4PGDB

Mhc class i in complex with modified sendai virus nucleoprotein peptide fapgnypaf
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title The first step of peptide selection in antigen presentation by MHC class I molecules.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/peptide
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pgdB00
4WFFE 5I1AA 5E2VH 4UDUA 3QDGD 5CS7A 4ORZC 4S1DC 4G6KL 4OZGE 1FL3A 1WT5A 4RMWA 4FRWA 3ZE1F 5HYJA 2EXYC 4OCRL 1JV5A 4LCWA 1FJ1B 1MWAH 1T1WB 1RZKC 4YFDB 4U6YB 1E6OL 3VFRA 5IB4B 2HVKB 4P2RD 2XPGA 1AGDA 5H2BA 4NNPL 2W0KA 4G9FA 4KUCF 4YBLC 3V4PL 3MV9E 3QO1A 4WHTB 3OB8A 1JYWA 2FCBA 2DQCH 1R24B 4XPTL 4PYGA 3RZWA 2IH3A 3ZDYF 1RUPH 3LQAH 1PEWA 1D6VH 1NGYB 3G6DH 3NTCL 3HNTL 4S2SB 2ZOLA 5DD0H 3CNKA 5HYSG 3SQOL 1INEH 2EE3A 5DD3H 4X8XA 1G7LA 3BE1L 3EOBA 2Z31C 4K94L 1KB5H 1F6AA 1OGTB 3ZDXE 5IKCB 2V2TB 3V6OE 3VFOB 1UM5L 2CIKA 3T4AB 1RU9H 3ARSA 3WS3A 1CQKA 3KHQA 3TV3L 4F7CB 4ORGB 3BSZL 1CLZH 1MFDH 2HWZH 2PF6A 1G7QA 4FTVA 4KTEH 2CQVA 1UJ3B 1N8ZB 3UTQA 1AQDB 1FFOA 4PJ8B 4HG4J 2X09A 1I3GL 2BC4B 2QBWA 1MIEL 3LKSB 4G8EA 3IDNA 3UTZA 5I6XC 2MKLC 3AM8C 2JELH 3OPZH 4WI5A 2VDML 2CDFB 4WY7H 2EDXA 2EDTA 5D93B 2MWCA 4PRPA 3P4MA 1UZ6F 2BERA 2KH2B 4GLRI 3MUGA 5D2NC 1ZGLB 2ZPKL 4MA3B 3REWA 2IAMB 2X6MA 3MLWL 4XBEH 1UKTA 4JB9L 4OM0L 5T1KA 4FP8L 3CH1B 3IFLH 3FRUA 4OLWH 3S35X 2YPLB 2HTLD 3QIBB 2N56A 3OR6A 4NHUB 4UUJB 4XNQB 1YNKH 3RY4A 4C57C 4KZDL 3JTSB 5H35A 3CSYB 3QQ9C 4GRMA 3HE7D 3N1PC 2RCSL 1UB5B 3IJSA 4PBVC 1DLHA 5B4MD 3TH4T 3PQYE 4NQCD 3QHFL 4LEXL 5GJSL 4XP5L 3NA4A 4G6KH 4YXLL 3T0XA 3V0VA 3BJ91 3G5YA 1JN6A 3LH2L 4MJIB 4OCRH 3ZE0F 3IRPX 2X4TA 3D2UD 5CJQL 3KLDA 4MNQD 5DMIL 4NNPH 4M7JL 5DQ9A 1A6AA 1A7PL 2P47B 3SE4A 3V4PH 4JRYA 1A6TA 4U1HA 3O3EB 4U0RC 4HIEB 1CT8A 4XPTH 1KTKE 4JQVC 3TPUB 1CK0L 3G5VB 4HJ0C 4HG4K 3HMXA 1IBGL 2V2XB 3NTCH 3HNTH 4XCCL 3TO4A 4R7NA 4M9PA 3QXTA 3SQOH 5I8EA 3VG0L 2GT9A 4G6FB 3BE1H 3RVUD 1ZMYA 2IFGA 2ZKHL 3S35L 1QR1B 3O41B 3QUML 3IDMB 4NO3B 4NQXA 4NRZB 2P5EA 2XA3A 4XTRC 3HC4L 3UTSD 1UM5H 3CUPB 2P8PA 3W39A 5DRZB 5DFWH 4YHIA 3MQIA 4LHUD 2X2YA 5I1JL 1GPOL 3TV3H 1KTLB 3BSZH 1DANU 4HIIA 2HYMA 3FQNA 1I1AA 3KLHC 4GW5A 1CICB 3FQUB 1I3GH 3EYQC 1FVDB 3HZMB 1N6UA 2BMKB 4RRPA 1MIEH 4DCQA 1F45A 1S9YA 3QEGH 4OCWL 1P6AB 1F4HA 4GKOA 4MD0A 1D6EB 2ED8A 5F1NA 3ZYZA 2PCPA 3H0TB 3REVB 1HHGB 1QTYT 2VDMH 1B88A 3CJJA 3SCMB 3ARXA 3D39A 4WI3A 2E9IA 2ZPKH 2Z8WC 5DS8B 3MJGX 3MLWH 3GM8A 3WS6A 2EEAA 5KW9L 5IESL 4MLSA 1F2XK 3HI5L 4JB9H 4OM0H 1L9NA 4HUUA 5CUSL 1PW3A 4FP8H 4AMKL 3L3JB 2ITDB 3THML 1OLZA 1UQSA 4PJEF 1PKQB 2BK8A 1P7QB 1ZE3C 5ISZB 2VLJB 4KZDH 4IRSD 1HKFA 4OIAA 2H9GB 3QPQD 3ZO0A 4F7PB 5FYKU 2QSCL 2RCSH 4JFFE 3RJDA 2L7UA 3QHFH 4LEXH 3B5GA 5GJSH 4XP5H 4YXLH 2WWMD 3LH2H 3QDMA 5CJQH 1WFTA 3SBWC 5DMIH 3ARDD 4WV1C 5DYOB 3KPMB 5IB3B 4M7JH 1A7PH 4PJEA 4NO2B 4DZ8A 3B43A 5I19L 3DNKA 4Y4FA 1F90L 1P1ZB 5EN2B 4WWKC 3SDCD 4Y19E 3QEUB 5F3HB 1CK0H 3EYOB 1G6RA 1L9MA 2A83A 1TQCB 1T5XA 3CGTA 4KROC 4MJ4A 3MV11 1IBGH 3L7EB 4XCCH 3ZL4L 2KDGA 4QRSB 1BD2D 2ARJA 4WW2C 3ULUF 3EFFA 4RWYL 3VG0H 4HGMA 1WTLA 5DK2B 4NJAL 4KGJA 3S35H 2ZKHH 3KXFE 3QUMH 3MBEC 5D7JB 2XQBL 3HC4H 1UXSA 3CFIC 2NTSP 4LLWB 1D5IL 4OZHE 5C9JB 2VNCA 4KGLA 4F37K 1AGBB 4V1DD 4I4WA 5I1JH 3L9RA 1GPOH 4XWOC 43C9B 5FEBA 4XZUB 5EZJA 3MV7A 3OKKB 3WFHA 4DGYL 3TT3L 4PGBA 2EDNA 4XXDA 5C9KA 4OF0A 4B53A 1H3UA 3B2UD 1I8MA 1AHWA 3UTTE 3K2UL 1ZLWK 5I30L 3QYCA 3VCLB 4Z18A 2XWJB 3MRNB 3BP7B 3OKYA 1GRWA 5EO0B 4KUZL 3D87B 4PB9L 4QHMB 2OTWA 5KG9B 4NM8L 1MAJA 1EHLL 1ONQB 4OCWH 3SKJL 1B9ZA 1QSFE 1KNOB 2XWBB 4JG1L 4H88L 1LE5A 4NPYA 1BVLA 4L8BB 2GW5A 4FA8A 5FKAB 4U1KB 5C0GB 1NLBL 1VEMA 5AYUL 3PNWB 3CFBB 4ODXA 4QOKD 1IAOB 4X7EC 4U6HA 2P48B 5KW9H 5IESH 1I3RB 4AM0A 2A6DB 2ITCA 3HI5H 3VWKB 5CUSH 2FJHA 1DQJA 3SPVB 3NFNB 4AMKH 1E4XL 1WGOA 3Q3GB 2X7LA 5DUPL 4OV5B 5T5NF 4QHKI 4B41A 3THMH 4ZXBA 3VXMD 1R5IA 4HKBA 1UVQA 4PJDE 1DEDA 2D31A 4P5MB 2NZ9D 1PG7X 3O8XC 1CG9A 5HJ3A 3VFNA 4MMZC 2JK5B 2QSCH 2B1AL 5AUMA 2W59A 3X3GL 1FV1A 1F3JA 2X44D 4BSWB 1BJ1J 1UM6L 5ADOL 4XCNA 1DQQB 4HUXB 3PWUB 3HR5B 1ZLUK 3X12A 4MQXC 3HRZB 1OARL 5I19H 2NY2C 1KPRB 1F90H 2NR6D 4NFBA 4X9BA 1P7KB 2Z35B 5IBLD 3C9NB 1BECA 3DWTA 3ZL4H 4V2BA 4D8PA 1OGAA 1A1OA 1X5AA 3KLAA 1MQKL 4YFEA 5L6YL 4ZTOL 4IJ3B 1JL8A 4NJAH 3LKRB 3GMOA 2GK0A 4NQDE 2V7NB 4JFQA 2M26A 4XAKE 2XQBH 3WN5B 4MS8D 1JFQL 4MXVF 1PG7L 1XCQB 4W6XB 2BNUA 1A4KB 1D5IH 2C1OA 2EEBA 4XPFL 5IF0B 3TYFA 2Z8VC 2V9QA 3LKQA 1MF2L 4P48A 1C5BL 4PRIB 5B38A 4CU8A 2RFXB 1DN0B 4K7PY 4DGYH 2ZUQB 3TT3H 4HFWA 1NEZB 4M93C 3KPRD 1A8JH 3K2UH 3MV01 5I30H 1LO4L 1RHFA 2BY1A 4NKMB 4QNPE 1AIFA 5JW5A 4KUZH 1R5VA 4PB9H 1BF8A 1HQ4A 5INDA 4NM8H 3OKLB 1EHLH 2LTQC 3SKJH 1NCUA 4JG1H 2WINB 4H88H 1DQML 1RUKL 5DFVC 3FN9A 1B3JA 4OFYA 2BOBA 4GS7C 3MJ6A 5H37G 1FHGA 4QRRB 1S7VA 1NLBH 2EDYA 5AYUH 1NFDB 3DTXA 2OTUA 1IZJA 2PO6D 4DN3L 4XC3H 2CMRL 4KHXL 1F00I 5GJTL 4G8GD 5M7QA 1E4XH 5DUPH 3MACL 2N4IA 1NCAL 3LN5B 3JV6B 2M8XA 4JDTL 1DUZB 3RWIB 4K94C 1P6FA 2JTDA 3C5JB 2B1AH 4YK4B 3L5WB 1WWBX 4NOBA 3X3GH 