2E5EA

Solution structure of variable-type domain of human receptor for advanced glycation endproducts
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
101
structure length
101
Chain Sequence
AMAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Variable-type Domain of Human Receptor for Advanced Glycation Endproducts
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Advanced glycosylation end product-specific receptor
total genus 10
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2006-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e5eA00
2CJUL 5ITBH 3WN5C 2X44D 1WC7A 3MCKA 5ESAA 3FHQA 3T0BA 4XPHH 3LEYL 2HRLA 3BPOB 4KK9C 4P4KD 2G5RA 5T5FL 3HRPA 1SMAA 4MJ2A 5DMIL 3FJTA 2XG5A 3SHSA 1Z5LA 3QWOA 4ZO8A 4XXCA 1ZHKA 5E2UL 4NDMB 1F8TH 3ARSA 5HI5D 3VFGH 3BAEL 1OF2A 4LSVL 1T4KA 1CICD 4M7LL 2FX7L 3KG5A 4JPWL 2NZ9C 3S37L 5ACZA 2IC2A 2VNCA 3ARDD 2V9QA 5HYSA 4G8EA 5EZOH 3O8XD 1WBXA 3X11A 5MP6L 1SBSL 3MV9A 4ZYKB 3U46A 4OF3A 2VXTL 4H1LA 3BKML 3HPLB 4IRSD 1F3DH 3RZWA 4YHZH 4JO3L 5I1HH 3MRLB 3C6LD 3QNYB 1UB5B 2D7TL 5HI4C 1DBBH 3WFDH 2HT4C 1IQDB 5E7BA 4NWUL 5EUOF 2FJHB 5CEZE 3FRPG 4PRPB 1JGDA 3ARGA 2GUOB 4LSRH 1X6LA 15C8H 3LY6A 3W2DL 1VFBB 2GUOA 4OKVB 4LSVH 5DJZB 4JPKH 3MRRB 1C08A 1F00I 1FNFA 2ICEB 1IM9B 3D69B 4DGIH 2NYYC 1QSEA 4YUEH 3UTZB 3QIBD 4ZUVB 3VWJD 2YK1H 3CUPB 1Z2KA 3EFFA 2IFGA 2YRPA 4R97B 4P4RA 2VERN 1O0VA 3FAXA 3BOVA 2PW2B 1G7JB 1V5JA 5FEBA 3KPPA 2JF1A 4KMLB 5CD5C 1OSZB 3QFJD 1U3HD 5D2LF 3ZSSA 1A2YA 3MZTA 4GKNB 3BPOC 3TCLA 3KJ6L 2BVUA 2EDDA 4ZOCA 1A3RH 3Q1SH 1I1CA 3SDXE 4NP4H 1J5OH 4JO1H 4XB8A 1FP5A 1SEBA 1ACYL 2E6JA 3LPGA 5FGBA 1HILA 3EYFA 4B7IA 5EU5B 2JJSA 1K4CA 4Z9KB 4RMWA 1W72H 1QQDA 5GRZA 2CIIB 3D5OF 2C1OB 5CEZD 5EIIA 1TITA 3K74B 4LSPL 1GL4B 2FATL 1AI1H 1M7IB 3U36B 1JHLH 5DEGB 2XOTA 1CQKA 2NXYB 4OIIL 4YPJA 4XNYL 3VXNA 2I9TA 4NHCL 5I19L 3Q6FB 4P2OC 2ARJA 1CL7I 4PGCB 5BS0D 1KGCE 1DE4B 4LQFH 2H6PA 2Y36L 3VXQA 1OF2B 4X6DE 3LKPB 5B8CB 1ZLWH 1JGEA 4NN7C 3I9GH 1HYSC 1YDPB 1Z5LB 3TBVB 2EDHA 3TWCH 3LS4L 4YFLF 4JR9L 4IJ3C 4OI8A 3SDAC 4M6MH 4Y4KC 2PNDA 2YR3A 4KK8C 5EBLB 1ZMYA 2F19L 1FGNH 4PR5B 1AD9B 4L8SA 4QHUB 2DRUA 2FSEB 4OCMC 4TYUA 4Z0XA 1ZA3A 5DGRA 3DUHA 2X1WL 3UJTH 1B90A 1HHJA 3TO4D 2OYPA 1MNUH 3IU4H 1HKLH 4WU5B 4RQQB 4R0LA 1DSFH 1RPQA 2C9AA 4EI6B 4IJ3B 4P5MA 2R56L 5C09E 1PW3A 1CI5A 5DS8A 1CLYH 4UBDD 3T4AA 3PABB 5K59F 2C7UB 4QXGH 2VE6B 5DR5H 3T65A 5D2NE 4LBEA 1Z0NA 1RVFL 2P5WB 4KV5E 4CGTA 2DQGL 2P8MB 2J4WL 2YUZA 1KB5B 3SPVA 2CK0H 1QD0A 2NY2C 3X13B 1KB5A 4AENB 4XNYH 1KEGH 4KKAD 4WI2A 5EDXA 3VGDA 4PTTA 5T1DH 3LKPA 4ODUB 2NY1B 3AS3A 3HB3C 4ZTOH 1C1EL 2BVQA 1MY5A 2V7HA 1WBYA 1D5MB 2XN9E 3JTTB 3JV4B 4XVJL 3TIEB 3KLHD 5D5ME 4RFNC 4IRJD 3AY4A 4Y1AD 3BXNA 1TCRA 4L4VE 4Z7WE 5GS0H 3WNOA 3SGEI 2P5ED 3RGHA 4DW2L 2O5XH 4X4MA 4ORGA 2YPVH 4OZFH 3RUGB 4MCZB 4PP1C 4ALAL 4X83A 3WBDA 1WCQA 3P30L 4NJ9H 1NUDA 3FQTB 3L6FB 4QCIA 2ATPB 1A5FH 3HMWH 4OLXL 3NFSH 3WXVH 1LDSA 4PRNB 4Y5YA 4FFZH 5AYUH 4KAQL 1ZHLA 4LHUA 4WFEE 3ARFD 4GKSA 4ORGB 3BD5A 3EAKA 5LWYL 1X3DA 2I5YL 1JNHA 1HWGB 1R5IA 4HG4K 3I02B 1RUKL 4NQDB 5DUBA 3PWUA 1S9VA 5J6HA 1BD2B 4OAWA 3H3KA 1SYSA 4HUVA 1YEJL 3A67H 3KYOB 3V5HA 2B4CL 4ONHA 1L7IL 1PY9A 1DQDL 3T09A 1SYSB 4OF5A 2CUMA 4DOHE 5IP4A 3EDJA 3MFGB 4E9LA 1JYNA 4NKOB 1P4IH 5I71B 3ZDXE 1K6QH 4L29A 4ZAKA 2ZUVA 4KKBD 3ULUD 2XKUA 4RFOL 4X6DB 3QXUA 4FNLH 3VXUB 3GB7A 5DJYA 5KOVC 5DQJA 5M94B 4XCCH 3HA0A 2CIKB 4DGYH 3BKMH 4XPTL 5I1KH 4LASL 4U3CA 1PEZA 4NUJB 3O4LE 5CD5D 3T1FA 5K9JH 4YDKL 2FWOB 4EQ3A 4OCSL 4H8WL 1S8DA 5IOPB 5EB9A 4EOWH 4LCYA 3LIZL 4NZUL 3BPCA 3SJVA 3V5KB 3L3KA 1RZFH 1OLZA 1TVBA 1U8QA 2AXFA 3HZMA 3TH2T 4HWZB 2YXMA 2ADJA 3DETD 4QXUL 1MJUL 1A14L 4Q9QH 1A64A 4L3AA 4P57B 4F7CA 1Q0XL 1F3RB 4PS4H 2JJTA 2OR9L 3MACH 2B5IC 1MAMH 1EUUA 4RSVA 4RA0C 5D72H 4NQEA 3HI6L 3UTOA 4P2RA 2VDKL 3AXLB 4NM8L 4WFHD 4OZGA 5FYJU 2O26U 5FDYA 5F9JA 1ULVA 2XPGA 1LEGB 4PRIE 4O02H 1T0MB 3G6JF 5J1TC 2FO1A 1LO3L 1NBYA 2J2ZA 4KHXL 3VRJB 1FNHA 3FMGL 4OLUL 4E0RB 3ESUF 4FQQB 3C08H 1X5IA 3LB6C 3WIIH 3IFPA 4G9FB 1NAKH 3RVTC 1U92B 3TIDA 1KJ2B 3MV9B 3MXWL 4LHQB 1UWEL 5B39B 3SDDC 3ALXA 1ZOXA 1SVCP 4YHOH 4MVBD 1BJ8A 2FX8H 3IGAB 2CO7B 2XZCH 5KVFH 4R4BA 4X7DC 3ULVD 2BVOA 4MB5A 2WWKO 5HHPB 2P42B 3GZKA 5DMKB 3RI5F 3MV7B 5JZ7C 2VITB 2PXYB 2HVJA 5J9PA 2F5BH 2WNGA 3C8HA 3ARUA 4Z7VA 3UPCA 3P9WB 4PGDB 5ESVA 4F37K 3VXNB 3PXHA 1ND0A 5GQBA 3QHTC 5DLML 4OIAA 1CD1A 4XBEH 2DQCH 4DVRH 3MRQB 3BHBA 1CZ8H 1T66D 2Y23A 3RU8H 3PQYB 4Y4HD 5KJRH 1YEHL 1KTKE 4G6JH 4MA8H 1P4BH 3O81A 3VGAC 2F15A 4ZPVB 3B5HA 4K3GA 3TZVA 5H94B 1NMCB 4G9FE 4GO6B 1AGCB 4XRCB 4HIJA 3KPRD 3DO3A 3EJJX 5EZLA 3FN0H 4PJ9B 2BVYA 4NOBA 1CGWA 1DLFH 2NNAA 1RUQL 3GMPB 4UINH 1JIBA 1IGIH 1RULH 4GBXB 1EFXB 2XWJA 3N0PB 1RZJC 3I2CL 3MLSH 4I4WA 4RGOH 5I66A 3QB7C 3IFOB 1CE1H 4GQ9H 4PP1D 4JVWA 4IRSA 3RWDA 5DK0B 5E08H 1YYLH 4NQED 2CK0L 1NEUA 4WHCA 4ONHB 1C1EH 4LCUB 4MQSB 4P2RD 2EE9A 4F7PA 1U8LB 5C70A 1IC7H 2X6MA 1Q9OB 4KTEH 3M8OL 3I02A 4QXGL 1WISA 2IANE 4NKQB 1DN0B 1IAMA 3IDIB 1JWSA 4KK9D 2ITCA 2N4IA 3JWDC 4KMTL 3QXWA 1IGCH 3UTSB 2E8ZA 