2E5EA

Solution structure of variable-type domain of human receptor for advanced glycation endproducts
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
101
structure length
101
Chain Sequence
AMAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Advanced glycosylation end product-specific receptor
publication title Solution Structure of Variable-type Domain of Human Receptor for Advanced Glycation Endproducts
rcsb
source organism Homo sapiens
total genus 10
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2006-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e5eA00
1Z2KA 1JRHH 2YA1A 2VDPL 2E8YA 1ZHLB 1J5OH 4NKIH 5E94B 2NY4C 4U0QB 3OAYK 4PY8J 3LB6C 3P4OA 3O2DL 1VFOA 4RGMC 1JYNA 3QEQE 3IDJB 3QCUH 4ENEC 2G75A 4FOMA 5I1IL 4HS8H 1RIVH 4N0UA 1RIUH 3QUXD 5IW6B 2UZIL 3UPRB 4XHJD 4BZ2H 1J0JA 1N64H 3MCG1 3SGEH 4I3RL 4PS4L 1BQLL 2E6JA 3HE6A 3IFLL 3ZL4H 3P11L 2LU4A 1P53A 1J7VR 2ZUUA 2W38A 3HUJF 2XZQL 4K7PH 4PG2C 4YNYA 2BZDA 3TN0C 1FAIH 5IHZA 3KS0H 4OD2A 3ARBD 2CO6B 2N7AA 3FTGB 4YJZL 4D0CA 3QXAA 5FA3A 12E8L 4UBDC 1Q9WA 4OFVA 4RX4A 1YNLL 2WIMA 4H20H 2VXUH 4ZYKA 2HH0L 1FYTD 1ZT4A 5E2JA 5L7XL 5I71C 4X4XB 3W0WA 4WV1B 4R7NB 2EIZB 3GIZL 1RURH 3RWEA 4PRBA 3P9MB 1ZE3C 3OAUH 3WL9B 4MAUL 1UZ6E 1CICA 4KU1A 4ZO6A 4N1CA 3REWA 1ZSDA 3KPTA 2CPCA 3BEVA 4NKDB 1YN7B 1FNAA 2MHAA 4YIQA 4YXKH 4LPWA 3KLHC 4MZ3A 2AK1H 4GXUN 4U6HA 4WHDA 4DN4H 4PJ5D 3MRGA 3I6GA 3X17A 2BSSA 1U8KA 2VERN 1XGPA 3MRDA 5F9WC 1I8KA 3BJLA 4OLUL 4QGYA 1CE1L 4H8WL 4R26L 4GFTB 3HPJA 1X5AA 5HHXH 1NCCL 5EZOH 1JI1A 4UNVA 2VXVH 4MLIA 1BHGA 1SYVA 2X10A 5E9DB 3L1OL 4X4YB 3DETC 4K3DL 4R9HA 1KB5H 4RGMB 1SY6L 3HB3C 1JGVL 4LF3B 1KCSL 3OX8A 3WDIA 4YX2H 3T0EE 4HWBA 2ZUTA 4MCYB 4C55A 4LNRB 1DDHB 2H3NA 3H42H 1QSFB 4RDQF 2D7PA 1VGKA 4L4TE 5CP3A 1V7ML 3T08A 4GKNA 3VRLE 1IFHL 3IDNB 5BJTB 1HCFX 1PZ5B 1SMAA 5TDNB 3BI9X 1V7NH 1PDKA 4P9ML 3U83A 1XGUB 1FFPA 2F58L 3N9GL 5EZJB 4R4FH 1BOGB 3WKMH 3O8XA 5SWSE 1INDH 1MCQA 2I07B 3O9WD 4S1DD 5IOPB 3CZJA 4KK8C 2YWZA 4KKBD 3VI3F 5HPMA 3U30B 4O02H 1SYSA 4Q58C 5DFVD 1OTUD 3HAEH 4PY8I 4UU9B 4PJEB 5D70L 5HHOE 4XWOC 2VMFA 3HNSL 4JQXA 5D7SL 1P7KB 1ZVHA 2NR6C 3HR6A 5HYQB 3D9AH 5TQ2L 5CJBA 2BVEA 4BQCA 3TESA 1J0HA 4KI5D 3DRQA 5E0QA 1BD2A 5C0NC 3OF6D 4URTB 3Q0HA 3N85H 1TCRB 1BQSA 3EAKA 1YEDB 3L5JA 3NMEA 3QDGD 4HXBH 4LBEB 5GISL 4P2OD 2ZNWA 3GI9H 1WBYB 4M43L 4FHBD 1L6ZA 5SWZB 3MJ7A 2ZJSL 1DBJH 2H41A 5DEFB 4OLWL 1GZPA 3BH8A 4RRPA 2WW8A 2YHGA 5E70A 2OLDA 5DQDL 3E6FB 4C56D 4MJ2A 2Z91B 3TH4T 5FUZH 2NW3B 2C3HA 3MRCA 3MRKA 2W0FB 3WNNA 1UQSB 4XNYL 2G2RB 1KJ2H 4PGJA 3L5WB 5DHYB 1AHWB 4BK4A 4EVNB 4X7CC 5E24E 5F1OB 3PGDB 2GFBB 1DBBL 3AROA 2PXYD 4RBPK 1J8HD 4M62L 3GMMB 4CVZA 3MRFB 4BH7B 5B8CC 4JRXB 1IEAB 3PV7A 2DQUH 3QHZH 1X5KA 3DECA 4HQQL 3FO1B 1B88A 1KEGH 5DMGC 3QH3A 2HVKA 4XPAH 5LGHH 4FNLL 2P5WB 2WUBL 4M61A 1UZ8A 5I15H 2V17L 5EU3A 3RUGE 2NY1D 2BFVH 3VFWA 2Q7YA 5FGSA 5F7KC 1PVHA 2P8MA 3F7QA 3GBMH 4RFNC 1OPGH 4OFIA 4R96A 5CEZE 2GI7A 4DJMA 4A6YL 1N6VA 2C7UA 3OHXB 1YC7A 3FOLA 4RGOL 3U1SL 1D5ZB 4OF0A 3C60A 4XI5D 1FG9C 3BP7A 5JUEH 4AMKH 1WZLA 5I8EB 4K3EL 3VD7A 4OLZH 1MIML 4G8GE 4U6VL 2F19L 3QWOA 4JFDD 2D4FA 2X44D 1IL1B 3GMOA 1P4IL 4NBXB 4FXGB 1Q9LA 4TUJA 5JPMB 1EFXA 1OAXL 1U91A 1ULVA 1ES0A 4M9PA 4XVUD 3HI1B 4Y4KC 1D9KC 4UT7L 3MGAA 4HLZG 2OI9B 4CADA 4A6YA 4RQQB 5EN2B 2NZIA 2JIXD 2FEEL 2J88L 4ONFL 4NSKB 5B21A 2W60A 4QKXB 1JK8B 1ZA3B 2VTFA 1FG2A 1ZLVH 3W9DB 3EKCA 3BDYL 3DSNA 4YHNA 1FPTH 3KAAA 4ODVH 3KPQB 3JSSA 4OLXH 4Z7VB 3SKOA 1AKJA 3W5MA 5GQBA 5D9SB 1S5IH 3BE1H 4N0CC 3SPVB 4X6CE 4Y16D 3EDJA 2FBJH 5KZCD 2W65B 1RY7B 3QEGH 1FVDB 4N8PA 4JFQB 1ZLUH 3SDXF 3TBVB 1WTLA 5HHQB 4YGVB 1MCWW 3IJHB 4NM4L 4Z7WE 1W72B 1NCBL 3GBNL 5K33A 1G7LB 5KSAA 3CVIL 5C0AE 1RZIA 2C1OB 4U0RC 3W2DL 2FBOJ 4FMKA 4LHUD 5D96C 3DJ9A 1BAFH 3MGOB 4OV6F 5KVDH 4YHOH 4BFIB 4X5WA 4YH6A 1G7MA 1IAOB 1MWAA 5B3JF 1F4YL 2X4PA 5IVXF 5T1LA 1LK3H 3TV3H 1IKNA 4JO4H 4HIIB 3ULUE 1P7HL 1LD9B 1EUUA 4GAYB 3BMVA 1BF8A 5GGSB 3QG7L 1ZEAH 1YEKL 1P4BH 2VNCA 2ZG3A 4XVSL 4JFFE 3MLWL 5T5NF 5EC1A 4P48A 3RY6C 4ETQB 3TO4C 3Q6GL 2OK0L 2XPGB 4JPIA 3GSUA 3GMLB 4OKDA 3V4VH 4IMKA 4XNUH 1BIIA 4HWUA 1E0OB 4QCIB 3ZE1E 2AV1A 4Y4KB 3WDHA 2DI7A 3UTSA 3HC0A 5C8JA 4MNGE 4QRQA 5F7WC 2PYFB 1PEWA 1HHGA 5AZEH 4RMUA 1YMHA 2IAMD 2P45B 5DUPH 5IFHH 1J1OH 1AGEA 1G0YR 3IKKA 5IK3B 3C09C 1XMWA 5FYJU 1LO3L 4DQOL 4PJIA 4ALAL 4TNVK 2JB5L 5I1JL 4JDTL 4WWKB 4G5ZL 4FFZL 1H3XA 1UEYA 4XCFL 43C9A 4JZJA 4NRZA 1QFPA 4XNZB 1PLGL 5FO7B 4PRIB 3ARRA 1HSBA 1K8IA 3MBEC 4LSSH 5F1KC 5DEGA 3C2AL 2DQFB 2NY2C 3BOVA 3GSRB 3RVWC 5KS9F 1QFWL 1W0VB 1NBZA 3KYNA 4FS0A 2VXSL 1VKXA 4I9WD 4AIXA 5E2UH 3PQYA 2B5IB 2OR9H 2VLKA 3F8UB 4UV7L 1UXSB 2DQGL 4EQ2A 1HK6A 1ED3B 2Q6WB 4X5XB 3S6CA 3QUKB 5K9KB 4NPYB 1MREL 3ZDYE 1WZ1H 4M7LT 4G8EA 5KTEL 4ZUUA 4M5YL 1HNGA 5FECB 5FYKE 5GS0C 2AKRB 3ECBB 3ESUF 2AEPL 1NKOA 4JVWA 1RV6X 4M3JA 3JV6B 4LASL 3SJVE 2XICA 1DJSA 3VWKD 3TO4B 1YMMD 2PYED 1BVKB 4X6DB 1XEDA 3H8NA 3L3OA 4NNYB 1I3UA 43CAB 3HA0A 4APQC 5IR1B 1OM3L 5IBTL 5GGVL 2JF1A 1GGIH 2ICCA 2ZOKB 4DVRH 5EU6E 1ZV5A 4S2SA 4H0IA 1HINL 