1KJVB 3JV0A 4X8JB 1EZVY 3ARBD 3QFDB 1I7UB 1I9RL 5IW1A 5GGRY 3WL9A 5E1AB 1UM6H 1X5GA 5ADOH 3AS1A 5I71C 4H1LB 3R8BB 4KKBC 2NX5E 2NY0C 4JM4L 2NY6B 1OARH 2AK4A 3VI3F 4QT5B 2DTML 4EZMA 3FCTA 3IETA 3ZKXC 1GZQB 1KB9J 1I7ZA 2PNDA 4UIMB 3QIWB 4AIZA 2ATPA 3QT2A 2VLKE 1OGTA 4FG6D 1J1OL 3PGDB 4N90D 5IKCA 5HGDA 2GJ6E 1MQKH 3HR6A 4OUOA 4YXKL 3K81A 4ZTOH 2DL2A 4KAQL 5L6YH 1TENA 4CKVX 3ARPA 1QPPA 3IFPB 3S96B 4E41E 4LLYA 2IQ9L 1JFQH 4LDLB 1OTUC 1PG7H 3MBXL 4IEFB 4XPGL 5E5MB 3BGMA 1ZA6A 3VGDA 4F9LC 4XPFH 1ZT7B 1O0VA 5JIKA 4WGVB 3RDTD 4HULB 1UJ3A 1N8ZA 1JMXA 4OBRA 1MF2H 4CN1A 2QADB 3B5TA 4N5ED 3ZHDA 1C5BH 4PJ8A 3D3VD 5DJCB 4U2ZA 1MJJB 4JAMB 1Q9OA 3L3IB 4X6EB 1QRNE 3QJHB 3V5DA 1IJ9A 2P5WE 1GHFL 3U0PB 3UYPA 3CFJA 1LO4H 2LAAA 3H2WA 3R4DA 1T22A 1SVCP 1S5IL 1U8HB 3KYMA 4NQUA 2YSSA 4WTZA 1KCSL 3AXLA 5F7FA 4ZDHB 5I73C 5EBGA 1DQMH 1IARB 4MA3A 1RUKH 3RGVB 2APXA 3P0GB 4EIZC 2BSSA 1QACA 4Y4KB 5BRZB 1G7IA 5SV3A 1V3JA 5D70L 3CH1A 5EPMB 1DANT 4KK6D 2CKBB 1FH5L 3B9VA 5EFIA 4DN3H 1IM9B 2CMRH 4KHXH 4BFGA 5GJTH 5CBAB 4JKPL 3BAEL 4UUJA 5CD5C 3MACH 1RUAL 4IRJC 1NCAH 1KB9K 4Q0XL 2P24B 5CP7B 1HXYA 1TJHH 1HE7A 3AS0A 4JDTH 1P84J 3WYRA 3NMEA 1KPUA 3AFLA 4I5BA 5E6ID 2OR8A 4A6YL 4ZNCD 2YXFA 1QFHA 1T89C 5SWZD 4MJIA 5I0ZA 2VTFA 2F74B 2XFXB 4PJFE 2D0GA 1I9RH 2F8VA 2OL3A 3D85D 4NO5A 2OK0L 2KZWA 5JIPA 3VDBA 2X9WA 1WISA 3HLAA 3CXHJ 5T1DH 2I60L 1KJ3L 5D1XA 1T83C 3TPUA 4I18C 4JM4H 3MJ9A 2DTMH 4M9OA 1II4E 2XN9E 4Q9BA 1JHLL 2AS5M 2VLRE 1Z5LB 4EEEA 2J5LB 5BOZG 2P8LB 4ZOCA 2FR4B 3WDHA 4R4NC 3QUYB 4MAYA 3IDMA 1J1OH 4NO3A 3OGOE 5B4MC 1B0RB 5EU7E 3MLXL 4YXKH 1X4YA 4KAQH 3BDBA 5GRVK 3MLZL 4H0HB 5MEQA 1FYTB 5DURB 4I0PA 4RGOL 1LO5A 4H5SA 4Y8AA 2IQ9H 3BIBX 4XPGH 3MBXH 2Z31B 4EI5C 3N50A 2AXFB 5IK3B 2VWEE 5DRNB 2AXGB 1KTRL 2YUVA 1JPTL 4O58L 4Z7UE 4I3GA 1I8KA 1GHFH 2FGZA 1D6EA 4EN3A 4AH2A 1SY6A 3GI8L 1S5IH 4C56D 1DBKL 4L3CA 3G04B 3VA2C 1KCSH 1QFWM 5LGJA 2OQJB 3VD3A 5F8RC 1FSKC 5I6XB 3TZVB 2R1WA 4G43B 4P99A 3PHQB 2FJFA 5D70H 5J57B 1N7ML 2X4SB 3W0WA 1ADQL 2D3VA 4NKOB 1U8IA 4OBSA 1FH5H 2AQ1A 5ISZA 2W38A 5BS0A 4BFBD 3BAEH 2VLJA 3HB3C 5D2NB 3NGBC 1RUAH 2DQJL 3OKMA 5MI0B 4Q0XH 4F7PA 3STBA 1QSEB 5E08L 4R96A 1A3LL 3EIFA 5CJ5A 4A6YH 3DVGB 3U79A 4FXLA 5F7WC 5IHBA 5BW7C 2I26N 1XH3B 2MHAB 3CU7A 3TYGL 4ETYA 1MY7A 1MCNA 2OK0H 5DYOA 3W9EA 5IB3A 2CIIB 1D7FA 2DWEB 2XZCL 2I60H 1KJ3H 5EOCJ 4P5TD 2OZ4A 3TBVA 5F3HA 3TLRA 4Y0GA 2DLIA 1IE5A 3I6LE 2AQ2A 3L7EA 2NXYD 3BP4A 2R9HD 1AD9B 1NANI 1JHLH 4Z7OF 2D0FA 3OAYH 3QJFB 4IHOB 4U0RB 3QPQC 2UY6A 5FGSA 3QDGE 2ARWA 3SJVD 4LRNL 4EQ3A 3MLXH 3PWVA 3FZUC 3MLZH 2WWMC 3NIGE 1MCRA 4DKEL 2IG2L 4RGOH 3KDMB 4P2RE 3RL1B 4XZUA 3OKKA 1GZPB 2JIXD 4LSPL 3TFKD 1JHTB 1KN2L 3KWWB 2P43B 2VH5L 1IT9L 3PGCB 4WI9A 3ULVF 5TGBB 2XWJA 4KTDL 4RDQG 3BP7A 4QHMA 4ZUTA 1JPTH 4O58H 1ONQA 4MDJB 3QDAA 3D25B 1RJCA 2XWBA 4IDLA 2DBLL 4U6XB 3GI8H 4YDVB 1DBKH 4AQOA 1VA9A 1HXMB 1BWWA 2GTWA 3A6BL 5C0GA 4P49A 1S5HA 2EZ0C 3PNWA 1MFEL 3Q5TA 1OHQA 2A6DA 1SEBB 5JO5B 3DX7B 4OV5A 1N7MH 1ADQH 4WU5A 2WMPA 3BT2L 1H3GA 4R3SB 3NAAL 4NRYA 3EDEA 1VFBB 2I9TA 4P5MA 4RWHA 3VFMB 3O81A 4KU1A 1CD1B 2JB5L 4F7MA 1XIWD 3QSKB 5E08H 3MA7B 2J8OA 2C3XA 3E2HC 2DIBA 4QHUB 1A3LH 1A3RL 4OLUL 5JLZB 4DOHE 4PG2A 5AG9A 5I1IL 4HV8A 3FT4A 2P4AB 1QPXA 3MNWB 1P69B 3MOBL 2APBA 4YPGA 3TYGH 4OZIB 4CMHC 3HR5A 1AO7B 4UT6L 1JWSB 4TUKL 1KPRA 2XZCH 3L95A 3EOAA 3V7AG 4P2QB 1PG7W 2Z35A 5MEOB 1UWEL 3C9NA 3I6KB 3WIHL 2HVJA 4WO4B 4WV1B 2ZSVA 2JKXA 2B39A 1FIEA 1W72L 3EUUA 4MB5A 5CSZB 2BNQD 1UC6A 2NZ9C 2R1XB 2VAJA 1QYGL 4WWKB 5DMYA 4YEEA 4LRNH 3JWOC 4KROB 3WN5A 2ZSWB 2AI0L 3IU3B 1JZ7A 3DRTB 1XCQA 3MNVB 3TIDB 4DKEH 1S7QA 3QG7L 2IG2H 2JCCF 4WW2B 5D6DA 5E00B 2PYED 1RIVL 1HH6A 3L7FB 1DN0A 1NFDF 3HZKB 3RWEB 4JFXA 5K59F 4LSPH 5A16B 1HDMB 1NEZA 1ES0A 1KN2H 3MBEB 5HYSA 5FKPB 1IT9H 5T3ZD 4X4XB 2E7LC 4M5YL 4KTDH 2QSVA 2A38A 5ANMA 4RGNC 1L6ZA 1QVOB 4JM2B 3OKLA 2Z93A 5T1MB 1ZLVH 1FG2A 4QRUB 5IBLC 5A2LH 2WINA 4HJJL 2DBLH 1ERNA 1YJDC 4TSBL 5EOTA 1AJ7L 5HHME 3QQ4B 2JCCA 3A6BH 3QUKA 5KSVA 4OF5A 2VYRE 1YNTB 1NFDA 3FQTA 4JZJA 1MFEH 4KV5E 1K6QL 3ZYIA 1HHIA 3UTSE 3BPNC 3D9AL 1ZLWH 3IDGB 3P11L 3UTOA 4MA1B 2NW2A 4ZPVB 4MS8C 1TTGA 1PSKL 3BT2H 2E27L 4JVUA 2BVUA 5DO2D 5C09B 1UH2A 5CGTA 1Q94A 3NAAH 5DMGC 4U1GC 3QNZA 4YHKL 2YOCA 2JB5H 1JHKL 2JJSC 4L1DA 5K33A 1YN6B 3L5HA 3L5WA 3L6FA 1WEJL 3K2MC 1WC7B 1A3RH 1FZOB 5DJDA 4OLUH 3DV6B 1T04B 1KIQA 5E1AA 5I1IH 3DMMD 2YMXL 3DLQR 3QWRD 1XR8A 1EGJL 1YPZF 4K7FA 3AU1A 3MOBH 5ESQA 4DKDC 3GBNL 2B2XL 3AC0A 5C0BB 4UT6H 4BFEA 4TUKH 1INDL 3D18B 5HD8D 3WKML 1G7MB 3JSSA 1TETL 4LHJB 3MRRB 3O6ML 5FYJU 1K4DB 5IVXB 5MENB 1T0NB 2J6EL 5DZOA 2V5SA 5C2UB 1T1ZB 2YPVL 5FM5O 5FB8B 2A9NL 4YHPB 1EEZB 2EO1A 4UIMA 2DMBA 2HT2C 1UWEH 1R3LA 1S7UA 3WIHH 2MPAL 4RA3A 3WCYA 3D6GA 4BQCA 3BZFB 4MQTB 3DO7A 2BNRD 4RGMC 4PJIF 2NY2B 1W72H 5T3ZL 3SOBL 3V6ZB 1R3HB 1MVUB 4JZNB 1EK3A 1YPZA 1UWGL 2VL5B 1QYGH 1NC4B 4Y4HA 5A2FA 3NCBB 1BEYL 1RJYA 1CDHA 3NCYP 1DVFC 2AI0H 4ZSOB 4PB0L 5CJXA 4WU7B 1JGEA 2OS7A 4Z7VB 2C7UA 5E5MA 5JOPE 1ZT7A 3QG7H 3T0ED 5DVLA 1RIVH 1HCFX 3MV8E 1MREL 