5D7KD 1AIFB 4ISVB 5FFLA 1KC5H 5CKGA 4ZDHA 1UJ3B 1YNTB 1A1OA 2EIZB 4XB7A 4XMLL 1RFDL 1NCCL 3IU3B 3ZDYF 2DQCL 1UM4H 3ZYOA 4DVRL 3N1QC 2MQCA 3VXPA 1EEQA 3CZFA 3SE8H 3P4NA 4PY8J 5D5MA 1CDGA 4XAWH 2EDYA 5D1QC 3PP4L 4YHMH 4KAQH 3S37H 5I8KL 4AJ0A 4BQBA 5DEFA 2ZOKB 3EKCA 3B43A 3BD3A 5CIPA 3K2UL 1MHPL 2B7DT 3CCHB 4NN5B 2FX8L 4WO4A 2F19H 5IEKA 4EXKA 1CGUA 4JM2A 5T1MA 3X3FH 3GO1H 4HK3N 5IWLC 1A3LL 2NY0D 1T04A 3O11A 3ULUH 3SKNA 4JB9L 4J6RL 1OAZH 4PG2C 2C3WA 1ZSDB 2Y07H 3UJTL 3WN5B 3PHOB 3BRFA 3E8UL 5FDWA 1JYWA 2Z93B 3M17B 3DTXB 5I8EB 5I1AB 3BPNB 3O3DB 5LAXB 3KPQA 4XWOC 3PV6A 1CXIA 3GMMA 1R3LB 5E2VL 1T1XA 4XAWL 5CZXC 4BK4A 4KKCC 3CXHJ 1A6TA 2DN7A 5FOBA 5EG6C 3V4UL 2ILLA 5FUCE 1MFDL 1N0XH 2VLLA 4TTDD 4MX7B 2MCPH 3PF2A 5D8JL 2HYMA 4ZUWB 5CEYA 1QKZL 1FL5B 1U6AH 3DRTB 4ZQKA 5AWNH 3C60C 3UTTD 2FX9L 2Q1EA 4H5SA 3DURA 3V7MA 2P46B 4UQ2A 1PSKL 3O0RH 5TDNB 3BVNB 3G6AB 4S1DD 1K4DB 1MUJB 1X44A 2EDXA 2OP4H 5KTEL 2ZZUT 3IFLH 4RA3A 3UROR 3D85A 3P9LA 3G5VB 3IDJA 1TXKA 3GMRB 5JORB 4I3SL 3ZKSD 2F9BT 4P5TB 2DKUA 4NCC2 1LK2B 4JM4L 4GW4B 3UTPD 3SKJH 3OKLB 4XVUD 4R96A 3KLDA 3CSGA 2LABA 2DQDL 1XCTB 4NRXA 4DJMA 4QOKA 2BFVL 1JPGB 1MVUB 5DFVC 4L4TE 5SV3A 3PGFL 3TWCL 1QSFD 3K46A 4KMTH 2Z92A 4N5EC 3O4OB 1IM3B 5FOBB 2FIKA 3NA9L 4G3YH 4KXZH 2G75A 1AXTL 1RJZA 3RKDD 1NC2A 2BY1A 5KAQF 1YMMD 3ARBB 4M5ZL 4Y4KD 3BSZL 1IL1B 1NC2B 1PKQE 3WFDL 1DZBA 4M4PA 3N1FC 1I7UA 5JIKA 3TCLB 1U8JB 2HKFL 4NHUA 3S3SA 4JQVA 1B88A 2XFXB 1FGNL 1FNGA 1WIUA 4OLZL 3QG7H 3HR5A 4PJGE 2PF6A 4KHTL 2Z31C 2J8UA 4WHTA 1REIA 4M4RA 1QRNE 1QO3A 1MRCL 5FF6A 5DT1H 3LVEA 4XWGH 5DJCA 1Q9KB 2NY0B 3BH9A 2V7NA 1FZOB 4KK6C 4H1LH 1A7PH 4IMLB 3MA7A 1B0WA 4QHLA 2AJVL 4C55A 1LK2A 2X2YA 5FA3B 4HBQA 5KSBA 4MZ3A 4RFNB 5GIRB 5SWZB 4P5TA 5SV4A 3H2WA 1S9KC 3ULUL 2XZCL 5D5MB 2R1WA 3LPFA 4PJEF 3SKMA 1ZVSA 3F7YB 1VFBA 5ACMA 2V5MA 1B0RB 5EOQL 2B1HH 4PJ8A 1F97A 4JFED 3CSYB 3MLTB 3SKJL 4BFIA 4QGYA 3U1SL 4JEGB 4OQTH 1CK0H 3MV8A 3K81A 1EO7A 5E2UH 2C1PA 4NPYB 4DOHB 4L9DA 3QI9D 3DURB 1ZTXL 4U2ZA 5C0DA 4CVZA 2ZSWB 3IDNA 3OKMA 4HUUA 2B4CC 1C16A 3CC5A 1RIVL 3FRPA 3BP5A 5JUEH 1YY9C 2CXKA 12E8H 4FXGA 3FFDA 4NFCA 3EYQD 4XCNB 1Q94B 3PQYD 4Y4HB 5SX4I 4J1UB 4ODHL 1I8MB 3WDJA 4F7MB 3U9UB 4Y5XA 1IC4H 2Q7YA 3RVVC 1FC2D 1LE5B 3GIZH 1NCDH 3C8KA 3MGAA 1S7XA 4JQVC 4WUKH 4XCFL 3T0XA 1WIPA 3MQIA 2J8UB 1GPOL 4WFFD 5IMMB 2ICWB 5F7HA 3W11C 4WO4D 4OT1L 3AU1B 1TETL 4FQHB 4RGNC 2A83A 3G5XA 2XZQL 2VITA 3V4PL 4L5FH 4UAOC 4AL8H 1EGJA 5E08L 1I9JH 3DVNA 4R4BB 3VFRA 1I1FB 4QEGA 1JUFA 4J3VA 2SEBA 4PJXE 3S35H 1LILA 3MPCA 3QEQE 1BFVH 1P84J 2M8XA 1AGFB 1R3LA 4FFVC 4PJCA 4G80A 3HAEG 2YPLD 1FFRA 2BNUA 3HNSL 5C2UB 3SGJC 2QQQA 5J1AA 1ZEAL 2X4QA 1K2DB 1FCGA 4I77L 5CJXC 4FNLL 5CSBA 1A7QH 3V6FB 2X9WA 4PR5A 5D1XB 4MA3A 3H3PH 3LMJH 2RIKA 3CSPA 3D87B 4OJFH 5BOPA 3WFHB 4OZIF 4I9WD 4CW1B 4NNXB 1AHWC 4NZUH 3P4OA 4WWKC 3SY0B 3NMEA 3P9LB 5DJ8A 4UNTA 4JDVB 3GSXA 4KROC 4A6YL 5IT2H 1W72A 3C8KB 1AI1L 1BQUA 1FN4A 3UYRL 1FFOA 3IFNH 5FV2A 3D1MC 4K8RD 4HWBH 5H8DA 5GRVK 2AJYL 3IJSB 3T4YA 1QVOB 1YYMH 2VZOA 4PV8A 1G7IA 4JFHD 5DMIH 4EBQH 5TPWH 1UKTA 3L3HA 3TBSB 1H8SA 1FZMB 2NW3B 1HH9A 4AG4H 3C6LC 4NO2B 3GSUA 2YMXH 2IFFL 4P48A 4JE4B 1G9EA 2X4TA 2IG2L 3FOLA 5I2IA 3CFIC 3LQAH 2PYEB 1Q72H 4YWGH 2Q3ZA 5C0GA 1CBVH 5KAQG 3GMLB 5FUOH 1FL6A 3D3VE 1UQSA 1Y6NR 1NPUA 5CGYD 3T08A 3CDYA 2PCPA 3U79A 4P49A 4G6AC 5TDOB 3DRQA 5T5NG 1PQZA 1C5BH 5DD0H 1X5XA 5DQJB 3ZYIA 4CJ0A 2ZUXA 2OSLB 4FOMA 5C6WH 3MMEB 5JW4R 1CGTA 1EZVX 3ZTJG 1AGDB 2CR6A 2ED8A 4HK0B 3SGDH 4YHLL 3REVA 1T0NA 3W0WA 4S1RH 1CICA 5A1AA 4I4WB 4PGDA 4LRIC 4YWGL 4FS0A 1KCKA 2HN7B 5FA4A 1PYWA 1A7NL 1OAUH 5INDA 4QRQA 5HYQA 2D7TH 3K7UA 2Q7NA 1IC1A 3FT2A 3CH8A 3VFUB 4ONFL 5LBSH 2PXYA 2YBRA 1VHPA 3OTTA 4Q7DA 3RPIB 3P4MA 4XPBH 4TTDC 4JG1H 3R8QA 5EPMA 1LP9F 3QDJD 1I1AC 4EBQL 1S9WA 4IDJH 4JFEA 1V7NL 3TESA 3F7QA 2IPTL 3EOYG 3HS0B 4YZFF 4DGYL 4MCYA 1XZ0B 1E27B 3PGDA 2VISB 2N1KA 1CFBA 3FONA 3O2DA 5E6IB 4ZUTB 4J2XA 5IJKA 1YEEL 1UXSB 5E9DD 5DJ2B 4MA7L 3NZ8B 4JHAL 4L29B 4K3JL 2QQLH 2IALB 4JFXB 1FDLH 1JRHI 3P73B 4OCLC 3I3DA 5CWSA 2NR6C 2PO6D 1N3NB 3RWJA 3HE7A 4X7TA 4DVBB 3QI9C 4RWYH 5AZ2H 2A6JB 4Y5VC 2BSSA 4LSUH 3FB8B 2BHZA 3GSRB 3TVMA 4GMSH 4M7ZB 2ZCHL 4BQ9A 3KPSA 4PJBB 4C83A 3P11L 2DQJH 4HW6A 3TNNA 3RVWD 1RZ7L 1TCMA 4X9IA 1FFPA 4V2CB 3D39D 2DMCA 4U1NA 5IT2L 1SJVA 3UTQA 2EYRB 4LMQE 5KOMC 4D9RD 4GAGL 4OZFB 4MQ7B 3QXVA 3CFDA 4K9EC 3SE9L 2AK4B 3JV5A 2DQTL 4JPIB 1FL5A 1K8DA 2F54D 4YHKL 1FZMA 4HGWA 3T4AB 4DCQB 4UT7L 1K5NA 4X99A 1I1AA 2D7MA 1LO4H 2OL3H 4Z5RB 1A5FL 1VADA 4WJ5B 1QP1A 1I8KB 1IBGL 4G6KH 3U0TB 2MQ3A 4PB9H 2UWEB 3ARVA 4NRZA 4JHBA 2MPAH 3BE1L 3HE6C 5EUOE 1TNNA 1YC7A 2X4SA 4RZCA 4N68A 5GRYA 5C3LD 3LPWA 3HN3A 4NN6C 4KUCD 5F7DB 4PJHF 3C09B 2LU4A 4GAGH 3CX5J 3HE7C 4G9FD 5EU4A 2W0LA 1N4XH 1T89A 3EO0A 3QXDA 5HVFB 3UEZA 1YDPA 2OZ4L 1KCRH 1T7YA 4O2FB 3LH2L 4M93B 3OAYK 3GBML 1AP2B 4KI5E 2X7LB 4D0BB 2YPLE 4GBXC 2GJ6D 3MRKA 3KXFD 1ZVHA 2NCMA 1IRAY 1VGEH 3TFKD 4U0RB 3RTQB 5K9JL 5C0JA 2KZWA 4WWKD 1N8ZA 2VXUH 1KCUH 4NQDA 1A6WL 2GSGB 5AD0B 2FLRT 4NN5C 4O4YL 3IFPB 3Q3GB 2NY4B 1MHPH 3RBSA 