4WFED 4QXTA 4D9RE 5DFTA 5TGBB 2HRLA 5DJAB 4YK4B 4Q9RH 3GBLA 2HLAB 1FDLL 2WBWB 3SDDD 1XZ0A 4IOFC 2E3VA 4M1DH 4EZMA 3AREC 3IGAA 5DRNA 5C0GB 2HKFL 1IAKA 4MQ7B 1EAJA 2A73B 5EH1A 4HMEA 2OYPA 4PP1C 3WYRA 3A6CH 3J8F7 3TZVB 5JXED 3F7YA 3PV6A 3QQ9C 4YHKL 1J1XL 2ADGA 4YDKL 1S7WB 3IDYC 1A14H 1Q1JL 1S78D 3TYGH 3TH2T 3UJTL 5FO8B 4Y19E 1J0YA 3DO7A 4JKPH 2R1XB 2GIYA 3C9NB 5E6IC 1KXTB 3R1GL 1EVUA 4RISL 2JJWA 2NY2B 4XHQA 3I6KA 3ES6B 3SGKC 5IMLB 1OSPL 1NCWH 4L3EE 4WFFD 5BRZD 2BNUB 4NO5B 4U3XA 2D7TL 2Y5TA 5EU7C 4EBQH 5ACMA 1FN4B 5ACLA 4P2RA 3P0GB 3SCMD 3D3VD 3N1MC 3NTCL 5IQ9B 3T1FA 4ZTPH 1MNUL 5EOTA 1JN6B 2XFXA 4O2CB 4NFDA 5I9QB 3DBXA 4OQTA 1RZGA 1VENA 1IAIH 1UB6A 2BNQD 3W11D 4BJLA 4JDVA 1FFOA 3QEUA 2DRUA 4ELMB 3MGTB 3VWJA 1FJ1B 1R3HA 2NPLX 5IUSA 5HPOA 2IFFH 4G6AD 2I25N 4HBQA 2AJUH 1HOCA 1LEKA 4TULL 4IDLA 1Y6KR 3NIGE 3RZCA 3SOBL 3QCVL 2DBLL 1FNLA 3HI6H 1HXMA 4X83A 1I1AA 3CDGA 4WNQB 4NC1E 3TPKA 2Z4QA 4PJFF 1LE9A 1N2RA 3CPLA 4I4WB 1BLNB 4DZ8B 1OCWH 3RAJL 2QV2A 4PJ9A 1QBMH 4FTVB 5H2BB 3D6GA 1QQDA 4WUUD 4NN7C 3LD8B 3WMSA 2FJGB 3M8OH 3MCKA 1EK3A 4HIEA 3K3QA 2VAAA 4YBQD 1QKZH 3KXFE 5CCKL 3E2HC 1KENH 1IC7H 1FCCA 4QHUB 3VXME 3EYOB 1QUNA 5E8NA 2FR4A 4C58B 1PY4A 4P46C 4Y5YB 5CIPH 1W72H 3BUTA 2VDOH 4FZ8H 5C9KA 1RZFL 3L7FA 5HGAB 3U0TA 3PWLB 3K80A 1F58H 3V4PL 3B2VH 2XNAA 3S37L 3T65A 1EV2E 2CQVA 1DQDH 4PRPD 3MR9A 2NLJB 5GRVL 3S88H 4YEEA 5GS1A 4V2BA 3DI2B 1GRWA 2HFGH 4OFPA 4MJ6B 3JXAA 1P5VA 3KPRD 4WO4C 4YHLL 4Y5XB 4NT6A 1UEMA 4MA8H 3M17B 3MV9A 3PHQB 2RCSH 4HAFA 5J56B 4MVBC 5IKCB 4XCEB 3HS0B 1OB1A 3BYTA 4HMDA 3TA3A 4F7MA 3X12B 3LRHA 2PNDA 1BM3H 4YFLI 3QEHB 1KLGB 1E4XL 2P8PA 4OM0H 2X4SA 1QFUH 3H6JA 2D7NA 5D2LB 3JWDL 4PJXF 5H37G 1JTPA 2BSRA 4LVHC 5DF0A 3BN9C 5C0FA 1WFUA 2X41A 1R6VA 3WNMA 4JZNA 4RFEA 1HQ4A 2VN4A 1JFQH 4HZLB 1T2QH 1WCQA 4HKBB 1UB5A 3QDME 3QDJA 4OIBA 2XWTA 1ADQL 4AJ0A 1IILE 5CP7B 1QA9A 1YEIH 3W39B 3BQUD 4HS6A 4TVPH 2CMRH 1RPQA 3ULVL 5JHDB 2DIBA 5FM8A 5E6ZA 2X1XR 3WFDH 5CGMA 4F3FA 2B4CH 2EYTA 5B3NA 4UUJA 4Y4FA 4P46B 3WFHA 4KGLA 1C1EH 2E9BA 3LOWA 4PJBB 3ZO0A 1CQKA 4LCYB 1IM3A 5EUOF 1QLEH 3BD3A 4P5TA 1N3NA 1GC1L 4LSRH 1YYLH 5DT1L 1VESA 3WD5L 3HE6C 5HYSB 3TT1H 3FT2B 4R8WL 3PL6D 4KRLB 1CGSH 1G7PB 1A3LL 4CW1B 1CLOH 5DK2B 5I1CL 2CLRB 4XGZB 2EXYD 1AO7D 4MCZB 4MJIB 4TUKL 5JO5A 3LZFL 2F5AL 1HI6B 2P49B 3K8KA 4F7PA 3NGBC 3R0MA 5IHUH 5C0CB 3IDXL 1DE4B 1I1FA 2HJLB 3DMMA 5FGCB 5D1QD 1MQ8A 4XP4H 1NC2D 1HE7A 3QFDA 3GIVA 2CR3A 4JHBA 5GJTL 1B2WL 5C92A 4MDJA 4X9FA 4BFBD 1CICC 5DO2D 5FAAA 1J1PH 3HFMH 2XRAL 2XN9D 2NNAB 2NY7L 4MQXC 4LLAA 3QZWB 5IM7B 3ROLB 2AQ2A 2HTKD 35C8H 5J13B 1AR2A 5IVNA 4ISVB 1VFUA 3TT3L 2Y06L 3LV3B 4NHUB 4XNMA 5BS0D 1NFKA 2V2WA 1D3CA 1NEZB 2DDQL 3AU1A 1WEJH 5KANG 2GJ6B 1UFUA 4LLDA 4XT1C 2RHEA 2EE9A 3VDCA 4H1LH 3VGBA 2VC2H 2E7HA 2IAND 1H3PL 1Z9LA 3GJFA 5KVGL 5DR5H 2H6PA 3BW9B 3T0EA 3TM6A 3HHRB 2EDTA 3B9KB 2G75B 5D1XA 3PGCA 1JV5B 2J8HA 1KTKE 4PJHE 1OTTC 4N0UB 5DMJB 3SDXE 2EYSB 4IMLB 2JTDA 3N1QC 1D6EA 1QNZH 2QQLH 1TVBA 3BZFA 3QDAA 5JOPD 4P2QD 3HE6B 1NMCB 1A1OA 5SWSA 2DWEB 1U8NA 1T04A 1UYWH 3O8XC 3QO1B 4AT6B 4XAWL 5B3JE 3U9UA 4DVBB 2CD0A 4QOKB 5IVXE 4HK0B 5IHZB 3GUTA 4OD2B 3X3FL 5HHOA 5BV7H 1F5WA 1WIOA 5FA3B 1P7QD 3BHBA 1HILA 4JQXC 1CE6A 4LMQI 3TVMB 4U6TA 5HDQL 1HSAA 4ZYKB 1KPRA 2DL2A 3VD4A 2IH1A 5D6DA 1YY8A 4NQEE 4HH8A 4RBPH 4ZFGH 3NAAL 5D7IE 3NFPB 2BCKA 4PRBB 3W81A 3IKCA 3MREA 4OCNC 3H7BA 1PKQE 1LDPH 1AE6L 1RJZB 1EMTH 3LIZL 5DD3L 5J57B 3T0XA 1JTOA 1T1ZA 5TF1H 3SE4A 4NHCH 2EICA 5DJZA 1EHNA 3BEVB 1EEYB 2RAMA 5J1TC 4WW2B 4KUZH 3V5KB 4M5ZL 1VGEH 2BSSB 1U8KB 5MENA 1S9KC 4O2EA 1OWWA 5JMOC 4WFHD 5HI4C 4JKKA 1ROWA 3MRDB 4AZ8A 4JR9H 2YUVA 4XC3L 4NJ9L 3CD4A 2A9MH 4LDLB 4LCIH 5LQBH 2OJZL 2ZWLT 1SYVB 3L5XH 5TPWH 3T2OA 2R0KH 5HI5C 4WEBL 5DMYA 1UENA 1IGFH 1GAFL 5CEZL 3CFKA 2H3NB 2Y07H 1KBGL 5GJSL 4Z76B 1MFEH 4GKNB 4P59L 1VACB 5FDYA 3D18A 1OAUH 2XZAL 2H9GA 1NPUA 3U2SB 3RIFK 1QYGL 4EDXB 3CH1A 4KVCH 4F58L 2DYPB 3TJHC 2F53A 3O8XB 2R2EA 5I8CA 4GUPB 3RUGA 4QXUH 5HYFA 4PJGE 1RZJL 4KTYA 1FIEA 5EFIB 2NYYC 1XF5B 1RHHB 2X5PA 5GGQL 4ZS7L 2QQKH 5ETUB 4OJFL 5I76A 4XCYB 8FABB 1NMBH 3LDBC 5JXAL 2DJ4A 2CUHA 3I9GL 2NTSP 3RGVA 3FB6B 1RUAL 3C60C 4Z7UF 3I75A 1WWBX 3P0VH 4X6EA 5B4MC 1V3JA 2OP4L 1D5MA 3BGMA 4OZFG 1ZANL 1UT9A 3O2WL 5ANMA 3FL7A 2R0ZL 3TFKC 1ZS8B 4JANA 4GBXB 3RI5K 4XVTL 2LTQB 4DZBA 5FYJL 1KYOK 4NWTH 1UKQA 3VFGL 1I1YA 1L4IA 1LO5A 3WHXA 2VLJD 1OQXA 3C5ZA 4F33B 1EEZB 1EEQA 1AGFA 3ILQD 2A0LC 15C8L 1BVLA 3MOBH 4RAUB 4DKAA 3D39A 2HRPL 4MXVF 3WO4B 4NNXB 2LE9A 1DQTA 2A83A 4XPGL 1DQLH 3OTTA 1BQUA 1JGLL 3BPLB 4J3OC 1K5NB 4DK3A 3QULA 2VQ1A 5C2BL 2C1PA 4P9HL 2VDML 1JGUH 4Z7NF 5E08H 1A02N 2XY1A 5AUMA 5TE7L 4TTGA 3X13B 1EGJL 1RUPH 4CJ0A 2ADIA 3ZT6A 1K3IA 3GEWB 4LDEB 3D85A 5CGYC 4KJPD 1TIUA 3ARGB 3ULUL 2ARJB 5CZXC 5HHMD 5F8RC 4X6BB 4IDJL 3TGXA 2ADJA 2HT3C 3KLAA 1T5XB 1S9WB 2B1AL 2EO1A 5HHNA 4L4VE 1TJHH 1B6UA 2PTUA 3PABB 4JFZH 4J3SA 4QRRD 4ZAKB 3FQUB 3QH3B 4QRPB 3AB0C 2WQ8A 4UB0H 1BFSA 2HVKB 4G7VH 5C0RH 5KSAC 4JFHE 2CDFB 3MACH 2NY3D 1FO0A 4OZHE 3O3BA 2J4WH 5EU3B 5L8JB 2PW2A 3G6JE 4ZO9A 5IT2L 3VFWB 2VZ3A 