4PGDB

Mhc class i in complex with modified sendai virus nucleoprotein peptide fapgnypaf
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title The first step of peptide selection in antigen presentation by MHC class I molecules.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/peptide
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pgdB00
5FECA 1DSFH 4P2RD 3RDTB 4FABH 4HXAL 2PO6C 3MRQB 1R3KB 2ZCHL 3CH8A 3K2MC 1F3JB 3HG1A 1D5IH 4FS0A 3GSOA 4ISVB 2OL3L 4ZQKB 4L1DA 1T20A 3C8KA 3CDFA 1HN1A 35C8L 1OAXL 1U2HA 5EN2A 3ZE1E 2AK4E 1BQHA 3T4YB 3KPMA 1GZPB 1ZS8B 4C83A 4OCNC 2WUCH 1RZJH 3HNSL 1PX4A 1MLBB 5CP7B 2W1NA 4OI9A 4K3JL 4WTWA 4PLJC 4WI4A 2FWOA 5TFSH 1D6VH 3VG9B 4L4VB 4ALAH 3Q6GL 4X6FA 3T2PA 5SX5K 2BC4A 3ABZA 1YZZA 4R96B 1GYAA 5DHYA 2Y72A 5E2JA 5EOQH 4FQHA 5FKPA 1VHPA 2I9LA 5E2UH 3TFKC 2LAGB 3MRDB 5DJXB 1KJ3L 1YEJL 1GZQA 3CPLB 1ZSDA 1FYTD 1VESA 3MLZL 4A6YL 2DWEA 4BZ2L 4L4TA 25C8L 4PJXE 1XF5A 2ZOKA 3MLVL 1G7QA 1BZ9A 2VITB 4XAWL 4LCWE 4ODBD 5HGHA 2C7UA 1WEJH 1DBAL 4DN3L 2RQ8A 3MV9E 3GDBA 5C0CA 2ZG3A 2DF3A 3NIDE 1MCEA 4K7FA 4YHLH 1TTGA 1WZMA 3LQZA 4JM2B 1I1AC 3KHQA 1SJHB 1DLFL 3U46A 2BVEA 3AROA 4NT6A 4YPJA 5ANMA 1CE6A 1CDYA 1I1YB 1L6ZA 3GUTA 1HIMH 4NWUL 4PJBF 2BXYA 3T2NL 3E2HB 3BZ4B 5E2TL 4HX1B 2XACC 5GRYA 1OGAA 4Z7WB 3CLFL 4U6HB 2V2TB 2CXGA 1RJCA 4NWTH 4NN7C 4MJ4A 4CBPA 2WWMD 1K8DB 3LHPH 2VXTL 2IH1A 4QXTA 4PJCB 4BKLA 1S8DA 3IJSB 4YQXH 2W65B 4GOSA 1I7UB 3HS0A 2EDYA 4Y2DB 1XGPB 3D18B 1MF2L 4MAYD 5D7JB 4P5MB 3SDAD 3V6ZB 2E27H 5F7UA 4QRPD 3P9MA 1A02N 2Y36L 1C5BH 4KUCF 3ZTNH 2X4NA 5EZJB 1G6RA 4NFCA 4DGYH 5EU4A 5E6ZA 2DDQH 3P3YA 4HAGA 3IAPA 4NSKA 3H8NA 5GGRB 5FO9A 1DN0A 4CNIB 3MPCA 5IB1B 2Z8SA 4NUGL 4MD4B 1RVFH 1M71A 1U8OA 2B1HL 2FRGP 4LCUB 5D96B 2Y07H 1RU9H 3KYOB 2GK2A 1FH5H 4G7VL 5LWYL 1HWHB 1IGYB 3AREB 5KZCB 5JR1H 4DEPB 3AS1A 4PJ8A 3N06B 4PP1D 3OKNB 3MV11 5L7XH 3QDAA 3DVFA 1AR1C 5DK3A 1CLZL 4ZXBC 1OAYH 4HIJA 2K9UA 4XBGB 1CT8A 1CQKA 4W68A 4YWGH 4F7PB 4L3EA 4Q2ZA 3O4LD 4LASL 3L1OH 3RA7H 5INDA 3EZ8A 4JY5H 5D4QA 4MVBD 1FZOA 2PXYD 3RZCD 4K8RC 3BDYH 4KPHH 4HK3N 1S9VA 3HUJE 2F54E 3ILQC 3RGHA 1JWSA 1AKJB 1LP9F 1F5WA 1HQRA 4FRWA 4EQ3A 4ZDHA 2DTMH 4NKQB 4Z95L 2APWA 1HXYA 4E41D 1CE1L 4FFYH 5SWSD 4M5ZL 5TQ2H 1OGTB 2BDNH 2EE2A 5JORA 3SE3A 4WHTA 5EWIL 1U93A 5E08H 4YJZL 5DQDL 4OI7A 1CL7H 2FGWH 1I3UA 3ULVF 3BJ91 2NW3A 3D85B 4O9HL 4PJBA 3BT2L 2CH8A 4MX7B 4POZC 1NAMH 4P5TB 5C08D 3REWB 1LO4H 3WS6A 1MCHA 2Y5TB 5HGAB 1OAKL 4NOBA 3ELAT 2IGFL 1J5OL 2X6MA 1ZLUK 5C0BA 3F7PC 4YH6A 1QSFA 4ZPTB 1YYLH 3GMMB 4ELME 1DEDA 1BBJB 2BFVL 5HHQA 3W9EA 4OUUA 3MXVH 3A67L 1FFPA 4KTYA 1RZ7L 3VFGL 2FX7L 5FK9A 1OAQH 1QR1B 5B8CC 4JKPH 5CJ5A 1CCZA 2W0KA 4JKMA 5T33H 3RNKA 4BQ6A 1EEYA 5C1MB 2APBA 1YECH 2X1XR 2JJUA 1YA5A 4NNPL 1P84K 5D7IE 4JFHD 5JW4N 2EDWA 2FZ3B 5D8JH 2BERA 5ITBL 2FIKA 3BN9D 3ZO0A 3RIFK 4MNGE 5IG7B 5EUOB 1WQVT 1IZKA 2IBZY 1ITBB 3D2UB 2A73A 1PQZA 2Z31A 5IW6A 2PO6B 4MDIA 4APQB 1EGJL 1XGUB 2VZTA 1JJUA 4UMGA 3PGCB 3U2SB 3GFUA 5D72H 3J7HA 4PLKC 4PUBL 3HCVA 4N9GB 1RZKH 3RWCA 2VL4A 3NACL 2YA2A 4WIQA 4HS6B 3VGGA 3QXAB 3BP5A 1P5UA 1K3ZA 2AERT 4YZFE 4KKAC 5DD0H 4ODXA 4MA8H 3VWJA 2CGRL 5BVJB 4UU9A 1HYSD 1NCDH 4M7KL 3SCMD 1Q94A 1T5WB 3IXTA 1FO0B 2E8YA 3QNYB 3DX6A 3BPLC 3QXDA 4HIEB 5D7JD 3LKPB 4KKBD 5DI8A 2F8VA 2ATPB 5D2LB 1T0MA 5HDOA 1MHEB 1G7MA 4HD9A 4KAQH 3D39B 3FZUD 3KPPB 3MOAL 4TSCH 4Z9KB 1JYVA 4HKJA 3O0RH 1BOGB 1IFHH 5F70A 4DCQA 4TYUA 5F9OH 5EPMB 3S88L 2VMFA 1XF3B 1CLYL 2OL3B 4QGTA 3ALPA 3T1FA 4JHWH 1K5NB 4S1SL 3MLUL 5FKAA 4Y4FA 1KV3A 4XRCB 1BGXH 4ZUSA 4YHOL 4UQ3A 3O9WC 4LDLB 3MODL 1EPFA 1OAUL 3QCVL 1A7RH 3RWDB 3A6CH 4MS8D 4OIIL 4PY7A 3D48R 2NY4C 3H9SA 5EU6D 5CEZH 5IMOB 5BZDA 1I1AB 2CMRL 3RWIB 3ULUL 15C8H 1MCDA 2M26A 3TBWB 4X7SH 3L5WB 5DHVH 1Z9OA 1MUJA 1T5XB 5MENB 2FEEL 3BGAA 1Q0XH 1JTTA 1F00I 2OP4H 3SE8H 1EO5A 4HIXL 3HG1E 4KK8D 4R4BA 3BD4A 4YO0A 4Q7DA 2QJDA 4OD2A 4NN7B 1KTLA 4AEIL 4OCMC 3DMMA 4QHUA 3T0XA 5C0FB 2FJGB 4MA7L 2YPLA 3KWWB 3QG7H 3W5NA 4WJ5A 1QYGH 4XXCC 1LD9B 4LPWA 1EEZB 4L9LC 3WO3B 3WNLA 4D2NA 5I1IH 3RVTC 5MEOB 3WUWG 1T7ZA 3GO1L 4I0PD 2YPKA 4Z7VE 1I1RA 3VXRA 4YNYB 1TZIA 1R24B 3RL2A 3NIGE 2D7TH 3S36H 4PFEA 3D85D 3O2VL 1BX2B 4KXZH 3UTOA 5EU5B 3OX8A 4YDIH 4P5TD 1T7XA 1B2WH 1S9WA 5J06A 2AJ3A 2IMNA 4L4TE 1UWEL 1QLEL 1CD1A 5E8EB 1FZJA 1H15A 3OKOA 1JUFA 2DQDL 5BRZB 1P4BL 4NZUH 4P9HC 1FQ9C 2DICA 1FNGB 1KCVL 1ZA6B 4J1UB 2AXHA 4OSUL 1ZLWH 1YYMH 1DANT 5C0CE 4XNYH 4ELKA 5T3ZD 3ILPA 4YXLH 3A6BH 3AU1A 1IGIH 3VH8G 1YEEL 5ANME 4ZUVA 1ZGLB 1RIVH 4GFTB 3U79A 1JWMB 4LEOA 2XWJB 5AZ2H 3VD5A 1ERNA 4GRLD 2RB8A 2I60H 3FO2A 1I9RL 5DD6A 1OGAE 2VAAB 3HPLA 4NC1E 5EIQA 3GM0A 3S5LB 5C2BL 3D2UD 5DK2A 3FJTA 2PO6D 2X44D 1J10A 2XZAH 2X4UB 2R23A 1C7TA 1E4JA 3ARFB 3HRPA 5CD5C 5EIVA 2IFGA 2YR3A 3NCMA 4RIRA 2FBJL 2PW2A 3KYMB 2MPAH 4G43B 4AH2A 4LSPL 1NFIA 4LRNL 4G3YH 4OB5H 4NGHH 5DD5H 2VLJA 5H2BA 3ALWA 3MV8A 4KRMB 1NCNA 4UINH 3FQNA 4JGJA 1IAII 4NFDA 1QBML 2Q8BL 3QUZA 4O02L 1QNZL 4LLAA 4PLJD 1CICA 3OR6B 4D9RD 4NKDA 5CINH 4M6MH 2APTA 4Z6AT 5IW1B 4F8TA 3I6KA 2R1XB 