5LGJB

The crystal structure of ige fc mutant - p333c
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
317
structure length
309
Chain Sequence
PPTVKILQSSCDGGGHFPPTIQLLCLVSGYTPGTIQITWLEDGQVMDVDLSTASTTLASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNVSAYLSRPSPFDLFIRKSPTITCLVVDLAPKGTVQLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title THE CRYSTAL STRUCTURE OF IGE FC MUTANT - P333C
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig epsilon chain C region
total genus 60
structure length 309
sequence length 317
ec nomenclature
pdb deposition date 2016-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lgjB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lgjB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lgjB03
2VUYA 4MLSA 5CS7A 5J7CC 2EDQA 2F54B 3VD5A 3SGKC 2BX5A 2AP2A 1JI2A 5JPNA 2RCSL 5JHDD 4Q9QL 3SGDH 9CGTA 5C07B 5DZOA 4OF6A 4UDUA 5HYJB 4K7FB 1A6WL 2VAJA 4O4YH 4W4OC 1YEFL 5JOFA 3MNWB 3LCYA 3H9SA 4KK8C 2J12B 5BS0E 4I3RL 3O6FD 4DUVA 3IJHB 3H3PL 5CAYB 2VAAA 4Z7UA 3OR7A 2KPNA 4GAYA 1ORSB 1G84A 2B2XH 2VLRB 3SGJA 2BJMH 3NCMA 3U9UB 4WO4A 1OARH 3QWRD 2GITB 4MDIB 4TTDC 1C12A 4X9FA 1CT8A 3SE3C 1INQB 4M1GH 4UIMB 1BPVA 3QI9D 4K94L 4N0CC 1GAFL 3QEQA 2DM4A 3PIQA 4GBXC 4PRBA 5DUMH 1NDGB 1I1AA 3BGMA 1IGJA 1S7VA 4OQ1A 5JPMB 1PLGH 2D0FA 1VGKA 2ZNXA 3MNVB 2WW8A 2GCYA 2A9NH 3LMJL 1NH6A 4D8PB 1S9YA 4KKCC 1RZKH 3EYQD 3L95A 3VWJD 3I2CH 3P30L 2VOTA 5IMLB 4OUOA 2Q3ZA 4RAUB 4Y4FC 3EAKA 3V52L 2NXZC 2IGFH 5IKCB 1SJXA 1CFTB 5JXEA 5SX5K 3JWOH 3RIFK 2F58H 4NDMB 4FQHA 5CEZD 2D03H 1C7TA 4GW1B 3MBXH 3ZTNH 4K3JH 4GW4A 5F1IB 5I19L 1LK2B 2VDOL 2EEAA 5GJSL 1ZLVK 5M94B 1BFVL 3BH9A 3B5TA 1QSFD 4OFKA 4JN1L 3JUYA 5IT2H 4P57A 4OFPA 4NKMA 1J05A 3T0XA 2HT3D 3L3KB 1NGXA 1NFIB 2QSCH 2B20A 5DGQA 1AR2A 4HC1A 5GRUL 3TN0A 4MAYB 3PGFH 4IS6B 2IBGA 1MLBA 3TBWB 5HVHB 3D0LA 5DO2C 4WUKH 4R8WH 1Y0LA 1V3KA 1JWUB 1XGYL 4NHUA 5L9DL 4WDIA 1EVUA 1YMHB 3BPNB 5DVNA 4PJGB 4KQ4H 1NLBH 5DWUL 3DV4B 3SQOH 1ZEAL 2FECL 5IVXA 1R5VB 2DLFL 1NGWB 4R26L 4NT6A 2RJMA 4LNVA 2HKHL 4MAYD 2VITB 4NZRH 1QFWM 5ICYB 5J6GB 5MI0B 5IQ7H 2H32H 5I76B 1D3CA 4NQED 43CAA 5LGJB 4YDVB 3S3JA 2V2TA 4P3CH 3EFDL 5E2JA 1IC7H 1R3IH 1U8PB 3W39A 1GGCL 5C0ND 4K71B 1FNEB 3KPMA 5F1NA 4M7JH 1T1XA 2WBKA 4K7PY 5DMJB 5TF0A 2D7MA 1GGIL 3QPXL 4HCRH 1GC1C 3OGOE 3H42H 5C92A 4NZRL 5DURD 3FO1B 3G5YA 4DZBB 1T1ZB 5CLTA 1RZFH 5JDJA 3NAAL 3Q1SH 4X4YA 1FZMA 4HWUA 2XKUA 5DQJA 5DA0B 2W38A 2ARWA 3F62A 2UZIH 3PE9A 5GSRB 1W72B 1CXLA 1RFDL 2XWBA 2NY6C 4LSQH 4X0KA 2ZUQC 4JO2L 1CYGA 2GSGB 4DEPB 3KPSE 3O8XB 3DSFH 3JTSA 2AKRB 2J4WH 5C09B 2BSSB 1XGQB 3G6DL 3KS0J 3O6MH 5HY9B 4UDTA 4PRIA 4LCCC 1R5IA 5EOQL 5J12C 3MV01 3VG9C 4H5SA 4GXUM 4C83B 1MCFA 3P30H 2BSTA 5L7XL 4LHUA 3T4YA 3ARTA 3BD4A 2H9GB 1HKLH 3LKQB 1KPVB 1OT1A 4UIKL 1JIBA 4NN5B 3QCVL 5E4EC 1NGZB 2DQUL 5EO1A 4AT6A 1U92A 3TFKD 5CCKH 4GMSH 5AZ2L 3FN0L 1WWCA 4UT9L 4JEGB 3PJSA 2VLJA 4K3JL 3FFDA 2ED7A 2E27L 4OV6F 1N4XL 1F2QA 1KV3A 3HI5H 3VJ6B 3EYOA 4JFXA 3VFUB 4JKPL 1MCKA 1CFNB 1T7VA 4L4TA 5CJXC 2FJHB 1EJOH 5IB4B 5DK0A 3C60D 4R4NC 1RUQL 1E4WH 1QZ1A 2NY0C 5CIPH 5I2IB 1JUFA 1U91A 1VPOL 1FO0H 1FH5H 4JY6B 1ZSDA 3KYMA 3OXSB 2V2WB 1YEDA 3ARFB 3I85A 4JKKA 4WI8A 2I24N 1YYLH 3ARWA 3RVXC 1UJTA 3BPCB 1FV1A 2Y6SC 3VMNA 4DKEL 1BD2D 2VDLH 4R2GC 2AJXH 1EHXA 5IMKB 1ZXQA 1FZKA 5J13C 3OAZH 4KI1A 2BSRB 1BFOA 4Z95L 3CVHB 2P42B 5CJ5A 3GIZH 3CFCL 3O4OB 3GSXB 5TDOA 3OPZL 3HNVL 4QY8B 1NFDB 3BEVB 4U6XB 1MLCB 1XIWC 2NLJA 5DRZB 4XCNA 5F3HA 4D9QE 3RFZC 4Y4KB 4D9RD 4HULB 2PN5A 4JM4L 2IQAA 4N0UA 4HC1L 3HR5B 2CPCA 1B90A 3CFEB 5IWLA 4HWBH 2QLVB 4LLMB 3N50A 4QOKE 5IHZA 3TZVA 4LIQE 4WHCA 3WS3A 3RPIB 1PFCA 1G7QB 1HNGA 1G0XA 4V1DE 4WI6A 3SKMB 5ID1B 4PB0L 4I4WB 4KXZH 3DRTA 2GQHA 4UNVA 5KVGL 3H3PH 2FJFB 4R2GD 4WCYH 3UJIH 3LN4B 1YEGL 1AI1H 5EU3B 5KJRH 4HC1H 1X5IA 5T3XH 4PJ8D 2YD6A 2P5WD 1KFAH 5T5NF 2DIAA 3OKNB 3U36A 1DN0B 1CDUA 3HE6D 3T09A 2H41A 5I74C 1Y6KR 3T4YB 3HC4L 3VRLF 1A4JB 1NFIA 3IU3B 3I6GB 1UH2A 4KJYA 4OLZL 1IAOA 2L4OA 3QEGH 2OTUA 4U4BA 4WJ5B 1MIML 4JHWH 3MGTA 4I77H 4PP2A 3X3FL 1RIUH 1QFWH 5FHAL 2MKLC 4Y4FD 2DQUH 4QHUA 1Y0LB 2F53B 3WIFA 3ARBD 4X6DF 1WAAE 3QDMD 1PG7H 4PR5B 2FO4B 1MI5E 2CK0H 3GSOB 1JVKA 1L6XA 4RMTA 1JGUH 5FEBA 5C08A 4OV5A 4PJHE 5FM5O 3U7WH 2OCFD 2BNQE 3LKRB 4OF0A 3IJHA 3LZFL 1FPTL 3JWDC 4LRIA 4HF5H 1XAUA 2C3XA 3O3DB 1D5XA 4JZOB 4HUXB 5HYEA 3QUYC 4XCEA 3MRNB 4FHBD 1RUQH 1TVDA 4QRRA 4RAUA 1VEMA 3VD4A 3AM8C 3DYPA 5C09E 2WP3T 3DI3B 1LEKA 3QUMH 1T1YB 1QVOA 1FH5L 2Y06L 4PRID 1S9YB 3NACH 1WCQA 1FNGA 1S7WB 3N1FC 4ZDHB 3P4NB 2QHRH 1R3LB 5GGTL 4YZFF 1E4KA 1YUHA 2R0WH 3BP7B 2EZ0D 1LP9B 3VRIB 1J8HE 4NZUH 3WFZA 3MRGA 4P46D 2CUMA 3PL6D 5L8KB 3BOVA 3DETD 2CIKB 3BPNC 1IC5L 3MLXL 3P77A 4L8BA 1H8NA 1QLFA 1MHCB 1TVHB 1KBGL 2X9YA 3QZWB 3SCMB 1G9NH 1XF5B 2VLJD 4TYUA 2HVJB 1J1OL 4P2QA 3D25A 5FA3A 1CT8B 2FATH 1WWAX 5F7MC 5CD3A 1W0VA 5TPWL 5JR1L 2JJVA 3DMMD 3FB6A 2VZTA 3MGOB 1CLOH 1T3FB 4TVPE 2B39A 2BXZA 5JOEA 1GC1L 5FKPB 1OPGL 2SEBA 4XP9H 2XTLA 4YR6B 2BCKA 1T22B 3ZL4H 2B1HL 1CG9A 1QBLL 1RUAL 3QCTH 1FSKB 2J6EA 3F7VB 4G42B 3S37X 1UXWA 