5MHSD 4P9HC 4JPIA 3QIUC 4FA8A 1NFDB 2Y7QA 4XVSL 3CVIL 1YMMB 5HGDA 2MQ0A 3EZJB 4OCSH 2CIIA 2WUBH 2G2RA 4Q6IB 1M6OB 3TT3L 2EDQA 2WP3O 5IEKB 1CG9B 2R0KL 4F9LC 4KMQA 1FZKB 4KK5D 4Q9RH 4HXBH 5HY9A 2QSCH 1KB5H 4S10A 3MNWB 2FO4B 3NA4A 3WLBA 5J56B 1KN4H 3QUZB 1RUMH 5DJDA 3KPMA 3OGOE 5ENWB 5DC4B 4LF3A 5IIEA 1H3PH 2YN5A 1JTTA 4NQEE 5MEPA 1BPVA 3EDDA 1D5MA 1T1ZA 3JV4A 5DI8A 3MA9H 1J1XH 3QDHA 4FHBD 5MEPB 4PJFF 1P5VA 3NVQA 3KPPB 4ENEC 5E03A 1WF5A 5HI3D 5IB2A 3CZFB 3HZYA 4RBPH 1ORQB 4P5KA 3KS0J 3VXPB 1QBLL 4TUKL 1ZEAH 1FO0A 1OAYH 1YEIL 3L95A 4LSSL 4U6XB 5KVGH 3UPRA 4NPYA 2X70A 2D4DA 4TNWK 5FCUH 1H0DB 2P45B 1WBZB 3F6IA 2NY5H 4DZ8B 2DM3A 3L7FA 1XCQA 5DRWB 4D0CB 25C8H 1RUAL 1JPFB 2J6EA 4PRHD 2XNAB 4H8WC 5L2KB 2DYPB 3B2VH 1N6VA 2BRQA 5HI4D 5F88A 1L0QA 2C7UA 2PTUA 2ITCB 1JFQH 1U8KA 4BH7B 4Q97A 4D9QE 5HYJE 4PBWD 1NCCH 3VWKD 4EI6A 4GKNA 5DD5L 1PG7X 4LKCB 1U8PB 1VKXB 1AXTH 3QIBC 4NKMB 4O2CB 4MXWH 4PV9A 3U7WL 4PBXA 1JCKA 2BVPA 1CYGA 1LDPL 4PJ8D 3OAZH 2XFXA 1WZ1H 5DWUH 1ORSB 3QISA 1BZ9A 1ZT1B 3C09C 1NCTA 1VFMA 2OSLA 1IT9L 1BZQK 1QSVA 4I18B 1C08B 3PWUB 4GRWF 5MENB 1Z9SA 3DI2B 4JFPA 3S4SB 1KIQA 1H3XA 3QP3A 2HJLB 2A1WH 5I8OL 1IZKA 2AV7B 4GQPH 4U6YB 1V7NH 3DGGA 1AHWB 4JREC 4O51A 5JMOC 4PGCA 4UILH 3L6FA 5FYKD 5IVXE 1CFTB 1X5ZA 4HIXH 4ETQB 3ZE2E 1NCUA 2DD8L 1BF8A 1G0XA 4JJ5B 3SGKA 2Y9RT 4C4KO 5CBAA 5DD1H 4CAGA 3S97C 5EOQH 4WI5A 4JKPL 3CSBA 1OAQL 2X09A 1QFWH 3WS3B 1T7VA 1QKZH 3O2VH 3IJHA 4G8IA 4PJDF 3OKNA 5A16B 3UBXI 4OUUA 1E6OL 3S8WA 4Z8FL 2BMKB 1XGYL 3G6DL 5JOPD 2UY6A 3V4UH 1OTUC 3H6JA 1CFQB 2Y5EA 1DEEA 1MFEL 3VXQB 3ZLQC 3OJDA 3CDCA 1R3IL 3SOBL 3D0VB 1M7XA 5F1KC 1ORSA 2NY1C 4ZUUB 1X5GA 4XCEA 4CMHC 4L4VD 3SDXB 4YJZL 2IBGA 1PDKA 3WDIA 4H26B 1U93B 4EEEA 1RFDH 1PVHA 3OV6A 1F02I 4I2XE 1NFDE 3L5XH 4PRHA 4QHNB 5TFSH 3BEWB 1RVFH 3IYLW 4HWEL 1HE7A 1RK1A 4YDJB 35C8H 3BDBA 3DGGB 3QHFL 2KKQA 3BEWA 1HSAA 3QQ4B 5DVKA 5I1LA 2VQTA 2EXYC 4NUJA 3FO2A 3R06A 1S7VB 5E8EB 4DQOH 5L2KA 3S36H 5JQ6L 1ZA3B 4LLAA 5BV7B 3KJ6H 5T1DL 5D9SB 2VLKE 2A83B 4CN1A 1ES0B 2IGFL 5FGSA 3I6GB 4P57A 4WW2C 5F21B 2NY6B 2CQVA 2IAND 1FJ1B 3KPNB 5HPMB 5LXGH 1PJ9A 3P4LA 1MFDH 2J1KA 1GH7A 2HKHH 1FG2B 2YS4A 1EBAA 25C8L 3RWFA 3OKNB 5EBMB 3BMVA 1Y6KR 4W81A 1F3JB 2VLRD 4X7FC 2GSIA 1QPXA 3MJ9A 2D03H 4OAWB 5L88L 5LJYH 2A9MH 4LLMB 1KBGL 4JRYB 5FGCE 3BD4A 4AT6A 3Q5YA 4FFWD 4IRJC 1G0YR 4X6CF 3ESVF 3NZ8A 5GZOD 1T83A 4DUVA 5D1XC 4OV6F 1MCKA 4BSVB 2PETA 5CMAA 5I1HL 2KBGA 1J05A 2R8SL 1MRDL 1UZ6E 4NZDA 1CE6B 1X5KA 4PG9B 4PJFA 1TVHA 5FB8B 3ARRA 5GZNC 1XGPB 5MHSE 1OW0C 2HG5B 3P3YA 5D7JC 5HVWA 2DKSA 5C07A 2I07A 3TT3H 2VLKB 4BKLA 2A6JA 3WXVL 4CNIB 3OSKA 3O6FB 5JHDB 3MNZA 5INDB 3QUML 2I07B 2DBLL 1UM4L 4BJLA 5J6HB 4HUWA 1NMAL 2MMXA 1Q8MA 3GBNL 3WHE1 4ZPTB 1DANT 4NN7B 3S6CA 5IQ9A 3VA2C 4JPVH 4ZUTA 1RHHB 2YKLL 2VN4A 4Y2DD 4NQCB 1MCSA 1F4WH 4KJYB 3DXAB 3L3JA 2Q8BL 1X6NA 3KDMA 1FIGH 3MUHL 3QAZC 5GRJL 5TF1L 1QFWL 1E4XI 4Q9RL 5FGCB 4Z76A 2R2EA 4KDTA 2B8OT 4PPTA 1Q9LB 1LO0L 3FQWB 4ZD3L 2AERT 3K8MA 2APXA 1BIIA 2JKXA 2VZVA 2E5EA 1FVDA 2OBGA 1RZKL 2WUCL 3GBLA 3RWHB 2DLFH 1XGUB 4CMMB 4YHNA 5C0CD 2QADC 1LWRA 4IRJB 1DQLH 4S1RL 5IFJB 1FJ1A 5HPMA 1AGBA 4HCRL 4FQ1L 4TSAL 4Y19A 1G7MA 4IDLA 1C5DB 4O58H 4GUPB 4U1JA 5DUPH 1CXHA 4TPRL 3P9MA 4OCYH 3HMXL 4UINL 4ENED 3AREA 5I1CL 3MZGB 2ARWA 1ZGLB 2WIMA 5FYLE 4I2XB 1PLGL 1MEXH 1YECH 3KS0H 1CE1L 1FG9C 1MRFL 5FHAH 1FE8H 3UTSD 1PX3A 1QOKA 3QHZL 4H25B 4WRLA 3HI6H 4QHMB 2GJ6B 3WL9B 1JGVH 1BM3L 3MOBL 5EO1A 3T04D 2FL5A 3G5ZA 3GRWA 2EDTA 1HZHH 5GS1C 1I3RA 1OTUD 4U1HB 2APVA 4HUUB 1KPUB 4PRDA 4Q9CA 1TJHL 1I9RH 3L7EA 4W4OC 2BERA 3DROA 3RJDA 3RVTD 4F57H 2VXTH 3I84A 4JZJC 3IJSA 4KH2A 3T4YB 1RJLB 4RMRA 2XPGB 5CZKA 2VLMD 3L3DB 4FQJL 2RCSH 5EA0L 4UDTA 4WEBL 3TV3L 4N9OB 2R8SH 1MCJA 2E7HA 4P3DB 1EIBA 2N56A 3VXSA 3P77A 4LPYA 4NO0A 1DQDH 5GSVA 3IVKB 1PD6A 3OZ9L 3AB0B 2DLEA 2B0SL 43CAA 1K8IB 1MLBA 4PRHE 3QG6B 5IG7B 4U1SA 2X4SB 3LQMA 1GGYA 2IANA 3QQNA 2GTWA 1FYHB 4DKEL 3MROA 3WHXB 3EDKA 4MXQC 1MCNA 3QRFM 3VFVA 4P23B 1M7IA 5SWZD 1EH9A 4LCYB 2HTKD 2CJUH 4YIQB 3JWOL 3D3VA 4QHKJ 5F9DC 1N6UA 2D2OA 4OSUH 4YH6A 3RA7L 3G5YA 4UT6H 4ZOBA 1YNLL 2XQYK 4PJDE 1N5YL 2ZCKL 4MJIA 3GIVB 4YO0A 2VLRA 3LRSA 3CMGA 3H3BC 4MS8D 2GFBA 5EZJA 1IGMH 1O7SA 3D39A 4WI9A 3BUYB 4HXAL 3C60B 1YZZA 3TJEH 3GHBH 1KJMA 2DQUH 4PV9B 5C0RH 1NJ9A 4YHPB 2H9GB 4XPGH 3VFOB 4EVNA 5TGBA 3RZCA 1AR2A 4YBQC 4K94L 3EOTH 3O9WB 5GRXG 5HHOE 3TBWA 5IB3A 4QHLB 4LRNH 4RX4A 3RL2B 5FO9B 2GTZB 5DJDB 3OAYH 2NY1D 4IRZH 5L2KE 3W11D 2YA1A 5FF6B 3QEGH 4GKSB 4X80H 4MYWB 3EDEA 4OLVH 2DYPA 1A3QA 2FECL 1ZANH 5D7JD 4U3HA 2DTSA 3LKOA 2HFGH 3QUKB 1DSFL 1XZ0A 2P8LA 4CVXB 4Z7UB 4EQ2A 3TBYB 2CLVB 4GRWH 3QDMD 1FZJA 4EN3C 1G6RA 1MCBA 4L9LB 4XCCL 5C09B 2VQ1A 5J1AB 3MJ6A 1PG7H 4R7DB 3V52L 1KB5L 5CLTA 2XN9A 5DTFB 1FYTB 2CPCA 3T0AA 2HJKA 4LKXB 4WV1C 5DI8B 3QRGL 2VDNL 3QDGA 2RHEA 4XVTL 3KPMB 2E7CA 1A9EB 3DGCR 1LEKB 3FB5B 4K3EL 4HFWB 1F4YH 1FVCB 1HHHA 4OLWL 4PGBB 1HHKB 1S7RB 4QHMA 5B38G 3ARXA 1NH6A 2VDQH 4K7FA 4RNRA 4WUUB 5D7IF 1JTOA 1UJTA 3SCMC 5GS0L 1CGSL 4M6OH 5IB1A 2EC9U 4LBEB 4IIQB 2V2TA 3KPRA 4DGVL 5JA8B 