3WYRA 3PV6A 4GBXA 3D39D 2YBRA 4RQQA 5JPMB 4NHCL 1IC5H 3TFKD 4YEFA 3PWPA 1GHFL 1RJZB 5GGVH 3LQMA 3VMNA 2VN7A 3FFCD 4XVTL 4FQCL 4UOW1 1JPGA 3DGGB 1MJ7H 3PWJA 3TT3L 1A4KA 3S6CA 2FX9H 3V5DB 2WINB 2FO1A 3GI9H 3MFFA 3MLSH 3E1F1 3GSNA 4Z7UB 3N85L 2EDOA 3G9AB 1SM3L 4Z0XA 4LVOC 5DFWH 2HJKA 5EBWB 1D5MB 1KXTB 3O2DH 4UT7H 4L3EE 3JV6A 5TDNB 1FC2D 5DLMH 1I1AD 4TRPL 3L3DB 3EYOA 3V6FA 1N6UA 1ND0B 1Z9SA 4PLNC 3LSOA 5JXEA 5FEBA 3GB7B 4N0YL 5MEND 4OCXH 3SGEI 4MQSB 3DSNA 3RTQA 1S5HB 1R3HA 3L3HA 5JQ6H 1FGNH 3QEHA 1BQLL 2QL1A 3ROLA 2G75A 2WM0A 1U8JB 2YD8A 3QCTL 5DJDA 5D7KD 1RZGA 1MCFA 4GAFB 1I8IA 3FB6B 3QNXA 5HPMB 4HHAB 2YUXA 3Q5YA 2AI0L 3ZE2E 3HZMA 1CXEA 4F7CA 3VFWA 3OGOE 1EXUB 2VXUH 2X41A 1T21A 1EAJA 4XNQB 1ZVYA 3BKML 1LE5B 1WSST 5JNYA 4H1LG 4ZTOH 3QJFA 2RHEA 3BMWA 3LB6C 4HQQL 4TUOA 3RX5A 2DD8H 5I8KL 5C0BE 5K9QG 2FB4H 2E6QA 3J8F7 4OCYH 1GAFH 1QSFE 3VFTA 4BK4A 2FR4A 3P11L 1HI6A 4WCYH 4FTVB 5EOTA 1BWMA 2C3XA 2EIEA 4ODHL 1FLRH 1PYWB 4P2QD 5F1KC 5I16A 4XP9L 5IWLA 1X4YA 5J6HB 5JQHC 3T2OA 4YHML 1QFWL 2BY1A 5ENWB 3GSVA 5I75B 3NFSL 4XPAL 2C26A 3GBLA 1WBZA 5FO7B 2B39A 2QQKH 4A2LA 1I3RB 1AR1D 3P4OA 4JCLA 2R1YA 1HH9B 5TJWK 1IEAB 2Z91A 4ZXBD 2C9AA 1Q9WB 2V7HB 1I7TB 3V4UL 3NCCB 3JV0A 2PYFB 5JIKA 4JPIA 1TVBB 4BSVB 3OKLB 3GZKA 4RGNB 5FCUH 3NABH 3NA4A 5JXAL 4E42B 3LEYL 3P0VH 4K8RD 4NRYA 3OKMA 4LSRL 4NBXB 1ZA3A 3DIFB 1JZ6A 3P4NA 4H1LH 3V6OA 3IDMA 3ILQD 4DKFH 3R06A 2QKIB 4XP5L 4R97B 4G6KH 3BD5A 4K9EC 5A2IH 4OTXL 2B0SH 4JY6A 5TE4L 3ARFD 3P9LA 2BNQB 4L9LB 5I15L 1HK6A 1IGTA 2DQUH 3SDCC 3VWKA 1G0YR 4ODTH 4KWUA 5F93C 3FOLB 1BZ7A 3QI9B 4D3CL 4JE4B 1QSVA 2PTVA 4NC1C 4Q0XH 1N6VA 4U1SA 4U3CA 1H3WM 5JOFA 3L3GB 3MRFA 4ZUWB 3DUSB 2MOVA 4LARH 1NGPL 1KJVB 4POZD 4Z78B 4PRNA 4P59H 4NCC2 4HDIA 1T4KA 3FCTB 5T3XE 2X4RB 1YEIH 4Y4HA 3O6FB 1S7RB 3RVVC 3IKCB 5C0JA 3B4NA 4Q9BA 1A6UL 2X40A 4HZLB 4X4ZA 3VFOA 3G08B 2F5AH 5FUZL 4P2OB 5IHUL 1URLA 3ULVE 3TZVA 3WIFA 3ZKXB 1BMGA 3H9SE 5L6YL 3RWGB 4JANB 4NHUB 4ZFOL 1ZWIA 5L8JB 2GITB 2H2SC 3CNKA 4NQEA 3KPLB 4PJHF 2CR6A 1OSPH 5C0AA 1T3FA 3LVEA 4IJ3C 2ZUQC 4IOSD 4NQUA 3OG6B 2O5XL 1V5JA 4IDJL 1OVZA 4LCWD 4J23A 2FH8A 3BPCA 2X9YA 4R26H 1HEZA 3EYVB 1J0HA 2YPLE 1XMWA 3L6FB 3MV9D 3B5GA 4PLKD 4GKZA 4HLZH 2GUOA 4RWYH 3QUXA 5JDSA 3CFEA 3VXRE 4JQIH 5E00B 4KKAD 3CVHH 3OF6A 3FONA 4X6DB 5DR5L 3Q3GA 4NM4H 3QXTA 1JGEB 1L7IL 5I1HH 3IFLL 2W0FA 1AQKL 3QRFM 1MLCA 3B6SB 4XWGH 4DK6A 3MV01 3HAEH 5HJ3B 2DQCH 4LHQB 4OM0L 2BSSA 2X4OB 4WV1A 4YDJA 3EOBA 4F7TA 3SE3C 3LY6A 5ETUB 2CJUL 5KVFH 4M1GH 4U0RC 1LEKB 1EBAA 3BXNB 2AV7A 2JCCA 3D69A 4FTVD 5I1LB 4XZUB 2E7MA 2EE9A 1VEMA 2XZQL 3MLWL 1C1EL 8CGTA 2EEDA 1WBYA 3O9WD 3OKEB 3VI3E 3KJ6H 3WS6C 4LVOB 5LQBL 3M1BA 2VQ1B 4HS8H 1KIPB 1TETH 3TIDB 1F6LL 2NY4D 1JK8A 1DE4B 2B7DT 2NX5A 2VISA 3Q48A 4QNPF 3IDXH 2P5WA 4XPBL 5GRJL 2OQJA 3D3VA 2IADA 4WDIA 5L2JA 3SKUD 4WHCA 3IRZA 1UWGH 4GUPB 1P1ZA 2GJ6B 3VXOA 5KSVB 3JWNC 4HG4K 4RX4A 1W72B 5FB8B 4KI5E 1Q72H 4RGND 1JF5A 2HJFB 4X5XA 5FGCB 1WV7T 3OB8A 3EOAA 2PYEB 4WI5A 1LK2B 1NANI 3GRWH 2NTSP 4BYHA 2XV6B 2ZOLB 4XHQA 2VZSA 1U8KB 2VLJE 3MV8E 5ERWB 2BNQD 2WQ8A 2R2EA 1LE9A 3FL7A 4PJHA 3RVTD 2DKUA 1FL5B 2HN7A 3MRGA 2Q8AH 3CMGA 4PJAF 5KBNC 1U92A 4YDLC 2GY7B 3IRPX 4ZMAT 3I85A 1YUHB 4LHUB 4NKOB 3VGBA 1H8SA 2I24N 3DBXB 2F54D 3LEXA 4N1HB 2CLZA 1INEL 3BYYA 4OCRH 2OSLB 5F7EL 1G7JB 4H20L 1J8HA 1MFBL 1JPTH 1NSNL 3PWPE 4JFXA 4JFDB 3ZTJG 4QHNA 1BLNA 4TUKL 3G5VA 5J13C 2CSPA 4XPHH 1HSBA 4ZOCA 1DUZA 5EZLA 2X1PA 3O6FD 4CADA 2HLAA 4Z7VB 4TTDC 3P77B 4KGLA 3FQXB 3EDEA 4L29B 3CFIC 3FQRB 3C8DA 2DBLL 2JB5L 1U91A 2NW2A 4OBSA 5C07A 2ZSVA 4YFLI 5E4EC 3BYTA 5TDPA 5C3LD 5IK3B 3TC9A 2VQUA 3HZVA 4HUVA 4G8FA 1P6AB 4HWEH 3QHTC 5ESQA 4WUUA 3WDHA 3JWOL 5AAWA 4OCWH 3HE6B 4PJ7F 4Y4FC 3W11C 1MJ8L 2V9QA 3SKOB 4ONFL 5FGRA 1Y0LB 3TT1L 3TPKA 1CXIA 4LAQL 2L7UA 4YIQA 1QQDB 3V0VB 3VFPA 4JRWA 1RFDH 3MJ6A 3LQZB 2VWEE 3GJFB 1U3ZA 5EO0A 2XWBB 3ARDB 5CD5D 3CVIL 3ARXA 3QUMH 4B7IA 2A9NL 3SDCB 1W0WB 4PS4H 2W9EL 3GSQA 4NNXA 3P2TA 4MNHB 1LO0H 1KYOJ 4WO4B 4XBEH 4U31A 2H3NA 2NY3C 3CXHK 4LLWB 1U42A 3QDJB 2X4PA 1CVRA 1MIEL 3CDCA 1VCAA 3DMMC 3G5XA 5B3JF 5KAQG 1YEDB 3STZA 4B50A 4TVPL 4L8BB 4J4PA 5DVKA 5D1XA 1ZHNB 4GQ9L 5CHNA 2P5EB 2VSCA 3MYZA 4AT6A 1RZIB 2JIXB 3TWCL 4UILH 2W9LA 1D5BB 4XXDB 1J7VR 2HKHH 1S7SB 4OZIB 3UX9B 1JGLL 4QHKI 1CGWA 2OR7A 1TITA 1NH6A 5DC0A 3QJHA 4KRPC 1OM3H 4PJAA 3VXNA 3UEZA 4NZTL 3QZWA 4QLRA 1H3PH 1W0YT 4HEME 4ORZC 5I1GL 1E6JL 1K6QL 4W6WB 1QRNA 3S96A 2Z4QB 2DYPA 3MSPA 5I30L 2V17L 5EU3A 3I2CL 5T3ZL 1MCWW 2H8PB 2LVCA 4IJ3B 2JK5B 1XR8B 4RA3A 4KJYA 2EYSA 5KS9F 1HILA 1CDUA 1HKLL 3MR9B 3IKKA 2GJ6D 1XF2B 1JNNL 4R7NB 3BVNA 4Z0BH 3LH2L 3FQWB 5AYUH 3FKUS 3BQUB 1JI1A 4L3EB 3DSFH 5TPWH 4KTDL 2A6DA 5J89A 1MRFH 1A6AB 4LLUA 4EIGB 4JRYB 3EFFB 2N4IA 4PJGF 1IILE 4YE4H 4ZFGL 3RPIB 1ZHBB 1R5WA 1B88A 3L7EB 3LRSA 4PJ7A 4L3CA 1HQ4B 4AEHL 2EH7L 4XCNB 3WIHL 1PX3A 4KI5C 3FO0H 5E2VH 4MD0B 3PF2A 3UTTB 3VJ6B 5DZNA 2H6PB 1GC1L 1RUML 2RAMA 1JNLH 2W0PA 5FYKL 2NY7L 5DJYB 3STLA 3MYJA 5EBMB 4JHBA 4Q9QL 4R3SA 4EN3B 2QV2A 1N3NB 4P3CH 4O51B 4JFDD 3X3FH 4PGJA 