1HH9B

Anti-p24 (hiv-1) fab fragment cb41 complexed with a peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
QDQLQQSGAELVRPGASVKLSCKALGYIFTDYEIHWVKQTPVHGLEWIGGIHPGSSGTAYNQKFKGKATLTADKSSTTAFMELSSLTSEDSAVYYCTRKDYWGQGTLVTVSAAKTTAPSVYPLVPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIEPRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/peptide
molecule keywords IGG2A KAPPA ANTIBODY CB41 (LIGHT CHAIN)
publication title Evolutionary Transition Pathways for Changing Peptide Ligand Specificity and Structure
pubmed doi rcsb
total genus 45
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2000-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hh9B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hh9B02
2NW2B 5HI5C 1YEGH 2BC4A 3WNKA 4X4XA 1JWMA 3QUMB 1HWGB 4JKWA 3SO3B 1DN0A 4BK5A 4I0CC 1CDCA 3EFDH 2X4OA 3HI5H 1LE9B 2WANA 2YC1A 2VOTA 1J1PL 3EJYC 4MVBD 1GGUA 4TSAH 4HUKB 4PY8I 3MOBL 5D7KD 4HPYL 4LCUB 3IXAA 4MA7L 1KPUA 1KTRL 3GMRB 4ZS7H 4JG1L 1QPPA 4RGNE 1O5DT 2W9EL 2OXGA 1BVZA 4CVUA 4PPTA 1WZLA 4ESKA 3M45A 1ZV5A 3FT4A 2E8YA 4N8VA 4HSQA 4V1DE 3EGSA 1E27B 1A0QH 1XF4B 3RGHA 1FSKB 1KN4H 2X70A 5EUKA 2ESVB 3LS5L 3L95B 4I4WA 4P5MB 4QXTA 5FGCE 3FO2B 4KHXH 1FVEA 3O45A 2R4SH 2R2CA 5I2IB 1Q9KA 1YC8A 4MA3B 4PJFB 2GFBB 4NJ9L 2NY0D 5DLML 5C7XL 4OM0L 1GH7A 1U8JA 1T89C 1S7RA 3GNML 5ADPL 1ERNA 4HGWA 2OR9H 5C70A 4WTXA 4CNIA 3MRGB 1F2XK 5TF0A 4BZ2L 4K7PH 4LLYB 2OJZH 3IDGB 3PWPD 3P0YH 1WBXA 2EO1A 4Y4KC 2VXUH 3MA7B 3PWPA 4JFDD 4DQOH 4FTVB 5DURB 3BVNA 4JFDA 4IS6B 1U58A 6FABL 1G1CA 3QEQE 4WHYG 1C5DA 5FDYA 4GH7B 1EO8L 3AAZA 5DJZB 4U33A 3FOLA 2XWJA 5AZ2H 1F8TH 2V7NA 5ERWA 5AWNL 4F9PC 3BPNC 1RZ7L 4WNQB 4JDVB 1DBKH 1U92B 1C7SA 4K55A 1TCRA 2P8LA 4ONFL 1MCSA 4GT7A 4HKBB 1U8QB 4JFXA 4G6JH 4NZRL 3MRPB 1RQ5A 2DMKA 4NHUB 3IDXH 4ETQB 1T1WB 5D1ZB 3QZWA 4CMHB 2PR4L 4Y4FD 5B3JE 3JV4B 3A6CH 3G6AA 2ZNXA 4Y4FA 2WMPA 4LPWA 4N8CL 2A9ML 1RUKL 1OQXA 3QDME 3ARED 2X1PA 4KJWD 1H15B 4JFFB 5T3XL 5C0JA 3PHOA 1D5BA 1N2RA 5IKCB 4BSWA 1MJ7L 4M8QB 4AENB 3QXVA 3QH3A 2GUOB 5E5UB 5IB2A 4F3FB 2JB5L 3GMNB 5EIIB 5IFJB 3WCYA 4MJIE 3U9UA 3UJJL 4U6XB 1N3NB 4WW2A 4XCYA 4P46D 1HNFA 5HGDB 4P46A 5KVEH 5D72L 5FUCC 5FHAH 4DKFH 5EORH 4HUWA 1CZ8L 3WIHA 1UB5B 3BKML 1BREA 3N1MC 3QIWC 4FQ1H 4H5SA 2H8PA 2JJWA 4TN9A 1U8PB 4MNQB 3TPUB 3SKOA 5JDSB 5MEQB 4U1GB 4QTIL 3THMH 3VXSD 1CLCA 3HI6L 3EO1B 5F7WC 2PYFA 3ARRA 3VH8G 2X4RA 5F7DA 4OQ1A 1WVZA 3VFWA 5TH2A 1NL0L 1H5BA 1Q0XL 3ARGC 3HPJB 1QRNE 1FIEA 4MCYB 4NKDB 1PX3A 1DQJA 2JIXB 3DO7A 4HS3A 3CZJA 4RZCA 5JA8B 5JNYB 4HIHB 2Q8AL 3UTTE 2Z91A 2AAVA 5I15L 2FH8A 2CKNA 1OQOA 4U7KA 3MRQB 1BBDL 2NY5C 1PEWA 4YR6B 3GUTB 5ALBL 3BP4A 5E6IC 3SY0B 2VXQL 3H9ZA 3OQ3B 4C83B 1D9KD 3VGHA 5DJ0B 1D9KA 3NCFB 1LHZA 2EKJA 5F1IB 5D93C 4ODUA 1YNLL 4WFHD 4JO1L 5I17B 1X5HA 5T33H 1MAKA 3EZJB 3RPIB 2EE6A 4FQCL 5LGHH 1F90L 5KS9E 2BHYA 4GKNB 5F71A 3AY4A 3CDGB 4FQXB 2A1WL 2A38A 3KPOB 5C09B 3MA9L 4ZDHB 3TGXA 3CFEA 4QT5A 4IDLA 2AXFA 3JWOL 5KSAB 3IJSB 4R8WL 3IS0X 2BOCB 3TZVC 3QA3B 3BQUD 3L5IA 3BQUA 3B9AA 2V9RA 2CUIA 3HLAB 1NGWB 4EN3C 4O58L 1HHJA 2W0PA 1JK8A 2B39A 4LNVA 4YDLB 1I75A 4PGJA 3UPRA 4UIKH 2AW2A 3GZKA 5JMOC 4X7SL 2NY1B 1WCQA 5DHVA 3PWVB 2DIJA 1YYML 1XGQB 5DEFA 4BQ8A 2HKHH 2EZ0D 1KIPB 1H0DA 2EH7H 1AD0B 2HJKB 2XKUA 1MEXL 2DQTH 3BZ4A 5I1IL 5GRXG 4TYUA 5GZOC 3KWWB 3NZ8A 5CZXC 5D7JB 2FJFB 2CO6B 1IFHL 3LEXA 1GHFH 1ZHBB 3QHZH 4ELME 4NC0B 4I8DA 4XXCC 2K7PA 1K8DB 3O11B 3SE4A 2X9XA 4P23C 4WTZA 1R5IA 5EN2B 1OGAB 5D2LF 1Z0NA 1YEKH 3DUSB 3J7HA 4C56D 4PG2C 4C56A 4P57A 1ORQA 1G9EA 2DYPA 4EKXA 1TZIA 1B0GB 3DX8B 3MV8A 2ZOLB 1QP1A 1ZA3A 1MCPL 4YHLH 1BIIA 1QSEE 1SM3H 5EOQL 2JCCA 2Q86A 3V4PH 3ZDYF 4N0YH 3DYOA 3E6FA 4YHML 1F42A 2P24B 4AIZA 2AKRB 3KPRB 1X5JA 1U3YA 3I3BA 3GSQA 4R96A 2CGRH 3ROOB 5EBLA 3WD5L 3T2QA 1W8OA 2EXYC 3Q6GL 3U30C 1QRKA 1S7TB 2YD9A 3MYJA 1BECA 3TH4T 5DYOA 1BFTA 3L3IB 3VXPB 4PR5B 1QA9B 5D8JH 4QKXB 5LCVL 5MEPA 1U8HA 2E6JA 4PRDA 4ZD3H 3QCVH 1S7QA 1BQSA 3X3FL 1QKZL 4L8CB 2MOVA 3VFNA 5KSBB 4JFEB 2D31A 3MLSL 3RVTC 4ZODA 5DRWB 4D8PA 15C8H 3U6RB 1G0YR 3TM6A 4DTGL 3QQ4A 2H3NA 3GBNL 3GK8H 1HYRC 3SCMD 1GAFL 1IEBB 1HHKB 3B8YA 3H3KA 4TUJB 3S35X 1J8HE 1HSAB 3HB3D 3SCMA 2DQGH 1K8IB 4YHYB 3N9GH 3NAAL 2WIIB 3VRIB 1DBML 4QCIB 5HDOA 3WO4B 2GSGA 5D6DA 3CNKA 4K9EL 3VFUA 5F93C 5TGBB 2HJFB 1TMCB 2LTQB 3OF6D 1B4JH 3MGOB 3OF6A 5E03A 5D7SH 2PXYC 3VFRA 2ZG3A 4UTAH 5ICXA 1QFUH 4BELD 3NGBB 1F4WL 4HW6A 2R0KL 4WO4B 2G60L 2K7QA 5JXEC 5FECA 5CGYD 4PP2B 2VABB 1QBBA 1A7OH 3HRZB 4Y19E 1FZJB 3OPZH 4OV5B 1EIBA 1JHLL 5GQBA 1IKFL 2FR4A 3F6IA 2ID5A 1Q38A 4HX1A 4MXVE 2H2SD 3QO1A 3C9NB 1CQKA 4RA0C 2A9NH 4ENED 2QADC 3SBWA 4LEOB 1C5CH 4ERSH 4R4NC 3H7LA 3VXMB 5CWSA 3MLUL 2B2XL 3T1FB 5JXAH 4YPGA 3OL2A 5GS2D 1RJZB 5B21A 2CLVB 5FM5M 1U6AL 1ZXQA 4P4RA 1EAPA 1I7ZA 2X4PB 3X3GH 2VL5A 1FN4B 5F6IB 1AC0A 1SHMA 3TO4D 3TO4A 5HJ3B 5EG6C 2VQTA 4UU9B 4WIQA 2H6PB 4NQDE 3QDJD 3CVHA 4L29A 4PRNA 4RMSA 5MI0B 5F6HJ 1NDGA 3ECBA 5D71L 5I30H 2Z93B 1YUHB 4PJAA 3B83A 2CRYA 4N0RA 2YR3A 3SE8L 2ILLA 2D0FA 4N0FB 1QFPA 4OCYH 4U3HA 1U2CA 3EYUL 4M3JA 2V7HA 1WJ3A 5KOMC 3QG6B 