1OAUL

Fv structure of the ige spe-7 in complex with dnp-ser (immunising hapten)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
AVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGNKAALTITGAQTEDEAIYFCALWYSNHLVFGGGTKLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN E
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Mus musculus
total genus 24
structure length 108
sequence length 108
chains with identical sequence M, N, O
ec nomenclature
pdb deposition date 2003-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oauL00
1RZJL 3G5VA 4HWZB 2JTDA 5LG1A 5TPWH 3WUZA 3LN5B 4LU5L 3EO9H 5E2JA 4PIRF 1EZVY 2PTVA 4OCYH 2GITA 4KU1A 1FO0H 2FLRT 3S96A 3BKYH 1YEDA 2BC4B 4B7LA 4PREA 3SQBA 3VWKD 2YZ1A 5IB1A 3B9KD 2ICWB 4HGWB 2ITDA 4OLXL 4P5TC 1U8IA 4V2CB 3ZYIA 2X4NA 1E6JH 3BD3A 1A7PH 1LK2B 2ZSVB 4IMLA 1OLZA 3B3IB 4U0QB 3V0AC 3OWEA 4R7NB 3PHOB 5DUBA 4FQIL 1QSEB 2J8OA 5C0BB 3QI9A 3B9AA 1YC7A 3RU8H 1XH3A 2VTFA 3BKML 3VG9B 4JLRB 5I73B 4XXCC 5C3TA 2VLMD 3IFLL 1Z9SA 1U8OB 4V1DE 2VL4A 2X10A 1FCCA 1BWMA 4MA1C 3FOMB 3EHBC 1D5BB 4Z9KB 2CGRL 3SGDH 5GISL 1FGVL 1JPGA 5D7SH 1OAKH 5LAXA 4JFYB 2A77H 4P5MB 5GS0L 4NQVB 4ZUSA 5DK3A 1HSBA 1PQZA 4KJYA 1UCBL 2ATKB 5EZLA 3T3MF 3ARGB 4YFEA 3THMH 3I9GL 4RAUB 2M1KA 5I2IA 2C3VB 3BP5B 1L6ZA 3EFDL 3K74B 3UJIH 4F9LC 4OLVL 2OS7A 5B38G 4L5FH 4Z0BL 4QXUL 5C0EA 1LMKA 2FWOB 5GHWH 1A1OB 1GZQB 4G80B 1FRGH 1OAQL 4YO0A 5FGSA 2Q86B 1TZGL 2D4DA 3MOBH 3HC0A 4N0YL 3SGEI 3DXAA 3K2UL 4EI5B 3N1PC 5B22A 3HAEH 3SKMA 2HT2D 2VXQL 2GJZB 3L5IA 1NGZB 3LQAH 1RFDL 4TUJB 2YWYA 4MNGB 2G75B 4CU8A 1I1FB 1VFAA 5I1HH 3LRSB 1AGCB 4XWGL 4K94C 5MEPB 4CBPA 4FQHB 1B0WA 3KLDA 4RMSA 1LE9B 4UTBH 2D4FA 4NO5B 3I6KA 1LEKA 3U9UB 1IQWL 1SBBA 1G9ML 4JN1L 12E8H 4Z7QF 4XH2A 3TYGL 4GRWE 4JEGB 1KT2B 3OJ2C 3ET9F 3P4LA 3STLB 4L8BB 3I85A 3GIVB 1M71A 5DVNA 5DVLA 5CJOL 2VAAB 1TXKA 2VZ1A 3K80A 2BY3A 3X12B 5DJ6B 3RA7L 3WJLA 4AT6A 1ZLVK 3REWA 5F93C 4RGND 2BVPA 4PJBF 3CNKA 1FN4A 5I76B 1U8MA 1TTFA 4QF1B 2QR0A 4J23A 5D7LE 4G8GE 1P53A 2VDRH 1S5IL 2DOCA 1HN1A 4WTWA 1CTOA 1OTSC 4ONHB 4NNPL 1QOKA 2JF1A 3CH1B 4QHNA 1KJVB 5AZEL 4LMQI 1SBSH 3ARBD 3HZVA 3T0XA 4M48L 1SEQH 1A3LH 3HC4L 2D31B 2IALA 1BQHA 3KS0J 4I18A 5D1QA 4KUCF 1PAMA 4P2OD 5CINL 2VC2H 4QRPA 4D0DB 1T7ZA 5TQ2L 3K8MA 2QSTA 4PJEF 3NH7H 4L3CA 2M2DA 5CMAA 1XCQA 2HJLA 1NCTA 4LSPH 1J8HD 2DMCA 4HH9A 3BE1H 3QNZA 2XA3A 2FBOJ 4Z0XB 4F80A 5FYKD 4LPVA 1T21B 2VLLA 3ILQD 5T1LA 5C0CE 1DSFL 3DVFA 4Z7VA 3R8QA 4Y5XA 2ERJC 1HKLH 2XZCL 4EIGB 1TJIH 1LVEA 4I5BA 4EZMA 4BZYA 5JA9A 4GRLA 5BO1L 5EU4A 1T22A 3EYOB 4Y0GA 2CK0L 3DX9B 5T5FL 2WSKA 3CVHB 5CJ5A 4Y16D 5IWLC 1S7VA 4X7SH 4OF3A 3T4YB 1I7UB 3CLFH 3TZVA 1F4HA 1VGKB 2Q8AH 4U6YA 5E24E 1DBAH 4PJFE 1VEPA 1E4KC 1EBPA 1C8PA 1F6FB 1VPOL 3ARFD 3QT2A 3D0LB 4J1UA 2YD8A 2IBGA 4F7CA 2WP3T 1JWMA 5DEZA 3MLYL 3KYKL 5A40E 2QQKL 4NP4L 5E8PB 2BNUA 4H5SA 3WS3B 4FFZL 3CSYA 1F4XL 2C3HA 3C5ZB 4LLVA 1J0ZA 4PP1C 1QVOB 3C6LD 4NO3B 4PYHA 3PDDA 4NRYA 2ZCKH 3HPJA 4E5XB 3PHSA 4R4FL 4Y2DB 3QDGE 3BPLB 4W6WB 5KTEH 5HHPA 2AXFB 4OJFL 5KZCB 2L7JA 4I77L 1DBKL 2PO6A 5EFIA 1FL3B 5E8DL 1HHIA 1YEJH 1UENA 4G9FA 3D0VB 1WK0A 3M8OL 4ZFFA 3BX7C 1N3NA 3LEXB 2Y1VA 3Q3GB 3VI3E 5FHAL 1FLTX 4PUBH 1ORSB 2F8VA 3FQTB 4P2QE 2Q7YA 1K4CA 1AKJD 5B8CC 1D5IH 5KSBA 1E4JA 4PJ9C 2GJJA 4MD5A 5JNYA 1T1YB 2F54D 1FYTD 2JB6B 2H1PH 2UUDH 2FEDD 4FNLL 1UKTA 2DLHA 3KYNB 4OLYL 3KPOA 4YXHH 2O5YH 3MGAA 3PWLB 5FUOL 4KQ4H 5IR1A 1JYXA 3JTTA 4P2RD 4Y4HD 3MFGB 4ZS7L 3BXNA 4U49A 1XF3A 1GAFL 4NC0B 5HJ3A 1F58L 3T4AB 1EMTL 2X70B 2Z8SA 3WO4B 5ID1B 4V1DB 2C7UA 4AMKH 3RWFB 4UOW0 3RKPA 5K9KA 3L1OH 1MHHA 3P73B 3X17A 2BFVL 4YC2B 2EEAA 4OBSA 5J12B 1S9YB 4DGYL 5EU3A 4AH2A 3BEWA 2VR4A 5IVNA 3LKSB 3D5OF 4JVPA 5FOJA 4P46A 2A73A 3QHFH 1IAII 5F3BB 1BJ1J 3FTGA 4NSKA 5ACZA 5FAAA 2CR3A 2BRRL 5IW3A 2HTLC 3AS0A 4OKVA 2X4RB 3C6SA 2ZUXA 5HTSA 1UC6A 3LEVH 3SO5A 2B4CH 5DO2D 4WU7B 2HN7B 3JWNC 4G43B 3C5SB 2IJ0C 5F9WB 4U1IA 3MA9H 3HS0A 2FYYB 2Q3AA 1EO7A 3I50L 2N1KA 4XNUH 2FR4A 4P3WA 4LMQE 3L5WA 3BQUA 4YPGA 5JW3H 4NKMA 4Q6IB 3LY6A 2G2RB 1KTRL 2IPTH 1HYRC 2BSED 2DBLH 2WNGA 2X1PA 1DEEA 2W60B 3T0WA 4OQTL 1NAKH 3RNQB 4XPTL 4JHZA 1UKSA 3IJYB 3JV0A 1I3RB 2AP2A 5SWSE 3KJ6L 4KC3B 4NQEE 4L9LA 2VN7A 5C07D 3B8SA 3REVA 1FAIL 1I9IH 1JN6A 2GIYA 1AR1D 4GRWB 4XT1C 2IPUK 3ARGC 1CQKA 2YEZA 4K3DL 3HB3D 3UXFA 1YNKH 1I8IB 3DETD 4LPYA 5GS2H 2FEEI 1BBDL 2EKSB 2EZ0D 3T0ED 1A6VH 3WN5A 3UCRA 1XGTB 1FIGH 1KCVH 4PJIA 5IJVB 4P48A 1MCHA 4P5KB 1MUJA 4S10A 1BAFL 4G8GB 4EI5C 1FNLA 4QY8B 1J10A 2BHYA 4P57B 4TN9A 4G8EA 5H37G 1V05A 4BH8A 4OAWA 1CLZH 5DHYA 4GMSH 2P7TB 2BY2A 2YUVA 4RGMC 4KKBD 4ZQKA 5HPOA 4FA8A 1EJOH 1KSRA 2E5EA 5FM4A 5IBTH 2ILLA 5T1MB 5FUZH 3HAEB 3QG6A 2VL5B 5BXFA 2XQYG 1CL7H 2I07A 3ZT7A 1R0AH 1JF1B 1BMGA 3I3EA 2BDNL 2ARJA 4ZTPH 4DEPB 3JWDH 4QRQB 4ZUVA 3GJEB 3HZYB 5D2LF 5CSZA 1S7XA 4TULL 4CN1A 2DWEA 3IETA 2F19L 2MJWA 4DVRL 3DECA 1IQDA 2YD1A 1LEGA 3NPZB 4H8WH 3LKOA 4RFEB 2X41A 4GOSA 5C0CB 1GCFA 2VDQL 2Z31B 2X4QA 3H9SE 4XVJL 2EDEA 3WE6B 5HI3D 2DLGA 4QNPE 2OR9L 5ID0A 1P7KB 5HVWA 4LCCB 1KOAA 1SEBB 5L2JB 5MEQA 