2HFTA 4NRZB 4FQJH 1NCWH 1IGIL 1WEJL 1CF8L 1YJDH 4WFFE 4U1JB 5E8NA 4XC1H 3SBWC 1BECA 3ULVE 3RNKB 4ODTL 5C08E 1IJ9A 4HKXA 5DHYA 1RK0B 5FXCH 2Y5TB 4JO4H 4Y4FD 5JW5A 1VFOA 3P4NB 4D9LH 3PQYE 5K33A 2MNUA 4GG6A 2AJSH 1CS6A 1XF3B 2KQMA 3WFZA 1J7VR 5E99L 2E27H 3O3EB 2AGJL 3ZTNL 3GJEB 3OR7B 5SWQA 2UV3A 3OF6A 4M6NL 1P1ZB 3BZ4B 2A73A 4FQ1H 5F89A 1TTUA 1N6QH 3G04B 4YFLI 5EH1A 1IGFH 2ATKA 3TNMA 4CN4A 4S1DC 4JDVA 3HMXH 1F11A 1E6JL 1XGTA 4UV7L 1JK8B 3HFML 1P2CB 5CINH 3IDYC 4GMSL 3ULUF 1ZSDA 4V1DA 2ZCKH 1GZPB 3MBXL 1XIWB 2NTFA 3AC0A 5CZVL 3D85D 4HPYH 1CDHA 1L9NA 1Q9KA 5ADPH 4YQXH 1IGML 3FQUA 2IH1A 3CX2A 1CFVL 1G1CA 1PG7W 4IMKA 2OL3A 2DTML 3VWJC 4AEFA 5E8OB 3TT1L 4ZTPL 5ECJE 3U4AA 1VESA 3L1OH 4AY0A 4PREB 5FGRA 2VLKA 2APBA 3IXTB 1EERB 2OJEB 4CVUA 1T1XB 1K3IA 3I6LE 4LEXH 4N5ED 3SO3C 1S7TA 3CZJA 3DVNB 5F3BA 4MJIB 5KSAD 1T6VN 4P59H 4JAMB 2R2BB 5HGHA 5HHQB 1Q1JH 3WO3B 3TN0D 1YEFL 1ZVSB 3F7YA 1MF2L 5CEZH 1I9RL 4XNUH 2NLJA 3QUMH 4UU9B 3QZWG 2CK2A 1A1OB 5CJXA 4XNZC 1UH2A 1L0YA 1INEH 1M7DA 2DLGA 1N3NA 1R5VB 5DRNB 3MRJA 3WFCH 5L8KB 3SKOB 3ZHKA 2KL6A 5GS0C 5FM5M 1FFNA 5CJ5A 1QSFE 1KTLB 4AT6B 4NKIH 4OF7A 3EDFA 4KJWD 4U6VH 1BEYL 1MIEH 1U3JA 1FNSL 2I60H 2H32H 4ONFH 1E4WL 2YD8A 5B4MC 1ZVYA 4F3FA 2XI9A 3CFJA 5EA0H 5JPNB 1I7UB 4AQOA 2HJFA 5GGRY 1FYTA 5DUBB 3QXAB 4MXVE 4BQ6A 4JGMA 5JOFA 2C5DC 3VFWA 5I0DA 4XMKH 3RWCA 4OZIE 2WANA 3A6CH 1YQ2A 5I74C 2WQRA 3BPLC 2VAJA 2J6EH 4OLYH 5LCVH 5BQ7B 3HC4H 4NKDB 3I6GA 2H2PD 3RY6C 4CKVX 4D2NA 3E3QE 1I1YB 4PJ8B 4YX2H 5L2KD 4BK5A 1WWCA 4QRRB 5C08B 3ME0A 2O5ZL 2IADA 4PJEB 2XWTB 5C0RL 1JVKA 1QYGH 2FL5B 3G5ZB 6CGTA 5HJ3B 3T8XA 3I75B 2R0LH 1B4RA 2QV2A 5ACZB 1WT5C 5C0EB 1FYTE 1V3MA 2FB4H 4FFWC 4RRPA 3DX7B 3NFNB 4TQEL 4Q6YA 4PP2A 5EBMA 1AR1C 3GSXB 4H26A 1NJ9B 3SO3B 4C59B 4N8PA 1QSFA 3HE7D 5LCVL 4KFZC 4MXQD 1FNGB 2J8OA 4YK4C 4CW1A 4HC1A 1VGKB 2WINB 3MLRH 1NGPH 1JZ7A 1OTTC 3O8XC 4WDIA 3R4DA 1NC2D 1DQJA 1WFTA 4XNZB 3GJEA 1IL1A 2LAGB 3VFNA 3WS6A 1FNSH 2I60L 3FN0L 4DZBA 2VE6A 2UVFA 4TSBL 2HKFH 2GCYB 3MBEA 2ZKHL 5KSUA 2BXYA 2EE2A 2R1XA 2VLRE 3BUTA 2ZJSL 5HGGS 1CT8B 2NY6C 1N7MH 3LEXB 4QOKD 2HT4D 1SHMA 2ZPKH 5E8OA 1CT8A 4PJ9C 4M7JH 5HDQL 4GSDH 1G9ML 4FP8H 2AJUH 5C07D 4KRLB 3L5JA 3JSSA 5J6GA 3BYYA 3OG4B 4X6BB 2Y36H 3KXFB 1KYOK 1Q1JL 4JFDA 3EYOB 3EYQC 3QDMB 4KHTH 5BZWB 2NMSA 1AIFA 3Q6GH 1QLEL 4AK1A 2AQ3A 1FVEA 4QNPF 1F11B 4HFWA 2A6IB 3KJ4C 3NZHH 3IDIA 3OF6D 1KPRA 4UDTB 5BZDA 3FO9B 1AGFA 1FYTD 3MGOB 3K0WA 3QDGB 2P24A 5MEQB 3TA3C 4CRPA 5IHZA 4NUGL 4GXUN 1FBIH 1BVLB 5DC0A 4L8BA 3AGVA 2DQIL 3D25A 1KNOA 4CADA 5E8DH 3GJFA 1U92A 3TIDB 4MD4A 1YA5A 5SWZE 5EC1B 5B8CC 4GMTH 1J8KA 1N59A 2P8PB 3RX5A 2WSKA 2HWZH 1U91A 3IU4L 2KZ1B 2RB8A 1OSPL 1ZE3C 2R1YA 3QUKA 4Y8AA 3RWIB 4W6WB 4YR6A 4Z7VE 1XF2A 3VJ6A 1A7RL 5HD8D 1B0RA 5GISL 4G43B 3VXSE 1JF6A 3VE0B 1XF4A 1AQKH 4I3GA 5TE6L 3SDYH 2FGWH 1W8NA 3Q5OA 2CDGA 1YMME 4RISH 2NY5L 1NSNH 4TVPD 3CH1B 4JRXE 5CCKL 1IAII 5DJYB 2VR5A 4Z7WA 1MCDA 1ZWIA 1HXYB 1JMXA 3DUUB 4M1GH 1TZHA 5CZVH 5IM7B 3GNML 5I73B 1LVEA 5FKPA 3QFJE 4JDZA 4FQCH 4I3RL 1GGUA 4XNXH 1H5BC 5BMFH 1V7ML 2EO1A 5CUSL 3ELAT 4ZUVA 4ZNEA 5I19H 1DVFA 3FQNA 4G7YL 1S8DB 2AJVH 4ZO9A 1A1NA 3NZHL 5F7WC 1A7BA 5TQ2L 4PD4J 3FFCB 3TBTB 2MFNA 4WTXA 5C0FB 4U1KB 4P59L 4BH8A 4HZAA 3ARGB 4Q9BA 1XAUA 3RZCD 1BQHG 2B2XH 2NY3D 2IBBA 4YPGA 2YD1A 3IS0X 4F2MB 4APQA 2ZUQC 3JUZA 4NO5B 1N59B 3FO0L 1EMTH 4YE4L 1HQ4B 3UTSA 4NO0D 1TJGH 5BS0A 4P9MH 3LDBC 1S7SA 3PDOA 2I24N 1MCIA 4ZYKA 5E70A 2E7LC 2ZUYA 1ETZA 2L4OA 4ZUUA 1UADC 3NCJL 1JZ6A 4F7PB 5I0ZA 2NY2D 4MQXC 3O4LD 4BKLB 4NQXB 1JWMB 3EHBC 5DUML 4KRNA 5J3HC 4P3CL 5EOCH 4R90L 5TGBB 4LOUD 2AXGB 1UWGL 3BO8B 5E6ZA 5EN2B 2IBZY 3WIFA 3CLFL 1HXMA 1G7HB 2XTJE 4IS6A 2CKBA 3G04A 3TZVC 1GJIA 4I0PC 1QEWA 4UNVA 2YEZB 5KTEH 2H6PB 3D39B 2MKWA 1HI6B 5F7EL 3KPSD 4R7NB 2Z92B 1IGTA 4K55A 4HIXL 4H5SB 3G08B 2AK4D 2G5BA 1AR1D 1CXFA 5JNYB 1NC4A 3TPUA 5DEGA 4FQQA 3SJVB 1OTSC 3V5KA 3WUWG 2ZOLB 4H0IA 1INQB 4W4NA 2CMRL 3D48R 4GRLC 4E41A 2HAZA 1FL3B 3PHSA 2FWOA 3BEVB 3PV7A 3I50H 3CLFH 1D6VH 3T3MF 4JCMA 4O2FA 3DTXA 3LDBB 2VXQL 2NY6D 4MSWB 4S2SA 5DRZA 1JBJA 1F45A 1K4DA 2FHBA 3CVHL 4FXKB 2E9IA 5F9OH 2NZIA 4JPVL 1E0OB 3MLSL 3WFEH 1QLFB 1UACL 4NFDA 4WO4B 3TNNB 4M61A 1PKQA 5T3XE 3GSQA 4HKJA 3GM0A 1JGEB 4NNYA 3RDTC 4UOW0 1J1OH 4QWWC 3RVUC 3WLWD 3HRZB 5LQBL 3OQ3B 3MXVL 4ZS7L 2GT9A 1B3JA 1RV6X 4LHJB 1UJ3C 3PHQB 2A74B 1IAIL 2C4XA 3QRGH 2ICEA 1UGNA 2QEJA 4WU5A 3FFCD 4OZ4A 5F1NB 2P5EB 1UKQA 2XN9B 2ADIB 2YPKA 2YXFA 5FM4A 3ZKNC 4OBSA 4TULH 1JHTB 3ZT5A 5JNYA 5TQ2H 4LHUG 2AJUL 3VGBA 1LEIB 4A6YH 1HWHB 1QSZA 3MLZH 4OB5L 3QDJA 1SEQH 2ATPA 4XMLH 4WFED 5JOPE 3VRLF 1EZVY 2BDNH 4FXLA 1DBMH 1FNEB 4HFUL 4NKDA 3PNWB 3MLXH 3MLYL 5DVNA 4M62H 1FORH 4JLRA 5E5MA 2AV1A 1IGCL 1IGYB 2ZKHH 4KXZI 4HAGA 3QNZB 2HT2C 2CKBH 1QPPA 4LVNC 4CDHA 4F8TA 5DK2A 2X4NB 3WYRA 4GKZA 4I8DA 5IK3B 3DMMD 2BVQB 4LF3B 1DL7L 1P53A 1DBAH 1XGPA 1OT2A 4P99A 2JE8A 4JDZB 3DOSA 3ARFC 1U58A 4JQXC 3O8XB 4ZXBA 1F3DJ 1ZS8B 1CG9A 5C0AD 3HUJB 4S1SH 3QUXA 4PJHB 2E9BA 5JXED 3QNXB 4HWNA 2N7BA 1IKFH 2AEIT 5IMOA 2OXHA 4UTAL 4HAFA 4ISVA 3BRGC 3OWEA 1QA9A 