3BP4B 3TO4A 3ZL4L 2X4SB 4XBPA 3QUZC 5E6YA 4NQVA 1CGTA 3EJZC 1J1OL 4CW1B 1IC4H 2OCFD 1FNFA 1UCBL 4U1KA 6FABL 5E99H 1UXSB 4RNRA 4I77L 1JHKH 2UZYB 2VL5B 1T83A 3LZFH 5DRZB 5GGVY 2V2XB 4G9DB 3WFDH 5L0QB 3WHE0 4NQEE 3P0GB 2YHGA 4MZ2A 5EZIH 4EBQL 2AEPL 3VXPB 1L4IA 1PEZA 3Q5OA 3C5JA 5DTFA 2IC2A 1FO0H 2L4OA 2DQGL 3CZFA 5ACLA 4HKXA 1ZANH 3EKCA 1KC5L 5ADOH 1VFBA 5L8KB 5IV2B 4HXAH 5CJXA 2R69L 3MROA 4B0MM 5C0CD 1FGVH 4QEGA 5MERB 3RUGB 4LF3B 4TSAL 2OL3H 5I8CB 4P23A 2Y9RT 2RGSA 4ZFFB 1I1CA 2NXYB 35C8H 1I4FA 1OAXH 1BVLA 1T1YB 4P49A 4RA0C 2CIIA 1QLRA 3SDCD 3KDMB 3TBSA 1JYWA 4S0TD 4UIMB 2YWYA 4X4XB 1OT2A 4JGMA 4YDLB 2HLFC 5IB5A 4FQJL 1AQDA 1OGAD 1L0YA 4K3JH 4YHKL 4ZFZA 4CVZA 4PJIB 4P3DB 3F7VB 2QR0B 3VDAA 2X7LB 3BWAA 5IEHA 2VWEC 3G04B 5DDHB 1X5JA 3BH9B 3IFNL 5ILTL 2EC8A 3IJHA 4HS3A 2DQFB 2JCCE 4LOUC 5IMLA 3BGFC 5GXBB 1KJ3H 1YEJH 3EJJX 3KJ4C 3RVVD 3BRDA 2J5LC 3MLZH 4A6YH 4BZ2H 3EFDL 4K94L 4PYGA 3OZ9L 5IBLC 25C8H 5D70L 4EUPG 4PJGA 4GW1B 1ZHLB 4XAWH 3LKNB 5JW4Q 4AG4L 1EVUA 5E4EB 3H2WA 5IB2A 3JV4A 5C0DB 1DBAH 4I18A 5TDOA 4QXWA 4DN3H 2NX5E 4IRSB 2P5WE 2AEQL 3QT2A 4KUZH 1WC7A 3KLSA 3QB7C 4YHPB 2H2SD 3SGDI 1IAIM 2NR6C 1SEQL 4OKVB 4P46A 1CU4L 4XPFL 4JRXA 2F74B 2YOCA 2HT2D 1JWUB 3GSRB 3LD8C 4NWUH 1V7NL 3T2NH 1OW0A 1NDMB 3QXUA 4CMHC 1PKQB 5E2TH 4KH2A 1DBKL 1FORL 3CLFH 1IL1B 3KYAA 1JHLL 2ATKA 2DQEL 3IGAA 3HR6A 5B38G 2X89A 2HKFL 2VIRA 2FYYA 5FA3A 4K8RL 4U4BA 2VXTH 1JN6B 4L3ED 4PJHE 2CRMA 5JA9A 5IP4A 3TESA 1XGQA 1YNKL 4O2CA 1MF2H 1T0NB 3DLQR 5I74C 3NPSC 3B3IA 4L8DB 1VADB 3HC0B 5F7DB 1CXLA 4W4NA 3UJTL 5IESH 1J8HE 1XFPA 2Y36H 1LEIA 2AJZB 2Q1EA 4DUXA 1D5ZA 3WXVL 4KMTL 4GXUN 1MCJA 3CFJA 4XP4L 1ADQH 3ARVA 4OZ4A 5D9SB 3VWKC 2DMKA 5ID0A 5HXMA 4OLUL 4X4YB 2R2CA 1KB5A 1GGIL 1QBLL 3BIKA 3T0VA 1OCWL 4F33B 1GPOL 1FAIL 4PY8J 3MFGB 2MTPA 4KRPB 5C07E 3DO7B 1XIWA 4G7VH 5LWYH 4KJPC 4V2BA 4HH9B 4G6JL 4G80B 3WBDA 3LPWA 5F6IB 4DVRL 5JOPE 4LNVA 4Y4HC 3S3PA 2Z35A 2AQ2A 1P7QB 5C0BD 1A1MB 4IOFC 4KDVA 1I9JL 2Q7NA 1KEGL 1CLZH 3B9KA 2ZCLL 1QSFD 1FNHA 1MWAB 1S7XA 1HWGB 3EJYC 1X5FA 3W0WA 5L9DL 5I71C 2ICWJ 4DWHA 1WCBB 2VR4A 3UTQB 2PETA 3SGKC 3L3IB 4IRJA 1FFRA 3T0EA 4HBCH 1WJ3A 1S9XA 4HJJL 3VFUB 5A40E 1QEWB 1BECA 3V8CA 5HYSG 2X9WA 2G5BB 2XFXB 3LN4A 4Q6IA 2GSGA 5GS2H 4IOIB 3NH7H 4DKAA 3JWDL 4NN6C 4F3FB 4LLQA 4HKBA 1CE1H 2CDEA 4M5ZH 2QBWA 4CVXB 3DXAB 4PRAB 5I1JL 3INUL 2ERJC 3C6LC 5EWIH 1IGJB 1UM6H 5JPNB 5JIPA 1YN7B 5DQDH 4PRIB 3NFNA 2X2YA 4JCMA 3RI5F 1AGEA 2XXMB 4JFYA 4O9HH 1A9BA 3TNNA 5MI0C 1INQB 1ZLUH 3MCKB 4LKCB 3KPNB 4LP5A 1T2JA 4DZBB 3HNTL 5C9JB 1R0AL 4PGDA 1S9YB 3D0LA 2Y06L 1B0GB 4PGCA 3S34L 2CLVB 4XHJD 4XAKE 3X13A 1M05B 2IGFH 3T0WA 1NFDB 5I17A 2FD6L 1NEZG 4LCYA 5DRWA 1E4KA 3QIBA 4YXKL 3GMNB 8FABA 3BHBB 4WGVB 4GRMB 2BFVH 4TTDD 3A67H 4PJAE 1RZ7H 3VFGH 2FX7H 5ID1B 1ZHKA 2VZOA 4WV1C 1QRNE 3MUGB 4OQTL 3PWLA 1UB5B 2EIZA 4X8JB 3CX5J 2RFXA 3X3GL 4RFEA 5IVXB 1CFQA 1YEKH 5DXWA 5FO8B 5T3XD 1E4XH 4IRSD 1A2YB 5ITBH 4PYHA 3QIUB 1BJ8A 4HXBL 4Y5YB 4FMKA 2FH6A 5ALBH 5I73C 4Y4FD 3W11D 3MRHB 2DMCA 5CD3B 1FIGH 1FG9C 5INCA 3MJGX 1X44A 1TCMA 3F7YB 4RAHA 2Q86B 3ARRA 5EO1A 3U7YH 1KXQE 1KENL 2ICEB 4N1CA 1FL6A 4GLRI 5FM5O 4HSQA 5IBTL 4PUBH 1C5DA 5CBAB 3WXWL 4QKXB 5CJOH 4OZFG 4I13B 3NACH 3MJ9L 4LSQL 1FCGA 3MRJA 3S4SA 1UEMA 2CGRH 4LP4A 3VXTA 4M7KH 4MXWL 3VFMA 5GRVL 2NY3D 2XQBL 4HULB 2B8OT 4XCCL 3SE9L 1ACYL 3DMMD 4JREB 1YPZB 2CDGA 1CR9H 3LKOA 5GRVK 3MOAH 3SKNB 5HHME 1XCQA 1WUNT 4BZYA 3BGFB 3KJ4B 1SJEA 3S88H 4N8VG 1CLYH 4H8WC 1WT5C 3VFSB 4JQXA 4PBVC 4X9FA 5D6CB 1AXIB 4M48L 5GGQL 4S1SH 5J6GA 3MLUH 3FQTB 4GAJL 5CGMA 1BIIB 4I5BB 4KRPD 2OTWB 4YHOH 4CMMB 2BSRB 3MODH 4Q6YA 5GSVB 3EOTH 1OAUH 3QCVH 2DBJA 1U8IB 4P9HL 5JIHA 5IMKA 4NPYB 5JLZA 4OIIH 4OF8A 5TQ0L 1OPGL 4GG6B 4WY7H 1DQML 2CMRH 3ULUH 2BRRH 2FJFA 1KELL 3BZDA 1C8PA 3DUUB 5FYLE 3K46A 3RU8L 4LFHD 5B39A 2ZSWA 3WJJA 3CFKA 1TZHA 4AENA 1X5IA 1NJ9B 5BV7C 1H5BB 5HYQB 3T04D 1UM5L 4ZOEA 1SYVA 1RJLB 1MRDL 1KNOA 3KG5A 2YC1B 1F3RB 4AEIH 4CKVX 3AC0A 5BZWB 4WEBL 5BOPA 1KGCD 2JJVA 1Y18A 1Q38A 4J3WA 4MA7H 1SBBA 4LPUA 1IEBA 1XH3A 3VGDA 4YX2L 1BF2A 1IGCL 1SBSL 3LOWA 5I74B 1Z9LA 4FNLL 2AXFA 3GO1H 1X5YA 2CR3A 3LQAL 4Z18A 3T1WA 4U1IA 4JZNA 3BP6B 4KI5D 3MA7A 1XAUA 5FA4B 5BW7A 3F58L 2XWTB 3RBGA 3GM8A 2NNAB 3KPRA 2VAJA 3O2VH 3VWKB 3ZKSD 1KPRB 5BS0A 5DEFA 4JDZA 1MHCB 2KUTA 5AEAA 3BDBA 1M6OB 5EBLA 1TQCB 1QLEH 2VLJD 3K0WA 3MV8D 2CKBB 2I07A 3NN8A 3WIIL 4PJGE 2GSIA 2DQDH 3QUZD 1P4BH 4JZJB 2DM3A 3SO5A 1KCVH 1L7TL 3MV7A 4OSUH 2D4FA 2I9TB 5KSAC 3VGEA 1R3JB 4L8SB 3I84A 1I7RB 4J4PC 2B5IC 1NAKL 3RKDC 5D1XC 3AVEA 5DJ6A 2W60A 1X6LA 1S7TB 1UH4A 2FEDC 4JRXE 5IFJA 1A47A 4CDGC 1YEEH 2Q6WB 2IAMC 1EERB 1JIBA 5I71B 1UACL 2R39A 4NBZB 3AM8A 3KPOB 1FL3B 2VERN 3MNZB 1I9RH 5IHZB 3LS4L 4B7LA 5C2BH 4FZ8L 3CDGB 4HIIB 4GMSH 1KIUA 1KLGA 3QBTB 1XF4A 4M7LT 3I50L 4LIQE 4QRTB 1J1XH 1ROWA 5TGBB 4M61A 2FBJH 1UXWB 4NJAL 4N0RA 4UNUA 5DA0B 2OI9C 3WEXA 1P53A 4LSVL 5DVOA 3MRKA 3C6LB 4TNVF 4JR9L 4LSPH 4LRNH 2V7NB 2WNGA 4LLMA 5F6HJ 4HUUB 1YEGH 4EZMA 2HLFD 3MLTB 4H0IA 1QBMH 1BZQK 3U6RB 4O02H 1QNZH 5MI0B 