2E5EA

Solution structure of variable-type domain of human receptor for advanced glycation endproducts
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
101
structure length
101
Chain Sequence
b'AMAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Advanced glycosylation end product-specific receptor
publication title Solution Structure of Variable-type Domain of Human Receptor for Advanced Glycation Endproducts
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 10
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2006-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e5eA00
1CXFA 4AT6A 3H3KA 2N7BA 5E99L 4ALAL 1EGJA 1WIPA 1Z9SA 5C0AB 1C5CH 1XAUA 1LDPL 2D7OA 1MI5E 4MNHA 2HWZL 5BVJB 1MFNA 4L9LA 4L9LC 4KROD 1CK0L 1B4JH 4P4KB 4NQXB 5CCKL 1UEYA 4HUNB 2PO6D 2WLZA 4PRIB 4CVUA 2H9GB 2WP3O 3LKNB 4PP1C 5EC2A 2F5AH 3C08H 5MERA 2Y06L 4JDZB 4PTTB 4G3YH 1XF2B 2OS7A 2I9TA 1N59A 3JV6A 4OIAA 5DMIL 1MLCB 5L7XL 5JMOC 4K3HA 3B5GA 3QIUB 1I8LC 4NOBA 1HK6A 2WV3A 3ARWA 4HGKC 5K9QI 3DX8B 3O6LH 5C9JA 1NSNH 1S9VA 5TE4L 2EICA 1KIQB 4NYLB 5FGSA 4O5LL 4X6EA 2FJFB 1LHZA 12E8L 2R29L 4H88H 1CDHA 4ZG1A 3KPRE 3BMVA 3ELAT 4MNQD 3ZYJA 3FAWA 2EC9T 4KJQC 4L3CB 4OZ4A 2BC4B 3PGFH 3RL2B 1NDGB 4H1LA 1MWAB 4TQEL 3CXHK 4HIHB 1OL0A 4HXBL 1LO5A 4G6AC 4A2MA 1E4XL 5EUOE 3FB6A 2MFNA 1C1EH 1G0DA 1M7DB 3OX8B 4LLAA 1RVFH 4UTBL 4D2NA 5IB4B 1JF5A 1PZ5A 1A47A 1UCTA 1Q94A 4JFPA 1OTSD 1U8KB 1FN4B 3J8F7 1U93B 3EYVB 2H45A 2Z8SA 3VGBA 2HVJA 1R3JA 2VLJD 4G8GB 4M7LT 1HHGA 5I1LB 1DEDA 1RZ7L 1N5AB 2FEDC 1I9JH 4OV5A 5FUOL 3V5KB 4D8PA 4PJ8A 4PJ8C 2K9UA 4K7FB 2VSCA 3RWHA 2GUOA 3GNMH 4UDUB 5DTFB 4X4YB 3MA9H 3FQUA 5GRJL 1LE9B 3VDCA 1E6OH 1CTOA 1M7IB 4Z7UA 3MBEA 3MBEC 5GRYA 4GO6B 1ZLWH 1DVFB 3E0GA 2FATL 5EOCL 4D9RD 4X8JA 2VJXA 1MF2L 1JPFA 1ND0A 4YE4H 2FH6A 3OV6A 3V79C 1T7WA 2E9IA 2FIKA 1K4DA 1A3RH 2YC1B 1JZ2A 4RA0C 1QQDA 3F8UB 1HQRA 2APVA 5CBEB 4IDJH 4LEXL 3UJIH 3EOTH 4XPAH 1ZA6A 3RVWC 4DWHA 3D2UD 1AY1H 4JE4B 1JN6B 1G6RL 2DN7A 5D2NB 5TFSL 1QR1B 3B3IB 3JTTA 3ULUH 4YXKH 1T20A 1TDQA 4YIQB 3KPPA 3O6KH 4NM8H 2HH0H 3GSNB 3K4DA 5TDNB 1YEIH 2NZ9D 4O58H 5KW9L 4BKLA 2G9HA 2KQMA 1HKLL 4LSVH 4DUWA 3AC0A 4LEOA 2Y36L 5T1KD 5DK0A 5IOPA 2D9CA 1J0KA 1S3KH 2FJGA 4N5ED 3FZUC 3CVHH 1HN1A 1RIHL 2H32H 1AR1C 4DN3H 5IGXH 4MZ3A 3VJ6A 2IADB 1HDMB 4PJGB 2D7PA 5F70A 1CIDA 4G43A 1GOGA 2HT4C 3LZFH 3N85H 1KPVA 5DWUH 2QSCL 5DMJB 2FSEB 4JFED 2Q8AH 2OTWA 2YWYA 2CLZA 4I77H 2HRPH 4TOYH 2MOVA 2EC9U 3IF1A 5C0JA 4PJIE 3B43A 1ZVHA 5E6IA 5E6IC 1NFDE 3O4LA 1XGPB 1HH6B 5IBLC 2X4UA 2DL2A 1M4KA 2P45B 4GAGH 3NCMA 1U8NA 2X42A 3TGXA 3O3AA 1EVTC 1G7LB 5JHDE 4GRMA 1IGFL 4PGEB 1N6QH 5FECB 4JFFA 1DANT 1NCWH 2IG2L 1CS6A 1A4KB 1Y0LA 1UEMA 1Q0YL 1MI5A 1X5YA 4XVSH 3NGBC 4I9WE 2CMRH 5E2VH 5BRZE 1D7FA 4GXVL 3P4OB 4RCAA 4HKBB 3IFLH 4WO4B 4FFWD 3RUGE 2NR6D 1QLFB 3WJLA 3WJLC 2DQCL 3V0VA 1XIWB 3FAXA 5D2LB 3OJDA 3QCUH 4GRLC 1NC2D 3WDHA 4G6ML 1GGBH 3HI1B 5SWZD 3LKPA 3O2DA 5HPOA 4EJ1C 3QDAA 4APQC 4APQA 3LS4H 5EA0L 4TPRH 3EGSB 2MPAH 1JZ5A 2EIDA 3ULVE 1NANH 3NBNA 3KPRA 3ULUE 5I1KH 2FGWH 1PLGL 1CD1A 1UH4A 1T89A 1T89C 5TPWL 3W39B 3QIWD 5JPMA 4H0HB 5DT1L 4E0RB 1XGRB 5JW4Q 4M93B 3FQWB 5DJDB 1OPGH 3HFMH 5E2JA 4D0BA 5FA3B 1MIML 2HKFL 3QG7H 4CJ1A 2MWCA 4ONHB 2EYSA 3RVTC 3SJVA 5D72H 1OHQA 4OD2A 5DD0L 3BYYA 5EUOA 5CP3H 1KJ3L 2D3VA 1M71A 4NPYA 4B50A 1GIGL 4HUWA 4WTZG 5TQ0H 2IBGA 3VFMA 3QXDA 3MBXH 3CIQA 5KG9A 4XXDB 3TBWA 2DF3A 4WW2F 2Q6WA 5GGSB 5D7IE 3AU1A 3U7WH 1JZ7A 5INDA 3GMNA 3L3OB 3OJ2C 4D0CB 4HKZB 4KFZC 2P5EE 3BPLB 1X5IA 1FVCB 5I2IA 5GZOD 1EV2E 2IPKA 5HYQB 4LRNH 3UPRB 1K2DB 1KPRB 2DM2A 4XBEL 3ES6A 3VD3A 4PB0L 5KVDL 4DFIA 3JBG7 1N2RB 4BFBD 4FA8A 2YD4A 3I75B 3QDJD 5EU5B 2ITDA 2JIXB 5LCVL 1ZTXH 1HXYA 4I2XE 3ARDA 1JRHI 1WZKA 3MRNA 4TYUA 1D5BA 4OZIF 3ARRA 4XVUC 5I1EL 1RZFL 3TA3A 3JV4B 3TA3C 2V9TA 3RPIB 4TVPD 4JRYD 5C70A 4WJ5A 2ARWA 3MLXH 5JIHA 2BOBA 3SGEH 2V5SA 5HPMB 1RULH 3QEQB 4S10A 1TQCB 4GOSA 2AERT 1IAIM 3DETD 4QRQB 4WFHD 2HG5A 4LKCA 2V2WB 3FQTB 3C87A 3UTPE 1F00I 1GZPB 5GS0L 2RBLA 1YDPA 2VXQH 3L3IA 3QAZB 5DMYA 4GKNA 4Y2OA 2BSED 4QXGH 4EN3B 4MJIB 4W81A 1L0YA 1AO7D 4IOFC 5ACZB 2VQ1A 3QA3B 5GGQL 1P5VA 1XF4A 5HYJD 2RFXB 3EIFA 4LK4A 5KVEH 1DANU 1DQQA 5FHBL 1MCJA 3DURB 4MJ5A 3OAZH 1NLDL 5CKAA 2H8PB 4F7CA 4OFYD 1NGWA 1BBJB 3O0RL 2H26A 3MRGA 5DZNA 4I3RH 4AEIH 3GSRA 5LQBL 3DWTA 2DICA 4KMTH 1KIUA 1UJ3B 4FHBD 3VFVA 3P11L 4U31A 5KTEL 2R39A 2H1PH 2Z35A 2VAJA 4KTEH 2R1XA 1BIHA 4P3WA 3VWJB 5FCSH 4X9FA 1FH5H 1RMFH 5GXBB 1IC5L 2IBBA 4GSDL 5FO9B 4ORZC 4KPHL 1UWXH 3PWUA 5IHBA 4PGCA 1NGZA 3KPOA 4P2QE 4YHKH 1VGEL 2CPCA 4KJYB 3WSQH 1FAIH 3GI9H 4YNYA 2X4RB 1PAMA 2E6QA 5FYJD 2ED8A 2VUOA 4XWGL 3F7VB 1HXMA 4KJPD 4PJIA 2CKNA 3CX2A 1RK1B 3LKRA 4M7KH 1NFDA 4S1QH 3FFDB 1NJ9B 5T1MB 4FXGB 1YEEH 4XPGH 3QHFH 2R4SL 2FO1A 4XP1H 1KJVB 3MV7E 1LE5A 1E28B 2VXUL 4PJBE 5EZLA 3QDGE 4M48L 5JHDA 1FHGA 1MJ8H 3ZSTA 4CN6A 5ITBH 1QFUH 1WC7B 2BVPA 1MQ8A 1A7BA 5HYEA 4GW5A 2EDLA 3HNVL 2PXYA 2PXYC 3TBYA 4LCIH 1AE6L 1MQKL 3FMGH 4NC1E 5GGRB 1AI1L 5I0DA 3ARFA 1UA6H 5F97E 4D3CH 1CFNB 5BRZA 1OWRM 2LVCA 1KN4H 3WLWC 4QEGA 