3BYYA 3M17A 5DJCA 5CWSA 1MJJA 3MJ8A 3G9AB 4OQTA 3ARGA 4PJIA 3GMRB 3SGEH 4M5YH 5E6YA 2VLMD 3U46A 1H5BA 2AJ3B 5BQ7B 2R23A 2VN7A 3TN0D 5C0EA 4OT1L 4J4PD 2YD2A 2DDQL 1BD2E 4TSBH 1AJ7H 5ICXA 4M93B 3PDDA 5BRZA 4F8TA 5I75C 3QPXL 2G75B 3VXSB 3D9AH 1NBVL 5EZOL 2LTQB 3P11H 5E6ZA 3QNXA 1PSKH 4PJ7A 4RISL 2E27H 3LRSB 4V1DE 4WGWB 5CP7A 5C08B 4N5EC 4H8WC 1ZGLM 4YHKH 1BJ1H 4XAWL 3P0VL 1JHKH 5BZWB 2HJFA 1IEHA 2GITA 1WEJH 2VAAB 1W0VB 1EA9C 2QQLH 2FHBA 3VXRE 5DJYA 2YMXH 1EGJH 4JRXE 5DT1L 3GBNH 2B2XH 2DMKA 3NZ8A 2IANE 5IB1A 2GAZA 1A7OL 1INDH 3WKMH 2XTJE 4KI5D 1TETH 3O6MH 5IOPA 1HZHL 2J6EH 3OF6A 5DD5L 4ELKB 2ENSA 2PTTA 2YPVH 3MYJB 1Z5LA 4HIJA 3HI1B 2A9NH 5I71B 2P8LA 2FR4A 1NEUA 4LOUD 2MPAH 4RFEB 3QUYA 2NY0B 2X5PA 5KTEL 2AJZB 2DS4A 3SOBH 5T3ZH 4F3FB 2X4RB 2WAHA 4OLXL 1UEYA 1UWGH 2BSRB 3ZKXB 5E8DL 1J0KA 1EBAA 1BEYH 2PYFA 3ABZA 2Y5EA 4PB0H 4PJAA 3VRLE 2AXFA 4XMLL 2O61A 4CDHA 5DRNA 4NQSA 1MREH 4NBYB 2EDFA 3BP6B 2YHGA 3QCTL 4WUUA 4NC1E 2VZ3A 2EDHA 2WIMA 4HIHB 2H1PL 3BIKA 3EO1B 1BHGA 4YH6A 5DI8B 2MKWA 4P4RB 1AP2B 1S7SB 2CRIA 5F8QC 3V7MA 1DDHB 2XI9A 3F7PC 2M1KA 1I4FB 4OT1H 3DARA 4QHNB 2YD4A 2DDQH 4M7KL 1NH6A 2OQJA 4G9FD 4DFIA 3L3OB 4P57B 3TZVA 5EU3B 3PHQA 1CFTA 5E4IA 1CLCA 2X4SA 5BJTB 2JB6B 1NBVH 5DHVH 5EZOH 1NFKA 4NN7C 5EBWA 4UT9L 3WDIA 5I73B 3VJ6B 5DZLA 4RISH 4PFEA 2YN5A 1HK6A 4J7RA 2D4DA 4QCIB 5F9WC 1QSEA 4HLZH 3QEQA 3HE6D 5JDJA 2XY2A 5FF6B 4XAWH 4NKIL 3P0VH 4KUCD 4XC1L 1RFDL 3WFZA 1X5XA 5IVNA 3HTLX 4UDTB 4LPTA 2B20A 2MHAA 1J8HA 4IRJB 5HHOB 5GGUB 2VC2L 2CIIA 2LU7A 4JHWL 4HIXL 3TH2T 5C0AB 2DWEA 3MSPA 5B8CA 4EUPG 5DT1H 4FTVD 2E3VA 4W70A 1A7OH 1S8DB 5FGCE 1NKOA 1HZHH 4ONHB 4M3JA 5DD5H 4ELME 5HHXL 1PLGL 4G8GE 1QA9A 3QJFA 1C08B 1JMZA 2J8UE 3BPLC 3VXPB 1KSRA 4PRPD 3TNNB 1BQHG 5FO8B 3CMGA 5KTEH 3ILQD 5HDBF 5IJKC 4OLXH 4OF7A 4PJBB 4FQHA 5E8DH 2AERT 4R90L 3L3KB 3KDMA 4J3OC 5CMAB 5LGKA 4Y1AA 5TH2A 4R4BB 4P4KB 1I7TB 1N64L 3KWWA 4XMLH 3PGCA 4NQCB 3CZFB 1Z9MA 3ZT5A 3MCKB 4P5TC 3QCTH 3GSWB 5DGRA 1W0WA 4MDJA 1U8OB 3QFJE 1BX2B 2H1PH 3KHOA 4AY0A 2NXYC 2WBWB 3BJLA 4EI5B 3P4LA 1U0QA 1ORQA 1FRGL 3LCYA 3HUJE 4HW6A 5L2KB 4JVWA 4M7KH 4GG6B 1KIPB 4N90E 1OB1A 5IGXL 4DVBA 4JGUA 1QG3A 3QAZC 1TVHB 4JRYD 4FQIL 1SEBA 5JO5A 1A7RL 3LN4B 3UC0L 4OZIF 3DX7A 4PY8J 3BUTA 4S1RL 1J10A 4UT9H 5JXEA 4OSUL 4R3SA 4JFEB 4D9QD 4N0YL 1OD7A 1VFBA 3TO4D 2ADIA 3HAEB 1FSKB 1CD1A 4KRLB 3TFKC 3RWFB 5JHDB 3WUWG 3BXNB 4L4VE 3D3VE 2IPKB 3MA7A 5IB5A 2UZXB 4NKIH 5D7IE 4YX2L 5LJYH 4XC1H 2P5ED 4YDIL 4LHUB 4U1JA 1RFDH 2Q87A 5EOCL 3SKNB 4O9HL 4B7LA 4J3VA 1JWSA 2VC2H 3V5KB 1U6AL 4JHWH 4HIXH 3OAUL 5DJ6A 1ODAA 4GKZB 4M03A 2BVOB 2PN5A 5DVNA 2XACC 3R1GL 2X05A 3AB0C 1PBYA 2CLVB 2X4UA 1C1EL 4Y2DC 3GUTA 1HOCA 4WO4A 4WV1A 3SGDI 3EJYD 1J0YA 3SEPA 1PLGH 2FWOB 2ESVD 5HHXH 3GIVB 4ZG1A 1RK1B 2CDGB 4WWKA 3RPIB 4JM2F 3QDJD 3D39D 2DQUL 4CMMB 2YZ1A 3JWDC 4ZNEA 4PY7A 3RUGF 3IS1X 5LXGL 2V5RA 2N7BA 4PJ5D 5EC2B 3RWHB 1EFQA 2I9LA 2R1YB 4GKNB 4R90H 2DQIL 1NCNA 1TXKA 1WWWX 4GRWH 3RWEA 2ADGB 4YNYA 2D2OA 4APQA 1N64H 3MBEA 5FKPA 2VZ1A 2BRRL 4Z7WE 5D5MF 3V4VL 1XGQB 1Z2KA 3RA7L 3GJEA 4JM2A 4O2EA 1RZFL 2FEDD 3HMXL 2BVTA 3S5LB 2P49B 3B3IB 1GGUA 1RK0A 1Z3GL 3RUGA 3QDMD 1FRGH 3MREA 5FUZL 3CMOL 1LO3L 3QQ3B 4XBPA 4YLQT 1ZVHA 1JPFA 1K3IA 1KCUL 5IGXH 5FFLA 3U6RB 5ESVA 4Y4FD 4ZQKB 4FQIH 5SWSA 3IDGA 4E5XA 1A7RH 2VR4A 1MCFA 4WI8A 5D5MA 3UC0H 2UUDH 1HYSD 3ZTNL 5EZIL 4S1RH 1QFWL 4OSUH 5IVXF 4N0YH 3GSUB 1G7PB 5T3XE 3EDDA 1A1MA 3DX6A 1T2QL 1YN6A 4LIQL 4F80A 1YNLL 1MRCL 1WC7A 4YX2H 5HVWA 4NRXA 4YDIH 3LEVL 2BHUA 3AS2A 1P5UA 4L3EE 3UTPD 5EOCH 2F53D 4UZGA 3HKFA 4BELD 4O9HH 4C56E 5F72S 5HSFA 3T2OA 1U6AH 1T1XA 3SY0B 3D18A 3OAUH 3MRRA 3MXVL 4OCMC 1K4DA 3MV7D 2AEPL 4LLUB 3VFPB 3ZDZF 5IVXA 5ID0A 5JOEA 1T0NA 3E2HB 3CD4A 2GI7A 3BFOA 4Z7VF 1IAIM 5E0QA 3ULUD 1KN4L 3R1GH 4JFOB 1N26A 5IJVB 3DURB 4LLVA 4XBGB 1C1EH 1RIHL 3TBSA 4YHPA 2OYPA 3TF7C 3BWAB 4OZFB 5DEFA 2F54B 3PL6A 4CMHB 1HSBB 3CX2A 4I48B 2IBGA 3BZFA 1P5VA 4F15C 5CJBA 3ZZ1A 1MHCB 2MQCA 5F7EH 2X1WL 1MVUA 3TBWA 4QF1B 4YZFE 2VITB 1QLFB 2VL5A 1NC4A 4CVWA 4QOKB 4F7TB 1FO0A 3BUYA 1G7HB 2DQUH 2QQKL 3F65A 4ZSOA 3R0MA 1X9QA 5LXGH 4Z7VA 4ZO7A 5HPOA 1KTDA 3VXMB 2DQIH 2KUTA 4ALAL 4XVJL 2FB4L 2VDRL 4ZXBD 2EH8L 2FYYA 3T3PF 5CEZL 1TQBC 4PUBL 3C5ZA 1A2YB 5BVPL 2LU4A 1U93A 1M7IB 4OAWA 3VD7A 2BRRH 3V4VH 1NUDA 4ZUVB 4DWHA 1BFVL 3OJVC 1G6RL 2W65B 4PLJD 5J3HD 2YUXA 3NCYS 5BQ7A 3HMXH 1CFSB 4GAGL 3VFTA 5B39B 1KPVA 5EO9A 1VKXA 1G9ML 2A0LD 4PJXB 1WJ3A 1Z3GH 5FUZH 1LK2B 4PGZA 3CMOH 1LO3H 2NY7L 3UAJD 5KSBE 2JJWA 5EIVA 1EX0A 4FFVC 4GXVL 3LKNA 1B90A 3FB8B 5JOFB 4X6FB 1KCUH 2R4RL 3BH8B 4RGNB 2PXYC 1JK8B 5HBBA 3P73B 3OX8B 1S7XB 4Z7QE 3D0LB 4RMQA 1DP0A 3ZTNH 5EZIH 3LRSA 1QFWH 4JFDB 5DJ2B 5DC4B 1GAFL 1E4JA 5CSGA 1SYVB 2YS4A 1OGAD 3PDOA 3QIUA 5DTFB 3ULUL 4OI9A 5BZWA 1LP9E 3BPNB 1T2QH 4RNRB 3MLTA 4NSKB 5C3TA 4LIQH 3ARED 4E9LA 1MRCH 3RQ3A 3NCMA 3I2CL 1W0VA 4Y88A 3LEVH 3TN0C 3GSQA 5FGBC 3SKMA 4U1GB 2WNGA 4H0IA 5L88L 2ICCA 2G5RA 3N06B 1JWUB 5GGVL 3KPRB 3MXVH 2WUCL 2AEPH 3VFVB 1XZ0B 5CAYB 1XGPB 4R97C 1KN4H 2VISA 1RZ8A 1BREA 