4PGDB

Mhc class i in complex with modified sendai virus nucleoprotein peptide fapgnypaf
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/peptide
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title The first step of peptide selection in antigen presentation by MHC class I molecules.
pubmed doi rcsb
source organism Mus musculus
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pgdB00
5TJWK 4KJWC 5E5RB 1U9KA 3M07A 1UKSA 1JGUH 5LBSL 3B4NA 1UXWA 2OM5A 5F3BB 4G43B 4EN3B 2KH2B 3CVIL 4KJPD 4ELKA 3JTTA 3MLVH 3S5LB 5CIPH 1Z9MA 5CJXC 4HKZA 4QRUA 4LAJH 5DEGB 1JZ6A 4NKIL 2A73A 1T2QH 4PJ5E 4JVPA 3IJYB 3RZCC 4N68A 3FO2B 5T1MB 5GSVA 2P8PA 2ZOKB 1ZV5A 3CVHA 3MRMB 4HBCH 3TESA 3EJYC 4HCRH 4HUWA 3MACH 3FRPA 5FM4A 4HG4K 1N6QH 2HVKA 4OD2A 1XGPB 3MLXH 1R6VA 3IU4L 2DQUH 4MYWB 4UV4L 3O4LA 1YEIL 2VKXA 4Y5XC 4JJHA 2UZXB 4TQEH 3F12A 3LOWA 3IGAA 5L6YH 5ICXA 3QUZA 1KTDA 4Y5YA 2FJFB 1B9ZA 5GSRB 3WS3A 5D9SA 1AJ7L 1DANT 4MNGB 4XRCA 4LSRH 3B2VL 3O9WA 1QO3B 4GT7A 3TBYB 1L9MA 3B9AA 1GOFA 5I1AB 3V6OA 3ZTNL 4X5XA 3UJTH 2QADD 2BVQB 4P5MB 1AGEA 5LVEA 3ES6A 1KCKA 5BJTB 4FMFA 1IM3B 4PJEA 5FA3B 1CFQA 2FHCA 5JO5B 3S34L 1WFTA 3CFDA 3QXDB 1MRDH 4L4TE 3V7MA 3S98A 1QHOA 4HEME 3MYJA 4RGNB 4AM0B 2FX8L 4R26H 2ERJC 3QEUB 1JTPA 5DF0A 5DURB 1ORQA 2HKFH 4ONFL 1OAXH 2XZZA 2Y7QB 5EU6B 1JNLL 3RJQB 4YXHL 1UGNA 3O3EB 4HC1L 1MAML 5L8KB 2WINA 4H1LG 1NCBH 2W60B 3SE8L 1WTGT 2DBJA 4O4YH 3VRIB 2DLHA 3X3GL 4H25B 1S8DA 3QUMB 3MXVL 1A7PH 5E5MA 3F5WB 4UDTA 2WAHA 2MNUA 4L29B 4OSUL 4ZG1A 4D0DA 1T20B 2GY7B 4R2GC 1WBXB 3CDYA 4XP9L 5DVMA 1QFHA 1I7ZB 4NZJA 3ARGD 2EDDA 3W2DH 4ZFFB 5BVPH 3OKEA 4J4PC 1QOKA 5A16A 5J11C 4OGAD 5CJXA 1BD2E 2AK4A 3BP4A 4ZQKA 1JFQH 3HE7B 5DXWA 3OAYH 4KVNH 1R5IA 3QRFM 1HSAB 1E4WL 3PWPD 5FGRA 1AO7B 2BX5A 1NMBL 3GSXA 2X4RA 4X6FA 2QQQA 3F7VB 3FFDA 1OT1A 3KXFB 4FTVB 1QBMH 3D85A 4B53A 1SHMA 3DX6A 3D0LB 3LDBC 3FT4B 2VUYA 3ABZA 1DFBH 4G9FD 4Y5XA 5MEOA 2J88L 4ACPA 3SKNB 4B7LA 5DMGD 1V7ML 4F15C 1DBML 4TVPL 5DQ9B 4RFOL 4YUEL 4FQXD 1CU4L 5E94B 3WHXB 4KKCC 1NAML 1NC2B 5I74C 3MRCA 4OZ4A 3IETB 4WW2B 5I76A 4MNQB 3VXQA 5EC2A 1BVKA 5TGBA 2DLGA 4LCCC 1DDHA 3BX7C 4JN1L 3VRLF 1OAUH 3GRWL 3LKOA 5AD0A 3T4AA 5CJOH 2I9LA 1K8DA 3PNWB 4PJDE 4AENB 4LMQI 5CSZB 4PY8J 3GI8H 3QO1A 3H42H 3QI9B 1E4XI 3EGSA 3VI4F 3CMOH 1IEHA 4LF3A 5TF1L 2A9NH 1U58B 1A3RH 4XVUD 1Z5LA 1VCAA 4R4BA 1NSNH 3DTXA 1KCRH 2MTPA 4JM4L 4DVRH 1NGYB 4K3EH 4RIRA 4OD3L 5D1QA 5I8CA 3TZVB 5K9QG 1T0NB 2N7BA 4RRPA 4APQD 1HYRC 3MLRL 1S7VB 4MNGE 1HCVA 4O58L 1FVEA 1W0VB 3ZDZF 4LIQH 2P7TA 4LNRB 3OHXA 3VFNB 2G9HA 1KULA 1XGUA 1HHIA 4J4PA 4K9EH 1OM3L 1NGQL 4CW1A 2FX7H 2GAZB 1LP9F 5B8CB 4PUBL 1BGXH 1T3FA 1SJVA 4RGNE 4JVUA 1R3KA 3SDYL 4W6XB 5IB3B 3ZE0F 3VW3L 1P1ZA 4UIMB 4HIXH 4YZFE 2M8XA 1K5NA 5EU6E 1K6QH 3QDJA 1RK0A 3OJ2C 1U2HA 3RX7A 1QEWA 3BKCL 1QSVA 3BGFC 3H8NA 4WFEE 4XZUA 5DFVC 1PX3A 3BPOB 1OOAA 3MGTA 3LS4H 2AQ1A 2MCPH 3UYPA 1NUGA 3GMQA 4CDHA 3OKNB 32C2B 3RNQA 4OLZL 1CK0H 3BGMA 3DUSB 3RWIA 4PJIF 2X9XA 5EBWB 1T21B 4EBQH 4JRXD 4LSDA 3RWCB 1EHLH 1UWGL 5J3HD 2YWZA 1CD1B 4HLZH 2PKDA 1WFNA 3O9WD 5BV7C 4KHXL 3A67H 1K4CA 5D72H 5K9KB 1FCGA 1JGVH 4LCCA 4Y2OA 5LCVL 3D69A 1HHKA 2VLRB 35C8L 4WWID 1H3XA 4NRXB 5IB1A 1VADB 5AAMA 3EO0B 5JDSA 4H26B 3B5GA 4OGXH 1D5IL 4RX4A 5HYSB 1FYTA 2ARJB 4JGUA 4M6ML 3VGGA 2R1XA 5IVNA 2OL3B 2Y06L 3BW9B 4K7FA 4HUXB 1RV6X 2HN7B 4ZUWB 1T89A 4H0GA 2I27N 1AR1D 1CFSA 3KXFE 3LRSA 5DD1L 5KOMC 3PIQA 2QL1A 5ENWA 4FTVE 3U9UA 3UTSB 4YE4L 3MUHL 1UACH 1AXTL 3FN0L 3O0RH 1A6TA 2UWEB 3E3QE 4PR5A 1CT8A 2H6PB 5DYOA 5E4IA 1IGIH 1QYGL 2G5BB 4R8WH 5TE6H 1FGVL 1I9JH 4KDTC 4RMVA 5IVXB 3O3DA 4S1DD 3NN8A 3HE6A 3ALPA 3PUCA 4Z6AT 1DQLL 1IGJA 1NAMB 4BA8A 4U6VL 4YHYB 5E6ID 4HUVB 4MNQE 4KJWD 1Q72H 3FONA 5FB8B 2VLJE 2PW2B 2XA3A 4QHKI 5DVLA 3L3KA 4CADA 3ZKXB 3KPSA 4I3GA 1A14H 1I8LC 4TNVF 1N6UA 2AK4D 4JFXA 1FG9C 2J6EL 3LSOB 1CTNA 3EFDH 1CE1H 1SEQH 1U3HC 2HFGL 3RZCD 4OAWA 4U1SA 3WYRA 1WEJH 3O2VL 4BSVB 4X4YB 5FKAA 1CDHA 3EJYD 4JDZA 2AGJL 4NQSA 4OJFL 2WZPD 3D3VD 3V8OA 1HQ4B 3D85D 4OLUH 2A6JB 1ZT7A 2AJYH 3RY5A 2EIBA 2C1PA 3WBDA 1L7IL 1K4DB 3MOBH 5HVGB 3EDJA 3G6JA 3G5VB 5C0CB 5JPNA 4P2QB 1HQRA 1RZGA 4JQIH 5L0QC 5GS1B 1T7YA 3LIZL 3BSZH 2VLME 4YHOL 3RGVB 1AXSB 4X6DA 5E70A 1T7VA 5F96H 2EEDA 4QXTB 2A83B 3DSFL 4WU7B 2EEBA 4ELMA 4NPYA 1OF2A 4H8WH 4AQ1B 4JRYB 2DWDB 5JA8B 5CEZD 1Q9WB 2N1KA 4HZAA 4UT7L 4UOW0 5I1HH 2R4RH 5E2TL 3WUWG 4PRHA 2I24N 3T4YB 4RISH 1GXEA 4X98A 2VMFA 3H9HA 1KEML 4OLWL 4XBPA 5D8JL 3UJIH 4OZHF 3UCRA 4OZIE 1J1PH 4UT9H 3EYOA 5C0IB 4C59B 4NCDA 4U7KA 4KDTA 4LGPB 3VFPB 3EUUA 3DO3A 4RGMC 4NZUL 5D1ZD 1KJ2A 3BVNA 4BQ9A 4MSWB 2HWZH 1XCTA 4R2GD 1YN6A 2KQMA 1NGWA 4YHPB 3MLTB 2Q8BH 1MCQA 4PJAA 3QFDA 4JZJC 5GGUB 3NH7H 1AD9B 3X3FH 4J4PD 1HHHB 5FGSA 1E4XL 2RHEA 1D5ZB 3GSQB 5D7SL 5E0QA 1I8LA 3MUGA 2WBJB 5IB2A 5J6HA 2Z8RA 3O6LL 3SCMB 5C0FB 5HHMD 1Z9OA 1U3HA 4NCC1 4LHUD 5D2NE 1RVFL 4WNQA 1BZ9B 4A6YL 2ORBH 2YKLL 4TSBL 3UTSE 4P57A 2A74A 5F9JB 5D7KD 3QDJD 2UWEE 4N0CD 4EI5B 2J8OA 3SKOB 1N8ZB 5F8RC 3HR5B 1JHLH 1ULVA 4N9GA 2V2XA 3LMJL 1RZJL 2ZSVB 4HWZA 