3RUGA 1MREL 1KB5L 4HH9A 5I9QC 1NGQL 1U6AH 2B1HH 4P5KB 3F7YA 3TYFB 3RX8A 1HIMH 4LRIC 4LRIA 2EH7H 1J05B 2XZQH 4KUCF 2AXGA 3VFPB 1YNTA 3EBAA 1CXLA 3LB6D 3T3MF 3S3SA 4PJDE 4NOFA 2JCCE 4JZNB 4NZRH 2Q7YB 3GI8H 4ZFGH 2X9YA 4HPYH 4K7PL 3ULVC 2FX7H 5A16B 4EOWH 1KCSH 4YH6A 4Z7QE 3GM8A 4KVNH 1OB1A 3ULUC 1T6VN 3GRWL 4QRPB 3FOMB 4NZUH 3QDMA 5CKGA 2AQ2A 4YK4B 3HB3D 1INDH 3NFNA 3V6FB 4S2SA 4DFHA 4Q9QH 2V2TA 2YEZB 5I18H 3GJFK 3UROR 4UBDC 2BNQE 1NGYB 4FQIL 5DRNB 1F8TH 5GSVB 1PQZA 1P6AB 3DO7B 3TT1L 5KSAB 4EXKA 1T04B 5D8JL 5HVWA 4OLZH 1JGEA 2VXTL 2KH2B 1JZ6A 4GG6B 3QXWA 3H9SB 5CINL 5JIPA 5TF0A 5EZIL 2DWEA 2A2QT 3CGTA 4W68A 2P5EA 3WV0A 2ZUXA 4U1KB 1AD9A 1OAYL 2VQUA 2EO1A 3KG5A 4NQDE 1ZLVH 1PD6A 5DJZA 3O41A 4OLYH 5E5MA 1OY3B 4P2OC 4P2OA 4QRSA 4KMQA 5CEXA 5D7LB 1NKRA 3MNVA 5E08L 2EDJA 1ADQA 1PGRB 2OCFD 4QRRD 5DD6B 1L6XA 2NLJA 1WWAX 4YHIA 2YD9A 2HT2D 2XICA 4I2XA 4NQVB 1G7JB 1FORH 4H5SB 1RURH 3E2HC 3GBMH 5I17A 1IL1A 1AGFB 5DQJB 4BZ2H 2X4QA 5E4EC 3V4UL 1A2YB 5HHQA 1YNKL 4PJAF 5FYKD 1JGVL 3DYOA 4Y16A 3SDCD 2D31B 1S7QA 1EMTL 1IILE 1NPUA 4G5ZH 1I7RA 4KUZL 4LSSH 5EU4B 5ADPL 2YUWA 1CL7L 3MUGB 3VMPA 3RWJA 4C83B 1U92A 4ZOAA 4FQLL 4YBQC 1AXIB 4I4WA 4POZC 4X0KA 2A9NL 3BIBX 2IPUG 3JUYA 1OAQH 2WBWB 2VOTA 3DNKA 5CILL 1F90L 1GGCH 4XMKH 4R96A 3S5LG 4Y4HD 2K3TA 1HHIB 1J0JA 3HZVA 4L4VD 5E8NB 1FVDB 3P4MB 3T0EE 1LVEA 4CGTA 3MLVL 2UY7A 4WHTA 3RKPA 5DUMH 3L3DA 3IJYA 2HJLA 4MD5B 2DQEH 2VZOA 4UIKH 1HI6A 1W0WB 4FMKA 1FNGB 4ELKB 3BZDA 1CE1H 2B2XH 2IQAB 1YUHB 4PY8I 4UTAH 5GGSY 4Z7WE 4RGNB 2DDQH 5BS0D 3OG4B 4JFQA 1RU9H 3ESUF 3KPSD 3MLRL 5MEND 4NZTH 4ODSL 2W65A 3NFSH 2Y72A 2FYYB 1A6AA 4NRXA 1EGJL 2WWKT 3D39B 3V6ZA 4U1NB 4QHUA 2WK2A 3WDJA 4P2QA 4HIEA 3T1FA 4ODHH 3VWKD 5CP3A 2DQGL 1DQTA 5F89A 1RPQA 5HHPB 1JUFB 4K3EH 4YX2L 4KGLA 1QR4A 2HTLD 4PJ9C 1D5ZA 1CFTB 4N8VA 4I18B 5HD8D 2FB4H 1WCBB 4JR9L 5GGVL 3VG0L 5D70L 2E9JA 2Q3ZA 1OAXL 1TVDA 4ZUUA 5IV2B 5FUZH 4HKXB 3MV7A 5J3HD 2BHYA 4PJBA 1QRND 5DJ6B 3QDGA 2D7MA 2P8LA 4HIJA 2OP4L 2BVOB 4WY7H 4U1IA 2NTSP 4KI5E 3UJTH 1BFOB 1CDGA 1CU4L 5T33H 3MOBL 4NC1C 1IGCL 1ZV5A 43C9B 1SJEA 4R0LB 1TCRB 2GITA 5F9OH 3UTTD 3RWDA 1JWUA 1CFVH 2MNUA 3GHBL 3MRHA 5D7KD 1UGNA 4PRDA 3QQ3A 4PJFB 1WISA 3ARBC 3ARBA 5I8OL 4IIQB 3MRDB 5LGJB 1A9BB 2PW2A 1KV3A 2Z0BA 1V5JA 3K80A 1AKJB 1D6VL 1J5OH 5T3XH 2EZ0D 4QYOB 3INUH 1R0AL 5F3HB 2LU3A 3L5XH 4HAFA 5IVXE 2X7LA 5KANI 4PJDA 3NTCH 2VR4A 4KQ4H 2JCCA 2BSRA 4M7JH 2ICWB 4OGYL 4E41E 4PJ5D 1MWAH 4MAUH 2QQNH 3BRFA 1WV7T 2NY1C 3BD5A 4X6FA 2H41A 4QTHA 1N0XH 3SDAA 3SDAC 3QULB 1QSVA 1XGTB 3O3BB 5J1TC 5SX4I 4PRBA 5B39A 1UB5B 3DROB 4YR6B 4LQ1A 4DGVL 1XR9B 5C0DB 2MQ3A 1DUYA 4O2CB 1HNGA 1F45A 4G9DA 5I1IH 2F53E 2HT3C 3MLUH 4GRWE 5C86A 1YPZE 1DQLH 3OAYH 5DA4A 3NACH 3QRFM 4LARL 2NY3C 3UAJC 4BH8B 5ANMB 3M8OL 1R3KA 5D9SB 3DHMA 2NX5E 2R2EA 4Y8AA 4XNMB 4LCYA 5IBTL 3FHQA 5IEKB 2NYYC 4NQUA 5EN2B 5GGTA 1L0XA 3K8LA 1LNUB 3K1DA 5A40E 1G7PA 4WUUD 5C8JB 3KYKH 5E8PA 3IVKA 3ARYA 4P2RE 4IOIB 1FZOB 5C7XL 3KXFB 1WZ1H 4NKDB 1G7QA 4OLWH 2W9LA 1FG2B 1KN2H 3VXQB 5GGRY 1SBSL 4Y19D 3WEXA 3RL1B 1A14H 4K8RD 3PQYE 2CDGB 2DI9A 1JK8A 1QTYT 2A73B 3KLHC 4X6DE 3CAFA 4UU9A 5D1XC 5L2KB 3NN8B 4MXWL 3GGWB 2XN9E 2XNAB 2DBLL 4PJXA 4TNWF 4YBHA 2IFFL 3ZYZA 1IQWL 5CD3B 4POYA 3G5ZA 4KGJA 4U1LB 1ZGLB 2GYSA 5KSBE 1KIRB 4MNGB 2Y4SA 3MCKB 3PJSA 4Z7VE 3QO1A 1JWMB 5EG6C 4Z8FL 3RGHA 4NN7B 3EO0A 1OWWA 1RSFA 3GSNH 1N64H 1BD2A 4RAVA 2DS4A 4L3ED 1UYWH 4OKVB 3STLA 1BPVA 1FRGL 1Q38A 3RDTB 3IDXH 4WI6A 1SEQH 2UYLB 4PRHE 4GLRI 5F72S 4JFDA 3V95A 4HX1B 1F11A 1NEZB 1FFOB 3JWOC 3SDXE 5T3XE 3SE8L 3T0EC 5C0GB 4N1HB 1AXSA 1LD9A 5E7FA 2MQ0A 5IQ7L 1UKTA 1YQ2A 2HFEB 3QWRD 1RZKH 1YN7B 3S4SB 2E3VA 3RGVD 1KCKA 4Z7WA 4G7VH 2W59A 1N8ZB 1JF6A 2IH3B 4TSCH 4DW2H 1A6VL 1WFOA 2AJSH 1YY8B 5E2UL 3DHJA 5I16A 1QSEB 3UYOD 2H3NB 4HBQA 3N06B 4JFHE 5JNYA 3SDDD 1H15B 4ZDHB 1EHXA 4LLMA 2ZUQC 3VI3F 4UT9H 4XNUL 3BAEL 4XNXL 4XAKD 1U0QA 1OM3H 3WS6A 3WS6C 1ZANH 5ISZE 2WWMC 4OLUL 4RSVA 1YEFH 1NFIB 1DBAH 2R0KH 4FOMA 4CMMB 5I76A 3VD4A 3O2DL 4UUJB 3HC4H 3NA9H 2X4TB 2WUCL 1C16B 1KFAH 1U3HA 2CRIA 3BZ4A 4LSDA 4NO0D 2YA0A 2FLBT 5EU6B 2P43B 3A6CH 4PR5A 3ZE2F 1WT5A 1WT5C 3RBSA 2BSSA 1KG0B 4ZUVB 4JN2B 1QBAA 1AQDA 4KI5C 3T77B 3Q3GB 4YDIL 5B38G 2I25N 3C2AH 3C60D 1BZ7B 5E5RB 4ETYA 4JO2L 4KUCD 1YN6A 5IM7B 4N90D 4RFEA 2YD2A 4EDXB 4LPXA 3UC0L 4Q2ZA 4RMVA 1MCSA 4HG4K 5J0BA 5BMFH 4Y5XC 1MJUH 3AXLA 3QJFB 1EEZB 4LVHB 3QEUB 1YECH 5F96L 1S7XB 3WUWA 4HV8B 5IVXA 2PTUA 3O11B 2A9ML 4FS0A 1OTTD 4N0CC 3A6OA 3TO4A 3TO4C 4FQ2L 3SEPA 4ZOBA 5GSRA 1PKQE 2WANA 4JPKL 5C0AD 2X4OA 1C12A 5L2JB 5HI5D 3VD9A 4Q6YA 4R2GC 4ZO7A 4P4KD 5FUCC 2EE9A 4PRID 3L5HA 4TUJB 5BVPL 4LSPL 2YMXL 3O6FA 3O6FC 1JIBA 4XMLH 3W0WB 3V5HA 3HMXH 2F53A 4ONFH 4C57C 3RZCA 3RZCC 1PSKH 4MNQE 5EFIB 5DEGB 5JXAH 4JLRA 3H9HB 5ACMA 5J89A 3QIUD 4MJ6A 4OI7A 2NX5A 1EBAA 4JVWA 3D25A 2L4OA 5H2BB 4MJ2A 4NNYB 3V7AG 1K3IA 4KAQH 5K33A 4Z5RA 1FL3B 2NXYC 5ICZA 4HBCH 3EYQC 1C5CL 3QFDB 2IH1A 4LDOB 4P2RA 4NNXB 1KCUH 1IAMA 1B4JL 1NEZG 1DEEB 2BCKB 4OZGB 3U9UA 3WFBH 4ZFOA 5IHZB 2C3VA 5IB1A 1JRHH 3C08L 4JKWA 4G3YL 4XCFL 3T4YB 1ZA3A 