1ITCA 4F7MA 5CIPH 3HG1D 3BKJH 1F3JB 3HPLB 5GZOC 1KC5H 1UQSB 5EH1A 3VXRD 1VERA 5E2TH 2HAZA 4ODSL 4F7PA 1CR9L 2F58L 4KRLB 4UT9H 1HOCB 4RGNC 4PRHD 5CD3A 3ZTJG 3EOBA 5IEKA 4K9EL 2PR4L 2X6MA 3QIBD 3OB0K 4NWTH 5FO7A 4L4TD 3BWAA 4NUJA 5AUMA 3UJTH 4R90H 1F2XK 1J0YA 5D1ZD 3CC5B 5K93A 1JNHB 4LSQH 2NY5H 3QHTC 3QEQD 3WNLA 3RNKB 4RSVA 3QQ4A 3QDAA 1JRHI 2DJ4A 2EXWD 4BFIA 2VWEE 1RZKH 5DLMH 4J4PD 3T04D 3U7YL 3QDGB 5D2NC 3TNNA 1BBJB 2HWZL 2PW2B 1QFWM 3CJJA 3UTQA 4OSUL 3DSNA 4MAUL 4G6AC 3FB7A 4HPYH 3RI5F 2ENSA 1IGJB 1IGYB 2UZXB 3N1FC 5C3LD 1F13A 1NGYA 2F53E 4MD0A 4TTDC 4ODWA 1EHLH 4Y7MA 1EVUA 1I9RL 5CP3H 3W9DA 1SQ2N 4LAJH 4W4OC 5C0FB 4NBZB 4MD4B 2FBJL 3NIDF 1JGUH 1H8OA 25C8L 2XWJA 3DMMB 2BNRA 3NBNA 4DQOL 5D7IB 3C09C 1RVFL 3PGDA 3PHQA 3RX8A 3WS6C 4O4YL 2LVEA 2C1OA 3EYSL 2EO9A 5DMJB 1G6RB 4DGVL 4M5YL 5F9OH 2VSDA 1Y0LB 3FMGL 4XNXH 3RVUD 1PYWA 5CKAA 5TE7H 2ZKHL 5M95B 4ZG1A 3QUMA 5C09A 1J87A 1AQKH 4X6DE 4RMRA 5JXAH 4PV8A 2HRPL 4Z95L 3HMWH 4BK4A 1ZVHA 3ETBF 2OZ4A 2Z35A 4K07A 1KCSL 4Y2DC 3ULVH 5HHNB 3BPLC 4PB9H 35C8L 3LN4B 1KIRA 3R0NA 5F44A 4MZ3A 3ARFC 3H9HA 1A6ZA 3GKZA 3WFZA 1E0OB 1JNNH 5B39B 2NX5A 3TEUA 2E7LC 5F96L 3RUGB 3R8BB 1VKXA 3QEGH 1W72B 1AY1L 4H25A 4PGEB 3C6LC 4NZRH 3WNMA 4ZFGH 2PW1B 2KZWA 3G5ZA 1OT1A 4S1SL 7CGTA 1AXTL 3IKCA 3B5GA 4P49A 4PRNA 1XGYH 3MUGA 4OZHE 5HHOE 4U3XA 4CUCA 5LXGL 2E6PA 3U0TB 5I1EL 4YDKL 2A38A 3MLRH 3WHE1 2PXYA 3B9VA 2LTQC 4LLDB 1DFBH 4POZC 1YEHL 4ONOA 5ISZB 3N1MC 1MH5A 4BFBD 4ZO8A 4OI9A 4KTEL 4NUGH 4QYOB 1JRHH 5CEZD 1QHOA 1FFNA 2I5YH 3OTTA 3VFSB 1T7WA 5LKNA 1MVUB 3VCLB 1Q72H 3DUSB 3MLTB 3RHWK 1MI5E 1X5IA 5E99L 5SWSB 2FEDC 4IRSC 4YC2C 2K1MA 1UH2A 1WEJL 4MVBC 3WUWG 3KVQA 5HYQA 2P8LA 1JMZA 3L3JA 3OAUH 4JO4H 1NC4A 3MV7E 5F7KC 5TDOA 2AEQH 5JIIA 5DJDB 3TIEB 2HMID 4HS8H 3CFBA 1RJZB 3HCVB 3WFEL 2D0FA 4XMKL 4QXGH 3VRLE 1A2YB 2D03L 2ZOKA 4N8CL 4OLZH 5TQ0H 2AXHA 4CNIB 3IJHA 1QLEL 1KN4H 3C5JA 3QDJE 4NFBA 2A6DA 1NUGA 3TJHC 1KNOA 2ZCLL 1Z2KA 4HJJL 1G7IB 3TBSB 3BGMB 2XTJE 5F9WC 1JGLH 1HIMH 4HT1L 4EXKA 1ZHLB 4CAGA 3OJDB 3I6GA 3IDXH 2AJ3A 4GW1B 4J6RH 3HE6D 5DWUH 5IESL 3ARXA 3BN9C 5HYFA 3MJ8B 3H0TA 3DGGA 1MRCL 2KH2B 2Y6SD 2RB8A 4HWEH 4DAGL 4QHLB 4G6KH 4GXVL 1QFPA 3E1F1 1CXHA 5C0AD 5L6YL 1MEXH 1E6OL 2W9DL 3F7VA 5D8JL 3UPAA 4LQ1A 1QEWB 4R4NC 1F42A 4L3EA 5GS1A 4YJZL 4WO4B 4ZXBB 1A6UL 2YUZA 1AO7A 1GPOH 3ILPB 4XTRD 3KYAA 4NWUH 5CSBA 2C4FT 2A0LD 2CIIA 1FZOB 4PJAE 4F33B 2UZIH 3S3SA 5INDB 1KFAL 4LLQB 1ZLSL 1BVZA 2YPVH 6FABL 5IJKC 4JM2B 3RWEB 1RUQL 2G60L 5JHDD 1MCPH 4N1EA 4HIXH 3HNVL 5DI8A 3H9SB 3T2NH 4AEHH 5D9SA 1G7QA 4GMTH 4GG6A 3EDKA 3D25B 2IG2L 4JCMA 3KWWB 5TE4L 1UJ3C 1S7RA 4XCEB 3FQNB 4P9HL 2HKFH 4ZS6C 3CCHB 2YKLH 3MLUH 2GSGB 4XPFH 4GAJH 3RL1B 8FABB 3HB3C 3GJFH 4PRAA 1NPUA 4O58L 1W0YT 2R9HD 1OP5H 1KENH 3VFOA 1MCWW 1MWAB 2NY1B 1NGQH 1UWEL 5JQHC 3L6FA 4FQXB 1BZ9A 4PJ7E 3UBXI 3MNVB 4G8FB 4JFOB 4A6YL 4M5ZH 1HCFX 1YUHB 2YRZA 3TO4B 3W0WB 2I9TA 4MCYA 4WFHD 1IFHL 3VXTB 4DEPC 3DPBA 1CGTA 4M1GL 4UNUA 5I6XB 2UY7A 1QG3A 5DC0A 4KKBC 4NPYB 4FQQA 3FO1B 1J0HA 1UXSB 1FCGA 3DVGA 2D7PA 3NPSB 3F62A 5T33L 1ND0B 4LL9A 5GRJH 3ZE0E 2DM3A 3OZ9H 3VXQB 1T20A 3C8KA 1E28B 4MHHI 1J1XL 4TVSa 1KB5H 2DICA 3G5YA 3MJ9L 1DBJL 3ARBA 3ZDXE 2F53B 4KRPD 4LCCC 2AKRA 3TBVA 2NY6D 4P23D 2HFEA 2EDQA 3MA7A 4P2OA 2Y5EA 1KELL 1HHKB 5T3XH 3VI4E 1K5NA 1UWGL 1RV6X 3HAEG 3KXFE 1I85A 4IMKC 4U7MA 1J8KA 2JIXA 1T03H 2C9AA 3JV6B 4ZUWA 3UTTB 1JZ2A 3V6OA 3QH3B 5CEYB 4HK0A 1I9JL 4FQ2H 3BGFC 2VNCA 3IAQA 1T83C 3HI6H 1HWGB 2H2SD 4OZFA 1X5AA 3QFJE 1S5HB 3JV5A 1HWHB 5C08D 1R3KA 1RUPL 3GMNB 2F5BH 1JPFB 5F6HJ 1FNSL 5HHOD 5I1DB 3FB5A 4TRPH 3MRRA 3QUYA 2QEJA 1NCWH 1SY6H 1HSAB 4N1HB 3GMMA 4ONGH 1TITA 5TF0A 3RP1A 3DHJA 2G9HB 2NTFA 1MRFH 4PS4L 3VH8B 5EN2A 4S2SB 2EH7H 2FJFB 4HUXB 5I16A 3GMLB 4ZDHB 1CGSH 5I66A 2EXWC 4KDWA 3RAJH 2R4SH 5DT1H 3CH8A 4OB5L 3RWGA 5TJWK 3CSPA 1B0RA 4NO2B 4EUPA 4HQQH 1U3HB 3HI1B 4GRWF 2WBWB 4JKLA 1TIUA 1T66C 4PJXB 1S7SA 3FO0L 4KKNA 3GFUA 4H88L 3TA3A 1BZQK 3MV7D 1IEHA 3FCTA 3PWPE 4JKPL 4S0SD 2V7HB 3V5KA 4M6NH 5I18H 2PTTB 1C08B 1CE6B 2VQ1A 1FHGA 3OGCA 1KPUA 1TJHL 4XAKE 4FXGB 3G5XA 3MGOA 2KUTA 5D72H 4HUWB 5MEND 1UG9A 4X6CE 2XN9D 5IROA 5C0JB 1RHHB 1AKJA 1QNZH 3DURB 4CDGC 5IB2A 1PZ5B 3RWIB 4JKWA 1MCLA 2A6JB 2B5IB 4M1CD 4LCWD 4UNTA 1FYTA 3V6FB 5HGBA 5CGMA 1II4E 4DFHA 2FHBA 2R1WB 2CMRL 1FBIL 5BOZG 3QDMD 3ESUF 3QUZC 1CGWA 4U1GB 4WTXA 4Y4FD 2O5XH 4JPKH 4KJPD 4PPTA 3PP3K 2AXJA 4P2RA 4KHTL 2A74B 3NIGE 1F4WL 4FZ8H 4KI5E 4I3RL 3P4OA 2QJDA 5MERA 5D93B 2BMKA 4C83B 4YGVA 5E9DA 3SGKC 3PNWA 2PYEB 1JF5A 3RIAF 1S8DA 4LSUH 1TTGA 1UT9A 3U48A 1AFVL 1M7IB 2ICES 1YMMD 3R1GH 4LCYA 4X80H 2R1XA 3OX8A 1T1ZB 3AM8C 5JLZB 3HR5B 5DQDH 2GJ6D 3CMGA 4UU9B 3U7WH 4JQIH 2GT9A 1M7XA 5HSFA 5EC2A 4YHLL 5KBNC 1S78C 3KG5A 4JANA 3VXME 1I1YB 4TUOB 1QSFD 2FX8L 4LP4A 5ICYB 3V9FA 1XGRA 1BGXH 4U31A 4UQ2B 4YX2H 4JAMB 1JGEA 3MCKA 1KPVB 5FECA 3FT4A 3IDUA 1R3IL 3D48R 4QRUA 2IBZY 4ZO6A 1LDPH 4K55A 1N59A 3EAKA 4UI2A 2AJVL 4U1SB 3CZFA 5E8EA 1I1AB 1YEEH 2XA8H 5AWNH 1LP9A 4K3JL 2EH8H 1QKZL 3FAXA 1I3VA 4HPOH 4ODXB 5DEGB 4X5XB 4X4YB 3O11A 2ZPKL 