1CFTB 4LVHB 1QFOA 3BKJH 2N7BA 4OGAD 3VRLF 1MWAA 4KXZH 4JAMB 1ETZA 1GC1L 2VZ3A 3DV4B 2AABH 1PSKL 1QR4A 2HMIC 4L8DB 4G7YL 4X6FA 4TSCL 2AV7A 1KBGL 4WW2F 3I3EA 4JANB 4GLRI 2D7NA 1U3JA 2XZQH 1KC5L 1SJHB 5GGTL 4D0BB 2B1HH 3CLEH 2IGFH 4XP1H 1UJTA 3VW3H 3QUML 3ZKXC 1AE6L 5E70A 1T83A 2BY3A 1SY6L 5IMLB 2P43B 2ERJC 3MFGB 3PJSB 3CMGA 4HKXA 2B1AH 4Y4HC 3V0WH 5GS2H 1M6OB 1QNZL 4X6DA 4F15B 4JY6B 3AGVA 3SPVA 2QSCH 2E3VA 3BT2H 4Y1AB 3S34H 5HPMA 3QCTH 3L95A 4NBZB 3FO2A 43C9A 1KEMH 3FB8A 1T1XB 1FL5A 1MCLA 4UQ3B 3I9GH 1O0VA 3EYSH 4NCC1 4QHUA 5DEZA 5K9OB 1JYWA 1J05B 3PHQA 4Z5RB 5IROC 2BNRB 3VFSB 1A7QH 3WNPA 4PLJC 3BZEB 4OZGA 1A6PA 3MNWA 3MRFB 4DZ8A 3AS0A 1SMOA 5L0QB 1WT5A 3WFDL 3QUXB 4FTVA 5C07D 5BVPH 3CH8A 3RZCC 5C07A 2EH8L 3WFEL 4U6HA 1MWAH 3T2PA 1DP0A 3TWCL 4PJBA 5IT2L 5B39B 3G6DL 1H3TA 4NNPH 4MD4B 4QTHB 1E4XL 4YC2C 1U42A 2XPGA 1G6RA 2AERT 3FT2A 4H20H 4D0DB 2FL5B 2OI9C 4NPYB 4XP6H 3LN5A 4W6XB 1EXUB 1FFOB 4GRWH 4PRPD 1IEAA 2HVKB 4BFEA 5HD8C 4OLXL 1OF2A 2DWEB 3ARYA 1J1XH 2O5YL 2DBLL 2PYEB 1ZVSB 5J3HD 5FM4A 4RQQB 3BD5A 3LAFA 3K2UL 4Z78A 3QEHB 4L5FL 5ACLA 3MACH 5GSRA 2UWEE 3RY4A 1WC7B 3AXLB 3H9SB 4U3XA 2XA8H 3RVUD 3ZDXE 1E6JH 1NCAL 3U7YL 4PJXA 5JMRA 3W9EB 3ISWA 4FQ2H 2V2XA 1FDLH 1JCKA 4GG6A 3W0WD 1Q9LB 5L2KE 4LHUG 3W0WA 4WWKD 4LKCB 2XTJC 4N0CC 3KYNB 5F7EH 3FFCE 4JFZH 3MRDB 2ZCKH 5JW4Q 4G42B 2B0SH 4HMCA 1FPTH 4FABL 4MQXD 1CD1A 5IVZA 3S36X 5I1HH 5BMFL 3BYYA 1WFOA 2GK2A 1HH6B 3TA3C 2NY4B 4LEXL 5ISZE 3MJ9L 4NO3B 1ZVYA 3KJ4B 4WI5A 2ZUVA 4TULL 2ADJA 3ZMRA 4LU5L 3IDJA 1FFRA 3ARDC 4GKOA 3GSVB 2GI7A 3MREA 5D1QD 2Q3AA 5D1QA 4R9HA 2A6JB 1LEKA 5MEQA 5F7YC 2FATL 3PGFL 3FT3A 1PYWB 5EU6D 4MB4A 5J57B 1A9EA 5E8DL 5EU6A 3SKJH 2Z31C 2XKSA 2JCCF 2CDEB 4MCYA 3ZE1F 4NKDA 2Z8WC 1FJ1B 5E1AA 2HTKD 4LLQA 4X9IA 5E6IB 2Y6SC 3RWHA 4QXWA 4YE4H 3BW9A 3V52L 1IGCH 4LMQE 4Y2DC 2VERN 2BSSA 3CVIL 4NO5A 3MRHA 3L3KB 5DGQA 1N6QL 1IM3A 1KXQE 5KZCB 1P2CB 1SJEB 5F1IA 2F54D 1T2QH 3ULUD 2F54A 3RDTC 1FFPA 3JTSB 1EGJH 1AH1A 4PY8J 4JHAL 5EUOE 4AL8L 1S3KH 4GKNA 5F96L 4BQCA 2PNDA 4HK3N 2YKLH 5DHYB 4ZDHA 4OF0A 5D1XD 5DO2C 4M1CC 5D1XA 3DECA 2W60B 3QSKB 1P9MA 2BERA 2VIRA 1QBMH 4EN3B 4I3RH 1KB5A 3L3JA 3NFPB 3O2VH 5EU3A 1EVUA 4JO3H 2ZG1A 3M8OH 2Q76B 3TLRA 1LO4L 4NWTH 2VL4A 2VITB 2R8SL 4RAUB 2WBJB 3RTQD 1B2WH 4YAQB 3RTQA 2NY1D 2BSTA 2P5WD 3BN3B 4PLKD 1OCWH 4OZHB 2P5WA 3I02A 4GBXD 3PWVA 4GBXA 1KIQB 5ELIA 3RI5F 4LFHD 1KIPA 4YUEL 2MJWA 4HS6B 1QO3B 4BQ6A 1Z6JT 4ORZC 1FORL 4L3CA 2V5TA 2BXZA 4PJ7E 1B0WA 1JZ5A 2CKBB 3I50L 1ZHBA 2X4SA 2ADIA 3GMMB 4I2XA 2R56H 3IDMB 3CDFA 1F3JB 1GCFA 3G5VB 4Z7VE 2NY7H 3IDUA 1ORSB 4V2BA 2Q3ZA 1YECL 2FH6A 4AIXA 1AJ7L 2YK1H 4KI5D 1RZKH 3ILQC 1WBYB 3HUJA 3PNWA 4HCRL 2HT4D 3QP3A 3U4BH 4PRBA 5DJ6B 4EOWL 2V5MA 1KG0B 3V79C 1Z9LA 3PL6C 4ZFOB 2Q6WB 2OSLA 4NFDA 2J8UE 2VE6A 1JNJA 1PFCA 4L9LC 1GVIA 2EE9A 3CSYA 5SWQB 4KUZH 4RMWA 3O3EB 1YJDC 2NLJA 2ZOKA 1WAAA 1KB5H 1IM9B 1B6UA 2VR4A 4KAQH 2P24A 2VDPL 4PJHE 4OCWL 1RFDH 1NGQH 4YXHL 2NX5E 4IIQC 1BAFH 4PJEE 4KROC 3QXWA 3HNSH 1MIEL 2FYYB 1T4KB 1YEDA 5HY9A 5IB5B 4PJGA 3RVWD 1FNGA 1KLUB 4Y89A 5DUMH 3VFGL 5A2JH 4OFPA 5ID1B 5HHOE 1NCWH 4U6TA 5C0AD 2ZUQB 3ZKSD 4XCEB 5C0AA 1VERA 3QRFM 1R5WB 4RGMC 1GGIL 2BP3A 5I76B 1DFBL 5LG1A 3MJ7A 3MLPA 4G6KL 3W11D 4UV4H 2VWEC 4JDZA 1DUZB 3BIKB 3CDCA 4YLQT 1MCWW 1PLGL 1DQQA 4ODSH 3OXRA 4UIMB 3ARBC 5GSVB 1N59A 1AFVL 3E8UH 4U3CA 1RZJL 4GRWF 3SDDC 3U6RA 4TPRL 2YPKA 4XGZA 3I6LD 2PO6C 4GUPA 1UM5L 2J12B 2PTTA 5CEZD 3KVQA 1BOYA 1YQVH 4DVBB 1VEOA 2QLVB 3VRIA 2J1KA 4LQFH 1FFNB 2DQHL 5AD0B 3LS4L 3C60D 3S37H 4PJ5E 3C60A 3S97C 1YEFL 1XCQA 5CGTA 3DXAE 4ONGL 5EZJB 1MY7A 3KLDA 5AUMA 4CVWA 1Q72H 4MCZA 3FN9A 1RHFA 3KYAA 3DGCR 1PJ9A 4LSQH 1T2JA 4CW1B 5HI4D 3UTSE 2CJUL 3PWJA 4WO4A 1L9NA 1UQSA 4JFOA 4PP2A 1IAIL 1MHHB 3WLBA 3FN0H 3IETB 5TJWK 5GRWA 4XHJD 4D94A 4FQIL 1FZJA 2B20A 4GS7C 2KH2B 3GHEL 2EYRB 3IFOA 1MFEL 4OFYD 4OFYA 4DGVH 4YDKL 1HOCA 2N1KA 4WJ5A 4XVJH 4LARL 1TQBB 1AY1H 4X8XA 1N7ML 3EYVB 5DRZA 5IEKB 5F8RC 1JGUH 3VXMD 4FQHB 4LEOA 4PJ9C 5IG7B 4BQ9A 3VXMA 1AHWA 2GSIA 1VFBB 4EZMA 1YDPB 1H8OA 1Z3GL 5D6CB 4HWZB 3BEWB 1HKLH 1LEGA 2FSEA 1X4YA 3ZTNH 4MX7A 3D0VA 1FN4A 3SGEH 2VH5L 3T1WA 3DURA 5EH1A 1C5BH 2FHCA 2VDLH 4MAUH 1QFWH 4L3ED 3RGVD 5CEZH 5MEND 4RGNC 2P8PA 4L3EA 3RGVA 5MENA 4HJ0C 5IBTL 2MFNA 1JI1A 1EJOL 2I5YH 2UV3A 2Y4SA 5HI5D 5LQBH 3IAGC 2BY0A 3TYFA 3IU4H 4XPAH 3D3VB 4U6VH 4JLRB 4PJXF 5EOTB 3KLSA 5C0BD 3KLHC 4EDXB 5C0BA 3HS0B 4HIEB 1KJ2A 5IQ7L 4IM8A 1P7KA 2JLLA 1OWRM 2ORBH 1IEHA 4U6YA 1CDBA 2OTPA 4JM2B 3TN0B 4WENB 4Z7UE 5SWZE 3EJYD 1KELL 4PTTB 5L9DH 1CFTA 1JF1A 1PQZB 3MXWH 3DV4A 3MRJA 1HH9B 1J5OH 2GITA 3QWOB 2I07A 5EOCL 5MEOA 5INDB 4MA8H 3F6LA 4O2EA 3LOWA 5L7XL 3S9DB 3PWUA 5KG9A 1NCBL 5C0NC 4NIKB 1S7VB 1U8MA 4Z95L 5TPWH 1GGCH 5DF0A 5J6GB 4HDIB 5FA4B 4LCCC 2F53D 3E2HB 2F53A 2EDHA 1A6VH 4NQEE 3QRGH 1CLZH 3R0NA 4JY5H 3TFKC 1FO0A 1VENA 1Z5LB 1XGUA 5HHME 2APBA 4QOKB 5GJTH 3IKCB 3KPTA 4U0QB 1X3DA 2YD1A 4LF3A 1NGZB 5EFIA 4S1QL 3D1MC 1Y6MR 1T89A 3QO0A 4OBSA 5TDPB 2EO9A 3SGKC 3ARQA 4M61A 1BFOB 2ADGB 3O3UN 4Q9BA 1MRFL 1GPOL 3W9DA 3QI9C 1BHGA 1J05A 4Y7MA 4K7FA 5C8JB 