1F45A 5DZOA 4E41B 1Q0XH 1U2HA 1G7LA 1ODAA 4K3DH 2EE6A 4NDMA 4GRLC 1IQDB 2LTQC 3G6JB 2YN5A 4QXTB 3G5XB 2ICWJ 1D7FA 2HKHL 1FSKC 4H20H 1QO3A 2UWEB 1F4YL 2R0WL 1T89A 5EO1B 2BVPA 2ESVB 2JIXA 5IVOA 3I02B 4N9GA 1EEYB 2VZ1A 3NVQA 2EYRA 1INQA 1FYHB 2ZUWA 3TNNB 1FBIL 1U9KA 5D7LE 1X5GA 5K9QI 2P44B 5I1HL 1I1AA 3FAXA 3LQMA 5ETUB 1E6OL 3BJ91 3HNSH 4RMWA 3QG7H 5KG9B 3U2SB 4LNRB 4JM4L 2YD3A 4WWID 3MRMA 3MV7B 4XVTL 4LP4A 5EUOE 5HDOA 1PZ5A 4BJLA 4OZHF 1FVEB 2OSLB 4NP4H 4I0PD 1IKFL 3PXHA 4KKCD 2H9GA 2XQYK 1AFVH 5DQDL 1JNLH 3H42L 1G7QB 3EFFB 5ICXB 2PO6C 5HPMA 5I66A 4XBGA 3GMPA 3IDXL 2V7HA 2IFGA 5I74C 2Z9TA 3MOQA 3OKNB 8FABA 1DUYA 4DOHB 3GK8L 3PV7A 4PV9A 3S4SA 1BLNA 5BS0D 3BHBB 3ARZA 3PIQA 4U1GB 4U6YA 4OCYL 4XP6L 1P84K 4OAWB 4LSQH 3TPUB 1J0HA 1EAPB 1VFBA 5A2LH 5J12C 4KGJA 4L4VB 3S5LA 1YQVL 5EU3B 1DBML 3TO4C 2V7NB 4GO6B 4Z77A 3TCLA 4J4PC 4YXHH 3IDGA 3N1PC 4RAVA 2EZ0D 1NCAL 5ELIA 3RWJB 4TRPL 1GVIA 3K0WA 4CADA 4POZC 3B2UC 3QUXA 5D2LB 4XNQA 4ODVL 1CF8L 1ZHLA 5IEHA 1BQLL 4WFED 1CGUA 4HX1B 4JRXB 1N64H 4PJEB 3WMSA 1A4KA 3T04D 1BD2E 5IHUH 1U8OA 4PRBB 5ERWA 5JLZA 4OM0L 3HPJB 5DUBB 1UCTA 4EOWL 2GEEA 1FZOA 5ACMA 5ALBL 5DMKB 1HQ4B 1HCVA 3NIGF 4YZFF 4PJ8A 3TEUA 1TZHA 3QDGD 4KK6D 1A8JH 2KQNA 3BP4B 4MGXA 4NQDB 2ENSA 1UJTA 1KIRB 1BJ1H 2D31A 3HPLA 5TDPA 4PB0L 3TYFA 5DJ8B 4YDLC 2GAZA 1DANU 4KKBC 5A16B 4OCWL 4NFBA 2X4RA 4B41A 1YEDB 3I2CH 1TQBC 3PL6A 2F58L 1GGYA 1F4XH 3TWCH 5CBAA 1RUAH 4LIQE 1FPTL 3EHBD 4K7PL 3VFPB 1WUNT 4AY0A 5JW3L 3SN6N 4M8VA 4JFZH 4KI5E 1K85A 3BPCB 3KPNB 3ARRA 5E1HB 4F9PC 1JHTB 2W65B 4L1HA 4HCRL 4R7DA 2PTVA 2R2HB 3GMRB 1FYTE 1K6QL 2XTJE 1GZPB 3GGWB 1FFOA 3BP5B 2Q3ZA 3OXSB 4APQD 4LLAA 4KJQD 5E99H 1XF2B 3OF6A 2B1AH 5IHBA 3QDMD 3VXPB 3UX9B 5KVDL 2YHGA 5ESAA 3MJ8B 2QBWA 1N6UA 2G2RA 5TGBA 3I3BA 5F9OH 4Y5XC 4NKOA 1RQ5A 5ACLA 1ZAGA 4HFUL 4HJGB 4WUUE 4TQEL 4JRYA 5DMIH 2W60B 5GZND 4OV5A 1FFRA 3CCHB 3FQTA 1BBDL 1TJIL 2R4SH 1MRCL 2JIXD 5DJAA 3ULVD 1NGZA 4TSCL 3OPZL 