2RBLA 1EGJA 2Q76A 4AEFA 4NCC2 3BRGC 4OLYL 5I2IA 1UCTA 1URLA 2GYSA 4PJAB 1IKNC 3REVA 4MB3A 4TTDC 2YD1A 2NY4D 2IQ9L 3LB6D 4J1UB 1H3WM 1U8IB 1OGTA 5F9DC 1KCUL 3VXSD 5JR1L 4YPGB 1MCBA 5GGUA 4ENED 2OXHA 3QWOB 2HFEB 1GIGH 5EO0A 5I1EL 4U4BA 3GMOB 3B9VA 4TRPL 2K7PA 3B83A 3ZKMC 5JHLL 1IC4L 4MNQB 4JHAL 4IMKC 1J88A 4U1KB 2X4OA 4MNGA 3ARDB 1ZT1A 2H45A 3S3PA 2YPLD 2OMNA 3KPNA 1M7DA 3TN0D 2YEZA 2W60B 3QUZB 3DYOA 4CDHA 2VDQH 4GSDL 4D8PB 3T77A 4MX7B 4UV4L 2XZCL 4JM2A 3DVNA 5BZWA 5HYJB 3RL2A 3LPFA 3IDIA 4UBDD 5F88B 3DVFA 4QY8A 3OJMB 4JQIH 4YHNB 1AP2B 1UM5L 1G7HA 5C6TH 4LEXH 3U0WH 4JZJC 5L2KE 4U6YA 4YUEH 2DLHA 1AKJB 2ZSWA 3LAFA 4LVOB 3V5HB 3VXUA 3KLSA 4GMTL 2HKHH 2XA8H 5FYKL 5TH2A 3VGAC 1GHFH 4JREC 2EKSA 2ZCLH 1F2XK 4YHPA 4Z7VF 3HNVL 3C87A 4FQLH 1EH9A 4DAGL 4Q2ZA 4BSWA 5HJ3A 1RSFA 2VLRD 4LQFH 4KUCD 2JB6A 1RZIB 3KLHD 1K4DB 1WWAX 2D0FA 3QG6B 5GZNC 2O5ZL 2GAZA 1DBMH 4X5WB 1G7MB 3S3SA 1M4KA 3HI5L 4WU7B 3CFJA 4JZOA 3ZZ1A 1Q9OA 2Z8WC 5T5NG 3HPLA 1G0XA 1K3ZA 1RU9L 4I2XA 1KTDA 4IRZL 3DETD 3BKCL 1BQLH 3F7VB 3IFLH 3HB3D 3LKRA 5J9PB 5A2FA 3C6LD 3T0AA 4PB9H 3W9EB 2EDDA 3P40A 4QXGL 3IFNL 2FSEB 4JPIB 3QIWA 3GSUB 4JFEE 1QVOB 2CJUH 4MMZC 3QIBB 2HJFB 5D93C 2Z92B 4RMRA 4Z9KB 2HA1A 4PJXE 4KQ4H 3T04D 5E99H 1F11A 1YEJH 4KVNH 3WUZA 1YNLH 3UTSB 1SHMA 2F5BH 2X70A 4HX1B 5HGGS 5CILH 2Q8BH 2DM3A 3T3PE 2E6PA 2A74A 5IWLA 4GW4B 4NZRL 5JORA 4HWEH 3S5LG 2F15A 2W0KA 4KK8D 1LEGB 3EDDA 3FO9A 1GZQB 2XWJA 2EDLA 5F6IB 3GIZH 1NLDL 2BOBB 5C07E 4XWOD 2FEEI 4MAUH 4KV5F 2NR6D 2GSGB 1DCLA 1NUNB 43C9B 5EORL 1A6PA 1RUQH 2AJZB 2B1HH 5I1HL 3G5VB 5C0ND 3VGAB 1OT1A 4YPJA 3T2PA 2ADFH 4NQCA 4Y19A 1F90L 4IHOB 2E27L 3BO8A 4HF5L 2V5SA 4OTXL 5EUOE 2WIIB 3IFPA 3MLTA 2E8ZA 5ENWB 3TBWA 3HMXH 1XGTA 3I3DA 1EPFA 3MLYL 5CWSA 4MXQC 1NBZB 1AQDA 5D6CA 3UXFA 4NP4L 2I5YL 1A6AA 1GGBL 1UA6H 4MA3A 3HUJA 5C7XL 4Y89A 1CL7L 1MCSA 3VFVA 3C5JB 3MNWA 4WDIA 5FO9B 3AS1A 1V7MH 4G8EB 2NTFA 4ZUUB 3LKQB 4DKEL 2E7MA 3OJVC 1NUGA 3DRTA 3Q3GB 5T1MB 5ISZD 4X9BA 3V7AE 4TPRH 5BZDA 4AQ1B 2W9DH 4Z78B 4Z7QF 1XF4B 2UUDK 3VWJC 3QT2A 3LH2L 4KY1H 3MUHL 4KK5C 4QHKJ 4EUPG 2OTWA 3G04B 4HFWA 4X80H 3ZE0F 4HHAA 4JPVL 3SQBA 3O4LE 5F6HJ 2YD9A 3P4NA 3QFJB 5TQ2H 5HDOA 5DMGD 3L3DB 4X6DF 4NQSA 3RZCC 4QXTB 1BFOA 1RK0B 3GK8H 5IV2A 4NO3B 1I1AC 5A2JH 3QBTB 1EFQA 1BVZA 3ZDZE 2VE6B 2K3TA 4PJ9C 2D31A 1K8DB 4BKLB 4OLVL 1P84K 1IAKB 3NCFB 3VCLB 4WU5A 2QLVB 3UZVB 4OCXL 4PJ7B 3KR3H 4JO2H 3E3QC 3KXFA 5IIEA 2YPKA 3VGGA 2XKNB 3OR7B 3H9SB 4OLWH 3WJJA 1RIHH 1OAQH 3CFDB 3F58H 4I0PD 2ICWA 3DO7B 2CLZA 4ZOCA 6CGTA 3ILPA 1DQML 3D0VA 2OBGA 1QRNE 1YECH 3LQAL 1B4JH 4TOYL 2APFA 1BZ9A 4LRIA 5HHPB 1UWGH 2OJEB 2W59A 1TTFA 1WAAE 2XTLA 1CYGA 3IVKA 1QFWI 4OZGF 4ORZC 5C0BA 3Q5TA 1D9KD 1NC4A 3ISWA 4LCUA 1KTLA 4YXHH 3BEWA 3KPSA 3QXDA 4R4NC 5GS1C 5T1DH 4E41E 4FQQB 1WZMA 1PBYA 2XFXB 4N0RA 3PP3K 2DQJH 1A9EA 1TZGL 3WFZA 3Q6FA 1DLHA 4UDTA 2GTWB 4KKCC 1ZHKB 2YRLA 2WUBH 3MXVH 3TA3C 4G6JH 4KMTL 3VWJB 1TXKA 5TE6L 1R3HB 5J8OA 2F8OA 4NWUH 1FGNH 1U3ZA 4HC1H 1INEH 2F8XC 2MQ3A 4N0CD 1HHJA 4K2UH 2N7BA 2OZ4L 3UYRL 2AEQL 3CZFA 1LEKB 4LLMA 5C0DA 4ELMF 5CKGA 2EO9A 1OTSC 1ZTXL 2ORBH 3K1KC 5IW1B 2JK5A 3MA9L 3MRRA 4QGTA 1TQBC 1N2RB 2QQQA 4K3EH 4L8BA 4PJ9B 4Y2OA 1U3HA 1MIMH 3CMOL 4U6VH 1Y18A 2F19H 3AY4A 3U4BH 3LEXA 4HH9B 4WUKL 3NBNA 2ZZUT 4V1DD 4JJ5A 2XTJD 2VAAB 4QT5A 1Z5LA 2WUCL 2OZ4A 1XF3B 2HTLC 4G43A 4YFLF 4P5KB 2Y1VA 4QHKI 2IPKB 3BGFC 5E8NB 4XXCA 3QUMA 5GRJH 3U7AA 1C08A 4Y4FC 2FR4B 5F6HI 4BZ1L 2J88H 3L7FB 2NX5A 1SBSL 3U0TB 1NGPL 2A6KB 4UTAH 4EKXA 5MEPA 3SDCA 4P5TC 4EI6B 4OGAD 4JRWA 4NNPL 4AG4L 3RJQB 3LCYA 3MR9B 4PJ8D 3KJ6L 3PDOA 4NRYB 4GAFB 4K71C 4JY4A 4QRSA 3HG1D 2R69L 1I9JH 3UEZA 4YBLC 5IBUG 2WWMC 3ULVC 4M02A 1PQZA 4LEOB 3D0LA 3OXSA 4E42A 2BXYA 2BVUA 4WCYL 3TO2A 2GQHA 4JM4H 2XKSA 4NM4H 3WE6A 3MLUH 3CC5A 3BP5A 4Z7UE 1OB1B 4UT9L 3CVIH 4WI4A 1RVFL 2EDYA 3DMMC 4NQDB 4HPYH 5IB5A 5C09B 3MBED 1GC1C 2KZ1B 4MD4B 4P23A 4ZO7A 1NBYB 3KPLA 1A6WL 1TZHA 3FFDB 4KHTH 2P8PB 4JKWA 3GHEL 1MH5B 3RVWD 4HMCA 4XP5L 1BQHG 5E8EA 4Y5VA 4DUVA 5FM5M 4RA3A 3DTXA 5DZNA 5L0QB 1EAPA 4JO3H 2BSRB 5E8OA 3AMKA 3RY5A 1M7IA 3O6KL 4ZFZA 5C0FB 4PRNB 4XVSH 5KVFH 4JRYD 3MLWH 3G5YA 5B39G 1K6QH 5D2LF 1FNFA 4NGHH 1UB5B 1Q72L 1A7NH 1XCTA 4YDJB 1QR4A 3F65A 1QA9B 2DI9A 5DMKA 5F9JA 3PWPD 1KCLA 4HS6B 5D4QA 5GS0D 5ID0A 1NAML 3GFUA 5DJ6A 1BWMA 3QEQB 5DDHB 3DUSB 3WFHB 3GSVA 3LN4A 4HBCL 4RGNC 5D1XC 4FQXB 3SDXA 3CSYA 3GSXA 3T2QA 4OSUH 3GMNA 1ORSA 4APQD 2RFXB 1FYTE 3BWAA 4FQPA 5I6XC 4I3SH 1OVZA 2EC9T 3PDDA 3SO3C 3WHE1 1F3JA 3DHJA 4I0CC 2VH5L 1HH6A 4XCFH 4XMKH 5J12C 1PLGH 4UINL 1BBJA 4WGWB 4IRJB 5IVXA 3SE8H 1NAMA 3ARED 5FUOH 5AYUH 1CF8H 3PJSA 4PJ5E 5EOCJ 1UGNA 3EYVA 2VLMD 3H9HA 4F7PB 3P4MA 4PP1D 1QFWH 4DGVL 3OKYA 1Q9KB 3QQ9D 3IDMB 2OS7A 3ARFA 3GM0A 3FKUS 5ABDE 1G9ML 4D9LL 3AS0A 3D25B 3LMJH 1S5HA 3ELAT 2Q8AL 3SDYL 5JA8B 5D6DC 2FEDC 3KHQA 5EWIL 3CVHA 3MODL 1G7IB 4J8RA 5E6ID 1MPAL 4I48B 2IFGA 1PKQA 5TE4L 4MDIA 2OL3H 4MDJB 2FYYB 4UQ3A 1F6LL 5J3HD 1E4XI 3A0OA 3FZUC 2RJMA 4GOSA 3SE4C 3WIFA 4U1HA 2Y7QA 5F96L 3GSWB 4WI7A 4GKSA 1YA5A 4EI5A 2N4IA 5GRUL 3IETB 1P84J 1NLBL 1T4KB 