5FOJA 4FQQA 4P3DA 3MRQA 4RZCA 4R4BB 3HE7B 2WZPD 4X6DA 1EO7A 3UZQA 3O3EB 4MD4B 2XN9A 2Z31A 4KU1A 5JORB 5I1JH 2VDOH 3QZWG 5L9DH 1NSNL 1RUPH 2DRUA 2VZ3A 3CFBB 4X9HA 5D7SH 4H88L 4PJ7E 4G8GD 1MAMH 2FR4B 3GUTB 2UVFA 4AEEA 1PY9A 3WNKA 2CK0H 3BZFA 5KSBA 1JFQL 3EOAA 2DMKA 2XWTA 1VHPA 1QSFB 3P73B 1KELH 1T5XB 4MXQD 4HIIB 2BJMH 4I48B 1ONQA 3BH9B 4CRPA 2BHZA 1J0ZA 1AHWA 1AHWC 5F1IA 1BWWA 4D9RE 2PYFB 3TPUA 3N0PB 3FT4A 5DJ0A 3X11B 5I1AA 4LKXA 2R23B 1FYTA 5DFVC 3V7MA 1C1EL 2ZOKA 3MRBA 1ED3A 1RVFL 4PLNC 3RP1A 3EO1A 4M1DL 3B2UD 4Y89A 1V8HA 3VXNB 2C3WA 2DKSA 4D9LH 4OM1L 1KXVC 3GEWB 4UIMB 5ALCH 5FXCH 2MCPH 1R5VA 3DTXA 3TZVD 5JDJA 3U1SH 4Q97A 3FT2A 1QA9B 4M3KB 4EUPB 3QJHA 4QOKB 4RQQA 3VRJB 5KJRH 1SMAA 3BZEB 4FXKB 4NUJA 5EORH 2NCMA 2VLME 4HDIA 4DZBB 4P57B 5C92A 3BN3B 5A43C 3TN0A 2W0FA 3TN0C 5E8OA 1EFXB 1Q1JH 3GNML 2XQBH 1S5IH 1QPXA 1XR8B 5IB2B 4PRPB 2HTKC 1I3VA 2BNUA 3GIVA 3MA9L 4P59H 4QY8B 1E6OL 1QO3A 3RIFF 1GGTA 7FABH 5JW5B 4HWBA 4NBXB 5AUMB 2KQNA 3FCTA 3E6FB 4YE4L 2E8YA 1FGNH 1GH7A 4XHJC 3OPZL 4FFVC 4XTRC 5D4QA 5DJYB 1A3RL 2JELH 2OR9H 3D69B 3TFKD 1HSAA 1RUQH 1CD9B 3S3PA 4PRNB 1CICA 1CICC 4AH2B 2G2RA 1EXUB 4IDJL 4L8SA 4L8SC 4LPTA 5I1DB 1I1YA 2XY1A 3W11D 3EOTL 4X4XA 1J87A 2XQYG 4XAWH 1AY1L 5L6YH 1U3YA 3ULVL 2XRAH 4KKNA 3QCVH 3VW3H 3VGFA 2L7UA 3OR6B 4K94H 5C6TH 4PBWD 3ULUL 5CJBA 4YXKL 5H8DA 3FN0H 1N6VA 2OJZH 4OAWB 5EWIL 3VRIB 3V4PL 2OSLB 4WV1B 1RJYA 4NO2B 3O6KL 4LAJH 4NM8L 2HH0L 1X6NA 4XVTH 1U8HA 5L88H 4O58L 1WWBX 5HHNB 4KZEH 2R8SH 3P0YL 4LSVL 4X6CB 5D7JA 5D7JC 1HHHB 1WICA 3L9RA 4MCYB 5HSFA 1S3KL 3GO1H 5D5MA 3CSGA 1JV5B 2PETA 4TSBH 4F3FA 3DPBA 2DD8H 1EHNA 4GUPA 4ZTOL 2YD1A 3E1F1 2PO6A 1ETZA 3IXTA 3U0PB 5H35B 4DN3L 5IGXL 3B4NA 1VFAB 2LTQB 3BQUB 3LZFL 1B3JA 1A7PL 1S9YB 2EDYA 4KHTH 5IJVB 1O0VA 2Q8AL 1CI5A 4OGZA 4I0PB 4V2CB 2XY2A 2X05A 4I77L 2I26N 4Q9CA 2HRPL 5SWZE 4TOYL 1CT8A 2M8XA 3TT3L 2VLLB 1R3LB 3VH8B 4ZTPL 3L1OH 5IVZB 3M1BA 1KTLA 3MV8D 5F3BA 3R0MA 1RIUL 5J1AA 1YMME 5EOQL 3C6SA 5F7KC 1XIWD 5IK3A 2ADIB 4BK5A 2HKHH 4GAGL 4MA3B 4XP5H 2Z4QA 5F7LB 3RX7A 4OCNC 1EO8L 1IGMH 1CG9B 5I71C 4MNQA 5F1NA 1UZ6F 4WFED 1A1OB 1T2XA 3VXTA 1OGAB 2NW3B 4RWYH 1UADC 4EIZC 5M7QA 2EDRA 3RWGB 5FKAB 1G7MB 2P8PA 1NCWL 1MFDH 1UG9A 5SV3A 4QWWD 1PY4A 4PJCF 3HG1E 2L0DA 5J6HB 2BY3A 3MOAL 4UDTA 2JB6B 4HH8A 3U6RA 4LNVA 4XVSL 4PLKD 5E2VL 1YEHL 1X9QA 3PHOA 4CVZB 2VITA 3ZKND 3IFLL 1OTSC 5EBLB 3ZDYF 1H5BA 1H5BC 1I7TB 1EHLH 4LAQH 2HYMA 3F7RA 1G6RB 1OARH 2VDML 1T1ZA 3QCUL 4EUPG 1U8IA 2ICEA 2X9WA 1AGBA 2RIKA 1FZKB 5GRUH 3LS4L 1QBLH 3VCLB 5CJ8A 1IGIL 1DLHA 4FTVB 4TPRL 1F4YL 2CKBH 2MPAL 5JTWA 4WHYH 2NTFB 3EYSL 5I74B 1Z9LA 3VG9B 1W72H 4HKJB 1KEMH 4RMUA 5H37H 3T2NL 5I1KL 2BY0A 2FGWL 5I8EA 1C5DB 1TNMA 3OWEA 2YPVL 1JGDA 3T65B 4OCXH 1OPGL 5CWSB 4TVPE 1ZSDA 4JRYE 1A6TB 1IEAB 1MFEH 1CZ8L 1LK3L 1J0IA 1XGQA 4NHCH 5FK9B 2JIXD 1WF5A 1E0OB 1VACB 1Y18A 5D72L 3RVXC 5E9DB 4XCNB 1FIEA 1BQHB 5K93A 5IJKA 5IJKC 3NAAH 4OZHF 5TQ0L 4U2ZA 3VI4E 3KNBB 3QH3B 1QFWI 1ACYH 3MBXL 3NZHH 3SE9H 3QEQD 2AV1B 1BHGA 1CGXA 2E27H 2DLIA 5FB8B 1OF2B 1UQSB 3I6LD 2P5WB 3BP5A 3T4AA 1X5LA 3QXAB 4BQCA 2C1OA 4F33A 4QRTB 2AJVH 2DTSA 3RQ3A 2I9LA 4LRNL 3VFTB 4PRAA 1EHAA 2J8UE 4X4ZA 5DMKB 4EN3D 4MJID 5MI0C 1U41A 4RMRA 1ZTXL 1N7MH 3O3DB 5T1KA 3ARTA 1S7SB 3VXRE 3H6JA 3FFCB 3DX7A 5AAMA 4L8DA 3CSPA 1L6ZA 3TBVA 1SVZA 3BUYB 3TNNA 2CIIA 3SGJA 1RULL 2E5EA 5T5FH 4M1CD 2EH8H 3QUYB 5J12B 1INQB 3GBNH 1KYOJ 1TLKA 4URTB 4WU7B 3UYPA 3MRPA 3U4EB 1JCKA 1NCCL 1CGTA 5IEHB 2FD6H 2X41A 5KSUA 3EDJA 4ZFFB 4QXGL 4UB0H 3VXMB 4G6FB 2AEQH 2YRPA 3M17A 4DCQA 3S37H 2GY5A 5FGRA 1K5NA 3LS5H 5DUBA 3MGOA 4YC2C 5BZDB 4LGPB 5JA8B 4LDLB 3ZE0E 3ARGB 1FBIH 4JZJA 4JZJC 4R8WH 5I8CB 3MJ9A 5I1CL 2ADJB 1B6DA 2CUHA 4NQSA 3DVNB 1GC1H 4KMTL 4XI5D 5ICXA 1PG7X 4S0SD 1TZGH 5EU3A 4LCWB 4P5TD 8CGTA 3DBXA 5AZEH 3GJFH 3QRGH 4LSQH 1I8MB 2UWEB 2AK1H 3RIAK 3KGRA 3MLZH 2NY4B 4TSAH 4JGUA 5GGTL 4DN4H 4Y5VA 4Y5VC 3DLQR 4F7TB 1AP2A 1NCAH 2CLRB 1W0VB 4CN1A 4FFZH 2A6JA 1NC2A 5FFLA 2WLYA 3FB7A 1FAIL 3GI9L 3FT3A 3QSKB 4QGYA 3WSQL 5SWZA 4KKLD 3PHQB 4X99B 1KNOB 5CP7A 4HD9A 2HMID 2BY1A 1CLCA 3GSVA 1F6FB 2VN7A 4M7KL 4ELMB 4S1QL 3OTTA 4WDIA 4Z0BL 1KJ2H 3OKDB 1YEEL 1T1YA 4XPGL 3QHFL 5DGRA 4XH2A 1H8SA 4FQPA 4NQCB 4DGYH 1JWSA 4HWZB 4QCIA 3HPJB 1F97A 3QXVA 5ITBL 1YNLH 4Y2DA 4Y2DC 4OI9A 5H94A 3W9DA 4JKKA 3LH2H 3F5WA 4RIRA 1U8LB 5D71H 3T0BA 2XPGA 1MIEH 4LCIL 3SKJH 2K1MA 3FMGL 4MJ4A 5HY9A 3HTLX 1V3LA 4QRUB 2GFBA 4QRPD 1UA6L 3IXAA 2EKSB 4M9OA 5C0BD 1NBZA 4WI8A 1T5WB 3CVIH 2C7UB 4NN6B 5GGUA 3PWVB 4XMPH 2NY6B 2B1HL 1U6AL 4H0GA 1ZLUK 1P4BH 5ITFB 3CFJB 1HIML 2EH7L 2XZQL 3WIFA 5HJ3B 3F6IA 3JWOL 3FL7A 5HHVH 5KSAD 3CSYB 3G5VB 1SYSB 5CIPH 1NUGA 1C7SA 1FZMA 3C5JA 4G7YL 1I75A 4JRXE 5FYJU 1R3HA 3VXSE 1T1WB 3GI8L 4QRRE 3H9SD 3QDJA 1LO0H 4ZFGL 4FZEH 3IFPB 5DSCA 4JPIB 4AL8L 4OLEA 4ZYKA 3LHPH 2FX7L 2F58H 4EOWL 1KCSL 5IMLB 4KVNL 3BWUC 4XNQB 1ZT1A 5IWLA 4NZUL 2I07B 4LPWA 4QHNA 3QUMA 4V1DE 5D7LD 1JNHA 4JRYA 3O2VH 3ISWA 5I18L 5FYKE 3FQXB 2KDGA 1F3JB 3UEZA 3L95B 1UH2A 3R06B 4LGRB 5AWNL 3DETC 5IFJA 3MMEA 3UTZA 3ZT6A 2ZNXA 2GKIA 1OP9A 3UDWA 3UDWC 5J9PA 