4PS4H 3SDDC 5GRYA 1X7QB 4KRLB 1X5FA 4PGBB 1I1AD 5GRJH 4F2MB 1D5MA 2P5WE 3TNMA 3OKYA 2F5AL 4FQQA 1Y6NR 5DD6A 1AHWA 4LHJB 3CZFA 3VGAC 2M26A 5C0EB 1NC4B 3OAUL 1T3FA 2IANB 4OCLC 4RQQA 4WFFD 1IRAY 2XNAB 1M6OB 3MJ7A 3ILQD 5I75B 1IKNA 2BVUA 4RZCA 5E8OB 1RMFH 1RUKH 1YEFH 2G9HA 1UJ3B 4JFHD 4N90E 3EUUA 1D9KA 5JPNB 5L8JB 2KDGA 4WY7L 4OQTL 1NBVH 4HJJL 1TVDA 3P0GB 1LP9E 1U8IB 2AK4E 1OGAA 1PKOA 3GFUA 3MMEB 3QO0B 3RIFF 4X9IA 5F8QC 5DK0A 4I77H 1QP1A 1QUNA 1WZKA 4M1DL 3L1OH 2ADJA 3RWGB 1AO7E 2HJFB 1RZ8B 3S35L 4J23A 5DT1L 3BMWA 1IFHL 2LU7A 5E5UB 1MCOL 2HRPH 4GRWB 5FHBL 5HI3D 5L88H 5DWUL 4P2CG 3STZA 4Z7UA 2BCKA 1OLZA 2ATKA 4WEBH 1A6WL 5DVMA 3FOMB 5GGVL 5HHNB 1YMME 1SHMA 4PGEB 4RGOH 4NO2A 1PVHA 3BXNA 3G6AB 1KBGH 4HS6B 1AXSB 2HJKB 3QUXD 3BD5A 3C09B 4XPAH 3CD4A 2QQQA 2VITA 4PRDA 1MAJA 4ZS7H 3BDYL 1LO3L 3GSNA 4I9WE 3EFDL 4PLNC 1FZKB 2F8VA 4MWFA 4FOMA 3K1DA 2YUWA 4DZ8B 1NMCC 1ES0B 2F19H 3ZE1F 5BW7A 1D5BA 1E4JA 4UB0H 4JY5H 3LN9A 1PY9A 4KMTL 2FX7H 3LQAH 3K4DA 1U93A 2IFFL 4OLZL 4PJ8D 5EBMA 1SM3H 5GGRY 1FN4B 1ACZA 2DLTA 4YFLF 3REVB 3RRQA 3P30L 5C0ND 2PYEB 4Z7VA 4V1DA 4YDVB 4KC3B 2GJZA 4GUPB 5F1SA 1KYOJ 1KJVA 5C3TA 4PJFE 4P2RE 3PL6D 4TSAL 1RZGA 4CVZA 4Z7NE 5IKCA 1VCAA 1HH9B 5DVKA 1YY9C 2PUQT 2XZCL 2AV7B 1FNFA 1Z5LB 1X4ZA 4LSTH 3D9AH 4QRPB 4D0CB 3IS1X 5J06A 4PJGF 3GRWA 5IR1B 4PP2B 4NO5A 5E8PB 3GZKA 3MRHA 4HIEB 1G9NH 4LCUA 1F4YH 3LKOA 1IT9H 3FZUC 5F71A 3CPLA 4G6ML 5E2TH 3VWJB 1U3HA 2QHLA 1QA9B 2NY2C 3SDAA 3OF6D 2YPVH 3UJTL 4IDJH 1NKRA 5GGVY 1ZLWK 1OTSD 4CN6A 5TDOB 4CVXA 4YHOH 1FBIH 1M1SA 5SWSB 4KXZI 1YEKL 3VH8G 4P2YA 3W5NA 5C6PB 1FH5L 5M95B 3ZKND 1Y18A 4HMEA 4TVPL 3FO1B 5B38A 1E6OH 3CH8A 1I3RB 1P2CA 5C2BH 1QPXA 3H9SE 5D7JA 4JRYD 1DDHB 2I26N 4UOW0 1AY1L 5KSUB 2X4UB 1IKFH 1VEMA 3GKWL 5DC9B 1MWAL 2AXGB 1S7SB 2X4OA 4P2OB 1FAKT 3IDXH 4QY8A 2RGSA 2OZ4A 1VEPA 5IBUG 5ADPH 4LVNB 4MB4A 1NEZG 4R26H 5IF0B 3PP4L 4ODWA 1CQKA 3LRSB 3ARGA 1X6LA 2C7UB 1J1OL 4KMQA 1D9KD 1ZEAH 