3LKSA 4X9GA 4YDIH 1J1OH 3V8CA 4NQEA 4YE4L 4F7TB 5E9DB 1AIFB 4HW6A 1I9EA 1OTUD 3H3KA 3AY4C 2C7UB 2UY7A 1MCQA 3OHXB 3KG5A 1N8ZB 2P47B 1EFXB 4KWUA 1QLEL 4Z7VE 5HDQH 1XGTB 2LABA 4GG6E 1J0YA 2PW1A 5I0ZA 2HJKB 3HB3D 4X98B 5EZIH 5L0QC 1D5IH 4KK9D 2BSED 4IRZL 4X6CE 4KTDL 4EI5C 3SKNA 3EO9H 1FVEA 3MV9D 3MFFA 4BQBA 2PYEA 3GK8H 5EZLB 1IGYB 2AV7B 4OB5L 4DVBB 4ZS7H 4NBXB 4DZ8A 1U3YA 3BHBA 2VQ1B 3TV3L 5T3ZL 1AJ7L 5KVDH 2PXYC 1WV7T 2Y25A 4WHYG 2CK0L 3Q3GA 4NQDB 1CD1B 1VFUA 1JPSL 4EI6A 4YFEA 4LL9A 1D5IL 2EDFA 1CLYL 4UINH 4YQXL 3EJZC 5CIPA 2YD4A 3I3BA 4X80H 5HHOB 3IFNL 3S37L 2VZ1A 2Y07H 4JFDD 5FOJA 1BGXL 3RWIB 3WD5L 4E42A 3MBEA 4HPYL 2RHEA 3I84A 1PY4A 5GISH 4YR6A 5CCKL 5DYOA 4P59L 4U31A 3FRUA 2WMPA 3OL2A 4OT1L 3TO2B 5DD3L 3FFCD 4A6YB 2A1WL 2XPGB 5IP4A 4BKLA 2R2BA 3ARYA 3AREA 1C16A 1NC2B 4WGWB 5C0AA 1T7WA 2J8OA 2JELH 5KSAA 4J3TA 2FECI 1FRGL 4I4WA 4G7VH 3OKMB 3X17A 3SDAA 2VL5A 1I9IH 2CKNA 1FIEA 1YN6A 5SV4A 1IBGL 3D85A 4DN3H 4ORGA 3VFMA 5JXED 1AXTH 3GSUB 1H5BB 4Q9RL 1ACYH 5HHPB 2KBGA 4D2NA 4Q9QH 3THML 5C3TA 5DT1H 5GRJH 4HBQA 2VDRH 4X6CB 1LE9B 5IV2B 5B39B 1FZOA 1FIGL 2CO7B 4F7PA 4ONFH 2R4SH 1JN6A 1WWBX 5DJ2A 5FUZH 2JIXB 2PETA 3JVGC 1Q9OB 2E7CA 4TOYH 4LHUB 2YC1A 5AEAA 3T0EC 1OVZA 3L3DA 3OF6D 5IB2B 3LKPB 2IPUK 3MRHA 5IB3B 3MUJA 1S7QA 3RAJH 5CEXB 5FYJD 4JCLA 5K9QG 2ZUVA 1G7PB 4HIJB 2VZVA 1JGDB 4HV8B 4IDLA 4L1HA 2OTUB 5B22A 2EH8H 3PF2A 3K4AA 2RB8A 4GKNA 4LSDA 3U4BL 1EGJH 1H3VA 5ESAB 4MNGE 1FORL 4CADB 4F7CA 3FRPG 4P0DA 1FAIL 1X6LA 3BRDA 2R4RL 4LSTL 4RGMB 5IB4A 3MR9A 1S9KC 1S9WB 3RAJL 4M6OH 3F6IA 1RZKL 3H0TA 4CAGA 5GGUA 4N5ED 5CP3A 2UZIL 3VJ6A 2X40A 1ZMYA 5FUOL 3FO9B 4PJEA 2ZCLL 2LAAA 1TZHA 1HOCB 4KKAC 1YEDB 4JVWA 1WTLA 2BMKB 4TRPH 3WE6B 3QO0B 1FGNL 3ZE1E 2WK2A 2OM5A 3L3IB 3DNKA 1JUFB 3IAGC 1HXMA 3BKML 4XC1L 4X9IA 5J3HD 5DTFA 2YRLA 3PP3H 4U0RB 3VXNA 1IEAB 4PJXF 5L7XH 4DN4H 3D9AH 4FXKA 3C8HA 2E7MA 2V5YA 5JDSB 1AI1L 1FVCB 5JLZB 1GRWA 3PWNB 5F72S 3BESR 2HFGH 4V1DB 2CKBB 2IFFL 3STZB 3SCMC 2YK1L 4PRNA 1R3KA 3WFDL 5BVPL 4MMZC 1MCSA 1TPXB 2B4CH 3MCLH 2NY0D 1A6ZA 2FEDD 5D7IF 4AQ1B 5C0JA 4Y2DB 1GJIA 2CDEB 4JQVC 3KLAB 5D7LB 1N4XH 4JFHD 3GMRB 4BJLA 3MRPA 4EVNA 4OLZH 1TZIB 1MLBB 1NMCC 1ZVSA 1MJJA 1RJZB 2BFVL 2QV2A 4ZUWB 3TO4A 1XGYH 5C0BD 4KRPD 3UP1A 1KACB 2D7TL 3QDME 2UWEA 4XP4H 1LQSR 1UA6L 4L9DA 1HWGB 1JP5A 5DS8B 3IFOB 3EZJB 4IJ3B 3VXTB 8CGTA 1H5BA 2EEDA 3TBVB 4CVWA 2YKLH 1EH9A 1XIWD 4DKEH 5LCVL 4AG4H 1RD6A 5IM7A 1RULH 1FIGH 3M07A 2FEDC 2R2HB 4BUGA 4GAJL 2AW2A 4BZ2L 2ZCHL 1FZOB 5A2LH 3QUYD 4Q9BA 3V6OC 5HGAA 4BZYA 5E1AA 1ZHKA 3VGGA 5H2BB 2XKSA 4HIIA 4PJAF 4J23A 3UTQB 5KVEL 5DD1H 1UM4H 4MA8H 4J8RA 2W60B 1MREH 1WBYA 1IGJB 1S7VB 3OR6A 4Z76B 4MJIE 2D2OA 1N64H 5JA8B 1JGLL 5E56A 1RJCA 1AC6A 1N8ZA 1CZ8H 4LVEA 4PFEA 2X4RA 5KSUB 1RZJC 1OF2B 4QRRE 3N1QC 4L8DB 4LCWD 4PB0H 1U3HB 5FDWA 2PKDA 1S7SB 2XNAB 2X1PA 3KDMB 1B0GB 4G5ZH 1DLFH 3WYRA 4JRYA 3VXOA 5E5MB 1F8TL 3VA6A 2HT3C 2L7JA 3T0EE 4GW1A 3D2UB 4K71C 1DBAH 5IB5A 2HTKC 2PYED 5AYUH 4GG6F 4P2OA 5K93A 3KYOB 1BVLB 5I16B 3CSYB 2W65B 4YDIL 2A6IB 4XC3L 3MRCB 2Q6WA 3ULVC 4G7YH 5IBUB 3BHBB 2HJLA 5EFIB 4D0DA 5T1DH 3MREA 1Q9KA 3RIFF 1T1XB 4GQ9H 5HDOA 1A1OA 1U93A 1X4XA 4D0BA 2R0KL 1RK1A 1KCUH 1INDL 1A5FL 3FQXB 5IMOA 3RWEB 1F8TH 5KANG 1TPXC 4LSPL 4XGZA 4DVRH 5EU7E 2BC4B 1VGKB 5J57B 5TFSL 4YQXH 3CK0H 4YDLC 4ZSOB 1NGQH 3ALXA 2MJWA 5K9JL 5D4QA 1LO4H 5KSVB 3CJJA 3MJ6A 4YHIA 5C0RL 3MXWL 2VQ1A 2K3TA 1MY5A 1IL1A 3QUZB 1HYSC 1NAML 3H9SE 5KSAB 1AR1C 5C0FB 1NGYA 4X83A 5I1JH 3U6RB 5ILTL 5JMOC 3L95B 5E8PB 2HVKB 4ODTL 4KJPC 3IDJB 1IM9B 1BQUA 4RMQA 2BCKB 3EYSH 3GFUA 1G6RB 1GGYA 1ORQB 4NWUH 5E2TH 1BWMA 4XPHH 3VFSB 1NLDL 1TCRA 1X5XA 1YEEH 2WSKA 1AE6H 3RVTD 3QEQB 4DGVH 2F8VA 3P11L 1J05B 2ARJQ 5D7SH 1NQBA 3HC0A 1YEIL 2PO6C 2R8SL 3ULUL 2XZCL 2EIZB 3V6OA 3DLQR 4DN3L 1FYHB 3WHE0 2DF3A 4POUB 3DVNB 3DRQA 3ZTNL 4IRSB 1YPZA 4GW4B 5A2KH 1GOHA 5C0EA 5F7UA 5E6IC 4UB0H 4K3EL 5FK9A 3KPQA 2O5XH 2XFXB 3ISWA 3CDCA 5TGBB 5DD6A 1D6EA 4WFGD 2N7AA 3P40A 2AJXL 4EXPX 1UENA 5JW3L 4J12A 4HG4J 3GSWB 3T08A 5EBMB 1A6WH 1L9NA 4G8GB 4NKDB 1LGVA 1SEBB 1RZKC 4LCWB 3MLPA 2P5WA 2XZZA 4LCCA 4MA1C 2G2RA 4UUJB 5CILL 5IW6B 1T20B 3C5JA 3P9LA 4K3GA 2IG2L 5JIHA 4EEEA 2F74A 3GBNH 4HX1A 1EBPA 3IKCA 1N26A 3C6SB 2E6JA 3EFFA 2M1KA 5KS9E 5C86A 4NO3B 3VRLE 3SGJC 2AK4D 3GHBL 4NQXA 5FYKL 3L7FB 4LLMA 1FFNA 3O4LE 4HS8H 4I77L 4YXHH 2X9WA 4YNYA 2CDGA 1MCEA 1UYWH 4JG0L 3MRDB 5FXCH 7FABL 3ROOA 3CFKA 3JV0A 5IQ7L 3WO4B 5E08L 1QPPA 2G9HB 4O5LH 4PJCE 3V4UH 3WXWH 2ERJC 3TJHD 1NFDF 4TNWF 1DEEB 1JGVH 5DFTA 2PW2A 4FZEL 1KT2A 3ZE1F 3C8KA 2CRIA 3NVQA 1BOGB 4PJ8B 3MV9B 3TNNB 3S36H 1QFPA 1UZ8A 4HS8L 4QYOB 2VZOA 4BK5A 1RVFL 4J3XA 3V4PL 1TVBA 1RZ7H 3R06A 4X99A 3R0MA 7FABH 2A6JA 3OBAA 1LD9A 1HK6A 4G6JL 4E0RB 3I75A 3ULSA 1B0GA 3ARBB 4XHJD 5F7LB 1A7OL 2AVGA 3VH8A 5IEKB 2DWDA 3OB8A 2X1OA 5CHNA 1RFDH 4O00A 4I0PC 1G7QA 2Q8AL 2YK1H 3C5ZD 4XMLL 1TDQA 1ACZA 1J1XH 4XNYH 4G9DA 5I1DA 4LPYA 4QWWD 1LO5B 2ITDA 3CFDB 1AGEB 2V7NB 5I15L 4WGVB 1FFPA 3DV6B 1NBVH 4NOBA 4WWKD 1P5UA 1UJ3A 3O6FC 4XWGL 5IK3B 4YEFA 5EUOE 3PGFL 4HWBA 5ALCH 5I71B 4OIIH 2ICEA 3N1GC 5K59E 4HFUH 