3MODH 4Y4KD 5DRXB 1BM3L 2YWZA 4Y4KA 2CIKA 3D69B 1KJ2H 5I1GH 1CT8A 2RJMA 7FABL 1ONQA 4EUPG 4OQTL 4RSVA 5E8OA 4H1LA 5IBLC 4YC2B 2YPVL 2M1KA 4GO6B 5FM5O 2OI9B 4XZUA 4JGMA 4F9PA 5GXBB 2R39A 2IADB 4QRQB 2DQDL 3LSOA 1TNMA 2W38A 4X99A 1S9WA 1GJIA 2NNAA 1AD9A 3QJHA 2MQ3A 1UXWB 4OZIE 4BK4A 1H9VA 2MCPL 2HRPH 1FGVL 4QRPE 1YEGL 5C0DB 1ZVSA 1ZLSL 3OKKB 4NKQB 1PGRB 4X9GA 1AO7E 4KKCC 4X6CF 5I1KL 5EBMA 4UUJA 4BUHA 1G7HB 3TJEL 1D5IL 4ZFZB 5JUEH 2H2PC 3HZMB 5DK3A 2IPKA 3HI5L 4XB8A 1LVEA 4JN1H 5DD5L 4O2FA 2BVPB 1T5XB 4OZFB 4XAWL 4N9OB 5T3XE 4YHPA 3U4EA 1U3HB 4BM7A 1FCCA 1HDMB 5C0EB 4EI6B 3UBXA 1I4FB 4ZS7L 4LSPH 3KYNA 4GXUN 3KNBA 4PJCF 3EYFB 4IRSD 1A64A 4FHBD 3IVKA 1G7PA 4S2SA 3P0VH 2C1PB 2L0DA 3B9DA 3T0DA 4KKLC 5DR5H 4LHUD 5KJRL 4LHUA 5HYSB 2IAMB 3WFBH 4BSVA 3MV01 4NQXB 1KN4L 3QFDA 1NFDE 2X1XR 3QIWD 4X6BA 1QQDB 4RFEA 5BXFB 3QIWA 4GRMA 4KHXL 3HUJF 4YQXL 1R3KA 1KPVB 3G6JA 4PGDA 4G8FA 3BWAB 1CICB 2BRRL 3BPOB 5B22A 1RK0A 3ARGD 3ARGA 3BUYB 1OVZA 2DICA 4GRWB 3Q0HA 3WUZA 1FIGH 1NEZG 5T5FH 5M95B 4X4YB 2VXUL 3DX9A 1WAAF 2FJGA 4JRWA 2CDEA 3MSPA 4ZUVB 3SQOL 3HFMH 5E6ID 4P4KC 3VDBA 1HN1A 3T65B 5E6IA 2DIBA 4UOW1 3CXDH 3N1QC 4WU5A 4PJGF 2EDQA 5I1EH 3C5ZC 1XGTB 1UWXK 3PQYE 4NSKA 4UT9H 1I7TA 1P1ZB 1CLOH 1DBKL 4P5KA 1P69B 1FHGA 5INCB 1CVSC 1P2CA 4U1HB 4BKLB 5J4MA 4ODTL 1JGEB 3TESA 1MHPH 2VLLA 3LDBB 4GKSA 2GK0A 3IDXL 2WWMC 2NY5L 3RWGB 3W81A 2FHBA 4QHNB 2YZ8A 1F2QA 3FQNA 5TF1L 3S5LB 5C1MB 3S88L 1G7IA 2YUXA 3TZVD 2VKWA 5DHYA 1VFOA 3TZVA 3R4DA 3CZFA 3QIBC 3V95A 1U41A 3UP1A 4EN3D 3OKMA 3FFDA 4EN3A 1RZ8A 1QVOB 1MRCL 2G5BA 3CMOH 5JW5A 1MCQA 3DTXB 4R3SA 5HDQL 4AEEA 5E8NB 1C08B 4HZAA 2X4UB 1TNNA 5T1MB 3GM8A 2YUVA 3JV6A 1DQDL 3BXNB 5FHAL 4DKFL 5EORL 2RFXB 5GZOD 5CZXD 3MBXL 4ZQKA 2NR6C 5DEGB 2NY6B 4GAGH 3ARXA 5D7IE 3D25A 3PWNA 1UCBL 2FD6H 2AEWA 3THML 4ODXB 1WF5A 4GMTL 4XXCA 3LEYH 5TE4L 2CKBA 3MUGB 2J8OA 4PS4H 4P23D 3GMMA 3HNTH 4U1NA 4PRIE 3T4AA 4NDMB 4NKIL 4P23A 2NMSA 3QWQB 2X40A 4PG2A 3TIDB 5IF0A 5JOPD 1PD6A 1L0QA 5DK0A 4ZUUA 1NGYB 4ZFOA 2Q6WA 3E6HB 3X17A 3B9EA 1JMZA 3SJVD 1JPTH 2CKBL 4GW4B 4DW2H 4Q9QH 3SJVA 2DJ4A 2H1PL 1QYGL 4IIQB 2BNUA 2DQIL 3TBWA 2EXYD 4S10A 3N1GC 1R3JB 5T33L 3ELAT 3VGGA 1DUYB 3ABZA 4HBCL 4QGYA 1RHHA 4ZFOL 1T4KA 1OT2A 3GB7B 2XWTB 2EDLA 4G43B 4NRYB 3U2SA 5DQJB 5C6TH 1AKJD 2VB5A 4ZXBB 3ZLQC 3RVTD 2XG4A 3AS2A 1AKJA 5DS8A 1IC5L 2APVA 2I9TA 2AS5M 3ESVF 1EHLH 1CIDA 1OAXH 1M1SA 5DJYB 1BLNA 2PO6B 2Z8VC 1Q94A 1EV2E 4P3WA 2GCYA 4JVUA 2AEQL 1U8IA 4WCYH 4FQQA 2JB6B 3FQUB 1V3KA 1FC1A 2NYYC 3BPCA 5F89B 3G04B 1DDHA 3VD4A 1KIUA 1NMBH 5IVXF 4OKVB 2HKHL 1KCLA 2FLRT 4LP4A 2PXYD 4O51A 3SDXE 2PXYA 5AD0A 3T0EE 3VFMA 1MFCL 2GEEA 2R1WA 1FGNH 1X7QB 5EBGA 1I9JH 5JHDB 1HE7A 5JXED 2CLZA 3CFJB 5JXEA 4OJFH 3RNKA 5CJOH 3MRKB 2LAAA 3P0GB 4PJDA 5AYUL 4X6CB 3EDDA 1UWGH 1OARH 3MXVL 3WDJA 5JPMB 2GT9A 2DLHA 4U1MA 4HUNB 3KPQA 4JREB 5FOBB 1JV5A 4HMEA 3IDIB 3BRDA 2ZSWB 1OAUH 4KK6C 1YEKL 5DJXB 5C92A 2W0LA 4GXVL 5DRNB 5TE7L 4YHOL 5A16A 1U95A 3HAEG 4LVEA 2QADD 3HHRB 2F58H 4R4ND 5DD3H 4GSDL 2UY6A 4QY8B 3IXTA 1YMMD 3CIQA 1NCDL 4J3UA 4QHMB 1YMMA 5DSCB 1JHTB 4LDLB 4TQEH 3V4PL 4PJCB 4LKXB 2AEIT 3KPSB 4YEFA 4URTB 1VFBA 3PGCB 1DQLL 1E6OL 1H8NA 2DI8A 3BEWA 2ZJSH 2CQVA 3JUYA 3O6FB 3QDGB 1KV3A 5EDXA 1WV7T 1RULH 1QSFE 2HTLC 4JFYB 4HG4J 1JZ2A 2AXGA 2OL3A 5D8JL 4R7DA 2QHRL 3KYOB 1A21A 1I85C 3JUZA 1SYVA 4FXKA 5B8CB 3F7YB 3RX8A 3C08H 3UC0L 5FGCB 3QXDB 2D7QA 4EDXA 1AQKH 1MCKA 5HYJE 1CL7H 3GSWB 25C8H 2V2TB 4KK8C 2DI9A 3MRMB 2HMID 4X4ME 3GK8L 1DBAH 1S9VB 2XXMB 2DQGL 3EIFA 3FO1A 2J5LC 3EDKA 2FB4H 3N9GL 1D5MB 3FZUC 5E2UL 1ZT7B 4NWUH 3MC0A 2O93L 1JRHH 1NMAL 3MRNA 4LBEA 4NO2B 3V4VL 3RWDA 4NBXB 2B5IC 1X5LA 1ZVHA 1WICA 3QHFH 5C0CD 2EDFA 2YSSA 5C0CA 1AGDA 4Y4HD 2VC2H 1XF3B 1BD2D 1XGRA 4OD3H 4Y4HA 1I1YB 4IHOA 1JGLH 4QGTA 1BD2A 4HDIA 3CFIC 3G6JF 4G9DB 1QFUL 5GRVK 1EA9C 3L7EB 4ZUWA 4F57H 5JW3H 5EWIH 5IB3B 1Z5LA 5JW4R 4DKEH 3SKNB 1G0XA 2YHGA 1IGFL 2YBRA 4QRRE 3T0WA 3OPZL 1KCVH 3BPLB 2ZCHH 4TNWK 4G6FD 5J7CC 3U46A 1WZ1H 2OL3H 2P45B 1CBVL 5F9OL 1TZHB 3GIZH 4K3JH 3BDYH 2CDFB 1T1ZA 5B38G 2P5EE 5IROA 2XXCB 4PLJD 1I8IB 2NXZB 1WWCA 4MDJA 3REVA 8FABB 3L5WB 4N1HB 4J3XA 3QDMB 4UT6H 3OKOB 3QUZB 3DVIA 5JXAL 2IQAB 4WU7A 3RZCD 3H7BB 5FEBA 5GISH 3RZCA 1EMTH 4X7EC 1CQYA 2X4NA 3T3PE 3QUKB 4JFQA 2VLMD 3ZKNC 2DQEL 3V8CA 2VR9A 5I6XB 5BZDB 2IALA 2VSDA 3WL9B 4K3DL 4MJIB 4F7MA 4Y5VC 1VFAB 2IADA 4JVPA 3P77B 5HD8D 5FYJE 3RX5A 1QSZA 2YD7A 5AEAA 4YH6A 5FO8A 3EW3B 5MHSD 1QBLH 4EUPA 1V7NH 1JZ4A 1FH5L 3ROLB 5ICYA 5DT1H 5HGAB 4U2ZA 1MELA 4WV1C 1EEZA 2WINA 3CFBB 4M48H 4MNGE 2MPAH 3BD3A 1H3PL 5K9JL 3D6GA 3IJHB 3BKJL 4CGTA 1T7ZA 3NZHH 3T8XA 3WEXB 1HEZB 2HFFA 1G9ML 3I75B 3QPXL 1NUDA 2XTJD 4OZFA 5E00A 4N0CD 1A22B 1QRNB 3DIFB 3HTLX 4AT6A 2O5ZH 1WITA 5CAYB 3RQ3A 3PV6A 2HT3C 3VXRE 5C0EA 4HUVA 5C0FB 1A6UL 1RMFH 2B1HL 3LKNA 4EI6A 1I4FA 3DHJA 3UTTB 4ZFGH 1P5VA 4QEGA 2PUQT 2ITDA 1BFVL 3TA3D 5F1NB 2GY5A 3TA3A 3GSNB 1S7SB 3HR5B 5DJ2A 1JBJA 3Q6FB 2B1AL 3O4OC 3V0WL 3AB0B 1WEJH 4KRPC 3L3DA 4EBQL 1TITA 3MNVB 3EYOA 5ADOH 4LLUA 3ARDD 1CGVA 2E7MA 5GS1C 3ARDA 2DMCA 1MF2H 4JFFE 4JO4L 4G6AC 1RZFH 