4Z5RB 3UC0H 4IMKA 3TCLB 5HVFB 5JUEH 1U8HB 4NYLB 4OT1L 1ZKAA 5C6PB 1M7IA 1L9NA 4I2XB 4JZOA 3MX0A 5I0DA 5E8DL 4F37F 1KB9K 3Q3GB 4LOUD 3O2DA 5J1AB 1GHFH 1W72H 5IM7A 4NQXB 1NCAL 1PGRB 1DQDL 4JPVH 4S1RL 4XVTH 1KIRB 2XQYK 5IBLD 1JF6A 1DLHA 1YDPB 1NMBL 3TT3H 4QCIB 1A3LL 4PJ5A 3CZJA 2ADFH 1U58B 3HC3L 3DOSA 5IMMA 3QQ4A 4LHJB 1AGFA 3N85H 2ICWA 4OFVA 3THML 2DLTA 3W0WE 1WGOA 3TO4C 1NGXA 2NR6D 5I73B 1F4WL 3GMPB 3T0EE 3MMEA 4TRPH 4CU8A 3WFZA 2D7NA 5DJ2A 5CMAA 1EZVY 3BO8B 3T4AA 3DVGB 1U8LB 4N5UA 3QEUA 5A16A 5H8DA 3CUPB 2CUIA 1U41A 4N0YH 5EBGA 1MFAL 1NBQA 1UQSB 3VD7A 1DDHA 1P4LA 4MCYB 4U1HA 1FV1B 1Q9OB 1CFSA 1BQLH 1Q0YL 3MGAA 5IKCB 2F58L 3QCTH 2BVUA 3OJMB 1P1ZB 2AI0H 3IDIB 4BELD 1IGMH 9CGTA 4UUJA 4Z76A 2DLIA 4K9EL 2WSKA 4G8GA 5CJXC 3U36A 2BMKB 2FHCA 1LDPL 2A77L 1DQLL 4HQQH 4P23C 5FGSA 4KY1L 4JFPA 4JFEB 5HHNB 4P57A 4MHHI 3CMOL 5I8KH 2AEIT 1DEEA 2BVYA 3PJSA 3VWKD 1S7VA 4QRRA 1F6AA 3QA3B 1NLDL 3VRIB 5C71A 2CO6B 2AJYL 5JZ7C 3P11H 3PHOB 4ODHH 1RD6A 4GG8B 4XP9H 2WWKT 5BMFL 1QFUL 2C3VB 4YHMH 1Z9MA 1QFWH 4KJPD 1LILA 4K71C 3ES6B 4RCAA 5ACZB 3NFSH 1F58L 4XPAH 1FVCA 1A4JB 4LSTL 5CZXC 4Y4HD 4WW2B 5MP6H 3QQ9C 1G6RL 1VKXA 2Y23A 4IOFD 2P42B 4O58L 1KLUB 2P8LB 3EJYD 2P24A 4X5WB 3V4UH 1YNTB 1OP5H 3SGJA 32C2B 4BZ1H 2ED9A 1U6AL 2ZUWA 3NZHL 5E8NA 4QHLB 5JXAH 3VA2C 4I18C 1JV5B 1AP2B 1TJIL 3LEYH 4LSRH 1HHIA 4M6AA 3IF1B 3U4BL 3NCBB 4XP5H 1MCSA 4P46C 3MGOB 4OTXH 1UJ3B 2FSEA 2CDFB 3QFDA 5TE4H 5I15H 2HVKA 2GFBA 2BOBA 3JVGA 3OHXA 4AQ1B 1OW0C 4QYOB 3C6LD 4D3CH 1VA9A 1FN4A 3BRFA 3VXSB 2JELH 3RWJB 5LGJA 3NIFF 1VPOL 1KJ2A 43C9B 4EJ1C 1KCRH 1JFQL 3E8UH 2W92A 2YN5A 4HUNB 5C0EA 3L3JA 3LKRB 5IB3B 1C08B 1RHFA 4Q74A 3BISA 4Y4KC 4YFLF 3L95A 5D1ZC 3D0VA 2ITCB 2YD9A 5CEZE 1HDMB 3V2AR 4MAYA 1T04B 3OF6D 5LG1A 4XGZA 1P2CB 4HGKC 3UBXG 1A6UH 4F8QA 3U0TB 5F9JB 4OLVL 5H94A 5J11C 3QO1A 1G7PB 1IAMA 5CILH 5FUZH 3QO0A 5KSAB 4HKZA 3FFDA 3GIVB 5DEZA 4JM2F 4LLVA 5L6YH 2NXZC 5H37G 1RIHL 1KPVB 3Q6FB 1VFAA 2GTZA 2IBBA 2NY1C 4OAWB 2IAMB 5C0IB 1LQSR 5M94B 2CLRA 3OR7A 2HTKC 3ZDXF 2EDLA 3U9UB 2BOCB 1N6QL 2UWEA 5GRUL 1XIWC 4OF7A 4Z7WF 4C56B 1EK3A 5EA0H 2WP3O 4OIBA 3CVHA 4YPGB 5GSRA 2P1YA 2UZIL 1T1ZA 5IVZB 5DC9B 2G9HB 1CZ8L 3FO1A 1N8ZA 1E6OL 3B9KC 3M17B 4Q97A 1UENA 2EC9U 5A2FA 4ORGB 2P5WD 1ZT7B 3ARGB 3HAEA 4S10A 2DLHA 5C8JB 2P47B 1UZ8B 3HN3A 5ESAA 2HMIC 1M4KA 2B4CL 4IRJC 1N0LA 3T0EC 1X5XA 3H0TA 3H7LA 4RX4D 3PP4L 3HB3C 5TF0A 3RDTA 2XG4A 1JGUL 5DR5H 4TPRL 3MRQA 1R3KA 2EDHA 4Q6IC 5AWNL 2R8SH 3KPRE 2YZ1A 1UCTA 1L7IH 2JLLA 5IQ7L 1F3JA 4FFZL 4P99A 1BFSA 5BS0E 4PGZA 4ISVA 1AQKH 4JVWA 4ZQKA 3IAGC 1RUAH 1MHHB 1QO3B 4OM0H 3LAFA 3O4OB 5H37H 4JFED 1CDBA 3WKNA 1U95B 4XMKL 3S97C 1R5WB 2PTUA 3V79C 3BKJL 3T4YA 1GZPA 3RWHB 1ZS8A 2CJUH 2NY2C 1MLBA 3AB0B 1ES0B 5CP7A 4NRXB 1P69B 1Z2KA 3MV7E 3L9RB 2ZUTA 2R56L 3S35L 4L4VA 4ONOA 5L88L 3GBML 5J3HC 5SX4H 2X05A 3MLWH 4CVUA 1TQBC 2CD0A 4R96A 1J8HD 1PVHA 5EUKB 1LO3L 5LQBH 2WAHA 1JE6A 1MSPA 3MRDA 5DJXA 5FHAL 3O6KH 5LAXB 1E4KC 3CPLA 4RFNC 4JVPA 2X4TB 3GRWA 5GRJH 3DVNA 5C92A 1VACB 4WI2A 2VITA 1LEGB 3PQYB 3PHSA 4Z7QE 5HD8C 3O6ML 5C6WH 4KZDL 5C07D 1XCTB 5D5MB 1OWRM 1BQSA 1G9EA 3NTCL 3MJ8B 1RZKC 2IANB 1K2DB 3ULVL 4JM2A 2H41A 1SJHA 1KCSL 4RAUB 1RZFL 3PHQB 3N0PB 1I1YA 5CSBA 2WIIB 2P43B 4PJEB 3QR2A 4JY4B 5CWSB 3N1FC 3PDOB 4IEFB 3BZ4A 1U8MB 3QPXH 5I1DB 4HX1A 5KVGL 4G7YL 3S98A 1IQWL 1IRAY 4Z7WA 5FF6B 4U6HA 1GXEA 2V2TA 4WI9A 1WWWX 3P30L 4AL8L 1T2QL 2NY6C 3P73B 1INEH 1K8DA 1AR2A 5F7EH 4PJCA 4H20H 3V7AE 5DUBB 3IJSA 4HF5L 1NSNH 2W65A 1I7UA 5IOPB 4TUKH 5FHBL 2QTEA 5DMKB 4Y2DA 1XGPA 3D18A 3PGFL 1SY6L 2N56A 5D7JA 4P5MA 1EFXB 3V6ZA 2QSTA 1ZGLM 3MRNB 1TZGL 1MFCL 1YY9C 4JQVA 3SBWA 4GS7C 1AFVL 3DYPA 1PAMA 2A6JB 4BH8B 4WTZG 1CLOL 5DJ0B 2DBLH 5EZJA 2JB5H 5KSAD 3WNKA 5GGRA 4J4PD 3RKDD 5D1XD 4CNIA 5KANG 2FEDD 5IB1A 5T1DH 5HVGB 3GNML 4OD1L 3TF7C 4NO0A 4UOW0 1NUFA 4MD4A 1DL7L 4LCUA 4XAKD 2E9BA 2IAMD 1QRKA 2FLRT 5E0QA 3KYOA 4TNWF 1ZT4B 1MJ8H 1IGYA 3AREA 3LS5L 4ONFH 4AZ8A 3OKNA 2F19L 4C56D 3TT1H 5HPOA 4I4WB 4ZUUB 4LAQH 1CDIA 2MSPA 1QFPA 3U7AA 5ICZB 1QRND 4LVNC 5K9OB 4BH7B 2DYPD 1FVEB 1QVOB 4XMPL 4BQ9A 5JHLH 2DJSA 4XBGA 2WV3A 2A9NH 3WJJC 4F7PA 4R9HA 2YD3A 2W9EH 3WFHB 4G8GE 3FTGB 1ZXQA 1NDGB 4U6XB 3BOVA 1A7NH 2FDBP 1PLGH 3DYOA 1IZJA 1LO2H 1FNEB 4MYWB 4NIKB 1U3JA 4U0QB 4U33A 1NBYB 1JZ7A 2DWDB 4NUJB 1MIEH 4Y4KB 4I3SL 4RGMB 1AKJA 5D1ZB 1LMKA 3P0YL 4QRRE 1MWAH 3TPUB 4TVPH 2ID5A 5HI3C 5CCKH 3NCJH 4FQLL 4FQPA 1OGTA 4M7JL 5M7QA 3UO1L 5ITFB 1KPUB 5I19L 5IROA 1U2CA 4GQ9H 1PG7W 2X4QB 4FMFA 1K8IB 1W8OA 1P84J 4W6YB 3DRQB 4ENEC 3V4PL 2VZVA 3SPVB 1I7ZA 1EMTL 2UV3A 5BW7C 4P4KB 5TH2A 1JGLH 3D85A 4IS6B 2V9RA 4MX7A 2YD4A 2DQHL 4P5TA 4U1NB 3CFCL 4FQIL 3REWA 1MPAL 4QY8B 2KZ1B 4UV4H 4NZTH 3SDYL 3N1QC 5SV4A 4WI3A 5HGAA 1KCLA 5ESVB 5I1GH 1E6JH 1K6QH 4RMTA 3B9AA 1MOEA 2R4RL 3O6LL 2VNCA 5I30H 2V17H 3CCHB 3I2CH 4ZPTA 3GMMA 4PTTB 1BBJA 1KT2B 2D9QB 5H35B 2FGZA 1CS6A 1QR1A 4QTHB 3BP7B 5E5RB 2HT4C 1HKLH 4BA8A 1D5XB 1JNNH 3WO4C 3LH2H 3MGTB 4PR5B 2FZ3A 3MRBB 4NO3B 1CG9B 3GSNL 3OG4B 3QXWA 5IIEB 4I48B 1OP9A 1B9ZA 3FOMB 3AM8C 