1HSAA 3ZHDA 3W81A 4UV4H 4HAGA 4OQTH 5KSBE 5D6CA 4Q6IA 3DX6A 4HH9A 3LRSA 3BVNA 3SE4A 3V7MA 4Q7DA 4YUEL 4AY0A 1UH4A 2XACC 1S9XB 3W11C 4HXAH 2C9AA 2O61A 4ETQA 1FV1B 1XH3B 5TE4L 1IGFH 2CGRL 4RWYH 3ETBF 3V6BR 5BRZA 3NOIA 2IJ0C 3W82A 2XN9E 3O8XA 3AGVA 2ZP0T 4N0YL 4KI5F 3R1GL 4PRNB 3GBLA 1OF2A 5DEFB 4W6YB 1NEZG 1RZJH 3FQRB 2K7PA 1DBML 3IJYA 3GSXA 5TDOB 5IROC 3VI3E 4PYHA 2OR8A 4OTXH 4ZUWA 4JFED 3TO4B 3T1FB 2F9BT 4OLWH 3WS6C 2IG2H 1MCCA 3AS3A 1CL7I 2R29H 1EMTH 4KHTH 3VXNB 3ZYOA 1WBYB 3P9MA 2JCCF 3E8UL 2DBLL 2D0HA 4HGWA 1J88A 3WIIH 5EN2A 2VDKL 3OSKA 3WNPA 5HYJE 3RTQB 1LP9F 1Q8MA 4IMLB 1RUKH 2CH8A 2W9EL 5E1AB 1WBZA 5LCVH 4AG4L 1M6OB 5EO1B 4OGZA 3WFCH 1IKNC 1UYWL 2CRZA 4JG0H 5JDSA 3SKMA 5JLZA 4ISVA 1OW0A 3KXFD 3O2VL 4G6AC 3V5HA 5HI4C 4KKAD 5IHZB 2GJ6A 3OG4B 4FFWD 4CRPA 7CGTA 4UBDD 5HHVH 1ZLUK 4I1NB 3G6DH 1I7ZB 1VFBB 1G1YA 3EYOB 3C60B 4JFXB 4PJEE 3IXTA 5KVEH 3QUMA 4JFDA 2LVEA 1HHHA 3OF6A 1FFOA 3KNBA 1TTFA 3PP4L 4XCNB 5F3HB 1ERNA 4MQ7A 1NBZA 2VLJE 3WFCL 2X42A 1IEHA 1H3GA 3DMMC 3O4LD 4UTBL 1J87A 1HQRB 3O3UN 4N0RA 2BY1A 4NKIL 1MQKL 4S10A 3VE0B 3R8BB 2XKNA 5FKAB 4I0PA 1DBKH 4YHNA 4F33A 2X10A 4JFFB 4NJAL 1XZ0B 3BJLA 4HIEA 4KVNH 4PRHB 1KFAL 3FCTB 5IFJB 2DQFA 1T03L 5GGSY 1WFTA 1NGQL 4Z7VF 4JO3H 1BBJA 2IH1B 3SDCD 2JB6B 4PJCB 1D5BB 1CN4A 4CW1B 2IGFL 5C09D 3V4VH 4M48L 4MB5A 4M1DH 4OM0L 2Y7QA 4YHYB 3DVGB 5JHLL 3OGCA 1M71A 1MPAL 3ZDYF 5GRZA 3CXHJ 3NCFB 1UXSA 1VADB 1DFBH 3NA4A 1A5FH 3ZYJA 3G6JE 3U79A 2Y1VA 3DTXB 4AQOA 3IS1X 3CGTA 4W6WB 1WZMA 3K4DA 3U7WL 1FL6A 5SX5H 3VH8B 4Z77A 1QD0A 4WW1B 1CFSA 1UA6H 3WDHA 2FH8A 1I8MB 3WJLA 4HWZB 4PJ9A 1SEBA 2V7NA 4X99B 4RFOL 4XB8A 3IFPB 3VDAA 4YWGH 2QQLH 4FFVD 3PV6B 1CGTA 3HPJA 2BY3A 3EO0A 4XNMB 3L9RA 4Y5YA 1OP5K 3T0EB 1XIWA 4MQTB 4L3EB 2BVQA 3VFVB 1J8KA 1S7TB 3LSOB 2DYPD 4NQUA 1FG9C 5CFHA 1ZOXA 2OJZL 5SWSB 3QBTB 5E0QA 4TNVF 1WIPA 2W91A 3FRPA 1HHKA 3UTPD 3BEWA 3QUYB 4NC1E 5CIPB 1IILE 4OF5A 1DSFH 4RA3A 3JWNC 5M95B 4EI5B 3V5DA 2X70B 1C08A 2ZOKB 5IJVA 4RX4D 3FAXA 4S0TD 3QEQE 1Y6MR 4NZDA 2M2DA 1KN2H 3HE7C 1L7IH 1JGEA 2VDML 4JKWA 4L9LA 4N8VA 4LEXH 4XMPH 5E99H 2ICWJ 4G9FE 3GBNL 1K8IB 4WW2C 2EE3A 4X6CA 1GC1H 1AFVH 3Q5YA 2HLAA 3MRJB 4QNPF 3T2OA 4H1LG 4JZNA 2DQHL 1KPUB 2KQMA 5DJZA 2GYSA 4POZC 2A77L 5EZOL 2OI9C 4KRPB 3VW3H 1UM5L 4U1MA 1NMBH 5IJKA 4MNQE 1QLFB 2AJSL 1KXTB 1IGIL 3QHFL 2PW1B 2X7LB 3ARRA 3NCYP 3BPLB 1RJYA 1ZEAH 2X4UA 3OWEA 4NDMA 3IDXH 2Z35A 3DMMB 2VXVH 2PYEE 3MLYH 2I9TA 2DTMH 5I8KL 5T3XD 4M6ML 3C5JB 2CLZA 4CMHC 4CVXB 1MUJA 4YJZL 4LAQH 3M17B 2Q7YB 1NKOA 4M62L 4MVBC 3ET9F 4LGRB 2FYYB 5IEHA 3O6FA 3WCYA 2GCYB 3QHFH 1LO0L 2P7TA 2JE8A 4JO3L 3VXUA 3VGHA 5B8CB 1DQDH 5I73C 3TNNA 3RZCC 1S7UB 4TTGA 3GB7A 2V9RA 1KJVA 3PWPD 3QFDB 1UACL 3UYRH 3ULVH 3V0VA 3QIBB 3DOSA 4P9HH 5I8KH 3QDJA 3L3KA 4U2ZA 3O11B 2D3VA 5I66B 3D9AL 5JIPA 3HZVA 4C56D 2MCG1 4EBQL 1AP2A 4Z78B 3GNMH 4NQEB 3PDGA 3FT2B 4WHYH 1AJ7H 3IFLL 4L29A 5TDNB 2CDGB 1A9EB 1KJ2B 4UQ2B 2NYYD 1OCWL 3NN8B 5JOPD 3QJHA 4YC2C 1ZGLP 4FZ8L 5F7HA 4PJDB 4A6YL 1OM3L 1ZS8A 2DM3A 4F7MB 2IC2A 2E6PA 4C56A 5IKCA 3BE1L 4JFYA 4Y4FB 1HQ4B 4YGAB 3U83A 3IFPA 5D71H 4U1MB 1I3RB 5EPMB 1OHQA 1NUFA 1CR9H 5FA3B 3VG0L 4KHXH 4P46C 3UAJC 3PL6C 3JZ7A 1FO0B 3PWLB 1UKTA 5IT2L 2LQRA 4OD2B 5DUPH 4QRRB 5E8OA 2X9XA 5GJTH 4JY5H 2QSCL 1QBLH 2HMID 2C4FT 1I1AB 1P4IH 3CFJA 2I25N 1KEMH 4NNXB 3F58L 5E6YA 5LKNA 4KVCL 4PGJA 5D1ZD 3AVEA 5TF1H 2XG5A 5D7IB 3QWOA 3RVWC 3SKOA 5TJWK 4KI5C 4LLQA 2Z92B 1CXEA 3CVIL 1OGAB 3RGVB 4D9QD 4XPTL 1X7QA 5JXAH 5HGDA 2R29L 2GITA 1Q72L 4PJFF 2DQFB 1UB6A 1PKQB 5DR5H 1KLGA 2EKJA 2NXYC 3HG1A 3I6LE 3QO1A 1ORSA 3T8XB 5GGQL 3UTTE 4XC3H 3HR6A 1YJDH 1NKRA 4ZUVB 1JZ3A 2FX9H 1KEGH 3MJGX 3SDDA 1ZA3B 4WI5A 5INCA 3P2TA 4L3AA 4MXWH 5DJ0A 2AXFA 3FZUC 4KJWD 1F4WL 4EI5A 2AXJA 2X1QA 12E8L 4HKBB 4Y2DA 2LU4A 1KLFA 3UTQA 4C54A 3FO0L 4BSJA 3KPLB 3HNVH 3F8UB 5DRXB 3VWKC 5DJXA 3UC0L 1KJ2L 2EEBA 3U7YH 3X14B 1C1EL 3HE7B 3L1OL 5DA4A 3RVTC 3LKOA 5H35B 4PJGE 4JREB 5C0BE 3UEZA 5KVFH 3ZTJH 1E6OH 2GIYA 3ORJA 1A6VL 2GSIA 4XNMA 4Y5YB 4KROB 1JPST 3VXSB 1KYOJ 5DRNB 1NAKL 2R9HD 2X4OB 4YHKL 3BZFA 3V5HB 1FAKT 5D5ME 5D9SB 4UNUA 3NCEB 5EU4A 4DTGL 3EOBA 3HR5A 4XPBL 1GAFH 4G7YL 4L3CB 5F9WC 3E2HC 1IC4L 3FAWA 1EHAA 5F89B 4EUPB 5ADPH 3RTQA 5MEQB 3HMXL 4MDJB 5C7XH 5I30L 4KUZL 3W0WD 1J86A 3LS5H 1BFVH 1NAKH 3L3OB 5I8CB 4TRPL 1U8OB 1S9VB 3QCVH 3VE0A 3AREC 4RMSA 3L3JB 5CUSH 2R15A 5C08E 4J7RA 1V7ML 1BJMA 5D7LA 1NSNH 1CK0L 3TJEH 1NCTA 3BEWB 1WUNT 43C9B 2AABH 3KNBB 5D93C 3CXHK 2P49B 5SWSA 3PL6A 1NFDA 3MBXL 5CEXA 3O3AA 2Z31C 2KQNA 2X41A 1CIUA 3FQTB 5HVWA 5LGHL 4R3SB 1KB9K 3ZKSD 3D39E 1CFNA 4R97C 4X8JB 1Z2KA 3P0GB 1T7XA 1Q9WA 4M9OA 2BY0A 1S8DB 5GGSA 3TCXA 5BXFA 1DJSA 4Y89A 1YYLL 2UUDK 3HAEH 1J12A 3PQYB 4YK4B 2NY4C 4NGHH 3JVGA 5D1XA 5K33A 5DQDL 1VFBA 2Y06H 3TM6A 5JW4R 1R24B 1VADA 5JXAL 4G8IA 3VMOA 1II4E 5JTWA 3NZHH 4C59B 2FRGP 4B7IA 3CDGA 1XCTB 1ZV5A 4QRSB 4OF8A 3U4BH 3T4AA 3WNOA 3EYUH 4MD0B 3ECBB 1HH6B 2XN9D 3IDGB 1A6UL 5HGBA 4NZJA 3SKUD 4JO2H 2GHWB 4U49A 3RZCB 5DMYA 4WWKC 1QBAA 5CEYB 2BOBB 1MAJA 1KLUA 3NABH 1KPRA 5GS0D 5AG9A 2XXCB 4PREA 2GTZA 4FQIH 4Y7MA 4XAWH 1WSST 2XWTA 