1YEIH 1N6UA 2WMPA 4IOFD 5GGRY 1XF1A 4RWYL 4R96A 5EOTB 1HXYB 4ZSOA 4KROB 5MHSD 4R9HA 5B4MD 3UTZB 1RZ8B 3GBNH 2J88H 2V17L 3AGVA 3SEPA 3QIUA 1CFBA 3VI3F 2Q6WA 3H42L 3M17A 3VD9A 3CFDA 3EYUH 3NZHH 4PJ7B 3RVTD 5EO0A 4DN3L 4YHYC 2GUOA 3RVWC 1DBMH 3QUXB 3SKUD 4RMWA 1R5VA 1X5LA 3BH9A 3EYQC 1DANU 1ETZB 3T0EA 4FG6D 4Y5VC 4OD2A 1I3GH 3BIKA 1K8IA 1KIUA 5F1NB 3FB8B 1LO2L 2P4AB 4XC3L 4JB9H 3H7LA 3S5LB 1TFHA 4AEIH 2YK1H 4XMLH 4FQJH 5F7NC 5KSVA 1ZA3B 1ADQL 1T0NA 5K59E 1HQ4A 4AK1A 4KMLB 4PJ5E 4JZNB 3LH2L 2BVTA 3LSOA 3Q1SL 4E0RA 2XACC 1G0DA 1JBJA 1N7ML 1X5KA 2X4TA 1N5YH 2J6EA 4Z8FL 1VGEL 1C16A 1DQJB 2J3SA 4HIIA 1QZ1A 4O51B 2Y7QA 3VMPA 4Y5YB 3KXFB 1F45A 4NKDA 5HI5C 3SDAC 5HI4C 2YN3A 3L3HB 2NY1C 1CK0L 2DF3A 2HVKA 4OFYA 4U6XA 4JQXA 4PJDA 3OB0H 2EDYA 1WAAA 3JWOL 4Y2OA 1IE5A 4N0FB 4FQXC 4C4KO 5KOMC 2X4SA 1JGDA 1TCRB 1JYWA 3O3DA 4S1QH 3WNNA 2ED9A 4TVPH 5L2KA 3W81A 3CFCL 3GJFB 3TO4C 4AENB 3VFTB 1P4BH 3PGCA 1RZJH 4PG9A 4LVNB 5L8JB 1AE6H 1QYGH 3EW3B 1YN6A 3GKWH 2VWEC 3H2WA 4X83A 2C1PA 3N0PB 2NXYB 3AU1A 1U6AL 4F7EB 1KIQB 4ZFZA 4UILL 3B9EA 4PFEA 1QFWI 4JQVC 4BJLA 4GS7C 4PJGA 5TGBA 3EJZD 5CFHA 1WT5A 2OJEB 5DJZA 2MCPL 3HG1A 1GSMA 4JFXB 1IKNC 4BK5A 1JI1A 2WBJA 5FYJE 4OTXH 1M6OB 5L0QC 4M6ML 3PWNA 1YN7B 2A1WL 3P3YA 2QHLA 1OCWL 4I2XA 5L8LB 2IAMD 1NMBH 4XGZA 5HHQB 1MCQA 3K0WA 1CXLA 1KB5B 1BLNB 1U92B 4L4TA 1TJGH 2FATL 1KJ3H 3F7QA 1EEYA 1OARL 3KNBA 5D1ZA 4HS6B 2NR6D 2YD4A 3MV11 2VKXA 3GM0A 3VXUA 4RIRA 3SGJC 1G9EA 1QTYT 1MCSA 1FGVH 4KRPC 3WBDA 1D6EA 5IMOB 4PBXA 1HYSC 3PWPB 3N1GC 4NKIH 5F9JA 3EJYC 1F6AA 2PCPB 5GRVL 5DK0B 2E8YA 1FL6B 1IAOB 2FIRT 1UCBH 3VJ6B 3QO0B 3TN0A 1NFIA 3I9GH 2P5EE 1IGML 4UMGA 3AMLA 4HHAA 3NGBC 4P4KA 4LSDA 2DLIA 4F8QA 2J1KA 3EFDH 1JNLL 1CG9A 4MDIB 4OLVH 4Z0BH 4WENB 1AQDB 5FKAA 5E94A 1NJ9B 4HWBA 2BRQA 2IH3B 3PQYA 3FHQA 4N0YH 3IVKA 3K2UH 2O61B 1UCTA 4K7PX 5JO5B 5IBUB 3BIBX 2VXQH 1FVCB 1MFBH 1GL4B 1MQKH 5F89A 1I7TB 4L29A 1DVFB 3H6JA 5DUPH 4OCLC 4KV5E 5A3IC 4FFVD 4DKFH 4WGWB 5ICZA 5ESVA 4XWGH 2IQAA 2EXYD 4NQSB 5DJAB 4ELKA 4JM2F 4DCQB 1WIPA 1LILA 1AIFA 3WNOA 3TLRA 1P2CA 1IQWH 1G9MH 3D6GA 5DHVB 1JWSB 4I4WA 1U58B 4JKKA 4OGYL 1Q0YL 1ZT4A 4Y19E 3TYGH 4QNPF 5DVKA 5GGRA 3UBXB 4X9GA 2N4IA 1BX2B 1QFWH 5IM7B 3SJVE 5CJOH 4HFWA 5JOPE 4P3CL 4WI9A 2W0FA 3GDBA 1RIUL 5GIRA 3RA7H 3VH8G 3LB6C 4NQCD 2HLFD 4G5ZH 1UM5H 3VXMB 5EZIL 1AGDB 3OKNB 3CIQA 3HZKB 1BVLB 5JR1H 4O02H 2B5IC 1MRDL 2J4WL 2VE6A 3BP4A 1KLGA 2GY7B 1R3HA 5DQJA 1YY9C 4HZLA 1A21A 1KYOK 4P2CG 1OLLA 1JUFB 1V3JA 3EDEA 4U1GC 4EDXA 4FTVE 4EIZC 3QIWA 1KIPA 1IZKA 4WNQB 2WAHA 1OPGL 5HYJA 5AZEH 1FDLL 2G5RA 3V4PL 1G7PA 2C3GA 2XTJC 1UADC 4YHNB 1N26A 3SHSA 3TPKA 4XBGB 5EO1A 3WIFA 2IQ9L 2H8PA 1CIUA 4JFPB 2P5WE 2AXGA 3IXAB 3HUJA 5TQ2H 2QHRL 3FRUB 2FNBA 1MCJA 1INQA 1OP9A 4ZUTB 4OZGA 4GW4A 5DMYA 5LQBL 3MZTA 4FFWC 4IHOB 4LSRH 3NACH 5DJCA 3MROB 1NUFA 1TZIA 3O0RL 2YMXL 4JRYE 4PG2A 2AVGA 1DQQB 4XRCB 3SDCD 3OKLB 4HKBB 1DSFH 1H3PL 1OAUL 1XIWB 1IM9A 1JV5B 1H3UA 1I9EA 4LVEA 4PJBA 4NJ9H 4F57H 3KAAA 3O3BA 4ONFL 4RX4D 4WFEE 3KDMA 5FYKU 1YEKL 1C5CL 2CDEA 5L9DL 1CLOL 4M1DL 2NLJA 3GNML 4PTUB 1JVKA 1C5DB 4QRRA 3QXDA 1MAMH 1NDGA 3BT2L 4K8RD 4YBLB 5FGBA 1PY4A 3JXAA 3KYMB 5EO9A 4PJ5B 1PX3A 3B6SB 5GGQL 1G7LB 1MJUL 5I1LB 4PGCA 2QQKH 3PL6B 4NP4H 1XZ0B 4PJEA 5I17B 1FAKT 4FFZH 1RU9H 2CDGA 1CFNA 4ODBD 3BYYA 2CLZB 3T0BA 4IOIA 4P5TA 5IVZA 4QOKE 3UTSA 1Q9OB 1S9WB 4MXVE 1NGXA 1N6QL 5F7MC 1OM3L 4R4FH 4KTDL 3O2DA 3BP6B 5B38A 2H26B 3JZ7A 4U1JB 1Z0NA 1EA9C 4WIQA 4I77H 1DBKH 4OZHF 5D6CB 2W91A 3QUXC 4QRTB 1EBAA 3V8CA 1YYMH 1GGUA 3I3DA 1P4IH 3L3GA 3GI9L 2CXKA 3VWJD 5JHDA 2CDFA 5B4MC 3D2UB 5FHAH 5T3ZE 1FH5L 3B2UC 3QNYA 3EBAA 4PJXF 5KN5B 1QBML 4JRXA 1U41A 4PR5B 1FPTL 5D1XD 2R2HB 5T1KB 4HXBH 3K8KA 5AYQA 3UO1L 4NZJA 1PG7X 5BRZA 1XF2A 4TQEL 4F8TA 1J5OL 3GB7A 5CHNB 4O2CB 3FOLB 3GGWA 4UUJB 3CPLB 2NW2A 3SKJL 4BZ1H 5CSGA 3F6LA 3VFRB 4FNLH 3RWHB 5DJYB 4OLYH 4FG6C 5EIIB 2VLRD 4I0KA 5FUOH 4MQ7A 4M8QA 2GKIA 5KSAB 5GRXG 4HXAH 4ZS7H 2JLLA 1A6TA 2QADB 4LBEB 5GGUA 1F58H 3L3DA 3SDDB 4N0UA 1HZHL 1K2DB 3FFCD 1ODAA 3SCMB 1MLBA 1EO8L 2VIRA 4Z7UE 2VR5A 2X4UB 1X5XA 3NVQA 1AHWA 2OCFD 3VRLF 5FYKL 4QRSB 3GMRB 4KAQL 2IFFL 4JGJA 2YZ8A 3S5LG 1H3TA 2QKIA 4LVNC 3MODH 4X4XA 4LKCA 4BSWB 5C0IA 3BH8A 3DUUA 4QTIH 5GGTL 2NY2B 1T0MA 1AC6A 3V4UL 4OV5A 2D7NA 4JY4B 2BRRH 2NXYC 5BVPL 1ZT1A 2APWA 3MLXL 2R0ZL 4P23A 5T5NG 2X40A 4G6FB 1K8DA 5DJ8B 2VDMH 4KPHH 1OSPL 3IDJA 1QRNE 3I50H 4EN3D 5CLWA 4NQDE 4MJIA 4OT1H 3TM6A 3VXSE 4JGMA 1AGEB 2Y5TB 2F74A 2J5LB 2CLRB 2HJKA 4LEXL 3PF2A 3MBEC 4KUZL 2ZZUT 5ENWB 4OQTH 5J3HD 4JFED 2YN5A 3T77A 1QO3B 2DQDL 3D3VE 5BOPA 5E00B 2EIZA 2EC9T 2VZOA 1FSKB 3D69A 1I4FA 3KJ6H 4KVNH 2Z31D 4YZFF 3O6KL 4OZFH 2WWMC 1PKQE 3AS3A 1NAMA 2W65A 1R5IA 4KKLD 1SJEA 2XPGA 4YNYB 2IAMC 4PRID 4RZCB 5EG6C 4NRXA 3ZZ1A 3L3OB 4K3DH 3SJVB 4DN4H 4WI8A 3FO9B 4PTTB 2P8MA 4LLUB 1BBDH 3CK0H 5ELIA 1NFDB 1S9VB 1CDIA 3GSXB 4JFQA 3BW9A 1L0XA 5FKPA 4XP9L 2YPLB 4YDJB 5GSVB 3F58H 3V4VH 1AXIB 1JK8A 1WC7A 5EPMB 2BNQD 4PJ7F 3TVMD 3HMXL 2E9IA 5BQ7B 4FTVB 3RGVD 1BPVA 3JBG7 1XGQA 1YY8B 4NHCH 2IANE 3WFDL 1BQHG 4KI5C 