3BT2L 5CBAB 4NKMA 3QCTL 3WS6C 5TDNB 5GS3A 3GFUA 1KEML 1E28A 1T04B 4P5TC 3F58H 3MRCA 3RNQA 1A6AB 3I9GL 4YNYA 5KS9B 4PGCA 4X6EB 1KPVA 2Z31D 3WNOA 2DQUH 4EUPH 3MOAH 3CFKA 2VZ1A 2Z31A 2HN7B 4WY7H 3ARWA 3TCLB 3OAZK 1A7QL 3PV7A 2FGWL 1OPGL 5D7LD 3L6FB 2MKWA 4X7CC 3NFSH 4OCSL 4MSWA 5D7LA 2AK4E 4X4YA 2Y6SD 3RWJA 1IZKA 4NNXA 2AJZA 2X7LA 5D2NE 2ED8A 4Y2DD 2FX9L 4Y2DA 1TJIH 5EO9B 4LGSB 2IEPA 5IVXB 4NNPL 1A4KB 3MCLL 3KXFD 4M5ZH 3RU8L 2WK2A 4MS8C 4RBPK 3L7FA 3KXFA 1NEZA 3QFJD 1WK0A 4XP6L 3QFJA 5ID0A 4K94H 4LASL 1I9RH 1XGTA 1FE8H 5EA0H 2Y5TA 1MI5D 3RDTD 1P1ZA 1EBPA 1MI5A 3H42L 3RDTA 3D48R 4E5XB 4J8RB 3VFTA 4NQTA 3GGWA 3U0WH 1FZKB 4G8IA 5DGRA 3S35H 3FO0L 3BO8B 1K5NA 1CE6A 1JGEA 2DM4A 2KDGA 2XY1A 1IGYB 5DI8B 5EU5B 1X5AA 3V5HA 1HYSC 3O6MH 2EIZB 4ELMB 4X5WB 2XA8L 4N1EA 4GAYB 4M1CD 5DO2D 1E6JL 4HZLA 2XFXB 1R0AL 3RZWA 2HT2C 1MCOL 2I9LB 3K74B 2I60H 5CBEB 5GJSL 3D0LB 4RNRA 1NUGA 4P3DA 4JFZL 3T0VA 4CU8A 4D0CB 5DVMA 3IDYC 5C08B 3DTXA 4NNYA 4EI5B 4UILL 2B0SL 4RIRB 1FPTL 4Z9KB 4YDVA 1QSEB 3GJFB 2G9HB 3QNZA 5C09E 3V0VA 4EDWH 4OLYH 4JO2L 4JQVC 4OFDA 5GS0C 1RURH 4PJDF 3B43A 1J7VR 2LU4A 3HR6A 5I1CH 4N0UA 4QRSB 2PTUA 4YO0B 3IJYB 2YEZB 4C59B 2D03H 4ZOAA 5DEGA 3MLYH 3W2DH 1MUJB 2WP3T 4KQ4L 1A8JH 3TCXA 4XP9H 5IB1B 4XP4H 2H32B 5CSGA 1MCWM 3HPLA 3U36B 3UDWC 5F7NC 3ILQD 5ITBL 2Z0BA 2R1YB 3PL6D 1ACYH 1HILA 3TIDA 4HAFA 1UEMA 4Z0BL 3S8WA 5F3HB 3U1SH 2QQNH 4L9LA 1XCTA 1XFPA 2ITCA 1NKOA 1J8HB 3D9AH 3VGEA 3FB5A 5DD0H 4O4YH 4Q2ZA 4HFWA 2XN9D 1OAZH 2XN9A 2HLAA 1VSCA 5FGSA 5IHLB 4IIQA 5HHXL 4KROD 4LHQB 4PB0L 1VACB 3CU1A 1HINH 1I1RA 2G5RA 4PREA 1UB6B 4OTXH 1OGAE 3O4LE 5BVJB 2EIDA 4AEFA 1A1OB 5H94A 1FVDA 1EGJL 2WP3O 1UWEL 3GIVA 4MJ2A 4BA8A 3V6ZB 4LLVB 2QQLH 1S3KL 1B6DA 2FRGP 3BEVA 3GB7A 5A2KH 2GJZA 5IMMB 1QLRA 2PW1A 4Z8FH 4WFEE 3ARBD 4U1KB 4YBHA 3U0TA 5IW6A 3SDDD 3ARBA 3KPRE 3HG1E 3SDDA 1HWHB 4I3RL 4MQ7A 3FTGB 4AMKH 1Q9OB 1UXSB 5EBWB 1DE4B 2PO6A 4ZTOH 2EKSA 1I3GH 5CSZA 1H3UA 2WQRA 3OAZH 4JO3L 1I1AC 3LMJH 4N9GB 3OB8A 2P7TB 2NY3C 5I75C 1TPXC 1SBBA 1AXIB 3HC4H 4HUMB 1L0XA 3QXAA 4X5XB 1GZQB 1OCWL 1LO2H 1FC2D 2CRZA 1A3QA 1JNNH 3FB6B 4HEPG 1RIUH 1NSNL 3H0TB 3K4AA 4RBPH 1YJDH 3T3MF 2C3VB 2WSKA 4NQDB 1A5FH 1F6AA 2VDMH 1Z9OA 3LZFH 3L3HB 5DVLA 1AP2B 3VWKB 4LLMB 1BVLA 1SYSB 1JGVH 2EDNA 3LKPA 4HJGB 2YK1L 1IGJA 2LFGA 1RZKL 1NUFA 3HE6B 4OD2B 4XMLH 5F9WC 1ULVA 2ZSWA 2YA1A 4P2OC 5F3BB 1AXSB 3KYMB 3HKFA 5DRNA 1LEIA 4WW1A 5H2BB 4PJ9D 1IC4H 2R23B 3C8KA 4PJ9A 5DJDB 4QY8A 4D9RE 4KUZL 3QWRD 4PV9A 5DSCA 3CLFL 3RAJL 3MR9A 1SEQL 2C26A 3I6GA 1JIBA 1R5VB 1NGQL 2MSPA 5I16A 2D2OA 4XBPB 3INUH 2EXWC 4RGND 1KCKA 4HJ0D 1H3GA 2VSCA 1K4CB 2VMFA 1A2YA 4OGYH 2UVFA 5DUML 4YBLC 4V1DD 3KLHD 4Y5YC 4U1LB 4EVNA 4I1NB 3RHWK 3REWA 4V1DA 4NP4H 2VLRB 4XCFL 2EDDA 2ZPKH 4LAQH 2B7DT 2DQJL 3WIFA 3BKCL 1J12A 1DR9A 4ODSL 4YDIH 4O5LH 4ZPTB 3S36H 2MTPA 2Z8RA 1ZEAH 3OR7A 1DL7H 1QUNA 3MRMA 3QIUB 1CDGA 4F7CB 4I3GA 2DOCA 1I9EA 2YOCA 4HS8L 3O8XB 2XY2A 4X83A 5K59F 5C0ND 1LD9A 2FBOJ 1M7XA 1F4XH 5E6ZA 3QEQD 4CN1A 4MJ5B 3MLWH 3QEQA 1Q9WB 4OT1H 4TNWF 4M5YH 4LCCA 2DDQL 2CSPA 5LXGH 4OLVH 3TFKD 4LCYA 4ODWB 1Q72L 3LPGA 3G08A 4NFCA 4XWGL 4WVRA 3WMSA 5I0ZA 3RVVC 1HXMA 3HAEH 1JUFA 1OB1A 2XNAA 4IRZH 4OIAA 4P2QE 5HGBA 1UENA 4HUXB 1NLDH 4M3KB 4HWBH 4LSUL 3SGKA 3QI9D 5L8LB 5CD5C 3QI9A 2R2BA 1BZ9B 3LH2H 3WNNA 4K23H 4DGVL 4ELKB 1P7HL 5SWSD 1F58L 4IBLT 4BH7A 1ZAGA 4TVPD 5SWSA 1IGTA 3IAPA 2WUBL 3CUPA 3QDMD 4KTEL 4EIZC 1JGUL 1CR9L 3QDMA 5GHWH 1FNAA 4MDIB 5IBLD 1NEUA 1OT1A 5GIRB 5L2KB 4C4KT 4Y1AE 3H7BA 4R0LB 1ZWIA 3FFCB 4HFUL 4NO0D 5IOPA 3QUKA 4NO0A 5B38A 3WE6B 3MO1B 1MFAH 5BZDA 1C5BL 1XH3B 4S0TD 1QFWL 4I0PB 4MJIA 5HHPA 4QXGH 3UYPA 5C0RL 2ZZUT 4P49A 1W72A 2F74B 3C6SB 2I5YL 3TBYB 4PY7B 5LQBL 3FONA 2J2ZA 3D39B 2BNRE 4XPAL 4XRCB 2YMXL 1JJUA 5J11C 1NGPH 2AV1B 1MOEA 2CRIA 4KKCD 5DA4A 4P3CH 2H2PD 4KRNA 5I1DA 1CGXA 3C6LB 1J11A 1G7LB 3R06B 3D2UB 1LK2B 5HGAA 3FMGH 2KPNA 2DF3A 2NY2C 3MYZA 3BSZH 5L9DL 4GQ9H 1TVHB 1UJ3C 3ULVD 4PRHD 4GKZA 2N56A 3RIFK 3LQAL 3F5WA 4XNXH 1OAKH 1WCBB 3OBAA 5IVOA 4KK5C 2VXTH 3IU3A 4C4KO 4Y5XB 1INQB 2C3XA 1JGDB 2MQ0A 1C12A 1BGXH 4HC1L 3OHXB 4KKLD 3P73B 4DK3A 2E7LC 1KTLB 4TVPH 3SOBH 1YY8A 4OUUA 3UO1L 4XI5C 2JJVA 1ZGLM 2ZUSA 5D2LE 5IV2B 1FVCB 5I9QB 5KSUA 1CLZL 4ZSOE 5JZ7C 2R15A 3MNVA 4FN0A 3GDBA 1INEH 1N0LA 3VFPB 1CDHA 5FA3A 3GO1H 4M02A 4EJ1C 2IWGA 3VJ6A 4JFPA 3V6BR 2UZIL 2NCMA 4X80L 5CMAB 1CFSB 1X6NA 3AFLA 5IK3B 3NOIA 1OSZA 2JK5A 3ZDYE 5I1LA 1A6AA 1NDMB 4OZ4B 3GMPA 4JKKA 4ZO7A 5EUOB 4YWGH 2EYTA 2YN5A 3BH8B 3CC5B 4XPGL 5AAMA 4ORGA 3GSNL 5I8EB 5A2FA 3LPWA 5F9JA 4UDTB 3DROB 5BQ7B 3PDDA 4LSSH 3BP6A 1R3HA 2OQJA 4JJHA 3OKLB 4P4KD 5TDOA 5CJQH 4U1IA 4P4KA 1B0RB 3KDMA 3JWOC 4Z76A 1PKOA 2YD4A 1A6TA 3ULVH 2HJLA 1KNOA 8CGTA 4G6MH 4YDJA 3NCMA 3O6LH 3MNZA 3C5ZD 4K3HA 3A67H 4HG4K 3C5ZA 1S5HA 2AQ3A 2KZ1B 5D7KE 1R3IH 1WQVT 4WEUD 3CXHJ 3HC0B 3QXUA 1P84J 3HI1B 5DMKB 2M8XA 2ENYA 5HYQB 3TT1H 5GGSA 2WWMD 4J8RA 4AM0A 3R1GH 4DFHA 4JCLA 1D6VL 3WN5B 1JPGA 1RZGA 2EYSB 3SHSA 2A73A 1XZ0B 3PABB 4PJ7B 1LE5A 5MERB 1NCCH 1BEYL 3WXVH 2EICA 2ICWA 4DAGH 3MLXH 4ELMA 4O02H 4XCNB 2A83A 3OKNA 4JN1L 