3MYJA 4CVZB 3BN9C 4QYOA 1RIHH 2G9HB 1I3UA 5IHUL 3CDFA 4P5KB 4GKSA 3PQYB 3OKNA 3UCRA 2ADFL 4K9EL 4HUVA 4Y7MA 2DKSA 2X4RA 5I66B 4E0RB 3OJDB 4OFYD 4DGVL 5IMOB 2QQKH 4PBWD 4OCNC 1MEXL 4ERSL 4MVBD 4N0UA 3NVQA 3MFFA 4RGMB 4ALAH 4XVJH 3GO1L 2FB4H 2NY3D 2VDRH 4CJ1A 2EH8H 4D0DB 5CEZH 5IG7B 4PRAB 1OD9A 4PUBH 5J06A 4ZFFB 5BVPH 3GBML 4JHAL 4MNGA 4MYWB 4CN6A 3VWJC 4TULL 3O11B 1WBYB 1DVFB 5KANI 1SMAA 1U3YA 1U8JA 4RBPK 3I50L 1BFVH 5E2JA 3PHOB 3LKOB 1AP2A 1G6RH 1S7SA 4RDQF 5J9PB 5EU6B 2ZZUT 4GAGH 5EBMA 1GGCL 4NBZB 1FAIL 1G9MH 4LOUC 3V8OA 3IU4L 4XCFL 3L5JA 5AZ2L 3DXAA 4P57A 1J12A 1F58L 2NY7H 4GXVH 3HG1B 2BNQE 5EU3A 1GL4B 2FNBA 1H3WM 1IEBB 3SDXF 4LLMA 2R4RH 4DAGL 3LB6D 5BJTA 2JB6A 5L0QC 1NQBA 4ZUSB 5ENWA 2A73A 1L6XA 1AE6L 3TC9A 4DZBB 1T1YA 2P1YA 2CLZA 1UG9A 4N8PA 2PYEE 4BUGA 5MEPA 3FOMB 1G0XA 1OVZA 4NQVB 5CBEA 1GAFH 4DEPC 3H7BB 2YA0A 5FF6A 4ZFZB 3ULUH 3MR9A 1PJ9A 4UTAL 4K3JL 4GO6B 5J6GB 5C86A 2B1HL 2NYYD 3ZT6A 3Q5OA 3SDXA 1JE6A 5E9DA 3I2CH 5HHOA 2OSLA 5GXBB 5GISL 1WWCA 3O4LB 5I1HL 3PABB 5CP3A 3B8SA 3KPNB 5FM8A 3FN3A 3MYZA 1QQDB 1BZ7B 5L88H 4PJBF 1KT2A 4AZ8A 1BZ9B 4MJ2A 1FYHB 5GGVH 1VADA 1S8DA 4PJ8D 3MROB 3B4NA 3K4AA 2VQ1B 2WUCH 2ARJQ 3IDYC 4LSTL 1S9KC 3P4OA 4LASL 3K8MA 3UZEA 5GGTL 5IHUH 1U95B 3VXPA 3VI4F 3CVHA 4K9EH 5FO8A 1YC8A 1TZIA 1QNZL 3M1BB 3ROLB 3VGBA 4PRDB 1F11B 1JPGA 5IBUB 3DVNA 4PJBA 3LVEA 4WCYL 4DGVH 3BDXA 4XCYB 3WSQL 2GY7B 1YUHA 1MEXH 4GG6F 4ERSH 2EIBA 4BSJA 4YXHL 3QIBD 4Y19B 4P4KA 4ZS6C 4UNTA 3GO1H 1KLUB 3CC5B 4Y8DC 3HC3L 1VDGA 4K3HA 4U1MA 5HPMB 3BGAA 3GBMH 3FMGL 5SWZB 4JHAH 5IEHB 4TULH 4OFPA 4EBQH 3I50H 2GSGB 1A6WL 3FB6A 4MJID 4KDVA 1GGCH 3W2DL 1Q9LA 1FAIH 4GG6A 1KIPA 3IU4H 5KZCB 5HHPB 4XCFH 5AZ2H 5C0FA 4BQ6A 4DQOL 4Y2OA 4KH2A 1F58H 2I5YL 3NN8B 3ILQC 5EUKA 1RJZB 5LKNA 4L9LC 2F5AL 4DAGH 1K8IA 1E28A 5TDOB 4LSRL 2R4SL 4ODWA 5JHLL 1NGXA 3T09A 1DBAL 3UTTB 1AE6H 4JFEA 1T3FB 2BJML 2CUHA 3T0EE 3RWFA 4G6FD 5KVDL 2IPKA 4PJHE 3STZB 1KACB 3I84A 4O51B 3MRLB 1SJVA 4HEPG 4HKJB 1PZ5A 4NN7B 4UTAH 4K3JH 2VLME 3SKNA 4KTYA 2B1HH 2A6JB 1JF1A 3ECBB 4YGVA 3NIDF 4I0PD 1H15B 3V5KA 5GISH 2W92A 5I1HH 5F9WB 3QXVA 2VXQL 1JYXA 3WNMA 5EC1B 4IMKC 1HSAB 2AJXH 3U7WL 1CICD 1MCEA 1I1YA 1HEZB 1JF6A 2H8PA 5GGSB 1BOGB 1JNNL 1Y6MR 4G80A 4LSQL 4LSTH 1BQUA 2FWOA 4EN3D 4LASH 1LE9A 2DQHL 4ODBD 3AROA 3IFOA 5GGTH 2Z8SA 1A9BA 3TO4C 4KJPC 1RK1A 2CDGA 5I18L 1JZ3A 1T66C 3MRPB 3MRKA 1OTSD 3F7VB 3SCMD 5FOBA 5GIRB 4KK9C 1QNZH 2WBKA 3VDAA 2EDJA 1DL7L 1IGFL 5ICYB 4G6AD 2FHCA 4NO0B 3CFEB 2R1YA 4WCYH 1F97A 3WSQH 2Z91B 3L3GB 3WLBB 4K71C 3BPLB 1MCWM 3O3AA 4YXHH 2W0FA 1P7QD 1SJEA 5ISZD 5FCUL 2VLJD 1J0JA 3ESUF 2VIRA 3BDYL 5LAXA 4QRTB 1C5DA 1F3RB 3HC3H 3K8LA 2ZUYA 4KI5E 1I1AC 3MJ9L 3FMGH 4WFHE 3S5LA 4XVTL 5C07E 4TNWK 4MZ3A 3B3IA 4QWWD 1RZJL 3EFDL 3OKEB 3MLSL 3TIEB 5HXMA 1A6WH 5CKGA 5E8PB 1MHHA 3W2DH 3KPLB 3ZT7A 3BO8B 4XNUL 4X6DB 1A3QA 4P5TB 5INCB 4DQOH 2I5YH 4RMTA 5AD0B 3S3JA 4LQ1A 1Z9LA 4XGZA 3O9WA 2F5AH 3WS6C 4R0LA 1R5WB 1S9VB 3DBXA 4LSRH 2R4SH 5JHLH 4K55A 1DBAH 2EYTB 5ITFA 1YMMB 2BJMH 4NUJA 1B0WA 1NDMB 2H6PA 3QAZB 2DB8A 4OD2A 5KVDH 5GPRA 4J1UB 3SJVB 4KZEL 1U91B 5BOPA 3HNSL 4Q2ZB 1QKZL 3FB7B 3CIQA 2IMMA 4HCRA 5D7JD 1QHPA 5CILL 5DQDL 4NNXB 1SY6L 3S9DB 4MD5B 3Q6FB 3SE3A 2VLLA 2JIXB 4N1CA 1SJXA 1TVBB 3SY0A 1N3NB 3V4UL 3QCVL 4GRWE 5EA0L 2VXQH 1FGNL 3VFPA 4G9FE 3M45A 3TVMA 3KGRA 1MUJA 1TZHB 1YN7B 4JFOA 1OCWL 3U7WH 4Y4FC 3U83A 1NC2A 2UWEB 4U1SB 2AEIT 4HWBA 5EIIB 1JNNH 4LSQH 5F70A 2J3SA 1NMAL 5KN5A 2DQHH 4FXKA 4C83B 2PW2B 3ZE1E 4QF1A 3FRPG 2VITA 1QLFA 5I18H 4F7TA 5E8NB 3AB0B 4Y2DB 1DL7H 1WAAF 1ZT4B 4NJ9L 1IGFH 4N0FB 4RAVB 3VWKD 3ULVD 3PWJA 4LPVA 5CIPB 5HVHC 1LK3L 3ZDYE 2D4FA 4OIIL 3MRGA 1A2YA 2DKMA 5FCUH 3BP5B 1N0XL 2HA1A 2EIZB 1DUYB 3BDYH 5KSUB 5FUCC 3IDJB 5AWNL 3OKOB 2XOTA 4M7ZC 1G1CA 4FQQB 1AHWC 3MJ9H 2ZOKB 1CFSA 4XVTH 3ZKNC 1YY8B 3V6OA 1RZJH 1XGTB 2W60B 3EFDH 3MLSH 4JDZA 5EULV 3WMSA 3ZSSA 1WAAA 1KYOK 1LK2A 1YC7A 3RGHA 1OTTC 4TSAL 1FORL 4C55A 4R7DB 4PJCB 3ET9F 1KIUA 4PRPE 4XNUH 2DLHA 3BH8A 5JTWA 3C87A 3U36B 4I0KA 3VFWB 5J89A 3DO3A 1S9XB 2YC1A 1S7XA 3T08A 5DEZA 1SMOA 1AGEB 4ZXBC 1SYVA 5D7KD 3LSOB 3M8OL 4ACPA 5HDQL 4K9EC 2FBOJ 1U3ZA 1IKNC 4RNRA 4A2MA 2R39A 4NSKA 4KZEH 2EIDA 3TCLB 1OQXA 3HNSH 4P46A 1AD0B 1JF5A 1QKZH 1UZ6E 5E8OA 1DLFL 4IOIB 1ZT1A 5J3HC 2VN4A 5CILH 4YR6B 5C0CE 2GFBA 5DQDH 1FFQA 1SY6H 3O4OC 4IMLA 2A0LC 2ICEB 4WDIB 4BKLB 1A6PA 1GGTA 3WNKA 4PRID 3V4UH 3QCVH 4M1CD 4NKQB 3GMLA 3MGTB 5EA0H 4QLRA 1FGNH 1LILA 3VFVA 1XZ0A 5D1QC 1OCWH 1EUUA 3O3BA 1MI5B 4QHKJ 4TUJA 3ULVL 2JE8A 2VXSL 1EIBA 4P5KA 3PQYA 2XIDA 5ALCL 2VMFA 1U36A 1NMAH 2KPNA 3MRIA 4D9QE 4JO1L 2C3VA 1YQVL 3I3DA 4E0RA 2FX7L 3OAZH 4PJFB 3ZE0E 1T03L 5F9JA 3BRGC 4QRRD 4RMVA 2BY2A 3VFUB 3L3DA 2XA8L 4ISVB 2GCYB 4X6CB 1T2JA 4NJ9H 3H9ZA 2P5EE 4EUPA 1A14L 1D5XB 1WFNA 3GJFB 4F15B 4HMCA 5F7UA 1LK3H 2B4CL 4KKLD 4D0DA 5AYQA 5IG7A 4GW1A 4OIIH 2Q3ZA 3CLFL 3G5ZA 1V3LA 1N0XH 1HWGB 1VGKB 2YPKA 5AWNH 1QFOA 1JNHA 3PHOA 3D69B 4J12A 3RVXD 1BQHA 2Y1VA 5J9PA 5M95B 3ZYOA 4LIQE 5EU6A 2H32B 2P46B 1MCQA 1ORSA 5FECA 1TQBB 2ESVE 3DUUB 4TSAH 