3UEZA 1T04B 3O6FD 1F3DH 1G7HA 4AM0A 5IWLA 2NY0C 2X9XA 4ZYKB 5J6HA 4XP1L 2DWDB 4HIJB 3D9AL 4NQXA 3EO1A 1F02I 3ZE0F 4YHPA 5FA3A 2AERT 3L7EB 2VLKE 2WIIB 3VFNA 5FB8A 5E5MB 3HRZB 4TULH 1U2CA 2B1HL 5T5NF 3DMMD 4JRYB 4LEOB 1Z5LB 3M1BA 1S3KL 5BW7C 4WVRA 3GSOB 5E1AA 5EUOE 3VI4F 2R2CA 4XVJH 2YS4A 3QDMA 43CAA 1H15B 4MQXD 4Y4FA 1XF5A 3MRGB 4ZAKA 3W39B 3IDYC 2ZNXA 3TPUA 1U8QA 1F90L 1IAKB 1KPRA 3QA3B 1N8ZA 2ADGA 3DO7A 2CO6B 3E6HB 3KJ4C 2ESVE 2ITCA 1ZLUH 1HKFA 4X5LA 1F3RB 4X6EA 3TBYB 4APQD 4MMXC 3MV8A 4PRPD 3KPNA 4ODSH 1CR9H 3UYOD 4G42A 5DD0H 3TCLB 2NTSP 3PWUB 2OL3L 3GSWA 4MAYB 3OXRA 3P4MA 2PR4H 2HFFB 4K9EH 3IJSB 1OVZA 1G9NH 1FJ1A 1PLGL 1SYVA 1CXIA 4L4VD 3O8XD 1CFTA 1JHLL 1I8LC 4P2YA 2OTWB 4QOKB 3HA0A 1NBYB 4V2BA 1QSFA 3BMWA 5D2LA 1GHFL 3QCTL 3HE7B 3MRPA 2HWZH 1S7WB 4OLEA 4ZUUA 4IDLA 4F7TA 1XIWC 4MAUH 4PP2B 2VDPL 4UT6L 4KK6C 4MHHG 5ILTH 5HGAB 5ITFB 1RZIB 5DMKA 3WLBB 4OD1L 3KPSA 4JN2A 5ISZD 1NLBL 4DUWA 1QUNA 3TIDA 4D8PB 4KH2A 1I9RH 4XP6L 4XI5D 1PSKL 1CT8B 4R3SA 2R4RH 2Q1EA 1IGIL 1KXTB 4XZUB 1EFQA 1ZWIB 1W0WB 2K3TA 4E41E 4HV8B 4IOSD 5EUKB 3INUL 4HWZA 4DQOH 4N0CD 3LN5A 1BOGB 4TPRL 4O4YH 3DRTB 1KCUL 3EYSH 1BJ8A 3OKMB 3CGTA 3PL6C 1U3ZA 4AYFA 3FMGH 3TF7C 4N5UA 1OTTC 2BC4A 4LVOB 3QYCA 2ICWA 4HGWA 1JZ3A 4Z95H 4LSVL 3OB8A 1DUYB 1LK2A 2ZSVA 5E6IB 3VDAA 3B3IA 4R7NA 1KCSH 3MC0A 3PHOA 2X44D 5IMMB 1QSEA 5C0BA 3UJJH 4Z7UB 35C8H 2AEPL 4FMKA 4NM4H 1A6WL 4J3WA 3DOSA 4BM7A 1GOHA 1T89C 4JLRA 3ARDB 1NBVH 4H1LH 2AK4E 5CEXB 4XBEL 3ZHKA 2YD9A 5BZWB 1U8OA 4KK8C 5IHLB 5JZ7C 3BIAX 1IBGL 1ZLWK 3A6CL 3FOMA 4S1SH 1AXTH 4LAQH 1CGUA 1MAJA 2BJMH 1Q94B 5I1GH 3QXWA 4PBVC 5L88H 3KPPB 5JW5B 2CQVA 3MBXH 4JFYA 4IJ3C 5LXGH 2JCCE 4P5MA 1ZHNB 1FG2B 4NQVA 4HC1L 3D39E 4L8SC 2ATKA 4WO4D 3OSKA 4ZXBD 3ARGA 2KKQA 3UC0L 2J6EH 3NTCL 4RAUA 3VU2A 1YEHH 2VLJE 4JFZH 3VXSB 2YRLA 4WJ5B 5DURD 2C3VA 3BP5A 4KK9C 4DK3A 3WFCH 3DRQB 4XNYL 4MMZC 1IC1A 2QADC 1DQMH 5SX5H 3SDDC 2FWOA 1FORH 3D3VB 1DUZB 3WEXB 2R15A 1A1OA 1GZQA 3SCMC 4G80A 2V7NB 2Q86A 4K2UH 1UEYA 4TUKH 2H32B 4EI5A 5E99H 5HDOA 3AFLA 1CDCA 5C2BL 3T09A 1DCLA 1WEJH 1ZT7B 2GJZA 1NGZA 4TUJA 4MNGA 2G75A 3RI5K 4TOYH 4MQSB 4OGAD 4DKDC 3IDMB 1I1FA 3W2DH 2Z8RA 3MLSL 3LRSA 1AGCA 2B8OT 4MXWL 5GS2D 1H8SA 5MEPA 4XMKH 4FQHA 1LE9A 2D03H 2HT4D 2YXFA 3RY6C 3V7AG 1J1PL 2HLAB 4NO5A 2MQ0A 3LS5L 3U9UA 4K3EL 2ZCLH 4HJJH 2DTSA 4UTAL 1KT2A 4RGOH 4YAQB 1CN4A 3STLA 4L8BA 3WIHL 1S7TB 3GIVA 4XP5H 1MOEA 2VAAA 2YUXA 2XQYK 4YGAB 1BFSA 2J5LC 5AZ2L 3X12A 2I60H 5DJ6A 2JJWA 2PYFB 1E4XI 4XX1E 3V95A 4HS3B 5I76A 3V0WH 2IANB 4GXVH 3CDYA 4QF1A 3Q5OA 4PLNC 3ES6B 4OUUB 5AD0B 4ONHA 3WXVL 5JOEA 3WKML 2ADJB 4OD3L 1GC1C 3CH1A 3H3KA 1KJVA 1CLCA 2CKBL 3ZHLA 1JNJA 5K59F 2HYMA 5LJYH 2D31A 2VLKB 1ZKAA 1QFUH 1KFAH 4D0DA 3HC3L 6FABH 4YLQT 3ZKQD 1QBBA 2HG5B 1MFDH 2R0KL 5DD6B 1RUQH 4ESKA 4JFHE 2YWZA 4R2GB 2Z0BA 5GS0C 1VFBB 3UTTD 1P7QB 4ORZC 2D0HA 3CDCA 5I8OH 3MLPA 1PG7W 4RA3A 5EB9A 4KKLC 4MB4A 4KTYA 1T2XA 4XBPB 4JM4H 5TE4H 3G6AB 4Z0XA 1BIIB 1J9CT 1FZKB 2ZG3A 1T21A 3EOTL 2ESVB 5J0BA 2AJUL 1J1OL 3BDYH 4O58H 3O3AB 5ITBL 4GW5B 5BS0D 1JI2A 3GMOB 3EYOA 3MUY1 4CU6A 1QFHA 4FQLH 3DX9A 4JFFE 3K8LA 5HGDB 3CVHA 2OBGA 1RJYB 2BVEA 3T4YA 4NO0B 4W4OA 1TDQA 1I7UA 4R4BB 1A14H 5DFVD 5SWQB 1RHFA 1VGKA 5ADOL 5KS9B 3LZFL 3PP4H 4MS8D 1BWWA 3SOBL 1IFHH 1C1EL 3RGVC 3Q6GL 3WS6A 4ENEC 2Y06L 4ZNEE 1RAMA 3D0LA 1W8OA 4M1GH 1YQVH 3RTQC 2HP4A 2J8UB 4NNYB 3V6ZB 1UKQA 5E8PA 1EHXA 3O6FC 3WS3A 2HH0L 2W07A 5IT2L 3C5ZA 1U3HD 5C7XL 3O3EB 1QVOA 5DZOA 4NO3A 4PLJC 1P69B 4DTGL 3V79C 3SE8L 5A43C 2EDDA 1J1XH 5BVJB 4E5XA 1DBJH 4Y2DA 2AQ2A 3WHE0 1NMCB 1E4XH 2AXFA 1GZPB 4LGPB 2AEWA 2WIMA 4Y4KB 3C60B 3TFKC 4I8DA 3ZTNL 1CFQB 4LCIH 4DK6A 1FL3A 2NZ9D 3GHBL 4LLMB 4WEMB 3NABL 2Z9TA 4E41B 2E7LA 3D0VA 1UJTA 3LEXA 2DQUL 3GIZL 2W92A 3Q3GA 1ORSA 5TF1H 3GK8L 3WD5L 3FQTA 1I9JH 4YBHA 4EVNB 1CD8A 3LPWA 3SDCA 3ULVD 1T1YA 2JB6A 1RUPH 3RDTB 1CZ8L 3D87B 4GQ9H 5SWZD 2JJTA 3KYNA 3HE7C 3T2QA 4M9OA 4H20H 1VADB 3PWLA 3KPRB 1P5VA 5GS3A 2E27L 1E4WH 5H94B 1MREL 4JZJB 2AK4B 3ME0A 4U3CA 3BPNB 1KB9K 2DD8L 3T4AA 4AIZB 1U3YA 1CGVA 1H9VA 2X70A 4FZEL 4ODUB 5ID1A 3O8XC 4V1DA 1NCCL 4Z7VE 2PYED 4PS4H 3RWFA 5ACLA 3UYPA 3O6ML 3P73A 4AIOA 2QLVB 1NMAL 4WI2A 1S9YA 4PLKD 4GKOA 3VW3L 3LKSA 2R8SH 3FZUC 3ROOB 3D39B 2WM0A 1BP3B 5F3BA 1MCBA 2VLJB 3FO0H 2VZSA 2X4RA 5FM5M 4JHAH 4H88H 4LVOC 1OGAE 1PDKA 4F9PA 5D5ME 1NFDF 3QHZH 4JKPH 1OAZH 2FD6H 1Q9KB 5IGXL 1HILB 4WU7A 2HN7A 3C5SA 3EDJA 3O2DH 1ZGLB 1A7NL 1L7IH 2FYYA 4FXKB 4P0DA 4WV1B 2GCYB 4XVUC 4MNQE 1D9KB 4OCRL 1TJHH 2XTLA 4M7JH 5CWSB 4Q6IA 4NNXB 3PIQB 3MRIB 3QJHB 2G2RA 3BHBB 3ZE2E 3QWRA 3ARDC 1V7ML 2W60A 2Q8BL 2Z8WC 3NCYS 4LSTL 3RNQA 3CDGB 3IJYA 4NJAL 1RIHH 1I3RA 4KROD 2B1AH 2OQJB 3BRGC 5IFAH 2CMRH 1FBIH 5IFJB 1KYOJ 2N7BA 1DLFL 3QI9D 3TWCL 2ED8A 3VXPB 4H1LB 3N85H 1KLFA 5LGHL 2OXHA 4U6VL 3MPCA 3CFJB 3MUZ1 2P8PB 3VFVB 3Q6FB 3WNPA 1XR8B 1I8IA 1OF2B 3L3IB 4WUUB 2B4CC 1XGTA 3OF6D 5I75C 1QPXA 4OGXL 4EDWL 4ERSL 4BSVB 1YJDC 1AFVH 3C8DA 5IJVA 4P5KA 2CK2A 3PV6B 4G8GA 4QY8A 2OXGA 2UVFA 5JXEC 4NKOB 3MJGX 4P57A 3EJJX 1JPSL 2YUWA 5F7WC 4AG4H 3U7AA 2VJXA 