5IG7A 5EUOA 1WK0A 3D2UA 2A6KB 3PABB 4ZFGH 2IBZX 2PO6A 4N90E 4APQA 1OOAA 1V05A 2MCG1 1XGUA 4AEHH 5B4MC 1H8OA 3WIHH 1NAMB 3PGCA 3U2SA 1V3JA 1GC1H 4P23D 4XX1G 4N9GA 1RUMH 2Z9TA 2D9CA 5FYKH 4LCIL 2NY7H 5F8RC 3QXAA 4U1LB 5ACMA 4PGEB 4WUKL 3BPNB 3TJEL 5KG9B 5T5NG 4BFGA 4N5EC 2VABB 5BVJA 5JZ7D 1ZOXA 1T5WA 4XMLL 3ZL4H 1FO0A 3QNYA 1CBVL 4HIEA 1J1OH 1EFXD 3LKPA 4IMKC 4Y5VC 3KYNB 2ATPA 1TQBB 6FABH 5D2LA 1JP5A 1F13A 3MUJA 4X0KB 4I77H 1MHEA 4P3WA 3D39A 3KPPA 4XTRC 5CJQL 1WFUA 2MMXA 3UXFA 4XNMB 2XIDA 1BOGA 2MQ0A 3CFDB 3C09B 1N0XL 4M43L 4NKIL 5CZXD 2BVTA 2VDNL 5EPMA 3QQ9D 1XF3A 4X5LA 4EBQH 2UWEE 4JO1H 2OL3A 2AEPH 4XVUD 1K5NA 2DQGH 1F4YL 1OD9A 2F15A 1FFNB 4XRCA 4FZEH 1A1OB 4C57C 4LSSL 1EJOL 3D25B 1JGVL 1KC5H 2BSTB 2A1WL 4KRNA 3RWDA 5EIIB 1XGRB 5F88B 3X11B 2OM5A 1CDHA 4I0CC 5E03A 5IMOA 1MCPL 1I1AA 4EVNB 3RWIA 1B3JA 2Z92B 4TSAH 3UJIL 4P46D 5BCAA 3TBWA 2XY2A 3L5WA 4JRXD 1UG9A 1ZTXL 1T5XA 5CLTA 5LCVL 3RNQB 5MENA 1GOHA 3LEVH 4HFWB 3IS1X 1JVKA 4FQJH 3P40A 3LCYA 1IAOB 4YHKH 1LP9B 2NY6B 4OGAC 2J6EL 1WISA 3KPSB 2X89D 5C0FA 4M8QB 2FJGA 1EFQA 4Y4KD 3KWWA 5D1ZD 2CIKB 5ILTH 1LD9A 4IM8A 1EEZA 5FXCH 1AJ7H 2EDQA 3LDBC 2EDBA 4WEUD 5MEOA 2ZCKL 4L4VE 2J2ZA 3JUYA 1KTDB 3TGXA 2R0KH 1DVFC 4DAGL 4K94H 4NRZB 3OL2A 4Z7UF 4YNYA 1R24A 3OZ9H 5I8EB 2PUQT 5D70H 2YS4A 2DLEA 1VEOA 3SKMB 3G5YB 2DAVA 4NCDA 4P4KD 4AG4H 4LDEB 1BX2A 2ITDB 3G6AB 3KR3L 5EU5A 2NXZD 5C9KA 2J88L 2KQMA 2NY1D 2AEQH 1M1SA 1ODAA 5DHVB 5E8EA 1QBAA 5F3BB 5I76B 1MHPH 1SEQH 1CU4H 1NC4B 5E1HB 5BRZA 4XPFH 1MH5B 3ARZA 2YD5A 2Y4SA 1FNGA 3DI2B 1XIWD 5FDYA 1ZA6A 4J1UA 5J56B 3NIDF 4JFHE 1RIUH 5L8LB 2NY0C 4NZDA 1VDGA 3ROOB 1DBKH 1FORH 3RIFF 1AGCB 2YA1A 1RJYB 4M7LH 2ZJSL 3B9KD 1QPXA 1JHLH 4PIRF 2CKBH 3UP1A 3SO3C 5BJTB 2ZSWB 1WCQA 4OLWL 4XB8A 4DOHB 3M8OL 3W0WD 1JWMA 2XWJA 4RDQF 1ADQA 4MLIA 3SGJC 2HMID 4U1JB 3ZDXE 4IRJD 3ZKMD 3RJDA 1QLFB 1X5GA 3T0ED 2BVPA 2VAAA 1YNKH 3EBAA 1PY4A 4MD5B 4OCLC 3S5LA 3SE4A 1AXSB 4O00A 3FRUB 2QADC 1MQ8A 2X4UA 2OZ4A 3UJTH 1X7QB 4POYA 4PJCE 3X14B 2J4WL 3ARFA 1BM3L 3QDMB 2CKNA 4NDMB 3WXVH 1KTRL 3PNWB 5DVNA 5ECJE 4KMTH 3KYMA 4NZRL 3NPZB 1N2RB 4G43A 3S37L 3JVGC 2GAZB 2X70B 1KBGL 1JPFB 1OT1A 4OLUH 5C09E 1GGIH 1QBLH 2HA1A 5E7BA 1OCWH 2XA8L 3OR6A 3BRGC 1GPOH 1FAIH 5J3HD 5AZEL 5D7SL 5T1LB 4V1DE 3TH3T 3W2DL 4MGXA 3O3EB 5IW1A 2R1XA 2BNRB 4G6JH 1QSZA 5E2WL 3QEGL 5JPMA 4DVRH 4YEEA 3L5XL 2GT9B 1MCWM 4M93C 1RJZA 1I9JH 1KEGH 3EO0B 3CSYB 2ZCLH 4DQOH 1ONQB 2HJLB 4MQTB 5E1AB 2EDNA 3DGGA 2VKXA 4LCCB 5L9DH 4XCEB 3V5DA 3WUWB 2WINA 4HMEA 1YQVL 3VXQB 5HD8D 4N0FB 2AXJA 4O5LH 4Z7UA 2EECA 2XT1B 4HJJH 2ED8A 4PREB 1T2XA 2PR4L 2F9BT 4J7RA 5EBWA 3U4EB 1JYNA 1D5MA 5J1TC 5IJVB 5TDNA 3JWDH 4P48A 4RRPA 3TN0C 4JG1L 4AMKL 3V9FA 3L3DA 1UADC 1YC7A 1ND0A 1OD7A 3GB7A 5I1JH 4HFUH 3INUH 3VXUB 4UDUB 3QQ3B 4P9ML 1S5HA 1A6ZB 1LK3L 3R8QA 1U8JA 2AV1B 2H26B 2VDPH 4NO5B 4GKOA 2NY6D 5FOBB 2QLVB 1O5DT 3HNTH 5HPMA 4HHAA 1R0AH 3QDGB 2J12B 1RUKH 4ZSOB 3S34H 3VH8B 1EXUA 3RDTC 4XNQA 2FD6H 4YXKH 1LE5A 4Y5VB 1BJ1H 1YY9D 5J7CC 5SV3A 1T03H 4OUOA 5CZVL 1NKRA 1NCBL 4ELMF 2ZUXA 3JTSB 5CEZD 3D9AL 5GGUB 1XZ0B 1HHGB 1MEXL 1X5AA 4FTVA 2D03L 3DV4B 1KN2L 3DVIA 3FT4B 2AJUL 1BFVH 4HXBH 3VG9C 1PYWA 1NGYB 1VEPA 3I75B 1NC4D 3RIAF 5J6HA 3PGDB 2D7PA 5D7IF 1J18A 5ENWA 4JJHA 1SYSB 1SQ2N 5HYJB 5D1QB 2OR9L 2IPKB 3G6JB 1SVCP 2R9HC 4R90L 5FO7A 1I3RA 2VDOL 5BV7L 1HH9A 2GQHA 5EUOE 1IEAA 4YHZL 1Q9WA 2V7HA 1I7TA 3WXWH 4W4OC 3G5ZB 3PWVB 3MJ9H 4LSQH 1P7KB 1N4XL 1U9KA 4BSVA 3OKLA 1PJ9A 3TYFB 4KU1A 4HMDA 1U8NB 4J3SA 2AKRB 4E42A 1BD2B 1HINL 4XP1L 3DIFA 4MXWH 3MCLL 1BF8A 4GRWH 2XQBH 2VXQL 2QKIA 1Q9LB 3BZFB 3T3ME 2GHWB 4XCCH 4JM2C 3SE9H 1ACYH 3SOBL 5BXFB 4UT6H 2BNQA 4L9LA 4LLDB 2WBJC 3PL6B 2ENYA 5HI3D 3LDBB 5GRZA 4L5FL 1UYWL 2D7OA 4NO2B 1HNFA 4L4JA 3E2HC 3FOLA 3QI9A 1DQTA 1DVFB 1FBIL 5D2LE 4ENED 3SKJL 4TULL 4M48H 3F6IA 3D39E 3FRPA 4GAJH 3D6GA 3L3GA 4ZUWA 4PG9B 3DUSA 3AAZB 1II4E 1KJVA 4Z78A 3WCYA 2OJEB 1AI1L 4P9HH 43CAB 3FCTA 1JF1A 2X4RA 1HYSC 2BNRD 5IF0B 4Y2DC 4JFZH 2VB5A 1S7RA 3O6FA 1PBYA 3IKCA 1W8NA 5TQ0H 2VO5A 2PW1B 4ZO7A 2IQAB 4KKBC 1DQMH 5EORL 1CDJA 3ESUF 1KELH 2A9ML 1IGFL 1ZLVK 4HZLA 3TO2B 1X3DA 3G08A 4OGZA 3X17A 4MJ2A 1JZ3A 1EH9A 4P2OA 3MV7D 3LKQB 4M1DL 2ORBL 4H1LB 2HT4D 4H5SB 4MCZB 1MIML 1UM5H 3RWGA 3H3PH 4JANA 1IKFL 4M5YL 4NHUA 5CEXB 1T6VN 1CWVA 1REIA 2GITA 3SO3B 1V7MH 3KPLA 4WEBH 3K3QA 3UZEA 1G9ML 5GS0H 5F96L 3CXDL 2GCYB 3BPOB 1NCWL 1VSCA 3AREC 5D2NE 4YX2H 1RI8A 1SBSH 4TN9A 2XTLA 2GJZB 2AJVH 1FFQA 3MBEB 2QADB 4X98B 3LQAH 1OSZB 2LQRA 5DD3H 3EYVA 4HJGB 2XPGB 5B4MD 5HHXL 3L6FA 1QSEB 4AIZB 4L9DA 3VD3A 3F58H 1LO5A 3HI1B 3U48A 3FN0H 5FV1L 4Z7VF 3N9GL 1ZT1B 5LVEA 1JRHL 1MRCH 4FXLA 5E00A 4KK8C 4N5ED 3RX7A 4K3EL 5J0BA 1NLBL 2WK2A 4X6DA 3WIIH 3LN9A 5J8OA 4URTB 5AUMB 1JGEA 5DF0A 3L95B 1DCLA 3B6SA 2DIAA 5HJ3A 4MHHG 4XTRD 2X4OA 3UTPE 4HG4J 2XQYG 1NAKH 3GSWB 1DQJB 4M93B 3O8XB 5EC2B 2P8MB 4ZD3L 5BRZE 3K2UL 5ETUA 4K7PY 1NCUA 1LEKA 5F7FA 3BXNA 1BQHG 4NCC1 1INDL 4XZUA 5I1LA 1KN4L 1PG7L 5CEYB 1GOGA 2GIYA 1F45A 2EKJA 5ISZB 2IQ9L 5GS3A 3VFNB 2IALB 3OKEA 3QAZC 4FZ8H 