4QHLA 4O00A 4OLZL 4U1MA 4R7DA 5DYOB 4Q58C 3PWPE 1YYMH 3JWNC 4JEGB 3LOWA 4X7SH 5ID0B 3X3GH 3RBGA 1AO7A 2WINA 1G9MH 5EO0A 1BM3H 2OMBA 1JL8A 2G75A 5FM5M 2ICCA 3B9KD 4I5BB 3TH4T 3H3PH 1CD8A 4OLYL 5C2BL 4OFYA 2R56H 2VAAA 3IKCA 2J8UA 5EPMA 4KV5F 1B90A 4Q6IB 1LEKA 3S88L 1MHCB 3CXDH 2YPLB 2GJZA 1Y6KR 3DO3A 1FORL 4DK3A 4I3SH 4QXTB 3GBML 5EUKB 4LDEB 4BZ2L 1CLOL 4PJEF 2X4NA 5GRVK 4DKAA 4IBLT 3D1MC 3F62A 3FOLB 5ILTH 3KPSE 5MENE 5C0CB 2JJTA 2JJTC 1KB5B 1FQ9C 2FJHA 2FNBA 3DX6B 4JZOB 4LSSL 1I9IL 2E6JA 1FFRA 1ZKAA 2PCPA 5E8DH 4Z18A 2ZCLH 1PZUB 4RRPG 5IW6B 4PBXA 4KH2A 3EYUH 2P24B 4OQTA 3QUKA 1GYAA 4JAMA 1GCFA 2EE2A 2R0LH 3MJ7A 4KJPC 1OAQL 1SJHA 3D39D 4BUHA 3HC3L 1GGCL 1TIUA 4HGMA 3I6KA 4YBLB 1MCIA 3G08A 4HGWA 2HFFA 4O2EB 1IGYA 2CRYA 1WSST 4GAYA 2YUXA 5CBAB 1QRNE 1MLBB 2DQEL 3MNZB 4UIKL 5JIIA 1OGTB 1Q0XL 1BZ9B 1YMHA 1CE1L 1MCWM 2B2XL 4UTAL 1MFAH 2DDQL 5FDWA 4U1GC 2CGRH 1RHHA 1WEJH 1FDLH 4G8FB 1RU9L 3DUUB 1AIFB 1PKOA 2PW1A 4NZTL 2X1QA 1ZLSH 3NFSL 5HGBB 1I1FB 1WGOA 4OZFA 4CUCA 4YPGB 5DK2B 1OAUL 3ALPA 1SBBA 4G80B 1AGCB 1QKZL 4WU5A 3UPAA 1KUMA 4F2MA 1W8NA 1QZ1A 3JWDC 4I1NB 5FV1L 2AXHA 3VGAB 5HYIA 3WNNA 1RZ8B 1EJOL 4JJ5B 2HFGH 4H8WH 1FLTX 4AYFA 2AAVA 3QO0B 3WCYA 2FB4L 1XH3A 1MCCA 3CDYA 4QNPF 2YBRB 5MHSD 4YDKH 4YDVB 5C08B 5C6WH 1BP3B 1Q9LA 1YC7A 4YEEA 1AKJD 4LHUG 2FX8H 4YO0B 2X89D 3WN5A 1JNLL 2XWBA 3HB3C 1RZGB 3HE6C 4S1SH 15C8H 3T0XA 5KS9B 1QFPA 4J3VA 1MVUB 1FNHA 4K3DL 5IHLB 2NMSA 3UJTL 2Z92B 1T7XA 3GMOA 4N0RA 2VIRB 3FO2B 4NC0B 2BRQA 5HTSA 2XFXB 4LSTL 3VFUA 4QHMA 5FOBA 1ZHBA 1P4LA 3WL9A 5EDXA 4WUUE 4C58B 3DUSB 4F57H 1LILA 2NY0D 1WBZA 1J5OL 4RA3A 5T3XL 3INUL 3HI5H 4OZIE 2C3HA 4PG9A 5E6ZA 4P5MA 1D9KD 3NTCL 1FO0A 4M7JL 4OKDA 4QRRA 4Y19E 4MAUL 2HT2C 5TQ2H 3NPSB 3GMPA 1F6AA 3CH1B 3IDJB 4J3TA 1Z2KA 3H7BB 3KXFD 1IC1A 3WFHA 4X80H 4V1DA 3VD5A 4JRWA 4M1GH 4NO3A 2ZSWA 3RTQD 2ZUUA 5DI8B 3RWEB 4AT6B 4DVRL 3DSFH 4W70A 3SDCA 4GJTB 1GC1C 4U49A 5MEOA 4HT1H 3WO4C 3MLTA 1NEUA 3D3VE 5E6YA 3NACL 3ZTJG 5CMAB 2CDEB 5L2KD 2EE3A 4AM0A 1UM5H 3GJFA 2AQ1A 1I1RA 1MH5A 1U8JB 3NABL 4BFIA 5LGHH 5EC2B 4JCMA 1JTTA 3RNKA 1Y6NR 1EEYA 3N50A 1B0RB 1T2JA 3KYKL 3L3JB 3ROLA 4Y4HA 3BX7C 4RFOH 4Y4HC 1VERA 3OKLA 3NCYS 1WZ1L 4ALAH 4AIZA 3SQOL 4OLWL 4ZOCA 3HZMA 5I1GH 4X6EB 1CK0H 1LEIA 1A14L 2XWJB 3WHXA 4B53A 1RJLA 3PWNA 3LEXA 3WIHH 3RDTD 4OZ4B 5EO1A 1KJ2A 4JO4L 4H1LB 2IBZY 2VDRH 1QYGL 2G5BA 3BI9X 5F44A 4JHAH 4NQTA 1MCOL 2ORBL 4PY8J 3T3PF 5DMIH 3KHQA 2JLLA 4QHKI 2NY5H 3KPSA 5MENA 3QPXL 1HILA 5JDSA 2FHBA 4QT5A 4JQIL 5TE7H 3X3FL 2PUQT 4OCLC 3DGGA 5I15L 25C8H 1PZ5B 1D5MA 1Q94B 1YY9D 1TPXC 1R24A 3VWKA 3VWKC 2QSTA 3PXJA 3QFJD 4J3XA 2B39A 3CD4A 4OCRH 3QBTB 3AAZA 3FB5B 4XAKE 1WIOA 1UYWL 4IRZH 4OFDA 1QSED 1BLNA 1SEQL 3U0WL 4OV5B 2OMNA 3RNQA 4PJ8B 1IGJA 1KXTB 2AXFB 1E4XH 2MKWA 5FO7A 3RWHB 4Z77A 4M6ML 3OL2A 2A77H 3A0OA 1QRNA 3MGTB 4PJHF 3IAGC 4L4JA 1QP1A 3BDXA 3MA7A 1EFQA 5FM5O 3MBEB 4G7VL 5DJCA 4DQOH 5F8QC 5EU6D 5GS2D 5IT2H 4OBRA 4X8JB 4TRPL 4F7EA 1NAKH 2QKIA 1ND0B 3T3ME 1XF5A 1OCWL 2AJSL 3HZKB 2FIKB 4M8QA 2Y7QA 3DXAB 1MCEA 2EZ0C 3PXHA 1ZA6B 3MROA 4UT9L 5KZCD 1OM3L 1ZANL 3JTTB 1ZS8B 1DN0B 1YEFL 4PJ5A 1T20B 2R0KL 4XGZA 2FATH 3HC4L 3KPPB 3NA9L 3TYGH 5EOCH 3MNWA 3O45B 3BGAA 5JHLL 1IEBA 2VXVL 3ZDXF 3NCEB 4MD0A 1TTFA 5IOPB 4NKQB 1XCQA 4HUVB 2UWEF 2FJGB 1P7KA 4WW2A 4WW2C 3BGFC 2FDBP 3C2AL 1Q9OB 4L8BB 5ESAA 4JHZA 1JYXA 1CGVA 3K8KA 3EYOB 4K7PY 2IPTH 3MLWH 1UKQA 2D9QB 5BMFL 4LASH 4UOJA 4BSJA 1MJUL 3BP7A 4WUUA 4MWFA 3WKNA 1HKLH 2VR5A 2Y36H 2VZVA 1YECL 3IF1B 2XA3A 4OZIA 5E6IB 4ELMF 3O4LB 3DECA 2X4UB 3B5TA 4CU7A 5CD5C 4U3CA 4Y19A 4PJAE 1JYNA 3KYAA 1K8IB 1KBGH 1X5GA 3BH8B 2IAMB 3KR3H 2X4PA 3O3AB 5CHNA 5C07B 4GRMB 4PJXF 4JFFB 3TNMB 4H0IA 1UVQB 43CAB 3QEHA 4L29A 4XMLL 5DQ9B 5EBMA 1RJCA 2XTJE 2UUDK 3NCCB 4ONFL 2APFA 3V52L 3LN5B 3HE7D 1MI5B 1PSKL 4D0DA 3NGBB 3IDGA 5A2IH 3BVNB 4NDMA 5JXAL 1QFWH 4IRJD 1DTUA 3SKMA 3D18B 3HLAA 4V2BA 3OJDB 1I8KB 4GRLB 1IGFH 3TJEH 3JUZA 1G7IA 5F7FA 3PGCA 5EO9A 3LKPB 4Z7OF 5E4IA 1KCUL 1FFQA 4BELD 1QSFD 4LFHD 1MHPL 4LHJB 3O9WB 1G0XA 2RR3A 1Q0YH 4L9DA 3R8BB 1JRHL 2E8ZA 1JPSH 3ECBB 4H8WC 3KPRB 3QWRA 2EEBA 2Q3AA 4R4ND 5E8EA 3MJ9L 5C0FA 5JPMB 4DJMA 3O8XA 3O8XC 2DQCH 5C0NC 3RGVA 2P7TB 3DX9B 3AB0C 3BPNB 5JUEL 5I1JL 2IQ9H 4G6MH 5L9DL 1RUPL 1ZVSA 5D7SL 1J12A 5EA0H 1ES0B 3I84A 5EUOB 1MAML 1M71B 5F9AC 4QOKD 4HUWB 3QISA 2LFGA 3HR5B 1PW3A 1FGVH 3QXDB 3SDDA 3VFMB 1I4FB 4DVBB 5KG9B 1ZMYA 4BQ8A 3S3JA 3TH2T 1PLGH 5INDB 4XP4H 2C5DC 4YLQT 3RWFA 3BEWB 1EFXD 2X2YA 3P0VL 2YOCA 2BXZA 2UV3A 4A6YA 1MIMH 4PRPD 5I2IB 3MR9A 2MHAA 2IPKB 5F7WC 2J6EH 5DD0H 4NO0A 4OF8A 3OKKB 3SY0A 4D9LL 4MMXC 2ITDB 4W4NA 3ME0A 3ZTNL 1WZLA 2X10A 1F4AA 3ALWA 3U1SL 1DL7L 1NH6A 1D5BB 3SPVA 3K1KC 2E9WA 5KJRL 3TA3B 3T1WA 4J1UA 5EORL 4WJ5B 2BOBB 5GGVY 4EZMA 2XQBL 1S5IL 4LVEA 4LKCB 4FMFA 2A83A 4PB0H 3TIDA 5F9JA 5LCVH 4MX7A 5DEFA 3EAKA 1YDPB 5EB9A 4GKNB 1CDYA 7FABL 3MO1B 3OKNA 2Y23A 2ZPKL 5IB5A 1X5HA 1D6EA 1XF4B 2WP3T 1DQQB 2IANE 5HGAA 1OTTC 1FGNL 4MJ5B 3VFWB 2CRZA 2D0GA 2OR9L 3LQZA 1NGWB 4BFEA 4F7CB 5BVJA 3TC9A 2H26B 1LO2L 3MRGB 5F1OB 1RUQL 3CFCL 5HI5C 5I66A 