3GM8A 4HIHB 2JCCF 5TFSL 4XNMB 3S5LA 2EC9U 2V2WB 5T3ZD 1BPVA 1ZGLA 4MJ4A 5ECJE 3GI8L 3P77B 3I6LD 3QXVA 2AQ1A 5I1DA 1LO4L 4IJ3C 2EDWA 3RTQC 3T0EB 2DI8A 1ONQB 3MV7D 3V6FB 2IBGA 4L4TB 4QTHA 2FGWH 4KI5E 4ZOEA 4G9FD 5E1HB 2KQMA 5KS9A 3ROOA 5HSFA 4OUUA 5IGXH 1YC8A 3SO3B 5IFJA 1KG0A 3C8DA 4MNHA 2PO6A 3RNQB 5SWSB 2I9LA 3QDGE 1U8NB 5MEOB 4YDKH 2YKLH 1ZGLM 1WFOA 3E8UH 3ARWA 4WI5A 2A9NH 4FQIL 3LS4H 3UJTH 1S9VB 1JPGB 2FX8H 1PG7L 3QUYA 5TQ0H 5HHOB 3R1GH 4PJCE 4CU7A 4MD5A 3CIQA 3QB7C 5J6HA 2NY0B 4GAJH 1OSPH 4OV5B 3MJ8B 1CE6B 1XGYL 4ODXB 4HCRL 1CQYA 1ERNA 3TPUA 1KPRB 4C56E 2ERJC 3RGVC 3E1F1 4AEIH 2NXZD 1P6AB 4JDZA 3ULSB 1IC1A 4KTEL 1J87A 3ORJA 1MVFA 4NC2B 1VFBB 4U3HA 3NA9L 4HG4J 3NCCB 3BMWA 3V8CA 4Z7OF 1Q94A 2AABL 4X4ME 1OAKL 3CK0H 3VI4E 1J8HE 1T89A 3RVVC 5DJZB 3ARZA 5HVFB 3C5ZC 1JRHL 1RZJC 4EUPA 1ZHNA 4LFHD 1KCVH 1CXKA 1KEMH 2PR4H 3VFSA 4DFIA 1J5OL 4S1RH 4GW5A 5K9QI 3DUUA 1FVCB 2XQYK 4NKIL 3BUYB 2ZCKH 1F4WH 3LRGA 3DV6A 3RKDD 3EO1B 3I2CL 3DV4A 3QCUL 4WO4D 4D0DB 5FOBB 4WW2F 3DROB 1H5BB 4K8RC 1NANH 5GGVY 4HS8L 4TULH 5D7JA 1RIVL 1RIUL 4KPHH 1M6OB 1D5BA 3QCVH 4BZ2L 3NIFF 3BH9B 3HZVB 2GW5A 2JJUA 3ZL4L 3FOMA 4KROB 5EBLA 4LP5A 4NO0B 1AGDB 4LPUA 5FA4A 3D18B 4K7PL 5I1LA 4UAOC 2H9GB 4UT6H 4QNPF 4L4VA 3THMH 3O3EA 4ZSOE 3CH1B 32C2A 2UVFA 1K4CA 4JY6A 4GKZA 3MRMA 4JFDE 5CCKH 2AK4A 3BN9D 3RUGB 4H20L 4NOBA 2OTUB 4YDVA 1YEGH 2VXUL 1E28B 1IKFH 5L8KB 2VKWA 4M48H 3FN0L 4CMHC 2D9QB 1RURL 5F7MC 5EUKA 1KIUA 3EDFA 3GRWA 1JMXA 2FB4H 3STLA 4JO1L 3NFNA 4Z7QE 2A6JA 4U2ZA 2DKSA 3BGMB 4M6AA 4DN4L 2AK1L 4CGTA 4G8GB 5GIRB 1T0MA 3MV7B 4NN6B 4U1MA 4DZBB 3GNMH 2BSTA 3WFBH 3ZE0E 3VXQA 2VDRH 1U8QA 1MCKA 1I7ZA 1N5AB 4N0FB 5GGTH 5IHBA 1WJ3A 3DGGA 4LCWB 4OD3H 4GRLA 1LO5B 3WHXB 4RSVA 1AXSA 1MJUH 1E4WH 5L88L 4EN3A 5HHXL 4PJFA 5EZOL 4Y2DB 3IDUA 2VXVL 1BVLB 3VH8B 1IRAY 2IBZY 1YEFL 1H3UA 2A83B 1UADC 2IGFH 1G7JA 5DJYA 4PB0L 3QO0A 1U3JA 2EDOA 3QULB 2VQ1B 5I66A 1DL7H 2C1PB 3CX5K 3H42L 4OGZA 4TVSa 2VISA 5CEYB 3RWIA 4CVXB 1QO3B 5C3LD 4JM2C 2XKUA 2KDGA 1CT8A 5E2TH 2CLVA 3JWDH 2Y36H 1X3DA 2N1KA 4EIGB 1V7NL 4HUWB 4YC2C 4Y88A 4P4KA 3DX7A 3L3HB 3L9RB 4R4FL 5D1ZD 3WKML 3W0WD 1INDL 4X6CB 4W4NA 2ADJB 4IRSA 4HUNB 5IEHB 1QSED 2BERA 5HHNB 3R0NA 4O02L 1KB5A 1CICD 4Z7WB 3OR6A 4OZGE 4DTGH 5C0AB 4MQXD 2MCG1 3D9AL 4HKXB 4KZDH 4LGRB 4XP6H 5I1KH 2AAVA 2ITCA 1HHIB 2PW2B 4ZXBD 5DEZA 3CFEA 4PRAA 5C71A 2IBZX 1PX4A 2Q76B 5ITFA 4GXUM 4MAYA 3BKMH 4EXPX 2VJXA 3QCTL 3RWJA 3N85L 3U48A 1ZGLP 4CN1A 1OP9A 4OGXL 4HXBL 4QEGA 3ABZA 1HYRC 1UH4A 1P4LB 3GI9L 1OQOA 3SDAA 3EJJX 4HT1L 4L9DA 1DBJL 2HVJA 3QNZA 4JFFB 4W6WB 4PJAF 3HAEA 3O3UN 4PGDA 5CZKA 1HHHA 3TNMA 3D2UD 1CDYA 1D6VH 1J05B 3QIWC 5JDJA 4BQ9A 1NMAH 4PJXA 5JA9A 2LVEA 4D9QD 5FUZL 3V0VB 2VYRE 3O6MH 2X4OB 3IDXH 1ZVSA 2FJFA 1ZT1B 1KJ2L 1FLRH 1MCLA 1U9KA 4ZPTB 4GG6F 1EHAA 2A6IB 5IWLC 3KPNB 2IPUK 1TVHA 3HZKA 4RA0C 3CCHA 2E9IA 5BVPH 5B39A 2ZUXA 3MRLA 1CGXA 2P48B 4QY8B 1XIWA 3D69B 3HNTH 2IQAB 4YC2B 5MEQA 3TH3T 4X0KB 2NY7H 3MRJA 4Q0XH 5EOCH 1BD2D 4F15C 3HE7B 3S37X 1KEGL 5HDBF 2BHZA 3LKSB 3EFFB 5TH2B 4XPAL 5LGHL 2UUDH 1RZ7H 4Z5RB 5I15L 4KFZC 5EUOA 4NKMB 4YHPB 1P1ZA 2Y06H 1BMGA 3VXOA 1S8DB 3QIUD 2BFVL 4Q2ZB 5BXFB 1AD9A 3GBML 1YMME 2BOCA 2PYEE 1OPGL 5TDPA 2JB6B 1IGCL 3S35H 3QI9B 5KVGH 1JYWA 2F74B 4HUMB 4NUJB 4YDLC 2GAZB 2Q87A 4XXDA 5HI4D 3OB8A 5IB1B 3ZMRA 5JUEL 4AMKL 4WFEE 1A9BA 2ESVA 4KJWC 3UP1A 5D2NE 3OJ2C 1JJUA 4OLZL 1Q9OB 3LSOB 4YZFF 2E7LA 4YAQA 1KTDB 3V9FA 2VB5A 3OXRA 1U8OB 2GJZB 5JOFA 5HI5D 2V2TB 3KYMA 3SJVB 3IXAB 2BY3A 2MSPA 3NCYP 2VN7A 5F1IA 2BNRD 4PRDB 3BVNA 3UBXA 3FFCA 1FVEB 2KL6A 4TSBH 4UIKH 4Q9QH 5BVJB 4XX1E 5L9DH 1FH5H 5CUSL 4XRCB 5EU6B 1F11B 3KNBA 3TBYB 3BYYA 5DYOB 1FPTL 1WT5A 2A74B 4NC1C 4TSAH 4ODVL 1G6RL 5D2LE 4WI8A 3OKOA 4OLXL 3MV8A 3OQ3B 4G42A 3C6SA 4WFFE 2E9JA 5BRZE 4MB4A 3IRZA 2NYYD 2CRMA 1PSKL 1S5IL 3BE1L 3LIZH 4OCYL 3PWVA 2FBJL 3JTTA 3D3VE 4U1LB 3E6HA 3LQZB 5I30L 1WFNA 3C60D 4M5ZH 5E03A 5B4MD 3WJJC 1MAMH 4Y19B 5E94A 4RCAA 1DLFL 5JW3H 3H3PH 3BO8B 3JTSB 4LLQA 5KVDL 2LVCA 3JBG7 3LHPH 3IDJA 2BNQE 3D2UB 5DJDB 3TBWB 1XGTB 4L3EB 5IJKA 5DWUH 2WK2A 5E6YA 4LRIC 5E56A 1I7RB 2OJZH 1LK3L 3RGHA 3TV3L 5IB4A 5IW6A 3HRPA 1EFXD 1A6AB 3EGSB 3UPRA 4JO4L 1AY1L 4YDLB 1IVLA 3B5HA 3EZJB 2Y5EA 1JUFB 1ZEAL 5T3ZH 4JGJA 1P4BL 4E41A 2ICWJ 1Y6NR 2X40A 4R2GC 3T0VA 3U4AA 4Z0XB 3BRDA 3WKNA 3RBSA 4O51B 5BZDB 3FTGA 3VXTB 2AP2A 2OXGA 4XNUL 4DKDC 2VSCA 5CGYD 2NY6C 4DW2H 5CZXD 2MNUA 4PGCB 2ATKB 4W4OA 5AZEL 4X4XA 5DUPL 5IFHL 1J1OL 5JW4Q 4HHAB 4R7NA 4NJAH 3WUWG 2EIZA 2XG5A 3P9MA 4XCCH 4NQSB 1BFOB 2FD6H 1YPZE 2QHLA 1TETL 4M9OA 1D5IL 1VADA 3CX5J 1KOAA 1UVQB 1YN7A 4N1EA 4NKDA 4NN5B 4OLEA 2JCCE 2R0ZH 5IB3A 2VXTH 1U3HC 2XZZA 4PRPE 4MS8D 2Z31D 3AY4C 5T1LD 3ZT7A 4LSSL 3RIFF 2Y72A 4TTDD 4LOUC 1BEYH 3KXFB 4QHNB 1MVUA 3KPRE 3VXMB 4I5BA 2YPKB 4N1HB 5A1AA 3VFMB 5E9DA 2HRPH 5HGHB 3DOSA 2ICWB 4XXCC 4PJ7F 5E2UL 4LF3A 3ILPB 1HQRB 1G6VK 3D0VB 4X7SH 1BREA 2X1OA 5FCUH 4MCYA 2QSQA 4LNRA 1DDHA 1QSFA 1X9QA 4LLWA 3ZKMD 2EDBA 3ARPA 4ZQKB 1WZ1L 5DQ9A 3G5ZB 3IDNA 2YSSB 5BJTA 3SDCC 4P4RA 5TE7H 2IH3A 1PZ5A 3IVKB 2LU7A 1CIDA 1EXUA 1JWUA 