3H9ZA 4LCIL 4PRIB 1G7IA 2UVEA 4G8FB 3LY6A 4WW2F 1YEGH 4TUJB 5DZLA 1X5GA 1YEKL 1E28B 3PDOA 4R7DB 4QTHB 3OXSA 3VFTB 4YNYB 2DTML 4WI3A 3IDMB 2Z92A 3LV3A 3CMOH 4NP4L 4JN2A 3RI5K 1U8HA 3S7GA 1UKQA 3HZYB 2NZ9D 3UO1L 2OR9L 3SDDD 1IGCL 2X05A 1T1ZA 5B38A 2FJHA 4TUKH 1X44A 5BRZD 3SGEI 4EDXB 1PY9A 3U4EB 4HQQL 4LHUG 5T1LA 1KGCE 4HCRA 3D3VA 2NYYC 4N8CL 5E00B 4NP4H 4IRZH 1J9CT 1U3HD 3RVXD 3EOBB 1GOFA 43CAB 2QADC 1DBBL 4L4JA 3A6OA 4JM2F 3BH8A 4GSDH 3LMJH 3LN9A 5FV2A 2VQTA 4KRNA 5CWSA 1JHKL 1TJIH 4ZAKB 1PGRB 4L5FH 1RAMA 1NCNA 4S1RL 1MCIA 3I2CL 4JLRB 2YMXL 1J1XL 4MXQC 3C5ZB 5BJTA 4ONHB 3SEPA 3VWJB 2YKLL 4L4VD 3VXQB 4F58H 1H5BC 2FNBA 2JB5L 3TYFA 1QO3A 3DBXA 1AGBA 3NACL 4OZIA 3OPZH 3SGKA 3FT3B 4XPAH 1OGAA 3RGVA 1T2XA 4RGOL 5HYQA 5FO7B 3U4AA 2RGSA 1WZLA 3S4SG 2BDNH 1FFNB 3RY4A 2Y9RT 3QRFM 4N1CA 4Q0XL 4TUOB 3Q5OA 4PJIF 3EDDA 5AUMA 4P9HC 1KBGH 4JPVL 1K8DB 3RWFB 4QGTA 2CO6B 5F89A 1K9TA 5JQ6H 4U6TA 1BJ1H 3RX5A 3LH2H 2LU3A 5FECA 4KZDH 1JFQH 1YQVL 4I3GA 4PJBB 4JFYB 4OF3A 3WJJC 1NANI 3ULUH 1RZJL 3B9VA 2ERJB 4WRLA 4IRJA 4LMQI 4XXDB 3U7AA 4HD9A 3TC9A 3BQUD 1EFQA 1JMZA 1BZ9B 1EEQA 3QXDA 5DHYB 1J8HB 1LK3H 1B88A 4UILL 4DEPC 4HUUB 2HFFB 4JY4B 4P5MA 5FYLL 1HE7A 2QQKL 3MXVL 4Y2DD 5E9DA 4OZGB 3ARFD 4LEOB 2MHAA 1O7SA 3CNKA 5IIEB 2JK5A 4NYLA 1C12B 4AYFA 4PJ7E 5GS1B 4KVCH 4ZO6A 1J10A 4JJ5A 4QYOA 3RTQC 4PJIE 4JO4H 5IBLC 3PABA 5FYKE 3MRCA 2Q6WB 3ZKQD 3OAUL 1A2YA 4RA0C 3U82B 3G5ZA 1YC7A 5J11C 2HKFH 5KTEL 5F6IB 1JK8A 1CTOA 2OR9H 4HFWA 1EJ6A 4UIMA 4HAFA 2XIDA 3HZKA 4PJ9D 5DHXB 1AIFA 5D8JH 4LF3A 4W6XB 1J0IA 2AJUL 1U8QA 3ULVE 3L5XH 3C60C 3OKKB 4R4ND 3F7VA 3QZWA 4L8DA 4NWTL 2H3NB 2F54A 5IG7A 5DUBB 1MPAH 3I6GA 3IU3A 2ICES 3OKDB 2NY5C 1MWAB 4HXBL 4WW2B 3L3GA 2QQNH 1KJVB 1MWAL 3X3FH 2GW5A 3O3EA 1QQDB 1MI5B 4PS4L 3QDGB 2ZG2A 5ALBH 3AAZA 4S1DC 2ILLA 3HHRB 3L1OH 4JVUA 3MFFB 1Q0YH 2E7LA 4GBXB 4CNIB 4X5XB 3LN4A 2X5PA 1B2WL 5FCUH 5IVXE 2DLEA 3MCKA 4RX4A 2IPTL 2EC8A 3GBMH 1EXUB 2R1XA 4YHKH 2NY3C 5JPMA 2EDHA 4C55A 3C6LC 3W5NA 2IH3B 3B6SA 4U0QB 1FYTE 3D69A 4XPAL 1FYTD 4OV5B 3W0WB 2HRPL 3UBXG 2BDNL 5JO5A 2A73A 2HG5B 5DMGD 2P48B 2UVFA 5HYQB 1S7WA 1VFMA 1PKOA 1LMKA 4NPYA 4P2CG 3UPCA 1JYWA 1AGDB 1W0YT 5IR1B 3GMPA 4PP2B 5LWYL 2OL3L 4HEME 4NQTA 1ES0A 1R3JA 5ITBH 1WITA 3F7YB 3D39A 1HHGB 5BJTB 4KJYB 3MSPA 3HPLA 3B9KB 4FP8L 4IIQB 3VXSD 4OZFB 5ANMB 1P84K 3UJJH 2NTSP 5HVFB 1U95B 5FO7A 2HAZA 3T0VA 4JFHE 3QNXA 5SWQB 1U6AL 3GSQB 4X6FA 4P3CL 3EFDH 3O0RL 1J0HA 5EZOH 3TYFB 1JF1A 4JJHA 1MVUA 2WIIB 3SO3B 5FF6B 5GRVL 4OCWH 1LDPL 1VCAA 3TBSB 3B2UC 3CH8A 2G75A 1ONQA 3E2HB 1CXIA 1I8LA 4ZTPH 4EN3B 3BKYL 3FFCB 2I5YH 1EO8L 4R7NA 3IF1B 3Q1SL 4JFEA 3K1KC 2OXGA 3B9KD 4MJ2A 1LHZA 5DF0A 5F8QC 4YDLB 4QHMA 3PHQA 1JF5A 1OGAD 3O2WL 5E8EB 3RGVD 1S8DA 2EYSA 3O4LA 4YHOL 3X13B 4S1SH 4GAGL 5AYUL 4XAWL 1JPFA 1V7NH 2ZJSL 5D2NC 3OJMB 5JW4N 4JM2D 4XHQA 3TBYA 5SWZE 5BO1H 3EJYD 1FL5B 4HUNB 1KB5B 3EO9L 3GMNA 3DIFB 2DQJH 2A74B 3CMOL 3GMRA 1AO7B 3IFLH 4YBQD 5LXGH 2ADIA 5TQ2H 4RGNB 4ZFGH 3MOAL 3ARGC 3H7BA 5D1ZC 4FZ8H 3MA7B 4ZUUA 4MA3B 4H8WH 1XH3A 4RNRA 3BXNB 1CXFA 4TULL 1QPXA 4WHDA 5T1LD 2AI0L 3K2UH 4Y5YC 5ACZB 4NKQB 4LSSL 5F7NC 4BM7A 5FM8A 4QXTB 2XKNB 4PG2C 4L8CA 4WFHE 5AAWA 1U58B 4JFQA 4OCMC 1RIUL 1P5VA 5GGRA 3IVKB 4JRYE 4WEBH 2EC9U 1FLTX 4P9HL 5DJ8B 1V05A 4PGDA 2FGWH 4PRAA 5DK3A 5F1NB 1T83C 1IQWL 3GDBA 4LLVA 5CJOH 3V6OE 2D9QB 4OIAA 3ESVF 1A64A 3L5JA 4GH7B 1S3KH 5D5MF 5I2IA 4WUUD 1J1PH 4AEIH 3VFPA 4U1KB 1NCUA 5H94A 5DTFB 1FNSH 1CLZL 1BECA 5EO9B 3EHBD 3SE8H 3P4LA 4X4ME 1Z9SA 2FGWL 2H1PH 2DQDH 4I3SH 4QHKJ 2IH1A 5DR5L 5ECJE 1N0LA 1D9KC 1KIQA 5TH2B 4Y4HC 2UWEB 3BN9D 3HMWH 5IFJA 4M3JA 3REWB 1W72A 3RBGA 1P1ZB 3N85L 3EJJX 3W9DA 4LGPB 4PRDB 4APQA 4MXWL 1P4LB 4N0CD 3MRPB 4LPWA 4IOIA 1E27A 2ZG1A 3RY6A 3D48R 4N5EC 3TO4D 3KPRA 5CP7B 1T89C 5HYSG 1RUPL 3UTSA 3ARFA 5SV3A 5JORA 4P4KA 2P8LA 5DD0L 3PP3K 4IRSD 4H0IA 3U0PA 1A9BB 1A6VH 1U91B 3LKPA 4EOWL 5FOBB 2AJYH 3G5XA 3TF7C 1IM3A 4OFDA 2NY5L 5I8OH 3R8QA 2ARJB 4Y1AB 1U42A 3GIVA 1NBYA 3HRPA 5IESH 1BF2A 4FN0A 2E7HA 1NGWA 4HS3B 1IEBA 4M02A 3RJQB 3DO7B 4PGZA 5EG6C 5BQ7A 5E8OB 2UWEE 1FORH 1MCNA 2DJ4A 4LLWB 5LVEA 2QTEA 2DQTL 3MA9L 2EKSB 2AJVH 1T04A 5SWSD 3CUPA 1DQQB 1MCJA 5HJ3B 3LOWA 1CICA 3NGBB 1MFEL 2MCPL 4F8QA 4YX2H 3C6LB 1QQDA 2EE6A 5D7LD 3S34H 3ARDB 4NQVB 4KKCD 4QXTA 2A83A 4D0CA 1Q38A 4K8RD 1C5CH 4W68A 1F13A 4XP5H 4S1DD 3B9KA 3TBSA 3MUGB 3GK8L 5DUML 3PDDA 1SJVA 4U6VH 4NN7B 5IWLC 2EIZA 1EGJA 1KXQE 4R0LC 1I9JL 4LKXB 3TT3L 4KC3B 3MRHB 5IB3A 4PRPA 2AK4B 2CD0A 1ZTXL 1T83A 3O11A 3P3YA 4OLYH 5F7FA 1MSPA 5INCB 3QWOB 3TBWA 5K9KB 1YYMH 3SDCC 2VLRE 1HH9A 5EUKB 3HC4H 4N0FA 4NNYA 3T0AA 1ZE3C 3AS0A 4HG4K 4UT6L 4OLVL 3VXUB 2AERT 3QXWA 3EO1A 4YBQC 3ZLQC 4CVUA 2G2RB 3G04B 4UUJA 3O81A 4PLKD 4JM2A 3BGAA 4OZHE 3MGAA 2E9WA 3CCHA 5T33L 4K8RC 2ZPKH 4G8GA 4F7EA 5E03A 1IGTA 1QHPA 1WIUA 1Z3GH 5C2UB 2F5AH 4GKSA 5MHSE 4WFFD 2ADFL 3VFWA 3UROR 4XBPB 1SJEB 5E24E 4XP9L 2AEQH 4MB4A 3B3IB 4OKVB 4ZDHA 4OCSH 3BD3A 1DDHB 4CUCA 3JV6B 4WDIB 2Z8VC 1DE4B 1T89A 5D1QB 4LU5L 1LO2H 5DJAB 4NKDA 4PD4K 4R8WL 4X8XA 1J5OL 2EDJA 3OX8A 5CJQL 4JZOA 3TJHC 2AJZB 5I1CL 4NZUL 4FRWA 