3G5XB 4P4KA 4NQXA 4P4KC 5HHMD 1CFBA 3MV8E 4ZMAT 4RMQA 2H9GA 32C2A 2XRAL 2FGZA 3QCVL 3GMRB 4F9PC 3U7AA 2Z35B 3FTGB 1QG3A 1TETH 4EEEA 1XF2A 3FN0L 4HJGA 4PLOB 4I0PD 2R1XB 1T0NA 2KUTA 3WIHA 5IFHH 4TVPL 1RK0A 4XVTL 1X5XA 1SY6H 3QIUA 3QIUC 4Y1AE 2C26A 3TBTB 4WW1B 2R8SL 3DX8A 4G9FE 5IF0A 2CLVA 1IFHH 4PGCB 1NGZB 4NYLA 2O5ZH 4NKIL 3SOBH 3UBXG 1OSZB 3KPMB 4CMHC 2YD7A 3U9PH 4ZNEE 3GO1L 3P4NB 4TSBL 3WKMH 2DD8L 4L3CA 1PX4A 2OXGA 3RL2A 5SX5H 4PJIB 1FL5B 3LKRB 1K6QL 4EI5B 2EXWD 2HLAB 4KHTL 4GSDH 4LLVB 3VDBA 1I8IB 3CFDB 2R9HC 1LE5B 3OX8A 5IB4A 4KPHH 3MV11 5EZLB 2D03L 5JHDB 2F54D 1TVBA 1Z5LA 2VN4A 3BE1H 3L1OL 4YAQA 4GW1B 5F7MC 5DURB 4GW5B 1FN4A 1CXIA 2PXYB 5TJWK 1U93A 3TBYB 1ZWIA 4Z78A 2XTJC 2I27N 4U4BA 4YGVA 3LD8C 5JOPD 1RUAL 2DLGA 3T0AA 3MQIA 5I1LA 5BRZB 3LVEA 1MCNA 3MACL 3DI2B 4MXQC 4FTVD 5DJ2B 4HH9B 5I9QB 5KOMC 3F7YB 3PF2A 5JPNA 5I1HH 2HLFD 4S11A 3JVGC 4M48H 4FQHA 1CE6A 1CDIA 1BJMA 2AXGB 1YNTB 4X4YA 1LE9A 3QUXB 5LWYL 3ZKMD 1M7IA 1ZE3C 1AE6H 3B2UC 3MUY1 1AI1H 1YC8A 2FL5A 1EHLL 1UB6A 2B8OT 1Y6MR 4UNUA 4LAQL 4BZYA 4MB3A 4AIOA 1OARL 3HRZB 3TZVA 3TZVC 5E9DD 5CSZB 1KCVH 1KEGH 4KXZH 3K46A 3KYOB 3C9NB 1NGQH 2N4IA 3DVGB 4S2SB 1A1MB 4WTZA 5CBEA 4ODBD 2CKBL 1DE4B 3IS0X 4K2UL 3VI3E 5D2NA 1QBMH 4WFFD 1W72L 1KEML 2P5WD 1H3VA 5IMKA 3EOYG 4M5YL 2Z91B 3CVHB 3G6DH 4K7PH 4OCXL 3ILPA 2H32B 5T5NG 3BEVB 5TDNA 1MFEL 3OSKA 5D7IB 2DWEB 5ETUA 1S9KC 3ZE2E 3U30B 5AZ2H 1AD9B 1D5IH 3EJZC 3JWDL 2KZWA 5E5MB 4P2OB 1KLGB 3FFCD 4FQIH 4QRSB 5CEXB 3TFKC 1KENH 3MNVB 4UOW1 1ACYL 3NZHL 3TT1H 2NLJB 3SE9L 4YHIB 5HVGB 3CDGB 3W11C 4PJGA 3B8YA 2APBA 2E27L 4I2XB 2VXTH 4HG4J 5CEZH 4JM2F 5B3JF 5JO5A 5IVNA 5FGBA 5FGBC 1WAAF 3BYTA 2EC8A 2FSEA 4RMSA 4R7NB 4X9BA 1WK0A 3GKWL 5E4EB 2AJVL 4LLYA 3MZTA 4NZJA 3TBSA 5J7CC 1S7QB 2GT9A 4G6FD 3VXMD 1N7ML 1NMCB 2YXFA 4O4YH 1U92B 1UXWA 2M2DA 1AQKH 1HH6A 2D7NA 2EDOA 3BW9B 5E08H 4RGOH 1F58H 2FRGP 4I4WB 4OIIL 1A8JH 4KJWD 4X0KB 1PYWB 4KQ3H 4G6KL 2GK0A 5FECA 4MB4A 1ACZA 2EH8L 3V4UH 4N1EA 2IANA 4RAUA 1JGVH 1A4KA 2XG4A 5DHXB 5ADPH 2FD6L 1CL7H 2UY6A 2NY4D 4WHTB 1ZLUH 2HJLB 3P4OA 1KXQE 4ZSOE 3X13A 2AQ3A 4FQLH 4HC1A 4UB0L 4EQ2A 2AEQL 1J0HA 3MV8A 2H2PC 3RAJL 3S37L 2ID5A 4LLDA 2A9NH 1XIWA 1XIWC 3BSZH 1P69B 1VFMA 2PR4H 3LS5L 3SKNB 2VDLH 3L3GA 2RJMA 1FBIL 4U3HA 4ZS6D 3X12B 5C1MB 4JFQB 2ZWLT 4ODUA 1QFOA 5FYKL 1DP0A 2W65B 4Y1AA 3IJSA 1GC1L 4NRXB 1A6AB 5DVLA 3U7YL 2GEEA 3EGSA 3MTRA 3V6ZB 4QHUB 3MLVH 2E7CA 4P2QB 4HIEB 1S9XA 3T1FB 2V5MA 4QWWC 4N8CH 1WBYB 4ZNEA 5F89B 4LSQL 2AK1L 3W39A 3MLZL 5C0BE 1XGRA 5DJDA 4PJ9B 4PLKC 3STBA 1D5ZB 1JGLH 3UP1A 1S9WB 4DN4L 4W6XB 2QQLH 5C0EA 5LBSL 1Z0MA 3KDMA 4ONHA 2W60B 4ZUUB 3WHE0 1NGPH 3MLRH 3N1MC 4ODSH 3MV7B 1XT5A 1EGJH 2AK4E 4PJBB 5DFTA 3QDGB 5GS0D 5JIKA 5GIRB 2P8LB 4HIJB 1CXKA 2Q20A 3BFOA 4U1IB 2DQGH 2NY6D 3K74B 5F88A 2F74A 3H9SE 4IMLA 5GGSA 3CMOL 1RZJH 2BNRE 1KJ2L 5CEZE 1G6VK 2A1WH 2GITB 4GQPH 1FVCA 3RWDB 4JR9H 3MRHB 3SKUD 3BKJH 5D70H 4PRDB 3QQ3B 4WGVB 3DI3B 5D7LE 1K2DA 1KPRA 3ARBB 1CGYA 1WFNA 5EU5A 3ROOB 2JIXA 4WCYH 3CPLB 2HRLA 3SKJL 3NCFB 2YR3A 3MODL 5I30H 4ZUTB 2OP4H 3WJJA 3WJJC 1L9MA 4N9GB 2X7LB 1CU4H 5SWSE 4PJDB 3OKEB 3RPIA 3CVIL 2JCCB 2BSRB 2LVEA 2R0WH 4C55A 4XMPL 5HPMA 4PUBH 3PUCA 2NY1B 4X6FB 2QR0A 4CW1A 5B8CC 1P4BL 4QRQA 3SDAB 1FC2D 4PGDB 3FQTA 4YHNB 1GZPA 4PRBB 5I8OH 4PY7B 1T2QL 1WCQA 4IEFB 5LKNA 1D6VH 3QAZC 4G9DB 2BNQB 1A21A 4EN3A 4MJIA 5ACZA 3GZKA 2ITCB 2VZ1A 3QA3A 1DQMH 3LHPL 3BN9D 3RWIA 4X98B 2NY3B 4PREA 4OGYH 1R3KB 5DC9B 1IVLA 2R2EB 5DGQA 2ZUSA 4OT1H 5BZWA 4DZ8A 1MOEA 4M7ZC 3O2VL 5J13C 1RZIA 2I60H 1F42A 1UJ3A 1UJ3C 2YPLD 3ARED 5E8PB 2YS4A 3DRQA 1FPTL 4JCLA 3O4OC 4NQDB 4XVJL 1CFQA 1G7QB 3QR2A 2CXGA 1TTGA 2DQFB 2HA1A 4X7SL 5FO9A 3IS1X 5C0CD 3KJ4C 3X3GL 5LJYH 3UTQA 1JK8B 1BM3L 1L0QA 4CADA 1VFBB 1J9CT 2IEPA 1A4JB 1DUZB 4UU9B 5D1XB 4KJYA 2R0ZH 1F3RB 4J8RA 4XCEB 4XWOD 4FG6D 4JKPL 1EZVY 3TVMD 1IKFH 2V17H 4JVUA 4OTXH 3L3HA 4JHWL 1KCRH 1VEOA 4MA8H 4XI5C 3CXDL 5B4MD 1RK1A 1U8OB 1ZK9A 5LVEA 4QTIL 3ZZ1A 5F9WB 3S5LA 3PJSB 4P5TA 4P5TC 5T1MA 1FJ1A 1FZJB 3QO1B 1AXTL 1N3NB 1KJVA 3NZ8B 1E28A 5ILTL 4WIQA 1I1AA 1I1AC 5I19H 1HYSD 3ZL4L 1WC7A 3STLB 3N1FC 1CBVH 2IFFH 2W9DL 9CGTA 1IQWH 5FCUL 2ZCLL 4U05A 2GSGA 4P9ML 5GGRA 3T0EB 1AXSB 3EYUL 5DR5H 2BDNH 2ARJA 4ZPTB 1L7IH 4KKLC 4MSWA 1UZ6E 1CFNA 4OGXH 5E94B 4ZSOA 2HMIC 4XNYL 2R0LL 1UZ8A 1J1OH 4Z8FH 4P5KA 3WS3A 5MHSE 4MQ7A 4YHYC 4HUKB 3QIBA 3QIBC 3KWWA 3BJ91 3ILQD 4PJCE 2EYRB 1FRGH 1BVLA 1HZHH 3T2QA 2Q7YA 3MUHL 3ZDYE 1CGSL 4FQXC 1U2HA 5E7BA 5C08D 5A16A 2YSSB 4HWEL 1T66C 1MFAL 2ZUQB 3FOMA 5C0BA 3SN6N 5IG7B 4RISH 3VXOA 4LP4A 4X5LA 4L4TE 4IHOB 2APWA 2B7DT 3BIKB 3ZKQD 1ITBB 4K71B 3TH3T 3WFEH 4RFNC 4XNZB 5SWQA 5E1AB 1LP9F 3BZ4B 3P0GB 2QSQA 3DO7A 5KSAA 2UZIL 2XKNA 5J06A 2AK4A 1HH9B 2BSSB 3I85A 3IKKA 4Z7UE 2HFGL 4H8WL 1A9EB 1AQDB 2E6PA 3H9SA 4GFTB 5EU7E 1S7VB 5HYFA 4XNUH 2BNRA 3BAEH 2VC2H 1TVHB 4U1KA 2FX8L 3ALXA 4AJ0A 4OF0A 3DOSA 4OZHE 4Q2ZB 1CQYA 2WUCH 5D7LA 4ETQA 4Y5XB 1P53A 4F7MA 2CH8A 5DD6A 5CGYC 4LHQB 1TJIH 4N9OB 1P7QB 1ZT7B 3LCYA 5MEPA 2C1PB 2GSIA 3CMGA 1NKOA 5KSVA 5IVXB 1Q72H 1KJMA 5SWSA 4OQ1A 1LO3H 1TZHA 3PWLA 