4MJ6B 1DL7H 5IVXE 1A4KA 3C8HA 5D5MF 3PWJB 3OAUH 1KT2A 3HNTH 3BOVA 2YSSA 2AV1A 1LILA 4GFTB 5HDBE 1JPGA 5TH2B 4YBHA 4U2ZA 1PQZA 1JPFB 2VITA 3HPLB 4YHNB 3RVXC 3NCEB 1U8QB 4X4XB 3BUYB 1DUYA 2W07A 2MPAH 2DMKA 4DVBB 1KB5A 1ADQH 3HAEG 3PP4L 1VFMA 5EIIA 4RX4D 4YAQB 1FYTD 1JRHH 5FYLH 3KAAA 3VWJD 4CGTA 3F6IA 3DURB 3P0YL 1A1OB 1NBVH 1FRGH 1FLTX 3V5DB 1WZ1L 4IRJC 5JQ6H 1A3LH 5MERB 2W0FB 5SV4A 4LCIL 1MFAH 3L6FA 4ZSOB 3U46A 2B2XL 3V4VH 2O5XL 1YDPB 1WBYA 4DKFH 3CFEB 4LSUH 3JUYA 3QULB 4MJ5B 5C0CE 4O5LL 4P2QE 5MENB 1B4RA 3CSBA 5DK0A 1H5BB 4I48A 2RB8A 4NQCB 1QFUH 1EHAA 3JWDC 5GS0D 1JGEB 1G7PB 1KC5L 2P8LB 4KJYB 3U4EA 4JR9L 5C0EA 4JZJA 5DJ8B 1I8MA 1W72A 1KJVB 3WFHA 4TUJB 1W2KT 3ZL4H 4CVZA 4Z8FH 3U9PH 1U8IA 4JRYE 1VA9A 2EYRB 5F44A 3KDMB 1BOYA 2VQUA 3B5HA 4P9HH 5FCSH 3LN5A 3W11C 4ZO7A 4M7KL 3TNMA 4OIIL 3TJHC 2VXVL 1OQXA 5HPMA 5SWSB 2Q86A 3UMTA 1P5VA 3P9MA 1E6OH 4UIKL 3FL7A 1G6RB 4AH2B 3L3OB 4PGEB 4X4MA 1RUMH 4HLJA 3K3QA 1H3TA 2MHAB 4XMKL 3RI5K 4QEGA 3NFNA 3RDTB 3T3PE 3BMVA 4ZO8A 4XNZC 2YA2A 4AL8L 1A0QH 2O61A 3DX7B 1YEKH 2WUBL 3GM8A 3SDCC 2ADIA 3V79C 1DVFB 5DHVA 3FT3A 1MY5A 2AEPH 4ZTPH 2GI7A 1FYHB 5K93A 1A7NH 5KVFH 5FO7A 3IXAA 1XF1A 4M8QA 3WNLA 1FORL 5CCKH 5DRWB 2GSIA 3WN5C 1ND0A 3LH2H 1KEGH 3PDOA 3TFKC 1N5AB 3PL6B 2XKUA 5ALCH 1G0XA 1U3ZA 4ETYA 3MRQB 4PJ5A 3OJDB 3VGHA 1I8KA 1QRNB 2X4PB 4IRJA 3NABH 2NY7L 4PRHD 4IBLT 4HIIA 2UY6A 3GHBL 3IDGB 4C4KT 1FFPB 4A2LA 3FQWB 4W81A 4MCYB 1SJHA 3AS0A 3O11B 4QOKB 3RWFA 1FNEB 2X42A 25C8L 5SX4H 2WWKT 1JF5A 5FHAH 2K7QA 2R2HA 4KRPB 5IFJB 4HJJH 5CEYA 3GMNB 2R23A 3OKLA 4LASL 4EEEA 1HZHH 3E6HB 2P45B 1S9YB 4EN3C 3V52L 2P24B 4DFHA 3EOBA 4FQ2L 3NAAL 5EA0L 2BC4B 5CBAB 1KIPA 4WJ5B 5I17B 1F6AB 3OGOE 1RURH 1NCUA 4AT6B 2Y9RT 2R2CA 1U3HD 4K71B 4X8JB 4BK5A 2NY0B 4Q9CA 4RMUA 2YPVL 2PCPA 2XIDA 4ZSOE 4UOJA 1KNOB 4KQ3L 4H1LA 4ODXA 2PNDA 4YIQB 2YPKA 3SKJL 4F7MA 3QUYD 5D96B 5DWUL 1CDUA 5LWYH 5MENE 1P5UA 2EXYC 1OSPH 4R0LB 3VXNB 3JV6A 4OI8A 5BZDB 1A7QL 4NQCE 4K94C 3SQBA 3SDCA 1Q94A 3W0WA 2WV3A 3HZMB 4UNVA 1RJZB 3BZ4B 1SBBA 4F57H 4XB8A 4C54A 3HCVB 3JVGC 4BZ1H 1T04A 5C70A 3W5NA 3WN5A 4JY5H 3ZKQD 3VXTA 1GZPB 3UTQA 1MCWM 1MCKA 4KK8C 2IG2H 4F3FB 5SWSE 5DQDL 3WFCH 4RGNC 5EPMA 4MX7A 2FX9H 4NO5B 1RUAH 2CPCA 1LMKA 4Y16C 1T03L 2V2TA 3F58L 1A6VH 1UZ8B 1XGRA 4J23A 2R0KH 4LHQB 2NXZB 3CZJA 3RTQB 4PFEA 2UZYB 2FBOJ 4M03A 3EYQC 4AEFA 3STLA 3QCUH 3DUUA 4OQ1A 1GZQB 1PX4A 2QJDA 5DGRA 4L3EB 5FOBA 5F88A 5DS8B 1RZFL 4I4WA 4LMQE 4OCYH 3FTGB 3TBSB 3VI3F 1OPGH 2V17L 3C08L 1ED3B 1N4XH 5CZVL 5F9DC 4WHTB 5F3BA 4G43A 4EN3A 1UA6H 5F1KC 2VJXA 2X1WL 3S5LA 4DUWA 3ALWA 1SMOA 1YJDH 5A3ID 5DEGA 1U91B 4JKPH 3NTCL 3HE7C 4JO3L 4OCSH 3IJYA 3O45B 7FABH 1QRNE 1MCNA 1NEZB 3HMXL 5T1MA 4DEPB 3B9EA 3MCLH 2ZOKA 3MRMA 4AEHL 2HFEB 1NBZB 2ED9A 2HTKC 2N56A 4H20H 3REWB 5C86A 1KXTB 1IAKB 3UC0L 3G6AB 2BRRH 1XGPA 3P77B 5IROC 4JKLA 3SQOL 1LO3L 3VFWB 2ITCB 5JPMB 2HKHH 3E3QC 1IZKA 4QOKE 2WBWB 5C07D 4LPTA 5IG7B 3A6BH 2IMMA 5EWIH 5HYFA 3MOAH 5GSRA 4MNGA 4JAMA 3L5XL 1QO3A 3TBYA 1FV1B 1OP3H 2W9DL 5J8OA 5EULV 2AEQL 3JVGA 5EU5B 5I1AA 3BH8B 1CDBA 1JPSH 4WW2C 4P5MA 4HWBL 4TSAH 5BJTA 3RVXD 3GBNL 3QT2A 2OJZH 5FA3A 4PIRF 2VZVA 5JO5A 5GISH 5HGDB 1UWEH 2D7QA 2BSSB 2AKRB 3L7FB 3QXDA 5KSVB 5EH1A 5E99L 5FYKL 3VRLE 3LHPL 4P9ML 4RMTA 4AM0A 2C4FU 4R96B 5I18L 1ZE3C 4WY7H 4Y16A 3AREB 3QI9C 4IRJD 1DEDA 5T3XD 2Y7QA 4DGVH 3WD5L 1OY3B 4XMLH 5F1OB 3O3EA 4OLXH 2EC9T 1B4JL 3VI4E 5JTWA 4JHWH 5DJAB 4Q2ZA 1UM6H 2X4OB 4GAGH 4DAGH 1FLRH 3TYGH 2ARJQ 3CFCH 3VRIA 4H25A 3TZVC 1CXEA 2ZUXA 3F5WA 3MJ8B 4L29A 2Y07H 1T20A 4Y5VB 3MQIA 1WBXA 5I8KL 1I7ZA 3WXVL 3O3UN 4HXBH 4BQ8A 4RAVA 3ZDZE 1LK3L 1MQKH 3SE9H 4ZFFA 3PWUB 1V3LA 3V0AC 1MCIA 3GNMH 1HKFA 1MY7A 5LAXA 3RWHB 3KPRB 4TNWF 2X4TB 4ZAKB 4LPWA 5CILL 5B8CC 3HE7A 4UTBL 3W11D 5IFHH 3MUZ1 2P5WB 4KRLB 5AUMB 3SPVB 1HSAA 3TJHD 1AO7A 2CK2A 3FB5B 3PWNB 4OM0L 4WUUD 3ZE0E 4QXGL 5FEBA 3KXFA 3QQ4B 1V3MA 4FTVA 1UC6A 2DI9A 3BPOC 3GKWL 3EOYG 3D0LA 3FT4A 4FNLH 5C09B 4L3EE 2I60L 4J3SA 4NYLB 1UYWH 4WU5B 5D2LF 4IDJH 4WGWB 4YHIB 4NRYB 3OMZA 4NUGL 1DN2A 1OSZB 4HXAL 5DQ9A 3TF7C 1UH3A 5ILTH 3SDCD 3WO4B 2EIZA 3W0WD 5E94A 4PJIE 5F7MC 2NW3B 1NC2A 2WK2A 1JTOA 3IETA 4WW2A 4MNQA 4N1HB 4P2RD 2X7LA 2R0ZL 2XT1B 4LK4A 1HILB 2XTJD 2W1NA 4OF8A 2CO7B 3TFKD 3FAXA 4AENA 4P0DA 5CSZA 3RA7H 2B39A 1CFVL 1V05A 3QI9A 2CMRL 1CR9H 2VSCA 4NM8H 2BVEA 4U6HB 1MWAH 1U42A 2E7BA 5A1AA 4DGIH 2Z35B 2ATPB 3GK8H 4JO1L 1V7NH 5I1DA 2DWEB 5HYJB 2EDQA 1NGYA 5ISZD 2DYPB 3TZVA 4NBXB 1T0NA 1SVZA 3D0VB 4PLNC 1S7VA 1I3UA 3BI9X 1ORSB 1W0VA 1ITCA 4QTIH 4I77H 3VH8G 4NQDA 3AS2A 3HI5H 5BS0B 3L1OH 3K1DA 3VFNA 2MQ0A 4YHYC 4HH9B 1P7QB 4U6YB 1RZ7L 4XPBL 3TO4C 4B7IA 5ADOL 2IC2A 4EN3D 3IKKA 4JB9L 3TPKA 2YRLA 4S0TD 1NANH 3X11B 5B8CA 1M7DA 1H3VA 3V0VB 3ZKXC 3UEZA 1R3HB 3S3SA 3MZTA 5B21A 2DBLL 3GZKA 4EXPX 4ODSH 4G8IB 4UIMA 3NFPB 4X5WA 2MSPA 3MV8B 1Z0MA 4JG1L 3KLAB 2F74B 3AY4C 3CX5K 3N1PC 2P5ED 4HC1A 1JYVA 1D6VL 4NNPH 3VDCA 1YEDB 2ICWJ 4LFHD 1J0JA 3HC0B 32C2A 1ZT1B 1L9NA 5HDQH 1D3CA 5FGCB 1AP2B 2BNQB 2MCG1 4EUPG 3I3EA 2EXYD 4OGYL 5TF0A 4S10A 2BVOA 