3QIBD 3O2WH 1N64H 4JKPH 5FFLA 3S3PA 3QIBA 5F8QC 5EO0B 3MLRH 1L7TH 2X1OA 4M8VA 3C2AH 4HXAH 4NM4L 2J7LA 5E2VH 3V7AE 1YN6B 2Z4QA 4TUKL 2AEPL 1HHHB 4H8WH 4LSPL 3SGDI 1FL6B 1YNKH 4LVOB 1J0ZA 3FRPA 1FV1A 2J8UB 1I3RA 2W1NA 3P0VL 1JI2A 3VI4F 1RUMH 5I8OH 3PWPE 1A7PH 3ZHLA 2NR6D 2EDXA 1FZMA 3VCLA 4PJHB 5KSVB 1UKTA 5T5NG 2ARJA 4DUXA 3V6OE 2OYPA 1A3RL 3ARSA 4XNZC 1QOKA 2BNQD 2BNQA 2R2HB 1MUJA 4X9BA 2V17H 2F5AH 5HHOB 1T7XA 4XBEH 4UT7H 3DMMC 1X5GA 4GW5B 1MHCA 2VAAB 2E27H 4ZOBA 4KUCD 3VRJB 4JY4A 4G7VL 3TNMB 1V7ML 2R1YA 4I3SH 3EHBC 1BP3B 2GTZB 5FYKH 4F7PB 1W2KT 5BS0B 5FUZH 4DCQA 3FOMB 3JWDL 3KPLB 1KFAH 5JOEA 5A2LH 3IF1B 3X12A 1JYVA 3NPSB 4QYOA 5J12C 2A6DA 4XVUC 2Z92A 1NGXB 4LDOB 3VDAA 1X5FA 5J56B 4Z7WA 5LGJB 3NCYP 4WEBH 4UT9L 1CGTA 1QLEH 3VRLE 4ONOA 1GIGH 1MVUB 2LQRA 4PJ5B 5HVHC 1EUTA 3QCUL 2CK0H 5BVJA 3DXAB 4BFGA 3ZKMC 1MHPL 1MPAL 1A1OA 4K9EC 1NMCB 1U0QA 3T0EC 3PP4L 3WV0A 3G9AB 5FYLH 2I26N 3K1DA 1ZLWK 3DETC 5JPNB 4M93C 1REIA 2LAGB 4ZO8A 1GRWA 2QEJA 4WI4A 4NJAL 1CXFA 4L8SC 1YY9C 5E99H 4JG0H 2HWZH 4Y19D 5GRZA 4Y19A 3LKOB 4RAVB 4XB7A 4HJJH 1JTPA 3P4NB 1UYWH 5I75B 3W5MA 1Q9OA 1N6UA 4RISH 3VXSE 2NYYD 5CILH 3WSQH 1BQLH 4ZUSB 5F9DC 3V5DA 1MJJA 3VGAB 3MBEC 3ULSA 3MGTB 1II4E 4UNUA 3SDCB 5IIEA 1I8KB 3B5TA 4Q0XH 2YXFA 4X5XA 1ZS8B 1GGBL 4MXWL 2FLBT 4GAGL 4JHBA 3MV7D 4ACPA 2X05A 3H0TA 1IAOA 3WO3B 3MV7A 4S1DC 5EIQA 4DUVA 1QACA 2DQCH 4FQPA 1YNTB 2W9LA 1VHPA 1HI6A 3P4OB 4LPXA 4HK0B 2XV6B 4PG9A 3LEYL 1DSFL 3B5HA 3BD4A 1S7XB 3IDNA 4PS4L 3HNTL 4K3GA 1ZANH 3SKUD 1SYSA 4KK6D 3WHE0 5CZVL 4P2OB 4ZUTA 4WFHE 3EZ8A 4O9HH 5KVGL 2DS4A 4NRZB 1Q1JL 4KZEH 3HZYA 1T22A 2P8MB 1K85A 4Z7UB 5SWZB 4N5EC 1YEHH 5IR1B 5LAXB 3UMTA 1S8DA 2X42A 3G5YB 2NXYC 5HHNB 2OK0H 4M1GH 2Y36H 4JPVL 5C71A 3DYPA 3O3DB 1TJGL 1TJHH 5I66A 1JPTL 4DW2L 4Q9QL 1GC1C 5DWUH 2DBJA 3HC3H 1AXTH 2VUYA 1RIVH 4JQIH 3GBML 3S4SB 2HTLD 1G9NL 3BJLA 3O0RH 4U1SB 3WS3B 4XBPA 3BHBB 1YN7A 3QNYB 3LN4B 4Y5YB 1TZGH 2IBZY 4J2XA 1I85A 3SN6N 3GKZA 4NQEB 4E41D 4JRXD 4E41A 4JRXA 1ZHKA 1T21B 5HHMB 3ULVF 2M2DA 2BK8A 3LKSA 1ITCA 3FAXA 4LPTA 1EHLL 1UKSA 1BQHB 1K4DB 4KK8D 5FO9A 1ZSDA 2VUOA 3I6KA 1N8ZA 1NBZB 4PRAA 1FG2B 1E0OB 1S9YA 1QR1B 4WCYL 3W39B 1MVFA 1OGTB 3BISA 3TNNB 5CJXC 4L4TB 3FZUD 4AJ0A 3JTTB 2ZCLL 3TBSB 5FF6A 1RK1B 3WUWB 2VQ1B 4RFNC 3D3VE 3O8XA 5E95B 5T3ZH 4C56E 2FX8L 5DMIH 3DRQA 5FIEA 4ZG1A 1AGFB 1FSKC 1EEQA 4TRPH 1QHPA 2ATKB 3SDAB 3RRQA 1I9JL 2JCCE 1I1FB 3UBXI 4CADB 4ODWA 4OJFL 1LP9A 4S1SH 3ZE1E 3MMEA 3LPFA 2C7UA 5EB9A 5CJOL 1AQDA 3LKRA 3E1F1 1UWGL 1OD9A 5CIPA 4JPWH 4CVXB 4QRPB 4ODBD 5L88H 3QYCA 2X9WA 4JJ5B 1AO7B 3FHQA 1WWWX 1OAUL 2YA2A 1ZLWH 3ET9F 3DV6B 3FL7A 2YRPA 4MA1B 5IMOA 2UWEA 1EZVY 4B7IA 1MCRA 1ZHNB 1BWMA 5CP7A 4WUUD 3RBGA 2YD3A 4LIQH 4JM4H 3D85D 1IQWH 4WUUA 4KJYB 3D85A 3KPNA 3ZKND 4QOKE 2X10A 4RX4D 4JFHD 5DMGC 5CEXA 4RX4A 1FLTX 3DJ9A 4Y5VA 3HMXL 3QQ9C 1M05B 5I1AA 2CRMA 5FDWB 4YXLL 1IMHC 2APFA 4LRNH 1FNLA 2WWKT 3LY6A 5D1ZC 1CTOA 5ISZD 5ISZA 1NKRA 1DLHA 3BMVA 4YK4B 4F37K 2AJUH 5ESAA 1NFDB 4B53A 3UTQB 2OJEB 4WV1A 4KRMB 2GJ6D 2NY2B 3CGTA 1AQKL 4CJ1A 1CFNB 1W0WA 2GJ6A 2WNGA 2G75B 1G7LA 1BZ7B 3P9MB 1OLLA 1KIRA 2V9TA 3EO9L 3DX6B 1P4IL 2QL1A 4Q58C 1AI1H 1EFXD 1DBAL 5DTFB 4ZNCD 1DEDA 1EFXA 4XC1L 1Y6KR 1CXKA 4YX2L 1L4IA 3HAEB 2HT3D 1A1NB 3ZYZA 1I7UB 5ILTL 3VG9B 2BVOA 2DAVA 2P49B 3MLZH 5TFSH 3C5SB 3HRPA 4A6YH 1QPXA 3NA9H 1JGDA 3GJEB 4KU1A 1FLRL 4Z7NF 1F3DJ 4AQOA 3OHXA 4KRPD 3V5KA 5BZWB 5D2NC 3GSOA 5GS1A 5FCSH 2WWKO 4G6AD 2V5RA 3HNVH 5JORA 3PQYB 4H88H 1MHEB 1X4XA 4U1GC 1RSFA 5JW3L 1V3JA 2FBJL 3WS6A 1DTUA 1RUPH 4DKEL 4P5TD 1OTSC 5JR1H 2DMBA 2WBWB 4XPFL 4NHCH 4P5TA 1KCVL 3H3PH 1GZPA 5IK3A 3GIZL 3QDJE 3STZA 1T5WB 3BDYL 4CMMB 5EUOA 2Y07H 2F19H 1UT9A 5KBNC 1XGPB 2NTFB 2DB8A 3OJDA 2JELL 1VKXB 4UT6L 5ICZB 4X7TA 5SX5H 32C2B 3OZ9L 3CD4A 3U0PB 3ARFB 5GGRB 5CP3H 4Z7WF 1HIMH 3BH9B 4ISVB 5ALCL 3B6SA 2L7JA 4FQJL 3AMLA 4U1JB 2H41A 1OAQL 3SEPA 2DD8H 5E24E 1PG7W 4MS8D 4GG8A 2A77L 2E7BA 1Y18A 2CDGB 3K8LA 5DJAA 3GHBL 4X7FC 1KJVB 2VO5A 4GRWE 1LILA 3HC0A 4FQXC 4NRXA 2IFGA 3BGFB 1VGKB 2JTDA 2IMMA 3CPLB 3RUGA 5D7IB 1HYSD 1X5ZA 3SE9H 4M48L 5ANMA 4LSTH 1T6VN 2I25N 4OCMC 5KSAC 2MPAL 3WHXA 4PJ7A 2A6KA 4ONHA 4QRUB 2HT2D 4DFIA 4H25B 5GGQH 1PZ5B 1AR2A 4IOIB 2FWOB 4PRIB 5HDLA 1R3LA 4YDLC 4Z7VA 2YUWA 4F7EB 1MLBA 1OOAA 4YIQB 1R24A 3FO9A 4Q9RH 4JB9H 2AJ3A 1IL1A 2BXYA 1AIFB 5L2JA 1RMFL 4KH2A 2CXKA 4DVRL 4ZFGL 1NAMH 4MNHA 2WUCH 3B3IA 3UPCA 1WIOA 3TIEB 1JWUA 3HZKA 5GS0D 2D3VA 5D7JC 4JQVA 3EOBA 1WEJL 2IFFL 1TVBB 2W0FB 4OLZH 4AYFA 2ZNWA 1AGBB 2CLRB 1C1EH 4POUB 1RU9L 4ZAKB 3LEVH 4XNZB 3UTPE 2NX5D 4JDTH 2NX5A 1I8MA 4PJEA 4R4BA 3T77A 5D5MA 3LRSA 2RCSH 3F58L 5ENWB 1U93B 2IQ9L 5DUPL 2R2HA 3UDWA 5LBSH 3OJVC 5T1LB 4PRPE 4RRPG 5IFAH 3QNXA 1CL7I 4GW5A 1BF2A 2RGSA 1UFUA 1CE1L 2FEEI 3NFSL 2X4QB 2OM5A 1HHIA 4GW1A 2OR8A 1BBJA 2FJHA 5K33A 3GRWA 4IMLB 1EO7A 3M17B 2D7TL 1F4AA 4PJXE 2FO4B 3UCRA 2A74B 1JRHI 1UZ8A 4K94L 4LSVH 3SE3C 3LHPL 4OM1H 2APTA 4BUGA 3ZSTA 3MCKA 3SDXB 2FGZA 4PJ5D 5DA0B 3U0WL 1JZ7A 2YA0A 4PJ5A 1DQML 1T7WA 1C16A 2BSRA 2PCPA 1DANU 5GRVL 3RBSA 3TV3H 3MLTB 3EUUA 1FNHA 5IEHA 4LCWD 1KJMA 