1FFPB 1FORH 4MJ6B 1KJ2A 1G7JB 1CD0A 1GJIA 2VE6B 3QDJE 2HN7B 3D39E 1SM3L 2NY6D 2DLTA 2NLJA 3STLA 4NZUL 5IUSA 1VFAB 4MSWB 4MXQC 1LWRA 4AEHL 4LNRA 4PJ5E 2ICWB 4MVBC 3UJIL 1BJ8A 3FOMA 4P9HL 2BNRB 2CLRA 4X0KA 3QIWD 2UVEA 3I85A 5GRUL 5HGHA 5IROA 3RPKA 1FVCB 3M8OH 5HDQH 2PXYB 3TEUA 5IM7B 4PV9B 3RVVD 3MJ7A 2EYRA 2HFFA 5J6GA 1DEEA 3MCG1 3O6LL 1QLRB 3ALPA 4OLZL 3OTTA 4BSVA 1DLFH 3HI6L 4NGHL 2Y5TA 5DRWA 3VW3L 4PRNA 4HGWB 1CL7L 1M05B 2O5YL 4OB5L 4UQ2B 1DQLL 5DSCB 3GMMA 1VESA 2BVYA 1BZ9A 4GBXA 3H3BC 2QADD 4ZS7L 4U7MA 5CEZE 1CVSC 2BVQB 3P4NA 2AXHA 3KJ4C 4YO0B 3ARGD 1FZJB 2AXJA 3ULVH 2VXSH 3P30L 1MLCB 4NNYA 5ALCH 2AABL 1WICA 3NFPB 3Q5YA 1FFNB 1A6UL 5CKAA 3LD8C 4JO1H 1GH7A 5A2IH 3FO0L 1YQVH 2PTUA 1IAIL 2FX7H 3DRQB 3RGVD 4OGXL 3GMPA 4R97B 1T03H 4YIQB 4Y4KD 4N8VG 5BRZD 1NGWB 4WEUD 2XA8H 3RX8A 1DBJL 2EE2A 1PY4A 4BK5A 3GIZL 1S78C 1A14H 4L8SA 3WV0A 4OZHF 5ALBL 1IM9D 4Y19A 5K93A 3UTPE 5IIEA 2F53E 3FKUS 2B4CH 1KLUA 4RQQB 4XT1C 3CC5A 3CLFH 3LOWA 3GSNA 3CFDB 1UJ3C 2L0DA 5FDWB 1ZEAL 2HJLA 4PJ8C 1FGVL 3P0YL 1AKJB 3ULUE 4KJWD 4EXPX 2GSGA 1T21A 3D0VB 1T20B 3KXFA 1QSVA 4D0CB 4HUNB 5CSBA 3QWOA 5T1LB 5I1CL 5HHPA 2WP3O 2SEBA 4KRPD 5FYLD 4OZHA 5HYQB 5I8OL 2L4OA 1EVUA 2D7MA 4BFIB 4KHTL 3VWJB 2OMNA 3H9SB 1RJZA 2F15A 3WJJA 5F9AC 1SM3H 1PGRB 2EXYD 2P7TB 4NZUH 4N0CC 5FYJE 1J5OL 1UKSA 5TDOA 3KPSB 4OTXL 4AEHH 3UTTA 1A6ZA 3UJIH 4J23A 3U82B 4P9HH 4FQJL 3OR7A 4GAYA 4U2YA 4MHHG 4QXUL 1EEUA 1SYSA 5GRUH 3QUYD 1MH5B 4O51A 1QSFA 5SWQA 3HZVB 3KPOA 4OQTL 1OT2A 4HKJA 5L0QB 1ZS8B 4HJGB 1FYTD 3O6LH 3MLRL 4OLZH 1H15A 5KSAC 3HI6H 4NGHH 3VW3H 4LQFL 5GRJL 1CL7H 2FJGB 4DEPB 2O5YH 4OB5H 1DQLH 1HSAA 5FAAA 5C0ND 5HHQA 5I1AB 4ZS7H 1H3XA 1EJOL 5D1XC 3ARUA 4PJDA 3QXUA 5GGSA 1UCTA 1BOGA 2CKBL 4M43L 5AG8A 5D96C 2FDBP 5HYJB 2ZNXA 1JV5B 4LCWB 3V5HA 3KYNA 2X40A 3P30H 3VFRB 1RZJC 2AABH 1KCKA 4HS8L 2XPGB 1AGDB 5H2BB 2XY1A 2AQ3A 1P2CA 2VUOA 1G84A 5C92A 1J0HA 4GMSL 2Y36L 1A6UH 4XRCA 2XNAA 1BBDL 1OGAE 3UPRA 4BA8A 3FO0H 1C16A 1IAIH 1UFUA 4MAYC 4OGXH 3TZVD 3CFEA 3OBAA 3RVTC 3L3GA 1CGVA 1DBJH 3HFML 3LRGA 3WLBA 2DQDL 4X6DF 1I3VA 1JRHI 2ZOLB 3GIZH 4I0PC 1JGUL 5ALBH 3ALXA 5FYLL 1G7LB 2Y7QA 6FABL 4QRTA 1ZHLA 4HUMB 1SBSL 4P2YA 4XCEA 1QSED 1ZEAH 5D2LE 1XF5A 1FGVH 3T65B 3P0YH 4Z6AT 1RZKL 2CIKB 1RI8A 3LQMA 3TIEA 3BEVA 3WS3B 3S4SG 4L9DA 3NCFB 1IC4L 4PY8I 4EN3C 4XHQA 1ZSDB 3U1SL 1I8IA 3KPLA 1M7DA 3Q48A 4PRBA 4X6DA 5I1CH 3QQ9D 5INCA 1CYGA 3LHPL 1DN2A 3LIZL 5DFTA 1OTSC 3UTQB 5I8OH 4MXVE 1FFOB 4KHTH 4G8EB 1GXEA 3UTZB 4G6AC 1R5WA 3VMPA 1OAUL 1J5OH 4OTXH 1FCGA 3AUVA 4WI6A 1Q0YL 2LAGB 1UXWB 2EYTA 2ZUSA 3ZKMD 5HTSA 4ZFOA 4FQJH 3NH7L 3MUGB 4QXUH 5AAWA 2UZIL 4KK8C 2V9RA 4ZUUA 4Q2ZA 3VE0B 4OQTH 1OWWA 4L9LB 4R8WL 3BZEB 3E6HA 4LGSB 4HJ0D 1T7XA 2YRPA 5T1KB 4UV4L 4QWWC 3FRUB 5F1KC 1OY3B 1QZ1A 3MLRH 3DYPA 1KJMA 3OR6B 1RUQL 1KF9B 2NZIA 4MMXC 4LQFH 5GRJH 2R2BB 5H35B 4UMGA 4TRPL 5JR1L 4UNVA 3IAPA 3GB7B 4GRMB 1DLHB 2Z92A 4LEOA 1CTNA 5DHXB 5F1IA 1JN6B 2CKBH 4M43H 1CTOA 4QRPB 4LGRB 1TQCC 2E6PA 2X4TB 3EHBD 4LARL 2WP3T 4HS8H 5F44A 1W0YT 5E8NA 3HNVL 4GMSH 3KLHD 3TO2A 2Y36H 3BKYL 1A6TB 4U1HB 3RHWF 1FVEA 1BBDH 4UILL 1FNGB 5DJ8A 4Y2DA 1Q8MA 1CT8B 1RHHB 1ZT4A 1FFRA 3VXUB 4KJYB 4PJCF 5LGHL 3HFMH 2DQDH 1LDSA 5TE4L 1EV2E 3TO4B 1FZKA 3FFCE 1JGUH 5FYLH 2OLDA 5I8EB 4HMEA 4I0CC 3FB5B 3S98A 6FABH 1DUYA 4EI6A 1CFNA 2VDOL 4G8IB 3IDJA 1SBSH 1WIPA 2VLKA 4FQQA 3SE8L 2ZOKA 4LVNB 4P3WA 1RZKH 4HDIA 4LRIA 1ZHKA 2P8PB 2AK1L 2F5BL 2GJ6A 1XGTA 2W60A 4K71B 4YHIB 4CU6A 3FO1A 1KXVC 2XKNB 1IC4H 4X80L 3IAQA 4E41A 4PJCA 5A3IC 3U1SH 3DV4A 1MIML 1BOYA 1UB6B 3CSPA 4HIIB 3LHPH 3C60A 3LIZH 1I1AB 5DQJA 1RAMA 1D9KC 2QLVB 1IZKA 4DCQB 1S9XA 1S9YB 3RWGA 1YYLL 1XAUA 1OAUH 2PCPB 1QRNA 2YPLE 4PJGB 5L8JB 1Q0YH 3WHE0 4WO4D 2P5WA 1PYWA 1A6VL 5JORA 3NH7H 1MWAA 4RFOL 3TCLA 2UZIH 4WWKD 1QEWA 3ARZA 4YHNB 4R8WH 5ECJE 2O26U 3QXAB 4HUUB 3W5NA 4UV4H 5CGYD 4YQXL 5DK0B 4PG2C 4PJFF 5TQ0L 1MJ8L 2ICEA 4FS0A 2GYSA 1NUFA 3QZWG 3S3PA 4JPIA 1RUQH 2FX9L 5GQBA 3V0WL 3PIQA 4TRPH 5JR1H 4QY8B 3UJJL 3GSVA 4YBQD 2FO4A 2IBBA 1CIUA 3MBED 3IVKA 3EJJX 1KB5A 4JM2D 3QDMB 1NCCL 4KMTL 3X13A 4R6UA 3WUZA 4XWOD 5SX4I 3VRIA 4LARH 4FMFA 2B5IB 4PJFA 1RJLA 4PJEB 1GIGL 1A4JA 3HNVH 4DZ8B 2IPTL 3BKYH 4Y4FB 2IBZX 4IJ3C 4N68A 4LLDA 4UILH 2HRLA 4CVXA 3HA0A 4JRXB 4GQPH 2A83B 2VQUA 4MQ7A 1J05B 3O2WL 2YEZB 2FEEI 2XTJB 5LGHH 5TE4H 1OQOA 3VXTA 5IWLA 4J2XA 1F4AA 2ARJB 1HWHB 5C09D 5D6DC 4FXGA 2XN9A 2VLRA 2WQ8A 2VDOH 2ZUQC 1JGDA 1M7XA 3K7UA 4UINL 3SE8H 4DUVA 4OJFH 4Z7UF 1UXSB 4HZLB 1LGVA 4F33A 2AK1H 2F5BH 5HVHB 2B0SL 5TDPA 3EOYG 3DUUA 1SBBA 5F6IB 1BM3L 4X80H 4I4WB 1BFTA 3L9RB 2A77L 1G7JA 5C0BD 1MIMH 2A1WL 3EYVB 3WFHB 1L7IL 2V6HA 4XXDB 4M7ZB 2EC8A 1I8MB 2HT4D 2R0LL 1VFAA 2QHRH 3FTGB 3JXAA 2FHFA 4JZJC 3DI3B 3LN9A 2ICWA 4MGXA 2FZ3B 3MOAL 1YEDB 1YYLH 3RIFF 3EOTL 4FHBD 5IEKB 4Z7UA 5HHVL 3PL6D 5D9SA 4MQXD 4NPYB 5FDYA 1BVLB 1PKQE 1A6VH 3SDYL 3LEXA 5ISZE 2VLJE 2VR5A 1EJ6A 4PV9A 4JLRA 5K9QG 4RFOH 1X7QA 3E1F1 3VXQA 1NC4D 3HZYB 4ODXB 3C6LC 5I1DB 4KKAC 3RKPA 5IT2L 3RVXC 4LCYA 4AM0B 5I1EL 2ITCB 4WNQB 2MQ0A 3S6CA 4HGWA 