3DUSA 3MRBB 1GVIA 3HRZA 1T21A 1U0QA 3RWCA 2RJMA 4NO0D 5GS1C 1CD1A 4LVEA 4M3JA 3QDGB 3RGVC 5D70H 1KIRB 3WDHA 3EDDA 5K9KA 5DZLA 3VXUD 2UZIL 1ZVYA 3KPRE 4RWYH 2VLRA 1VGEL 4NRXA 3EO0A 4PB9H 4H26A 5C0NC 4LVOC 2P5WE 3CDGB 5IESH 5HYSA 1WT5C 2ARJA 1DEEB 1R3IL 2OL3A 4KK8D 4P3CH 3CH8A 4XNYL 5DD5H 5DMKB 1JNNH 2P43B 3BW9A 5FA4B 1KCVL 4HUXA 3I6KB 2HN7A 4ZUWA 1OARL 4YR6B 4Y16D 5DK3A 1X6NA 3UTSA 1WGOA 5C0AB 5DD6B 4JFZH 2ADGB 2UWEA 3DHMA 5K9JL 2H6PA 2XYCA 1T4KB 4WFED 5EZOL 1TJHH 2HJLB 3EYQD 4FZEL 4OZHE 2G5BA 2NCMA 3VXMB 3H7BB 3WNNA 4R4FL 5E2UH 5IVXA 4L9DA 4C56B 3L3DB 1MHEB 1RJYB 1ZS8B 5DJXB 5KG9B 5EO1B 2V5RA 1XGYH 1NAMA 4WFFE 1JF1B 2HLAB 1CLYL 5B3NA 3DYPA 4O51B 5FB8A 1VFBB 2PW2A 1UADC 3LD8B 1TETL 2XZAH 3GRWA 4JN2A 3RKPA 1GC1L 2AP2A 3RKDC 4FFZL 4H88H 4HF5L 2ADFH 2WBJC 3VE0B 3SCMC 1A6AB 4AG4H 3S3JA 1YEHL 4GMSH 1P7HL 4DUXA 3VGEA 1AO7D 3UTTD 4BSVA 2HTKD 3BZEA 4X4YA 5CP7B 1J86A 3I75B 1KCSH 1SBSL 1FAIL 1BVLB 3KXFD 5HYJE 4FTVD 1HQ4A 1KBGH 1NUDA 4QWWD 2A6JA 2EH7H 5ESAB 3GUTB 4MNHB 2MKWA 3RJDA 5DSCB 1K4DA 5CLWA 2G5RA 3G5VA 5C0CA 5D5ME 5BS0E 2AS5M 5GS1A 3O6KH 3RGVA 1AXSA 4URTB 1WZLA 5J6GA 1X5JA 4QXTA 4PGCA 2A83A 2DQIH 1NC2D 1BX2B 3O81A 5EOQL 5DMIH 4MNQD 4WU7A 1IRAY 3BD5A 3WDIA 4HUUB 1MCDA 5IGXL 4JRYA 5IHBA 1WT5A 1EGJH 2DWDA 4IMLB 2FIKB 1Q9WA 3T1FB 2XZCL 1U3YA 5I8EB 4PY8I 1Q1JH 1J7VR 5F93C 4XB7A 3U7WH 2XQBL 2APWA 4Y0GA 4BH7B 2XRAH 3T4YA 2DQHH 5H37H 4Q9QH 1I4FB 3QI9D 1JGLH 4ZFGL 3VDAA 3RX8A 1LVEA 4D9QE 4N8PA 4NWTH 1JCKA 4ZMAT 1U8JB 5C0IA 3BE1L 2CKBH 5FGCE 2GUOA 2BNQE 4RGOH 5IVZB 4G8EB 1DBJH 1BWWA 2YS4A 3VFPA 4FXKB 4PGZA 3VXOB 3OKDB 3MA7B 4HX1B 3PGFL 1H5BC 4MSWA 5CMAB 2HRPL 3T0VA 5TQ2H 4DGYL 2FEDC 4G3YH 1SVCP 1FZOB 1T7WA 4NQDD 3MLTA 5TDPB 3ULSB 2Y36H 5GGUA 1AD9A 5EG6C 4YHLL 5JXAH 1ZOXA 1HHHA 2BOBB 3OTTA 4POZD 1D5ZA 3GSQA 4KXZH 3LKSB 3TBTA 2WBJA 3RBGA 1U36A 2OTWA 3SCMA 5C0FA 4ZUUA 1IQDB 1BZ9A 1JV5A 1UEYA 2OP4L 3NACL 5I9QB 4DZBB 3SDAD 3Q6FB 1BIIB 5CUSL 3C5JA 3KYOB 3GSNH 5C0AE 3AS3A 3QFJA 4W70A 2YN3A 4LSPL 1J5OL 1R5WA 5INDA 2VXSL 3TLRA 1ONQB 3SKOA 1N8ZA 2Q8AL 3HR5A 2A1WL 3VXME 5AYUL 3ARDD 2R4SL 4MJ6A 3BAEH 1P7KB 4PG9B 4JFYB 4YLQT 4C56E 2ZG3A 1EVUA 4YDIL 3PWJA 3W9EB 4KPHH 1WTLA 3UZQA 1MVFA 3HMWH 5TE4H 1FBIL 2JIXD 3FMGH 5CKGA 3IFNL 5CKAA 3I6GB 4D0CB 1YEFL 5TH2A 3JTSB 1JPFA 4JO2H 3HPLA 4YHNA 1TITA 1P9MC 2E27L 4MQSB 1U8QA 4X4XA 3BUYA 5FHBL 4DVBA 2VLRD 2GKIA 1P84J 2J6EA 4JDVB 4YAQA 4NDMB 3PL6C 4ZUSA 3HB3C 4FQ1L 1P69B 3DURA 1BECA 1A1OA 3HAEH 3V5DA 5B38B 3ARFC 2QHLA 3GMPB 5MERA 4Z5RB 2BHUA 2OXGA 4A2MA 2OTPA 3MA9H 3UTSD 1GAFH 1CL7H 3E2HB 4ZSOA 3UBXI 3C2SA 5B4MC 1YDPA 4DN4H 1MOEA 1RZJC 3ZTJH 4QRRB 4POUB 4OQTL 4O02L 3QULA 3TN0B 2YA0A 2FECI 4Z7WB 4MJ5A 5CSBA 3LEVH 2EYTB 5DVOA 1QSED 1QBBA 3WIHH 2QSTA 4AIZB 1S78D 1H5BA 4NP4H 4KMTL 3GO1L 1C7TA 4NQCA 2B7DT 4HJ0C 4TVPD 2V9TA 3O6MH 4KTEL 3EW3B 4KRPC 1G9NL 4XNUL 1JGEA 1G7PA 1MJUH 1PG7X 2P8LA 4KJYA 5D7JB 3G6DH 1JHKH 1PVHA 3DO7B 1K8IB 1X9QA 3M1BB 3TO4D 5IEKB 4XCCL 2HJKB 4LOUC 3WFDH 3KDMA 3WLBB 2A6IA 1PKQB 3C60D 2HT4C 4F37F 2VQ1B 3PHQB 5IOPA 4M5YL 5SWSA 2UUDK 3AFLA 4S1QH 2J8UF 3QWOB 3TEUA 4J7RA 1KCLA 3LCYA 3O8XD 4K23L 4CN6A 4OLYL 4AH2A 3L3OA 4PGEA 4HT1H 4ZTOH 1ZSDB 2DQCH 2XN9B 4LARL 3I9GH 3ZMRA 2MHAA 4NQEB 3FCTB 1CS6A 3NZHH 5D96C 3T65B 3GKZA 1VFOA 1OHQA 3C09B 1VENA 4FQLL 4YHKH 2PYEB 3ULVL 2VDML 3DX7A 5HD8C 5C0CD 1ACYH 3K74B 3REVA 3QXAB 5DI8B 3RGVD 4IM8A 4Y88A 3RHWK 4NGHL 1P9MA 2VXTH 3MV7B 5DRWA 1DSFL 4XWGH 2EDHA 2P8MB 1IGYB 3SN6N 5GS2H 1P4LB 3S37H 1A9BB 5IR1B 5C0ND 1NGPL 1FDLH 1N5AA 3PL6A 1X5GA 4A6YA 1MCEA 2QBWA 4KV5F 3MRQA 3OJDA 1TVHA 4L8SC 1INDH 3FN3A 2EH8H 2X4PA 4RSVA 4UV7L 3SJVD 4ODUB 4NKMB 4QHLB 5GGVY 2ESVB 5FCUL 5GRJH 2PYFB 2V2WB 1O5DT 2NXZC 3H3BC 4LSTL 3RTQC 5D6CB 3T04D 3IDGA 1YNKH 4AEEA 2ZCHL 4M7ZB 1FFPA 3MXWH 4M1DH 3QIUB 4NO2A 3FQWA 4MCYA 3O11A 4QOKA 3N9GH 1MHPL 4L4JA 3UYRL 2ICCA 3QNZB 2EYSB 2I9TB 1NCCL 3DMMB 2J2ZA 1FO0H 2E8YA 1AQKL 1FJ1B 3GMNA 4YHZH 1DQML 1PEWA 2RIKA 2EDYA 2AVGA 3E6HA 4QRSB 4I5BB 3VI3E 4X80L 2P24A 2CXKA 4BFGA 3C2AL 1CZ8L 1R0AH 1C1EH 2BC4A 3P4OB 4WJ5A 1F6AA 5E4EC 3LQAL 5IBUG 3RKDD 2WBJD 2Z31B 4JY4B 3S36X 4AT6A 1BJ1H 5CEZH 3KPMB 4X8JA 4PTTB 4KMLB 5B38G 2VC2H 5IW3A 5E2WH 1AGCB 4AEIL 4CU8A 5FYJE 2BJML 1KNOA 3QFJD 1OB1B 5D7LB 3L9RB 4YIQA 2JELL 1UWXK 4QRRE 1I7RB 3CFJB 3LV3B 3M17B 2J7LA 2Y5EA 4Z7WE 4OGZA 1MFBH 2DAVA 4XPHL 2D4FA 3VXNA 4M93B 1IC4L 2XKNB 2O5YH 2WIIB 1C5BL 4LQFL 4OCRH 3BT2L 3HZMA 5F89B 4XNXL 4GBXB 1RJZA 3BZ4A 5GGVL 1NPUA 4GQ9H 5HPOA 3HCVA 1KENH 4QHNA 1ZT4B 1ZKAA 5L8LB 5EU4B 5FKPB 1FGNL 1OQOA 4J3VA 3ARVA 1YEGH 4WCYL 1GZPA 1PKQE 4TVSa 1QNZL 5DUPL 3CXHK 1ZHNA 4F3FA 1T1ZB 3BZDA 5HBBA 1BBDL 3AXLB 2VDNH 3KJ4C 4NO5A 1NCDL 2OR9H 2B4CL 3AREC 5DT1L 1IAIM 1UZ8A 2EKSA 2XN9E 3RTQA 5IHLB 3ET9F 4NQEE 5EUKB 1Z2KA 4JFPB 3HPJB 1BF8A 1L4IA 1GZQA 1W0YT 4OLVL 3GSVB 5BMFL 2PYEE 3ZYZA 3V6ZB 1QLEL 3MO1B 3QJHB 5DS8A 5F9OH 4Y5VC 4NQCD 1ETZB 3FTGA 2FEDD 3TBSA 4WEUD 3GB7B 3MV7E 1ED3A 3OQ3B 3HLAB 1K3ZA 3VFTB 5KN5B 1XF3B 1MFCL 4G6MH 1EEUA 5ID1B 1U91A 4M6OL 6FABH 1OP5H 3TA3B 5DMJB 1EUUA 3KPOB 3O45A 5SV3A 1NEZA 