1HN1A 3NFNA 1DBMH 2NZIA 4JDVA 2OI9B 2P43B 4XTRD 3JWOL 5L0QB 5B22A 3IAGC 1VESA 1A7PH 4BQ6A 1VGEH 4PRHA 5K9QG 2Q7NA 1OGAD 3RQ3A 4UNTA 4PJAB 4PV8A 4AIZA 4ZDHA 2BOCA 2DQFB 1BM3L 1D5XB 5E4EC 4HS3B 5FEBA 4BK5A 3IDNA 2YXMA 3BKML 1CF8H 4ODVH 5C0CE 2GYSA 4HWBA 2D7NA 2NTSP 3I75A 5EZJA 5KSBA 3QZWG 4BH7B 2ZUVA 3IU4L 4DGVL 3AVEA 4NN6C 1JNHB 4KVNH 2NMSA 4I0PB 5EWIH 4HK3J 1NSNL 3MJ6A 2A6DA 5GJTL 1T7ZA 1OAYH 1T0NB 3NPZB 5C8JB 4ONOA 4LU5L 1G7JB 2RAMA 1ONQB 2IG2L 3FO9A 4PRNA 4WHTB 5BS0B 5EO0B 5EPMB 1Q0YL 2OCFD 4PJDB 1QSFE 4L8SA 4B5EA 1HKFA 4UBDD 1FFNB 3H3BC 1JWUA 5FA3B 2OJEA 1G7PB 5ACZB 4QOKA 5F7EL 1FPTH 1A7NH 1DVFC 2H26B 2NY0C 5JNYA 1KFAH 5D2NA 3EZ8A 4RISL 1DBKH 1ROWA 5GQBA 5HHOE 2X4NB 4OZGA 3ARTA 1OD7A 2XIDA 4QHLB 3QHFL 2R8SL 4V1DD 1GGCL 2KL6A 2EE3A 4R97C 5C08A 4OLYL 5HYSG 4M6OL 1WBYA 3SE4A 2YPLE 4OZ4A 1BAFH 1NBYB 3P9LA 2NY5L 4IMKC 5CBEA 2A38A 4IOIB 1MIEL 3P4NB 3O0RL 4EXPX 4ZD3H 3LD8B 4WJ5A 5ITFB 3CFJB 2R29H 3HAEH 2D4FA 4C55A 5H94A 3LMJL 1DQDH 1ERNA 4X4XB 3MLRH 2Y7QB 1ZT1B 4QTIH 1T1WB 1U3HD 2RBLA 5JXEC 5AUMB 5HGAB 3SDAD 3QQ3B 4TSCH 4PY8J 2VAJA 1I3UA 4OIIH 4U1MB 5DO2D 3HZMB 2YWZA 4LEXL 3HI5H 3CGTA 4CMHB 4HS8H 1FGNL 3S98A 1C5BL 1CGWA 2F5AH 4M5ZL 4P9HC 5IQ9A 4TTDC 3O4LE 1BGXL 1KCKA 1L9NA 5D7JD 4OQ1A 4C83A 5IW3A 1F4WL 1KPRA 3F7RA 1RZJC 1M7DB 4NOBA 4OD2B 3AU1A 3C08H 5CD3B 4AL8L 3SQBA 5EUKA 1IGCH 4XPTL 5IBLC 3PWUA 3QDMB 2WINB 5GISL 4U0QB 1RD6A 3NIFF 3LKRA 3PV6A 4LSPH 1ZVYA 4MYWB 1G7LB 1F4AA 3V5HA 4BSVA 4NDMB 5C0GA 2HTKC 4KY1L 1I3VA 4LQ1A 2PW2A 3B5GA 1QO3B 4RFOL 1CZ8L 2QSQA 2DLFL 1XCQB 1YUHA 3ARGD 4HSQA 1VKXA 2BVPB 4ZXBA 4N5EC 4PJIA 2JIXB 4U6VL 2K7PA 5D1ZB 4R3SA 1VFUA 2P42B 4IRSC 1MCOH 4N9GB 5JMRA 5DWUH 3QIUA 2BVOA 2EYRB 1A6WH 5GGVH 4PRHD 3QWOA 2GQHA 4FQ2L 2P5WB 3NPSC 2B5IB 4HIXH 2YRZA 2HP4A 1O7SA 5K9KA 2X40A 3CVHL 4WCYH 1QFOA 3MRMB 2YBRA 5FYKL 3WJLC 2X4TA 1ZMYA 1PZ5B 2XWTA 2J6EL 5F70A 1T21B 3CX2A 2FJHB 1A9BA 2MQCA 4KMTH 4NQVA 3D25A 2IFFH 4PJHF 1CK0L 2VDLH