4TUOB 4LCWA 1N5YH 4YHKL 3UTSD 4F7TB 5HVGB 5I8CB 2Y06H 3DHMA 3UTSA 3RIAF 4WDIB 1JE6A 4HQQL 5GGUB 2VDNH 4RGOH 3RJQB 4K2UH 4XVSH 1M7IA 2I60L 4Z77A 3JWNC 3OAUH 3CFDA 4PTUB 4X9HA 4YHYC 3OXSB 1I1AD 4X98B 5BO1H 1I1AA 1KTDB 2NY3D 2VLKB 3WO4C 1K2DA 1LO0L 4NM8H 3X13A 3M1BA 1DANT 5FKAB 2F5BH 4F58H 4KC3B 1BFSA 2LTQC 1KPRB 4KKBC 5GRJH 5EU6E 4Y0GA 5JLZB 5EULV 1RJYA 4EDWL 2J6EH 1LP9F 4DUWA 5TE6H 5E5MA 5I1CL 1ZGLA 4HKZB 3O41B 3DVGA 1D5XA 3B2VH 3GRWH 4OD1H 3EOTH 1PY4A 3UTZA 2OS7A 1JN6B 5IESH 1T1YA 3VXQA 3MLYL 4MD0A 2ZKHL 3O3BA 4XP9L 5CLWA 4Y16B 2IH3B 3CK0L 2J3SA 3EOAB 2QKIB 4I77L 4P2OD 1UZ6F 3FQWB 2F54E 4P2OA 1T0MB 1ACYL 1I7RB 2NXYB 2QQNL 1CG9A 2P8MA 4OF8A 5SWZD 1DVFB 2YN3A 3L1OL 4WI3A 5SWZA 1CDYA 5F6IC 4O4YL 3VA6A 4IEFB 1I1CA 1A47A 2Q1EA 4X6CE 2YZ1A 4JHWH 5MI0C 2PW2B 4FFZH 4NZJA 3CXHK 4RFOL 3QUYB 1P84K 1QEWB 3B4NA 4Z0XA 1FRGH 4OTXL 5GPRA 3J8F7 2F8XC 1PKQB 3BP7A 12E8H 3WS3A 2BVQA 4JVWA 4XBGA 4Y5YA 2E9JA 2XQBH 2OZ4A 4NQEA 1I3UA 3VXTB 3HE7B 4LVHC 4E0RB 4NN7B 1XF2A 1HSBB 4KQ3L 2R4RH 4NYLA 4PJCE 4M7ZB 1XR9A 4QRRB 2GTWB 3KPSE 4RWYH 1K4DA 2XZAH 4XPHH 3QDGE 1ND0A 4DZBB 3ZZ1A 2P5EB 3LMJL 1QR1A 4RFNB 3BGMA 2OZ4L 2R2EB 1ZT4A 3HC4L 3HUJE 3MV11 3TBSA 1RK1A 5EC1B 1TETL 3ARTA 1LO2L 2K1MA 2VISA 1JNNL 4F15C 4QF1B 5KN5A 4Q7DA 4I9WD 2O61B 5E56A 2Y25A 3DI2B 3CSBA 4NGHH 4Z7QF 3RP1A 2FO1A 1KLFA 5IQ9A 5JHLL 2Q7YB 3RVVD 4J3WA 1MJ8L 3MOBH 1NC4D 1I1FA 4CADA 4HPYH 1WAAE 1NC4A 1S9XB 4XPTH 3GMOA 4I48A 5T1DL 2VLJD 2COQA 1EK3A 5JTWA 2VLJA 4OZIA 1G7QA 4QRPD 4R90L 4JG1H 4DJMA 4CDHA 4QRPA 1MJUL 5GGSY 2Q87A 5CD5D 3OX8A 3WFHA 3P30L 4PJGE 4APQB 1HHGA 3UZQA 4XMLL 1U8OA 4MNGB 3B9KB 3UZVB 4WHTA 5L0QC 4NQVA 3WDIA 4ODVH 3QUXC 1KXVC 3GSXB 5CEYB 4KY1H 1F02I 1YPZF 4JZJB 3LS5H 5T3XD 2DL9A 4MLSA 5C0GB 1BX2B 3TBVA 4HHAB 4F37F 1W8NA 1B88A 1P4BL 1A1MA 2IAND 1M7DA 2HA1A 3VXRB 2IANA 3AU1B 4NJ9H 5C7XH 5DLMH 4OM0H 3NBNA 2VDKH 1AGCB 3G5XA 5TQ0L 2LVCA 4JKLA 3RWEA 1A02N 3GNMH 1MH5A 5ADPH 3QAZB 1LK3L 3RUGF 5CEZE 4XTRD 5I0DA 5DJ8B 1CTNA 1V5JA 3VFVA 4XMPH 5EOCJ 3MRIA 2MHAB 6FABH 2ZPKL 1VEMA 4RAHA 1NFDA 4XXDB 1S7WA 1EO8H 2OJEA 2NY2D 5HYIA 3BRGC 2BMKB 2C1OB 4S1RL 2DTML 2BHZA 1PG7X 4YDIL 1UJ3A 4UINL 1BZ7A 3P9MA 5GGVL 2B4CH 1IAIM 1K6QL 1CFVL 1ZEAL 5J1AA 1QLFB 3RL1A 4GRLB 3WXWH 2H26B 4KK5D 4DN4L 2VDQL 2PETA 2Z35B 3MJ8A 4L8BB 3VG0H 4ZOEA 4ONFH 2AK4B 3BP5A 5D70H 3SKMA 3VFOB 2NY4C 3NN8B 5MP6H 1F4XL 3KJ4C 4BSJA 2E7LA 1TQCB 3MLWL 5D2NB 4F9LC 4XI5D 3C5SA 4M5YL 2BX5A 2R0LL 3CCHB 4OLVL 1JNLH 3DX7A 2A9MH 1BJMA 1RUKH 2HVJB 1KGCD 5JZ7D 4TSBH 3C2SA 1MJ7H 5IB4B 4TTGA 2WIMA 1MHEA 2AJXH 3VDCA 1JZ8A 1MLCA 4MD5B 5EO1B 5T5NF 3SO5A 3LVEA 3DVNB 3MRLB 4HWBL 3X11B 3GSUA 2YD2A 4XMKH 3RWFB 5EPMA 1D7FA 3ARPA 1A14H 5MENE 5E4EB 3UJJH 3H9HA 4MJ6B 1FZOA 5CUSL 4OAWA 5JO5B 5D72H 2DWDA 4YZFF 3Q3GB 1XGPA 4G9FD 4NT6B 5C0BE 4G9FA 1NJ9B 2BCKB 1F11A 3LQMA 3OGOE 1KTKE 1CZ8H 3O3AA 3BKMH 2DQFB 1X44A 3IYLW 3RWIB 3OKEB 3HCVA 1ACZA 3LD8C 3HI6H 2NZ9C 1MFAL 4C54A 4MLIA 4G3YH 4HF5H 5C0IA 5FCUL 1NL0H 1Q0XH 2CDGA 3L5JA 5ESVA 3ES6A 1TTUA 2EDKA 3P9LA 4PD4J 3WIHH 2Q8AH 1G7JB 4A6YB 5I15H 3CFCH 4U7SA 1BBDH 1VGEL 3V6OC 2F53E 4LFHG 3MFFA 4ZYKB 2VXQH 3KLAA 3BSZL 4DGYL 5IVXE 5DUBA 3VI3F 1VPOL 1MCCA 4OF5A 4E42B 4HD9A 3TVMB 4LNRB 4H25A 2FWOA 2IH1B 3KJ6H 1OAKL 2GAZA 2R29L 4F7EA 3CH1A 2OTWB 4JRYB 2WBJC 2VXTL 1LMKA 3OR6B 4X0KA 5DJCB 1F90H 2CIIB 3VD5A 1AIFA 3TBTA 2BZDA 2A1WH 1OY3B 3MA9H 1NC2B 1JPST 4J23A 4FA8A 5E2WH 3BUTA 1X5XA 3BE1L 1P7QB 1TVBA 1MRDL 1N4XH 3AREC 5ESQA 4WFFE 1INEL 4HAGA 1CFQA 2J88L 5CD3B 5J1SC 1HQ4A 1EHAA 3GO1L 3MUY1 3O4LB 5DQ9A 5KVDL 5FB8A 1U8LB 3GMLB 4ODHL 5HHQB 2DYPD 3DMMD 4KVNL 3G5ZA 4XNYL 5D96C 3DMMA 3MV8D 5C08E 4PJIA 4YWGL 4HLZG 4QHLB 4X7SH 4KPHL 5DMJB 5E08L 3TO2B 2BRQA 1YYMH 1IQDB 3L9RB 1Q0YL 3EHBD 4JZNA 5CZKA 3VWJB 1HCFX 5E94B 3HG1B 4AH2A 4FP8H 2NQCA 3O9WB 1S7UB 2PN5A 1N26A 5AZEL 4XNMB 4DKDC 4LLWA 4LOUC 4G6ML 4XVUD 4RRPA 1X5YA 3O6LL 5EZOL 5DHVH 1FNEA 5LJYH 4U4BA 4JZOA 1U3ZA 1R3IL 4IDJH 4KKNA 1KOAA 5GRUL 4J6RH 1EEYB 2ZUQC 43CAA 4KTYA 3O6KL 5IW1A 3ZKMD 4HIIB 1JTTA 4R7NA 5E9DD 3TT1L 1BVKA 1WGOA 5FK9A 3SDXA 5E9DA 3T0ED 3R1GL 3T0EA 1MCPH 1NAMB 3DETD 5CHNA 3HA0A 5EOQH 2EIEA 4EXPX 1UGNA 4U2YA 2IBZX 5JW4M 1NCCL 1LNUB 2ZSVB 1T0NA 1YY9D 4I5BA 3MLXL 4L8SA 4YHMH 2XTLA 4TUOA 3RWCB 4F2MB 1N64L 4W68A 4BH8B 3GSRA 1ZA6A 3PGDB 1T20B 3Q6GH 4MWFB 1RZIB 5DQDL 1YPZB 3G6JE 5E2VL 2UZYB 4F8TA 1XIWC 5LCVH 5F21B 3EFFB 1KTDA 4BZ1L 3MBED 5DD1L 3UTOA 5BJTB 1M71B 3MBEA 5IM7B 3X3FH 1QKZH 5I8OL 4M9OA 3GMQA 5K9KA 4N8PA 5C2BL 1A7PL 4ZPVB 1D5ZA 2FIKA 3U9PL 3S96A 4HIJB 5JIKA 3WHE1 4S1DD 1GAFH 3OG6B 5FGRA 1QSFD 4NQCB 1QSFA 1JN6A 4UDUA 2VDOL 2V17L 1VFMA 4XBEL 4UT7L 4G8EB 3PIQA 5IMKB 1DBMH 4HKJA 2YXMA 3RFZC 4FFYL 4UQ2B 3H2WA 3EOAA 3DGGB 3UYOD 3RA7L 2QKIA 4K9EH 1A6WL 1TQBC 2AJYL 1SVCP 4N5ED 4JPKL 4G80A 5EU4A 5I74C 3IGAB 3FQWA 5HYJD 1ES0A 2NXYD 4S0SD 3IFPA 1I7RA 5HYJA 1DBJL 5DC0A 3VE0B 5FYKL 3UJTH 3LQZB 2ICEA 3VXNA 1A7RH 3GI9H 5FUZL 1EZVX 1F4WH 4NKOB 1DVFA 2R0KH 1MNUL 2HG5B 2G60H 3F12A 1KFAL 3DBXB 5HGHB 4R4FL 2JJTC 1KEGH 2YWYA 3K4ZA 2W65A 4QWWC 3QQ3A 4K8RL 4WEBL 1JHLH 5H35A 1IKFH 3KPPA 2F8VA 4XNQA 4HV8B 