2VQ1A 4YHIB 1KIPA 3GK8H 4CJ0A 3WKML 3TIDA 4NKMB 1DE4A 2V9TA 3I50H 5K9KB 3TN0B 3GKZA 5DJZB 2RIKA 3EDDA 4ZG1A 5IB4B 4X9IA 5K59E 5EOCL 4NJAH 2WLYA 4EI5B 1MELA 3HI6H 2IH3B 1D5IL 2OXGA 1AD0B 2ADGB 4LSVH 4GUPA 2GJ6A 3C60B 4JR9H 5KSVA 1W72A 5FB8A 1D3CA 2HJFA 4F58L 2HT3C 1BAFL 1QPPA 1MCBA 2GJJA 4RMRA 5FYLL 5GJSL 2PYEA 5A2LH 4OGAD 4KK6C 2EXWC 3SJVB 4OT1H 1AHWB 3MUY1 4M9OA 2ZOLA 3TIEB 5I1EL 1U8KA 1EDQA 5A2JH 4OZIF 3EHBC 5ERWA 3AUVA 1JRHI 5E8DH 5F7WC 4FN0A 1TTUA 4EQ2A 4APQC 1FL5A 4G8GD 3VFVB 4WFEE 1NCAH 1DQDH 1DVFD 4S1RH 5IJKA 2EKSB 2DM4A 3WD5L 3EW3B 3S35X 4LHUA 1YUHA 4NKOA 2MHAB 1NMBH 3DBXA 1A3LH 1PD6A 3TM6A 2Q3AA 3HC3H 2OSLA 1G7JA 4M8VA 5MEPB 4BFIB 4JFDA 4QRRD 3THMH 5CLWA 5JW4M 1WEJL 1BHGA 4IMLB 5K93A 4Z7VA 1F4WH 3P77A 3EDJA 3QEQB 3FQXA 2VJXA 4L29A 3FN3A 3FQRA 4Z7UE 2FLBT 3KXFB 3DUHA 1FG2B 2NY0D 1BFOB 1MFAH 1NBVH 5IK3A 3CXHJ 1Q0YH 5CGYC 3DVNB 3H42L 3QHZL 3VRJB 2F58H 4X6EB 2Z0BA 1HZHH 1JZ2A 3HE6A 4PD4K 5LBSL 3SKOA 3MBXH 1Y0LA 2P46B 5JHDB 3MRIB 1D9KB 1QQDA 4YQXL 3V0VA 4UTAL 3HR5B 2QADD 5JW3L 2NZIA 1LDPH 3ZE2F 3GJFA 2P7TB 2A77H 2XWBA 1DQLH 4JDVB 4M7ZC 2PTTB 3ARDA 3VXMB 2WBJB 4KY1H 2DLGA 3SDCA 1W0WA 3CMOH 5FYJL 4FQ1L 4MNHA 2C1PB 1NLDH 2AJYH 2C4FT 5D2NC 1FNLA 5CP3A 4WO4A 4LIQL 1TPXC 4M62L 2KL6A 4LLWA 4E5XB 1GGBL 3QDJA 4N90D 1X5KA 3NZ8B 2AAVA 3CC5B 4OZHB 1RVFL 1KCKA 3IDYC 4X6BB 2AXGB 1YEDA 1CXKA 3UPAA 1F58H 4L8BA 4FTVE 3WN5B 1PW3A 1ZHNA 4WHDA 4FFWD 4P5KB 1TVDA 3O45B 2P5EA 2Z93B 1RZIA 2JIXA 3KPTA 3O8XD 2FATL 4XNXL 1RAMA 4U6YB 4G42B 5C09B 5AAMA 3S36X 4O58H 1D5BA 4XXDA 4MLSA 3HMXL 1S7SA 4PLOB 4JVUA 4OZIA 1JMXA 3CLEL 1U6AH 1G6VK 1KB5L 3OAZK 4S2SB 5HHPB 3NZHH 4V1DB 3U82B 4OQ1A 3X12B 4YWGL 5ISZD 1TIUA 4Y7MA 5DMJB 3DHMA 1A0QL 3L1OL 2ESVA 3PG2A 4D9QE 3U1SH 5IEKB 4NO0B 3QUMB 2Z4QA 3RHWF 3QSKB 3HI5H 5D6DA 1FZKB 5DMGC 4RGNE 1CGSL 2H8PA 3TN0D 1T7YA 5HGBB 2EH8L 2JK5A 1TTFA 3B5TA 1XR8A 1YEFL 2CK2A 3AXLB 4G8IB 4PJIF 3MR9A 5HY9B 5MEQB 1VFOA 4FFYL 1XF2A 5TQ2L 4R7NA 1QKZL 3MNVB 1VPOH 3FQWA 3RWEB 1JFQH 1CF8L 1YN6B 2BNQE 4LKXB 3BQUA 1CL7L 2J8HA 3V5KB 1KLFA 2R1WB 5C70A 1A6AA 4OFYD 2LV4A 2C1OA 2AVGA 4JRYA 3NGBC 3QUYC 4MB3A 3ULUE 3EFFA 1RHHB 2YEZB 4I9WE 2VXSH 3RPIA 1ZHBA 3SE4C 2XRAL 4G9FB 3RDTD 4N8CH 1LO4L 3L7EA 3OWEA 3PWUB 1RUQL 4CUCA 1HQ4A 4XCNA 1UH3A 5I1AB 4OLVH 4MD0A 12E8L 3UTTA 3ARFC 3VJ6A 4F7MB 2H6PA 4W70A 4G6AC 2OR8A 4RMWA 4UT9L 4RZCB 1WFNA 4YXHL 1B4RA 5DJYA 5AYQA 5EBMA 4FA8A 2VUYA 4EN3A 2VLKB 1N7MH 1RIHH 3V0WL 5T1MB 4DN4L 4JKPL 1N3NA 1IBGL 4O51A 5T33L 4Y16C 1RK0B 1I7ZB 3BP4A 2X4SA 5TH2B 4OLXL 5E6IB 4CW1A 1N6QH 4L4VD 5GRUH 2UVEA 1GGCH 1UXSA 3QEQD 4MSWB 2VDRL 2VL5A 1RUPL 3QAZB 4QXGL 5DRZA 2VLRB 3H9YA 4L3AA 1JHTB 3KXFD 2V2XA 4G9DA 4PRBB 1T80A 5I1CL 1NBZB 5T1KB 2UZIH 4PV9B 4EDXB 2R9HD 1CZ8H 3KLAB 1EHXA 1E6OH 1S7QB 1W0VB 3C8HA 4XC3L 3VXPA 2YN3A 1BVZA 4HWZB 5CAYB 1AD9B 3EAKA 1MREL 3LV3B 2B4CH 1GH7A 2V5YA 3DX9B 1G1CA 3PP4H 3DJ9A 1JGUH 5IV2A 3BKCL 4TPRH 2IEPA 3CJJA 5AWNH 5MERA 3EYQC 4FFZH 3RUGA 1ACZA 4LF3A 2N1KA 5I8CA 4JM2D 1G7IB 4C59B 1CL7I 4ZFFA 1RZ8B 1T1YA 3GMOB 2WBJD 5ADPH 5DRNB 2APVA 4XMKH 2MQCA 2BK8A 4X6DE 1DFBL 3KDMA 1JPSL 3OB0K 4UIMA 4X4XA 4TSCL 1R6VA 3O0RL 3HZKB 4U7MA 4KHXH 3BJLA 3WJLA 4XP6L 2R56H 3S35H 4PJIA 4GAYB 5L88H 2OLDA 4P3DA 3VE0B 1EA9C 5KTEL 3F7VA 3W82A 2QR0A 2X7LA 1YMHB 3G04A 5DDHA 2NY5H 3BH9A 1LO3H 2DQFA 5FHAH 4Y2DD 1T89C 3BEWB 1AE6L 4ODUB 2A38A 1R5VB 1A7RL 2EO9A 3KGRA 4HPOL 2EDTA 3VI3F 2EXYC 4KROB 5C09D 1YJDH 5CEZL 3DV6B 5F3HB 4GW1A 1ZHLA 3LKNA 5SWQB 2ZG1A 3ARWA 3H9HB 3O6MH 4KZDH 3GI8L 1HHHB 4UBDC 5C0DA 3GBNH 4V1DD 2R29L 4IRSA 2YPVL 1Q0XL 3U30B 5HDBE 3NTCH 4ACPA 2O5ZL 4YHPA 3BZEB 4NO0D 2PF6A 2EYTB 4OKVA 1A6VL 4TQEH 3ULVH 1A3RL 1MCRA 1WITA 2GJ6E 4KI5F 3BH8B 1KCSH 2F74A 5GPRA 2JJWA 5KS9B 5KZCD 3ARED 1JWUA 5FGCE 3GSRA 5I75C 2DM2A 4Q9CA 3RI5K 1NDMA 1WIPA 3OKDB 3ZSTA 2PYEE 3QG7L 1PKQA 4LFHG 4G7YH 2AW2A 5EU7E 5J9PB 4M7ZB 1IL1A 1GIGL 5DJCB 4H0HB 3P30H 4JAMB 4Y88A 3QWRD 4F57L 1NFDF 1T2QH 4XVSH 5C86A 3OMZA 4NC0B 4G8EB 2L7JA 1JN6A 4KRLB 4PRPB 2HAZA 1AO7B 2D7TL 4HF5H 2CQVA 4RGNC 5D2NB 3S8WA 1UA6L 5FHBH 4A6YB 1MI5B 1TPXB 3PGFH 1T0NA 1AIFA 1SY6H 4R7DB 4MZ3A 4YDIL 4HLJA 1B2WL 1TZGH 1VADA 3HC0A 4L8DA 1MFCH 4BQ8A 4G9FD 5F7DA 3QWOB 1AFVH 3RP1A 4R97C 3IDYB 4ZS7L 1AKJD 2AJZA 3MLYH 1CLOH 4JFDE 1J88A 5D9SA 1T0PB 1IAIL 3QI9C 2VLKD 3ULUC 4NQDB 3GNMH 4OD1H 4X4YA 4HGWB 3V95A 1I3VA 4F33A 2Z8RA 1TVHB 3DO7A 3V5HB 1E28B 4K3DL 1KIQB 1C16B 2F19H 4HH9A 2QHRH 4G80A 4QXUL 2Z8WC 3BX7C 4OCSH 1DJSA 2HFTA 4PPTA 3O6FC 2P4AB 3TJHC 1MCCA 3ULSB 1P7QA 1IEHA 5T1KD 1U3HC 1A1MA 2W59A 1ULVA 5GJTH 1MWAA 1TXKA 3QG6B 4P2OC 1WBXB 4Y19B 1WCBA 3UTQA 3L3IA 4M4PA 3CU1A 3ZKXC 3DRTB 3I9GH 1KEML 3N1GC 1J1PL 3EGSB 1EO8L 1LWRA 3VFUA 1FIEA 1QEWA 2JKXA 2HT3D 4KK9C 5JO5B 2G5BA 2XFXA 4G3YL 2Y1VA 3LRHA 5HHOB 4IOIA 3CFBB 2O61B 4UINL 4KK6D 2EXWD 2GTWB 4RAVA 3NGBB 3QUYB 4N1EA 1OP3K 5E9DB 4F3FA 2BVPB 4M9PA 1BJ1J 3S37X 4M7JH 5CINL 4CVXA 3DXAA 3UO1H 3EHBD 4PRAA 2D0HA 3FT2B 4KXZI 3QDJE 1IGJA 1YY8B 4LPXA 5JPNA 4APQD 1YN7A 4XB7A 5F7KC 4PRIA 3V4PH 5DK0B 4Z77B 1I75A 4PRHB 3B83A 4HUXB 1H0DB 1INQA 