3RI5K 1ZAGA 2O93L 3GJFK 1SEBB 5AG9A 1JWSB 2PTVA 2FJGA 3BN3B 3S4SA 2ADIA 3CXHK 7FABL 1A21A 4CJ1A 5IVXA 1N8ZB 1BFOA 1U41A 1IQDA 3L9RA 2VR9A 2EDFA 3GJFH 1QTYT 3VFSA 3STBA 4GAFB 4RGNB 5A43C 3QIWC 2V9RA 4Y16D 3BPNC 5D1ZA 5K9QG 2Z8VC 2D3VA 4Z7OE 4PLKD 3SN6N 4WW2B 4UT6L 2D9CA 2WBJA 1B0GB 3MJ7A 1L6ZA 4GJTB 1FAIL 1M4KA 3CK0H 2DQJL 3JZ7A 1QRNA 1N64H 5DEZA 5FK9B 4CUCA 5EO0B 2DQHH 3EOAB 4EI5B 3MRGA 1RHFA 3VXMB 3VE0A 4MLIA 2JELH 4XRCA 4XVSH 1G0DA 4X4ZA 4D0DA 2VDNH 5HGBA 3BEVA 5IBLD 1RMFL 1DJSA 2AAVA 3N1GC 5ADOL 2A73B 3QT2A 3JWOH 1P4IL 1F5WA 3U0PB 4DGVH 4PGZA 5DSCA 3NACL 4U6XA 1SJEA 3G6JE 4MGXA 2X4RB 4HIIB 3UPRB 2AI0L 1TQBC 1UXWA 1EMTL 2WM0A 1GOFA 4HS8H 2P1YA 5HD8C 3T3PF 2VDQL 1NMCC 4KQ4H 3PP4H 3NIGF 5BXFA 4CADB 5I16B 3FCTA 5I8CA 4EKXA 5IW1B 4KY1H 3HI5H 1AO7D 3S5LG 1N0LA 5I1DA 3CK0L 1HKLL 5F7LB 2EYRA 3QHZH 2IQAA 1ZANL 5GS2D 2Z8WC 1HKFA 1QHOA 2OTPA 5DMGD 5B3NA 3JWOC 3QIWA 3B8SA 5B38A 4IMKC 2NX5D 3GMOA 3M1BB 4R4NC 2WBKA 1CLOH 4K3DH 2V5SA 1OTSD 5INCB 2GI7A 4HDIB 4G8IB 3UBXB 4I18A 3WFHA 3B3IA 3TN0B 4H20L 2ESVA 5JXAH 1P7QD 5CILL 2ICWA 4U1MA 3HI1A 4J7RA 1KEGL 3OL2A 1P4LA 4LLYA 3KYAA 4NRYA 4MHHG 2DQEH 3FO2B 3R06B 4LIQL 1OM3L 5I74B 2FJFB 1VEOA 4IDJL 4PP2B 5DD5H 4L9LC 2OTWB 1G9MC 2E9JA 5EIIB 4AIOA 4YFEA 4BZ1L 5GSRB 4X5LA 1QFWI 4MCYB 1I1AB 3ULVH 2HJKB 5BO1H 5I75B 1TFHA 3F8UB 5IVXB 3KYNA 3I2CH 1ADQH 2G60H 2NY7L 5ABDE 4XCEB 4R26H 3NGBC 2F5AL 3TBTA 4HIEA 4LLQA 3WEXB 1WBZA 5CHNB 2IFFH 3IFLL 2KUTA 4HS8L 1DVFB 4YXKL 3QWRD 5F7DA 2HH0L 2XA8L 4EDWL 4KUZL 2ADGA 2VDPH 5KS9E 3WJJA 4NNPH 3O9WD 1OL0A 2CDFA 3LN4A 1U95B 4HJ0D 2DDQL 3UMTA 4XPTH 3X11B 2CKNA 3CFEB 2X4NA 1H3PL 1YEEH 1CU4H 2QKIA 3EO1B 3C5JA 4XTRD 3U0WL 4OCXL 1IM9A 2B4CH 3D69A 4NO3A 5DMYA 1FZOA 3AM8A 1BQSA 1YEFH 5HGAA 3QNZA 2HMIC 3MBED 4JFXA 4JRYD 5DVOA 3MNWA 4YGAB 3MRPB 2Z8SA 4WHTB 1V3KA 2A6KA 1LQSR 2QR0A 4U2YA 3MOAL 3RHWK 4L3ED 4KKCD 2BJMH 3F12B 4Q0XL 5IV2A 4PRPA 1RU9L 4O5LL 1NMBH 3U48A 2H41A 4F2MA 2HP4A 4NQVA 3MJ8B 5CSZA 3EGSB 4XZUA 4N8VA 1YMMA 1J9CT 5JO5B 2Y07L 5T1KA 4TULL 3V8OA 1ZS8A 1HSBA 2VLRB 4POZC 3EFDH 3H9YA 4KKBC 1BOYA 3ULUC 3WXWH 3V4VL 5FIEA 4OKDA 5IR1B 3O3AB 2YBRB 1HNFA 4Z7NE 3QXTA 1KCSH 2OZ4A 5CEXB 4QRQB 5CINL 4LARH 2X7LA 4NN6B 5ETUB 5C71A 2F5AH 2VXSH 4J3SA 3UXFA 1R5IB 2H32A 5ITBL 1MFEH 5HHNB 1TJIH 3IF1B 1J8HA 1P7QA 1WAAF 3DX8A 1HQ4A 4G8GB 3FONB 3GFUA 4QTHA 4L4TB 1F4AA 2IAMA 2HFFB 4JN1L 1JYXA 4AIZA 5D72L 2D7NA 4MQTB 3VGFA 1MCCA 5EIQA 1EHLH 4MAYB 4CU7A 2NYYD 4GT7A 3SKUD 2XNAA 2C4FU 2YOCA 3IXAA 3KYNB 5IBTL 5D6DC 4DEPC 2R1YB 2R4SH 5AG8A 2ZWLT 4XHJD 4E41B 4KROD 2WWMD 3NCYS 4Z7QE 1RIVH 5IB5A 1P7HL 4ZNEE 4K3HA 1EHXA 1KGCD 4WGWB 3VXOA 5BS0E 4PYHA 3ZYZA 5EU3B 1U3HC 3H9SA 5CEYB 4HZLB 1NGPL 3SGJA 4R2GC 5KG9B 1PKQB 3UYRH 2QQNL 3TVMD 1WWAX 1ZHNB 4M3KB 5TH2B 3MRFB 3WKML 3UO1L 4HF5L 2VC2L 5DYOB 1I85A 3TO4B 1SYVA 3CIQA 2YZ1A 4LCCA 4NGHH 4KKNA 4RRPG 3BWUC 4NT6B 2YMXL 1KT2A 3K1DA 5B8CA 1XGYH 2NY4D 1LE5A 1I8KA 4R8WH 1JF1A 4MVBC 1K6QL 5ISZB 1QHPA 3CMOL 3O6ML 1HHKA 4Z95L 4NZTL 5KSVA 4OFYD 3MV9E 4Y4FA 4P2OD 1E6OH 4QRSB 3AAZA 4QRRA 3I3EA 3BGAA 1RIUH 4NSKA 4B53A 2YUXA 4WV1A 3V6OA 3X3GL 4A6YA 1YY8A 3FQWA 4XCYA 2EEBA 3RY4A 4U1LA 4OZHA 3LZFL 1MJJB 3W9DA 4NZRH 3TT1H 2Q6WA 4QRUB 3WIHL 3H0TB 3WXWL 3JTSB 4JY5L 1S7QA 3KHOA 3O11B 4JZOA 4HKBB 4YQXL 4G8GA 3HC3L 4APQD 1XF1A 4PJBF 3ZMRA 3ARGC 5FECB 3OKDA 3W5NA 4LPTA 3FL7A 5L88H 1LK3H 3QZWA 3OG6B 2QTEA 3J7HA 4FFYH 5B39G 3OX8A 4J1UA 4U7SA 3MNZB 4X5XB 4N0UB 4KGJA 5F9AC 1H3TA 2IBZX 4K7PY 1ZLVK 3LEXA 1U6AL 4FZ8L 4X9BA 3O3AA 4PLOB 1KIRB 2R9HD 4MAYD 1IVLA 5HGHB 1CFSA 1GZQB 3EUUA 4J3WA 4OF6A 1CBVL 3PWLB 5SWSA 3P0YL 3LKNB 3IXTA 3H9SD 5CSZB 2DQDH 2VL5B 2IG2H 2BNRD 4JY6B 3WO4C 4GW5A 2EH8L 1U36A 5EU6A 3HUJA 1UA6L 2CRZA 1KIPA 3VXUD 4UT9H 3RVUD 3WLWC 2HH0H 3F12A 5DC9B 5FYJH 3EFFB 4NKIL 2R69L 1QLEH 1DCLA 2BRRH 3HE6B 4XH2B 1CXKA 2VR4A 4XBGB 1QR1A 1HINL 4PG2A 2X40A 2B5IB 4K7PL 4AEHL 1T4KB 3MGOA 43C9A 4YBQD 1VFUA 1QBML 3RZCB 4M1CC 1CD1B 3X14A 3HC0A 1XGTB 3A6CL 1JPTH 1OOAA 3OKDB 1R3JB 4LDEB 3IDXH 1W0WA 1TVDA 3QPQC 3GMLA 5E6IC 1S5IL 2I9LB 3MRLA 3G6DH 3VWJB 2VDOL 5IVZB 1KEMH 2X4TB 1EEUA 1RQ5A 1XH3B 3NCBB 4P2RE 4M5YL 3P4MB 4G6JL 1JRHH 2HJFB 1S7UA 1NDGB 3SDAA 2IQ9L 3B6SB 3MV8E 4HWUA 4KV5F 4M7LH 4MA7H 4LSDA 3ZSTA 1HIMH 3SDAB 1Q9WB 4N0FA 5MENE 1PG7L 3NGBB 3MBEB 4JJHA 3VFVB 3BKYH 5I6XC 2JIXB 2DL9A 2QADB 1OARL 5JHDD 4TPRH 1FVEB 1AJ7L 2YWZA 3LV3B 5D1QA 2WWMC 1HQRA 1DQTA 3IAQA 4TSAH 4MA3B 3H9HB 5C7XL 4FFZL 3QIUD 3H9ZA 4JFYA 5C9JA 1A6ZA 1P2CA 2D7QA 4LCIL 4PGBA 5J6GB 4EJ1C 2EYSA 2X4OA 2DLFL 2JIXA 3X14B 1ZT4B 1IEAB 2RQ8A 2XZZA 3TNMB 3OKOB 1CL7L 4ODHH 3BKJH 3LKSA 4RGNE 4C56E 5L2JA 3QAZB 2YSSA 3MUGA 1UH3A 4AIXA 1OGAB 1DLHB 4Y19B 1JTPA 3BZ4A 4PREA 2JCCB 4HLZG 4YXHL 2JJWA 1JUFB 1F6LL 4MNQE 3BWAA 4NM4L 4QT5A 5LKNA 2DQHL 3DMMA 1R3IH 5BVJA 4RDQG 3VCLA 2EEDA 1I1AD 5HHMD 2WV3A 3IDNB 3OKMB 4LSQL 1E4XH 5JW5B 4JM2D 2H3NB 4ZXBD 1BD2E 1PX4A 1S9XB 1LK3L 4XXDA 5AUMA 2X1XR 3LKNA 3N9GH 3RL1B 4HT1L 1MQ8A 2X05A 4N1EA 3QQ9C 5I8EA 5HDBF 5I1AA 2F8XC 3EOTL 2OQJA 3S5LB 1OCWL 2EH7L 5EO0A 1MUJA 1OPGH 3QCVL 1N0XL 5DYOA 4ODSH 1HQRB 4PJ7E 3RGVD 