5T1KB 4HIXL 4OSUH 2NW2A 1QLEL 1HKFA 5IBUB 5GGTA 2DKUA 4PYGA 4Y8DC 4RCAA 3QUMA 2CK0L 3Q1SL 4PV8B 2W07A 1SY6A 1H3WM 1LE9A 2B2XH 4JM2C 3TN0C 5C9KA 1OP5K 1JPSL 4JEGB 3UYRL 1LDPL 4P59L 3MJGX 4YFEA 3WJLC 4M62H 1A6ZB 4LCUA 4JG0L 4OGZA 4P2QB 3TT3H 2GTWA 4HJJL 5K93A 4QHKJ 3FQTB 1J0KA 5DDHB 1UYWL 3C87A 3GMRA 4YHNB 5CJXA 3LV3B 4QXUH 3WSQL 1MIMH 4Q6IB 4OCRL 1N5AB 1DEEB 1OWWA 2XRAH 3SE8H 4H26B 1CDJA 4KV5F 4AEHH 3E2HC 1URLA 2HFEB 3LB6C 1DBBL 1E27A 1XF4A 2VLRE 2ESVD 2KL6A 3EYUH 2ESVA 5EC1A 4P5MA 4O2CB 2BOBB 2A6IB 1DLFL 3CVHH 3KPMB 3DVFA 1GC1H 2AJSL 4XH2B 5I2IA 4H1LG 2DQCL 2QJDA 1WLHA 2GFBA 4MA3A 4PJFA 4G7YH 2KQNA 3R0MA 4JCMA 2E9WA 5B39G 1KT2B 1Y0LB 2ATPB 3MRGA 3PWLB 4LLYA 3IDGA 4FTVD 5DURD 3MA7A 3QULB 3ZYOA 1SY6H 4IS6A 1NFIB 4HMDA 2QBWA 2E9BA 1J1OL 1YEHL 5DJZA 1QNZH 4M1GL 2GQHA 3RVXC 1UH4A 1JPFB 5FYJL 2BVEA 2SEBB 4OLUL 1OAYH 1JTOA 3VXOB 2FECI 4WNQA 4JDVA 5DMGD 1G9MC 5J89A 4ZFFB 1IARB 1U92A 5JOFB 3QQ9D 3QJFB 1F3DH 3O0RL 3E3QC 4OGXH 4HKBA 1U8QA 2BDNL 5D1ZD 3MRPA 4NHUA 4ETQA 3UBXG 1T1WA 4OLWL 1TZGL 5D1ZA 1KCRH 5DVKA 5D2LB 2W59A 3JV4A 5DJ8A 3LCYA 4ZSOB 1J0YA 4OFVA 3MJ9A 1CXIA 3WFDH 4OIIL 4JFFD 5E8PB 1UA6L 3ZHDA 3NIFF 4Z7OF 1CU4H 1H15A 4JFFA 4P9HL 2DI7A 2EH8H 2JJSC 3FCTB 5IKCA 5IT2H 4M8QA 4AENA 3G6DH 1SEBB 1U3HC 1E4XH 2GUOA 2BMKA 2C1OA 3NCBB 1OLZA 4F3FA 3MZTA 5BW7C 3GMNA 1T3FB 4PJDE 5EIIA 5IFJA 5FO7B 2C3HA 5CCKH 1F4YL 4JR9L 2YPLE 4U6XA 2BC4B 1N3NA 4X4XB 1JWMB 3D39E 5HGDA 2ICWI 3K2UH 2J4WL 4L5FH 1INDH 1DN0B 5T3ZL 1PAMA 3VFOA 1HNGA 1NFKA 2IAMC 5DMIL 4TRPL 4YBQC 2YC1B 3N85L 5D2NA 1G6RH 1UB5A 2RIKA 4KTDH 5DFVC 2LVEA 2BFVL 1YMME 4M6OL 2DLGA 4MNQD 2VRAA 3QB7C 3GI8L 1U8PA 4MNQA 3IXAB 3TPUA 5JDSA 4PJIF 4S1SL 3EO1A 1OTSD 5HGGS 4WHYH 1CICC 3UZEA 5DK2B 3BPOC 2XIDA 4JKMA 4JPWL 3HPJA 5L88L 3PHSA 4MD5A 3OB0K 3S3JA 2JIXD 4HBQA 4OKDA 4FABH 2JIXA 1OP5H 3QG7L 3FT4B 1KUMA 5B4MC 1FAIL 2AQ2A 4N8VB 5BMFH 4XVTL 5JNYA 4HIHA 2R0ZL 2HH0L 3EGSB 4LEXH 2IJ0C 4CAGA 5EUKB 1ZLVK 3MRQA 3GUTA 4YR6A 4I4WB 4TULH 4JM4L 4QXTB 3WFCH 3SY0A 1IQWL 3Q3GA 2EDBA 1FVEB 3O45B 4XP5H 3L5XH 3LD8B 1Q9KB 4C83A 5DJ0A 3B2UC 2DQFA 4HT1L 3IFNH 1U8JB 2NY0B 1S7RB 5I17A 3RPIA 4HGWB 4CNIB 2FATH 4KI1A 1QD0A 3P11L 3LDBC 4FQXD 5E8DH 5J13C 1WBXB 5C09D 3CDGA 4FQXA 3PWPB 3KPOA 3HN3A 5C09A 3BVNB 4JFDB 1U58B 3FKUS 3VXUE 4ZMAT 5E2TL 1C5DB 2HYMA 2QSQA 3AAZB 4LGPB 5C0CE 3FOLB 5KSAD 4Q9CA 1A3LL 5LGKA 2XWJB 5KSAA 2V7NB 3IJSA 2BOCA 5ERWB 3AMKA 3ZHKA 1U8NB 3QA3A 4GMSH 2HFTA 3HLAA 1NGWA 3P40A 4A2MA 5FGBC 3OSKA 2P44B 5I18L 1N6QH 1TCRB 4K3EL 1DJSA 4LNRA 3Q48A 4LQ1A 4H0IA 2IH1A 1J8KA 1IGIL 3T3ME 4JFXB 2UVEA 4CU6A 1XGQA 4HCRA 3C8HA 3QZWB 4P2RE 2QQKL 3MLZL 1AD0A 4A6YL 2HJKA 3G6AB 1OSPH 5D7JD 3KWWA 5D7JA 2NY6C 2FJFA 5KW9L 5I73B 1CF8L 4M7JL 5C0JB 2VZTA 3AREB 3PHOB 3TP4A 1D5BB 1N2RB 1YZZA 4I18C 4BSWB 3HNVL 4M7LT 2ADFH 3ALPA 3QH3B 3SGJC 3TF7C 4POZC 2HKFL 1K8DA 1RUPL 1UG9A 2VLME 1BQUA 2X1WL 3O11A 5D96B 1LQSR 3ULUH 1OGAD 5EN2A 2MMXA 1OGAA 2XG5A 2E7CA 3DUSA 3NCCB 3U9UB 1LO4H 5A3IC 3FQRB 3NA4A 4WW2B 2R8SH 4XCYB 1B0GA 4OCXL 3DX8A 4P46B 2ZOLA 3RKPA 2Y07L 4W70A 2F19L 4WFED 2LE9A 3JVGC 4HUWB 4YUEH 3KPRD 3K80A 2HAZA 2AKRA 3KPRA 4H5SB 4PJAF 1FORH 2H8PB 3SKOB 3ROOA 1NPUA 3I50H 3VXSB 4KMLB 1S7TA 4LLAA 3EOYG 4H0GA 2X4RB 5F7DB 3L3IA 3VXPA 3VFWB 3EDJA 4PR5A 5TH2B 1H5BB 4WI2A 1QA9A 4HLJA 4UTBL 5E0QA 2XTJE 1F6FB 3SE3A 1YECH 1RIHL 1DQJB 4EOWH 4C58B 3DO7B 5I1JL 1IBGL 4JFED 4QLRA 4RZCB 5KSBA 4L8CA 4JFEA 4ZXBC 3WDHA 2Z91B 2XACC 5DRWA 1IC7L 3BP4B 4LSTL 4UBDC 5BS0E 2Z8SA 1F3RB 1OL0A 5K59E 1IEBA 1HHKA 4TUJA 1HSAA 3K0WA 2DKSA 1D9KB 1EBAA 4L3AA 1ZLUK 2VDPH 4JN2B 5C9JB 3OB0H 4OCWH 4ODUB 4YXHH 4F2MA 1XIWB 5I19L 1K8IA 4AG4L 4YXKH 2WIIA 1CLYH 1MIEH 4X6DF 3PGDA 4QCIA 3MCG1 1A9BB 4UV7L 4JB9L 4Q9RL 1J0HA 4XC3L 4CN4A 3VFGH 1RZKC 4D9LL 1ZLVH 4KKBD 5TGBA 2HJFA 1N6VA 2E8ZA 3MUHL 2OMBA 1NAML 3MGOA 3EFFA 2WUCL 3MGAA 1M71A 3CFEB 4QT5B 4XPBL 1DFBH 4D9RD 1BZQK 4KGLA 4UZGA 4BFBD 2JF1A 4PJFF 5D7LE 4WO4D 4OLZL 2UYLB 1PLGH 2GJJA 4UB0L 3ZDZF 1GYAA 3UJIL 1AFVH 2VABA 1RZJH 4HLZH 1MQKL 3BQUB 3ESUF 4OZGF 3HRZA 4TPRH 1HHJB 1JK8B 4OV5A 2RCSL 4JREC 3UPRB 5GGVY 1BPVA 1MFDH 4MMZC 5F70A 35C8L 5L6YH 3QFJE 5DHVB 5LBSL 3C9NA 5BV7H 4PJBF 1J18A 3CSPA 4MAYC 4OFIA 3SGDH 5I74B 1H0DB 1MI5E 1U36A 2BJML 2Y1VA 2V2WB 4AQ1B 3T1FA 4NN6B 4PLKC 4D9QD 1RJZA 3BZ4B 2XZCL 3PXHA 2R9HC 2CLVA 2X4PA 4HXBH 4J3SA 4ONGH 5FHBL 3LEXB 3BZFB 1ADQL 5HVFB 4XX1E 1NUNB 5HJ3A 3O6FC 3IB4A 2P4AB 4UU9A 2H6PA 2CJUH 5HSFA 1IAIH 3O2DL 1R5IB 1YEEH 2Z93A 1YUHA 4FQIH 3WFZA 4C56B 1AGEB 3NABL 4P57B 1ORQB 1MFEH 1TZIB 5B8CC 4PD4K 4N0FA 4GG6F 4M7KL 4ZO6A 4YDKH 4J4PC 1BIIB 1FBIH 4NUGL 3LIZL 1SVZA 2JCCB 1N7MH 1X5IA 3QG6A 2Q86B 3E6FB 3TYGL 4AIZB 4JAMA 1KJ3L 1Z3GH 4UNVA 3MZGB 3F7PC 3GSQB 1NBYB 4N0UE 2F8OA 5HTSA 4L8DA 1HZHH 5EBLB 3CU7A 4BFIB 4RGOL 4M7LL 4XVSL 1MCBA 2DJSA 4P2QA 4JANA 5MEPB 1VA9A 1VB9A 1SJHA 5F44A 4D0BA 1UEYA 2VXSL 1U8HB 2P46B 1IGMH 4PRDB 1S7QB 2JJUA 3LV3A 2X41A 5IMLA 1T03L 1IE5A 3PJSA 5GRJL 1M6OA 1FAKT 4D8PB 5IQ7H 2J6EL 5TE6L 5LWYH 2HFEA 2K3TA 4JY6A 4Y1AD 3QQ4B 2WAHA 2VDRL 2H3NB 3L3GB 5GGRY 4Y1AA 3V4UH 3K3QA 1KCUH 1KELH 4OQTA 3EOTL 4O2CA 3SCMB 