1RK0B 2VDLL 2P7TA 4K94H 4UV4L 3WLWD 1XGPB 3GRWL 1TMCB 3TJEH 1KF9B 4LK4A 2QQQA 3TGXA 5IHUL 1T5WB 5T1MA 2EO1A 3HAEA 5I8KL 2AGJL 2VL5A 2MHAB 3P0GB 4QCIB 3DXAD 2MMXA 2AJVH 1Z3GL 1MHPL 3X11B 1JF1A 4K3JH 5J89A 3O4LE 4QRQA 1IC4L 4MXVF 3GJEA 3HZYA 5EWIL 1MJ8H 3EZJB 3AROA 3DVNB 4CADB 3O9WB 4J12A 4WWKB 1P6AB 4RFEA 4CN4A 4GBXB 1X5HA 4UIKL 5C0CA 2Z31A 2KBGA 3WE6A 2V17H 4XPGL 3ZKXB 4YK4B 3CFEB 4M6OL 1P7KA 5I1IL 4K71B 4JFFB 2QQNL 4LCCA 1SEBA 3LPFA 5L2JA 1I1CA 3S37X 1RUML 1NAMH 2V5MA 4DN3H 3QAZC 1F3JA 1BEYH 1F5WA 1MCKA 3HPLA 4LHUB 5TFSL 1U0QA 1JZ5A 1UQSA 3BKCH 1C5BH 4YWGH 3CFIC 1HOCA 1QBAA 3S36H 1A7OL 4XVSH 1OAYL 1JZ4A 1LO2H 1UH3A 4XC3H 2VRAA 2X4OB 4NN5C 1GRWA 1L6XA 1RULL 4HGMA 1ADQH 1VHPA 3VGBA 3U9PH 3CC5A 3QZWB 1JNHA 1UACH 2I24N 3RNKA 2MQ3A 5JQ6L 2ZCHH 2BZDA 3LH2H 3Q1SH 4Z7UF 2P49B 5T3XD 3QDGA 1OOAA 1BBJA 2PW2A 3IXTB 4QRPD 1W8NA 1A7QH 4Z8FH 2DI8A 2EIBA 1QBLL 1OB1B 2OLDA 3RIAK 1IGYA 1IGJA 4X7DC 4F37F 1CK0H 4D9QD 1HDMA 3NCBB 2UY6A 3VXOB 4NQUA 3OL2A 4LPTA 5C0FA 2LU4A 4C56B 4MD4A 4UBDD 1IGFH 3ZKMD 3CFCH 3DMMA 4KK5D 5D7IA 4OZFG 1A4JB 5I15L 1F97A 4HZAA 1G6RA 1UWXK 5F3HB 1IKFH 4GRLD 1S9XB 3LCYA 3V52L 2ADIB 1Y0LA 2AJYL 5F1IB 1U6AH 1ZHKB 4A6YB 4P4RB 3HI5L 3RKDD 3T0AA 3LD8B 4OCSL 4YBQC 1J88A 3TZVD 2YHGA 4WHCA 4OFVA 4YHMH 4FOMA 4X9FA 4L8CB 3OKEB 2QSCL 2RQ8A 2NXZD 4M6MH 5J13B 1RURL 5HHNA 3IYLW 3LN4A 5EU6B 3W11C 1BQSA 3C60C 1OCWH 4IRJB 5B39A 1J0IA 4LRNL 3AXLB 3RUGA 3V0VB 1W72A 2UVEA 4PGEA 3QJFB 1OARH 4XVTL 1FC1A 2PW1A 3KPQB 1JHTB 4FABL 1CICC 1MFAH 2KQMA 3BOVA 3UPRB 4H0IA 4UINL 1CVSC 1D5MB 4F2MB 1OGAB 2GEEA 5DEFB 5D5MB 4HMEA 4ZPTB 3U0TA 2WWKO 4YDLB 3CMOL 1HE7A 5EBMB 2NZ9C 5I1CH 3GI8H 3F5WB 3RDTC 1GGYA 4UQ3B 4G9FD 4LLDA 1A3RL 5E5UB 4MNQB 4RMQA 1G0XA 5ISZA 2LFGA 4I0PB 1NCAL 4OCWL 4QYOA 1FE8H 4IDJH 4NCC1 2QV2A 5HYSB 4KDTA 3UAJC 1YA5A 4G9DB 3VFSA 1KJ2L 4YE4L 1MVUA 1WZ1L 3VCLA 3C08L 1F4YL 3DUSA 3ZSTA 3MLTA 4R97B 3N1QC 5C0DB 5SWSA 2HJFB 4Y1AE 4Q9RL 4JHWH 1T1XB 2IC2A 3LHPL 5DJDA 2P48B 3TIEA 5HHMD 1RJZA 4OF8A 5KVDL 3HCVA 2JJSC 3DUHA 2DLFL 1UZ8B 2BNRE 5FCSH 2NY3D 1A2YA 4AL8H 2AS5M 3BN3B 4CNIA 5ADPL 2APBA 4CVXB 3BRFA 4XPAL 4O2FB 5EUOF 1AH1A 4OGYH 1G7IA 3MRLB 4ZD3L 3BGMA 2NYYD 3TBSA 3O2VH 4PLKC 2FHCA 4HCRL 4WV1C 5JOFB 1ZHLA 3OJDA 1IEBB 2AABH 3G9VA 3SE3A 4GW1A 3P9MB 4LKXB 1EGJL 1RIUH 4P46D 5FOBB 2HTKD 3I84A 4GRMB 3MXVH 3MJ8A 2CIKB 5A2IH 2WUCL 5J11C 1VEOA 3DIFB 3QB7C 3NFSH 1VESA 5EZIH 2CR6A 4LPWA 4QHLA 3V6BR 5I1KL 1YECH 1K9TA 2CJUH 1MRDH 2J4WH 4LSSL 5D7JB 1QEWA 4WO4A 4HH8A 1G1YA 4F58L 4ZXBA 5HGHB 3ILPA 5E1HB 4CMHC 3KPMB 3FJTA 1BD2E 1JMXA 3LVEA 4JO2H 1FZOA 3BZFB 1YQ2A 2GFBB 4ACPA 3JTSB 4F33A 4MA1B 3U0WH 3IFNH 4JFDE 3O4LB 2Y9RT 1KN2L 5INDA 1NKOA 4LLQA 3BISA 3E6FB 4JM2A 3MFFB 3RWEA 1KGCD 1JF6A 5AYUH 2V5TA 4O5LL 4LIQE 1X6NA 1TQBC 4P59L 5FYLH 1IAIM 3H9SA 3RJQB 1WWAX 3S35X 3RPIB 5LQBH 3ZT5A 1YMHB 2Y25A 3D25A 2H2PD 2Q76B 3KWWA 5FV2A 2FSEB 2SEBB 5KVGL 3O0RH 2H9GB 2YMXH 4XCEA 3FQNA 3CCHA 4HLJA 2LABA 3TT1L 2GSGA 1H3PH 3RL1A 8FABA 3S3JA 3U30C 2DTML 3E8UL 4N0RA 3WHXB 2AQ3A 1MWAA 3WL9B 1A9BB 4HIEB 1P5UA 1C5CH 4FQXA 4M1DH 5I74B 3BUTA 3MNVA 5HDLA 1K3IA 3GNMH 4M7KL 4G8FA 4JFOA 1U8NB 3NCEB 4ZMAT 3MRJB 1MCIA 1YUHA 3MNZB 3TO4A 3W0WA 1RJCA 4Q74A 4RAVB 1R3JB 2A9MH 3VXTA 4P9ML 5J1SC 2VSCA 4OF6A 4LQFH 3SQOL 3QCVL 2R69L 5IW1B 5JORB 1Q9LB 3K3QA 4XX1G 4R8WL 3RFZC 1MJUH 3CSBA 5DJ0B 5D71L 4NPYA 3FO1A 8CGTA 1UXSA 4GBXC 4JQVA 1CFVL 2ZJSL 1JJUA 1ND0A 4W6XB 1IL1B 3IRPX 2NY2D 4PY7B 2VLME 3VXQA 1IKNA 1E28A 1Q8MA 5E08L 5EZOH 3K1KC 3ZKXC 2XIDA 2WQRA 1N6QH 2W0PA 3P30H 3P40A 4K71C 2F53A 4KTDH 4DUXA 4TVPD 4C59B 4CRPA 4DKEL 1RIVH 4RAHA 5F7DB 1YYLL 4MA7L 3MV9B 3PUCA 1HHKA 5LBSH 1YDPB 5TH2B 3WXWL 4K3GA 2QTEA 3JV6A 1BFVH 3UTTA 4Z7WE 5M7QA 3QH3A 3DHMA 5CEYA 4I1NB 3SGJA 4YHZH 3UO1H 3CLEL 4MSWB 1ZAGA 1Q0XH 1MPAL 4TQEH 3B2VL 4LCUB 3MRKB 2B2XL 2VXUL 4D0BB 1S5HA 1UYWL 2NNAB 3GMNA 4WEBL 1AJ7L 4R26H 3VGEA 2DQIL 1A3QA 4QT5B 1EFXB 2ZUYA 5IB5B 1JPFA 1N4XL 5I1DA 2LVCA 1JYNA 2ARWA 2CUIA 5GRYA 1HSAA 4JDTL 4J8RB 5JA8B 2Y36L 3E0GA 4PRDA 2ICWJ 5A16B 3RQ3A 1DR9A 4LHUG 2G9HA 4XPHL 2DQTH 1EO8H 4PJ8B 3OKKB 3VH8A 3OQ3B 1S7UB 4P9HC 2GI7A 2AK1L 2RCSL 2WUBL 4HUXA 2ERJB 2YPKB 4S2SA 3GMLA 4ZDHA 3T8XB 1IILE 3J8F7 1JPTH 3KPLB 2IFFH 4NO2A 3L3KB 2YPLD 5D1QC 4XCCL 4OM0L 1U3HA 3HI1A 3P0VH 5GGTH 4Y89A 3FN0L 2MCG1 4HEPG 3GEWB 2D7TH 3RRQA 5CP3A 4PJXA 1HCVA 5DRNB 3OHXB 3O6LH 5BVPH 3QO1B 1IARB 2DQJH 4PJCB 1P84J 4R7DB 5B21A 3LD8C 3AREB 4RGNE 2V7HA 5EZJB 1W0VB 2OJZL 2PTTA 4MWFB 1C08A 1QPPA 4M4PA 1CE6A 3CD4A 2XWBB 3BZ4B 1MCDA 1OSPH 5J13C 2GQHA 4FXGA 3UTPD 2QQLL 4Y1AB 4LEXH 4GRLC 1JYVA 4HUWA 4HFUL 2PKDA 3LRGA 3ZMRA 5SV4A 3B4NA 5C0JA 4NDMB 4U7SA 3ZKND 3DURA 4OIIH 2FX9H 5AG8A 4NT6B 1PZ5A 4YHOL 3RWIA 4CMMA 4LRIA 5C09D 2A6JA 1WZLA 1JE6A 3V6FA 5GJTH 2R1WA 2NXZC 3RZCB 4FQCH 5TPWL 3QXVA 1TCMA 4JPIB 4U2ZA 3EO9L 4YDLC 3ULUD 2A74A 3DBXB 4ZFOL 4UNVA 3LIZL 1FO0L 1N64L 2NX5D 3E2HB 4FFYL 5B8CB 3GSNL 5JDJA 3GUTB 5FYKE 4C83A 4I0PC 4PJ9B 1SVCP 1XCTB 2PYEA 2HRLA 3WO3B 1E6JL 3ARVA 5FGCE 1ZANH 1FZMB 3OR6B 5CGYD 3MXWH 4KMQA 5DJ2B 3SKOB 1M7IA 4MAYD 3QQ9D 2HKHH 1T1ZA 2PO6C 