5DQDH

Structure of s55-5 fab in complex with lipid a carbohydrate backbone
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
222
Chain Sequence
EVKLVESGGDLVKPGGSLKLSCAASGFSFSSHGMSWVRQTPDKRLEWVALISRGGSYTYYSDSVKGRFTISRDNAKNTLYLQMSGLRSEDTAIYYCTRHKGLRRGTNAMDYWGQGTSVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lipid A-antibody structures reveal a widely-utilized pocket specific for negatively charged groups derived from unrelated V-genes
rcsb
molecule tags Immune system
molecule keywords S55-5 Fab (IgG1 kappa) light chain
total genus 43
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2015-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dqdH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dqdH01
1LO0L 2DIJA 2DQTH 3FQUB 1A21A 2E3VA 1K3IA 3AXLB 4GG6A 1MWAH 4F7EB 2E6QA 1SEQL 1S7RB 4Q6IA 2YKLL 3T77A 5IB5A 1NEZG 2VYRE 1OF2A 1AGFA 4ONGL 4U3HA 2DLFL 4QNPE 5DRZB 4I18C 4BSWA 3DV6A 4BH7B 5DMIH 3SGJC 4POYA 4ODXB 3TYGL 2FO4B 1TZGL 2F8VA 3OF6D 1QHOA 1RZFL 1TQCC 2BHYA 3O3UN 3PWVB 4D9LL 4QHLB 3DX6A 5IBTL 4KV5E 4K07A 5GGUB 4BFGA 3RBSA 4DVBA 2F58H 4OLEA 1FNEA 3MJ8B 3SBWA 4DFIA 5FHAL 3V6OC 3ZYJA 2XKNA 4UOJA 5D7JC 3ZT7A 3D2UB 3RX5A 4WUUA 2IEPA 5E00B 1QSFA 3D39D 4HULB 1JHTB 2IQ9H 4L8DB 2NY7H 4LSDA 5D1ZD 4LKCA 5IF0B 4AK1A 5E95B 1FFQA 3BUYB 6FABL 1VFBB 4PG2A 3F6LA 5IBLD 1RZ7H 4YDKL 4PJCB 1MIEH 1EV2E 4X8JB 3VWJC 4QLRA 2R8SL 1UYWH 1GIGH 1FFNB 4YDVB 3M1BA 5I76B 4ODVL 4J3SA 5MI0B 3FB8B 1N59B 3MLZH 1R0AL 1S7WB 4OM1L 1SQ2N 2X4QB 2NY3D 5FM4A 4M1DL 2GCYA 3HMWL 4JHZA 1CF8H 5CFHA 1LK2A 1UEMA 4PJ5A 2BNQB 1ZANL 3C6SA 1UM5H 2E9IA 3C09C 1ACYH 32C2A 1W0WA 1NCWL 2H1PL 3VXPA 1UA6L 2EXWC 4KK9D 5JXEC 4P4KC 3IAGC 1FQ9C 4B7LA 4HIHB 5E8NA 4NNYA 3FOLB 1MCLA 3ES6A 4L5FL 4J3OC 5GGTH 4O02L 4TTGA 2HFFB 2IQ9L 4W4OA 4GKZA 1HHJB 3VXQB 4PRPE 3NCYP 4I3RL 5I8EA 4GS7C 1Q1JH 1OAYH 5FYJE 3LPFA 3L5XH 1OAXL 3CVIL 5ILTH 3G6AA 1YQ2A 4QWWC 4C56A 2FJGA 5E9DA 2RB8A 3PG2A 1J0IA 1NC4A 5INDB 2ZCLH 2WQRA 3GSWA 3FMGL 5E9DB 3RQ3A 4GXVH 5K59F 1LE9B 1KTRL 2PW2A 4NHCH 2Y5EA 4FOMA 4PJCA 1ROWA 4LRIC 4J8RB 1CG9A 1O0VA 1IGMH 2YRLA 4FFZL 4UT7L 4Q7DA 5J11B 3P0YL 3HCVA 3ARYA 4TSBL 3BUYA 1NANI 4HK3J 2FX8L 5EWIH 5B39B 5IF0A 2ORBH 5IOPB 3SY0B 4NWUH 4S1SL 2NXZB 2ZG1A 1IARB 1U3ZA 