4UV7L 4GG6F 3MCKA 4LKCA 3KPNA 2DQHH 4DZBA 4EI6B 5C9JA 3CFCH 1MPAH 2P5EE 3BMVA 1S9YA 5DJ8B 3SDYH 1B0GA 1R5IB 2FX9L 4WU5B 2CLVA 4OLEA 4Y16B 4Y5XB 5B38B 1M05A 4NP4L 3MLSL 1NFDA 2R4RH 4J3XA 4OZIE 3O6LH 3OXSB 3GMNA 5GIRB 3BHBA 4GRMA 3UPRB 1JGDB 1MVUA 1LNUB 1FYHB 4UT7L 5ID1A 1UGNA 2NQCA 3OAYK 1U8PB 2ESVE 5DLML 1BBDL 2C3WA 1X5HA 3MUGA 1M7DB 1F90L 1JI2A 1UB5A 4X8JA 4FQXB 5IVXA 3U4AA 5FO8A 1UZ6E 5CGYD 4HK0B 1A2YA 1YMMB 2QQNL 4DZ8B 3QIUA 1KG0B 1U8QB 4Y5YA 5JQ6L 2FL5B 3MRHA 5CD3A 2RCSL 1XR9B 4MNQB 2DQJH 4GO6B 3VGHA 3F7YA 2X09A 2Q86A 1EV2E 2BP3A 2GEEA 4WFFE 2ICEA 5DQJB 4FQ2L 4JRYE 5SWZB 5CBAA 5J12B 4LCIH 3I02B 5E94B 2QSCL 5HTSA 1AC0A 2R0ZL 4JFFA 1FLTX 3DURB 4WUKH 3TJEH 1T1XA 4BQCA 3K4AA 2DD8L 1GGUA 1IM3B 3FT3B 3UTTE 1J86A 1N59B 4YAQB 5JTWA 3KHOA 4OCYL 4UTBL 3RGVB 1CBVH 1O7SA 2EYRB 4JN2B 5EU7C 1YPZA 3KYKH 2HVJB 1ZAGA 4QHMB 1J0KA 3SKNA 2XYCA 5HYSB 1CXFA 3NAAL 4UZGA 4WFHE 3RBSA 1Z0NA 3QH3B 2K1MA 1N0XH 4NKIH 3R1GH 2DLFL 5L2KB 2VDNH 5BVPH 4Y1AB 5KVEH 3VFSA 1T22B 3GMRB 4PY8I 5IJKC 5D6CA 1ETZB 5E8OB 3L3OB 1E0OB 3FQTA 1F4YH 3K8KA 2L0DA 1BIIA 3O3AB 5DJAA 1NGZB 1X9QA 4I5BA 3O3DB 2OTWA 4LSSH 4CMMA 2BSRA 5GSVA 4D0BB 3ESVF 2HRLA 2OTUB 3H3BC 1CK0L 1U8IA 2A1WH 4ZNEE 1AC6A 3TLRA 4NPYA 1G9NL 5DEGB 3UTPD 3JUZA 4GG6A 5K33A 4OFKA 2XNAB 4JEGB 4GMTL 3DUUA 5BRZD 2ICWI 3IXAB 4TNVK 5J1SC 5IGXL 5DMGD 4RBPK 1ZTXH 2P48B 1OQOA 2UYLB 1AGBB 1MCOL 4NC2B 1NEZB 3DNKA 2B0SL 1NJ9A 4CU6A 3F65A 1H5BA 3R0NA 5HYQA 2Y6SC 2VC2L 1RJLA 4OLZL 2OK0L 2YC1A 4J8RB 4QRQB 3RUGE 4LL9A 2UUDK 2FECI 2VRAA 2R0LL 3ZLQC 3UAJC 5BZWA 2J6EH 3HE7C 3HE6C 4MJ5B 2ADJB 5EO9B 3IDGB 1BIHA 4W81A 4F37K 5F97E 4OFPA 4M3KB 3MRMA 3IDNB 3WS3B 3WDJA 4KQ4L 3QUYD 4FQQB 1G7HB 5E9DD 3SDDB 2FX8L 3RY5A 2F5BL 1JPST 4Q9RH 4NN5B 1OP5K 4KVCL 2ZCKH 4PJIE 3V4VL 4UNVA 4NQCB 1P9MA 3H7BB 3K1KC 4DAGH 1YEIL 3BP6A 1ZE3C 2DOCA 5FA4A 4Y0GA 3ARDC 4PRHD 2JCCF 2XWTA 2NNAA 4G6AD 1WZ1L 1KPRA 3I6GB 2AJSL 1KJ2L 1DUYB 3F62A 1MHCA 5C3TA 3IFOB 3MRCB 2J88H 1M6OA 1SVZA 4D94A 3OKKB 4WO4C 4OZFB 2CKBA 2DKSA 4Y16D 5ABDE 3MCG1 3TA3B 3QFJB 4JZJA 3M07A 5HVHC 4WFED 2E9IA 2R2BB 4XC1L 4PJ9A 5DMIL 5F1NB 1OLLA 2XKSA 1JF1B 2I9TA 5MHSD 1R3JA 1X6NA 4L8SA 1I7RA 4YDVB 3LKSB 1U3HB 5GS2D 1S7TA 1QFOA 4HV8B 2ZJSH 4KFZC 4ZPVB 2Q6WA 2ADIB 1TJHH 3M8OH 3SGKA 1NCTA 5D7LB 4EOWL 2R15A 3KPOA 4N8VB 1PKQE 1FL3A 2ZKHL 3MNZA 5IHZA 2E7HA 4MNQD 5DS8B 1KB9J 3CDGA 3QYCA 4HIIA 4U05A 5K9QI 3F5WB 4P4RB 2DI9A 5D6DC 3CVHL 3EYQD 2J4WH 4QRTA 2HT2C 3FB8B 1BM3H 4NM4L 5DYOB 5TGBA 3DPBA 3UJJH 2V2WB 1UXWA 2VLLB 5SWZD 4NZRH 3ARBC 5EH1A 5I1HL 3S37H 4RMVA 2A83B 5ELIA 3C6LA 4WFGE 4DJMA 1L0XA 2DQCL 2BHYA 2V7NA 3DX7B 2IFFH 4HUUA 4YHYB 3MLTA 3U6RA 1TCRB 2XA8H 4ODVL 1LO5B 4Z5RA 3ME0A 3TCLA 3TBVB 3BQUC 4WW2F 5DVMA 5M95B 1U8HA 4NYLA 3FB7B 4UB0L 5AZEH 3C5ZB 3DYMA 2D7MA 2VE6B 3QISA 5GGSB 3W2DH 5E2WH 2E9WA 3QEGH 1CDGA 4I2XA 3L5XH 4J6RL 1D7FA 1BQUA 5J1AA 4DGIL 2HFEB 5DHXB 4NQXA 1KIRA 4I0KA 4XI5C 3TCXA 2EXYD 3TVMC 1XT5A 1PG7X 1YDPA 4TSBL 4CRPA 4QCIA 1EHLL 1YQVH 1U58A 1OF2B 5FAAA 3C9NB 4UBDD 4EN3C 3RL1B 4XWOC 4DKEL 5CFHA 2XA3A 3FQUB 2PR4H 5EFIB 2AGJL 2VDLL 3C2AL 1T1WB 3GMPA 4LDOB 4AMKH 4OFIA 5HGGS 4NFBA 2EDRA 1TDQA 3BO8A 3DVGA 1U8LA 3CUPA 1EZVX 3OKYA 1QBBA 3OSKA 4KJQD 4X99B 5F7MC 5L0QC 1KGCE 1WAAA 1UQSA 2LTQB 5FDWB 4P9MH 4U1MB 4MCYA 1VENA 1FV1A 1Q9OA 3VDBA 1LK3H 5IKCA 1ITCA 4D9QD 1RPQA 1E27B 5DQ9B 1MFEL 3DXAE 1ZVSB 1XGYH 4ONHB 4OF6A 1F11B 3IDIA 3WHXB 2PCPB 3BDXA 4PRIE 1Z6JT 2AQ3A 1KCUH 1IM9B 5CS7A 5BQ7B 2BMKA 4BFEA 2Q76B 2IG2H 1BVKB 4XPHL 4LRIA 3L3KB 4NQCD 1NGWB 2VH5H 1OLZA 3QIWB 4FHBD 1A21A 3TBTB 2NXYC 5CIPB 4JFEA 5CZVH 5HHNA 4QWWC 5C0RL 1NFDE 3G6DL 5DSCB 2R2HB 4J3OC 1NCBH 3REVB 4GW5B 3QA3A 3BKYL 2WIMA 4JJ5B 3VRIA 1WT5A 4CN1A 3QI9D 4JM4L 1MEXH 3ULUD 2D03H 4MA3B 4I9WD 3PHOA 5C2UB 2AJUH 3WJLC 1S7WB 4GG8A 5IQ9B 4U6VH 2YK1L 3VRLE 2A0LC 3QFJD 3HMWL 2C3VA 3E6FB 3QXVA 3KVQA 4BSWB 3PXJA 4UAOB 2EE3A 3ES6A 4O2FB 4XHJC 2JJSA 4XH2B 5ACZA 4LMQE 5IVXE 4JFOB 1RMFL 1DTUA 1F6FB 1FSKB 2OR9H 1A4JA 4WW2A 4PJFB 1SJVA 5EC1B 4P2RB 1YEHL 3TJHD 4R90H 4D0CB 4LLYB 1NMCB 1FE8L 1U3HD 2VDOH 5BV7H 3MRRB 3JTTB 3DHJA 5DC4B 1KLUA 2P8LA 4X5WA 4GT7A 3ZYOA 1CFTB 1YNTA 4P2OD 32C2A 1RV6X 3HLAB 4KTEL 3RZWA 4YBHA 4QHLA 5GGTL 1JV5A 4PS4L 1AP2A 1BREA 1HINH 4XP1H 4IRSC 1CGYA 4KK9D 2VXQH 5D71L 3HE7B 3IF1A 1MFDH 3MGOA 3QZWG 4JFFE 1UJ3A 4R0LC 2XN9E 2CDFA 3SOBH 5E4IA 2BXZA 5FV2A 2COQA 4L5FH 1UYWH 4GAGL 4PGBB 5F6HI 3KS0H 4QYOA 4U1GC 1J0IA 1VGEL 5IFAL 3VXSA 3TBYB 3RWJA 1YPZE 4F15B 3VDCA 3H6JA 43C9A 1FYTB 4X9HA 3FB5B 3CH1B 3K74B 1MAKA 3LKRA 5IB3A 1C08A 2QQQA 4X7TB 1N5YH 1P4IL 2HKHL 3ZTJH 2ITCA 1ZLVH 1AI1H 1HDMA 3ZKQD 1T04A 1MJUL 4DVBB 4JPWH 4HC1L 5EB9A 4PB9H 1P2CA 5EORH 3NCEB 2A9MH 3BD3A 4CN6A 1HKFA 1IGFH 5F9JA 1T66C 5D5MF 3U0TA 3UCRA 5HVHB 1I3GL 3GKWH 1QA9B 5DGRA 1G7PA 2ENSA 5KSAA 4JFQB 2G2RB 2JB6B 5JOEA 3T8XB 4HWBA 3GIVA 4M1DH 2ORBH 1VGKB 1MIMH 2VOTA 4GG6E 1IKFH 4M5YH 2ARJB 1KPVA 3Q6FA 1I8MB 4OAWA 3GHEL 4X8XA 3IU3B 2IAMA 3WE6B 5C0IA 4K7PL 1G9MH 2Y7QB 4YK4B 5F96H 4D0DB 3CXDH 2JJTC 3U9UA 2BOCA 4IIQB 1NCWH 5CJ8A 3ARTA 1FRGH 1UVQB 