2ZPKL 3NBNA 3AMKA 3U1SL 2HFEA 1NBZA 5DQJA 3VD7A 2LAAA 2ESVE 3REWA 4CJ1A 1IAKA 3G6AA 3IS0X 4NFBA 4OIBA 3Q3GA 4Y89A 3L5IA 3VFWA 3DGCR 3GFUA 3F7YB 3LEXB 3EFFB 1S3KH 5JPMA 4JJ5B 1YECL 3VWKB 3EHBC 4H5SA 5IG7A 4PJXA 3VFVB 3G5YA 3NPSB 2V5SA 1S9WB 4RMWA 3QQNA 1HWHB 4LSVL 1FV1A 2NY3B 3WO4C 3FOMA 3MRFB 4P2OD 3MV9D 5GS0H 3QRGL 1YYML 5E9DB 2DD8H 4S1SH 1UM4L 1I3GL 2VABB 5IMKB 4YFDB 5BO1L 3HZVB 3IDMB 5HGDA 2AI0H 3MLWH 2BSSA 2AKRA 3L7FA 5KSVA 2YUXA 4WENB 4X99A 4YDVB 4OTXH 4R96A 3HB3D 3ARUA 4W6YB 5DJCB 3AREA 3ARFD 4XC1H 2BVUA 2DLFL 5D7LE 3TCLB 3MRPB 1RZKL 4M7LL 3RU8H 2EDXA 1F4XL 3DVGB 4JFHE 5CJ8A 5DJAA 2X4OA 5F3HA 4PRPB 1B3JA 3DI2B 5DTFB 3GSRB 4OCXH 3UX9B 3S4SB 1MCHA 4J8RB 4P46B 3LZFH 2DQTL 4GH7B 3G04B 4QOKD 3BZFB 4KZDL 3MJ8A 4GUPB 5F6IB 5D7IA 4Y5VA 4YC2B 5DHYB 2CK0L 1JBJA 2F15A 4HJ0D 4UQ2B 4G6JL 4KRPD 4TTGA 4N0FB 3PWUA 2LE9A 4YNYB 4LCYB 3C6SB 3RWHA 1BZQK 1UG9A 3KPRA 4PJFF 4LOUD 2X4TA 3M8OH 1MJ8L 3W5MA 4TRPL 4B50A 1A7OH 2EC9U 4QHMB 1EO5A 2P5WA 4HV8B 5AUMA 4X6EB 1SEBB 3DV6B 2VLKB 3FB5A 1DBBL 4N90E 3P4NB 3MRRB 4EKXA 3T2NL 2CUMA 2VOTA 1F2XK 3T2OA 3W82A 5C09A 5JOPD 4NYLA 3MLVL 1M4KA 4YHIA 2NZ9C 5KSAB 4V1DB 3O3AB 4NRYA 2PXYB 4I9WE 3VXSD 1OSZA 2EDTA 4BKLB 5HD8D 1Q0XH 4YHMH 2NW3A 4HBCL 2XICA 1WICA 4HCRL 5DR5H 2Z4QB 1CXKA 2W9LA 5IJKC 1CD9B 3SEPA 4IRZL 3ALXA 5JNYB 5F7EH 3NOIA 2DQUL 4ZPTB 4RDQF 4ENEC 1HH9B 3WJLC 1IFHH 1EFXB 3HNSH 4O2FA 3BWAB 4HFUL 3STZB 3V6FB 4U6HA 1WFUA 4LSRL 1A8JH 4XH2B 2Z35A 4OT1H 2ATPA 4ZFZB 3HKFA 2NXZD 3UJTL 2DWEA 3RTQD 5HYJA 4WVRA 1Z3GH 5GJTH 5KW9L 2DYPA 4P23B 3U2SB 1IC7H 4CNIA 2BNRB 3D0VA 1PLGH 5CWSA 1RD6A 3KPLB 1C16B 1ORSA 2GFBB 5KVDH 1FNAA 4X9FA 4KQ4H 4PJGF 1MFNA 4R26L 4OZGA 5E9DE 2QSVA 2VXQH 4HH9A 5HYQB 1P7QA 4HWBA 2HKFL 4U6YA 2JJUA 5BRZD 1RAMA 2FYYB 2OQJB 3FB6B 3TT1L 3LD8C 3X11A 1XR9B 3V0VA 4MD5A 1B6UA 1R3HA 5MI0C 4K3DL 5E03A 4O4YL 3ARPA 4G8IA 5IB5B 1A7PL 3MV8A 2B8OT 2XV6B 2DIAA 4L8DA 2F74A 3BYYA 1VHPA 4U1HB 4MAYC 1YEDA 3D5OF 1SQ2N 5I2IB 4IMKC 1VDGA 4ODBD 2CIKB 4PRPE 5L9DL 3HC0A 3GIZH 2QEJA 4XP5H 1ZT1A 2VE6B 4MB5A 2QSQA 1AP2A 2BNQA 3S4SG 2D7TL 2JJWA 3DGGA 3HR6A 3MRBA 1MI5D 1QBLH 4KVNL 4EUPH 1WAAE 4YXLH 4Z0BH 3P4MB 4YDJB 3QDGA 2OK0H 1F4AA 1KIRA 4RMRA 1DQQB 4LBEB 5IJKA 4M7JH 4MMXC 2V7HA 1YQVH 1KXVC 5IBLC 1QBML 2F5BL 3CH1A 5HHXL 4E41A 3U4AA 4MMZC 3WJLA 1DFBL 3CDGA 2NTFB 2FATH 1DEEA 4UT6L 3QP3A 2VLKE 4I3SH 1T0MB 5FA4A 1TQCB 4WV1B 4YX2L 4GG6F 5BW7C 3I6KA 3D2UB 4RA0C 4YR6A 4WFGE 3ARED 3MGOB 4HIJB 5C0AA 5DD6A 1QHPA 2UVEA 1IM9B 2ADGA 3F6LA 4HZLB 1T4KA 2GJ6B 2HJLA 4WHYH 5CIPB 3VXMA 3H7BA 4V1DE 3WMSA 2GIYA 5L88H 2V5YA 2E8ZA 3GHEL 3S97C 4C56A 3L3DA 1FFOB 1HINH 1MHEA 1RJYA 4XCYA 1ZS8A 1UFUA 3IAQA 5KG9A 3OKOB 1AQDB 5C7XH 3HC4L 5DJDB 2OTUB 4K2UL 2HLAA 1K85A 5EBMB 3QIWD 1K3IA 4O51A 4PJBF 2PUQT 2FHBA 2CRIA 3L3GB 2DM2A 2A9NL 1DQDH 5I1LA 3MTRA 1A3RL 3JWOH 4JPKL 4LVNB 4NFDA 4LKXB 3DYMA 3ZKMC 1CGSH 3K0WA 3UBXG 1NSNL 4P3DB 3WEXB 1KCRL 3KPRD 3VE0A 1BJ1J 2IPUG 1A6AA 1RFDH 4QF1A 2P5WD 5AYQA 4WHDA 5I9QC 3JXAA 1GHFL 1I9IH 3O41A 5CP7A 4LIQL 3QEHB 5DK2A 3I75A 4IMKA 5T3XH 1BVLA 4I0PD 1I85C 3BHBB 5EIQA 3S96B 3FO0L 5JR1H 2PO6B 4WTZG 5ESAA 1G7MB 2VDLL 3CNKA 2BNRE 3GUTA 5C09D 4MNHA 3EHBD 3MRHB 1HN1A 4LLWB 1IGCH 1AHWB 1NAKH 1J8HB 1IC5L 4HSQA 2CDFB 1WZMA 4UB0H 1TLKA 1MCPL 1K6QL 5IKCB 1J87A 1MCFA 4Q58C 2VDKL 4J3WA 2P46B 4HUUA 5GZOC 2H2SC 1GC1C 4JM2D 1KGCD 3LS4L 1JRHI 2BSTB 2VNCA 5I6XB 2VZTA 3T1FA 1KLUB 5I8EA 5CJQL 4G7YH 5BW7A 1CK0L 1N0XH 4RNRB 4UINL 2VAAB 4UZGA 1B0RA 1OAZH 2ZG2A 4QNPF 4BH7A 2RCSH 3UAJC 1EHLL 3MPCA 2YD9A 2NXYB 4Z7UF 1U8JA 1RHFA 2OLDA 4PP1C 1JGVL 3NCBB 5IVZA 5FO8B 5HYJD 4G8EA 1P4BL 2OJEB 1J1XH 4M1GH 3TBVB 4EOWL 4UTAH 4FXKA 4TYUA 3QXWA 2I25N 3ZYOA 1FNHA 3VXOA 3OKDA 3MA7A 4HX1A 5J1AB 4P4RB 3R0MA 1AD0B 5CMAA 1YUHB 1L0YA 1YEJL 2I5YL 1FZOA 3PGCA 5D7JC 5TDPA 3ULSA 3VFUB 3ZE2F 4IOSD 2EDNA 1P7QD 5T3ZE 3GJFK 5KS9F 4D8PA 1LK2B 4U0QB 3O0RL 2VDOH 4PRAB 3LKSA 4FFYL 4RMSA 5DA0B 3WFZA 1ZMYA 2DMBA 4OI7A 1I3VA 5FYKD 1IQDA 1PG7L 4S1RH 5ID0A 4X6BB 3BKYL 4DZBA 3MV8D 3Q6FA 1BIIA 3U7AA 3NCYS 3KYOA 2DIJA 3HUJF 3IKCB 3KWWB 4WEMB 3RUGF 1HHJB 2J8UE 5FUZH 1ONQA 2DQJH 3MLUL 4X0KB 3H3PH 1T83C 4XTRD 1ROWA 2D7NA 1P7KA 4PG9A 4JFYA 1JMXA 3W9EA 4XWOC 2NZ9D 1A14L 1HE7A 4IJ3B 2DS4A 4KJQD 3VRJB 3S8WA 2RR3A 3EFDL 1SEQL 1I7TA 5FOJA 4Y1AB 3I6GA 1FFRA 3KPNB 5IFAL 2NY2D 3D18B 3QDGD 4LSQL 2UV3A 3UTZB 4YDLB 1NFIB 1AGDB 4WUKH 5AG8A 5ABDE 3N85L 4M62H 1X4ZA 5EOTB 3VXPB 4TUOB 4E41D 4DQOH 4ENED 2RBLA 4OBSA 1RQ5A 5FF6B 4NDMA 1Z9LA 3IAPA 3NMEA 4F58H 4JDTL 3MOBL 5B38A 1EO8H 5KJRH 3GMPA 4KV5E 4Z5RA 1EHNA 1EJ6A 1MLCB 1FH5L 1S7SB 1UKQA 5JOEA 4KVCH 5C6TH 4QRRA 4M7ZC 1RU9H 2B1AH 2IFGA 4XBEH 5SX4I 3TN0A 2PR4H 3QIUC 4Z7WA 3IDNA 2O26U 4H8WL 2CRZA 3WS6C 4AIZA 4C56D 2R8SH 1J8HE 3TJEL 2ZUWA 2ZKHH 3IFLH 3DMMC 1S7WB 4TPRH 5D7JA 2R4RL 3CXDH 3WNPA 3C5ZB 2Y6SC 3Q5YA 2XA8L 3KLDA 1K8IA 3DO7A 5HHOA 2E7MA 1QFWM 1RMFH 5IEKA 2YD6A 4LCWB 1CGTA 1KLGB 4UT9L 1B2WH 4FQJH 3WLBA 4XPAL 3EDKA 2Z31C 4LNVA 2VQ1A 3PHQA 5KOVC 1F2QA 4LPYA 3MODH 3QWOA 5EU7E 2XFXB 1EAJA 2HWZL 4MAYD 1YC7A 1F02I 1KTLB 1T83A 1ZSDA 