5TDNA 2R8SH 2ENSA 5DJCB 1KTLB 3BEWB 1XGUA 1CL7I 5EZJA 1CXLA 1T22B 3QXDB 5F7UA 3ULUH 1BOGA 3WEXB 2I60H 2I07A 3RI5F 4ZG1A 4R2GB 4I1NB 2W07A 5IOPA 1DN0B 5GSVB 3O4OC 3VGDA 4F7EB 1A9EB 4CU8A 2ARWA 3B2UC 4AEEA 4UU9A 5T1KB 1S9YB 1TENA 4PJEA 3VG9B 4Z7UA 1I3VA 1DBAH 4UDTB 1P7KA 3FO0H 1GGIL 2MKLC 3AGVA 3RY4A 2NXYB 1RAMA 3LQMA 3MZTA 1A3RH 1DFBL 2AJXH 4P23C 1CGYA 2PKDA 4LLMB 5C0DB 4M1DL 1JYXA 1TCRA 1YEDA 4Y5VC 4LBEA 1WCBB 4F9PA 2ICEB 2JK5B 1X5IA 5MI0C 3QUXA 1WBYA 3MRRB 2ICWI 4H26B 3A6CL 5SWZA 3PQYD 5IEKB 2VLKD 5GRXG 1A14L 5DEFA 3SGJA 3QDMB 1MHPH 3TYGL 3F6LA 3P2TA 5KSVA 3MOQA 4JJ5B 3K4ZA 2PCPB 3NPSC 3E6FA 4QT5B 2Z91A 2NW3A 2YR3A 1MRFH 1Z5LB 2VZUA 1NCWL 2W0FA 3ZKQD 1AO7E 2G2RA 3L5WA 1AHWA 1R3KB 4EVNA 4K94H 1AD0A 5FYLD 3PGDA 2GFBA 2VXQH 4KQ3H 3U0PB 4UV4H 2XZCH 4R90H 3GMMA 4PBVC 4NM8H 4ZTPL 3SDCB 2F8VA 2VO5A 3K1DA 2MPAL 1UM5H 3MRFA 4BH7A 4JRXA 4KHXL 5JTWA 1IEAA 2A77H 5DA4A 2F54D 3FO1A 5DHVB 2N56A 5E5RB 4CL7A 2C4FU 1BFTA 2Y6SC 4XP9H 4WHYG 4JY4B 4QRSB 1IAIL 5FYKH 4JLRA 5F8QC 4LHJB 2CKBL 2P5WA 1NGZB 3ZTNL 2XN9E 1PQZB 1LO2L 5EBMA 2RGSA 3EYSH 5CHNB 5ERWB 4ONOA 4E42B 3O4OB 4NOFA 4PD4K 2Z31B 2IFFL 4DAGH 5IF0B 2R2HA 4KRPB 3WE6B 2AQ3A 4D3CH 3ARFC 5AAMA 1JL8A 4ACPA 1V3KA 5BS0E 1N26A 1VEOA 3VMOA 3HI6L 5IB5B 2AS5M 5LVEA 3NFSH 4HGWB 4U31A 2O5ZH 3S8WA 1CK0L 4FQ2L 2IANE 3Q2CA 1OCWL 5I8EA 4KXZI 2KPNA 3WIIH 1QBML 1BJMA 1XFPA 4Y5VB 4MXQD 3BD4A 3TYFB 4G7YH 5MI0B 3QA3A 1EAPB 1GH7A 1V3MA 3M8OL 4YDIH 3MLZH 2IC2A 5JPMA 1QKZL 2Q86B 4QRUA 1FL3B 4EI5C 1KENL 1IC7L 3G5YB 4P2RD 3HI1A 4P2QE 2APTA 5JOPE 2EIEA 1JZ4A 1XGRA 1A64A 1JI2A 4ERSH 3RNKB 1G9MC 5J89A 4RQQA 5DMKB 5F9JB 2X9YA 1UACH 5DGQA 5ID0B 2VDOL 4FZ8L 3DURA 1JK8A 1OSZB 1ZA3A 5DVLA 4WWID 4ZNEE 1WBZA 3W9DA 4C83A 1F58L 1IGJB 4HUXA 1FZKB 3B2VL 1IAIM 4NZRH 4G8FB 3LN4B 1HH9A 4XTRD 3KPQA 4BUHA 4Z7VA 4PJHB 3SDXB 1TQCC 3O0RH 3GSXB 2RB8A 2I24N 3GMNB 4KK5D 1A6VH 2HFGL 3SPVA 2YPVH 1F3JB 4LSVH 2W65A 3RZCD 1FVDA 3QDGA 1F6AB 2PO6C 4MA8L 2HT4C 5HYSG 5ILTH 4P2OA 2DQEH 5I0ZA 1HDMB 1I1AD 5HHQA 4GLRH 3V79C 4GRMB 5CEXA 3EJZC 3IJHA 1ZXQA 1BBJB 1W72A 5FKAA 5IVXB 1G7LA 5EIIB 1F90H 1NAMB 2C1OA 1MCCA 4X99B 1Q0XH 3QUYC 2ITDB 3EYVB 2IG2H 1DUZB 1IAOA 2J8UF 3GJFK 4BSVA 3MLYH 1GXEA 4U33A 2NY5C 4WFHE 4OM0L 1U93B 4NZTH 4C56A 1PD6A 1WFTA 1QFUL 2M8XA 1RFDH 4HIIA 3W5NA 4NQEB 4HJJH 4GAYA 3STZB 5D7IB 3TF7C 5JIPA 5GGSA 3NOIA 5E95B 2WBKA 4G6KH 4E9LA 4CNIB 3EIFA 4ELKB 1PKQB 4MDIB 4UQ3B 4ZO8A 5JNYA 4ETQA 1JFQL 5D5ME 1T2QL 4DKEH 1Z9OA 1T89C 2Y7QB 2BDNH 3LRSB 1YEIL 4GG6E 1UZ6F 3PXHA 4TVPL 3QZWG 3EJYC 3OZ9H 4QCIA 3WFDL 2B4CL 1I9IH 1HKLL 4J23A 1C1EL 1NEZG 5CMAA 4X7TB 4CJ1A 2QTEA 1OP3K 3OKNB 4HUUB 5IK3A 5D7JC 3MV9D 1MJ7H 1WC7B 1QLEL 4U3CA 4M4RA 5IP4A 1R3LA 4LSRL 5FO8A 2DD8H 4WWKA 4M7KL 2ATPA 3KYKH 2Y9RT 4J12A 1CGSL 5FO7A 2FH8A 3V5DB 1N0XH 1CLOL 1JZ8A 4WHTB 4GQ9L 5ALBL 1GOFA 4ZSOA 1F13A 4MNHB 3HMWH 4OCXH 2DQFA 2I9LB 3GSRA 1X5XA 2QSCL 4LLVB 1MEXH 4PJGB 2VLJE 4JPKL 1B4RA 4N5UA 2HG5B 3MRQB 1UXSA 1MHEA 4GXVH 4YZFE 2WBJD 4XP4L 3QDJD 2QADC 1ED3A 2Q6WA 4HIXH 4XPHH 5F1NB 3QUKA 5K9KA 2JIXA 2QBWA 5C70A 4DEPC 1ORQB 3ARTA 4R3SA 1J1PL 4JDZB 5FECA 3GMPB 3HFML 3ECBA 4Y4FD 3F7RA 3PDGA 3OKDB 3JV6A 1RMFH 2CK0H 1OW0A 2P43B 4LKXB 5ICXB 4X6DA 4YQXH 3BP6A 4GRLC 4RWHA 1TZGH 2B2XL 2DMBA 4P5TD 2JJTA 2FIRT 5HHME 5IR1A 1ZHNB 4EN3C 1MCOH 1VFAB 2ZOKA 4N90D 1KV3A 2VC2L 1WLHA 4QRRE 5DR5L 2ZCHL 3DV6B 1OGAD 2WWMD 3ULVD 4P0DA 3DV4B 4KXZH 1F3RB 4XVJL 5DJAA 4JVUA 1YEHH 4LHUA 5D7JB 1ZTXH 1LWRA 1ZWIA 4MQ7A 2YD6A 2A73A 3ZKSD 3MA9H 2QQLL 1LEIB 3ZHLA 3DMMD 2J1KA 5D7LD 1NCAH 4P4KC 3TZVA 2A6DA 2O61A 3FOMB 3DVGB 5GGRB 1UYWL 1S7WA 2X9WA 3CMOH 5FA4B 5I1LB 5JZ7C 3DPBA 5FUCC 1G1CA 1LK2B 4X8JB 5DHVH 4L4VB 2XV6B 4IRSC 4WUKH 3VXSE 3ZSTA 3O3EB 2R1XA 5H94B 5BV7L 32C2B 1K4CB 1KPVB 4JY6B 3ES6A 1MFNA 4F7TB 3NABL 3WIHA 5IMLA 2WUCH 2YS4A 4OZHB 1RK1B 1QZ1A 4LAQL 3VD9A 3G6JB 1MWAH 3OSKA 1AJ7H 3CFCH 5MHSD 4CRPA 4PTTB 3AC0A 1FN4A 4H5SA 2UWEF 4MAYC 3UC0H 2YPLE 4YR6A 5IQ9A 4M6ML 4RMWA 2PF6A 4DEPB 1LDPL 3STLB 1EMTL 3NFNB 4NNPH 1JN6A 2WLYA 1JNHB 4NHCL 3SDAC 4MSWA 5E2VH 1EX0A 5KOVC 5AG8A 4O2CA 4KUZL 1MJ8H 4RGND 2R69H 5D1XD 3FMGH 1VGEL 2YBRA 4NCC1 2GITB 4ZFOL 3VXQB 3MGTA 4G3YH 4ELMA 1FJ1A 5EULV 4XPFH 1I7ZB 6FABH 7FABH 3DGGB 3GGWB 4GRLB 1I9EA 2QSTA 1J0IA 2ZUSA 2A9ML 3AVEA 4EN3B 1I85A 4LU5L 4LCIL 5LQBL 2BRQA 4UT9H 3L5XL 1JRHI 4XWGH 2R0KL 1EO5A 4LCCC 2AI0H 4LSPH 1KELH 4WNQA 2VLRE 1IGFL 5B38B 3WNOA 1FSKC 4HJGB 5I66B 4I4WA 1BLNA 3FONB 4DZ8A 1KN4H 1W8NA 1T1YB 2Y07L 4JE4B 4UDUB 3RWIB 3V0WH 1MFEL 3GHEH 1DQJB 4FTVA 5H2BA 1JGDA 4YXLL 1OAUL 1XIWC 2CLVB 1RQ5A 2FJGA 5L2KB 3T0DA 3CFBA 3ZTJG 2V5RA 3KHOA 4IBLT 4KVCL 3DX7B 2QR0B 5F9OH 4BFEA 5JIHA 4ODWB 4EEEA 1J8KA 4QHUA 3MRBB 2CUMA 4QXUL 3EYOA 5ICYB 4IRSB 2HP4A 3K2UH 4WI3A 4X6FB 4HD9A 4Y5YA 4AQOA 3OR6B 1YMMA 2PYEA 3FZUD 1ZVYA 4QWWC 4X6CF 3VJ6A 3O6LL 5HGAA 3V8OA 3PWLA 3CFEB 5MEND 4Z7WF 1IARB 2NLJA 4KKNA 3P0VL 3T8XB 5D2NA 4ZPVA 5FKPB 4MAYB 4OZIF 3C08H 2EDJA 4KK9C 4PY7A 5CAYB 4LHQB 3O6FD 3SDDA 2E7LC 3HCVB 4NWTL 4Y5XA 1LNUB 3SDAB 2YXFA 3M17A 5FYLH 2HVJB 3RTQD 3EOTH 1Z6JT 3PHQA 4PREB 2FIKB 5IKCA 3ULUF 2V7HB 