1FL6A 3IKKA 4YQXH 3V0AC 5TQ0H 1MJ8H 5DSCA 1R5IB 1X5KA 4HKBB 1UVQB 2A9ML 1WFOA 3TJEL 5IV2A 2VABB 4AG4L 2FX9H 1I85A 3V0WH 2DYPA 2BVQA 1CG9B 5HJ3B 3V9FA 3VFNB 3UJJH 3CZJA 3P2TA 1PFCA 5AUMB 3N1QC 1FZJA 4RAUB 3O4OB 1NCCH 5IMMA 4KMTH 3KVQA 3NFPA 4PP2B 4XCNB 1IAII 5DGQA 3X12B 1X5ZA 3FT2A 3DRQA 5D1QB 4C59B 1GIGH 5KAQG 1I9EA 2IPTH 3VH8G 3QI9A 2GJZB 3VXSD 5HDLA 4LMQE 4Y4HC 2P8MA 4JHZA 4ZAKA 3NIGF 3O2WH 2FATL 5CJXC 4OFVA 5DFVD 4TNVF 4D8PB 4UB0L 3VU2A 1A1OB 2F9BT 5FDWA 1FC2D 4LDOB 1MELA 1KLFA 3GMOB 4U1LA 2GK0B 2J8UB 4Z7OE 4UINH 3ARGC 1XGUA 1AR1D 4XVSL 4YE4L 2B0SH 2BNUB 2C1OB 1H5BC 4P59L 5T1LA 3TYFB 4CW1B 5ID1A 1FQ9C 1BM3H 3LKQB 2A77H 4BFIA 3MFGB 2A1WH 1L7IH 3H9SA 2F19L 1FO0L 4P2RA 4CJ0A 1UACL 2R0LH 3INUL 5CHNA 4X4ME 1AIFB 1R5VB 1BBJA 3MOAH 5INDB 3EOTH 3ULVE 4QHLB 3U9UA 4HUWB 1HNGA 5HHVH 1IAKA 2K7PA 5F71A 4XPHL 3QFJB 1LO2L 3SDYH 4KKBD 3RTQA 5F21B 2BOBB 1NMBL 1S9WB 1QOKA 4I2XE 3DIFA 1X5YA 1S7VB 3VRJB 3E8UL 5J6HA 4KJWC 4HJGA 2OTUB 4HX1A 5IT2H 2G5BA 1R3IL 3IF1A 5I1EH 2HRPH 1HH9B 3C8HA 3IGAB 2FJGA 1CE1L 4JFHD 2A9MH 2FH6A 4KRPC 1SQ2N 3TJEH 4AG4H 1CBVL 3GDBA 32C2A 2EDLA 4Z9KB 1OTUD 5IW1B 1U8QA 3QUMA 4GUPB 3KPTA 3WL9B 4OFDA 3SDDC 5D7IB 2A6KA 2J5LC 1Q1JL 3QUYC 1ZOXA 5F89A 1NCTA 3KJ4B 1UYWH 2E8YA 2VZTA 5T33L 2AK4B 4XP1L 3FCTB 3IETB 4X99A 2Y06L 1FNLA 1I7ZB 2FATH 2J1KA 3LD8B 3NZHL 2ATPB 4AIZB 5IW6A 1KGCD 4UB0H 3KNBB 5IMKA 5DWUL 3DSNA 1BJMA 4PRIE 4I9WD 1P53A 5HGDB 5C0NC 4HLZG 3T65A 4PJ9B 3QUXA 2Q7NA 1DSFL 3FRPA 4WEMB 4LLYB 3HE7A 4R9HA 1K4CA 2YD7A 4QXGL 1ZSDA 4XVSH 4YE4H 5CD5D 4IRJD 5HHOD 3BGMB 1ZA6B 3IFNL 4M1DL 4P59H 5KS9B 2VDKL 2NNAB 4W4NA 5C0AD 4HKZA 1C7SA 3D2UA 1EHNA 4LNVA 4K3GA 2MJWA 1OLLA 2FIRT 5GGRA 1Q9OB 1AGFA 2F19H 5C0DB 1TPXC 4KV5F 1UACH 4QRRE 2HTKD 3ARTA 1TIUA 3L1OL 3TZVC 3V5DB 3INUH 3CFJB 3BI9X 1UXWA 1T22B 2OXGA 1XF2A 4UNUA 1LEGB 3K4DA 3KYMB 2YSSB 1A9EA 3AXLB 3GM0A 4YUEL 4XPHH 3QEHA 1LO2H 3IAGC 2Q86A 3VE0A 5MI0C 4L9LA 3BZEA 1NMBH 2BSSB 4UIKL 1G7IB 3E8UH 4M6OL 5BXFB 3UJTL 4JRWA 1VEOA 2XG5A 1R3IH 5EFIB 3W81A 3MRQA 3U30C 3UTSA 2IBZY 2R2BA 4R4ND 1ROWA 5LWYL 4FQXA 1CE1H 1IC7L 4P4KD 3GB7A 1HXYB 1CBVH 4N1HB 1EAJA 1HHJB 5B8CC 4UOJA 1KPUB 1XF4B 5EDXA 4KKCC 4I5BB 5CZXC 4JDVA 4TTDD 4P3DB 4QRPA 5KSAB 1BF2A 4XHJD 5ESAB 5F96L 3UPCA 2WW8A 3OAYK 1E6OH 3I3EA 4NO5B 2OL3B 4D0BA 4EI5D 3FJTA 4IMKA 3UMTA 3ZKMC 1Q1JH 2WIIA 3UXFA 3HLAB 5L2KD 3MUHL 2UV3A 1FNGA 1TCRA 4L3EB 5D1XB 1Y6NR 1RHHA 3ORJA 1HQRA 4HXBL 3TJHC 5D96B 5T33H 3LRHA 5EZLA 5E7BA 3VXUA 1WUNT 3S34L 1FZMA 4KJYA 1MY5A 5DEGA 1AXIB 5JA8B 3LDBC 2CKNA 2Y06H 3PGFL 3D1MC 1NGPL 3RAJL 1UM4L 1QHOA 1X6NA 2AV1A 3MXWL 3FB5A 4JFED 5FV1L 4WJ5A 3NZHH 2DI8A 5DUBA 3K1KC 4K94H 4G8IA 4MAYB 4N9GA 5DWUH 1OW0A 5JHDD 4LCCC 1A21A 4TVPD 2R15A 5EU4A 4PJGF 1A02N 1DSFH 3GSRA 2DN7A 4CADA 2H45A 4ZFGL 5MEQB 3C2SA 3GMNB 4M61A 4I0PB 2XKNA 1LO5B 4H5SB 1HNFA 3HB3D 2FSEA 3EHBC 4QXGH 1XF1A 3IFNH 1UB6A 2GJJA 4M1DH 1HCVA 2NCMA 2VDKH 4O5LL 4ODVL 1CLOL 4QKXB 5C0RL 3T77A 5HGGS 3ARWA 4CGTA 2C5DC 2HKHL 3ARDA 3MV8A 4HAFA 1WFUA 5BRZE 2LE9A 3EDJA 3L1OH 2Z0BA 1I8KB 3JTTB 5D7LB 4EN3B 4AH2B 4PJGA 2NXZD 4N0RA 2DL9A 3SDCA 4L3CB 4N5UA 5JXEC 1WLHA 4PREA 5JW4Q 1H3TA 4D2NA 5LGJB 4YUEH 5DJZB 4OD1L 4EDWL 2E6QA 4YHNA 1N59A 5C2BL 5C6WH 1TZGL 2ICES 2R1WB 4UIKH 4WFGD 4K8RC 3QXAA 2FJFB 4M6OH 4X5LA 1FG9C 3W0WB 3UJTH 2LVCA 5DK0A 1U8IB 5D6CB 2CK0L 5D1ZC 2YRZA 5BS0B 4ZPTB 1X5JA 5LWYH 3OKMB 5FYLE 1I1RA 2X1PA 4QY8A 2NY4C 4X6BB 4V1DA 4R96B 3FZUD 1TNNA 4IRZL 5B3NA 5HGAA 8CGTA 1U8NA 3U2SB 4B7IA 5B3JE 5HGBA 2LV4A 5F96H 5F1SA 4HWNA 4WO4C 4X7DC 4JN2A 4NDMA 4JPWL 1VEPA 4XMKL 3W9EB 2E7BA 1H8NA 4TVPL 3VXRA 3DYOA 1CGSL 4WENB 4JRXA 3TBVB 3K80A 4HXBH 3V6FA 2EICA 1FNHA 3P9MB 1J05A 3EBAA 7FABL 1MCWW 2IANA 1ZLSL 2YEZA 3S34H 1FYTE 3BP4B 5CGYC 3QG6B 3PGFH 2COQA 2IQAA 1NGPH 3RAJH 1UM4H 3MXWH 2VQTA 5FHAL 2OBGA 2EZ0D 3F12A 1RUML 2QEJA 4M48L 4YBQC 4APQC 1IC5L 5DHYA 4MA7L 3PWVB 1C12A 2CPCA 1ZLVK 4HZLA 3FFDA 1UT9A 3NPSC 5L8KB 3WNPA 4ZFGH 4JM2C 4KRNA 1XF3A 4NKDA 1K5NA 1IGJA 2BXYA 2ENYA 3EYVA 3KPQB 3GMQA 2DQFA 4O5LH 4ODVH 4LDEB 1CLOH 3CDGA 1N5AA 2W9EL 3X17A 3FTGA 5C0RH 1ZHNA 2DI9A 4BQBA 3CSBA 2HKHH 3BRFA 2FZ3A 4ZUTB 1T0MA 2DD8L 1YEDA 3OV6A 1NC2D 2X1XR 1KLGA 4MA1C 2APVA 2CRMA 5IEKA 2F54D 4M8VA 2C3HA 3TH3T 1DE4B 4G42B 5GS1A 1Y0LA 2E7CA 5GHWL 1M71B 2GTWB 5D2NE 1D9KB 1MAKA 1S7WB 4HK3N 4OD1H 1S5HB 4EDWH 3HZYA 4WHDA 1QSEE 5I1DA 5EUOE 5C2BH 1TZGH 1ZK9A 1RULL 2W07A 5K9KB 4WNQA 3VD4A 5E03A 1DBBL 3BN3B 1LEIB 4PLOB 1I7RA 4WU5B 2VKWA 2CK0H 3RWJA 2VABA 4NRYB 1IKNA 2I9TB 3CCHB 2C1PA 4JQXC 3DGCR 3WNNA 4F7MB 2HT4C 4BZ1L 3NPZB 3HN3A 3RKDC 4Z0XA 4RAUA 4IRZH 4OUUA 2C4FU 4HV8B 3FT4B 3WXVL 5F3BA 2YXMA 4PP2A 5TE7L 3U4BL 4YPGB 1GSMA 3PL6C 3LQZB 3OXSB 2J8UF 3HAEH 4XMKH 4K3DL 5D1QA 2DQGL 4TVPH 3K3QA 1CGSH 3L95B 4OZ4A 2GJZA 4AT6B 2H26B 4RGND 4HCRL 3EOAB 1UWXH 3MLPA 7FABH 1ZLSH 4EVNB 2IPUK 2EDKA 2HVJB 2ZSVB 4ELMA 4OFKA 4RWYH 1NANH 4JFDD 3O2DL 4G8GA 4QTHA 5FHAH 3C5ZC 2J8UA 1RUMH 3UBXG 4M48H 2IC2A 1IC5H 4Q9CA 1U3HA 4MA7H 4IIQC 2HG5B 4HWBL 4P46D 1AR2A 3OZ9L 1H0DA 1NMCB 3WE6A 1S7QB 2W91A 4CW1A 4XP4L 2XZAL 