2XN9A 3S36L 5LKNA 4NQEA 1JP5A 3FCTA 3X3FL 1BQLL 3J7HA 3T65A 1NFDA 3WNOA 4M93C 2PYEA 2YMXH 4DCQB 4L1HA 5DGQA 3EOAB 1G9NC 5GRXG 4TUKH 5KTEH 4GBXC 4DW2H 4M6NH 4MLIA 3QXAA 4O9HH 3ARRA 5FO9B 3MV7A 4JO4L 5LQBL 5DJ6A 2P8MA 5IBLD 5DZOA 1P4LA 1JHLL 3I2CH 2VN7A 3HNVH 5IR1A 2JLLA 3U4BH 1IAIH 3LQZB 5KVEL 4PJFB 3OAUL 4KAQH 3HNTL 1J18A 4ODUA 4NKMA 3LRGA 1U95B 5D1XB 4QHLA 2ESVA 2PYFA 2V2WA 2VDQL 1KF9B 5D6CA 5HI4C 3S3PA 2APFA 3WKMH 3QIUA 2ENYA 3H9SB 1EMTH 3TYFB 1EA9C 3WS6A 3ULVC 2B0SH 1RY7B 3B5TA 3D25B 3QNZA 4XBGB 4Y1AE 2EYSA 3WIIH 2I9TA 3DMMA 3PWLB 5BZWA 4HWEL 3FQNA 2AJSL 5ACLA 1T0PB 2GEEA 5T1DL 1NBVL 1ZLUK 1FRGL 1FJ1A 1LEIA 2I07B 1A3LL 2NNAB 3UJJH 4EQ2A 4QRSA 3U83A 3VXRB 4U6XA 5K33A 1CF8H 1OTUC 4M02A 1OTSC 3P4OA 1MCOH 3V4VL 3ZKMD 2R69L 4RWHA 2FRGP 2Z31A 3K80A 4JY4A 3TA3C 5ESQA 2XY2A 4MJID 4NZRL 4RAUB 3KPMA 4LIQE 4U1NB 5T33L 1Z0NA 4PTTA 3LKPB 4M00A 1TFHA 1XFPA 1AGCA 5CFHA 1OB1A 4WFHE 5D7LA 3L9RA 2ZCLH 2ATKB 4N8VB 1I7RA 4QRPA 3CDCA 5F71A 4OQTA 4HGKC 3ECBB 3VU2A 3ZL4L 4Z8FL 4ZUTB 4QRQB 4UV4H 3U9PL 1JVKA 3VWKC 5E6ZA 2JF1A 2XKNA 4P9HL 4EI6B 2WIIA 3NPSC 4GRWF 1NDGB 5F89A 3TT3H 5IW1B 1IEAB 4GBXA 3VFSB 1N2RB 3BESR 4JGMA 2ILLA 5I1EL 2NY3C 3B2VH 3GSWB 1G9MH 1E6OL 4P59L 1ZT4A 3U0WL 4LCWE 1GSMA 3LQMA 5EU4A 5FKPA 2LVCA 4PJGB 3ZTNH 4N0YL 3ULUF 5GZOD 3LQAC 4OCMC 1OLZA 3WV0A 3OB0H 2VLLB 4X7CC 3N1MC 3SDXF 4CMMB 1T1ZA 3AXLA 1HHGB 3MBXH 4UNTA 2V9RA 4MQ7B 5GRZA 2APVA 2VZSA 1A0QL 2X44D 5DC9B 5GGRB 1FL5A 5I1IH 2LABA 1I9EA 4PJ7B 2Q1EA 3UAJD 4LLUB 1R3LB 1JNLH 2AEPL 1J0IA 5KVFL 2AXFB 5EUKA 5JORB 5DUBB 4JFPA 4PB0L 4PP1D 3CJJA 2C7UA 3LH2L 2IPTH 3GSVA 4P46C 1F4WH 3V6ZA 3MO1A 3QJHA 3MXVH 1KEGL 2E3VA 3MJ9H 1RPQA 5F6IC 5ALCL 3C87A 4OSUH 1ETZA 1WFOA 4KFZC 1VEOA 4HK3J 1JWUB 5D7JD 4S2SB 3HLAA 3VFTA 5KN5A 4OM1H 1LO0L 4MA1C 4F7PB 2B5IB 3Q5TA 2BVTA 4ZYKB 2JB5L 5HHOD 4G9DA 1P4IL 2XI9A 3IVKB 3PP3K 4FFWC 1LE5B 1GGTA 3BPNB 4JFFD 3TA3A 4PJFE 3KPOA 5FAAA 4G6KL 2B4CC 2YPLB 1E4WH 5FHAL 4AJ0A 1NMBH 2J8HA 4FP8L 4Z7VF 4HJJL 2LU3A 3HN3A 3U0TB 2LVEA 3F7YA 3LEXA 3EFFA 4FFVC 1IKFL 5FGBA 3H9SE 5I8OL 3HA0A 3VWKA 3DOSA 4NQED 3WL9B 3VFVA 1RURL 2IAMC 2QSCH 1BM3L 1V7MH 1G7HB 2EDRA 3PV6B 4TVPH 3FFCA 3MRFA 5ICZB 4RFOH 1QA9B 1CXIA 5IMOB 4RZCB 1CU4H 3VXRE 5E9DA 1EBPA 4P99A 12E8L 1OGTB 3FT2B 5IMKA 3MV7D 3HZVA 3IDMA 4PJBB 4ONHB 3D87B 2C5DC 4NO3B 1A47A 3ZLQC 1BF2A 3AUVA 4YDVA 2AJZA 2C3VB 4OI9A 4R3SA 2IWGA 1A02N 1OSPL 3UPRA 4RDQG 1QD0A 1MJJB 3TCLA 3MRPA 2FZ3B 3G5ZB 1LO4H 3FQUB 4F57L 2IH1B 5TF1H 4N8VG 5JLZB 4BZ1L 1INEH 1WIPA 3QYCA 4PRPA 2B1HL 5DTFA 3GSRA 4ODTH 4JM4H 1XMWA 2NLJB 4J8RA 4JY5L 4P46A 5FECB 1DLHB 1W8OA 3A6CH 1F5WA 3G04A 4FZ8L 3BZFA 5T1KB 1W72L 4GUPA 5FDWB 4G6FD 3MLPA 3OKMB 3MLRH 5DHYA 2ED8A 4UQ2A 1MF2H 2GTZB 5FXCH 3DMMD 2FX9L 2DJ4A 5D93C 1RUAL 1WAAA 4N0FA 3EOTL 4PJGE 4B41A 1A6VL 1NANI 3T8XB 2Y6SD 4LCYA 4RFNB 2R0KL 4CU6A 3C6SA 2P44B 1WCBB 3QCUL 1RULL 4QHMA 1H3PH 4HV8A 2Z31D 1YPZF 1C8PA 1SEBA 5JW4Q 2VLKA 1CBVH 3RY6A 3AB0B 4PJ7E 2AJXL 2HG5B 3VW3H 2ZG1A 3P4NA 4PLOB 1I1AB 4GS7B 4LP5A 1RZKC 1QRKA 4F7EB 4OLEA 1OPGL 2APBA 3BKCH 2ZCKH 4E5XB 5D7LD 5EC1A 3RIAF 1UA6L 5H35B 4M4PA 4QRPD 5HJ3B 2E7HA 4Q7DA 4QXWA 4Z7UB 1WISA 2NY6C 1CXHA 3DHJA 2IAMA 2KPNA 5KANI 4OLZH 5EO0B 4ZNEE 3P0VH 2JTDA 4OCSL 1FQ9C 1BJMA 5L2KB 3MCLL 3CUPB 4GBXD 4KRNA 3PDGA 4PV8B 4ZO9A 3OAZK 5JW4R 4H20L 2Z4QA 2G75B 2KZ1B 4KHXH 1MHHB 1NDMA 2BRRL 1RIUH 4LDLB 1BQUA 5JNYA 3C8KB 1PYWB 4ZPTA 5IB4A 1IEBB 5JHDB 35C8H 3IFOB 1HH9A 1ZHBB 1UJ3B 1EFXA 5KS9B 4L4VB 3BWAA 3VGAC 2VR9A 1Z6JT 2YPLE 3A6BL 1TQCC 3PHOB 5IV2B 3LEYL 3STZA 3V6FA 2X41A 4C4KO 1OCWL 4O00A 2NMSA 5DD1H 4WEBL 4XH2A 4ZFZA 3E1F1 1AXTH 1JIBA 5HI4D 2WWKO 3G5XB 4CVUA 3LPWA 3RUGB 3GMRB 3U2SA 2OJZL 3N1GC 1QYGH 2BNRA 5FYLE 1FGVH 2APTA 2M2DA 3KPLA 1C16A 3QEQD 2Z93B 2GFBA 3ULVD 5TQ0L 4HBQA 2E9WA 4I9WD 4XP4H 1EERB 1NL0H 3OJVC 2GCYA 3B83A 5HYQA 3GBMH 3EYSH 4DGVL 4XMLL 1A2YB 5C0BD 2VKWA 2L4OA 4PJBE 5C9JB 2FYYA 2EE3A 2OQJA 1OTUD 2F58H 4LVNC 1XR9A 4W4OC 1NKOA 4DAGL 1FLRL 1YNLH 3WFBH 4KK6C 4NKDA 3D39D 5IB5A 2AEIT 4UDUB 5FUCE 2HFGH 4WWKB 4U1HA 3O2VH 3EJJX 2YXMA 2FD6H 5I2IA 2CIKA 2YEZB 4Q6IB 1MQKL 2AGJH 1CE6B 2VE6A 4XGZB 1AI1H 3VWKD 3ARSA 3VG0H 1C08A 1LQSR 5I16B 3TBWB 1L7IH 5IFHL 2H32H 3C5SB 2VXUL 1OD7A 3U7YL 3P4MA 4J1UB 4YDJA 2NY3D 3FFCD 5J13C 4LBEA 4YHOH 2DL9A 5GGSY 4ODVH 5E9DD 5EZJB 1U6AH 3DSFH 2AERT 1RUPL 2VN4A 1OGAB 2XACC 4P5TD 1KPRB 5I6XC 2NTFA 2VIRB 1UYWL 3DXAA 3QZWA 1JYXA 4IDJL 1GGBH 2AW2A 3MNZB 2KDGA 3D2UA 1U8PB 2PTVA 1HI6B 3C6LB 2CSPA 3MGOA 4LLYB 5ILTL 4HIJA 4QNPE 5EU7C 1IM9A 4PTUB 3P73B 1KEMH 2NXYC 4HZLA 4OLWH 5GRUH 5D8JH 2GJ6A 4NHUB 5DRNA 1YY9C 5CIPA 3IFPB 4Z7UE 1X5YA 2IQ9L 2X1PA 2R0LL 1FFOA 4P46D 1AIFB 3FB7B 3OKOA 1AQDA 1A6UH 3QDHA 4NZUH 5DJDA 4OV5B 3RWGB 3X12B 5EBMA 1AKJB 4HCRA 4KXZI 4ORGB 2IH3B 4NM8L 3L3GA 5I75B 3VJ6B 1MWAL 1VFUA 3VFRA 5L2JA 3ZE2E 3CFKB 5JHDE 2GITB 4W4OA 2A77H 2C1OA 4MQXC 4P3DA 5KS9E 4L4VE 5D7SH 4FFWD 3KGRA 4DK3A 2Q3AA 1T1XB 5IM7B 2VLKD 3FO1B 1RVFH 4A6YH 4QTIL 4YH6A 4I77L 2YKLH 3QEHA 3HI5L 3L1OL 5D71L 3OR6B 4BK4A 3HUJE 1U92B 2YUWA 5I1GH 2WUCH 3BHBA 1KYOJ 