4NBZB 1S7RA 4PJCE 1F58L 4X6DA 4ZFZB 3MOAH 4EUPH 1LP9B 5CP3A 1KSRA 3O6KL 4PFEA 4YHPA 1ODAA 3IFOA 5FO7B 1X5JA 4C56D 4KTDL 1KIPB 3SE4A 4F58H 2Z8RA 3S35X 2Y5TA 2FH6A 3HNVH 1WCBB 1BIIB 2SEBB 2D0HA 4FMKA 3BZFB 5J12B 1HINH 2Z31D 4PJ9A 2W0FB 4ACPA 5KS9B 5LGHL 3VFPA 1FHGA 2ZCHH 1A7QL 4JHAH 5BRZD 4ZPVA 3HZKB 3S34H 4EI5D 4FABH 3PGCB 4JRXB 3L1OL 2UYLA 2PKDA 3PWPB 4WV1B 3FN9A 3RIFF 3QNXA 5AEAA 7CGTA 2ADFL 3BKCH 3QQ3A 3ZE1E 1I7RA 4QRSA 5EORH 3B9KA 1U58B 4WI6A 4XP9H 1XCTA 4WFGE 3WFEL 1B2WH 4IHOB 2FEEI 5F7MC 4MQXD 2BY3A 3N9GL 1Q9OA 5FHAL 1PGRB 1R5VA 2PTTA 2J6EL 3MODL 2DJUA 1S7QB 3QFDA 4PLNC 5JHLH 1U8MB 1KN2H 5DK2B 3W39B 4UU9A 1XF4B 4WU7B 4I0PD 3SDDD 3PUCA 5ICZB 3VXTA 3T0EA 4X80L 2ADGB 3DX6B 1A4JA 1D5XB 5FYLL 4EIGB 3IU3A 1EFXA 2XWJB 5HVGB 3V6ZA 4LAJH 2PO6C 1K3ZA 4HS3A 1KCLA 3U9PL 3V7AG 3QA3B 4OD1L 2AJSL 3GK8L 4HEPG 1FRGH 4DN3H 2H2PC 1C5BL 5IV2B 4GW1B 3QUMB 4XNQA 5KG9A 1OGAE 5KVEH 1T3FB 4GQ9L 3CXDL 4LLUA 1MCRA 3TP4A 5HHXL 2XRAH 4M03A 3RJQB 1PEWA 5A2KH 3MRHB 4X7EC 3MA7B 2CGRL 4PRIB 4PJAB 3H7LA 5LGHH 5E2VH 3O9WA 2UZIL 4EZMA 1MJ7L 2D9QB 4DUXA 4YXHH 4ZUSB 4GKOA 2JJUA 4YXLH 3R0NA 3UYOD 3W2DH 3RX8A 5EORL 5JHDE 1F6FB 1YNKL 2R0WL 1T04B 5TDNA 2EDLA 4JFDE 5IFJA 5EZLB 2UY7A 4UBDC 5AYUL 1XMWA 1NBZB 3U30C 4MAYC 5JUEL 1KN4L 1T20B 3T0EC 5CLWA 4RFOH 2P43B 1MVFA 4NQTA 1KJVB 2AEPL 3PQYA 2AJYH 5I8OH 1A6TB 4X99B 4KGLA 5EUKB 4ELMF 5KSUB 3T2NL 3TM6A 4EXPX 5H37G 1T5WB 1BJMA 1SM3L 4NRYB 1K8DB 4R2GB 2R2HA 2GJJA 1ERNA 5C2BH 4NC1E 1BQLL 3GK8H 1EAPA 3C9NA 1G7LB 5EU7E 3B3IB 3TN0A 2A0LD 2XZQH 1YN6B 4TNVK 4PGJA 5F9JB 1LP9E 4LEOA 5C0IB 4PJDA 3VRIB 1MFNA 1J8HB 3IF1A 3MV7A 3MRPA 5HSFA 3JV6B 3MRDB 2K1MA 3IDGB 1HDMA 2XXCB 1LNUA 4LGPB 1CL7H 4MD0B 5IKCB 3S35L 4NQXA 5J11C 4K23L 5TDPA 1ADQL 2ERJB 2V2WA 4FQXD 2IJ0C 3LKRA 5BCAA 4I0PB 1I9JL 1T83C 5E5UB 1OAXL 4IOSD 3BKJL 5DJ2A 1QACA 3DXAE 1J86A 4U31A 1CFTA 4H25A 4Y5VB 3WCYA 3QDJE 3O41A 1T0MA 3V6ZB 1Q0XH 2UUDK 4PS4L 1BFOB 3ROLA 5F7EH 2Z31A 4PJ9D 4RWYL 1U3HB 4HKZB 1R6VA 4OCNC 3SKMB 4HMDA 3QCTH 2Z4QA 3HZVA 1UZ8A 1JP5A 4BZ2L 2OI9B 3F7VA 1D5ZB 5AZEL 4QRRE 3FQNB 4MA1B 4WUUE 2ZG2A 4LCUA 1BIHA 1CGSH 4PJEE 4L8DB 1JPSL 5K9KB 4XAKD 1B0GA 2QSVA 3EBAA 3MJ7B 3U1SH 4AG4L 4BSWA 5E56A 3VFOA 3L3KB 5IM7A 3KPNA 1C5CL 4U1SB 1BMGA 3GSVA 3NCFB 1YPZE 2ESVE 5AZ2L 2Q6WB 4HLZH 5DJZA 15C8L 1ITBB 5F7YC 3T65B 3OXRA 5C3TA 3MFFA 3HHRB 1S7TB 5GGVH 1V7MH 1RURL 3PG2A 4WFHE 2YC1B 3HAEA 3THMH 2VXVL 5IMOB 3SQOH 4TTGA 2IPUG 3L3GB 3QDJB 3SDDA 4NQCA 5HGDB 2GAZA 4HHAB 4OFKA 5CD3B 4LQ1A 5E95B 4HMCA 2KH2B 3HLAB 4AZ8A 3QQ9D 1J0HA 5EZIL 1OB1B 5DD0L 3Q5TA 4KTYA 3BP4A 2ZG3A 5CBEB 3E8UH 43CAB 1DBKL 3V7AE 3D9AH 1A6AB 1JHLL 1URLA 2PXYD 4NP4L 1LNUB 5IHUH 4XP9L 2AGJH 5FYKE 2B39A 5DJ0A 4HKJB 5DQDL 5J3HD 5BRZB 4N8CL 4DQOL 3V95A 5E00B 5ESQA 5D71H 5F89B 3U2SB 2R0LL 1J05B 1MFCH 3IB4A 5E8DL 1YEKL 4LSTH 4S1QL 3V6FA 1J10A 4K7PH 1UCBH 4OD2B 1VFAA 1RIHL 4RZCB 4KZEL 3QUZC 4HCRA 5TE6H 3SDYL 5GZOC 4A2LA 4YAQB 1JHTA 2OZ4H 5DXWA 2BOBB 4DKDC 4Q58C 2VC2H 3U36A 1FC1A 5F1NA 2MHAA 5HYSG 3W5MA 1RK0A 1A0QH 3JTTA 3AUVA 5L2JB 3WD5H 2ZOLA 2JK5B 3WSQH 1W0VA 1Q72L 4I3SH 1IC4L 5GGTA 4AH2B 4QOKE 3LAFA 4RGND 3LS4H 2BSRA 2JB6B 1CXEA 4JFPB 3WN5A 1T80A 4OQTL 3ULSB 4QHUA 4ODXB 3VMNA 1MFCL 1CDJA 5BW7A 2JJVA 1KCSL 1NGYA 2EDJA 1ES0A 4Y2OA 2VYRE 1S5IH 1HHIA 4CL7A 2JB5L 2EDBA 3O3BA 5IBUB 3VI4E 1IMHC 2QHRH 2R29L 5DJAA 3OB8A 4ZUSA 1D7FA 2FBJH 4JN1H 1H3UA 3HZMB 3T0EE 1KPVB 2EKSB 3HC4L 2W0KA 4XPHL 3Q0HA 5HYJA 4JRYE 5GGSY 6FABH 4JB9H 4PY7A 4PJGA 4Y19E 2VABA 4YDIL 4JFFA 1JI2A 1XH3A 4CBPA 5ITFA 3PDOB 3BP5B 3ES6B 1TJHH 2AV1B 5I9QB 5LQBH 4I48B 5C0DB 1A8JH 3D18B 4MNQA 2GK0A 1CU4L 5C0BB 3NIDF 4EDXB 3U0PA 4GRWE 4YBLB 1OGTA 3P0VH 2M1KA 5C0BA 4EDXA 1AQKL 1A6UL 1T7ZA 2A9NL 1P7QB 3OAZK 3TBVA 5TE7H 1N2RA 2H2SC 2VZTA 3AXLA 4HF5H 4U1KA 3V52H 1GC1L 5GISH 3PP3H 1QZ1A 1F8TL 3GRWL 1U8NA 1NGXA 4WNQB 3KYMA 4Z77A 1NAKL 3QWRA 5T3XH 3O6FD 2COQA 1IC7L 5BW7C 3BW9B 4M3JA 2HRPL 4JO2L 1BX2B 2EEAA 2M26A 5DK0A 1U95A 2NZ9D 5T33L 1NC4D 2DS4A 1V3LA 5CSGA 2AW2A 2HVKA 5EBWB 1U8QB 3EYSH 4DFIA 5HVHC 3GHEL 5C0AB 3C5ZC 1ONQB 1IM9D 2FGWL 4WI7A 4DN3L 1GXEA 5EZIH 1M6OA 5TE4H 5D6CB 1DUYA 1NKRA 2VXSL 1DBBL 3EYVB 2P5WA 4JFEB 1PQZB 4P2QE 3W81A 3MFFB 5DGQA 1I8LC 4IOFC 1KIRA 1KV3A 4YHZL 1KFAH 2IGFH 1SY6H 5DDHA 3KGRA 4KZDH 4OLEA 3BZFA 2OJEA 4L4TD 4ZS6D 1CDIA 1R3KA 5EFIB 3O41B 3SCMB 3DV6B 4R0LB 1R24B 4FQXB 3PL6D 4YBLC 3W9EB 4YDLC 5DQ9A 3VXRB 5D2NC 1EFXD 1CZ8L 2DJSA 2VDLH 3KPLB 5FYKU 1HHJB 1NGZA 4P5KB 3IKCB 4RAUA 3ULVL 1KB9J 3SDXA 3FQUB 1KNOB 2XZAH 3EJZD 3ARPA 3O3BB 3BE1H 2R0KH 1E4KA 2ICES 4Z77B 3CLEH 1IAKA 2VB5A 4R9HA 5INCA 1H5BB 4G3YL 4G6FD 1XF5B 1MI5B 2CLRB 5HHPA 2PCPB 1ZA6A 1HZHL 1GGBL 3VRIA 5C0IA 1W0VB 4P3WA 5DS8B 4AQ1B 4WW2F 1UQSB 3MLXL 3RL1A 5IGXH 1L7TL 5AUMB 5JR1L 4L3EB 5JIIA 5DD6B 4I48A 1K5NB 4LLWB 3MCKB 4JN2B 1T5WA 3SDCA 2QQNH 5KW9L 4FQIL 4K94C 4PJCB 2X4RA 3WO4B 1MCOL 1E28A 1X4YA 4G8GD 4L4JA 2VLLB 4GRMA 3RNKA 4KVCH 1OP3H 4PJAE 5JZ7D 1D9KB 4X6FA 4LSUL 4UIKH 4Z78B 4LPWA 3AVEA 5CKAA 1GGIH 1P9MA 5DJ8B 3GSNH 1PFCA 3P9MB 5JMRA 3PWPE 1BZ7B 2ZP0T 4ESKA 4K8RL 5GGQH 1RJCA 5ANME 1VCAA 