2W9DL 4C56A 4LEXH 5I66A 2ESVB 2DS4A 1CFVL 2V5SA 4YPGA 3W39B 4HWUA 2JF1A 5F6IC 4HCRL 3TV3L 2A2QT 1F4XH 2RBLA 4GKNB 5IVZA 3MO1B 2G9HA 3CX2A 3SDAB 2ZUYA 3M17A 5HHXH 1EAPB 1DN2A 4HUMB 4ORGA 1ZT7A 3ARGA 4QRPB 4K2UL 3ARBB 1RULL 5C8JA 1UZ8A 1B6UA 4Z7NF 4GXUM 2DM7A 4L1HA 3N9GH 3ZYZA 4JO3H 5KVDH 2NMSA 2P8PB 4LBEB 1NQBA 4K3EH 1UWXK 2E7CA 1MY7A 2PYED 2D3VA 2LAAA 5J4MA 4GW4B 2C1OB 3HPJB 4ZFOB 1MHHA 1J05B 1QO3A 3IFPB 1OTTC 1U95A 1PSKH 3FO9B 1WFTA 2Q7YB 3RWHA 1DANU 3VI4E 1EUUA 4QGYA 4TNWK 1NL0L 5I6XB 1ES0A 3TVMB 4NRXA 3L9RA 1INDH 4HJ0C 1KN4H 4LHUD 5EZIL 1PG7H 5F1IB 5IBUG 3EYSL 2IQ9H 3O4LB 3Q1SL 4H26B 1QFHA 2LU7A 3EZJB 5EUKA 2CK0L 2PXYB 3RZCB 5HGDB 1D6EB 5LAXA 3WKMH 3VCLB 1EHAA 5ADOL 2X4TA 3B43A 3WNOA 1NKOA 1TFHA 4JHAH 1ZLSL 5J57B 1FGVL 1VACA 5EZOL 5GRWA 1BP3B 3PV7A 5EOCH 1HCFX 1HH6B 1LEGA 3PQYA 4E41B 2G60H 5SWSB 2V6HA 3UBXB 1HSAB 2WWKO 1XCTA 2Y6SD 5D5MA 4OM1L 4F58H 1BAFH 4DTGL 1C12B 3MJ8A 4JO2L 1HOCB 5FYLH 4L8CB 5GJSH 1GC1C 5E5MB 4K23L 3UAJD 2FO4B 3QIUC 3M45A 2IANA 1K2DA 3HE7D 4Y5YC 4U7KA 1A7BA 3HE6D 4E0RB 4S1QL 4RAUA 4JGUA 5I1EH 3PHQA 2WIIA 5C08B 4PJEA 4JY4A 1JNHB 5CWSA 3PDOA 1U8MA 5I1DA 3ECBB 3C5SB 3ZHLA 2ZCHH 1A7OL 4AM0B 3T0AA 5FF6A 3WD5H 1Y6MR 3KLDA 3W9DB 3ARDD 1K85A 4I2XE 2MKWA 3P73A 3CSPA 4NOFA 1B0RB 5DUBA 4ZAKC 4P0DA 4JO4L 5IOPA 3HNSH 5DMKA 3TNMB 4EXKA 4KDTA 2VZ3A 4WO4D 1EFXA 3MRNA 3L5JA 2AQ1A 3Q6GH 3QDJD 1WFOA 3QUKB 4KUZL 3B2UC 2A6JA 4BH8A 4JREC 4BM7A 1A1NB 4QRSB 5DJ0A 4U2YA 4MAUL 4WRLA 3F12B 1S7UB 4LVHB 4QT5B 3FHQA 1A14L 2DI7A 1AXTL 2MJWA 5I1KL 1JNJA 4PP2B 1IMHC 2P5ED 2JIXD 3H42H 4HUWB 3QHZH 2DQIL 3MLVH 4XCFL 1S5IL 1SJXA 3VG0L 3BSZL 3VA6A 1I1FB 1ZT4A 3PDDA 5LBSH 1WAAE 3GSUB 4I4WA 4ZUUA 5HBBA 2HFFB 1CGXA 5LXGL 2ESVD 3ARPA 1CGUA 4UTAH 5A2KH 5HYIA 2LE9A 5ICZA 3SCMB 5JW3H 1F8TL 5K9OA 4BH7A 1FVEA 1QVOA 4R0LB 1XGTB 3BAEL 1DLFH 4MWFB 5KVMC 2W91A 2W38A 4OFDA 2F53B 1GJIA 4C55A 5FYJH 4FQ1H 2XZCL 3ARBD 3EYFB 3WFHA 5IESL 3FTGA 4U1GB 1NDGA 4FP8L 4U6XA 5F1SA 5KSBB 1H5BC 3IYLW 2XY1A 4J3UA 1ZK9A 1FNEA 4ODSL 4K94C 1ADQL 4JKKA 4LIQH 2YD7A 4M62H 5TE6L 3S3SA 4DGVL 4DUWA 1NBYA 2DWDA 2YSSB 4NUJA 4H25B 3BW9B 3SQOL 1GGBH 4HH8A 4JFEE 3U0PB 4Y4KA 3BQUD 1WICA 3SY0B 5D1ZA 4RGOL 2I27N 2NLJB 4WFFD 3TPUA 4JRYD 2OZ4L 1AIFB 1DBBL 5ITFA 1KPUA 1CVSC 2X4QA 1K8IA 3DRQA 2FATH 1P9MC 4XNXH 4EUPH 3OAZH 4OKDA 1Y6NR 4LNRB 5EU6B 5JW5B 3SPVA 3HMXH 4XI5D 2FHBA 5GS1B 2VDKL 4P4KA 3UTTD 3TVMD 4IS6A 2D4DA 3CLEH 3UTZB 4HAFA 1Z3GL 3SDXB 5E7FA 4GRWE 1KB5H 4U1NA 1IJ9A 2DIBA 4QY8A 4XCYB 4EN3D 3DECA 1A0QH 4UQ2B 2BRQA 4XWOD 4RFOL 5ESVA 4NUGH 3RY4A 1TQCC 5AD0B 1GCFA 3GMLB 5DRXB 2B1HH 4HBCL 4WFHD 1T7VA 5I9QB 3CCHA 4TUJB 1MAML 4PTTA 4JZJC 3UTSE 4PBXA 1KT2A 5H35A 4S1DC 1CGSH 4MB5A 1Q9KB 2EH8H 4PJ9C 1YEFH 3O3BB 4JDTL 3NH7L 3IT8D 4QTHA 3BP7A 3WUZA 4JPKL 1EEQA 4L8SC 1D5XA 1L9MA 2BHUA 1QKZH 4I0PB 2OMBA 3MGTA 4PR5A 3VGAC 1CF8H 3MRBA 4HPYL 4NO3A 1CG9A 1UM6L 4LPCA 3PIQB 4DUVA 4LASH 1OWWA 5IIEA 4I48A 1N5AB 4JN1L 4KVNL 3FOMA 3VXSE 2A6KA 3MUZ1 5LKNA 3PABA 2XRAH 5IHLB 3ZZ1A 1JTPA 4O2EB 3S9DB 1RUQH 1DQQB 1Z5LB 3NFPB 1NAMA 1CXHA 5C7XL 4Z95H 12E8H 4RAVB 4MA1C 1S9KC 1R3IL 1ZEAL 1W2KT 3TYGL 4UT9H 2NXYD 4YXHH 5C0GB 4QWWD 1SMAA 5IT2L 4U1LA 4PGEA 3V0WH 5KG9A 2NPLX 4DN4H 5I2IB 1NPUA 1IBGH 1HHKB 2VABA 5JA8B 4D8PB 2DKMA 3DTXB 4N0UB 2P45B 3BT2H 4GXVL 4OLXH 4QRUB 5GISL 3S4SG 3KYNA 1YEKL 1OAZL 1E4XL 3O81A 4X0KA 2A0LD 3GJEB 1BOYA 4GRLB 2VDRH 1RUPH 4QXGH 5ALBL 4XNMA 1OAKH 1IT9L 1J5OH 1FIGL 5I1CH 3BGMB 3CFDA 1X4ZA 1MFNA 2HP4A 4X6CB 4WWKC 5FM4A 4WENB 2Z8VC 4XC3H 2DI8A 3CAFA 3JWDC 1EX0A 2AK1L 4C56E 1MVUB 2DTSA 3DROB 4RMUA 3RWFB 3U7YL 1CI5A 1MREH 1FFNA 2FIRT 3L7FB 1A1OA 5CJOL 3D25A 1WWAX 4NNPH 2BSTA 5EIIA 1XGRA 5F88A 3X11A 3BKCH 4YBLC 5LGKA 4WNQB 4EVNA 3KNBB 2Z92A 3OB0H 4ZUTB 1Q1JL 5KOMC 3CD4A 1O7VA 4NM8L 2F53D 3RNQA 1A6TB 2H9GB 1DFBH 1CR9L 1JPSH 3C6SB 1EGJH 2WMPA 2YRLA 5B39G 4HFWA 1R3LB 2X10A 1IAOA 3JXAA 4HW6A 1LP9A 3FFCB 4XP6H 4PTUB 3KPSA 5KTEH 4M8QA 3K1DA 3MLPA 4JFFB 4ZAKB 2XN9B 1A5FL 3MRPB 1T1XB 2CIKA 3JZ7A 1U36A 5TF1L 3HRZB 5CKAA 5E8PB 4MJIB 1AGDB 2BX5A 1OTSD 4PRDB 1AE6H 1F97A 3EOTL 1NEUA 4WFGD 4HPOH 1KTDA 1DZBA 4NRZA 3MNWB 1F02I 1T66D 4LRIC 5I8EA 1ORSB 4H0GA 1E4XI 4WY7L 3SKMA 4PJDB 3G5YA 2BRRL 3IVKB 4OZGE 2ITDA 2GK0B 3GI8H 3WDIA 3G6AA 4M6OL 2OMNA 4QOKB 3KLHC 3ZE0F 5DO2C 2R29H 3BUYB 2YPVH 2EEAA 2O5ZH 4ONGL 5DHVA 5F3BA 4Z7QF 4OV5B 3LRGA 5I76A 1JBJA 1A6VH 1NC4A 3PQYE 1A3RH 1NFKA 3WL9B 5DJAB 1FVDB 1MH5A 2BVOB 1JCKA 5D5ME 1IKNC 2JJSC 1SY6A 2OXHA 3JBG7 3D1MC 2D31B 3ROOA 1K3IA 4WW2C 2IANE 1AGCA 1P7QD 1RJYA 1GIGH 4ZYKB 4IHOB 1H3TA 4OZFH 4F57H 3K4ZA 5BJTA 4TVPD 5I8OL 4PJEE 3WNNA 4YR6B 4U1JA 1QLFA 1UA6H 4HIXH 2J7LA 4MD5A 4EEEA 3LN5B 1AXSA 3WFBL 1K4DB 5F72S 1J12A 3FRUA 3GGWB 3DX8B 1ZGLP 1X7QA 3X14A 4ZS7H 1A9EB 1UJ3C 3GMQB 2E8ZA 3QDMA 4P2QB 3UPCA 4NDMA 3MRMB 4NQSB 3PNWA 3IAQA 3B8SA 4F9LA 3IS0X 2KKQA 4I1NB 1BEYL 1N2RA 3DXAD 1OTTD 2R4SL 2KDGA 4Z7NE 3BE1L 2GAZA 2X70A 1IAIH 1JPFA 5C6TL 3WSQL 3PWNB 3RIAK 4F2MB 4PRID 1IQDB 1QD0A 4OGYL 3K80A 3G6JF 4ZXBB 4HJ0D 2K7QA 2YD2A 2C4XA 5CUSL 2OX5A 5T1LA 5HDLA 4K3DH 1NUDA