2X40A 2YZ8A 4OFDA 3RUGE 1VPOL 5C1MB 4FFVD 5CGMA 1G7MA 4NIKB 2DQGL 3JV4B 5CD5C 3L3HB 3V5HB 3LMJH 4H0HB 4XNMA 2VDRL 4LLMA 4IJ3C 2HJFB 4LLWA 4LAQL 2IAMD 3NFSH 2V6HA 4JFDB 3UO1H 1J8HA 3QNYB 5ITBH 4G8GB 2CDFA 5C0JB 1MPAL 3N1FC 3EIFA 4L3AA 5IKCA 4B0MM 3H2WA 1HKLL 4XHJC 1CIDA 4YDLC 4ETQB 4OCLC 5IK3B 3CFIC 3QWRD 3W9DB 4C55A 5EFIA 5HDQL 1KLUA 2UUDH 5EORL 3PP4H 4I13B 4RNRA 1EFXD 2VAAA 3OGCB 2QQNH 1CL7I 3DX8B 3P0YH 1WZ1H 1HNGA 3QUML 3QUZC 4HW6A 5B39G 2OSLB 4LCIH 3ROLB 3TGXA 1CD8A 1Y6MR 3BQUB 3QDMD 5FO8A 2F5AL 2OJEA 4KI5C 3TBVA 3V6OC 5IESL 5J1AA 4P4RA 4O5LH 1L6ZA 4P3CL 2W0KA 5DD5L 3CMGA 1YUHA 2NZIA 1QFWH 2Q7YA 2HP4A 2XWBB 3LPGA 4JFEB 2ADJB 4JLRB 1GGYA 1KC5H 3R8QA 4JR9H 3CSGA 1C5CH 3EYUH 1OGAE 4U1LB 1LK2A 4JFZL 5DO2C 5HYIA 4PRAA 4H0IA 3IT8D 2DKSA 1X5KA 5E2UL 1SM3H 4X6BA 1VACA 4M7KH 2H26B 3QHFH 3UTPE 2W38A 2VXVH 2BNUB 1XGYL 5JA9A 3IKCA 3SDXB 3KWWA 15C8L 1HHJA 2XWTB 3VMNA 5E8OA 4X0KA 3CCHB 2NR6C 2F19H 2FEEI 4PG2C 4BQCA 1OAQH 1WK0A 3DVNB 2BY3A 4H88L 2NY6D 2ADFL 3RWJB 1RUQH 4OFVA 5EZIL 2F53E 3UTOA 4AG4L 5J1SC 4AMKL 4Y1AA 1WUNT 4QHUA 3KPNA 1CQKA 1MWAB 3UTZA 4PJDB 1YMMB 4PLKC 3VD9A 2ZUQC 1NFIA 1AGDA 1TNNA 3T3MF 1KCSL 1H9VA 2P1YA 1QQDB 3VXPA 3K4AA 4Y19A 1XF5B 1KCUL 3CX5J 1CGWA 4L5FH 5FF6A 3DXAD 1YYLL 2FO4B 3HI1B 5GGSB 1J05B 5D1XC 2E9BA 1UWXH 1MLCA 1WITA 4NHCL 1UB5B 1WV7T 1S7SA 2NY1B 3AAZB 3ILQC 5DMIL 3GHBH 2GJ6D 4MJ2A 3ZT7A 3BISA 1NQBA 3B8SA 1DUZB 4JFDE 1EGJL 4ZDHB 4JZNB 4G8GE 3OX8B 2DLIA 1Q1JL 1S7WA 1ZLSL 5I71B 3AC0A 3U7WL 4J3OC 3C5ZA 3UP1A 1X5AA 2DQHL 1ZANL 1QSFB 4Q9QL 4I0CC 5BQ7B 1ZAGA 1N5YL 3TIDB 5C0DB 1EJOL 3LKNA 1JYWA 2QLVB 4UAOB 4LCWA 4NWTL 3V52H 1KLGA 4FQ2H 3NAAH 5EA0H 4RGOL 5E2JA 1SJEB 1FN4B 1S7RB 4KK6D 2CGRL 1ZLVK 4HHAB 3DRTB 1REIA 5D1QC 2FNBA 1ERNA 4FQIH 2KKQA 5TQ2L 4HS3B 2IANE 3MFFB 2I26N 2YPVH 4YPGA 1KTLA 3KYNB 1R5VA 4NJAL 4CAGA 1P6FA 2Z92A 2Y36L 4KQ3H 4PG2A 2Y5TB 5JXAL 2R0WH 3SKJH 3F65A 5GPRA 4OKVB 4H8WC 5DZNA 4M3KB 4EQ3A 1RUKH 4NSKA 4DCQA 5HDLA 1TZHA 1A7QH 3OB8A 2FWOB 2IJ0C 4JFEE 5MEQB 4GRWE 3K2UH 3NGBC 5J4MA 2OL3L 5FO9A 4KUCD 1ZGLM 5IW6B 4ZODA 1ZWIB 1JI1A 1WSST 2UY7A 1B0WA 1U8OB 3LQZA 2CJUH 4PJFA 4KPHL 5GRWA 8FABB 3VGBA 5DQDH 5TDNB 3HMWL 3SDXE 2QHRL 5TE4L 3ZKNC 5D1XA 3FMGL 3WNMA 1J0YA 2NXYD 3V9FA 4JO2L 3KHQA 2Y72A 4CVXB 1YY9D 5A2KH 5CBEB 1G7LB 3TYFA 3NIFF 1QKZH 1C7SA 2PN5A 2OI9B 3BO8B 4KWUA 3IJHB 4PY7B 2VLJB 3D25A 2IBGA 4TSCL 2NX5E 3PWLA 1TVBB 5MHSD 5TE7L 1RZFH 4OF7A 1YMME 2I07A 3LN4A 5T1LB 3SO3B 3GJEB 2D7MA 5IQ9B 2V17H 3C08H 3MA9L 1GAFL 1CL7L 2BSRB 1T89C 5FIEA 2B5IC 5KSBF 3HG1D 2FH6A 3FRUA 4HGWB 1Q0YL 3L5JA 4MQXD 1EO7A 4LCUB 2VZ1A 5HGAB 5C2BH 4JY6B 1IGML 3G6JF 3V95A 3NTCH 5A2LH 4RAUA 4JO3H 4U1NA 5B3JF 3LKPA 4C58B 3HMXH 4NP4L 4I1NB 4X6DF 1ZXQA 4AEHH 4GAYA 4MLSA 2ZZUT 4XAKE 1T5WB 2GK0B 3HE6C 3ARGB 2ATKA 1JHKL 4N8VA 3UC0H 3ECBA 1LO3H 3HZYA 4QRQA 5CD5D 1CQYA 2ITDB 4NC1E 4MA3B 4HIEB 3G9VA 4EI6A 2BCKB 2EDFA 4M9PA 5HTSA 4MD0B 4YXKL 2XOTA 1NDGA 4M5ZL 1IEAA 3VFSA 1NMCB 1N2RA 4N5EC 2QQKL 1QSFE 3PWPB 4S1QL 1U8KA 4Y1AD 3GMMB 3L5XH 3GSWA 1B90A 2VL5A 5A2IH 4MDIB 1MCBA 4XHJD 2AEQH 3CSYB 5DA4A 3WUWB 4PJGA 2XQYK 4HT1L 2CKBB 4ZTOL 1SYVB 4HMEA 4PRIE 2VLLA 1CDJA 4GKOA 4LGRB 4Y19D 4CMMA 2E6JA 1HHGA 2VO5A 4OZIB 3SBWA 4MQ7A 5FYKH 3O4LD 2BDNH 4YHKL 4P9MH 1LEKB 5I18H 5GGRA 4PJ7A 5KANG 2VISB 4PJAF 1FZMB 5C71A 4FQXB 4LLUA 4XVJL 3DARA 1R3LA 3WD5H 4MWFA 3QUZD 4OCWH 2AXFA 5JORA 2G60H 5DUBA 1RK1A 1RHHB 5CP3H 4XWGL 4GG8B 4KI5D 4P9HC 3MNVB 4V2CB 3L7EB 5HGBB 3MV11 4M7LT 4LDOB 1FDLL 3TPUB 4ZNEA 1M1SA 4C57C 1INDL 3GSNB 4HKJB 3HC3L 1JWUA 5E5UB 3V5KB 3WXVH 4S2SA 1XH3A 4F7PA 1FC2D 5D2NB 4GQPH 4ZYKA 5DO2D 2EDKA 1VGKB 2WBKA 3IVKA 1YY8B 5FYKU 5F7UA 3WDJA 2Q87A 1BIHA 4UTBH 4ZOAA 3WSQH 3BRFA 3ROOB 2AXGB 2YPLA 5HHPB 3AB0C 2FIRT 3QPXH 3BP6B 4J12A 1UVQB 1TQBB 4GS7C 4P2YA 2XG5A 1NBQA 4GJTB 4GLRH 3MC0A 1FO0L 4YHZL 3I85A 4KTDH 4PRNB 3U0TA 4FA8A 2NR6D 4PV9B 3RVWC 3G08B 1X5XA 3WE6B 4KROB 5SWZB 4PJ8B 4EXKA 4XHQA 3T0XA 4ELKB 1MRFH 2I60H 3WL9A 5DC4B 1X7QA 2AJUH 4XNQB 4YPJA 2AJVH 4HKZB 1ZTXH 2VZUA 3DPBA 4NUGH 1CIUA 4HXAH 3HAEB 1CICB 1G7HA 2A73B 3PV6A 1BFSA 5ICZA 5IMOA 4RZCA 2EECA 1NGZA 2EO9A 1YNTB 2X2YA 4MA8L 3JZ7A 4PLKD 4D94A 4XPGH 1OGTA 5HGGS 1PW3A 5BVJB 3FT2A 4HUWB 1S7TA 3P2TA 2APXA 2L7UA 4PJBA 1Y18B 4ONHA 5JW5A 5DJ0B 4NO3A 4QXUL 1GOHA 1DLFL 2C3VA 1WQVT 5M94B 3OKKB 5EIVA 3F12B 2COQA 5ADPH 1I7UA 1A6WH 1CFVH 1T80A 3PWVB 4JRXB 1T22B 5ICXB 2FZ3A 3G5ZA 3WS3B 2LTQB 2H3NB 5D1XD 3FQUA 5JOFB 4GQ9L 4XRCB 1DR9A 3AM8A 4ORZC 5JLZA 5F9WC 1E6JL 4BH8B 4JO1H 1KOAA 3ILQD 4X5XB 5F6HI 2XTLA 5FECA 1YEGL 1J8KA 2X1XR 4XCEA 5T1KA 1GGUA 4HJGB 5FDWA 2CRYA 3OKMA 5C08B 4NQTA 3CFDB 1HEZB 3PWPE 2CLRB 2VDNL 1BHGA 5H37G 2OR9L 4P4KB 4RMQA 3T8XA 4JPVH 5IEHB 1AFVH 3WNKA 1KFAL 1RZ7H 3ELAT 4XPBH 4GRLC 5ADOH 4FQHB 1A1MA 1WCBA 3BFOA 5HVWA 1G6RL 4LLDB 2EDEA 3PG2A 3M45A 4V2BA 1MCLA 3SE3A 5LXGL 5BXFA 1FE8H 2HG5A 3PDDA 4Y2DB 3QXUA 5D1QD 1I1AA 4JG1H 4WWKC 3IDYB 4OD1L 1MIEL 4F7EA 5TFSH 1UENA 1WWAX 5E6IB 4E5XA 1HH6B 4Q6IC 3D9AH 1EK3A 5IQ7L 5HJ3A 2DJSA 4G6ML 3X17A 4Y4FB 4Z7UA 1KXQE 1FHGA 4QHKJ 4JZOB 1HYSC 4OZFG 