1T1XA 4UQ3A 5D4QA 3BPLC 5K9OA 5EZLB 5EOCH 2W9DL 4L4TE 2BNRD 4Z5RA 2BNRA 3VFSA 5L7XH 1XEDA 2NXZC 3VFUB 3BZEA 3U7WL 2ATPA 3AUVA 1NCBH 3MRFA 2FX7L 3JV5A 4NZUL 3BZDA 3QUXD 4Z95H 5E7FA 3QUZC 3QUXA 1JHKL 3VFRB 5ICXB 2IC2A 1NFIA 1ZLUH 2P1YA 5FECB 5B39A 3ULUF 4MD4A 3BAEL 4LLDB 4QTHA 5I6XC 4P9MH 4D0DA 2FL5A 3DSNA 1JPFA 2IF7A 4M6AA 4NPYA 1EXUA 1FFOA 2VNCA 3LQAC 3ZE0F 2AXHA 4S1QH 2HVKA 2PYED 2FR4B 5KTEL 1CFBA 2DWEA 4C55A 2PYEA 4OZFG 4HX1B 4RQQA 1FRGL 4GFTB 1FNFA 3QEHA 1B4RA 1WC7A 3EFDL 5CWSB 5HDBF 3H9SD 1FO0H 3AXLA 4YPGB 3H9SA 1FYHB 5IGXH 4P4RB 1I7ZB 2E5EA 4OBRA 4TSAL 7FABH 2VL5B 2BVTA 3W9EA 4WI6A 4OQTH 4D2NA 2MQCA 2YPVH 3R8BB 1Q9LA 3TO4B 5HYSG 5A43C 4LKCA 3BN9C 3CVHB 3VI4E 4L29B 2DQDH 3QDJB 3D87B 4PRNB 4XPHL 1NDGB 3ECBB 3MRDA 1RD6A 4G42A 4PJAB 3IS1X 2MCPH 1FGVH 2NY4D 1HH6A 1FFQA 1ZLSH 3GM0A 1A0QL 2N7AA 4NO3A 4H1LH 2V7HB 3AB0C 4F9LA 4PLNC 5I1KH 4NZTH 3TJEH 1D5IH 4FXGB 3T0BA 3GSVA 1MWAB 4WGVB 1ETZB 4YFDB 2R4SL 4KI5F 4NGHL 4UNTA 1I9IH 1OHQA 5DD5H 5FV1L 1G6VK 3WNMA 4F8QA 4X6FB 2AV7B 4LGRB 4XAWH 2A6JA 1K3IA 4XPTL 2OR9L 4K71B 1PYWA 3OV6A 3DLQR 3WJJC 4K7PL 5DK2A 2OJZL 3P0YL 4DQOL 1B3JA 4HKXB 1FJ1A 4ODVL 1WUNT 5GRYA 4X6DB 5AZ2L 2VZUA 5HBBA 1F8TL 5KJRH 4L4VE 4KY1L 3SPVB 5HPMB 4IOSD 1G1YA 1IKNC 1CGUA 4FQLH 43C9B 3FB8B 1FL5B 5BOZG 2DLIA 3L3KA 5DC4B 4CL7A 4YQXH 2NZ9D 2HFGH 5KZCD 3S5LG 4QHUB 1RVFH 5KSBF 1SJEA 2BRRH 2VDKL 4G6JL 3PHQB 5J13B 3JTSA 5C2UB 1E4KC 4OZGB 3MNWB 3A6CL 4DZ8B 2PTVA 4XMPL 3QISA 1T7YA 5C07B 4PFEA 4U6HB 3SQOH 2W60A 4PJBB 5F72S 3V6OA 2KUTA 2XPGB 1G6RB 3FT2B 2X09A 1U8NA 3NFPA 3LN5B 2B4CL 2OTUB 4HK3J 3NH7H 1JF5A 1IEAB 3BDBA 2Q76A 1OF2B 3A6BH 4PRPB 3WXWL 2APXA 2VITA 4EI5C 2WBJD 4ZOCA 1RUQH 4RAUA 2WBJA 4YAQA 4Z78B 2VJXA 3VG0L 5KVEL 4OZHA 4WGWB 5GSRB 4ODTH 5D70L 1KIQA 5MP6L 4EEEA 2NY5H 4HGMA 5JQ6H 4HS6A 1QO3A 5F88B 5A40E 5SWSE 4FQ1L 4PJXB 4WHCA 3BYTA 4FXLA 4I18B 4TVPE 1JNLL 4U0RB 5TF1H 2V2XB 3NIDF 3S88H 3JWDC 4GG6B 1FNSH 3FAWA 4V2CB 5E5RB 3AREA 4TSBL 3W0WB 1CDUA 3AM8C 3DSFH 3IDMA 4WWKB 1F3JA 3G5VA 4DOHB 2AJXL 1ORSA 1MRCH 1QFWM 2BY1A 1KN2H 5HDQH 1WBYA 4N5UA 5DJ6A 3PF2A 1CD1B 1KG0A 2DLFH 4XMKL 5IVZB 5DHXB 1A14L 3T0XA 1KULA 3FQRA 3NIGF 4IRSC 1OTTC 1RPQA 2ADJB 1DQDH 1ZK9A 1JZ6A 1NCTA 5SWQA 5ETUB 3IDJB 3O3EA 3MBXH 3MQIA 3MREB 1IM9D 2IMNA 1IM9A 5D1QB 2YD6A 4DEPB 1XGYH 4LOUD 1UCBH 1LEKB 3QDHA 4NOBA 2FYYA 4GMTH 3W82A 2ZUWA 3ULVE 5TE4H 4PRHE 2AP2A 3VXSA 5LGHL 3FT3B 5IB5A 4G3YL 4HF5L 5JA9A 1A9EB 2VTFA 1KLUA 4NKIH 5EU6B 5ID1A 3VU2A 4IMKC 4XCEA 1R5WA 2DLTA 1B9ZA 3FB7B 5HYEA 5I76A 4AEIH 5E1AB 4LLQB 3WIHL 3RWHB 1DUZA 3BIKA 5KANG 3BW9B 3VH8B 3CFCL 4UIMA 5GSVA 3AROA 2BSSB 4PB9H 4NO5B 3LKQB 4RA3A 1P6FA 2CKBH 3MRHB 4MB5A 2ICWJ 2H1PH 1QYGH 3AS1A 2DQIH 2ZG2A 1IM3B 4UIKL 4DN3H 2A0LC 4DVBA 4JN2A 3KJ6L 5C9JA 1XIWD 1XIWA 2F54B 1FFPB 3N1FC 1UC6A 4HBCH 1ZE3C 4KDTC 1A9BA 1FFNA 3QEGH 1GL4B 4UOW0 2EH7L 4OI9A 2HLFC 5I8KH 2DQTL 3PUCA 1PBYA 1UWXH 5EZJA 1GHFL 3QHZL 5ITFB 1IC5H 4PBWD 3NTCH 5E2WL 2H9GB 2BY2A 5D1XB 1U9KA 3D5OF 2VIRB 4CW1A 1KB5B 2R69H 1N4XL 3KR3H 1KB9J 2UYLA 3L3JB 1T80A 1DZBA 3VWKC 5EU3B 1MHHA 1ZKAA 2DLEA 1BOGB 1TCMA 2AEQH 3IETA 3VMNA 1JMXA 1G9NC 2EYRA 3HE6C 2VLKE 4MAYB 3RTQB 2BSTB 3H6JA 3KAAA 4Z6AT 3K46A 4YHLL 2P5WB 3I02B 1SM3L 4GBXB 5IEKA 3EYVA 5JIHA 5JQHC 4N0YL 4FQHA 4DK6A 4J12A 5IG7A 2V2WA 1MFCH 1YDPA 4FP8L 4L3CB 3ZE2F 5D6CA 2CGRL 4HWZA 3TEUA 5FYKE 2X6MA 1N0XH 2KQMA 2X4SB 2ADIB 3BZFA 4NUJB 4I2XB 5F7KC 5SV3A 4OCNC 3ME0A 5AYUH 2JJTA 4QWWD 3MXVH 1NLBH 4ZD3L 3PNWB 3HUJB 3OKYA 3RI5K 3RL2B 3QCVL 4IDJL 3EDFA 4PRBB 3D3VD 4J6RL 3D3VA 2YD8A 4GXVH 4JLRA 5EOTA 1AGEA 1PG7H 4YHOH 5TE7H 2OSLB 2VE6B 3HS0A 4HIEA 4LK4A 15C8L 4IJ3B 4GSDH 3C5JB 4JM2D 3CSYB 3TN0D 4JM2A 3T09A 3TN0A 1NCDH 1GOHA 2NLJB 4PTTA 1L0YA 5FYLE 2ZOKB 1U91B 2EDJA 4LRIC 3WJLA 1Z2KA 1PQZA 1KSRA 3QIUC 1HH9A 1DQLH 1E6OH 1NBYA 3WLWC 4Z7NE 3QWOA 3EDEA 4BFIA 5INDA 1YEDB 3TJHC 5HY9B 4PJGB 1J9CT 1FNGB 2BNQE 2KZWA 3O8XC 1SJXA 4RDQG 1PKQE 1B4JL 2QHRH 3OGCB 5C0AB 5D7SL 1S7VA 1CS6A 4BJLA 5BV7B 5J6GA 5FA4A 4UTAL 3MJ7B 3LB6D 5C6PB 3UC0H 4JDZB 5F97E 1GXEA 4CBPA 1G7MB 4LP5A 1TTGA 1DQQB 3OXRB 4QOKD 2HRLA 1N59B 3NVQA 4QOKA 3IKCA 1A7OL 2YPKB 4XGZB 4LSDA 4M6MH 3L3GA 5IJKC 3DUUB 1NGZA 4GUPB 1DN2A 2PTTB 4KGJA 3MX0A 4OUOA 1XR8B 4XAKD 4HH9B 3RPKA 5TDPA 1BFOA 2KBGA 4Z7WE 4NQSB 2ADGA 1X4ZA 5EZLA 1MQ8A 2A9NL 3HMWH 5E2UH 5C8JA 1C5CL 5DRXA 4ERSL 1NMAH 3V4VH 4X9FA 1RJCA 3C60B 3DWTA 3D69A 5BOPA 1XCQB 2CR6A 5AYQA 3X3GL 5AUMB 4MCZB 4M03A 3UJTL 1WIPA 4KJQC 2X44D 3RVXD 1A7RL 4R0LC 3GI9L 5CINH 3Q2CA 4MJ4A 3PWJB 1UQSB 4QRQA 4L1DA 3N06B 4JFOB 4LLDA 2AJVH 5I30L 3WLBB 1IILE 4I0PC 3ZT5A 1IGFH 1KEGL 4B5EA 3IFOB 1UXWA 1PY9A 5F9OH 5BRZE 1CBVH 4OSUL 2Y72A 3K4DA 5C0DA 1Z9MA 1OP3K 2L4OA 1HOCB 3OKKA 4OCYL 4WJ5B 3BIBX 2C4FU 3V2AR 5DRZB 1G7HA 3C6LC 4ZFZA 5KVMC 2AI0H 3HZMA 1AHWB 1X6LA 2GSIB 4N90D 2AABL 1ZGLP 2BVPA 1T5XA 1LEGB 2JJSA 3PDGA 1BJ1J 2FSEB 4M62L 4PGBB 4MX7B 1U3HD 2DQEH 3D0VB 5F9AC 1ROWA 3TT3L 1U3HA 3DURB 2FNBA 3MV7E 2XZQL 1HDMA 4K3DH 3C09B 4OZHF 4WFGD 5BW7A 2P8PB 3CLEL 4L3EB 3RGVB 5MENB 2IGFL 1T2XA 4XP1L 3VW3L 2R0WH 4HEME 4Y5XC 2YD5A 3QDJA 5TQ2H 3TYFB 1IC1A 3EYFA 4QX