5JLZA 3HR5A 3PWVB 1G7JB 5IK3B 2PXYD 3N06B 3HMXH 4UU9A 2R29H 3KR3H 5LCVL 1JCKA 3DO3A 4LOUD 3HLAB 1I1YA 2F8OA 4TUOA 1BD2B 5ICYA 1FZJB 4GXUN 5EU5B 3MREB 4JFDB 5FEBA 4UQ2A 2R23B 3MUGB 4JAMA 1KPVA 1OAKL 3CFKB 1HI6B 1K4DB 2KDGA 1OD7A 2A77L 3QWOB 2EECA 3D9AH 4HBCL 5IOPB 4YFLI 5HDBE 4U1SA 1I1AA 5KANI 4HSQA 3RVVD 4Y8AA 3WCYA 5C6WH 4X4YA 4ODXA 5DEGA 4X5XA 5DK2B 5C6PB 5HYSG 2DQEH 1BM3H 1NC4D 2EDOA 3U82B 5CILL 5DRWB 3U1SL 5JW4R 4Z78B 5EOTA 1HXYA 2B1HH 4TSCH 1S3KH 4XCFL 5IP4A 5GJSL 2XRAH 5GHWL 3UTZA 1RZ8A 2DM2A 5D6DC 1MCWM 2EYSB 5FO9B 4GJTB 2NYYC 5D7JC 2MSPA 5HYQB 1GC1L 3LQAL 5DGRA 1FYHB 3GSRB 4PJ7A 1KTLB 5JHLH 2UZYB 2VABB 3VWKB 3QUXA 4N9GB 4GRWH 5E6ID 3B9KB 3L9RB 5I1HL 3LDBC 2F54E 2HTKC 1FYTE 1AGFB 3LS4H 4I13B 1ETZA 2D9QB 4O9HL 4BQ9A 1QD0A 4EJ1C 3OF6A 4CVUA 4CW1B 4UTBL 1RMFH 4UIMB 5F1NA 3FB8A 3DI3B 2OL3H 1IJ9A 4GFTB 4MLSA 1EJ6A 3ULSB 1VSCA 2O5ZL 4P2RE 3S5LA 3PWJB 1GGTA 1UM4H 3QDHA 1ZA3A 4L3ED 2VZ3A 4PJHE 1PLGH 1AO7D 4WY7L 3AS1A 2KL6A 3BQUC 4JZNA 3DX7B 1MHCB 4ZTOH 3IFOB 5HHXL 1GHFH 4Z7VF 4JREB 1MCNA 2Y72A 2FJGB 4Z76B 3V7MA 2J7LA 1HHGB 2VDPH 5E70A 1CIDA 3R4DA 1DQJA 4O51A 5CJBA 4S1DD 1LEIB 2VDRL 1CXEA 4Y5YA 3KXFA 3L3HA 4HIHB 4QWWD 5FCUL 2BSRB 5J56B 4U1NB 4Z7WB 4N0FA 3WMSA 1DEDA 4XP6H 5I74C 1DP0A 3QCUL 4D9LH 1NL0L 3S9DB 1SBSL 4O2EB 1NGWB 5E4EB 1K3ZA 1EEZB 2FX7H 3GJFA 5D5MF 1A3LL 3VFTA 4AENA 3MRQB 4RGMB 3S36X 3INUH 3E3QE 5ACMA 3B9DA 3CUPB 2VC2L 1YEGL 4TPRH 2IH1B 3G6JB 2BVUA 1A7RL 1KCUH 2BXZA 1QP1A 5FA4B 3VA6A 4QHKI 3GBLA 1LP9E 4KQ3H 3WN5C 3MLZL 4F7EA 4K3HA 1KIQA 1GGIL 4WUKH 2VITB 3C2SA 1IMHC 1TNMA 2OJEA 1N5AB 4JFXA 2ADFH 2C4XA 4WGVB 1M6OA 4EQ2A 2BP3A 2A6KB 1XAUA 4RFNB 1K85A 2AEPH 1DQLL 1TJIL 3VGFA 5C07E 1A6WH 3G6DL 5HHQA 1UWXH 1KCRL 2IADB 3AC0A 1KB5A 1BLNA 3VG0H 1U92A 1V3MA 4X7SL 4HS6A 3CLFL 3G08B 1V5JA 3S4SB 3Q0HA 2Q8AL 1RZ7H 4HJGB 2IGFH 4JDZB 4M00A 3BMVA 1DBAL 5GSRB 4OZIE 4X6FB 5IMOA 3T0EE 3PWPA 3QPQD 1EX0A 3GJFK 4RGNB 2PCPA 5HPMB 5DK0A 3BRDA 4X6BB 4HC1H 1OP5K 1FL6A 3IDGB 1IAOA 1ZHBB 2A9NH 3VJ6A 3QO0A 4NZUL 3UC0H 4YXKL 4D2NA 2OR7A 2JIXD 3MYJB 3VFGH 1KXVC 4AZ8A 2FGWL 4M62L 4WHYH 1A1MB 5H35B 3TC9A 3HN3A 4D3CH 4KY1H 2YD6A 4MDIA 4X4MA 4WHDA 5T3ZL 2CLVB 5KTEL 5D2NB 1NJ9A 2IH3A 2E7BA 3PJSB 5KG9B 4PJ8C 4JJ5B 5IB3B 4YUEL 4R2GD 5JO5A 4XWOD 3SGEH 32C2B 4QKXB 1FVCA 5JPMB 1SY6A 1OT2A 2BOBB 4XNMB 4BZ2H 1I7TA 1DVFA 3QUYD 5ESQB 1G6RH 1J8HB 4QGTA 4RA0C 1XR9B 5ANMB 4KKCC 3GSUB 1L7TL 3MLSH 4JY6B 1Z9OA 3JWOC 1LK3L 4LASH 1N0XL 1KG0B 4NQSA 5DJAA 4DCQA 2XY1A 1U8LB 3C09B 4KHXH 3AREC 3AY4C 5FGCB 1C7SA 2ZNWA 4N9OB 3H3BC 5DHVA 3X3GL 1JWSA 1U58A 4MXQD 3S6CA 1F00I 1MF2H 4UTAH 3UBXA 4MYWB 2O5YL 3HRPA 3GHEH 4I9WD 1BX2A 4X7TB 4KQ4L 3WIHH 4Y16B 1NANI 5IM7A 4PJGE 1A8JH 1XFPA 3HG1E 1UA6L 1NSNH 2E9BA 1W72H 5BW7A 3VXRE 3BPCB 4PY8I 4RWHA 5JW4Q 3BJLA 1LNUB 3VXMA 3TA3D 1AGDA 5KJRL 3OKNA 2IWGA 3HZKA 2ZG1A 3P9LB 1BVLA 3ARFB 4PRHE 3L1OL 7FABL 5TE6H 4I2XE 3EOAB 4JZOB 4BUGA 4EUPB 3IDNB 3RZCC 1JUFA 4L4TE 3WKMH 2RJMA 4OD3H 4WNQA 3C6LB 2YRPA 1W2KT 3FT3B 2DAVA 4E42B 3QEQE 1AXSB 3QHFL 4YHNA 3VFUB 2ZG2A 5LWYL 3E2HC 3MRCB 4H0HB 4JFPA 3IXAA 3X3FH 1H3XA 1QACA 1AD0B 3LEVL 2B4CL 3FRUA 4OFPA 2R0KH 4ZUTA 1NBZB 1YJDL 3UX9B 2LTQB 5GQBA 4XNUL 4DZBB 2Y07H 5D7KD 3HFMH 3SO3B 3ULUC 4IHOA 4WU5B 3MROA 5IHZB 2IPTL 5DMIL 2DBLL 3AUVA 1DQQA 1NAKL 4XRCA 2MQCA 5EBWB 4HUVB 2OSLB 3OKLA 4OM1H 4HKBA 3KLHC 4X9IA 1XIWA 1ED3B 2AJUH 3VMOA 1J1OH 1JV5A 5E9DD 4B50A 1T2JA 1ONQB 2VMFA 5ITBH 2VZUA 2OP4L 2F54B 2VUOA 1C12B 5CGYC 2WZPD 1YZZA 3KPRD 4IRSB 3MNWB 3UYRL 4IBLT 1UB5B 3BDXA 4Y4HB 4PTUA 1DN2A 1I9IL 1CLYH 1C5DA 2NY4D 5ADOH 2XKNB 4PJHB 4YQXH 1C1EH 3KYMA 3Q6GH 1EAJA 4PJ5A 1YNKL 3B6SA 4LOUC 1G7LA 4KI1A 4WWID 3BUYB 4HKJB 4KZDH 5I1LA 3PL6A 4YEEA 1XZ0A 3C9NB 1A6VL 1JTPA 5I17A 4GXUM 4DW2H 1KCVL 2NY7H 4IIQB 1AI1H 2CLZA 1UFUA 5C7XH 3KPTA 1NANH 2FH6A 1YNLL 2RFXB 4DTGH 4FN0A 2R1YB 1Q9OA 1S9WA 5JMOC 2B0SL 1QA9B 3RVVC 5DD1L 1RZGB 2EEDA 2GT9B 4YDVB 4ORGB 2D2OA 3BP6A 2H26A 4CN6A 4U1JA 1OWWA 3QNXB 1GGBH 3QEUB 4J3XA 1OGTB 1WWWX 5D6CA 3VWKC 3ZTNH 2V6HA 4QRTA 3GHBH 3S34L 3B9KC 3MRFB 1LO5B 1NUNB 5IBTL 1D9KD 1X5YA 2CRYA 4EI6B 2DQUH 3GIZH 4PD4J 5FM5O 3D2UA 5LVEA 1E27B 3K46A 5DTFB 5KN5A 1CL7L 1GOGA 3WD5H 5F97E 4PR5A 3HNTL 5J1TC 2R2HA 3QIUD 4PJCF 3EDFA 5T1KA 3DJ9A 1RUAH 3W82A 5CEZE 3QUKB 4ZTPL 1RQ5A 3JWDL 3RL2B 3AS2A 5CHNA 4O2CA 1T5XB 3FOLA 4HF5L 3HUJE 4UUJA 3CPLA 4HMDA 3VFRA 4H0GA 4H8WL 5DJYA 3RWHA 1UXWB 2OL3B 4OZGE 5EIIA 4JREC 3UROR 2NQCA 5E8NB 2FCBA 5C07B 2E27H 1CF8H 5KSAA 5KOVC 3U4BL 1PVHA 1MWAH 3ZLQC 1J12A 5D7LB 4LBEA 2DD8H 1UJ3B 2GY5A 3SDDA 4ODHH 5GS1C 5HDQL 1K2DA 3SCMA 2OYPA 3TYFB 3BKJL 1NCCH 4GLRI 2X4UA 3IRZA 5EULV 5C0RH 1QLFB 4HAGA 4WUUD 4QRSA 2I25N 5E4EC 1NMAH 3I02B 4OZIB 4X8XA 2VQUA 3GMRA 3VFWB 1BF8A 2CPCA 4UT9L 3B83A 2ZUQC 4H26B 1A0QH 3VW3H 3FQUB 5IBLD 1EHNA 43C9B 2X2YA 3U6RB 4OIAA 2DM7A 4JY4A 3UJTL 4R90L 3Q2CA 4FQ1L 1IAIH 1OSZB 4OFYD 3RY6A 2EIDA 2HT2C 2NY5L 4LSQL 3DX6B 3TCXA 2FZ3B 5DS8B 5IGXH 1DQDH 1X6LA 5L2KD 1Y6NR 1D5ZB 4JG0H 3KLAB 5DJ8A 1A7NH 5C0AE 2P24B 2K7PA 2YBRB 1KEML 2FHFA 4RFNC 4OCRH 4XC1H 2DMBA 1AGEA 4LFHG 1DE4B 2Y5TA 