3VXRA 2ZUXA 3V0VB 4WW2A 2ED9A 3TWCH 4JKLA 2KZ1B 1ZANL 5GRJL 5CGTA 4Y0GA 3D3VD 5B8CA 1CVSC 1UB6B 2O93L 1W0VB 1WT5A 1R3JB 3NA9H 3DX7A 2OS7A 5KSAD 4A2LA 1MFBH 2V9TA 1OGAE 4MMXC 2MFNA 3MXVH 4F80A 3IYLW 3OKEA 1YNLH 2VDQH 5FDWB 3WHE1 4XMKH 1YN7A 5EA0H 1IAOB 3TVMC 2AJ3A 3GSVB 5EWIH 3TT1L 5LAXB 2CJUH 5EBWB 3AXLA 1S7RB 2G5BA 2BOCA 3DURB 2BRRH 4OSUH 4C58B 3ARDA 4HK3N 5ANME 4ZFOB 2R69L 3I6LD 5MEOA 4NC2B 3WS6A 3HZMB 2Y72A 1V7NL 4GO6B 2AV7A 3JUZA 4XBEH 1QSFA 2VH5L 1KCVL 2WQRA 2X4TB 3PWLA 3VD7A 2DYPA 2BZDA 4XMKL 2YRZA 5TE7H 4D0BB 1A7RH 5J0BA 5F7DA 4XVSL 3SOBH 1KCSH 3JV4A 5SWZB 3AUVA 4HZAA 1AO7D 2DLHA 3IT8D 1AH1A 4U1NA 3DSFL 4PD4J 2AEIT 5EIIB 3VXSE 1C5BL 1MNUH 2VZSA 1BX2B 4KJQC 1NEUA 2YD3A 4XT1C 2RAMA 1RZIB 2R56H 3V79C 3F6LA 4PRPB 2P8MA 2VXTH 1M7XA 2DOCA 3LHPL 3FKUS 1G0DA 1AE6L 4P4KB 2QQQA 1MRCH 5DEGA 3BZEB 5T5FH 3FQNB 4U6XA 4WEUD 1T0PB 2HFTA 4Z7QF 2MMXA 3Q6GH 5DZNA 4NBZB 3NBNA 5GXBB 5D2NB 1P4LA 3QAZC 3S35X 4P2OB 5I16A 1AHWA 3VH8G 5E95B 2BVEA 2FO4A 3A6CL 5F6HJ 1UEYA 2ZCKL 3F7RA 2NY1C 1BEYH 4OFYA 1IT9H 1TXKA 1AXTL 2ADGB 2X6MA 3NCBB 5D7KE 3A0OA 5C0AE 2JCCE 4IHOB 2RQ8A 1U41A 4Q74A 5E00A 1YA5A 4IOFD 5E1HB 2LE9A 1IC5H 1SJHB 4U1JA 1UWEL 3MQIA 5T1KA 4ZNCD 4NQCD 3BX7C 4NRZA 1NSNL 2NXZD 1Q9LB 5T1MB 4OZHF 4I3SL 4UI2A 3LD8C 5MEPB 3GIVB 4GRWB 4MLIA 2GJ6B 2QBWA 4CU7A 2HT2C 2IAMD 5E9DD 3IB4A 3OKNA 4YEEA 3G9VA 3J8F7 1R3LA 3BGFB 4PBVC 4NRYA 2MQCA 5D1XB 3UZVB 4M6NH 2CKBH 5EU3A 4OD3L 4Z6AT 1T04B 4ZNEA 1JYNA 4OLUL 3CLEH 2W1NA 4ERSL 2NY1B 1PKQE 3TIEA 3RWFA 3MRNA 1MFAL 3FTGB 3QULB 4FQJL 3HC3L 1SYVA 1VKXB 1A14L 4XNUL 4EDXA 3IJSA 2B1AL 1R3HB 3GO1H 2W65A 1WF5A 4NFDA 2EDBA 1XF2B 5D1XD 3V4UL 3H7LA 4XNZC 5J11B 4P2YA 3VI3F 4FABH 5EO0A 1XF4A 5MERA 3S35L 3HCVB 4MNQD 3SKJL 3ZSTA 1TETH 1A7PL 4MXQD 5DD1L 4O2CB 4IOSD 3SDYL 4TUJA 1RVFH 4WWKA 4PY7A 1QACA 2OR7A 3QXTA 2BVQB 4LVNC 3VFVA 2GTZB 4G6JH 3EYFB 4PREB 2YXMA 4XPBH 4PJ7B 1HDMA 5KVGH 1EO5A 3BKMH 4XC1H 2P43B 4G43A 4Z8FL 2AJVL 4JQVA 2XA3A 4WNQA 1K4CB 1NCBH 1A0QH 5HHQA 2AV1A 4S2SB 4WENB 1N6UA 3ILPB 1RZ8A 3PV7A 3UMTA 1IAIH 2DDQH 1IRAY 1MCRA 4CDHA 3BDYL 5C6TL 2NR6C 4P2RA 4WW1A 3HI1B 1A3QA 3VI4E 5CBEB 2IBZY 3DX8A 4JFDB 3MRIA 2R1WA 5CEZH 1ZT4B 3UBXA 3U4EA 4HWNA 2FEEL 4NFCA 1NEZB 3K2UL 1M05A 1H3PL 4GQ9L 4HPYH 2MQ3A 2Y7QB 3CSPA 3IDMA 3BIKA 2OK0H 5I6XB 1NJ9A 1MCOL 2DI9A 5LWYH 3H8NA 3LEYL 3ZDXE 1U8KA 4PRAB 3A6CH 2DMKA 5EN2B 1RZGA 4M1CD 3DARA 5MENB 1NGZA 2CGRH 4RWYL 2ICWI 2DLTA 5DSCB 4IRJC 4GOSA 1S5IH 3P9MB 4K7PX 4FMKA 1UQSA 2XWJB 2YOCA 3EOTH 2A6KA 3CPLB 3KWWA 3NFNB 4JZJA 3DXAD 1WWWX 5DYOB 3AROA 3S96A 4Y5VA 2Z9TA 4KTEH 4LFHD 4PY7B 5DEFA 4P57B 2B5IB 1MHHA 2ADFH 1XGUB 2XZAL 4LBEA 4GXUN 1YYML 4JRXA 1OAZH 1FFOB 2IALA 3T77A 3RBSA 5F3BA 3QEHB 1GH7A 2D7PA 4DCQA 3SE9L 3WDIA 4RBPH 5BV7B 5I76A 2HN7A 3EOTL 2Q76A 3JBG7 5IGXH 1MH5B 1F45A 3WFEL 3SDAB 2B1AH 2FX8L 1JL8A 3TZVD 4ZUTB 3MUHL 3HNTL 4OZHB 1BZQK 1HEZB 2P24A 4GRWF 4OLWL 1KTDB 3W39B 1MVFA 2GJZA 2XPGA 3H0TB 2ADGA 1U3HC 1KTLB 3BI9X 3UTSD 4KKLC 2P5EE 5IW1B 5JMRA 4L4TE 2DB8A 1GYAA 1BIIA 4KK9C 1DUZA 4PV8B 4ELKB 1XF1A 1UGNA 3TN0B 4K7PL 3KXFE 4X6CF 4C83A 1ONQB 5EBWA 3T0WA 4MQSB 1V3MA 1T7YA 3PIQB 3BQUB 3MLVL 5DJDB 2J8UB 4GKOA 1N5AA 5TDNA 5DD5H 3MV8A 4MNHA 2J7LA 4MNGB 3S6CA 1MCPL 1N7ML 4NPYB 4QWWC 4N8VG 1HHJA 4MZ3A 1XR9B 5BMFL 2O61B 4MA1B 4HGMA 3HKFA 5DQJB 3EYQC 2HLFC 1G7LA 3NIDF 3TO2A 3T3MF 3ULUF 4P4RB 4Z7UB 3QCTL 3QDJE 1A2YB 3VGBA 3NIDE 4JFEE 3MRRB 4FFYH 4PJBE 3D87B 3KPSA 1KN4H 2YHGA 3F7YA 3QQ4A 4NM4L 4FOMA 5CJOL 4DN4L 5DEGB 4UTBH 2FYYA 2VB5A 4AM0B 1FGVH 1CIDA 1CDGA 2EYTA 4MD4A 1YEJH 3RUGA 3WUZA 4HIHB 1QSFB 3C09C 4KH2A 2J5LB 3WIHL 2R56L 3EBAA 3HAEB 3AAZB 4Y16C 3KLSA 2YSSA 5ADOH 5HI3D 1BJ1J 2XQBL 3B6SB 2HTLD 3IFNH 1C5DB 3MLTA 1TJGH 1S7RA 3S5LG 2ESVB 4OCXL 4LDLB 4RAHA 4GUPA 1CVRA 4WUUE 3UTSE 1EAPA 1A1MA 3LKOB 2R1XB 3MJ7A 4XGZB 3FO2B 1P2CA 3W9EA 1BP3B 2FO1A 4PJXB 1U8QB 4R90H 1I7RB 5HDBE 4UOW0 1RK1B 5HXMA 2B0SH 2H26B 4PV9B 4QRTB 1MF2H 2OX5A 2I07A 2H32A 5L2KB 1OM3H 2GJJA 2GUOB 3WKNA 3HMXH 3QISA 4TUOA 1MJ8L 3UZQA 1UVQB 1JJUA 2JKXA 2CIIA 1NCWL 1OP9A 5FO8A 4DJMA 5T5FL 3RY5A 5I1AB 3WDJA 3IDJA 3DRQB 3TEUA 1XR9A 1CD9B 3FQNA 1KJ2A 2DICA 1INQA 4R90L 1DL7H 3O2DL 4BH7A 2H2SD 1H0DB 1AGDA 1HXYB 1QFUH 3HZVB 3S8WA 2HFFA 4Q9RH 3L3HA 5C9JA 1HILB 3GI9H 1Q0XL 4HJGA 5TE4H 2HJFA 5DC0A 3VFSA 1BQLL 3HPJB 4E41A 1ZT7A 1DN0A 3FB6B 1MHEA 3ARGA 5J1TC 3QRGL 3P9LB 1FNLA 3O6FB 4JO4L 3OXRA 4RFNC 4HIIB 4N0UE 4Z7OF 2VN4A 3BQUC 3SY0A 3U6RA 3BAEL 4OAWA 1CXKA 1Q72H 3RKPA 1MUJB 5L2KE 2H6PA 2CMRH 2VTFA 3FB5A 3DTXA 3GSWA 1CGSL 1RUML 4C56B 2F53E 5HGGS 2DBLH 1RJYB 2AJUH 4WHTB 1OAXH 4OCRL 1SMOA 5DUBA 5EU5A 2ENYA 1TNNA 4BQ6A 2OSLB 5K9OB 4UQ2A 1NUGA 4CMHB 1WEJH 4F9PA 5JOPE 4YDKH 4JRYB 4Z0BL 3KJ4C 3T65B 2VH5H 1IAII 3HG1D 1OD9A 4U6YB 4DGYL 2NLJB 5DRZA 2AS5M 2OYPA 5GS0H 1AGFB 3B5HA 4YO0B 3MRMA 4MJ5B 1EEUA 1WICA 3GI8L 3LSOA 3QDJB 5ID0B 2QL1A 4NNYB 1ZA6A 3NH7L 4KXZI 3DUUA 4LASH 1AKJB 2V17H 3ARZA 4LSUH 4X5WB 5D1ZA 1UWXK 4ONGL 2XQBH 4QHUB 5I8EB 5E8PA 3MV8B 1W72H 4I18C 2ZUSA 3TA3B 4LSRH 3M17A 4NKIH 5FHBH 3I9GH 3FN3A 4MJ4A 3QUZA 4APQC 1GCFA 5KG9B 4I0PD 5FM5M 5ILTH 2CIKA 2CUHA 