2QQQA 4E41B 4JO2H 5GSRB 1X5ZA 4QO1A 1WITA 1PDKA 1RUMH 3B9KA 3B9KC 1BWMA 4R2GB 1BFSA 4MNGE 5E95B 5E24E 3WE6A 2R69H 5IHUH 2A74A 1X4YA 2FBOJ 3HI5L 4HS3A 3O6FB 4PP1D 4LL9A 5E2TL 1NUFA 3V7AE 2F53B 4UINH 2F15A 4GRWB 1YPZB 1MEXL 2EDDA 4N0UE 3S97C 4MJ6B 1HHIA 4JFYB 5BV7H 5E8NA 1FVDA 2NX5B 4BFGA 1TJHH 3D25B 4JPKH 4UQ2A 4X80L 5ESQB 4ZUWA 4Z5RB 2NXYB 4HCRH 5EIIB 3MJ6A 4MD5A 2ATPB 5GISH 4HS8H 1J18A 4HT1L 1I1CA 1OSPL 2JK5B 4KJQD 3I02A 2I5YH 3CFIC 5ID1A 2IQAA 4JM2D 3AGVA 3U9UB 4M61A 1UM5L 3QFJE 3QWOA 3ZYIA 4M7LH 2G5RA 2Z8VC 2R4RL 4NWTH 2C3VB 2JKXA 3DSNA 4G6AD 3OHXA 4ONOA 1X5KA 1HEZA 3PQYB 3OBAA 4RZCB 1T80A 3D39A 1UM4H 4XZUB 5FM4A 5JOFA 2E7MA 4X6DB 2J4WH 2ZG2A 4RFOL 3S96A 1Q9WA 2XN9B 3QNZB 1I3RA 3OJVC 4NGHL 4BZ1L 4JPWL 4NN5B 7CGTA 3GK8H 5HHPA 1JUFA 3HAEG 5GZNC 4ZAKB 5D6CB 4NRZB 5I1GL 1KT2B 2EDHA 4YFLF 1X3DA 2ZZUT 1CFTA 2H2SC 4RMTA 2CJUL 3HHRB 5KSBB 1IM9D 3TEUA 3WIHL 4XC1L 3EOAB 1QSZA 1RZJC 4Z7VB 5IV2A 4XCFH 2VDRL 4HKXA 5D7IF 4KTDH 4JHAL 5F1IB 3GIZH 2NY5L 4ODXA 3TPUB 2X6MA 2BX5A 3FO1A 2BXYA 5DJ0B 4LKXB 2ZOKB 1FSKC 3OB0K 5TE7L 4TTGA 25C8L 5FHAH 4PRHB 1HOCB 3EO1B 3RVUD 2YWZA 4KK6D 3MBED 3SDXB 43C9A 3TLRA 1TCRA 5EC1A 1WFUA 4U6TA 4CNIA 1NMAH 5F7NC 1R5VB 3DTXB 1JFQH 1KGCE 4OCRL 3ZMRA 1OAKL 3WHE1 1FLRH 4PJFA 4MDIA 4M8VA 3KPQA 3QJHB 3MRDA 4IRZL 4RQQB 4FNLH 3V0AC 5E2WH 3BP4A 3SJVE 4MDJB 1AKJA 3DXAD 4J7RA 4S1DD 5AD0B 5DJAB 4PJCA 2X89A 2A77L 1DJSA 3TN0B 5E8OB 5LAXA 4M1DH 2Q8BL 2X70A 3UYRH 6CGTA 1DBKH 3I6GA 4OM1H 2HN7B 3K3QA 4JPVH 1GXEA 4N68A 2D0HA 2Y5TA 4KK5C 1V05A 2EXYC 2BP3A 3QULA 3WFCH 4DQOL 3D5OF 2UUDH 4YXLH 5IT2L 3DROA 3FCTB 5ISZB 3ARQA 1NAKL 4L4TA 4Q74A 2W91A 2H6PA 2WQRA 1T7ZA 4WNQB 4BYHA 5ESVB 4GG8B 3LDBB 1EDQA 2NY0C 5B38A 4JDTL 2WNGA 3AM8A 1CICB 1YEKL 3AM8C 4L8SB 1AR1D 4X5WB 2AJUH 4X4XB 2PYEE 4OF6A 1A7OH 5F9DC 5BQ7B 1D9KA 1D9KC 1QHOA 2BVTA 1SQ2N 4GKZA 2QJDA 2LV4A 1XEDA 2VDPL 1M05B 3CFKB 2PKDA 5EN2A 4Z7NF 3WXVL 1LNUA 4WVRA 3HA0A 5EU7C 3U2SB 1RJYB 3NCJH 4OFIA 4XCCH 3UXFA 3TYGL 2F8VA 4R3SB 1FL6A 4FRWA 2MKLC 5CUSL 3OPZH 3KXFA 1AH1A 4AENB 1UACH 4OZHA 5D7JB 5E6ID 1FG2A 3VXQA 3L9RB 2YZ8A 3RTQA 3RTQC 1KSRA 3RL1A 1GPOL 2CDGA 4ZS7H 2YD6A 2A73A 2IAMD 3ULVH 3KPNA 3IT8D 3HMWH 1S7UB 4GUPB 5C07D 3UTOA 3IXTB 4DKFH 1ETZB 1B0GB 5I75C 1U95A 3HC0A 5EWIH 2IPTL 4B7IA 3V4PH 3MLWL 4LASL 5B3NA 4JG0H 2OZ4A 1PKQB 1V3JA 4KV5E 1QLEH 1MI5D 5K9OA 1DSFH 3P0YH 1FV1B 1CT8B 4MNGA 2BMKB 1NGXB 5DHVH 1EIBA 1JWMA 1KTLB 5F3BB 4X9GA 4PJEE 1KULA 4GRLD 4ZTOH 1AC0A 2Z4QB 1KBGL 3RVVD 1P5UA 4OKVA 4MNQB 5F1NB 3KR3L 2GAZA 5KBNC 3RDTA 1A7PH 4N0UA 3RDTC 3VXTB 4KKAC 2UYLA 5TH2B 4ISVA 2BFVH 4A2LA 4HX1A 1NEZA 4LF3A 1FFOA 3O9WD 1IZKA 3TF7C 2P8PB 3IDIA 4Q0XH 5IR1B 3TT3H 2HFEA 1ADQH 4QHKJ 4ZTPH 3N9GH 1QLRA 1TQBC 4UDTB 2V9QA 3U6RB 3MX0A 1RIUH 2R2BA 2EDNA 5EOQH 4NKMB 1QFWL 1YY9C 3PHOB 4Z76A 2VITB 5K9QG 5L0QC 4NHUB 5HVHB 2FO4B 3QFJA 1BFVL 1EO8H 1N8ZA 3QZWA 3IB4A 2NXZC 4JANA 3THML 1XCTB 1U8IB 3TJEL 2AS5M 4G42B 2DM3A 1A6UH 1H3XA 2QV2A 2H3NA 3KJ6H 2ZJSH 2ZSVB 1H15A 3QNYB 4ZDHA 1DLHB 3KLSA 3MOAH 2GK2A 1CLYH 2XOTA 3BPCA 4FXLA 1JPSL 4PJ7B 4R97C 2D7QA 1YEHH 5I8EB 3C6LA 3C6LC 1NFIA 4M43H 2EE6A 4CMMA 1IAKA 2KL6A 1JGDB 2FECI 3EZJB 1OP3K 1B2WH 2VDMH 2X4TA 3TESA 1C16A 1ZSDB 3H7LA 4EBQH 2EO9A 2IALA 1XGQB 2IQ9L 5EU6A 2AEPH 4R26H 1CCZA 1Y18B 4MA1C 1KG0A 1ZGLM 1KTKE 4JN2A 1IGIH 4CVWA 1PJ9A 2ADFH 1F4YH 4XVUD 3SO5A 4QNPE 3Q3GA 1CXHA 3DV6A 2AKRB 3EYSH 3BT2H 3CU1A 4ODTH 1FGVL 1YJDC 5T3ZD 3T2NH 5IM7A 1VKXB 3F58L 3HN3A 3STZA 3QDME 4XP4L 3T08A 2YPVH 2DJ4A 1J1XL 3FKUS 3HS0A 2VUYA 1CZ8H 1MFCH 3E8UL 1KIPA 1LK3H 2YXMA 5DVNA 3WYRA 2C1OB 3P9WB 3QJFA 1EEZA 2I9LB 4LVHC 2J6EL 4PRAB 3MRRA 5ELIA 3ULSB 5DRWB 5HHME 5GS3A 4IOFD 4F37K 1HHKB 5T1KB 3W82A 3O11A 1NC4A 2VLRE 3JTSA 3UBXI 1IT9H 3MCLL 5B21A 2MTPA 1T83A 1T83C 2VLKE 4L8DB 1Q9KA 3TBVB 2FZ3A 3TNNB 2DIAA 1AR2A 3EDEA 1IQDB 1NUDA 5BV7C 1BIIB 5GQBA 4MQXD 1S7WA 4HCRA 3MRPB 2YUZA 4ZXBA 4ZXBC 5EIQA 2ZUTA 2E9BA 5EFIA 2J2ZA 1A7NL 3T2PA 3ARDC 4OUUB 5KSUB 2OXHA 2DOCA 2Q86A 2PYEA 1IZJA 2P8MB 5H2BA 1K5NB 5DUBB 3MGOB 4YC2B 4LSUL 2ZP0T 1FL3A 2C3GA 1T1XA 2OTPA 5IP4A 1WIUA 2ZNWA 3QFDA 4U1HA 4UI2A 3C09C 3KYMB 2F54E 3LY6A 2XZZA 1KACB 4HLJA 1B6UA 1TCMA 1DR9A 1TZIA 4U1JA 1NCCH 5IHZA 4EI5D 3MRFB 5A2JH 1TETL 1OQXA 3DBXB 4P3CL 4LPUA 2DJSA 3HE7A 5JOPE 5CJXA 3S8WA 1JBJA 3CLEH 4HF5L 5IFHL 2O61B 3O3EA 2FBJH 1SY6L 4IRJA 4IRJC 3V5DB 3SGDH 1AP2B 1HCFX 3F12A 5DURD 5I1CH 3WFDH 3G6JB 1IFHL 2O5ZL 5DZLA 3SOBL 1CVRA 2A6JB 3U9PL 3FT3B 4N5UA 3WKML 4I9WD 3DJ9A 4TUKL 3U46A 1CQKA 3WLWD 1MNUL 2OJEB 3P73A 1T5XA 4I48A 1YMMB 3BH9A 4HJJH 4WDIB 4PJEA 3T3PE 2IMNA 2AGJH 2KKQA 3X11A 1DFBH 2CK2A 4R4NC 5GGTH 1FVEB 2R23A 2QTEA 3QUXD 4FQ1L 3MZGB 1JWSB 2QL1A 3U48A 4UMGA 3BE1L 3VXNA 4OUOA 4Y2DB 3S36H 3F5WB 4RIRB 2XPGB 3C5ZD 5HY9B 5F7DA 3HG1B 2LABA 4Y4FA 4Y4FC 1GZQB 5HDQH 3ULUD 4EUPA 1IJ9A 3IXAB 4LMQI 2VDKH 3TWCH 1NBZB 5ECJE 3BZEA 2ICES 4B7LA 4OF7A 4Z0BH 3BP6A 4P4RA 3HCVB 3MSPA 2AVGA 4UBDD 1UWGH 4XRCB 2ERJC 4ZUSA 2IF7A 4DZBA 4P57A 1TJGH 5IMOA 5I1HL 5K59F 3IFOB 1EFXA 4F15C 3WIFB 1XR8A 5IB2A 1G7HB 5FKPA 4PJHE 1ZVYA 5FYLH 3FFCE 4QY8A 1WTGT 1F3DH 3MXWL 