1LO3L 2WMPA 1C5CL 1CDGA 2EEBA 4HKJB 4LHUB 3SQOH 4L29A 4KJYB 4RBPH 5E2UL 3WHXB 2Y06L 2ZUYA 4EZMA 2FEDD 3MXVL 3DXAB 4P9ML 1F6AB 4MJ4A 4PREA 5LXGL 5CHNB 3HE7D 2YWYA 3FTGA 1MVFA 5DGQA 2FHBA 5I73B 4YHKH 1FBIH 2P24A 2YK1H 3GSVB 1UACL 3IDXL 4ZTOL 3GFUA 2B1HH 3S5LA 4G9FA 1QFWH 4B0MM 5GRJL 3VXMD 5FUOH 3U48A 2GK0A 4FQXB 4BSVA 5EZJB 3ZDYE 4M8QB 4OUUB 3QHZL 3VA6A 5J6HB 4TSCL 1MFAH 5T5FL 5BOZG 5HVWA 1B0RB 2X1XR 3X11B 1JZ2A 3TIDA 1BLNB 3ZKQD 1V7NL 4LRIA 3P2TA 4G80B 4IRZL 1QQDA 3ROOB 5JNYB 4LLVB 4L3EB 1INDL 1DDHB 5D7IE 5CZVL 5EORL 4XVSL 1ZOXA 4KDTC 5E0QA 3OKKA 5JHLH 4EQ3A 3GNMH 2Y36H 2BSRB 4OD3H 3SGEI 2H32H 3AAZA 3P0GB 3VXTB 3IF1B 4KUZH 2OMNA 5AYQA 3WS3A 4WCYL 1QLEH 4ZOBA 1CK0H 4PPTA 1PX3A 2NW2A 4P2QA 1HHHB 2WBJC 3QO0B 4JAMB 1UXWB 4XPAH 1X6LA 2Q3AA 3RJQB 3KPMA 1B88A 4ZOAA 2VQ1A 4JFDB 1G7MA 1QO3B 1JNHA 3N1QC 2GT9B 2R1WA 3O6KH 5CIPA 2NY2B 5ERWB 1BOGB 2B1HL 4KDTA 3MRBB 4GAFB 4JHBA 2R39A 4YQXL 3KPRD 2A2QT 1LNUB 3KPSA 5HHOB 5L6YL 3INUH 2ZUUA 3I6GB 2Z4QA 4IM8A 4QEGA 2XFXB 4YIQB 4LNVA 3QI9C 4OD1L 2YBRB 5I1IL 2IANE 1D5BA 5EBLB 5FV2A 1I8KB 3R1GH 5IW1A 2CDGA 3C60B 3LRHA 1A4KA 3KS0J 1EMTL 1VA9A 4X9FA 3STLB 1YY9C 3ARED 1A3LH 1JPTL 5D4QA 3EGSA 3LEVL 2DAVA 4F9LC 5CJXC 1MFBL 1W72B 3L5XL 3LRSB 1E6JL 4ZAKD 3QP3A 4ZYKA 3UTPD 5FYKE 3H9HB 1NBYA 2FLRT 3TT1H 3MGAA 2Z31A 3TH2T 5D72L 3QO1B 1BFTA 4MZ2A 4KHTL 2QADB 3X13B 4Q97A 2PYED 2VLKD 1KTDB 5H37G 3MNZB 1RIVL 2AJXL 3V6ZA 2LAGB 4Z78A 5IV2B 2MQCA 5CSZA 4OV6F 4KHXH 2OTUA 1UM4H 3IJHA 1SJHA 4QGTA 3WS6C 2VLRA 4U1LB 3LKRA 3BRGC 4OFYA 1IC7H 4ZFFB 5C70A 3ZE1E 2BJML 1G1YA 1VFMA 4JANB 1BEYH 2P5WD 5IVZA 5I0DA 1JGLL 3EDJA 5DZNA 5F9AC 4BQBA 1S9XA 4GMTL 4G6MH 1HE7A 4NQED 4RDQF 3GJEB 5IK3B 3X3FL 3TV3L 5I1JH 3CSPA 1VEMA 1C1EL 1U9KA 2ICEB 3I6LD 3C6LC 1KNOB 3K2MC 3DXAE 2L7JA 3ARBB 5JXAL 3QXWA 5IROA 1KACB 1GGBH 2J5LC 2OTWB 3QDJE 1A7OH 1LMKA 2ICES 1T5WA 4PUBH 1OAZH 4O51A 5F89B 3O3EB 2BC4B 4HJGB 4I2XB 5F1OB 1WTLA 3F7PC 1YDPB 2C4FT 1PG7W 1OSZB 3G5ZB 3U4AA 3WHE1 5D7SL 4S0TD 4YK4C 3NGBC 1E4KA 3RZCC 3ZKNC 3O45B 4PY8J 2I26N 2ERJB 2PKDA 2PN5A 3BWUC 3E6HB 2H2SC 3GO1H 1VGKA 4UU9A 4HV8B 5KVGL 4QTIL 3GRWA 3VJ6A 4M9PA 4EJ1C 2BNUA 5ETUA 1UCBL 4N0FA 5I8OH 1I4FB 4NWUL 1OAKL 3UXFA 3UPRA 1FNHA 4ZSOA 4X5WA 1M6OB 4JVWA 4S2SA 4LHJB 1MWAB 1SVCP 