4J6RH 1W8OA 4ELKA 3IDIA 3UDWA 2B4CL 1AKJD 2P44B 3MCLL 4L4VA 3GHEH 3VFPB 4X4ZA 1V7MH 4PIRF 3HNSL 3HAEA 1A7NH 2GTWB 3CUPB 3U0PB 4LSSH 2R1WB 4LKCB 1CFQB 1RIVH 2IALB 2A1WH 2DJUA 4I48A 2Z93A 1B0RB 1F3DJ 2NY7H 5HHNA 1WZKA 4DGVL 1Q9KB 4RBPK 4X6BA 4LCWE 1IARB 1U92B 3V95A 2Y36H 2NXYD 2Y5TA 1W0WA 3CXDH 1FFRA 1OP3H 3FN0H 4JZJB 5DGRA 3G6JA 4U3XA 3NFSH 4EXKA 2EE2A 1IM3B 2WZPD 1UADC 4G43B 3MJ8B 3T1FA 4M7ZB 5JHDB 5BVPH 1QBBA 1IKFL 5C0IB 2FHBA 2FSEA 4X6DB 5ESVA 3FZUD 2F53A 4I2XE 2O5XL 4U7SA 4YPJA 4YE4H 4AEFA 3VXOB 1NC4B 1JTPA 1I85A 4D9RE 5GGVH 2VSCA 4MNGA 1XGQA 4O58H 2ZSVA 2HKHH 4BZ1H 5ALCL 2VDKH 5JW3H 3QUXA 4WVRA 4TVPH 1EHLL 4OLUH 2VDRL 3S3SA 3OZ9L 5FGRA 5HI5C 5L0QB 1LE5A 2FATL 4ZODA 2DI8A 3B2VL 1DVFD 1DVFB 1X5JA 3BVNB 1NDMB 5JXEC 1UJ3C 1P7KB 5AWNH 5KN5A 1W8NA 2OXHA 5BW7C 3RJDA 3N85H 1JZ6A 3BT2H 4GMTL 5D7JB 4G6FD 1KTRL 2DQIL 1QSEA 5ACMA 3LIZL 4K3DH 3RWGB 4F2MB 1G6VK 2GAZB 4QHKI 3SDCB 5C8JB 2N7BA 4HS3A 4K23L 4PUBL 1A8JH 1OAUH 1KNOB 4K9EL 3X12B 3X11B 1MCPH 3NPSB 2HN7B 3DXAB 1KC5H 4YHML 3O6ML 3TFKC 5AD0B 5ESAA 5F97E 3WN5A 4ZUSA 2WBJB 4JM2C 4R7DA 2DMBA 3WD5H 2CR6A 1J11A 4N9OB 4BKLB 4PJDE 1CF8L 4I18B 4PG2A 5D6DC 3WEXA 5CEZL 3RNKA 4ETQB 4OZIE 2Z31D 1W72L 2ED8A 5JIIA 1KPRB 3I02A 1MRDL 4D9LL 2WUBH 4XTRD 5FYKD 3QCUL 4MAYA 2R0LL 4QOKB 5C9KA 1OAQL 1P1ZA 4Q6IB 3IJYB 3LEXA 4MDJA 2W0PA 3QAZB 5BMFH 2PYFA 3EDJA 1MELA 1IKNA 3DETC 3MV7D 1OARL 4JANA 1MCWM 1GSMA 4HLZG 2OSLA 5K9OA 2GI7A 3C60A 3D3VE 1NAMH 1MQKH 4K94C 4NQDA 1CK0H 2Y07L 3TJEL 5H94B 2VWEC 4CU8A 3QNZB 1S5IL 1YDPB 4AZ8A 4WHTA 3BSZH 4FQHB 5DRNA 4Z5RA 2DQEL 3CSBA 2WWMC 2DTSA 5D6CB 4MA7L 5C0GB 1AXSA 3UYPA 4OLXH 4QRUA 3QIWB 5ALBL 1Z9MA 2EZ0C 4M7LH 5GGSB 1U8LA 4LFHG 4OLVH 2E7LC 4HF5L 1OAZL 3DV6A 5HYJD 3T0DA 2PTTB 3V52H 4QLRA 5JW4Q 2G5BB 3DURA 3T3PE 5I1KL 2PW2B 4H88L 3L7EB 3B83A 4ORZC 1HZHL 1RULL 4LP5A 2ITCB 2EXWD 3L5IA 3MLUH 5IVXB 2VXQL 2E5EA 1N2RB 2FHCA 2JJTA 2AJYL 4S1QL 5DJXB 3AREB 1EGJL 1JWSB 2E9IA 4WU7A 4DKFL 1G7PA 4DK3A 1K2DA 4D94A 2CXKA 2P8PB 1SQ2N 4V2CB 3CX5K 5ESVB 1XCQA 3NIGF 4WV1A 1WQVT 3DUUB 1U8IA 2X1XR 1F6FB 4ZQKB 4AEHL 1LEIB 5AAMA 3EFFB 4HH9B 3GM8A 1NGXB 2GJ6D 1HHGA 4GRWE 3RWIA 4E42B 3OX8B 5J1AB 3O2WH 3BP6A 2WM0A 1FLRH 1B9ZA 1CCZA 1TETL 1A7PH 2AXGB 5DVKA 3K4ZA 2FX9L 1KEGL 4JY4A 4P5MB 3SDYH 1BQLH 1FCCA 2FD6H 4P3DA 3MV8D 3HZMA 4Z0XB 2NY2D 5DWUH 4L4VB 5EZJA 3QG6B 4QHLA 3MLWH 4XHJC 2BVYA 2B4CC 3EUUA 3UDWC 4NRXB 1R5VA 3FL7A 3OKDA 2YEZA 1I1FA 4R0LA 2RBLA 4Z8FH 3JV4B 4ZAKD 5SWZA 4MX7B 1ZLVH 1GGUA 3U0TB 3GUTA 2GY5A 5HD8D 5BV7L 5IMLA 4PJGA 1CGSH 1RUMH 3L5XL 1NC2A 4IDJH 1DR9A 1LD9B 3KPRD 4MDIA 2ESVD 3HZKB 2HJKA 5CSBA 4NQSA 2X4NA 4NCC2 4P48A 4U6HB 3MRKA 4P46A 4UMGA 4XNXH 4HMEA 5AUMB 4LRNL 2XY1A 1CQKA 1CS6A 3NGBC 3SBWA 2XQYK 5D2NA 4OM0H 1I8KB 4LQ1A 4ODHH 4OCXH 3TYGH 4LAQL 2FWOB 4PY8I 5GS1A 1U0QA 4LIQL 3MFGB 1ZLUH 4LLAA 1HHKB 2MNUA 1K5NA 1TJIL 1SEQH 4P2RE 1BFSA 4UT7L 2B5IC 2MOVA 3VRJB 1A4JA 3FB8A 2H2PD 3P4MB 3PWUA 1CLZH 2ZUWA 3GB7B 4OGYL 1UWXH 1GZQA 1N6QH 3KLHC 3QH3B 4LU5H 3MV8E 5DXWA 1FVEB 2YUWA 4WEBL 3O41B 5HVGB 2Q7YA 1W2KT 3JV5A 1QSVA 2GT9B 5C0BA 3F5WA 1MREL 3VCLA 1XGPB 1K8IA 4HDIB 1CD0A 5I18L 4NRXA 5ID1A 4APQD 3FN9A 4JDTL 3O3EB 4X7SH 5C0DB 2IADB 2IFGA 2F54D 1PD6A 2Z35B 5CGYD 1CBVL 4LHUD 4P5TB 1RIVL 3CDFA 1KULA 1X5ZA 3GSVA 4KJQD 2DKUA 1XCQB 5DD5L 1FNGB 4LRIC 1I9IL 4IIQC 3MV9E 3N9GH 2APVA 3T77B 5F3BB 3QUYA 1KIPB 1E28A 1U3JA 2VQUA 3FT2A 3PDOB 1NAMA 4TSCL 2D7QA 1JPTH 4ZFZA 1EBAA 1D9KA 2VR9A 3WFHB 1BZ7A 4JFFA 3EYUL 3QFDA 2A77H 2VABA 3VW3L 4Q9CA 2IAMB 3M1BA 5BS0D 3G5VA 4IJ3C 4PLKC 3IS0X 3RP1A 4KJWC 4TVPL 3REWA 3BDBA 4MJIA 2EYRA 3MNZA 1QTYT 2GJZB 3MLWL 5KJRL 1I9RL 2VXVL 4DOHE 5HHMB 4PRIE 4OZGA 2IPUG 5CGYC 1ZHKB 1KC5L 4PP1D 4NN5C 2OL3B 4EQ2A 1MHPH 3SKJH 1I1FB 4R0LB 5L8LB 1PQZB 2XOTA 4FG6C 4J3WA 3TCLB 4M00A 5JW5A 5CWSB 1E6JH 4IRJB 5ISZB 4Z76A 4X80L 4PJAB 1J7VR 1U8JB 4J3OC 4K94H 1I9RH 1ZLWH 4RAVA 3SPVB 3PUCA 5INDB 2VWEE 2BMKA 3WE6A 3RVUC 4F37K 4JO1H 2EDEA 3BZ4A 3LRHA 5EOTB 1MFDL 1PZ5B 4HUXA 1IEBB 2WWKT 2FX7H 5K9QI 1OSZB 1T03H 3QQ3B 4WFHD 1YC8A 5FB8A 4NQDD 2GK2A 3WS3B 5LGKA 2ZCLH 5LQBL 4LP4A 4WNQB 3RWCB 3BRFA 4GLRI 1PYWB 4LARL 4RQQA 2BSTB 1LNUA 4HBCL 4ZSOE 4BH8B 4QO1A 1WZ1H 1INEH 1QR1B 5DSCA 5C3LD 4FQCL 4ESKA 1NCDL 5FYLD 3SO5A 3UTSB 4Z7UF 5ICZB 3DHJA 3QT2A 3GI9L 4UB0L 3EZ8A 4E41D 4M93B 3MUGA 1B6DA 1QFWL 4S1RH 5FHAH 3ARPA 3CVHA 5DVMA 5B39G 4Y5VC 2C3GA 2VIRA 1ZTXH 1QKZH 1MEXH 5I8CA 2YPVH 3KPTA 4XPHL 4W81A 3DX6B 3JWDL 1OY3B 2Q1EA 2EYSB 3O4LB 2VDNL 3EJZD 4QF1A 3DJ9A 4I9WE 4LHJB 1LO2L 1YECH 3PHSA 5GHWL 1TTGA 5C1MB 1FNEA 3KPMB 2UY6A 3CH1B 4MD0A 5D2LF 2V2WA 5JHLH 3VFGL 3ZDZE 4XBGB 4JPIA 5HGHB 3MLUL 4H0HB 4Q0XH 1HCFX 2EIBA 2J88L 2XA8L 3VXRD 1U36A 4CMMB 1LO5A 4OTXL 2FBJH 4B7LA 1CD8A 2LU7A 4KQ4L 5ISZE 4F57H 4HMCA 3VXRE 3DO3A 1MFNA 3BPOC 3O3AB 3DX9A 5C07D 1IM9D 5HDLA 1DZBA 1CE6B 1P4BH 1NL0L 2JTDA 4PJ5E 3MLXH 1JFQL 5DK2A 5BV7C 4LCUB 3S3PA 5BXFB 2GSGA 1EK3A 4FQ1L 5DJ8A 4I9WD 3NFPB 2WLZA 4NNPL 3NCJH 1E27B 1IAMA 5JQHC 1S7XB 4KROC 4MCYA 4X8JA 5E5UB 1L6ZA 2IMMA 1J5OH 3K8KA 1AKJA 2AGJL 2OP4H 4R3SA 4XVUD 5HYSA 3LQMA 4XNQA 4JGUA 3W9DB 1F4XL 4PJFB 3O6KL 4C57C 