4HS8H 4OGYH 2YR3A 3JWNC 2IPKB 5L2KA 3B9DA 1NKRA 3CUPA 3RZCB 3S88H 1R5IB 4PV8A 4DN3H 3CK0H 5CJ5A 1TCRB 2G75A 1MHHA 3QG7L 4X6FB 1QR1A 3BJLA 1DE4B 4LKCB 4LU5H 2YD4A 1PYWA 3D3VB 5CINL 1IGFL 5H2BB 4D9LH 1IEBA 3DX9B 5JHDA 1GJIA 4K3JL 1VGEH 4CJ0A 1ZHBA 2IFFH 3SGDH 5KS9A 4L4VA 4MXQC 1IKNC 2Z8WC 1R3IH 4PBVC 3PHOA 1KCVH 3ZKND 1FO0B 1F3JB 2D9QB 4MVBC 2X1QA 1PSKH 1D7FA 3G5XA 5H94B 5SWZE 2RGSA 5DEZA 4KKCD 2OCFD 3RUGA 3GMRA 2X10A 4FZEH 5DD3H 4HK0A 2WNGA 2Z93A 5FDYA 5HHVH 3LKOB 5E95B 2J4WH 5AD0B 3BIKA 1C5DB 4NN7B 1OTTC 3RI5F 4XC1L 4PRBB 3QCTL 3RU8L 3CXHJ 4R9HA 5C9JA 4GRLA 1D9KB 3FRPG 3ZTJG 4L1DA 3KLHC 1KN2H 1EAPB 4FFZH 1YEEL 4OCXL 4PYHA 2DQDH 3H9ZA 3LZFL 4UDUA 2KQNA 4KH2A 5I8CB 4Q9RL 4NN6B 4JRXE 4PYGA 4PLJC 3TWCH 4WWKA 5D1ZB 2VSDA 4GKNB 4MCZB 4YBLC 4K3HA 4R2GB 1IBGL 4Q6IA 3HE6D 1SBSH 1NLDH 1CE6A 1XZ0B 1XGUB 4XGZA 1BFOB 3BP7B 3VFMA 3GMLA 1G7IB 3M8OL 5C08E 3MUY1 1A7OL 1PAMA 5I16A 1EXUA 3WHE1 4NZDA 1DP0A 4LHUB 3FQTB 1R3KB 1NMAL 2K9UA 3KPSD 4J1UA 4X7SH 4N5ED 3STBA 1WWCA 5DEFB 3GM0A 5CAYB 3GJFH 3OKYA 5DHXB 5EZJA 1A5FL 5I19H 2E7LC 2J5LB 1OGAA 1WF5A 2R29H 4JCLA 4FS0A 4NFCA 2VIRA 5DFVD 2VL4A 1DBKL 1IKNA 2PF6A 5E8PB 4PGDB 3MNZA 3OG4B 1JWMB 2JK5A 4LLYA 1Q0XL 4U31A 5EUOA 5E8NB 3BIBX 3TP4A 4PTUA 3P73A 5HHQB 5DR5L 1R3JB 3IFPA 1F3RB 3ZHDA 3BE1H 3EZ8A 5F7EL 2AABL 2D03L 2AK4E 1AIFA 3D69B 3FB7A 5KVGH 1IFHL 3QH3A 1ZLWK 5T1KD 1A1NA 2H41A 4KI1A 4OV5A 3RWGA 1NUNB 3NVQA 3VWJB 2R15A 4U0RB 1AKJA 2WMPA 2V7NA 5EU3B 4ORGA 2IH3A 3VJ6A 3Q2CA 3D3VE 3CFKA 5JXEC 1T6WA 2GITA 3U9UB 4OT1L 4YHLH 3VD4A 5KZCD 4Q0XH 3V4PH 1UXSB 3T0WA 1CT8B 1NCAL 4HK3N 1QP1A 1MLBB 4O2CB 4X6CF 4Y8AA 3QQ9C 3DETC 1IC7L 1T1XA 2LU7A 5IM7A 1OAKL 3FO1A 4W4NA 1TZIB 4FQCH 2OP4H 4HS6B 4L3CA 3OF6A 1EDQA 3OR6A 4LPCA 1IGJB 1J5OH 4JREB 2EIDA 3ARXA 2X1OA 3RVWD 3IDXL 2FB4H 5GQBA 3JV4A 5AYUH 1EUTA 3L3HA 2R4SH 3P40A 2LAGB 3L3KB 2JJSC 5CEZE 2HJFA 4XVSH 3NA9H 5DMYA 4JFDA 4G8FB 5DJZB 3QNYA 4G8GA 4CN4A 5C0JA 1FBIH 1CDIA 5SWQB 5L2KD 4L4TA 3IFNH 4WI3A 5CGYC 4ETQA 1YN7B 2E7LA 5FKAB 2FL5B 3W9DA 2E27H 4R7DB 3TCXA 3T3ME 4XP5L 1YA5A 5J57B 5FHBH 5JHDD 5GGTL 4JG0H 4NNYA 3MRLB 1EVTC 5KSBB 1OVZA 4L4VD 1FFNB 1KTRL 3OGCA 4WHCA 4QLRA 4RRPG 3V4UL 3DX8A 4K8RH 1QBLL 1BEYL 3JV5A 4Z0BL 4OF3A 3LS5L 3ROLA 3P30H 2OSLA 4U7MA 3RAJL 1IAMA 3ARQA 3HI6L 4NUJB 2J12B 4W68A 3KHOA 4XP1L 5F8QC 1MJ7L 1OF2B 4XXCC 3OR7B 1WC7B 4I3SL 4YFEA 3DLQR 1ZA6B 4ODWB 5ACMA 1BD2A 4LHUG 5I71C 5JW3L 4JFEA 5D7KE 2ADJA 1G9NH 4JLRA 2Z8VC 3QDJE 5I1CL 1N26A 4YGAB 2BHZA 1LP9B 5JXEA 1NCWH 4LEXL 1AH1A 3DIFB 4X98B 4UAOC 1FVDB 4GRLD 3ZDYF 1K2DB 1JUFB 3KG5A 1EPFA 4P49A 1Q9OB 5L88L 3B3IA 5JIIA 3ZHKA 4RFEB 2H26A 5I15L 1TTGA 4M5YH 2VDPH 1EEYA 2BNUA 3SDXA 3HTLX 4KHTH 4WW2F 1ZHKB 5KBNC 1U3JA 2XWTA 3CCHA 4EIZC 4OLYH 1YN6B 2MOVA 5I1JH 5KSUB 4K7PX 1Q8MA 4KJPC 4PJIB 4ZS7L 3DVNA 4MXWH 1FL3B 1CGSL 2JJSA 3VD3A 4U3XA 3RWJA 4N1CA 1HYSD 3MUGB 2IEPA 1ZLUH 3ULVH 2VDMH 4KMQA 4UILL 1U3HB 5DUML 1PZ5B 4BYHA 1MWAA 1H3UA 4PJDA 1YMMA 2ZJSL 3FO2A 3ARBB 4P57B 1F4YL 4NGHH 1IAII 4RQQB 1QQDA 1JN6B 3OXSB 5IP4A 4GSDH 1DQJB 1XF5A 3QUYB 4N9GB 5FV2A 1HIML 2Q76B 3HI1A 2YUVA 2VAJA 5GGSA 1BLNB 1NAKL 1J05A 4UV7H 3WKNA 2LV4A 3UTPD 2NYYC 3DROB 2FJFA 3GSUB 5ECJE 5I30L 4MVBD 3VH8B 1UB5A 1XIWB 2W9EH 3AAZA 2C4XA 3HFMH 1JPGB 4HWNA 1KIQB 4LSTH 1KJMB 1OWRM 4M1CC 2VITB 3GMOB 4NBYB 1CFNB 2BVQA 1DUZA 1GGIL 4ZDHA 1DUYB 4XXCA 1IM3A 4JZNA 1UQSB 1MHPH 3OX8A 3DVIA 3NIFE 4G7YL 4GAJL 3UYRH 4JHAH 3QCVL 2BVYA 5EIIB 4ZOBA 1NCCH 4LSSL 2BFVH 1OTTD 2RCSL 1QSFA 1BWMA 1AKJD 5BQ7A 3QEUA 4HPOL 5C0DA 3TIDA 4I2XB 5F7LB 1DQMH 4PJ5D 3MOQA 4YFLF 2R1WB 4BFBD 5EU6A 3C2AH 3U46B 3KLHD 1GPOL 1QR4A 5KSBE 1DANU 1TDQA 4R90H 1QLRB 1SJEA 3LQAH 1FN4A 1CWVA 1S7RA 4M1GL 1FPTL 2W60A 3TNNB 3U0PB 4HHAA 3VCLB 1XT5A 3DRTA 3G6JE 2R56H 3QUMA 1KYOK 3QR2A 4NWUH 4PLJD 4EUPB 4FABH 2HFTA 5B3JE 3WXWL 2E6QA 3MFFA 3OF6D 2R2EB 1W8NA 3DI3B 3TO2B 3ARGC 4DZ8B 1NH6A 5JHLH 2Y5TA 2JELH 5C0EB 4JFQB 4HUMB 4OKVA 4ZUVB 1MFDH 5F9AC 1Y6NR 3T77B 1S9VB 5DFWH 4XPHH 1T7ZA 4HD9A 3QAZB 4S1RL 2FWOA 2BVPB 1NMCC 2D31B 2HLFC 3BT2H 5MEQA 1LP9E 4PRHE 4U1JB 2UWEF 4L4TD 4KY1H 2DQJL 1ZWIA 3F7VA 3PP3H 4GRWH 4TOYL 3VGFA 1X5HA 3MZGB 1U8OA 1QNZH 2P48B 5C07B 1U8MB 2PW1B 1SJXA 4ODHH 3MV01 3CD4A 3O6FB 5TDNA 3SKNA 2D3VA 4OZHB 4U1IB 1H8OA 5DMGC 3ULUH 3O3BB 5F7HA 1X4XA 1CTOA 2GT9B 4KKNA 5HHNB 4NOBA 5DT1H 4N8CL 3EDFA 3RGHA 4PJAE 4U2YA 3MJ7B 3WHXA 3CGTA 4CVXA 4WUKL 2FH8A 4PBWD 1XGQB 5CBEA 1G7LA 4TULH 2WLZA 5DLML 1S7QB 4PY7A 3ARYA 3BO8A 3QBTB 3MNWB 2VLJA 1MFEL 4BQBA 3VFGL 5IF0B 1QLEH 1TVBA 4F58L 1TNMA 1BD2D 3VMPA 3PNWA 1EO8L 5T1LA 3GJEA 3NCMA 4JFED 3IU3B 3NCFB 5IQ9A 4P2CG 2Z8SA 2BSRA 5D2NC 3QXTA 5JXED 1X44A 4PJ9B 1I9RH 4HGWA 3T2QA 4XVUC 1U58A 4LCUA 5MP6L 2B1AL 4EDWL 4JY6A 2PR4L 2QQLH 5JQHC 2X4UB 3QQ9D 3DETD 4QT5B 1BAFH 5EO9B 1SJHB 1AE6L 2R8SL 2ZPKH 5C3TA 4NNXB 5B22A 4CRPA 3UZVB 1TQBC 3Q1SH 5IHUL 2GK0A 3CXDL 1BPVA 2OX5A 3ARGA 5EOCL 1PDKA 1YMHB 4LNRA 5D5MB 5CEYB 3P9LB 4L9LB 1RMFL 1N7ML 5A2JH 4KROC 2ITDA 4U3HA 5K59F 4PJ8C 3FHQA 4HIEA 1EGJA 1YECH 2FGWH 3EOBB 1B2WL 2BCKA 4FQJL 3KYKH 2GAZA 4K07A 3NCJH 