3LV3A 3ARFC 3ARUA 4JFOA 5DSCB 4ZYKB 3Q1SH 1KEGL 1KCVL 3CH8A 4NT6A 1ZT1B 4KRPC 3GKZA 1XF3B 4JRYB 5FA4A 3QDHA 4FQCH 3LQAC 1EXUA 3JWOH 5I1DA 4GS7B 3VXME 1E4WH 5HGHA 1QBML 3BUTA 3MMEB 4G7YH 3UTZB 1H3PL 3MC0A 5J9PB 2FIRT 4QHLB 1R5IA 4TUOB 4WV1A 4WV1C 2APXA 4AL8H 3G6DL 4J3WA 4N0FB 3H9YA 1ORQA 3PHSA 4KVCH 2XZCL 4LBEB 2WINB 3LSOA 4YQXL 1HHHA 2QADB 5AZ2L 1D5IL 3UTPD 5EZOL 4L8CA 4YBQD 4OV6F 4F9LA 2WBKA 4F9LC 2UWEE 1KENL 4JO3H 5AWNH 2J8UB 1LEKB 3U0PA 5DHVA 1MHEA 5H35A 4ZFZA 1VFAA 5CEZL 4WRLA 2VLRA 4F7PA 2VXSH 3VXRB 4JREC 4I0PA 4I0PC 5HDLA 2VLKA 2X4NB 3KPLA 3S35H 2X44D 1Z9MA 2Y5EA 2Y6SC 1R3LA 2FJHB 2NY7H 3CZFA 4WI7A 5LXGH 3MRIB 5IVZA 1ROWA 3H2WA 4O4YL 5C2BH 3BO8A 4I0CC 1AQKL 3QQ9C 4ELME 3SDXF 4RGOL 1F58L 4I13B 4KKCD 1NBVH 3NCBB 3S88H 4NSKB 1A1OA 4KQ3L 3VXUE 1PFCA 3EJYD 2NW3A 3MJ7B 5FGCE 1SJHB 3QNXA 4PJXE 2GQHA 2X9XA 1CLOH 5FKAA 3RWGA 4X6BA 3E6HA 3QWQB 5FDYA 1ZAGA 3U4BH 2HFFB 5GRWA 3B9VA 4WUKH 4Y16C 4YFLI 3BISA 5FYLE 2QHRH 1GOHA 1I9IH 2JB6A 2ENYA 3U79A 4HJ0C 2F54A 4PJ9D 5IB3A 3OAZK 5EBLA 2CKBB 4KHXL 1G84A 2X1XR 1G6RA 4TULH 3BSZL 3BPOB 2PR4L 1W72B 1TITA 1BD2E 2VDLL 5BW7C 3CNKA 5BW7A 1NCNA 3MV7D 4U1GB 5FDWB 2XA8H 4HIXH 1RHHB 4I8DA 2OTUA 4OCSL 4HFUH 3HC3H 1OLLA 3QDGD 3M07A 4Z7OE 2EYTB 1QBBA 4JFDE 4FTVA 2HJFA 5J4MA 3PABA 2HLFC 1R5WA 4BA8A 4N8CL 4F2MB 1TTUA 1EUUA 4GRWH 3QHZL 1E6JH 3F7QA 5CS7A 3QG6B 3ZKMC 1Q0XH 5A3IC 1JGLL 3OXSA 5CWSA 1A6TA 3ARBD 1XH3B 3MLYH 2AJXH 2QQLL 5D96B 1Q9LB 1VACA 1LO4H 1NGPL 5E9DA 1KLUA 4XCNA 2OL3A 4EI6B 1I7ZB 4LLUB 3PDOB 4TNVF 4NWUH 3UJJH 1X5JA 4JG1L 1OAUH 3HE6B 4YDLB 2DTMH 4DOHE 1QKZH 3QH3A 4UILH 2LU4A 4Z9KB 2XACC 2NY1D 4RGMC 2AV1A 4MS8D 1RZJL 1EJOH 1OF2A 3SDAD 1II4E 2EKJA 2A1WL 2DQHH 3TPKA 3BKJL 1BECA 3LEVL 3PL6A 3PL6C 3X14B 3VFUB 5FOBB 5IBUB 2BNQD 4WWKD 1ZHBB 3MRJB 4NFBA 1P4LB 5ICYB 4WCYL 2YN3A 3EHBD 1JNLH 5GRVL 4AEHH 5I30L 3RY5A 4GXUM 3UAJD 1F5WA 4PJHA 1S7TA 1S7SA 4ZQKB 5JW4M 2WIIA 4K3DH 1MRFH 3FFCA 1RHFA 4PG9B 4P5MB 5TDPB 1J10A 2NYYD 4JRXB 3VXSB 4NQEE 1I85A 1I85C 2R0WL 3BUYA 3UPCA 4PJGF 1NBQA 4PUBL 5A2KH 3O81A 3L7FA 4GAJH 3GMPB 1F6AB 1INQA 4B0MM 2N1KA 4LSTH 3HZYB 4WU7A 3MRMA 4NQDD 1QOKA 1H8OA 2W38A 3GMMA 3LKOB 3AS3A 4R4FH 4V1DB 3FQNB 5IEHA 4FQJH 1KB9K 2ZSWB 4QF1B 5GS1A 5GS1C 3OZ9H 4ZFFA 4PTUA 5HDBF 1S8DA 1DBJH 3CX5K 1U8MA 3VXMA 4HSQA 5BO1H 1Z3GH 3WO4B 1ZHNB 1FP5A 3ARZA 3CDCA 1DQML 3KLHD 5D1XD 1EVUA 2P49B 1ERNA 2BVYA 4PGZA 3MRKB 1H3WM 3GJFB 3MV9B 3PWPB 4KJWC 1KTRL 4OT1L 4E42A 5D1QB 5FUCE 2I60L 1K8DB 3V8CA 5HHOE 3ROLB 4WHDA 3I3BA 2DWDA 4Y4HB 4HUXB 3BGMA 4O02L 4DVRH 5DXWA 1MY7A 3KAAA 4AIZB 1U8PA 1K9TA 2UWEA 2NY4C 4PJ7F 2DYPB 3P3YA 4W4OA 4W4OC 1LEIB 3WHXB 4HWBH 1QFWM 3PWNB 4WHYG 2PN5A 3SGEI 4F7TA 4LGSB 4Y7MA 4NKOA 2CLRA 3NABH 2GY7B 3UTSB 5D2LF 1VEMA 3W2DH 3TCLB 1KJ2B 3TO2A 1F13A 5H37G 4LQFH 1XGUA 2G5BB 2R0ZL 3T0ED 5DUPH 4RRPA 3QUZD 5HGDB 6FABH 3WNMA 5JQHC 2R1YA 1IKFL 3KPSB 5MENB 2V17L 4GW4B 4NNPH 4OTXL 5JDSB 1KCRL 3S6CA 4QT5B 4MA8L 4HULB 3WNLA 4YHZH 2EDEA 3SQOH 4DTGH 3NIDF 4YGAB 1D5MB 4ELMA 1TPXB 1R24B 3OKDA 4WFGE 2FLRT 4IRSD 3GSOB 4JM4H 1CD0A 1CN4A 5JQ6H 3AAZB 3VXUA 4E5XA 1ULVA 3MXVH 4JO4H 5I19L 2R2HA 1QYGH 2P48B 3NIGE 1MCOH 2ORBH 1JYVA 4HK3J 1BLNB 1SHMA 1URLA 1CBVL 2XG5A 4PP2B 3QPXH 2HJKA 3P9MB 5FO7B 5D93C 4JQIH 5CIPB 3P9LA 1QRNB 2EKSA 2BDNL 5DR5L 3D85A 1L7IL 4HQQL 3X3FH 5I15H 1T5WA 4OGXL 4NN6C 2EDQA 3REWB 1J1OL 4LCCA 1JI2A 4LCCC 1CFSA 3MRCB 4OCMC 2P44B 3UCRA 5ITFA 3GSWB 2DLTA 2QHLA 4CBPA 2GJ6E 4PLJC 1FYTE 3CSYA 3G5VA 5L8JB 4F7EB 4JY4B 3U0WH 3V6OE 1G1CA 1H3UA 1HZHL 5IBUG 4JJHA 5ALBH 4MAYA 4MAYC 3MFFA 4M6MH 3IFPA 1INEH 4M8QB 1F02I 2Y7QB 5IMLA 4PFEA 1DBMH 2V7NB 2ZUVA 3MROB 4LHUA 2VERN 4RISL 3W9EA 3U36B 4FFYL 4PPTA 5C0RH 4HFWB 4XC3L 2F8XC 3WFEL 4XGZB 1P7QD 2DQDL 3H8NA 1ZOXA 3ZE1F 2A0LD 2FX9H 3MNWB 3HUJB 4TRPH 5DLMH 2F19L 1OCWH 3VFOB 1IEBB 4MD0B 5CEYB 1XCQB 1MJJB 4N0CD 1WBXA 2LQRA 4E41D 5ID0A 1E4JA 1S5HB 3GSUB 4WW2B 4Y4KB 3BGFB 2VC2L 3AY4C 1T21A 3AY4A 5D1ZB 4R2GD 2R1WA 3PIQB 1VDGA 4G8EB 2WBJB 4PGBB 3ET9F 3G6JF 3ZKSD 5DF0A 4TTDD 1U3HC 2VYRE 4Q6IA 4Q6IC 2F53D 5JHLH 5KOVC 3BP7B 5HDOA 4HZLA 4WUUB 3SCMB 1TJIL 3AREA 2YPLA 3AREC 1P9MA 1P9MC 2VXVH 1YJDL 4ZPVB 3WD5L 1MCKA 2YUVA 4QXTA 3K2UH 5B3JE 1GHFH 1H3GA 1WAAE 2RCSH 2D0FA 4OZIB 1Q72L 1VFUA 4N0YH 3OB0H 1LO3L 4NQEA 4EIGB 3FOLA 2NXYD 2OLDA 4Y19B 2AJZB 2OX5A 3ZSSA 5C0CA 1KTDB 1KB5A 3OAUH 3DX6A 4JZOA 1RUML 3EYQD 5J8OA 3LAFA 3V9FA 1U58A 5CHNB 1EK3A 5BXFA 5EZJA 2R69L 5IHUL 3KYNA 5E03A 5D5ME 3QEHB 4L29B 4OLVL 4XWOC 1GGYA 4KK9C 3TVMA 3TVMC 4U6XB 1CDBA 1I3GH 4UINL 1MRDL 3PQYD 1G9NC 5CZVL 1F3DJ 4X5XA 1FFPB 3D3VB 3IDGB 1HNFA 4NDMB 2XKSA 2YRZA 4OCWL 5F6IC 5DMGD 5BV7L 3SKMB 2RQ8A 1TJHL 5CBAA 2D7TH 4ZAKD 1MLBA 4HCRL 3QXUA 4M5ZH 3MNZA 5DDHB 1IC4H 2AABL 1HYSC 5GISL 1G7IB 5HHOA 4HS8L 4KI1A 1OGTA 1BEYL 3GBLA 3ZKXB 1BZ9A 5CJOH 2FEEI 2I5YL 1UXSB 3MYJB 3V52H 4M7LL 2JTDA 5JW4R 4X7TA 4M6NH 4NWTL 4MXVF 4XCYA 3VFGL 4G8FA 3DUUA 1AIFA 3OR7B 3CC5A 2LAAA 5DFVD 1UM4L 1V7MH 3O8XB 4IJ3C 1NAMA 5DK2A 3IGAA 4PRHD 2J4WL 4LLWA 4G80A 3AB0B 4BUGA 5T3XD 1A5FH 3OKOA 3GK8L 1N5YH 4LPYA 3WLBB 2CD0A 5INCA 4JJ5A 3QYCA 3QO0A 1MHPH 