3DECA 1MWAL 1EAPB 2GQHA 3NIFE 4N90D 2JB6A 5C6TH 1OB1A 1EXUA 1MJ7H 1M71A 4LNVA 4R3SB 3W0WD 4P23D 3PABA 4P2OA 4YHKH 5EU6D 3MTRA 4WJ5A 5EO9A 5I1GH 1G7QB 3C8DA 1ZWIB 4NQDE 2ZUUA 2XRAL 1TETH 3ABZA 4G8FA 1WZLA 4OFYA 3T0WA 1P6AB 5D7LD 1J11A 4HSQA 3AS2A 4ODTH 2R1XB 4JFFD 4WW1B 4NUGH 1T7WA 2XXMB 4EIZC 3LN5A 1UM6L 2R0ZH 3EJYD 4LHUD 2MPAL 3RGVB 4K8RH 4JKPH 2FJHA 4ZFGH 4NCDA 1BJ1H 1E4WH 2EDOA 3NTCH 3MC0A 4ONGH 3UTQB 2YD5A 4HX1A 4O00A 2CKBL 4KWUA 2APWA 4H8WH 2W59A 2MKLC 4NZJA 2VLJD 1XEDA 4G5ZL 1C5CH 2HLAB 3JBG7 5ICZA 5DJ6A 2NXZD 2J88L 1RMFH 4XMPL 1GOGA 1OARH 5MEOA 2V2XB 4Z7UF 1I9EA 3RRQA 2Q7YB 4DVBA 3JV0A 4R4FH 4HJ0C 2JELL 1S3KH 1H3GA 1IAIM 3GSNA 4WEUD 3IKKA 1RURH 4HGWB 5K9OA 3QPQD 2BX5A 4HUKB 5DJXB 2WBWB 4G43A 1KLUA 1ZHLB 1F4YL 1YC8A 4I13B 4XC3L 1F13A 4OTXH 4WTZG 2C1OA 3RY6A 3L3GA 2AI0H 2HFEB 3MR9B 4MJIE 1YEJH 3A67L 4I9WE 2FEDC 4K7PX 5EU5A 5TPWL 4P2QA 3HNTL 4J8RB 4UV4L 3FMGH 4OLUH 5DHVA 2B0SH 3VFWB 5EUOB 1YYLL 1OAXH 3C5ZD 4PJGB 3RWEB 2BNRA 1U8MA 4OLXH 3W39A 3MUZ1 4FZEL 1MEXL 3S9DB 2P24B 1FNLA 5T3XD 3QEQD 1L7TH 1AH1A 4P4RB 3TFKC 1NBZA 3ZKMC 2A6IA 4XGZB 5DRNA 3MXVH 5MI0C 3DUUA 3V0VA 1YEIH 5IBTH 5GGTL 3PL6C 1YNLH 4K7FB 4W6XB 1OQXA 2J8HA 1A1MA 1KIUA 4BUGA 5KVMC 1UEYA 2YD6A 3MBEC 2Z35A 3V2AR 2P4AB 4DTGH 4JVUA 1AY1H 4AEEA 5F6IC 4D3CL 3C6SB 3ECBB 1J0YA 2VDMH 5DD3H 5DLMH 1MJUH 1FQ9C 1B2WL 4N9GB 2H3NA 2GHWB 3TA3D 1NC4B 4CU6A 3L3IB 2OL3B 5HVHB 2DI9A 1YN7B 1WZMA 4P3CH 1Q38A 1QSED 1U2HA 2VUYA 2VLJA 5IVZA 4DKEH 2DM2A 1ZLSH 5MEQA 3U2SA 3PWJB 3O6FC 4X9GA 5HDLA 2O5YL 3D0LB 3GMMB 2DIAA 2H1PH 1U8OB 1BGXH 2VTFA 4P2RB 3NIFF 4NBXB 1A6AA 4LVEA 2NX5E 4LRIA 4Q2ZB 3MRBA 3E6HA 2IPTH 3F65A 2XYCA 5GRJH 5TF1H 4OV5A 1CDYA 5D70H 3GSOB 2BSTB 2XWTA 5F9OL 1SVZA 5FM8A 3CFBB 4MD5A 2XG4A 1KJMB 2L7JA 1TVBB 3KVQA 3VGAB 1CN4A 5CD3A 5F7KC 5HBBA 1A6UH 1CDUA 3B9KD 4JHWH 5IOPA 4JGUA 3QIUB 3C6SA 3ECBA 1K85A 4JRXD 1AFVH 2DQFB 2D0GA 3GIVA 4YXKH 5IFAH 1TENA 2Q86B 3MRGB 1VACB 1VERA 1IGJB 3CDGB 4N8VG 3MV01 2EIZA 4YHIA 2NY2B 2PO6B 2DICA 4P46B 1GGIL 3SE9H 4FZEH 3NPSB 3GHEH 1VSCA 4KK6D 5IUSA 2HVKB 5EBWA 3TEUA 4WI4A 4PJFE 3CUPA 2VKXA 4G80B 5BVPL 3MNVA 4XMKL 3UC0H 2XWBA 4OCRH 5GJTH 5FUOL 3QQ3B 4BA8A 3MMEA 4ERSH 4N0YL 2DQGH 1WUNT 1DLFL 5I1KL 2CDGB 3FFDB 1WGOA 1LO2L 1UWGH 4QRUA 5ISZE 2NY5C 3MUY1 4N0UE 5EWIH 4FG6C 3WNLA 4Q9QL 2R4SL 3DV4A 3LEVH 3REWB 1N2RB 2D0FA 1U42A 1AC0A 5KJRL 3FZUC 1YEGH 2ADFH 4YEFA 3QWQB 3IFNL 2QLVB 3AU1A 1W0WB 4R90H 5C6TL 5SWSB 2P5EE 4ZXBB 4CU8A 3RIAF 1YY9D 2EIDA 2MSPA 2ZUTA 3X17A 3DV4B 2B1HL 4QXTA 4XWGL 1AQDB 5F1IB 1EAJA 2GJZB 5C0AE 1MCPL 5ITFB 2IMMA 4XMPH 2YD4A 5SWZA 4EN3B 3RVVD 4NC1C 4PV8B 4PY7B 4OF8A 1X4XA 2WIIA 3P2TA 4OZHF 4JPKL 2V7NB 5H35B 1KLGB 3FO9A 3BIKA 3QZWB 3WLBB 2LTQB 2VXVH 3BQUC 5TE7L 1C16B 3CC5B 4OI7A 1ZHBB 3H9SE 1MCLA 4P46A 4WENB 1CDCA 4D8PB 4HKBA 3WHE0 4YHOL 1MI5D 4Y1AA 4NHUB 5IHUL 3ARDC 1T7XA 7FABH 5D1QB 1JMZA 4RAHA 3OR7A 1NFDA 2Y7QB 4X6DF 5D1ZC 2VLJB 5GZND 2C4FT 2AJ3A 1KCVL 2AK1H 4XNUL 4YO0B 1I7TA 2FD6H 1HEZA 3NPSC 4HXBL 1JGVL 3MOBH 1MWAA 4OCYL 4R6UA 4KRPD 3IDMB 4LVHC 4N5UA 3N1PC 2C3VA 1WCBA 3ET9F 4Y4KB 1N5YH 3MUGB 4IRZL 4D0BA 1GSMA 5BV7C 1ZXQA 1WFOA 5E2WH 4Z7VF 2NXYD 5E9DB 1T5XB 3H42L 5GGQL 4M61B 4YAQA 2DDQH 3R0MA 1HYRC 1WZKA 4BUHA 2Z93A 3M17A 3QCTL 3OKLA 3WSQL 2W65B 2BC4A 3V9FA 2CLVA 5FYJD 2F58H 2YUWA 1GOHA 4S2SB 4XPAL 5DRZB 1X7QB 5JA9A 3LS5H 2W91A 3BJ91 3E1F1 4L5FL 4MDJB 1C12A 5C0BD 2AVGA 2UZYB 1EFQA 3G9AB 4ZS6C 4HWEH 5BV7H 1C7TA 3BIKB 4V1DD 4CMHB 4IIQC 3VXRE 2BCKB 4XWOD 1DR9A 5DD3L 1BOGB 5EBGA 3WFBH 1MQKL 3DNKA 3I75A 1I4FA 4WHYG 1S9YB 4LCWB 1FSKC 2WUCH 3P0YH 3DO7A 4WY7L 3RIAK 1RUQH 4Y4FB 2YHGA 2AJ3B 4OQ1A 2EIBA 3I3BA 1CE6A 1LDPH 5DSCB 1JF1B 2WBJC 4KJPC 2AEQL 1JGLL 4L4VB 5IMMA 4C83B 4MDIA 4MJ6A 3M45A 3C5SB 2R23A 3T2OA 1W8OA 2YZ8A 1S3KL 1KF9B 3NCCB 5HGAB 1HOCB 4KJQC 2F54B 1QBMH 4F58L 2ITDA 2BC4B 3I6LD 1Q94A 4L4TA 4Y4HA 4JFFE 3U82B 2YWYA 1WK0A 3DHMA 3OPZH 1H3WM 4JQIL 4KQ3L 4PJ7B 3EIFA 1FFNB 1FG2A 1TJGL 2ARJQ 4NKOA 3B4NA 1MCWW 5A40E 5DEFB 3VGHA 4U6VL 1NFIA 4G42B 3PWPA 4M7JL 1QBAA 1H15B 3DV6A 4ORZC 4X4XB 5IR1A 1TMCB 1EJ6A 4C56A 3P77B 3WJLA 3NH7L 4HIJB 2FB4L 4LVNB 3WD5L 3WFBL 1A1MB 4XBEL 1DQMH 4KVNH 4PJ8C 4N8VB 3DSFH 2I9LA 3B9VA 1MY7A 5T33H 5HYQB 3FQTA 32C2A 4ZTOL 1OP9A 4OZGF 1G7QA 4L8SC 3TLRA 3T77A 2GK2A 1V3JA 3BFOA 1FH5H 2XTLA 2DIBA 4HUXB 5HYIA 4P2YA 4HK0A 5KSVB 2GTZA 4OFDA 5FHBL 4BFBD 1MJ8H 2QKIB 5JHDA 1BF2A 3B2VL 2E6PA 4HUVB 3P30H 3WNKA 1HOCA 1N5AB 2FX9H 4P2QD 1CTOA 1DDHB 3TCXA 5ERWB 4M7ZC 4TVPE 3R8BB 2AJZA 5GPRA 5DMKA 5FKAA 4X6CB 5HY9B 2DM7A 3GMNA 4YR6B 4GG8A 5A16A 1OSPH 3C60A 1F90H 3KLHC 4PJ5E 4HX1B 1TJIL 3QUZD 4HD9A 2P8PA 1KLFA 4Z18A 3RP1A 3WFCL 5AWNL 3V8CA 1CCZA 1LEIA 4LIQH 3RKDC 3VD5A 4GS7C 2BK8A 1MCEA 2R15A 2ZUWA 5D71L 4MX7A 1EO5A 4YGVA 1GHFH 5EUKA 4BZ1H 1EHLL 2ED9A 5ISZA 2W9LA 1G7IB 5T1LA 3DSNA 2E27L 4OD1H 2DLTA 1EV2E 1KJVA 1CVRA 4FQCL 2MCG1 4JANA 3IXAB 2DM4A 5MEOB 3I6KB 1KBGH 3CJJA 1KEML 4KDWA 1R3HA 5IESH 3U7AA 3QJFB 4K9EH 1NLDH 1G9MH 2VL4A 3HG1B 5ICYB 4KRPC 3S98A 1EX0A 3KDMB 4KVCL 3T3ME 5DMJB 1SYVB 2IAMB 5J7CC 3MJ9H 3TJHD 3DX9A 1FLRH 1NQBA 4HDIA 2DQTH 