3HS0A 4JFEB 3U4EB 4HUVB 1DVFD 3VE0B 2WINB 3HN3A 3DWTA 4QF1A 5BQ7B 3RDTB 1DQLL 3O3AB 4KKLC 4PJXB 4BH8A 1RULH 3QEHA 3HZYB 3U7YH 1UC6A 3QHTC 1QOKA 5C08D 1U36A 3MLRH 2DBJA 1JGUL 2FJFB 5E08L 2F53D 2Z35A 2Q8AH 1WT5C 5D2LA 1RUPL 3ZE1F 2NW2A 1DQQA 2KQNA 5C07B 1MPAH 3QPQC 4J7RA 2IALB 3IU4H 3MRLB 4HFUH 1XIWB 4HZLA 3D3VA 1DEEB 4M93C 4HKBA 4AY0A 5BW7A 4B0MM 3P3YA 5CP7A 2HMIC 1TJHL 4JFZL 3RGVD 2DKMA 1Y0LB 1Q8MA 2DIJA 1XCQB 5JHDA 3CNKA 4UB0L 5C0RL 4G7VL 1NLBH 4WGVB 5ID1B 3MACL 5ISZE 5EUOB 2J4WL 4M1CC 1FC2D 1KB9K 1KJ2B 5EO9B 5IJKC 1R5VA 1T1WA 4PJBA 3GI8H 1R3IH 4LCYA 4L1HA 3C5ZD 4BQBA 5CJQH 5EC2B 2FLRT 4PJDF 5A16A 4P3WA 1E4KA 3ALXA 2YZ1A 3D39D 4PRHD 3MMEB 1G7QA 2D3VA 5HYSA 3FT2A 3MA7B 2P8LA 5T5FH 1G7PA 2IPUG 4K8RD 3T4YB 4CW1A 4P5MA 1QLRA 1A7QL 1C12B 2MQ0A 5DK2A 2CLRA 1GVIA 4YAQB 1GIGL 1IGIH 3FRPG 3ZDYF 3OXRB 1S7QA 1O0VA 1FL5B 5FYJD 3EOAB 1CFSA 3D85D 5T33H 2IWGA 4IS6A 2C3VB 5F1IB 5CLTA 1DE4A 5C0JB 3UBXB 2YD7A 4PG9B 4R0LA 4N8VA 1PG7H 5I75C 4W4OC 4K07A 3TCLA 3O4LB 3BZ4A 1C5DB 2VDQL 3FAXA 2BVQB 4H88H 1CDHA 3BIKB 2P47B 4UQ2B 3DXAB 3ZE2E 4XCNA 4JQIL 3AXLB 2R0WH 3OKOB 5A2IH 5C6TL 1L0XA 4G42B 4LEXL 2NNAA 3U0WL 2JCCA 2OM5A 1QFHA 4YUEL 4TUOA 3DO3A 3QZWA 1B90A 5IM7A 2GCYB 4BQ6A 1NAKH 2XA8L 2G9HB 1GHFL 5CJXA 3PWVB 4M93B 2K9UA 3JTTB 1OAKH 4Y7MA 1OP5K 5E7FA 4NHUA 2B0SH 4OF6A 3KPRA 2FX9H 4FQLL 1NEZA 2EC8A 4BELD 3E6HB 2GJ6A 4FN0A 4LQFL 3MJ6A 5A43C 2HAZA 4LLQB 1QRNB 3BW9A 3KWWB 3I2CH 4HKJB 1DBML 3B9KA 3QXUA 1G6RB 1X5YA 1JV5A 2EDKA 2DOCA 2WWKO 1N6QH 4I3GA 5IB4B 2EYSA 2J5LC 4IMLA 1VFMA 3UBXI 3FO2A 5KAQF 3SQOH 4ODTH 5E4IA 3L5IA 4YHMH 2DWEA 4E41B 1CGUA 1NCDL 3QO1A 4AT6A 4PB9L 4LPTA 2J8UE 1ZLWK 4DVBA 4QOKA 4HK0A 1U58B 4JM2D 2L7UA 2CJUL 3ET9F 3U30C 2X4RB 4X9IA 3O2DA 1G9NH 4XPBH 1WSST 4KQ4L 3VFPA 5E99L 4PPTA 1YEJL 4KVNL 3TVMA 4V1DE 2F5BL 2Q8BL 5CILL 3VXUD 2XTJE 4XNXH 1PW3A 4HWEL 4RMSA 5I75B 5JW5B 3FN0H 1EO7A 1BJ1J 4ZS6D 3NFPA 3WLWC 5IG7B 5KJRH 1O7SA 4QHMB 4F9PC 1RJZA 2FRGP 4JO1H 3QUXC 4TQEH 5F89B 3L3GA 1VADB 2CGRH 3G9VA 4HLZH 3NIGF 1EEYA 1RUQL 4WW2A 4FA8A 2B1HL 5IB3B 4AH2A 3V5KA 5HI3C 3QQ4B 3SGJC 3ZKND 2ADFL 1LQSR 1VEMA 1UCBH 1LP9E 3GO1H 4I77H 1GGYA 4K9EH 3HG1E 3HMXL 1MVUB 5L88H 3TEUA 4I5BB 3G08B 1UA6L 1RUKH 1YEFH 1ACYH 1FNEA 4Y4HD 1AHWC 3QQ3A 4PB0H 5DJXB 3V6OA 3RWFB 3QIWD 5D1QA 4LLWB 3MYJB 2J5LB 3BKJH 4Z76A 3K8MA 5DQ9B 1N4XL 1VACA 4P4RB 2IH3B 3O81A 1EXUB 1JWUB 2LV4A 3HZMB 3U2SA 2R2BB 3V4UH 4EDXA 4TPRL 3EYUH 2DYPA 2W9DL 3QJFB 4HIJB 4LPXA 1NH6A 3MV11 4GUPA 4K7PY 4UMGA 2P24B 2VL4A 3VFRA 1DBKH 4KY1L 4O58H 1I75A 2CKNA 4JRYE 5EFIA 1SY6A 1RHHA 1XF5A 4Z7UB 4X80L 5ETUA 4XCYA 3CXHJ 3VRIB 1FFQA 8FABA 1QR1A 3PWPE 3GK8L 4NQCD 3FB6A 1INQB 2ENYA 1CTNA 2EE2A 3J7HA 3WBDA 3QCTH 1ZS8A 4GBXA 2VQUA 4OGXH 1S9XB 5HVGB 1GCFA 1CFVH 4HKZB 4RZCB 3QUXB 4N9GA 1JPFB 1V8HA 5ICZA 2C3GA 4HT1H 4MMXC 3KR3L 4JO2L 4F33A 5I19H 1QBLH 1EEZA 1D5XA 2L4OA 4RAUA 5IMKB 1RIHL 3H3KA 4KJWD 4DGIH 2VITA 1OAQL 2XWBA 3F58L 4NNXA 3BDBA 1FRGL 2OI9C 1NJ9A 5KSVB 2D0GA 4K7PX 2EKJA 3BFOA 3GJFH 4UIMB 5HHVH 2SEBB 1YECL 2H2SD 1K5NA 4KKBC 2DQHH 3WN5B 1B4JL 3ARBB 2BRRL 2A2QT 2XACC 5DFVC 1BFVH 5K9JH 1UWGL 3OPZH 1OAZH 4MD0B 2XY2A 4HWNA 2VLME 1MCNA 3X13A 1AD0B 2YMXL 1FZOB 3JWOH 4LNVA 3CLEH 3WSQH 2MFNA 4YXHL 1FYTB 3ARGA 5KBNC 5T1DL 2ARJA 4KDVA 5T3XD 4X6BA 1T5XA 1S9WA 3IYLW 2C5DC 2DQJL 1C5BL 4P2OC 4ZAKA 2HFFB 3PABA 4RNRB 2FHFA 3FQUA 3BIAX 4QRPA 4JLRB 4P2CG 2CDFA 3MXVL 4G6JL 5EBMB 2UWEE 4PJ5B 4NWUL 1FGNL 4HC1L 1INEL 1CFNA 3VW3H 4K2UL 5KOMC 2R2HB 3ESVF 5I8KH 2P1YA 1IGCH 3RPKA 2AJYH 4PJAA 4K7FB 2ORBL 3UZQA 5K9OB 1S7RB 5T3ZE 5C0IB 3CSGA 3I6LE 4J1UA 1U8IA 3Q48A 2B8OT 1BX2A 5HBBA 1VCAA 4YPGA 3L3JB 4OCWH 3ZDXE 2YD5A 1MSPA 5D7KD 1XH3B 3MV7E 1NBQA 4LSQL 2HFEA 3WNPA 3QA3B 2CKBB 3U4BL 5ADPH 4G9FE 4J3UA 4MNQA 4LCWE 5GZOC 5H35B 5C0BD 1U92B 4QRUB 4U1KA 1NC4D 1IZJA 4OCSH 2C9AA 3FCTB 3KPSD 3ARDA 1CBVL 1XGRB 2XYCA 3FQTA 4U1NB 5GRJL 1GJIA 3O9WB 1KFAH 5SX5K 5CUSH 3MRNB 3QUZA 2X89D 3DURB 5JOEA 5C2UB 3NCYS 4D8PA 3MCLH 3ARSA 4MX7A 4DKFH 1WBZB 4ZUWB 3U7WH 5HYJA 4C83B 4UTAL 4HUXB 5F88A 2P5ED 1I8MB 1AP2A 4B41A 1HH9B 1G6RH 4WWKC 2NY6D 4FFYH 1HHKA 2VWEE 4OT1H 4XNZC 4Q9CA 3V5HA 1I9JL 4ODUB 4XI5C 1PSKH 1MI5D 3KG5A 4OCYH 4KRNA 3MROB 3C5SB 3GSNH 3RU8L 2B4CC 3QDGB 4PJHF 3NIDF 4P2OB 3QRFM 2EXWC 4JM4L 5CIPB 5DK0A 5CEXB 5I30H 5J06A 3BPCB 3MLUL 3MRPA 1ZHBB 5FKAB 3LEYH 4MA1C 4LVEA 2VLJA 1DLFH 5IB2A 3SKJL 4OZIE 1K4DA 3QG6A 4HPYL 1U3HD 4ODSL 4PJCB 1IAII 4DGYH 5KW9H 2OR7A 2B5IC 4HGKC 4L8CB 1DN2A 2W91A 4BSVB 4F7CB 2GEEA 1CFTA 4WU7A 4LOUD 4KHTL 3UTOA 2OR8A 3UDWA 2VABB 4C56B 4GH7B 1KT2B 2CIIA 1NCUA 3FB7B 1SJVA 1AY1H 4ZTOH 2DJSA 3FRPA 4JO3L 3F7VA 3CUPB 1A4KA 1RZKH 1F02I 1FP5A 5J9PA 1X7QB 4RWYH 5KVFL 3DARA 3RVUD 4WTZA 5JNYB 3W9EA 1K6QL 2PXYB 1OW0C 1J8HB 1P5UA 2NX5D 1YDPB 4NGHL 2FSEA 5D7IF 5A2KH 1MUJA 1QVOA 1U8HA 1Y6MR 1A7NL 3QIBA 2HJFA 2JJTC 5KANI 2Z92A 4HEME 4HDIA 1JHKH 4IM8A 4HX1A 1F8TH 4RAVA 1WV7T 4GW4A 5IMOA 4RMQA 4YK4C 5CMAB 1LEGA 1GZQA 3H0TB 5J11B 2NY1B 1M71A 3B2UD 1SJHB 3O2VH 4OSUL 2BOBA 2YOCA 2HLFD 4I3SL 4CVWA 2V9RA 1CU4H 1EHLH 2GSGA 1R3LB 1TETH 1D5IH 4XMKL 2ATPB 4Y1AD 3TZVC 