3LN9A 2CLRA 3NOIA 1VFOA 2V2XB 5DD5L 3HR6A 4NFDA 1V7MH 5ENWA 3OGOE 1QO3A 2APVA 4LSTH 4NM8L 5E00A 3RVXD 4NBYB 4NJAH 4F15C 1JGUL 2DQHH 2WBJD 1GVIA 1NLDH 3PGCB 5JHDE 1DLFH 3TWCH 4PJFB 1ZTXL 5AAWA 5B3NA 3CDFA 4OLWH 3K4ZA 1NEZB 3LV3B 3MR9B 1ACYH 5LGHH 1WFTA 4YNYA 1ZA6B 4XNXL 1ZSDB 4RZCA 1TZHB 2ATPB 3L3OA 3H9ZA 5TE7L 3LMJH 3BGFB 4KJQD 4LHUD 3IU4L 3O45B 3SJVA 3KYOB 3FO9A 4XMPL 4PTTA 4YEFA 1Z9MA 5JXAL 4LLUA 5CZKA 1A64A 1SM3H 2XQBL 1NFDA 3VXRB 3VXUD 5F21B 4JCLA 1F11B 1MCOL 1S9VA 3ARBC 2P46B 3ULVL 2LE9A 3MCG1 3GSXA 1CS6A 4OGXH 5HD8D 4PB9L 4ERSH 3QPQC 2YPLA 4YDJA 3H8NA 3PXJA 4P2OC 4PRHB 5GSVA 2CRIA 4I2XB 2JE8A 1JNNL 2EKJA 4K7PL 5EPMA 5GZND 3VD5A 5DR5H 3U0PB 3QIBB 3TN0D 3QEGL 5BQ7A 4FTVA 1I85C 5JIKA 4MDJB 3S7GA 4ZFGL 4WFHE 1YY8A 4GLRH 5ESAB 1OL0A 4P4KD 3QEQB 2VDLH 3IAPA 2R0LH 1T04A 5JW4M 4P2QB 4NRZB 5GRUH 5MI0B 5CZXD 1NKRA 4ZYKA 3PQYD 3T3PF 5I8KH 3ILQC 2DWDA 4HIJA 4OV6F 3MLRL 1MHPH 3QPXL 5GGSB 3U46B 3L7EA 5E2VH 2WIIA 1IC4H 5E5MA 5EWIH 4Y16C 5KW9L 4NUGL 3HRZA 3MJ6A 2DL9A 4M3JA 3DV6B 2I5YL 4JRYA 4LEOA 1Z5LA 5AEAA 1NCDL 1U8JB 3GBMH 1KV3A 3GSOA 3BPOC 4UIKH 4JR9H 2MWCA 2RGSA 2V2TB 1H15A 4XPGH 3FQXB 1ZVYA 2R0WH 3MRGA 3DTXB 1B90A 4M6OH 2FL5B 4I48B 5J06A 4MXQC 4Z7WF 5DQ9B 1IAKA 3QA3A 3R06B 3OAUL 3E6HA 2LQRA 4JO4L 1BREA 1JGVH 4WW2B 3HHRB 3TBYA 3G04B 2AEQL 4HS8L 1WTGT 2EIEA 3BZEB 5C08E 3G6JF 3TCLA 5EU6D 3PWUA 3I3BA 2XZQH 1OAYH 2YR3A 3QUZB 4OLZL 4NHUB 5TQ0L 3CXDH 4MAYA 3T2PA 1KN4L 5BZDB 1OHQA 4IRJD 4U1KB 1KTDB 2HFFA 3BVNB 5TDPB 4JKMA 3IJSA 1H5BB 3I6LD 1Q38A 2XKSA 4M7LT 4JO1H 1KEGL 2CKBB 1B0GB 5EOQL 4RMVA 4OF0A 2JELL 2YOCA 3IDXL 3QIWD 2OTWA 4J6RL 4QOKA 5T1DL 4UV7L 4XNZB 2OR8A 5DWUL 3SO3C 1NBYA 3NZ8B 4E9LA 5HYJD 4IRZL 1WWBX 3HE7A 3NFNB 5IROC 2DB8A 5IB4B 5CBAB 3VDBA 1S7WA 2VZTA 4HWEL 2MKLC 4PP2A 5F88B 4ELME 1QBLH 4KRMB 4FXLA 4C54A 5HGAA 1DQTA 4D9RD 1YNTB 5ITFA 1RZIA 3WLBA 2QL1A 1FLRL 4YIQB 4DZ8B 4NQEB 3MV01 3W9EB 1BFTA 3EYFB 1KIPB 4D8PA 3PDOB 3MOAH 3OAYH 4CVZB 1CT8A 5DMGD 1UB6B 4Y4HC 5DYOB 4JHBA 1WBYB 1IVLA 4XZUA 1ZWIA 1W0WA 4HV8A 5EUKA 3ECBB 5DDHB 2DRUA 2ZUTA 1BOGA 3DRTA 1IM9D 4BA8A 1P4LB 4DVBB 2YSSB 4OQ1A 3V52H 3OKMA 1MCPL 3OXSB 1HHHA 2DYPB 5I71B 4HIXL 4GW4B 3T2NL 5MENE 4FQPA 4IIQC 2DL2A 3FQRB 2XN9E 1NCUA 3HI5H 2BHUA 2FO4B 1HH6B 1DUYA 4QRRD 5GPRA 5E6IA 2QSCH 1M7DB 2HKFL 2VZVA 2AJSH 2YKLL 3MRNB 3MLUL 4LCWE 5IMMA 1B88A 1BZ7B 1HQRB 3QQ3B 4Z7UA 4PLOB 4YHKH 1CDJA 3QDME 5I19L 4KUCD 5I1AB 2HFGH 4HD9A 4MJ4A 1KENL 2VDOL 5EOCH 1TVDA 3ARDA 5DO2C 5CEXA 5KVEL 4DFIA 4LRNH 1IC7L 2YD5A 3E3QC 3O2WH 4GQPH 5BZWA 4XB7A 3K1DA 4XVTH 5E03A 4YHYB 3RIFF 4P5TD 2Z91B 3UTSD 3HE6B 4HAFA 4UINH 1Q94A 5DRZB 1PG7L 1NCBH 1IGCH 3KPPA 5JW5A 5M94B 4Y5VB 4LLYB 3QEHB 1ZHNA 1FG2A 5DVMA 3IAGC 1YMME 5GRWA 1JIBA 1WITA 2M26A 5C0AB 5CBEB 2GJ6E 1HH9B 1JWUB 1MJJB 3VXSA 4WJ5A 3WFBL 3NCMA 3OZ9L 4Z7NF 1NCAH 4ZODA 4OCWH 2X4PB 4X5WB 1WBXB 4JRXD 3DRQA 3ZKSD 3L7FA 1QSFE 2P1YA 3EHBD 2YD3A 3QIUC 1A02N 1AR1C 5BRZD 3D3VA 1DUZA 2IPKB 3WEXA 3TO2B 1WZ1H 2V7NA 5H37H 2VH5L 1LE5B 5KSUB 2VDNL 2Z93B 2H32A 2C4FU 1EERB 3MX0A 3DETC 3R0MA 4IS6B 5JXEA 2EZ0C 1ZT7A 3T0EC 3TH2T 3SDAB 1T03L 4ZOAA 2WP3O 5IIEB 4GKZB 4MX7B 5DRXB 3IDMA 2V2WB 4XCYB 4F37K 4FQ2L 3STBA 3BD5A 5FDWB 4K23H 2FB4H 4WDIB 2HLAA 5MHSE 3U4AA 4XPAH 4ISVB 1QSZA 3NCJH 4BQ8A 1KCLA 4YAQA 4HCRH 1PBYA 1S7TA 4KGLA 4X7FC 5ETUB 4GS7B 5ALBL 1NCWL 5IBLC 1QR1B 3JUYA 4G6ML 3JVGA 2X05A 2F5AL 2PYFA 1CQYA 5L0QB 5E95B 3DVIA 1I8KB 2ZUWA 4HS3A 1DL7L 2EH7L 1AHWB 2IANA 5I1KH 2XYCA 4NN7B 4OI7A 1CGSL 3K81A 4HDIB 4LSSH 2R4SL 3TNMB 1FIEA 3ES6A 4OUUA 5DHXB 3MCLH 5AD0A 1JZ7A 4F58H 2ADJA 4MJID 4OQTA 2H6PB 4M7LH 4PJHF 5HI3C 2PNDA 3DSFH 1WIUA 1PFCA 2E6JA 2VLKA 3STZB 3TH4T 1KN2H 5IW6B 1VB9A 3NIDE 4KRPB 2NY6B 1S7QA 1WT5C 2HG5A 2GK2A 4X6DB 5DD6A 1TPXB 4KMTH 2GTZB 4QO1A 1MCEA 1GXEA 1OTSD 1VFBA 4P59H 1P7QA 3ZE1E 2H41A 3NGBB 2WQ8A 5KVGH 4XBPA 3G6AA 4A2MA 1BIIA 1FZKA 3FT2B 5C0GB 1U2HA 3QIBC 1BVKB 2AV1B 4QTHB 3C8HA 3TT1H 5FV1L 3K2MC 2ESVA 4MA8H 5D1ZC 3O3AA 4GW5A 2DTMH 3QXTA 3VGAB 5K33A 3GMOA 5C08B 2XY2A 1IEAB 1J05B 1NEZG 5HGDA 4J4PC 5MI0C 4OZHB 1RJYA 5F71A 2O5XL 1IAMA 5HHOB 4JPKL 4NO0A 1MNUL 3P0YL 4MCZB 5DHVH 4R4BA 5IF0B 5SWQA 4M7KH 4UZGA 2DQFB 5KS9A 5GZNC 2CXGA 4BKLB 1CXFA 3F7PC 5JDSB 5EOCJ 3QQNA 4R8WH 2J8UA 1QSVA 4NNYA 3V6ZA 5L7XL 5D71H 3LKPB 1GIGL 5FXCH 3RJDA 4U1MA 3O3EA 3OV6A 5E7BA 2C3XA 5HXMA 4ELMB 4WHYG 4M43H 5DQDL 2NMSA 1MI5B 5BVJA 1FFOB 3LKQB 3DYMA 5FK9B 3U7WL 4AEEA 4JQIL 4D0CB 4DKEH 1V8HA 1GZPA 4Y4KA 1YYLH 3C60A 3RVUC 4WW2C 3H7BB 4OZIF 4MA7H 1XGUB 3MV7B 1CFQA 3EUUA 4LLMA 1NUDA 3MZGB 4E41A 5HVFB 4YX2L 4PP1D 1UVQB 3MO1B 3WXWH 2DQGH 3EFFB 5C6TL 4ALAH 4OZ4B 3QDJB 4ZAKD 1YEEL 3I75B 1H5BC 1CXKA 2EH8L 3CLEH 4OF5A 5MENB 4EVNA 2XTJB 3ZYZA 1MPAH 2XN9B 1P9MA 1QLRB 5BV7C 5J9PB 5MEOB 4XNZC 3MV8D 1T2QH 4N5ED 5EORL 3RY4A 2FJHB 3RDTA 4WEBH 1ZGLM 1GGCL 3T1FB 1AJ7H 4YFLF 4EOWL 1YEFL 2DQIH 4LCWB 1N4XH 2VAJA 2EE2A 1VADA 3KPRA 3GBNL 3VRIB 5H94A 2EE9A 1XF5B 5B39G 4JZJA 1U93B 2AI0H 2AK4A 5DUML 2Y36H 3EO0B 4AIZA 2CUMA 3EYUL 2X7LB 3NZHL 4ODUA 1CBVL 4PJ9D 4XPHH 3P2TA 4B5EA 5DXWA 4QHUB 1DBML 2WUBH 2AK1H 1ORQB 