3F58L 5DMGD 1HH6B 3WJLA 5IR1B 2IALA 1KXQE 3FT3A 3ARBA 4JFXB 3RBGA 1ES0B 2QSTA 5CEYA 2W9EH 5HYSB 2A6IA 3F7RA 1A47A 5ANMB 5EG6C 4GJTB 4E42A 2DD8H 2Z93B 4QHLA 1FG2B 4KC3B 4HUWA 1FL5B 3PQYD 4AJ0A 3QFJA 4DUXA 2MSPA 4A6YA 3UYOD 5EOTB 1W2KT 5GHWH 5EU5A 1S9WA 2JCCB 2WQRA 2UVFA 3JWOL 3QUKB 3QXWA 1JUFA 5KSVB 2BHZA 3RRQA 3E3QC 3VRJA 3HUJA 4G7YL 3FQTB 4JZJB 3QIUC 1HHIB 1KEML 3HCVA 5D7IF 1RULH 3A67L 1U92A 5B22A 2NW2B 1EDQA 3QA3A 2HT2D 1HH9A 1DBBH 3H8NA 1AR1C 3IGAA 3MGAA 4WEBL 3TCXA 4OZIE 1AO7E 1Q94B 4HS6A 1B0GB 4OKVB 3QNZB 1IGYA 4UQ3A 2HFGL 3C6LB 4CRPA 3QH3A 4BZ1H 4LKXB 2YWYA 1DVFD 3L6FB 4L4VA 3D3VA 5DJDB 3BPCA 4P2QE 3GHBL 4XP6L 4LAQL 4G8FA 5H94A 2F8XC 4GUPA 1YJDL 5EU6D 3VDCA 1KIQB 3WXVH 1LVEA 5D7IA 1XR8B 3RIAK 4TTGA 1RVFL 3U4BH 4K7FB 3AU1B 5ESQB 2FIKB 2HT3D 1ETZB 5HYIA 4K3DH 2MFNA 5IFAL 2DQGH 3HG1D 1JBJA 5C0JB 1V3MA 4LHQB 5KS9F 2XQYK 4ZNEE 4KXZH 1BP3B 1JI1A 2MCPL 5TE6L 1R6VA 2Q7YA 2BSED 1VCAA 1R3LB 1S7UB 2YA1A 1WV7T 5GSVB 3MRMA 4JANA 3KNBA 3C2AL 4PLKC 3DO7B 4LCUA 1OAYL 3O2DH 4AIOA 5F6HI 1YPZB 4PJ9A 5TJWK 1I1FA 4Z7WF 1FIGL 4Y4HB 1K2DA 2VXTL 4H25B 4FMKA 1X5HA 1EPFA 2UYLB 1TFHA 3GJFK 1RJYB 1UH4A 4OZFH 4HWBH 5D7SL 1JGEB 3C08L 2C7UB 5E6IA 3OZ9H 5KS9A 1M6OB 2NNAA 3O4LD 2RB8A 4XP4H 3WIFB 2XZAH 3F58H 1IEAB 3M17B 5CWSB 3MJ8B 3D85A 1ADQA 4GBXD 3RI5K 3S7GA 5C0DA 4NC2B 2HMID 3ARGB 4YJZL 4PJIB 1AXSA 3MTRA 5HI4C 1OP3K 3OGCA 2E7HA 3BPOC 3CK0L 3U46B 2WSKA 4Z7WA 1H5BB 3BMVA 5D72L 1LEGA 3ZKQD 2DTSA 2VERN 2R23B 5C0EB 4BQ8A 4OF8A 3N1GC 5BV7C 4CBPA 2BSTA 4DVRL 2NY1C 5C09E 3O0RL 5ICXB 2BHYA 1JTOA 5I1KL 4FZEL 3MMEA 2BZDA 3JWOH 4K23L 5ERWB 4G7YH 2AEQL 5JXAL 5BXFA 5JIIA 1KEMH 4MCYA 1JWMA 1E0OB 3A67H 1CXEA 1J86A 1H8SA 3QNXB 4PJ7B 4Y19D 4D94A 4KY1L 4WEBH 1BIHA 5C0BE 1HHJA 3PWLA 5T5NG 1IMHC 4W68A 5DA4A 3T2PA 1XF4A 4PRHB 2HFGH 1XCTB 2HJFB 3LZFL 15C8L 1NBZA 4P3DA 5IVXE 2DMCA 3WNLA 5MENE 5KSAA 2HTKC 3BVNB 4POUB 2GITB 4U1NA 5ESAA 4KFZC 4XP6H 2E8ZA 3GHBH 4LAQH 3V8CA 3KXFD 1YJDH 1QLEL 5DJYB 2Y4SA 4KRPB 3RIFK 1RVFH 3ELAT 3O3DA 4L3EA 5KZCD 3NZ8B 5GS3A 5IB1B 2GAZB 4F37F 1L0XA 5J4MA 5IFAH 3BH9A 3QZWA 3MRJA 3EZ8A 5F1OB 5IOPB 5JZ7C 4JKWA 4Y5YA 1OAKL 2PTTB 4HIJB 2ZCLL 3SDDB 3VXNB 2MCPH 1OAQL 5TE6H 2P45B 3UTTD 2VDLL 4H8WL 4Z7VE 1UZ8B 3S97C 1RZIB 3C2AH 1PVHA 4P4KC 3QB7C 3SO5A 5B38G 4MA8L 1OAYH 2QKIB 3Q2CA 4L5FL 5GZOC 1FIGH 3IRZA 1F5WA 2VXTH 3GMNA 4TTDC 5HY9B 3VA6A 4QRQA 4XHJC 4MD4A 2PYFB 5D7SH 4PJAB 3C08H 4U3CA 1PX3A 4HC1A 3VG9B 2O61B 4NT6A 2FD6L 4NQSB 5KSBF 4P3CL 3BGFC 5IHLB 4WUUB 4HH9B 4F2MB 1EEYB 1TLKA 3VXSE 1P84K 3JTTA 5D7LA 3BIKB 3CK0H 3O45A 4LVHC 1D5ZA 5D72H 4Z7QF 4GW4A 1I8LA 5IP4A 5TF0A 4DVRH 5DJZA 5C08E 3I02A 3O0RH 3ZE2E 1TPXB 1S7TA 5I1KH 4FZEH 4Q6YA 2ZG2A 4U33A 4K23H 1CFTB 3CXHK 2HP4A 2BCKA 2AEQH 5CCKL 5JXAH 5KSBA 4NO0D 5D6CA 3PWPB 5EBWB 2ZP0T 4BH8A 4JKPH 1IQDA 2WBJA 4ZPTA 4WRLA 1O7SA 4KY1H 4P2CG 4X6BA 1IL1B 3K8KA 3O6FC 3QEQB 4FFYL 2W0PA 3H9HA 3MLYL 1Y6KR 3FHQA 5EIQA 3ARFC 1C8PA 3QUZA 1B6DA 3LZFH 15C8H 3U30B 3U2SA 1W72A 3TA3C 1WK0A 1J8HB 2NXZC 3QRFM 4DFHA 1YEIL 1QO3A 3F6IA 4MAUL 4XAKD 3BHBA 4BYHA 2DAVA 2F8OA 4OCLC 5B8CB 5GZNC 1Q9KA 3P9MA 2KL6A 1HILA 1OSZA 3T1WA 1JPST 1OAKH 3QG6A 4N1EA 3B9EA 1KIRA 2ZCLH 1OAQH 1QA9B 2DJUA 2VDLH 4H8WH 1YMMD 4JFHE 1D5MA 5F93C 3OWEA 4ODUA 2C4FT 4O02L 2ID5A 4U0QB 1FNSL 1WIOA 4MA8H 3IDIA 4TVSa 4L5FH 3K74B 1TMCB 1LMKA 3LDBB 3JVGA 3OB0K 4XX1E 4FQHB 5SX5K 3QO0A 3FHAA 4MJ5B 2EDQA 3HHRB 2LQRA 1XIWA 3VH8A 4Q58C 2PETA 3RWDB 4X83A 4Y1AB 3KPQA 5TH2B 3FOLA 4FN0A 4LCCB 4XPBL 2H2PD 2FD6H 5I1LB 4P3CH 3U7AA 1H3VA 2GKIA 2UUDK 4Q6IA 1W0WB 3O9WC 1DE4A 3PWNB 4G42A 5DRXA 4R0LC 1ORQB 4UI2A 2OR9L 1M71A 3I75A 3QHTC 1T7ZA 1D9KA 3MZGB 1S7WA 1OB1B 4I9WE 4DVBB 1DCLA 3E6FA 1A7QL 4KVNL 5K9KA 3QWQB 4Y2DD 1EGJA 5CCKH 1LEIA 2HLAB 2BNQA 4XWGL 1NFIA 2EYSA 3F5WB 1SHMA 5L2JA 5HHOE 4I3RL 1NKRA 2J6EA 3CCHA 2NY5C 3SE3C 2ADIB 4YBHA 2DQJH 5C0AE 2Q6WA 1IGML 1INQA 4Y5VA 2PYEA 1UENA 4P2OA 1BFSA 4MDIB 4FFYH 3MLYH 5IB5B 5F7MC 3TVMC 5CZKA 4U1JB 4M6NL 5D1ZB 3EYFA 1J8KA 3UYRL 1N6VA 2GJ6D 5HI3C 3LQZA 3OXSA 1YEIH 4MX7B 4PPTA 4MAUH 2G2RA 4ZFOL 2NY4B 4E41D 5DJ6B 2WANA 1AC0A 5I9QC 5HVFB 1ZAGA 4KXZI 4AT6A 2H26A 1EEQA 3C60D 1PQZB 2X4UB 4X4YA 1AH1A 4EVNA 3EJZC 3GUTB 1HOCB 3T8XA 1N2RA 1XGRA 4NP4L 4G6JL 4OM1L 4Q9RL 4K3EL 3V95A 4FQPA 2AP2A 5IMLA 3MRFA 4AEIL 2X4QA 1GGYA 4JJ5A 4O02H 1Z6JT 3WFEL 4NQCE 1NAMB 3WDJA 2BOCB 5DMKB 4PY7B 2HG5A 1ZVSB 3RVWC 1Q72L 2I9LB 3CXDL 1J18A 3C8KB 4EIGB 4MNQE 3V6OC 5IR1A 3WXWL 4HK3J 4YNYB 2IADA 5DHVA 4XPBH 4APQB 4AEEA 5L2KE 4XNMA 4GG6E 2VH5H 3PHSA 5I2IA 1KG0A 2JJVA 3GJEB 3BKML 2HAZA 3NPSB 2D7PA 5J1AA 4O2EB 1MI5D 3MUY1 1FL5A 1IFHL 2MNUA 1RK0B 4J3WA 3RUGB 3MREB 2OR9H 5FCSH 4NQEB 3JWDL 1EMTL 4XBPB 4YWGL 1DTUA 4JO4L 4HT1L 4PJHF 1JPFB 5JHDE 5ESVB 4TVPE 5SWSB 1A7QH 4KVNH 9CGTA 4E5XB 3SGJC 2ATKA 5D5MB 3SKUD 1SJHB 4IS6B 4P46C 4XWGH 2D03L 3DROB 1MLBA 4KKNA 5HDOA 2BXZA 3FAXA 4I3RH 1B0GA 1U2CA 2EDWA 2X41A 4OKVA 1H3PL 3C6LA 1A1MB 4O2FB 1REIA 3DX6B 1IGMH 1JPSL 4HHAB 3T0EA 3VFSB 3RU8L 4PD4J 4LKXA 5I8CB 2DLFL 4OKDA 5HYEA 4XVUD 4PJHA 1DBML 3OKDB 4NRXB 4OQ1A 4M6NH 