3S97C 4CN4A 5K9QG 2AJZA 4POYA 3G5VA 4P23D 1XR8B 4F2MB 4Z95L 3T2NH 1NGYA 3SE8L 4IHOA 3TNNB 4L29B 4ZSOB 5FUOL 5AYUL 1CF8L 4PJDE 2WIIA 4JFDB 3EBAA 4OD1L 1BJ1H 5ENWA 4MXWH 3MXWH 4MA1B 1SEBB 4U1JB 3UPCA 1I9RH 5F7LB 1G84A 3LMJL 3B5TA 1MHEB 2BJMH 3PF2A 4S0TD 5I16B 3S36H 1G1YA 1EUTA 5EOQH 3C5JA 5I17A 2PW1B 2JIXB 4PJGF 2YC1B 1A4JB 5FO9A 1JCKA 2OL3L 3LKQA 4R3SB 1DUYB 4WJ5B 3Q3GA 5T1MA 1U8PB 1SVZA 4XBPA 5JMRA 5I9QC 4JHWH 2DQTL 5C0EA 1OARH 3INUH 2R1WA 4Z78A 3V6BR 1XF4A 1S7SB 1HIML 2DQIH 3BP6B 4ZFFA 1KNOB 3W0WE 5EDXA 4Y16B 5KZCB 3UMTA 4OB5H 3G04A 1I85C 5H37H 1WITA 4AL8H 1MAJA 1QSEE 3QFJA 5DURD 3L3DA 1HEZA 1U2CA 5FB8B 1RK0A 3H9ZA 4NO3A 1DFBH 3S3JA 4ZUTA 1ZLSL 3RQ3A 3O45A 4ZUVB 4LHUB 1JZ7A 2VE6A 2FGWL 1X4XA 2EZ0C 4YE4H 5DXWA 5D72H 4PLOB 2GK0B 1K8DA 1ZWIB 4BKLA 3LD8C 4N0YH 5IGXL 3ARFD 1QFWM 3VCLA 4L4JA 4PJ7A 2O61B 2A6DB 2PUQT 1EEUA 2YKLL 2ZOLA 1I8IA 3E8UL 3KDMA 5FF6B 1MLCB 2XKNA 3OR7A 5IMMA 3H9SA 5AEAA 2FCBA 2A9NL 3CFDA 3LS4L 4H1LB 3C6LA 4M7LH 4V2CB 2FX8L 5TQ0L 1NUDA 3MUY1 4OZGB 1IM9D 4Y5YC 4P2YA 4LPCA 2X4UB 1U8JB 2ID5A 4GAJL 5LWYL 5HHPA 3BZEB 2OJEA 4EI5D 2M1KA 1A2YB 1J12A 2AV7A 4X98B 4D9QE 4AEIL 4LAJH 1EDQA 1UM4H 3MTRA 4JG1L 4W70A 3OG6B 5D2NC 5FYKU 4OZHF 4H5SB 2O5XH 2P46B 5F7HA 4LPVA 3SO5A 1CN4A 3ARVA 2IAMB 3G6JF 4YR6B 5KSBF 2J2ZA 2APXA 4S0SD 3SDDC 4FQQA 2MPAH 4KHXH 3VMNA 3CK0L 4M1GH 4Y5XC 4MSWB 5DD0L 4JY5H 1JPST 1XR9B 1I7TB 5BV7B 1KCVL 3NN8A 1KEML 2PR4L 2GTWA 4S1RL 2H32B 2YBRB 2CKBH 1ZHKA 3AAZB 3ZTNH 3ZSSA 4B50A 3U36B 1LO2H 1BD2E 4BFGA 1KN2H 2ZCKL 1F4WL 4R97B 1S78C 5D8JH 4PGEA 5ACZA 4HPOH 1GSMA 2PO6D 4I18A 2OQJB 3VH8G 4KPHL 3EJZD 3IU3B 5E2WL 4XZUA 3DX6B 3KGRA 5IW1A 3FN3A 4O00A 1XF2A 1CK0H 4FQ2H 2O5YH 3QUYD 3TIEA 3EO0A 4Y8AA 1E27B 1JGDB 4UT6L 3UTZB 4ZFOB 4HH9A 3CFBB 3THML 5BW7C 3QWQB 1B0GA 4POZD 1IE5A 4GAGH 3NH7H 3HTLX 5IQ7H 1A7OH 2VDLH 1MAKA 1IGYB 1KF9B 1TLKA 1XF3A 3JV4B 4P5KA 2IPKA 1YEGL 1RJYA 4M8QB 1IKFL 3BZDA 3VWKB 1KCRL 1YMMB 2PYEB 4M48L 1SM3H 2YA0A 1PYWB 3LS5H 5IW3A 3U6RA 4PV9B 2BNRE 4L9LB 3VJ6B 4PFEA 3O11A 4G6AC 4NO2B 2FNBA 3EJYD 2A6KA 4K23H 4PYHA 2FB4L 1E4KC 4NQVB 4EI6A 4JFOB 2IF7A 5D2NB 4ZPVB 5ALCL 3IDGA 2X9XA 4NRYA 3GHBH 4PY7B 5DC9B 1MF2H 3SY0B 3SDDB 3GNML 3KYAA 3WFBL 1OP5H 1AFVH 4LEOA 2VDRL 5GGTL 4OD3L 4JN1H 2DICA 3VMPA 1MJUL 2IBBA 1E4WL 2C3XA 2X2YA 3BESR 3OAYH 1BZQK 5J7CC 4WEMB 4NQDA 5T3XH 4QF1B 4R0LC 2IGFL 5C09A 3FQXB 4BH8B 1P9MA 4MD4A 4I0PA 2J3SA 1NBYA 1DL7L 5KN5B 5I73B 1Z3GH 3FFDA 1YJDC 2VR9A 3EFDH 1MH5A 2ZNXA 2AK4D 2Z35B 5E2TL 3IAQA 2Y36L 2EEBA 5BRZB 3T4AB 3NA4A 1MFBL 4K3JH 2NW2B 1DQQB 4PRNA 3MJ9H 1A0QH 3T3PF 3CH8A 3OGCB 4M03A 3HC4H 2QADD 5J13C 1ZLWH 5E00B 5CJXC 2WV3A 3SCMB 3D3VB 5D71H 1QPPA 3B6SB 2DLFH 4U6XB 3GMRB 4YDJA 3ZLQC 1AXTH 5E8PB 4DTGL 3DX8B 3UTPE 5SV3A 4KZDL 4XP6L 5I1KL 3QEQA 1HKLH 2A1WH 3LN5B 1MFAL 2BNQB 5DDHA 2KKQA 3DUSA 1AC6A 3B9KC 2BX5A 4FQXA 1R5VB 1T1WB 3BKML 5K59E 1DP0A 4P99A 1JE6A 2EYRA 2RFXA 4OFDA 1SQ2N 4D94A 4Q6IB 5A16B 3MO1B 2CDEB 1G7QB 4G6FD 1NCTA 4M7KH 1NMCC 2P8LB 1F6FB 1ADQA 1TITA 4JHZA 5CFHA 2GUOA 2J8UA 1A7PH 3VXRD 3MLPA 4H0HB 4IRJA 4P5MB 1QLRB 3VRJA 1A5FH 5EPMA 3I02A 5GGSY 4GQ9H 5ALBH 1D6VL 4WUUB 3FHQA 3UX9B 5LAXA 1NMAL 1S7QB 2F9BT 2GT9B 3U46B 4V1DA 2QSCH 1IQDB 1CFSB 3O6ML 4P4KD 5ESAB 1ZLVK 1Q9KA 4IS6B 3IDMA 3TVMC 2B7DT 3B3IA 1SVCP 1PG7W 1FLRL 4JPKH 4OZFH 3D25A 4R0LB 5IVZB 5TDOA 4N8VB 2CIKB 2G5RA 5JZ7D 3ZHDA 3TCLB 1MOEA 1IAMA 3M1BB 3BZ4B 4WFGD 1G7IA 4AYFA 4I48A 2MMXA 4FQHA 1O5DT 5BVPL 4XCNB 2FYYA 1YPZB 4LRNL 3HNTL 3TBSB 3QPXH 3V6ZB 1QBAA 1MCDA 2JCCB 4Q0XL 5EOCL 1N5YH 1B6DA 4TUOB 5DD5L 4Q74A 5C6PB 4WW2C 4Z8FH 3GSWA 4PRPB 3IETA 4PJ8A 3QNYB 1RZ7L 4E0RA 1T4KA 1FFNA 3ZDZF 1CD0A 4HIHA 2B2XH 3KPRB 1UKSA 1OLZA 3QUMH 1VA9A 1OD9A 3DYMA 3P77A 3VFNA 1DSFL 2P42B 5TF0A 4PJIE 2NZ9C 1MRDH 3S35L 2ZCHH 1IC5H 4XVJH 3V6OC 1CD1B 1ONQA 2VLLA 1UH2A 3V6FA 3GJEA 4L4TA 5D1QC 4DWHA 2X42A 5GS0L 3NIDE 4NIKB 3QWRD 4OKVA 3WLBA 5EIQA 5F3BB 5J1SC 4B53A 3FO2B 1S7UB 3DIFA 3RNQA 3SHSA 5MEOA 1CDJA 1WAAF 2OSLA 4H8WC 2KZWA 1UJ3B 3NZ8B 1A3QA 3PQYE 1S9VA 4O4YH 1JPGA 1A21A 2VLKE 5I1AB 3LKOB 3KYOB 4TSBL 4UIKL 4Q9QL 2H32H 5L9DL 1FH5L 4OV5A 3NABH 3VFPB 5E1AB 3MJ8A 5F97E 4LAQH 4ODXA 2AEIT 2BMKB 3BQUB 1HNFA 2X4NB 3GKWH 4TSAL 1A6UL 3ULSA 5LBSL 5HD8D 2CR6A 3L6FB 3SEPA 1WQVT 4LP4A 1VFBA 5J6GB 1GGCH 1OLLA 1CDBA 4M6MH 4GBXC 1AIFB 2LTQC 5FYLE 4J3XA 1FORH 3GKZA 3VDBA 4OF3A 4OF8A 3L3GB 4GRWH 4O2FB 4M8VA 1K9TA 1T7VA 3IF1B 3K4AA 4AH2B 4DCQB 2YK1H 4R4BB 1FVCA 2F54E 1MAML 2DIAA 4NQTA 3PL6B 2ESVD 5JW3L 3ME0A 3BUYA 3H3PL 3WO4C 1CLYH 5CD5D 4M7JH 3EO1A 3LHPL 3DX9A 4JAMB 5FOBA 4D0DA 3BPLC 3DROA 1H5BA 3UTTD 5DWUL 4LU5H 1AO7B 1AC0A 4RDQG 5CBEB 1M6OA 4I0KA 1T2JA 1FV1B 1FNEB 3QQ3B 3BH9A 3HZVA 4N5EC 4KI1A 1CD8A 1KXQE 3CFIC 3W82A 3FFCD 3SE3A 5D1QB 4X7DC 5T3ZL 3GMQB 4YFDB 3ARGC 3FRUA 4KKLD 4JB9H 5I74B 1CZ8H 4ODBD 4NO0A 1AGDA 1NC2B 1LE5A 2WM0A 4YXLH 1EZVY 1AGCA 1N59A 2VSDA 2R4SH 4ZAKC 3MV8D 2XN9B 4NFCA 4FFVD 2UWEA 2OTUA 2BXZA 4DW2L 1E28A 3VFRB 1CI5A 5SX5H 2EDHA 4P2RE 3UROR 5IBUB 4NJAL 1MHHB 3M45A 3O6LH 5BS0B 2HMID 1FIGH 3CVHH 2APBA 4XCCL 3HKFA 1QR1B 3JV0A 2FD6L 2IANB 1OOAA 4M1CD 3OWEA 