4TNVK 1H3TA 2YBRA 1DCLA 1SVCP 2DMCA 2VISA 5EULV 5KVMC 5C08A 4UAOB 1A7QH 2B5IC 2B4CH 3FB8B 1NDMA 2VLJE 4PBVC 3TP4A 4KTDL 3MJ9H 2MCG1 4LU5H 5T1LB 4H26B 2X4SA 3S4SG 3GSXB 5J56B 3GIZL 3BIAX 4H25B 1P4IH 1RZGA 5FF6A 2Z31C 3QQ4A 3MR9B 1MVUA 4JFXA 5JUEH 3VFRB 2IWGA 2EECA 5FHAL 2Z92A 4JFHD 4YWGH 2VIRA 3FN3A 4NO0B 3FO2A 3O2WH 3SY0B 4Z6AT 1NMAL 3K7UA 1EUTA 3DUHA 5ISZD 4GG6F 1FLRL 3MREA 3QXTA 3SPVB 4FFVD 1V7NH 4XTRD 2CXKA 5C9KA 4FNLL 4J1UB 5E2WL 1G9EA 1NBYB 3P0VH 2GJ6A 3GMQA 4MA7L 1KPUB 2WSKA 3V6OA 3V6OC 2C4XA 3UYRL 4PIRF 1I3UA 2A83B 3FO0L 1DBKL 4NJAH 3TIDB 1JNJA 1DVFD 1T0PB 4GBXB 4MX7B 4LVOB 4JPVL 4JQXA 4JQXC 3ZTNH 3ORJA 1F4XH 1MPAL 3QI9A 3QI9C 4XP6L 3EW3B 3EO9L 2NW2A 3CH1A 1A3LL 1DL7H 3IDJA 3VE0A 3WFCL 5IB5B 4YXLL 1D6EB 4P0DA 5D7JD 5F7HA 3GB7B 2CO6B 5DI8A 3RWEA 1FNEB 3HKFA 5GJTH 2YD3A 2ADGA 3LQZB 4BSWA 5I66B 5DS8A 3J7HA 1JE6A 1ZEAH 5CMAA 2CDEA 5CZXC 2AJUL 3RWCA 4M03A 1U8JA 32C2B 1A7OL 1EA9C 4HJGB 4OM0H 1UKSA 1T0NB 2ZPKH 3NCJL 4XCCL 1B0RA 3L3JA 3OB8A 4UQ3B 1RK0B 3S34H 5DO2C 5E00A 1I8LA 3LQAL 1OW0A 1OW0C 4P46A 4P46C 4JFEE 4GH7B 1UACL 4Z95L 5IF0B 2CLVB 3V2AR 1A7RH 2PNDA 1RY7B 1LO2H 1S78C 1CF8L 3CFCH 3RJQB 2VABA 1OP3H 4CMHB 1JNNH 4HS6B 2XWJA 5ENWA 2P42B 3IDNA 4ZS7L 2DJUA 3HMWL 5IUSA 4NRYA 2VL5B 4JM2A 2JJWA 4JM2C 4DKFL 3V4VL 1P2CB 1CIUA 1WAAA 1W8OA 1RAMA 3QUMH 3ABZA 4TVPH 4JG0L 4PJAB 3CK0L 4DKEL 3BWAA 1QLEL 2FHCA 3EJJX 1BQLH 1DSFL 5DVKA 4M4RA 1X5AA 3PNWA 1TVBB 1Z5LB 4NKIH 4YAQB 4EKXA 1DDHA 4TNWK 4U0RC 1ZHLA 5DJXB 1ZWIB 4HAGA 3FB5A 4KROC 4Z78B 2VNCA 2XTJB 2PO6C 4YGVB 3LD8B 4K55A 4RNRA 1IM9A 1K6QH 1T22B 2BFVL 2P46B 2XZAL 1Q8MA 2AXFA 1MCHA 4NP4L 4Q0XL 5JPNB 4UV7L 1X44A 1BX2A 2PTTB 3LRGA 2PTVA 2D03H 4FQHB 3MGTA 1CE6B 1U9KA 4YXHH 4MHHG 3CFEA 5CAYB 1ADQL 3N9GL 4WO4D 2BVQA 2DQUH 2GHWB 1C08A 5GHWH 3RVUC 4BSVA 4KK6C 1VFOA 5T3ZE 3OKMA 3QEGH 2FL5B 3QB7C 1UB6B 1RUAH 1OT2A 2BY2A 1JF1B 3TZVB 3RVXD 3BDYH 4LFHG 1NL0L 4PJFF 3PGDA 4L5FH 4MQSB 5C3LD 2VO5A 3MACH 1A6UL 2OYPA 3HZKA 2DI8A 4YDJB 4YHPA 4P49A 2WUBL 3G6AB 3KJ6L 2ZJSL 3DXAA 5IMMA 1EH9A 1MCRA 4S1DC 1T0MA 4ENED 1CLYL 4KK8D 3SO3C 5FYJH 5LWYH 3FRPG 3LPGA 4OQTH 4NBZB 1ZS8A 4AMKL 1DN0A 2JB5H 2FH8A 4LCUA 2ZCHH 5IMKB 4M43L 4LMQE 1B2WL 3ILPB 4WHCA 1UC6A 2L7JA 1PEWA 3O45A 4XP9L 2VLMD 4EBQL 2VLJA 1BBDL 2QQKH 1LP9E 3FQRB 4J6RL 2HVKA 2AEPL 4JDVB 4R26L 5ETUB 2D2OA 3W5MA 5J6GA 3C5SB 4KKBD 3LN9A 5F21B 4HUVA 2ADFL 2DIJA 3CUPB 3QDJE 3OQ3B 4JY5L 1R3IL 4K2UH 3BT2L 4ODTL 4L8BA 1Q9OA 3VU2A 5IW3A 3DMMB 2YKLH 3IU3A 3EYOA 4D94A 4M5YH 4P9HH 4TN9A 1FG9C 3GSQA 4OD1H 5JO5B 3B2VH 2RAMA 2OL3L 4GMTH 4X7EC 1VGKA 1MFCL 4P23B 1JPGB 5FO8B 4OZFH 3UX9B 2DKUA 1F4WH 4JO1L 4LLYB 2QSVA 4WFHE 2XI9A 3TBSB 4MZ2A 3JWDH 2GT9B 3IDUA 2ZOLB 1NLBH 1BOGA 3KPTA 1NCBH 1UXWB 1GGIH 1PX3A 1HHJA 2G60L 3VFSB 1J88A 1IT9L 1T3FA 1K8IA 3H3BC 4MLSA 1AO7E 3BH8A 1VENA 2IAMA 2IAMC 3D2UA 5GJSL 3IRPX 1VB9A 2IPUK 5HYJE 5C07A 2GK0B 1DQJA 4M9PA 3TNMA 3GKWH 4X4ME 1UVQA 43CAA 4JQVA 4JQVC 2VQTA 2IANB 5DQ9A 2ZG1A 4BQ6A 4RAUB 2NZ9C 3G04B 8FABB 3LN5A 2VH5L 5I73C 5I8KH 5ERWA 3BVNA 4O2FA 3X13B 1A22B 4LVNB 3MV8B 2Z93B 3D18A 4NZDA 2VE6A 1HQ4A 4OIIH 1IAOB 4N5EC 4LLDB 3TJHD 2ESVB 5EH1A 1I8KA 3Q6GH 4GRLA 3UBXA 4G6KH 3L3GB 3R8QA 3RVVC 3SGJC 3N1QC 3BHBB 1YEGL 2A6KB 4I3GA 4ODUB 4Y1AB 3IJSB 3ZO0A 3QCTL 1AD0A 2VMFA 3MRLA 3O9WA 3O9WC 4JFEA 4G9FB 5DRZA 1JJUA 4CL7A 5F6HI 1YMMD 2M26A 1U3ZA 1RJZA 5GRZA 3VWJD 5FYJE 1S9XB 1YYLL 1FO0H 3ECBA 3VH8G 1J8HB 4HXAH 1FNSH 1MY5A 3Q6FA 4OFVA 3RAJH 3CLEL 5C0IA 3PV6A 4YEFA 1I7UA 2FBJL 2P7TA 4HMDA 2B4CC 3DX9A 4UT7H 5C0EB 1NCDL 3BPNC 3KLAA 4Y2DD 3BKML 3WFDL 5TF1L 3KDMB 3HUJF 4L3AA 5EOTA 3M45A 5FYKH 3HG1D 1ES0A 1HINH 3U7YH 3CCHA 2UZYB 1UFUA 3HR5A 3S9DB 1I4FA 4DVBA 5HYSB 4WI4A 5F88B 2F74B 4IMLB 3IDYC 3Q2CA 4HJJL 3BEWA 2AGJL 3PV7A 1A6ZB 1DFBL 4FFWC 4NIKB 2NR6C 5LBSH 1ZT4A 4HLZH 1UCBL 3OGCB 3OKKA 5SX4H 3S36L 3V0WH 5A1AA 1ZGLP 1LDSA 5HDQL 1U8QB 4FP8L 4GKSB 3OKYA 1S7RB 2VDKL 3TWCL 3CMOH 1UWGL 3AVEA 3D9AL 4CW1B 2QR0B 5B8CB 1TJGL 3QIWA 3QIWC 1M7XA 4ONGL 2EDTA 2X1OA 5FYLL 1P84K 5C71A 3DRTA 3FO9A 3MODH 3REVA 1BQHG 3MO1A 1C5BH 4Q7DA 3LRSA 5K9KA 2AV7B 5C6PB 3B83A 1VADB 3RWIB 3Q1SL 2QADD 4PREB 2SEBA 4AEFA 3VFWA 5DC4B 3RIFK 3BJLA 5BZWB 4M7ZB 1XZ0A 2AJ3B 4DZ8B 2LAGB 5J13B 2FWOA 1RZIB 3FJTA 4FQCL 3G5XA 3U4AA 2W1NA 1LP9A 3LPWA 2P4AB 1E4WL 1T2QH 5GZOC 3DRQB 4MQXC 2P1YA 3GMRA 3O4OB 3FTGA 3VXRD 1CFQB 5IFAH 1F6LL 3O3UN 2X1WL 4Z7NE 5DD3H 4LLQB 3FRUA 3KJ4B 3GHEH 4KVCL 4PV9A 3TBTA 3UTQB 4WW1A 5IWLC 2CUMA 2XTLA 4CADB 2F5BH 4Y8DC 1MAKA 1OSZA 3KPMA 3Q0HA 4J8RB 1IM3A 3P4NA 2Y9RT 3EOBB 4JO3L 4U6HB 3Q5YA 4GLRH 1FPTH 2CIKB 4WI9A 3L3HB 1ZHKA 1T4KB 4OZGF 4WENB 4QLRA 2UZXB 4XVJH 1FL5A 3T04D 4EI5A 4EI5C 1JHKH 2WM0A 3HPLB 1E27B 2HLAA 3S5LB 4P5TB 1FJ1B 1YEDA 2VXSL 4LLVA 4O51B 1I8IA 4G8IA 5C09B 3CFDA 3BESR 3S35L 5IKCA 3G5YB 5HYJA 5F93C 3TV3H 1I1AB 4UNVA 4B41A 2NY7L 2ED7A 4WEBH 5LXGL 4L4VE 4GW1A 4X4MA 4JKPH 1TFHA 4XBPB 2GSGB 1ORSA 4JHWH 1NBVL 2BVEA 3P30L 4BH7A 2ARJB 4MSWB 2Z8WC 1QRKA 4QTIH 4ZSOB 5HYSG 5JLZA 1UZ8B 4WEUD 3W81A 4P48A 3ZHLA 4KMLB 5DJ2A 1AXTH 3EYFA 3WS3B 5BS0E 2JJVA 4I0KA 4MQ7B 4YHYB 3U4BL 3QIBB 4ORGA