2IEPA 4NN6C 3UYRH 1WTGT 1RIUL 1RPQA 1BLNA 2FIKA 1ETZA 4HH8A 1LDPL 1B6UA 1KENL 1T1XB 3DUSB 4GT7A 4OD3L 3P9LA 4JE4B 2CXGA 4J4PA 5C0JA 3NIDE 3UDWA 5ID0B 1IM3A 4X7TA 1MCHA 1NL0L 1QD0A 4LLVB 4NOFA 1T2XA 3KYOA 3TBSB 5DJ0B 4F9PA 8FABA 5DEFB 5J11B 3PL6B 5GSVA 5F88A 4NP4H 4G6JH 4OM1H 4Q9RH 4K3EH 2FL5B 1RZGA 5FV2A 4FFVD 3SGDH 3X3FL 4AEIH 2Y6SD 3TBWB 5EO1A 1P9MA 1X4ZA 3OG4B 2PXYD 1FO0B 4H25A 3BUYB 3WFEH 3G6JB 2UYLA 1VENA 4S1QL 1T4KB 1CFBA 3NIFF 3N9GL 1Q72H 1KTDB 1M6OA 1FN4A 4NWUL 3CXDH 5AZEL 3WIFA 1CFQA 1IEAA 2FYYB 2HT3C 3WXWH 2QR0A 3C5ZB 4X9GA 3TBYA 2RAMA 3WD5L 4F57L 1U93B 4OAWB 1TNMA 3JZ7A 3GI9L 4IIQB 4PJ7F 2CSPA 3BKMH 3CFKA 4FQLL 5TPWL 1X3DA 1KC5L 3S36L 3VFTB 1K3ZA 5CIPH 1KPVB 1ZWIA 5D2LB 2AV7A 1IFHH 5EO9B 1VKXB 4HJJH 5C07A 1ZHBA 2DQEL 5K9OA 2BDNL 1L7TL 3JWDH 1EMTH 4YWGH 3LKNB 5IROC 4JO4H 5ERWA 4HT1H 4FFWC 1K6QH 4GXUN 3BN9D 1N4XL 3QI9D 2WUBL 3MLVL 5DVKA 3BOVA 1KELL 1DZBA 3T3MF 1PDKA 4C54A 2D03H 3CU1A 4ZUWA 5DXWA 5DF0A 25C8L 1O5DT 1E4KA 3PDOB 4GRWF 1M1SA 4PRHA 3QIUB 1H3PH 3MUJA 4GBXC 1XCTA 1JPSH 2WWKT 2HMIC 3RU8H 3MLTB 3BVNA 1AKJD 5KVMC 1QFUL 2ED7A 2QSQA 3W9DB 1MFAL 2BVPA 4XXCA 4L1HA 2F54E 2W0LA 1JI2A 1XEDA 3GSQB 1RIUH 3SKMB 5T1LD 1DR9A 4FQ2L 3VGGA 1LDPH 1KENH 4OD3H 1D5BA 2CJUL 1KCRL 5E8EA 3V52L 3VWJD 1FNFA 1MVFA 3H9SD 4QOKE 4JY6B 4PJAF 1Q38A 2VISB 1VPOL 1RZ8B 1NL0H 4NCC1 4QYOB 3KPSD 3SDDA 3VXNA 1MCJA 4GKSB 5E4EC 2J4WL 3OKNB 5F7YC 1UZ8A 3VXME 1LO0L 1RZIA 3EGSB 4L8SC 4M6ML 5GSRB 4HUVB 3SDAB 1J0ZA 2QKIA 3X3FH 5KOVC 3RTQD 1NEZG 5HY9A 1X5LA 4S1QH 3F62A 1FBIL 4QGYA 2X89D 3QXDB 1P4LB 1CCZA 3HE6A 3N9GH 1A7NL 4N0UB 1S3KL 2NW3B 5T5FL 4NWUH 3MFFB 4NZDA 7CGTA 2JJTC 5AZEH 4PJXE 2PR4L 3BW9A 1WAAE 3GSXB 5I8KL 1RZ7L 5M94B 3IDXL 4JFYB 1OT1A 1NAKL 3WD5H 4N9OB 4X5XA 4F57H 1FCCA 2FECL 3C6SB 4HH9A 4F2MA 3FFCB 4MNGB 1R3KA 1GGBL 1U8PA 1EEYA 3GI9H 4RGNE 3WJJC 1IC1A 1U8JB 2EH7L 4FQLH 5TPWH 5IHZB 5HYJD 1YMHA 3GJFH 4LCWD 1X6LA 1WSST 1KC5H 3S36H 2GTZA 3WEXA 5EBMB 1IVLA 3RZCA 2DWDA 3A6CL 2DQEH 1VFOA 3QEGL 3DXAB 4JFDE 2BDNH 4Z76A 1L7TH 1FE8L 5IFJA 3QPXH 1J88A 3BPOB 4LLMB 2FBJL 3R0NA 2H32H 4YFLF 2WV3A 1N4XH 3PWPA 5I16A 1OP3H 2WUBH 2A73B 3MLVH 5ENWB 5BV7B 1KELH 2NY1B 4DN4L 1T1YB 2CLZB 3PJSA 5MEPB 4P23C 4X9FA 25C8H 4H1LG 1IL1A 4K7PX 5CBEB 1S7RA 3HPJA 1U8KA 4M8QA 1U8LA 2YN3A 3KPRE 3MR9B 3QUXD 4Z78A 1RMFL 1QFUH 2XV6B 3SDXB 1MFAH 5E9DB 2OSLB 1FNEA 4ZS6D 3MGOB 1F4XL 3RWCA 4FABL 5C0CA 2RJMA 1CF8L 4FQ2H 1KT2B 3CPLB 5F7LB 1U8MA 1VADB 2CJUH 1KCRH 4L3AA 3V52H 4POYA 4GG8A 1VPOH 4R4FL 3KS0J 2DICA 2D7OA 3P4OB 2J4WH 4ENED 1LO0H 4NZTL 4M6MH 5DJXB 3CVHB 2VL4A 1TZIB 3OL2A 4YDJA 1JPGB 3DVNB 4G9DB 5HHMD 4MJ5A 1OM3L 4HBQA 2OM5A 3DX8B 5T1KD 1PZUB 1YUHB 1FBIH 1EZVX 4K7PL 3RWDA 1A7NH 5EU6E 1S3KH 2XKUA 3VGHA 3FQRA 5FA3A 5T5FH 5LG1A 4LCCA 3AGVA 5ICZA 4ODHL 5FO7A 2PR4H 5I8KH 1RZ7H 3RL2A 1QRKA 3IDXH 4CUCA 4FQXD 5I1LA 4EQ2A 1NAKH 4U1MB 3HG1E 4JR9L 3VD9A 1X44A 1ULVA 1GGBH 2EEDA 5JNYB 4WI4A 4KQ4L 3PWNA 4J3XA 2EH7H 3FB6B 3MX0A 4QRPD 4Y16A 3UBXA 5GS0C 3H6JA 2D9QB 3A6CH 1Q9LB 4MXWL 1J1PL 3BGFB 5C0FB 2WLZA 2KQNA 2XG4A 1EO7A 2ESVA 1FE8H 2C26A 5EUKB 3BQUA 1ZTXL 2HLAA 4LVHB 2FBJH 1K8IB 2VXUL 3VXUD 3QDJA 4LPUA 1E28B 3F5WA 4ODWB 4UBDC 1NGXB 1JGLL 5J7CC 4L8CA 4KJPD 4O2CA 4DN4H 1HHKB 1CGWA 3O4LE 1T66D 4PJ5A 4I8DA 2W1NA 4KK9D 3DVIA 3DI2B 5EOQL 3ROOB 2H2PC 1WZLA 3RX7A 4X7FC 4MDIA 4KDTA 2X70A 1MRDL 5LQBL 5DDHB 1PZ5B 2CH8A 5D1ZA 1MSPA 4RFNC 4L4TB 1RMFH 3G08A 1JF1B 3L3HB 4YGVB 4MX7A 2IH1A 4BM7A 4L4JA 1F4XH 3O6FB 4FABH 1CF8H 1ED3A 3ARFB 4NYLA 5JOPD 2ERJC 1PQZA 1I1AD 1NLDL 3QBTB 3T1FA 2R0WL 1I1YB 4KRMB 2XXMB 3TA3B 2H8PB 3MV8D 3I6GB 2EECA 2NXZB 5C70A 4UTBL 4G80B 4R4FH 1YQ2A 4W4OA 2N7AA 5BZDA 1LE9B 3IFOB 2QL1A 1OWRM 1A9BB 4ZOAA 4NZRL 4NZTH 4POZD 3MRKB 4U05A 4UU9B 1NAMA 5FOBB 4Z7NF 2W9LA 2BOCA 5DMKA 3V2AR 1CXHA 1WCQA 5KVFL 2CGRL 1ZVSA 5SWZE 1A5FL 4GQ9L 4D9RD 4XB8A 2CXKA 1OM3H 3C8KA 1E27B 4LRIC 4K7PH 3KR3L 3ES6B 1LQSR 2YD6A 3O3AB 2W0FB 1SJEB 4RCAA 4ODHH 5LAXB 2VIRB 4ZYKB 4B5EA 3ILPA 1C5DB 2F53A 2RBLA 1VACA 1GC1L 3C60C 2HJKA 5I76B 4JR9H 3T0DA 3OB0H 4KQ4H 5SX5H 1F8TL 2D0HA 1MHHB 4NQEA 4G5ZL 4MXWH 3T0BA 1CD8A 1R3JB 1J1PH 3VXRD 4PR5A 3LPFA 1QBML 1ZTXH 1SJHA 2YUZA 4JRXD 4IS6A 4XGZB 2V2WA 3O9WB 1OAXL 4R0LB 2VXUH 3MZTA 2IAND 3DROA 2Q3AA 4WHYH 3DBXB 3IJYB 1EFXB 1CQYA 2XTJD 3TNMA 1JGLH 4HKXB 4GRLB 4BJLA 1PKOA 3B6SA 1IGCL 3BEWA 5D71L 5ITFB 4NUJB 3NOIA 2H6PB 3H3KA 3LQAC 4O2FA 4PV8A 4XC3L 1WQVT 4HHAA 4OD2B 3VFSA 3MRHA 5EOQH 5MHSD 5I8CA 4HBCL 1MRDH 5LQBH 1AGCA 4U49A 2WK2A 3OKDA 3GSOA 3LKPA 4TYUA 1J0IA 2ADJA 1I9IL 5SV4A 4XMPL 4I2XB 4HAGA 5A1AA 2CDEA 5DZNA 4JQXA 2VLLB 4CAGA 3OAZK 3G6JF 3DUSA 4JKLA 3UROR 4BH7B 4WUKL 3TVMB 1MUJB 1NLDH 5IVZA 4PIRF 2R0WH 1NC2B 3ZKND 4IBLT 1NUNB 1T7YA 5DJ0A 5KOMC 1EAPB 4UTBH 1X5FA 4OZGB 4GXUM 1OTTD 2FL5A 5KN5B 1KFAL 4M7LT 5DD1L 4FXKB 5I9QB 4NZRH 5IWLC 1CVRA 3U48A 3PG2A 3IS0X 3G6JA 1JGVL 5D2LF 1T4KA 1NPUA 5KVFH 1CXLA 3MV9B 2CGRH 4XVUC 3RNQA 1A5FH 4GQ9H 1CDGA 3PWJB 1QBBA 3KR3H 2Q76A 3WLWC 5EU7C 3B9KB 4YDLC 3AREA 4M3KB 1F6LL 3FQXB 3MRGB 4DW2L 4X6DE 4IIQA 2YD1A 3QCUL 3RA7H 4KDWA 1GC1H