1C5CH 1A1NB 1JF1B 3FT4B 2IADA 1KJ3H 3B8YA 5AWNL 4G8GA 4LGSB 2VXTL 5GIRA 3MV7A 2Z93B 1AH1A 3WJLA 4UZGA 3RPIB 4D0BA 1F4AA 1N5AA 1GOGA 1BP3B 4N0FA 4N9GB 2WSKA 4ONGH 4LCWA 5ICZB 3RL1B 1ZK9A 1BEYL 3H7LA 1EZVX 2V2XA 2AERT 1TZIA 3MJGX 4UOJA 1D5XB 4FQCH 4P2QB 4XMPH 4Y2DA 3VH8A 1MY5A 2VITB 2XWBB 2X4TA 3ARDC 5F71A 2X7LB 1NJ9B 1P2CB 4X7SL 3F12A 5FCUL 4PUBH 1L7IH 3QUZC 3EYQC 5CEYA 4CVXA 1QO3A 1P7QB 5KG9A 4MYWB 2R8SL 2E9WA 1S7TB 4HUWA 3E3QE 2YWYA 3L3HA 3L9RA 2K1MA 4LVOC 2NCMA 2I60L 4X6CA 2WWKT 1A6TB 4P3CH 3LN9A 2AJVH 2QL1A 5IEHA 2D03H 5E8DH 4Z7WA 5J1AA 3O41B 1DBAL 5C0AA 1NFDF 2DM4A 3FO0L 1YEEH 4OZIA 3LKNA 4HKXA 1QHOA 1HHIA 1CDCA 5KSBE 1A3RL 1U0QA 1CFNB 4JCMA 3ZKXB 4PLKC 2XT1B 2AJXL 2VRAA 4ZNCD 3ARYA 3PE9A 4KH2A 1BJ8A 5INCB 3EHBC 3UDWC 4LKCB 1HXYA 5FHBH 1YNTA 5E9DD 1P4LA 3HLAA 3ZYIA 4WW1B 3MV9E 1W0WB 2D0HA 2YRZA 4JFFA 1BX2B 4JFYA 3B8SA 4NRXB 5D5MB 2DQDL 2GTZB 1A8JH 1A7QH 1E6OH 1MHPL 1H0DB 1QSFD 2IMMA 4UTBL 5JPNB 3OMZA 1J05A 2ZG2A 2I27N 4GG6B 3QIBC 1QSVA 4U1SB 1FFRA 1MRFL 4GW1B 3V0VA 2YD8A 4HXAH 3JWNC 1C7SA 3BD5A 1U8LB 5DRXB 3FQTB 4ZPTA 2A6IA 3ARXA 4K94L 1KIRB 5JLZA 2VXQL 4KQ3L 1IEHA 3S7GA 5F6IC 4PTUB 4R90L 4NM8L 3SKNB 2C4XA 3QDJE 3D69A 5JQ6H 2G60H 1OAYL 2A77L 2IQAA 4X0KA 5M94B 1HHKB 3LKPB 4XP9L 3HE7A 4KMQA 4YHIB 1JZ3A 1H9VA 3LKSA 3EFFA 2QEJA 3EUUA 2R56H 1UWEH 1RJLA 3WLWD 4Z5RA 3EYSL 4NKMA 4PJDA 2VL5B 4KI5F 1S8DA 2GKIA 5CSGA 5BXFA 1YYMH 3K0WA 5DK0B 3MRPB 5SWZD 1LILA 4D3CL 2VLJB 5IB2B 1CDUA 3MRIB 4BUGA 3QI9A 3AS3A 5HI3D 3EDEA 2F74A 2VR4A 3NFSL 1QFOA 4NUJA 4D2NA 4OAWB 4N90E 3QRGH 4OBSA 3GRWH 5IB1A 1CFTB 3WIIL 1OGAE 3ULVE 3LSOA 4PJCF 2CIIB 4NFBA 4G7YL 3AM8A 1MCPH 1CWVA 1BZ7B 1A4KB 1IGTB 1U8OA 2GJZA 3MLZL 4YDIL 2V2TA 3SJVA 3IXAA 1NCDH 4PRDA 5D7LE 5D1ZA 5EZIH 4ERSL 1MUJB 2A38A 1U8HB 3B9AA 5HHMB 2XA3A 1FVEA 2EH7H 4GG8A 4JRXD 5BVJA 1UACL 4HDIB 4XRCA 5EU6A 1QSEA 2P44B 1H3VA 3WXVH 2H2PC 3TBYA 4JG0H 4Z18A 3VI4F 4QRRB 4HWBL 4WY7H 1CGWA 3BAEL 4H25A 1NEUA 2E7BA 4QYOB 5DYOA 2UZXB 4RAVB 2P5WD 5IMOB 1H3TA 2NY3B 2EIBA 3QSKB 4ZXBA 1Q38A 1FBIH 3O0RL 1M71B 4ETYA 5MHSE 1A6VL 5F3HB 3IXTB 3E0GA 2YPVL 4LSVL 1T6VN 1IMHC 5ILTL 2DQEL 1NL0L 4U1LA 2NY4B 2QQNH 3LQZA 1J18A 4YLQT 3K81A 1EHXA 1CXEA 1X6NA 1NGYB 4FXKA 5L8LB 3VXSB 4KKAC 3P30H 4XPTH 1T5WB 3C6LC 3JTSA 1Q0XL 4DN3L 3OB0K 4BYHA 4RGNE 3JUYA 3FQWA 4UNUA 3D2UA 1TJIH 5DJDA 3QP3A 2IG2L 4L3EA 3AMLA 1I7RA 4Y8DC 4AM0A 4NZTL 5DRZB 3EGSA 3TJEL 1I4FA 1RFDL 2D2OA 4HJJL 3UO1H 4MHHI 1PX3A 2FECL 2YPLB 1JUFA 4G6KL 5I17B 1PEZA 3TN0B 1NKRA 1N4XH 3DGCR 4CDGC 4F57H 3TP4A 4Z0XA 5ESVB 1VPOH 4XBPB 4UNTA 4O51A 2BDNL 3VXTA 5C0EB 1ACZA 2R1WB 3OZ9L 1KYOJ 4WRLA 3DI3B 4DFHA 5I71B 1I9IL 3EYFB 4ZFFB 3NCJL 4PGCA 2ATKA 2DLTA 4M6OH 2X6MA 4TYUA 5INDB 1B0RA 1TFHA 3QIUA 4I18C 3RX5A 3X14B 2RR3A 1MJ7L 3LPGA 3R06B 2FX7H 1HEZB 4GT7A 3UCRA 1RZ8B 1KTRL 4M6NH 4RIRB 2VLRB 2OL3B 3DXAE 2DD8L 3I50H 4ZUTB 1A1MB 3O45B 1KGCD 4FXLA 3RWCB 3H9YA 1UVQA 3KYKL 4F37K 3UJJL 5MENE 1N0XL 5F9WB 1HZHL 2R2CA 3HMWL 1JWMA 4QHNA 2ZUYA 2ZOLB 1I8IB 3VXMA 3KDMB 1ZKAA 3PWNB 4LVNC 5CJOH 1KJVB 5IMMB 3VFMA 1MEXL 3LEVL 2M2DA 5F1SA 3VFOB 3EZ8A 5HGHA 1A7RL 2X4QB 1FRGH 3C6LB 1HQRA 1R3JA 2BNRA 4GXVL 4CKVX 3B9EA 4F80A 4HIXL 5F7DA 5MERA 4XPHL 2BRRH 4ZQKA 5GZOD 2XIDA 5DVOA 3G5ZA 2YSSA 1T3FB 2AV7B 3BXNB 3NACH 3OGOE 2YMXH 4Y4KD 5C08E 5DJCA 4OGYH 5FDWA 2F53E 1T22A 3GSQA 2WP3O 3WEXA 3KPPA 1RMFL 2CK0L 3FQNA 1DN0A 4FABH 5GSVA 4NUGL 1WBXA 1MJJB 4YQXL 3Q1SL 1GYAA 4F7EA 1C5BH 2D7OA 2RIKA 3RX8A 5T1KA 1S9YA 3NN8B 2DWDA 4WWKD 1MCOL 2VDNH 2ZUQC 2QHRL 5ADOL 5KSUB 1L7TH 1CD9B 1YNKH 4KDTA 3IJSB 4PRID 4L5FH 3GB7B 4TVPD 5F7EH 1P9MC 1Q0YH 2AXFB 4PGEB 4I0PC 5ACZB 1YEHL 5ANME 5BMFH 2CK2A 4I18B 2Y23A 2EXWD 5C3TA 4XZUB 1FGVH 1S3KH 2FWOB 1RUMH 1CXIA 1WCBA 2ICEA 3HRZB 5L0QC 5C9JB 4H26A 1XF2B 5L2JB 5B38G 1NCAL 2FATH 2H26B 5IEKA 2CRIA 1KCKA 3D39E 3EO0B 3TIEB 4PRHE 3WV0A 3QDMA 4LSQH 2FH6A 2WMPA 1B0GB 5F7NC 4GRWF 2PCPA 5BCAA 4B7LA 2VZTA 3I85A 5DTFA 4LVNB 4EIZC 3KLDA 5ISZB 3OKLB 1MWAL 1CBVH 1RJYB 1F4HA 1AJ7L 5FYJE 1CXFA 1R3KA 3CFCL 3TO4D 1Z0MA 3U6RB 2YUWA 3JWDC 4JFPB 4FQXC 4CVUA 3U0PA 1CLCA 3UC0L 1PGRB 3O11B 5B8CB 2HN7B 1FNGA 4RAHA 1SJEB 2BVPA 3BRFA 1ITBB 5DHVA 5E2VL 3IDGB 5CBAB 1MJ8L 2Z9TA 3QHFH 3FMGL 4IRJC 1NGZA 4JFXB 4G3YL 1T1XB 5IESH 3VD5A 4OCLC 4XPFL 5CHNA 5ERWA 2UYLA 6FABL 7FABL 3RU8H 4RFNB 4WEUD 2Z31A 3SE9H 2PTTA 5IF0A 2UY6A 3RWDB 2ZUQB 3JZ7A 3HAEG 3TZVD 3C8KB 2XTJC 2DQCL 4G9DB 2I9TB 2AXGB 2FL5A 3SKJH 4XWGL 4ODSH 2AI0L 4LSPL 4HGWA 1KELL 3PGFH 1BBDL 4I0PB 1JZ5A 5DK3A 1KN4L 5LGJA 2JJVA 1CFBA 1PY9A 3BPOC 2NY2D 3V0WL 3RFZC 3I3EA 1M05B 1JPTH 3OG4B 1XGQB 4HW6A 1NANI 3TYFA 2VUYA 3S96B 4OGAC 2MQCA 2Q86A 1D9KB 1FL3A 5F9OL 3U9PL 4LARL 4PJ8C 3IB4A 3IS0X 1JGEB 3JVGA 4PYGA 2K7QA 4CMMB 3RNKA 3K2UL 1KC5L 4NZJA 1YUHB 3H3BC 3PIQB 1OSZA 4LLUA 3NZHH 3PNWB 2EH8L 1IGJA 1OL0A 3MLVH 1FZKA 3T0EC 4G8FA 2IPTH 1PAMA 4J6RH 4PJHA 1JZ2A 3VXUE 2COQA 3C08L 4XAKD 4HAGA 2EYRB 1NGQH 4Q9BA 1D7FA 1KJMB 3OJDA 1NFDE 2ZG1A 2EDQA 1F6AA 5SWQA 5FYLL 3EOTL 1HDMA 4GRMA 4U0RB 2GUOB 2J8UB 1MQKH 5LCVH 1X6LA 5MP6H 3IAGC 4A2LA 3N1GC 1GPOH 5D96B 2QJDA 4Z95H 5GSRB 1HWHB 3VRJB