3ETBF 1MHHA 1ZHNA 3W9DB 3RGVA 4EOWL 5D7IB 4N0CC 4FG6D 1JPSH 3QJFA 3QIWB 5JW4M 5EU3A 5T3ZH 1UCTA 3ILQD 5F3HA 4PJHE 2JJTC 1KXQE 2DLHA 3MRCB 2R0WH 4U7MA 1E6JH 3VFSB 2EXWC 5FUZL 3L7EB 2ARJB 3AB0C 1NDGA 2X10A 5DWUL 1AE6H 5T5FH 3FCTB 1ZT7A 1OWRM 3MBXH 4XVTH 5CBAB 4U1HA 2AS5M 2CR3A 4MAUL 3HLAA 1M71B 4OF0A 4LLYB 3GSOA 4QHKI 3FO1A 1B4JH 3WIIL 3FRUB 4ZAKC 4JHZA 2F54E 4I5BA 3SDDB 1IGTB 3MLWH 1H0DA 4ZO6A 4LGRB 1SMOA 5LXGL 3PE9A 5BVPH 4DW2H 3PWVA 1QYGL 5L7XL 5FYLH 4JDTL 1X5YA 4M43L 4TVPH 2E7BA 3GBMH 5DJ0B 4LSQH 1KC5L 5HHOD 3O6KH 5ACLA 3FAWA 3QULB 2XV6B 1JNNL 4QYOB 3I50L 5IB3B 4DGIL 2OK0H 3QEHA 2JTDA 3LQAC 3V5DA 1EHAA 5EUOA 2BHYA 4IHOA 3UTSE 4O2CA 2Y25A 3QPXH 3ARWA 1IQWL 4BSWB 5E94A 3WE6B 5F6HJ 1OW0A 1CLZH 4M7KH 5D7JA 4N9GA 3ZO0A 1EK3A 4X7SH 4FQ2L 2YD7A 1C7SA 4QKXB 1ZLVH 3OXSA 4UOW1 3RWGA 5DR5L 5FHBH 5IF0B 4TSBH 4HIEB 4RDQF 1QFWM 2YC1A 3HAEB 2FR4B 4OKVA 1CFSB 1GZQA 5ILTH 2FYYB 4PJGF 3SOBH 1BBDH 4UB0H 4MNHA 2E7LA 1CF8H 5FUZH 1BHGA 1AJ7H 4J12A 3DPBA 4E5XA 5T3XL 1GVIA 2X4PB 2VIRA 5C0CE 1FAKT 5JXEC 2X70B 3OX8B 2PYFB 4PGEB 1T89C 3BHBB 3BT2H 1CR9H 1MH5B 2Z91B 3U7YH 1KTDB 3NACH 3DETC 3JWNC 4XC3H 5IEHB 1PAMA 3E2HC 1QO3B 2FJFA 3SDXF 4TQEH 4M5ZH 2HLAA 3HR6A 2GTWB 1VKXA 4JFZH 4OIBA 4NNPL 5CJ8A 3DJ9A 3NCMA 1HXYA 3SJVE 4UQ3A 2ZCLH 4F7EB 3RFZC 4HQQL 4QYOA 3ZE2F 1S9VB 1BQHA 5LBSL 1ZGLP 5DHVB 3C08L 3ZE0E 1MHEB 2X9XA 4ZFOL 4KQ4L 1DTUA 3AS1A 3QIUA 4NOFA 3UC0L 3WKMH 1PZ5A 3ZKXB 4X4YA 1RI8A 1JPTL 5D6CA 5DHVH 5HDOA 4ZOEA 3EHBD 1W2KT 3LQZB 4XNMA 1NGQH 4NCC1 4DTGL 3VXUA 1AO7A 4ZFGL 3MRIA 2UWEE 2FLBT 1CFVH 1U93A 5BMFL 2HT3D 1WZ1L 1S9YA 4LCWA 2WW8A 3INUL 1P7KA 4XPAH 3VRJA 4CN6A 3EO1A 4BM7A 4M1GL 1UWXK 4ZFOA 4QO1A 4JG0H 3LKSB 4J4PA 1E4XL 1A7OL 1WEJH 1YJDL 2OMNA 4TUOB 3RHWF 5IJVB 1CLCA 3LQAL 4MNGA 3GKWL 1F6AB 5ANMB 5T1LD 4TUOA 1RUPL 1HHIB 4NNXA 3CXDH 4GRLD 4NIKB 4I1NB 4BQCA 3BZDA 2W92A 5GGVY 3MRFA 3WS3A 4LVOB 4G6ML 2P8MA 2OI9C 4HH9A 4HXAH 4X9HA 9CGTA 4LLDB 2AEPH 2L0DA 1YN7A 1Z9LA 3GMQB 3CVHA 5L9DL 3F7PC 5E24E 1I8LA 3MV8D 3UCRA 1F90L 4JM2F 1UXSA 1MIEL 4JDTH 3H7BB 3QSKB 1TCRB 3X12A 5GS0D 1QBLH 4TUKH 2A74A 2RJMA 4JO1L 3O2VL 1R3KB 4MMXC 1PZ5B 4X4YB 3EJYC 2EC9T 3TPUB 4N0CD 5C08D 3S4SG 3EOBB 4F80A 1AGEB 4NQCE 5F88B 3VXRD 4LCIH 1ZK9A 2LU3A 3AMKA 5I17B 4EUPG 4NWTL 2V17H 3DXAA 3L3JB 3TV3H 1H8OA 3OKEB 2EDKA 3GB7B 4PJHA 1JZ5A 3CFCL 1DEEB 1KENL 4ODXA 5CAYB 2K7QA 3LN9A 3DYOA 5C9KA 1FO0B 4F9PA 4MB4A 2UZXB 2WLZA 3PP3K 5JIPA 2FD6L 3BGFB 3BT2L 3FOMB 3IS1X 3F58H 2GYSA 3FKUS 1DANU 1ITCA 4YBHA 2B20A 4HJJL 4MS8C 2R2CA 3V0AC 5KSAA 3NH7H 5C07B 1JV5B 3NCYP 5CWSB 2ZNXA 3MO1B 3VFMA 4RAVA 4JR9H 5HXMA 1S5HB 4WTZA 1BLNB 2R69H 3S96B 5BS0B 1ZLUK 2DF3A 1UXWB 3IDUA 4AEIL 1I1YA 2CMRH 5DRXA 1JZ3A 4PRAA 4XC1L 1YNTA 4JCLA 4NQVB 5IHBA 1JGUL 5EOTB 4HMEA 3D18A 4MNQB 2EO9A 3MRMB 1P6FA 4G5ZH 3QDME 5E6ID 5E94B 2A6KB 2VUOA 4GAJL 4ODSL 2F53A 3D6GA 3K3QA 1BLNA 4Z7WF 2DI7A 5D2NB 5IB2B 3B5TA 3KPOB 4FTVB 4PY8I 1V05A 1UVQA 2OTUB 2ZUSA 4KK5C 1J5OL 3TJEL 4G8EB 4LRNL 2AP2A 1EGJL 3BIBX 1T1ZB 1D6VL 5IBUG 3NOIA 3C2AH 1UACH 4MD0A 2W38A 3BH9B 3BKYL 4MAUH 5LVEA 1WAAA 5D93C 4D9RE 4OTXL 4UDUA 1P4BL 1QRND 4O9HL 3BGMA 5LGKA 5EFIA 3PWNA 3QDMA 3HUJE 4ZFFA 4WEMB 4M43H 1TTGA 4OCWH 1QR4A 4M00A 3C5SA 2FCBA 1MWAH 2X5PA 1XF2B 3DLQR 3VFMB 4JFFB 3ZDXF 5ID0B 4LNRA 5A2IH 4X4XA 1YY8B 4LU5L 1FL6B 4G8FB 3LMJL 1IM3A 3OXSB 2CRIA 4XXDB 3AMLA 3MGTB 3PL6B 5ILTL 3C60D 1AP2A 3VWKC 5D4QA 3RWFB 4U3XA 3ISWA 5D7SH 5ICXB 3HI1B 5EIVA 5SX5H 4I0PA 4AEHH 3V79C 4FQ2H 4HH9B 1BFVL 1TZHB 4OV5B 4YDIH 1WWBX 8FABA 1RIUL 3U7YL 3LKQA 5D8JH 1UB6B 3D9AL 1QEWB 2AJXL 4OZFG 4PB0L 4YC2C 4XP5L 2NY3C 3D85B 4M93C 4OJFL 2DWDA 4X6CE 2BFVH 1OGTB 3L3OB 3FQXB 4JZNB 4GRMB 3B9EA 4K71C 5F97E 4I5BB 2GEEA 3QO0A 5KS9F 3MCLL 4X8JB 1M05B 3GNMH 2V17L 3B2UD 3T8XB 3EYUH 1UYWH 5DFVD 4MWFB 5AAMA 2VSDA 1OCWH 1UZ6F 1NAMH 3MLWL 1H3VA 3V4PH 2JJSC 5EO1B 1NCDL 4LLWA 3ARTA 1WBXB 4NO5A 1KACB 3PGDB 1BAFH 1T2XA 4PRBB 3WUZA 1OGAA 1A0QL 4MNQD 4C54A 4OT1H 1U3ZA 3VFTB 4QLRA 1Q0YH 3EYFB 1CLYL 4XVJH 3ARFB 3LCYA 3UTTA 4X6CA 3UJJH 3RX7A 1YPZF 3QXAA 2AXGA 3N06B 1QLFA 1BD2D 3F7RA 4MHHI 1A1NB 3EJZC 4RMSA 1IGFL 1A2YB 2EICA 3QFDB 3LSOB 1MPAL 1DFBL 1T22B 4LDLB 5F72S 5JDSA 1JYVA 4HWBA 5L6YL 5EULV 4BZ2H 3MYZA 2HTKC 3DXAD 2LV4A 3GBNH 1FVDB 2ZOKA 5ETUA 1U8IB 3U9UA 5JOEA 5F7FA 2Q20A 3AROA 2MCPL 5AYQA 1QQDB 3L9RB 2VIRB 1AHWA 2WZPD 3QDAA 5HHOA 3QHFH 4IBLT 2GITA 2X89D 5D7LB 1T20A 4QGTA 3AFLA 1EPFA 2C3HA 3VFRB 3VFNB 5GS2H 1X9QA 1FIGL 1S7WB 3OKKB 2XA3A 4P2QB 5H2BA 2ZJSH 4L3EE 4XZUB 1DBKH 2C1PB 3F5WB 2YD3A 4UQ3B 1BP3B 5I2IB 2WINA 3A6BH 5D7JB 2XIDA 4QWWD 1G7HA 4IS6B 2VAAA 3PIQB 3QEUA 2AJZB 3QUYB 1DVFD 3FTGA 4HGMA 3SE8L 1UC6A 4RWHA 4PTUA 2WK2A 1WLHA 1Z9OA 3ZKND 1RZ8B 4H20H 1JNLH 4XP4H 2IWGA 3RIFK 3HG1E 1UZ8B 3IDGA 1MHCA 4MLSA 4ZNCD 1OAQH 1IEBA 1QUNA 4HKZA 4GAYA 5GRVL 1NL0H 3PWVB 2YRLA 3D39E 2PO6A 4EN3D 1FNEA 4Y88A 5C8JA 3IJYB 1P69B 4DZ8A 4W4OA 5CMAB 1UB5A 5IQ7L 5KZCD 4KTDH 1FH5L 3KXFA 1IARB 4YHML 1S9WB 5F71A 2EDWA 4NO2A 1CICC 1XIWD 4JFOA 4QRPD 1D5IL 4X9FA 1LMKA 1A22B 4LSTL 2R1WB 5JPMB 3KPRE 1MREL 4L1DA 4E42B 4HG4J 3L3HB 1JV5A 3VW3L 1DN2A