1RIHL 3MODL 1CICC 3PWPA 2AJ3B 2BY2A 3I3DA 4LSVH 5IB3A 4WUUB 4I2XE 4J3UA 1L0QA 4MDIA 1VSCA 3CSYA 2GY5A 5CGYD 3QRGH 1YMMD 5DRZB 3WUWA 3MLZH 4MZ2A 2VZOA 1I3GH 1SYVA 2EC8A 4F7CB 5BO1H 5E7BA 2CD0A 1PJ9A 3T3PF 4XI5C 3OKNA 4OZIA 2W65B 5IT2L 1SY6H 1LEKA 1CCZA 1IC1A 3JV6B 4XNZB 4IS6B 2VISA 5AZ2H 4FQXA 1J12A 5EBWA 4M6NL 1CGUA 4PJHF 4XAKD 4C83B 5DRXB 3OXRB 4WGVB 4P2RB 4AIXA 2V5TA 1RIVL 2XY1A 2MKLC 3MNVA 2XTJB 3L7EA 5HGBA 4MB3A 1N3NB 2DQTH 2CR6A 1VADA 3TPUA 1J0HA 4KZDH 1MNUL 2YA1A 1ZHLB 4LLVB 1G0DA 1QACA 3OAZH 2CK0H 1F90H 3GSNA 4G6JH 3V5KA 1CDYA 4P4KC 1QSFD 4RGND 5D2NA 1UCBH 4YBQC 5DURD 1VGKA 4WHYG 2YK1H 5H8DA 5EU6D 1YY8A 5C07E 3QEGL 5FM8A 3TVMB 4YDKH 5ISZB 5JIKA 1MJ8H 4P48A 2AXGA 5HHPA 2B0SL 3BP6A 2DTMH 4Y2DC 3WIIL 1UVQA 1AXIB 2GJJA 1DBBH 1JNHB 3IDYC 4PRNA 2O5ZL 5E6IC 3UJJL 3VD5A 3N50A 4OFYA 4PV9A 3G08A 4HUVA 2HH0H 4KGJA 3WE6A 2C26A 4PJ8A 1CF8L 5SWZA 2DB8A 4Y4FC 1MCOL 4L8CB 4XNQA 4FMKA 1KELL 2DOCA 1G6VK 3HAEA 1CICA 1JHTB 3LKRB 2H2PC 3CFBB 5I0ZA 3LSOA 4BELD 5JZ7C 5T3XE 3HE7D 1YNTA 4JANB 4PREB 1JK8B 5BVJA 2P5EB 2ZCLL 3F8UB 2M1KA 3GI9H 1Y18A 1PY9A 5DJ0A 4UI2A 4IRZH 4NZTL 4X9IA 1MCRA 4EI5C 4ONOA 5FYJL 2C4FT 2F8OA 2CXGA 3WIHA 3OKKA 5M7QA 3HRPA 4HFUH 1JTTA 4HEPG 3KR3L 3PWVA 4JRXA 1T22A 4X6CB 3TT3L 5T5NF 4NO0B 5JOFA 2H3NA 4XAWH 2NYYD 4JAMB 4P2QA 3R4DA 3N06B 1D5MB 1G9ML 4Z0XB 1CLCA 4BH8A 4U1MB 2L7JA 3VXUB 1A7BA 4D0BB 3MRGB 5LGHL 4M1CD 5KW9H 5E56A 2Z91B 2BRQA 4HJGA 5C08A 1JPST 2VLJD 4YQXL 5C6WH 1HEZA 1CXLA 2DQEH 3ISWA 3MBXL 2CLRA 4WUUE 3A0OA 3PABB 1ES0B 2Y25A 1J88A 3O2WH 4NN7C 4P4KA 1KJ3H 5I1IL 5I66B 3S9DB 5T1LD 4Y16B 5IEHA 2QR0B 1XAUA 2D7PA 4F7TB 1A9EB 2XNAB 4FQHA 1D9KC 1MQ8A 1MIML 1UJTA 1S7UB 3TT1H 4LLDA 3BN3B 4Q2ZB 4K3DH 2IPTL 4Z78B 3E6FB 1F4WL 5FUOL 3HZKB 4BSWB 4NCC2 2F8XC 4Y2DA 4YO0B 4NN6C 3MJ9L 3TZVD 3W0WE 5D1ZC 5ETUB 5LGKA 1F58H 2WWMC 4G6AC 2FJHB 2MQ3A 1GIGL 5E6IA 1HH6A 4P2RE 4OM1L 4RAVB 4FQPA 4YEEA 3L3JB 3EJZC 4GW1B 4YHPA 2OZ4L 1J9CT 5L9DH 2XTJE 4Y4FA 2WSKA 2VLMD 1F8TL 3MFGB 5FM5O 2Z9TA 5LAXB 3LN9A 5DDHB 4JZOA 3KYMB 1QLFB 2D7TH 2IPKA 2YD8A 3INUL 3RZCA 5ELIA 2HLFD 4OZFH 5E08H 5GXBB 3EO9L 1TCRA 3UTTB 1M6OB 5F21B 3UPCA 3DNKA 1DE4A 4LKCA 4N0CC 5F9JA 1MAJA 3D3VA 5H2BA 2J5LC 3DX9A 5ISZE 2F5BH 4EI5A 5HHXH 3ZT6A 1IT9L 4UT6H 2ZSVA 5J89A 4YX2H 3RDTC 5L7XH 2QSCL 1FO0A 1F3JA 4NT6B 2YUZA 2EIZB 5F1SA 1MEXH 5H94A 1DVFC 4ZS6C 3FO9B 1XR8B 3RIFF 3SGKC 2X7LB 3S5LG 3GHEH 3BUTA 4WW1B 5IBUB 1C5DA 3JV0A 5GHWH 4U1GB 1X5IA 1FCCA 4X5LA 3HC4H 1OP5K 3OPZH 4U0RC 3VWJC 2BOCB 4K2UH 2P5EE 4PRBA 5DVKA 1LO4L 2Z0BA 1HCFX 2W0FA 3DVFA 1D9KA 1I1CA 3OJMB 4LFHG 5IJVB 1PEZA 5ITFB 1EAPA 3CVHH 1INEL 4JPKH 4P5KB 4HQQH 5I1DB 4CKVX 4ODTL 1XEDA 3A6CL 3RHWF 3CFEA 2MWCA 4Q97A 3TIEB 4X6CE 1BFVH 5D1ZA 3RL1B 2EE9A 2N4IA 3CZFB 5IBTL 5MENA 1MF2L 4GKNA 4MCZA 1GHFH 4GXVH 5GS0C 1V3KA 4NQDB 3P11H 1I8IB 3VXUE 4JREC 1VEPA 1LEGB 5BOPA 1E4JA 1XZ0A 4DUVA 1BFOA 4G5ZL 4OFYD 3BP7A 3FO0H 4N0UB 5DJ8A 4KROD 1G7IA 2VDLH 1KJVA 4PJ8D 5SWZD 4ZD3L 4TUJA 2UVFA 5J12B 2NY5L 5TPWH 5F7WC 4Y4KB 1H3PL 1M7DB 2EYRA 4LHUA 3FQTA 1CBVL 1CICD 4X5WB 5DEFA 3SDAB 4E0RB 1IC5H 2DM7A 1JGDB 2FGZA 1CFTB 4K71C 1MCPH 3RIFK 2NY0C 2ZCKL 1LDPL 2VDKH 4E42B 1G6RA 3NZ8B 3RBSA 3ARDB 2DQFB 2NQCA 1TJIH 1CGVA 4M43H 5E8PA 2JJVA 4PGDA 4XI5D 5ALBL 5CJQH 3P0VL 3RDTA 4UINH 1JWMA 4DK6A 3U6RB 2BVOB 1JWSB 1EIBA 2JIXB 3HRZB 4R0LC 2IADB 3MRDB 4NC2B 5E8NA 2G2RB 1ZEAH 1PKOA 4P2QD 5HHQA 4K7PY 1R3JA 1DVFA 3NIDF 1JF6A 1M05B 1Q9LB 5IMMB 4Z95H 1RIUL 3SGKA 1FC1A 1MVUB 1P4BH 1QFWI 1ZVSB 4EOWH 3OG6B 1SYSB 5J9PB 5C08D 5T5FH 3CLEL 4KKLC 3UPAA 4PPTA 4JRYD 3VWJA 1AO7E 3UTTE 3RRQA 2I5YH 1YEJH 5EU3A 4XVTL 4P4KD 2VH5H 1FIGL 1QRNA 1E0OB 2HAZA 4YBQD 4MQTB 1UXSA 4FFYH 4PJXF 5EZLB 3QDAA 3T0AA 1L7TH 1MLBA 4O2CA 3ZDYE 1WJ3A 1DN0B 1PG7H 3B9VA 1QSEB 1TZIA 4HS6A 3BKYH 1FNEA 4Y2DD 4XP4L 1DQTA 1NL0L 4D3CH 2XPGB 1E27B 5D2LB 5IFJA 3GBML 3EYSL 1JZ4A 3MLUH 4JQXC 4CBPA 3TO4B 2F58L 5GS2D 4Y4FD 1S9YA 4JN2B 1YNLL 3WFBL 5CBAA 5AWNH 5I17A 4G8FA 5DJZA 3C60B 1AC0A 2H2PD 5SWQA 3SCMD 5JZ7D 3O2DL 2ZNWA 1H8NA 4K7PL 5IFAH 1AC6A 4DEPC 3O8XB 3PQYB 3ARBC 4PGBB 1YN7A 2FD6L 4LSQH 3BZEB 3Q6GL 4HGMA 2FL5A 1OLLA 3N85H 4XC3H 4R7DA 2WW8A 3BRGC 4EI5D 3QUYC 3VFOB 3MRLA 1ZLVH 1AI1L 4X9BA 1OD9A 3RL2B 3WHE0 5KSBA 1JYNA 5D7IF 3BIAX 1GGCL 3VG0L 4LQ1A 1FFNA 4JDTH 5E8EB 4R0LA 5BZDA 4NQDE 1KSRA 43CAB 5CJBA 3BKJL 1XIWC 4JPIB 4HIHB 4NUJA 5J6GB 4ODVL 4N0UE 4PGCB 1HDMB 3RWDB 1FH5H 3B6SB 1U6AL 2B20A 5DJ2B 1HXYB 4OFIA 3OR7A 1WC7A 4LVOB 2E6PA 3A6OA 1ZA6A 3LRHA 4ODWA 1GGBL 3TJEH 1BZ7B 3SJVB 2CDGB 3BH9B 3CX2A 3V8CA 2R2BB 1W0WB 1U93B 1MRCH 1LP9A 3CAFA 1BFTA 4NM4L 3DIFA 2XA8H 1TZGL 3WLWC 1FVDA 5GRUL 1D9KD 5HI3C 2OS7A 1K2DA 4GW5B 1JUFA 4TNVK 3SGJC 1Q9OA 2GUOB 2H1PH 4PD4J 4XPAH 4RFEA 3QHTC 1IE5A 4K55A 4L3EA 1JJUA 1A6UL 3TV3H 2W91A 2DL2A 1ZHKA 5MEND 4G6AD 2WWMD 4JM2F 3MBEB 3KS0H 2DM3A 5KSUA 4JQXA 3EJZD 3S36H 4PJIA 1MREL 4WHTA 1FL3A 2VLRE 1BQLH 2A77L 4PJHB 2HT3C 4GRMB 2W92A 3MMEB 3TBTB 5A3IC 2OTWB 2CRMA 3QAZC 5HYSG 1CDGA 4ZUUB 4ZAKC 3RVVC 3THML 3BDYL 1PZ5A 5FFLA 1JV5B 1EV2E 1CLZH 1OAYH 3ARBA 5E1HB 3C5JB 5SWSD 4LGSB