2RCSH 3DUHA 4S1SL 4EJ1C 3MBEB 3MA7A 4ZUUB 5D7IE 3CC5B 4M8QB 5SX4I 3V0WL 1HH6A 5CSZB 3BPOB 3RDTD 4AIZA 4RRPA 1JRHI 5GSRA 2PCPA 1VACB 5IB2A 4LOUD 5FYJH 1HN1A 4KV5E 1NGPH 3GI8H 4G5ZL 1HINH 3ARXA 4FQLH 3KYKL 4KRPC 5DMKA 4UINL 3UTTB 1M7IA 3K8LA 5DO2D 1I3UA 2YXFA 4Y1AE 1PZ5A 3OKMA 1MIMH 4XBGA 3K1DA 5DEZA 4X5LA 4LRNH 2DWEB 3SE3A 2ICEB 1H3UA 4M6AA 1JZ2A 1RZ7L 4QHMB 4UV4L 4PGDB 3BW9A 4J4PC 3E0GA 3TPUB 1K6QL 2YPKB 3WL9B 2PXYB 4Y4HD 4KY1L 5IBTH 4QHNB 5HPMB 2DQDL 4JFQB 2PO6D 2APTA 2ITDB 5C2BH 3C5SB 4EBQH 3KR3H 5T3ZD 5FM4A 2WBJC 4OLEA 3NIFE 4IMKC 4MJID 2IAMA 4MNQB 3KYKH 4CDGC 2CUIA 3FB8B 2QKIA 4DVRL 2N1KA 1T0NB 3PNWB 3MJ9L 1QKZL 4YO0A 1L0XA 5K9JH 1DQDL 4KAQH 3QUML 1JHTA 2C1PA 3OKEB 5C0AB 5KSBA 1JGDA 1D5MB 3PWVA 3I75B 4X7TA 4E0RA 4Z9KB 4OGAC 3VD9A 2C4XA 1MAKA 4K55A 3GEWB 3J7HA 2ZWLT 3OJDB 5FO8B 1QSZA 2GK0B 5K59F 5GZOD 3AU1A 4HFUL 2AQ2A 2NTFB 3RI5F 5DLML 2J6EH 4YIQA 4NGHL 1CFTA 5TE6H 1I4FB 3U2SA 1T21A 3THMH 3TLRA 4QRTA 4NWUL 5E2TL 2VDLL 2PYEB 5F7EH 2ORBH 2ATPA 1UJ3B 4FP8H 1F2XK 3LN5A 1IAIM 2ENSA 4PUBH 3SCMA 2YD1A 2PTVA 3MRLA 4X98A 1UM6L 4UZGA 2V7HB 5IOPA 4MYWB 1SBSH 3MJ7B 3CVIH 1MAMH 1MHEB 2YEZB 1J8HA 1CXHA 5GZNC 3KAAA 2HA1A 5C0DA 3P4MA 2YD9A 1O5DT 1PQZA 5IVZB 1KN2L 2XTJB 1L7IL 1DQTA 3RHWK 5H37H 5FDYA 4NRZB 4B0MM 4HUVA 5L88H 4JR9L 1BIHA 1KIRA 1GIGH 2W0FB 2AXGA 3KHOA 3RKDD 1JWUA 4NHUB 1V5JA 5FYJE 5DT1L 3QQ4B 3LIZH 4NQEE 2I27N 2WUBL 3QRGH 4D9LH 2FD6L 3G5VB 5A43C 3I6KA 1A1NB 2P4AB 1I7TB 4I5BB 2DS4A 2VAAB 1OL0A 1EZVX 1V3LA 1NCAL 3MACL 2KH2B 1BZ7B 1VFAA 3AB0B 3SDAD 4MXVE 1F58L 1FYTB 1KELH 5JOFB 4UU9A 5EU7C 4JGJA 4P2RD 5CD3B 5L88L 1YMME 4P3WA 3GHBH 1A7RL 4Y16A 5FYKH 1F4YL 3UTZA 3VMPA 2KZWA 3WJJA 3DX7B 5I1AA 2W9LA 35C8L 2HMIC 5F9OH 4ONHA 5F6HI 3VWJA 1SY6L 3WSQL 4LGSB 4RIRA 3LD8B 5E2VL 5C0CD 5C0CE 2ZPKL 2NY3B 3MOAH 3TH4T 3RHWF 3BUTA 3U7YL 2P5ED 3MOBH 1MF2L 3LS5L 1ZGLM 3EYSL 3NIGE 2HTLC 1JNNH 3D1MC 4Q2ZA 2OL3H 4PP1C 4UT6H 4NKOB 5AG8A 3V4PH 5AZEH 1EEZA 3S4SB 2VISA 3GM0A 4ZFOA 1FBIH 3C6LD 1BD2A 1G7JA 4Y19D 2VKWA 3L3GB 3VFWB 2JIXD 4ZFFA 2Q7NA 2X7LA 3UJJL 3CLFH 3N0PB 2N56A 2XZAH 1VACA 5IVOA 4B50A 1VGEH 2EH7L 4MSWB 4YPGA 4DKFH 2DL2A 4KZEH 1T2QL 5JORB 4M5ZH 1CR9L 3GBML 3PGCA 1BBJB 2HRLA 2D31A 3IGAA 3QHZH 4WU5A 5J56B 1NLBL 2PO6A 1H3TA 1UCBL 4H25B 4HIEB 3CZFA 1FE8H 1TMCB 4Z7VB 1FNAA 5E99L 4RZCB 2UYLA 1MJ7L 2H1PL 5FKAA 4U3CA 1ZT1B 1I85C 2ZOKA 3I02B 2QQLL 3DYMA 4XX1E 1KJ3L 1NPUA 4DAGL 3MODH 2BFVH 2IAND 4DOHB 2CRYA 3MO1B 4LCYA 4YHYC 3NFPA 4BSVA 4Y5XC 2C3WA 4EDWH 4XAKD 3ABZA 3U30B 4OFYD 5E8NA 4ACPA 1OLLA 3BGFC 3DRTB 4FQ2H 2X4RB 3INUH 4KKBD 3GIZL 3GMQA 5AD0A 3GO1L 2I9TB 4GJTB 4GKZB 4R4BB 4D0CB 5F21B 4Z7WA 1T6VN 4F15C 3H3BC 5CMAB 5C71A 1BQHG 2F8OA 2BNUB 12E8H 4KPHH 3F12A 4NCC1 2ZUUA 1XF3A 4JDVB 3OKYA 1F4XH 3O6KH 3BP6B 3UC0H 1DBAL 1SYSB 5IVXF 1QSED 4Y5XB 1VEOA 4ONGH 4NQCA 3BUYB 4CN4A 2AV1B 4S2SA 3DYOA 5ETUA 1BVLA 5FGBC 1M71B 3WUWB 3QNZA 1UZ6F 3G6AA 3OJDA 3BYYA 1P7QD 4QXGH 3WEXB 1PEWA 3HTLX 5FYJL 3FT3A 4KPHL 3P73B 1SVCP 5DJCB 5DI8B 5EORH 2EDNA 5I1GL 1MLCA 4FQLL 4HV8A 2VLLB 2NY4D 4YFLI 4KK5C 4GBXD 4ZOBA 3FB7B 3CIQA 5KSUA 3TP4A 3NABL 4GRLC 2A74A 2NY3D 3L7EA 4LAJH 5IFAH 3MXWH 3FMGL 1IFHL 1BQSA 4ODVH 1S5HB 3X11A 1EJOL 4WTXA 4MVBD 5DK0B 5IMKA 3V6ZB 1TJHL 3U36B 3C5SA 3UTTD 5D93B 1W0WB 3WLBA 3ULVL 3BPCA 5CUSL 3BPLC 1IBGH 3FOMB 2HTKD 3QI9B 4Z7NF 1KN4L 3QIWA 2YZ8A 4TSBL 1SY6A 3STZA 2NQCA 1VDGA 5EOCJ 2APBA 3NPZB 2I26N 3H9SD 1YNTA 1QBML 2YD8A 1EX0A 2DQGH 1YEJL 2MSPA 5GGRB 3IVKA 1M7IB 1LILA 2ZNWA 3G08A 2VXSH 3RX7A 4N0YH 3ROLA 4M48H 5IB1B 3LPGA 4RNRB 1LO3H 1AD9A 2AKRA 3DROA 4AJ0A 1MVUB 4YDJA 3L6FB 2F5AL 4KDWA 4MXVF 5E2WH 2VLKB 3MRBB 4M93C 3QHTC 1EPFA 2XN9B 5C07E 4JCMA 1ZAGA 4G3YL 4JQIL 3SDDC 5EO0B 2D7OA 1B6UA 3CPLA 3B9DA 3KWWB 4XVJL 1J8HD 1B4JH 1DBJL 1RMFH 1BOGA 3WFBH 2DLGA 1RHHB 3V5KB 4P49A 4O51A 3VXMB 3BXNA 1BD2E 4ZOEA 1RZGB 3H9HB 3MTRA 3JTSB 1OTTC 1QRND 3PGCB 1CGWA 5D7SL 2IANB 5ENWA 2DQTH 1NC4A 4IRSC 3VA2C 2GFBB 3TWCL 3NZ8A 5EO9A 1XF4B 5MERB 5HPOA 3P4OA 4TN9A 3SKOB 5BVJB 3NMEA 2YPLB 5CD5C 4TSAL 2VL4A 4U1KA 4YHLL 1NEZA 1G0YR 1GGIH 2GSIB 1OW0C 4U1SB 1WC7B 2G75B 5DHVA 3K46A 1DANT 2Z4QA 1KENH 1F4AA 2BP3A 3MRIB 4NZTH 4X7FC 5E6ID 1EXUA 3OAZK 5E8EA 3ULVD 5E8NB 3AY4A 2R4RH 4ZPVB 3MLRH 4OGXH 5MI0C 4OIBA 4CKVX 4FZEH 5HHME 3MO1A 1IMHC 3SO3C 5BZDA 2AXFB 3D18B 4LASL 1X9QA 1T0MB 2XXMB 4L8CB 1MRFL 4OCYH 5FAAA 2DQHH 3HUJF 4ZUVA 3PWUB 2Q8BL 3W2DL 3GMQB 1A47A 2NY6D 2EXYC 2PXYD 2L7UA 2VSDA 3JTTA 4MHHI 3REVA 4DGIL 3UZEA 1QA9A 4KUCD 4HXBH 5ERWA 1BOYA 2OQJB 4L29B 1HHIA 2P5EB 3KPLA 1WEJL 3RVVD 1P6AB 3QEUB 1J0KA 3RKDC 1PLGL 2VDPL 4Z7OE 1FN4A 5AZ2H 5C0CB 3ZHKA 4KK6C 3L3JA 4ZFFB 3PWPE 3QIBA 5L2JB 1Z5LA 1TJGL 4L8SA 2CDFB 2IH3A 2X4SA 1Y6NR 1NBVL 5HVHC 3CZFB 1AO7E 1S3KL 1F4YH 2I07B 1PKQA 4U6HA 2V17L 3TZVC 4P5KA 1RK0B 3KPNB 4EN3D 3BZ4B 5EOTA 4KTYA 3QSKB 2IBZX 4QKXB 3BRGC 1UACH 3UYRL 5FYLE 4DUXA 5C0FA 5E2VH 5HHPA 4ODHL 3TYGL 2Q86A 1T5WB 3U0TA 3NFSL 3P77B 2VXQH 3IF1A 4UOJA 1NMAH 5F88A 3WJLC 3C08L 2CLVA 1BM3L 4XXCA 2R23A 4Z7QE 1JZ5A 2YSSB 3GSRA 3DGGA 4Z0XA 5E6ZA 4WEMB 3GHEL 3QQ9C 5KANI 1RMFL 4MZ2A 2BNRB 2BVTA 1HXYA 5LJYH 3NTCH 1WVZA 