1INEL 5F1KC 1PEWA 4PJFF 4PJAB 3BP7B 2AAVA 1I3GL 4RNRB 1MJ7H 4NZTL 1YMMB 3ROOA 4JB9L 3D39A 1LD9B 2YK1L 5JUEH 5I71C 5IG7B 3KPSD 4PJGF 2VLJA 1Y18B 2GJ6B 2W38A 3EGSB 4IM8A 3LEYH 4GO6B 3VMNA 5ICXB 4G7VH 4X7CC 4TTGA 4CGTA 4AIXA 5IV2A 4NQCE 1ZLUK 3ARRA 2BVOB 1Q9KA 2DLTA 1HILA 4PG2C 1ZGLA 3RWJB 2HMIC 4FXKA 4WV1A 2GCYA 4N8VB 2EICA 4JPVL 1D9KA 2A6IB 3GSQB 3KS0H 5CWSA 4NNXA 3PIQA 3MRIA 3QJHA 3BHBA 4JJHA 5I0DA 4U1HB 4HFUH 3I2CH 5I30L 3NMEA 2DI9A 4XHJD 2HTLD 3G9AB 4K7FA 4WCYL 4R0LB 3CDGA 1GH7A 3H9YA 5CS7A 5K9OB 1AD9B 4S1QL 3BJ91 4TVPL 3HE6C 4P3DB 3OKOB 4L1DA 2OQJA 5FGBC 4LLWB 5IFJA 1QSED 5C0BD 1HINH 1AE6L 1QYGL 3VXPA 4RMTA 4H1LA 5FYJH 1ES0B 2Y6SC 3GKWL 1ZV5A 4LPXA 1ZXQA 3LIZH 3WJJC 1N0LA 1U91B 1N64H 3DYPA 3CFJA 4FFYH 2P8PA 3VFVA 3GSNH 3Q6FA 4RFOH 1XR8A 3FFDB 4XTRC 1OF2A 3L3IA 4OTXL 4WUUA 2A0LC 2L0DA 1Z6JT 3TT3H 4GAGH 4BSVA 1X5FA 4XAWH 4HJ0D 3SBWA 3PV6A 4HUMB 2IF7A 4ODVH 4KJWD 1NMBL 2W59A 3ARGD 4UDUB 4WW2F 2ZOLB 4Z5RB 2FRGP 4NKOA 2GW5A 5LCVH 1TLKA 1TJGL 1KJ3L 2NZIA 3BAEL 5CGTA 4KVCL 1KJ2B 4NC1E 1RK0A 3EKCA 5BMFL 4XCNB 1O5DT 4KZEH 3P9WB 2DDQL 1XGPA 1P6FA 1JFQL 4NKIL 1T5WA 2D7OA 5FYLD 3GMPB 4HBCH 2MHAA 4LU5H 1PD6A 4QCIA 1O7SA 2AEIT 3QFJB 4EI5D 4LFHD 2JB5L 4LARL 3X11A 2R9HC 5DZLA 3RWCB 2C3WA 1B4JL 3DVNA 5CILH 3U1SH 4CADA 2XNAB 3O9WA 3D85B 1LHZA 4OLXH 3OAZK 4WWKA 4XCFH 4GBXA 5DFWH 5GJSH 2L4OA 1VENA 4FQIH 5IMKB 1G7MB 3FHAA 1EAPB 1AHWC 3CFEA 4NN7C 2X9YA 1JTOA 1EXUB 1T4KB 2ARJQ 4JFFA 3BKMH 1MFBL 5HVHC 2XOTA 1U8PB 1MQKL 3MBEB 1GC1H 2EE3A 5DUPL 4LLAA 1WISA 3T0VA 5C8JB 3IFLH 4LHUA 4DKFL 4EXPX 1N2RB 2DQCL 5SX5K 3HUJF 4O9HH 4ZNEA 3QUML 2CGRH 5GISH 2Q3ZA 2NY6C 2VLRE 1SMAA 4OZGF 2OZ4L 4P23C 2O5ZH 3IF1B 5GS0H 2X4OA 3RBSA 1TPXC 1V7NL 1FVDB 2IAMB 4NOFA 2GK0B 3T08A 1DDHB 1QFWL 3ULUL 3QZWA 4YHIB 4WY7H 1BOYA 2ORBL 3T65B 5GZOD 3FFCE 4PGJA 5F1OB 2FGZA 3VFMB 4U1LB 5HHXH 2OTUB 1I7RB 4G5ZL 4X6CB 5E4IA 1UM5L 1KLUB 3IXTA 4QXUH 1BJ1H 2VXTL 1A5FL 1OAQH 4HX1B 4ZPVB 1OB1A 2H2SC 1TZGH 5JR1L 4O02L 3VRJB 1AP2B 2N56A 3VGAC 4NOBA 4B7IA 1A6AB 4FMFA 4Q6YA 5F1SA 4AEFA 1CD1B 3VDCA 5FCUH 1BQLL 4UT7L 3VXNB 2WINB 3DV4B 4LIQL 3VXOA 1RFDH 3QCUH 1NL0H 3IU3B 2LU3A 4C56A 3GMQB 3SDXE 1TVBB 3L95B 2IBBA 1A4JA 1YEGH 2E7HA 1U8HB 1A7RH 2NY0B 4G6AD 5JPNB 5F3HA 4DKAA 4WI7A 1S9XA 2ADIA 4Y88A 4S1RL 3MLZH 2D7QA 1I7ZB 4JN1H 5F1IA 4EKXA 1GGIH 4TTDD 1ZHKA 4A6YA 5HBBA 4P4RA 2ZSWB 4JFEE 3J7HA 3MRDB 4LSRL 1SMOA 3NACL 5JTWA 1FNHA 3MSPA 4L8CA 1A1NB 3OKEA 2Z8VC 4J7RA 3LOWA 3MRMB 5EU6A 2AJZB 1DQLH 3PGFL 4J3UA 4NJ9L 2E7MA 3G6DH 4F57L 4IRJA 4N90D 2XT1B 3AXLA 3IDYB 1KCRH 2B20A 3V0VA 1S5IH 3O4OC 3QRFM 2IEPA 3C5ZD 3QJFA 4PRIE 3MJ9A 4CL7A 4NNPH 3KPQA 3KJ4B 1JHTA 1NCNA 4X8JB 4WFFD 3UPRA 3HKFA 1MAML 4Z6AT 4WFGD 1J7VR 1D5MA 4Y2DD 1MSPA 4F2MA 2WK2A 1OGAA 4M48H 3HC4H 4NQCB 4TSAL 5D5MA 5DEFA 5KZCD 4ZPTA 4QHMB 5CINH 2E3VA 1WBZB 5EBMA 3F5WA 1MIML 4QXTB 4JY5L 4UQ3A 4M1CC 1RU9L 4NZUH 2A83B 4YXKH 4MNQA 4ZNCD 2BNQE 1FNEB 5F9DC 4I0PA 2FGWH 4M62H 4Y4FC 4KJPC 4ZAKC 5HYSA 4G9DA 5T3ZH 3ISWA 4HKZB 3BI9X 2VDKL 3AAZB 5DFTA 4N5EC 5C0DA 1CYGA 4YUEH 2XZCH 4WTZG 5CJXC 1YYML 5ERWB 2HJFA 1P4IL 5BO1H 2RIKA 4L1HA 4POZD 2CK0H 5T5FH 4HUUB 1EEUA 1X7QB 3WUWB 5HY9B 1T1XA 4BQBA 1L7TH 1GOFA 4HXBL 1U3JA 4OCXL 1LK3H 1N0XH 1F4AA 1URLA 1UZ8A 1HHJB 5D7IE 4GKNB 5E2UL 3SDCB 4X6DF 4V1DD 3IS0X 4CVXA 4O2FA 1VPOH 4BZ1L 3X3GH 3GSVB 4IRSD 3MRLA 3MLYH 3KYKH 3NFPB 4MVBD 1VACB 4BQ6A 5I8CB 3AB0C 5JOFA 3ARTA 1IEBA 1F4XH 3BDBA 4NZDA 5FGRA 4HKXB 4HXAL 4HLZH 3P9MA 1UA6H 4LKXA 1H0DB 5FOBA 1T0PB 4GRMA 2CIKA 4XB8A 4PRPE 3DIFA 3WNKA 5D6DA 4R0LC 3VE0B 5KJRH 1MIEL 4OJFH 2BY1A 4WHTB 2OMNA 3TJHD 4IOFC 5C2UB 7FABH 5D7JA 5INCB 5E8DH 5IVXE 1A4KB 3RZWA 4J2XA 3RUGE 4W4NA 5HGHA 1MLCB 3M8OH 3MODL 4NIKB 4XXCA 2Y23A 1FVEB 3KPMA 5IVOA 4L4VE 4QTIL 1EUTA 4HBQA 1CL7I 3BN9D 3BZFA 2GFBA 3QWRD 3JTSA 1SJHB 2JJUA 4GKSB 3O4LA 4XHJC 5LWYH 1Q1JL 5J1AB 3E6FA 3CU1A 2VKWA 3QFDB 3MFFA 4IJ3B 3RVTC 1G84A 3V5HB 4N8VG 1YJDH 4R4ND 3ZYOA 2VDML 4KPHL 4L8SB 4ELMF 2FH8A 3VWJB 5DSCB 4ZFOB 3RPIA 4OT1L 5ISZE 2H32H 5SV3A 1YMHA 1FO0B 2Q76A 5I8EB 5D96B 2FSEA 3CX2A 2SEBA 1R24B 2V9TA 3GSNB 2H9GA 4U6HB 4KXZI 5DMIH 3VG9C 4F9LA 5I73C 3PE9A 1L9NA 5D1XB 2HA1A 1GAFH 3HZMB 1NDMA 3D18B 3LKNB 1EMTH 5IKCB 4Z77B 4I0CC 2OP4H 1I1RA 1U36A 3MOQA 4YR6B 3WHXA 4MGXA 4KVNL 1DLHB 3WL9A 3OBAA 1A9BA 4HIEA 1KXQE 2BFVH 1QFOA 3OPZL 3UYRH 2VLRB 4DGYH 4HJ0C 1U8NA 5D7LD 1MAKA 3WIIL 4G8GD 3MRJA 5C9KA 4KJWC 2K9UA 3MNZA 4U05A 1D5XB 4NQTA 3V5DB 4ZS6D 4RAVA 1R3JA 3O41B 2P5EB 1XF4B 3FFCB 4DN4L 5IW1A 5JORA 1Q9LA 2EYRB 3CK0L 5DJ0A 5D70L 1NBQA 1T3FB 2EDNA 2W9LA 1IL1A 2OK0L 1U8KB 1YNLH 15C8L 4PY7A 2VISB 3CAFA 3F58L 3V4VL 4Q0XL 4U33A 1Y6MR 4P99A 1DN0B 2B0SH 5DD1H 3MLVL 1A7BA 3S37L 2H3NB 5F7DA 2B7DT 3MV9A 4JPWL 4PJAF 4XPTH 1MY5A 4NHCL 3EJZC 3S34H 4LDEB 4EQ3A 3A6OA 1YDPA 5F7HA 3SDXB 3X13B 4BSJA 3RWDB 4CVWA 1EZVX 3S3PA 4RQQB 5TH2A 5C0CD 5F9AC 4FP8L 2MNUA 3H3PL 4EN3B 5LGJB 2DLEA 1OY3B 3HNTH 4KRNA 4MSWA 1FAIH 1YPZE 4Y19B 1WTLA 3P77B 4JFEB 4BFEA 4LCUA 3MRKA 4D0BA 4HF5H 5CUSL 2NNAA 3MUJA 2NR6C 1X4ZA 2W1NA 2UYLB 4QT5A 3QULB 1EFXA 5FF6B 5IB5A 2GAZB 3NA9L 3CXHK