3KPSD 5HBBA 2XZQL 4LVNB 3B9EA 4X6FB 1YQ2A 4P9ML 3DSNA 1K8DA 4XCEB 3G9AB 3KHQA 3IAQA 3MV9A 1IGML 4HMDA 5TQ0L 2NR6D 2OI9B 3E8UH 1HH9B 1TZGH 3KYOA 4QXWA 4J4PD 4AEEA 4M8VA 2AK1H 2ZSWB 3CFBB 4LMQE 4Z7UE 1EFXD 4P2QE 2FIKA 2IEPA 4R26H 1G9NL 3IGAB 1A9EA 2XZQH 4UTAL 3KJ6H 4P2QB 1KIPA 1FCGA 1KIRB 4PRPE 2A2QT 2J8UA 3LRGA 1OAUL 1XFPA 1CG9B 5C70A 3AM8A 4NJ9H 3L7FA 4GUPB 3RWHB 1TZGL 4KMQA 4I3RH 1J0ZA 1I7TA 4I5BA 4XBPA 1PEZA 3O9WC 4Y19E 4YBLC 4M1CC 3DVIA 4DVBA 4ODXA 3H42L 4GG8B 5GGQH 1I7UA 1T5WA 1JPSH 4XPFL 4XNXL 4QT5A 1T1YA 2QEJA 1D5ZA 1RIHH 3NAAH 3LHPH 1OAKH 2FB4H 4HPOH 1F00I 5FA4A 4YAQA 3GSNB 1NCBL 1A0QL 1DUYB 3V0WH 5FYKU 2AQ3A 2YWYA 3OB0K 4OFVA 1SM3L 1AQKH 2WUCL 1NDGA 5I9QC 4H1LA 5D2LA 5L6YL 2IQ9L 2VLRD 1Z5LB 2VE6A 4PJBA 2ZKHL 3GSOA 4H8WL 1ZHNA 2H8PA 4L1DA 4LSPH 5I75B 3MUZ1 3OJ2C 2LV4A 1QVOB 2A9NL 1E6JL 4U1GB 5ENWB 2COQA 3S5LA 2JB6A 4PJCA 1UEMA 1GPOL 4AM0A 3HUJB 1F97A 4G80B 3KPRB 1U2HA 1ZHBA 3P0YL 2RFXA 2I60H 3HUJE 3V0AC 1QG3A 2DQEH 2JJSA 1DVFC 4N0FB 1F11A 2HFGL 4AH2B 4HGKC 4F33B 2C26A 5F6IC 5LBSH 2X09A 3QIUA 4YXKH 1FN4B 5C0CA 3RNKB 2H26A 4NC1C 4M43L 1X5LA 4B41A 5HYJA 1JMXA 4OZFH 4QGYA 3GMLA 4M6NL 2CKBL 4MQ7B 2P5EA 3IDYC 1JV5B 3QDMB 1CFSB 3IDGA 3GKWH 3K81A 5T1LB 3VDCA 1TVHA 3V7AG 4LPTA 4OD1L 4XWOD 2JB5H 3RL1A 4NIKB 1A14H 4KK6D 3RZCD 3TVMB 4RGND 4RGOH 3TO4C 1DUZB 2R4SL 3OG6B 4PV8A 3EO0B 4FS0A 5E2WL 2X4UB 4GMSL 3BH8B 5J1SC 1V3JA 1IGTB 2E3VA 4BFIB 5TDPA 4FQQA 2EO1A 3MYJB 4JM2B 2NW3B 4I13B 1AXIB 2CLRA 4PGBB 3QI9A 4JG1H 1RUAH 3H9HA 2MWCA 4M7LL 4P99A 1IC1A 5C08D 4FQXD 1REIA 2O5YH 4OF7A 3GRWA 1LEGA 2ATKB 3E3QE 3ZMRA 1TZIA 3VFGH 5K9KA 5BVJA 1FLRL 4H5SB 3W0WE 2VXUL 2WAHA 3LV3B 3ILQC 4N0UB 4EOWH 4RDQF 1YNKL 2H2PC 1R3KB 4LVHC 3REVB 2A38A 5I74B 5E6IA 1MY7A 2WBJA 4OCLC 1CGYA 25C8H 5E2UH 1YEHL 3MUY1 4KTDH 4YXHL 3NFNA 5CINL 5C0IA 5GZOC 3L9RB 2BSRA 3ALWA 1IEAA 4XVSH 1KCSL 3SOBL 1JPFB 3ZKNC 3KLAA 2PXYA 1SYVB 2A0LD 2Z0BA 2VYRE 1B2WH 3LS4H 1I8MA 5CJ8A 5IFHL 1C5BH 4LCUA 1CE1H 1CF8H 1U8KB 4I48B 1KG0A 3EOAB 3W2DH 4ZUSB 1A6AB 1ITBB 1QHOA 3AMLA 4P2OC 5IB1A 1F90L 4TULH 2D03L 2VC2H 3RUGF 5B38B 3MBEC 3UYOD 3FMGH 1MFCH 1S5HA 3WV0A 4GRMB 4JFOB 4WCYL 1DVFA 3TCLA 5JW5B 1RV6X 1JNHB 2EDRA 3MLRL 4XXCC 5T1MA 1ZT4A 3SJVE 3DV4A 5IFHH 3FFDB 5HY9A 5DJ6B 1TZHB 1CTNA 4XMLH 5DD3H 4U1HA 3TA3A 1FP5A 4UBDC 4K3HA 1D7FA 3LDBB 1P7HL 2WLYA 1T66C 3HNSH 3VI4F 4IRJD 4O51B 4FQPA 5HI5D 3TIDB 3VXMA 1P7KA 2FSEB 3ARBC 1A6TA 4XRCB 1KLUB 1NUNB 4M4PA 3C8DA 5HYSB 1L7TH 4U6VL 1UG9A 4R4FH 4G9FA 1DBMH 3D6GA 3OKOB 2BHYA 4PYGA 1CL7L 1I9JH 1EUUA 2YWZA 2EDLA 3ELAT 4FFVC 5T5NG 1H9VA 5E6IB 4KKNA 2G60L 5MEQA 5DMIH 3MX0A 1BWWA 2NW3A 1B0RA 3PHOB 4FFZL 3DX9B 1T2QH 2W9DL 5J9PB 2ICWA 3GMMB 3Q2CA 3ZE2E 1OWWA 1RY7B 2PTUA 1OTTD 3MRFB 4JQIH 1XF2A 2VE6B 4DWHA 1FSKC 4ETYA 3VXSA 3FO1A 1EHLH 4KV5F 1OSPL 3LQAH 3TGXA 4GXVL 4OGYH 4PBWD 2UZXB 3RL1B 5DMIL 5F93C 3TBTB 4NKOA 5EBGA 3HE6C 1UWGH 4YHMH 5CBEA 5JW4M 1A3LH 1CU4H 1YMHA 4ALAL 5TE6L 4ZTOL 4BFIA 4N90D 1P53A 4XWOC 2NCMA 3TA3C 4AEHH 3DUSA 3SCMD 4P23B 4NUGL 2VNCA 4P23D 4UTAH 4X7EC 3UAJD 1ZA3A 6FABL 4NO2B 5ANMA 3FFCA 4OZFA 4GAJH 4LLDB 2DM7A 3VWKB 2NX5B 3EYFA 3GGWB 4OUUA 3MROA 4W4NA 2BY2A 3D39B 3IAPA 3QQ9D 2V2XA 1KENL 4ZXBA 5I6XC 3QIWD 1IAIL 4TPRH 1FGVL 4M3KB 1X5YA 1ZKAA 4P5TC 1KYOK 3FOLA 1OTSC 1IFHH 3DIFA 3EDEA 4PLJC 6FABH 5E4IA 4MHHG 4OZIF 4JQXA 1TCRB 5B3NA 3ZKXB 2I9LA 4JVPA 4M6MH 3Q48A 2J2ZA 4MJ6B 4KUCF 4TNVK 4YAQB 1GZPB 4OD2A 3QA3A 3S88H 2WP3O 1YY9D 5IR1A 1DBKL 2XRAH 3M45A 3HE7D 3QXAB 4WO4D 3BMWA 3NH7H 1I3RA 1LK2A 4JRXD 5J3HC 5LGJA 1CD1A 4KKBC 3WFDH 5EBMA 3MJ9H 4LPXA 5F9WB 2X4OA 1A7QL 1GVIA 5KSVA 3SE8L 1BQHB 2XFXA 1I8IB 3RIAF 1M4KA 4M1GL 4HDIA 1FZJB 4HPOL 3ULVF 2BC4A 2APWA 3ZKND 2DWDB 2JCCA 4UQ3B 5IW3A 2IWGA 1X5AA 4ODUA 4BQ9A 1DEDA 1JF1B 1XEDA 2BHZA 3A67H 4Y16B 3U1SL 2P5WB 4QT5B 5D7KD 2C1OB 1CI5A 2FWOA 4X9HA 4XNYL 2BXYA 4UU9B 2YA0A 3QI9C 1MEXL 4MGXA 4RGNC 4EKXA 4R2GB 5I15H 2SEBB 1T5XA 3GKWL 3JWDH 4RZCA 2ORBL 1KT2B 3RWHA 1FNFA 4PJDA 3T8XA 1T80A 3LB6C 4WI4A 4G7VL 3RDTC 3GRWH 2J8HA 2P7TB 2P8PA 3C2AL 1I1AD 3WNMA 3OKKA 4MB3A 4F7TA 5IF0B 4ZNEE 1QP1A 1E4XI 3E3QC 2J88H 1AP2B 2XA8H 4QRRD 4DQOH 2WANA 4L4VE 4LPUA 3RTQD 4HUVB 2BERA 1T66D 4FA8A 1EAPB 1UWGL 1ZLSH 1M7DA 2FR4A 4KZEL 1SBBA 4YHIB 1HIML 1FJ1B 4EI5D 1UM5H 1NMBL 3BIAX 4ONOA 5EZJB 4NZTL 1T3FA 1ZHLB 3P11H 4DZ8B 5GSVB 3KLDA 1IM9A 1EEZB 4E41E 4NUJB 2Z8WC 2MKWA 4AENB 1KIUA 1JGLH 2HVKA 3CX2A 4LCCB 4DQOL 4JPWH 2EIDA 4D8PA 2P45B 4LEXL 4UAOB 3SJVD 4OZHA 1ZLSL 1A1MB 4WY7L 4EIZC 4AL8H 5CKGA 2R2HA 4U1IB 4M4RA 3MLZL 1ACYL 4FQIL 4KMTL 5C08B 1YUHB 1OAYL 3OHXA 5EB9A 1OQXA 2BNQB 3HFML 2WWKO 3FOLB 2V5TA 5FECB 3WIFB 1SHMA 4LSVH 4GRWH 1IJ9A 3BKYH 3CMGA 5L2KD 1JWMB 1XR8A 3H9YA 1WFNA 4MS8D 1T6WA 3EKCA 3WNLA 5T1DL 1MHPL 3FT4A 2FLRT 3EO1B 4CJ1A 3CVHL 2DDQL 1IGCH 4KI5E 3ME0A 2DM2A 3V5KA 1KCUL 2DKSA 4BYHA 5FO9B 2BOBA 1NUDA 3ARGD 4KGLA 4HSQA 3U46B 1MFEH 4UT7H 4XRCA 1CDIA 4WTZG 3N1PC 4PB9L 1I7RA 2P46B 1U8LB 1P7QA 1WAAF 3FONB 3PGDA 5IROA 5CINH 4LLWA 1AD9B 3DROB 2IPKB 5GGTH 4JHAH 4C4KT 4JY6A 3MROB 1JGVL 3BYTA 1U9KA 5J13B 2XY2A 4XPGL 3GJFK 3O8XD 3PWNA 4JPKH 3QWQB 1WC7A 3HRZA 5GISL