4HC1H 2QQKL 3NA4A 1IKFH 3EYQC 2DKMA 3H9HA 2FCBA 3PF2A 4CJ1A 2YD5A 1OGTB 2I60L 3FRUB 5JHLL 3ZKXC 3FOMA 3L5WB 3QJHA 5I15L 4OV5A 5JW4Q 1P4BL 5IB3B 4KY1H 4JRWA 2YA0A 4YHKL 3BT2L 2WK2A 2AERT 1CK0L 4J6RH 1DQJA 3GJFA 3OJMB 3WDHA 2JK5A 3ZTNL 3QULB 1CE1H 2ZOLA 4KXZI 5HDBF 5T1LD 5DD3H 3L95B 2ICWI 3PWLB 3MJ9L 4OJFL 5E2UH 4PLKD 4LP5A 3BSZL 5SWSD 5D5MB 4OGYL 1UG9A 3OKLB 3V4VH 3U6RB 4NNPH 4X9BA 2OL3H 1NCAL 1JHKH 1XGYH 5ETUB 3MJ7B 1TJIL 1VFAB 5F9WC 4TVPH 1G7QB 1K4CA 3VFWB 2RHEA 3E6HA 1P84K 1ZTXL 5DS8A 2EE3A 3QDHA 2CK2A 4M6AA 4ZODA 3UBXA 3C08H 3DV4B 3ZKND 3CGTA 4P4KA 1I9EA 3K8LA 1F42A 1U8KA 2OSLB 1JBJA 5TF1H 1KIPA 5EU6B 1LEGB 3D85A 3NOIA 5F6IB 3KS0H 1I8LA 5F89A 1RFDH 4DZ8A 2CLVB 5MEQA 1V7NH 1A1MB 5KSVB 3SGJA 3TBTA 4G8EA 3EYVB 3O0RL 1DBAH 2BSRA 4PJIB 3MA9L 2AK4A 3RNKB 1X5JA 4J12A 1IAKB 4KTDL 2OX5A 4I3RH 4L3EA 3U36A 4PJ5D 4KKBC 5I17A 3RVWC 4R4BB 3KYKL 5SX4I 2FGWH 5HHXL 2JB5H 4MJID 4Z6AT 4Z5RB 4JANA 1A7QH 3PWNA 3RZCD 4DGVL 1RVFL 2EH8L 2IFFH 3PHOB 2A83A 3MLYL 4KZEH 5BW7C 1R3HB 3UYPA 2VR5A 1YY8B 1MAMH 3HRZB 5IEHB 5D7LE 4ETYA 4N8VA 1OGAA 4ONFH 3MRFB 4NHUB 4WFEE 4L8SB 3HE7A 1RIUH 3C09B 4FQ1H 1WFNA 4ORGA 4OZFH 5IG7B 2FR4B 4EIZC 4N5EC 1OM3H 3O4OB 5BRZD 1T04A 1F2QA 4ODHL 3WSQH 4I8DA 4AEHL 1OP9A 1IC5H 2ZG3A 5C0BA 4LLWA 4XMLH 1XMWA 3SDDA 3RX8A 2AJ3A 3FB7B 4K8RD 3BUTA 3QWRA 4Z8FH 3ARRA 3IS1X 1KG0A 4APQD 4Z7UA 4WIQA 3H3KA 3CVHB 3QQ3B 3FB7A 1A7OL 5I1IH 3ARFC 4KKNA 2BNRA 2DKSA 4OLVH 4LLWB 4P23B 2J6EL 1R3KA 3TYFB 2ZPKH 3ULUE 5TPWL 4XP4H 5K93A 1J8HE 3D18A 3VXRE 2FH8A 1D6VH 4E41B 5BW7A 4L1HA 2OBGA 3MLVL 1TPXC 3KPSB 2OP4H 4XPGL 3UTTE 1MHPL 3ZDZE 3QEUA 4ZUTB 1U8HA 3GRWH 1GSMA 2MPAH 1YY8A 3RNQA 5CSGA 1YEKH 1EGJL 3K7UA 2W0LA 4OCSH 3VH8A 3SJVB 4U1IA 1AO7A 3PWNB 4MXWH 4HKBB 5HDQL 3VFGL 4XTRD 4K23H 2XA3A 3ARFA 4M4RA 3AREA 1I7RB 2YD6A 1ORQA 1MRCH 5JHDA 4LHQB 1U42A 1JFQH 2AV1A 2BOCA 1KC5L 2I60H 4OT1H 1ZLWK 5C0IB 5L8JB 3P77B 2V2XA 2GITB 1CTNA 4JVUA 4Y4KB 3QDGA 1VESA 5KS9F 4HUVB 4QKXB 3OKYA 1QUNA 3GNML 2DQHH 4YXLH 1HSBA 5JW4M 3T4AB 2YA1A 5GGVH 4JQXC 4J6RL 3W39A 4Z8FL 2E7CA 3WKNA 1RI8A 4Y4FC 3T2NH 3VU2A 1ZLUK 5FGSA 2HJFB 4LCUA 4ONHA 2IG2L 1VKXA 3N1GC 1UB6A 1AH1A 1P53A 2H8PB 3KDMA 5TJWK 1C8PA 4GQ9H 4QGYA 3DO3A 1E6OL 2CIIB 5CILH 1BLNA 1WEJH 3KPTA 3KPSE 1G7QA 4HAGA 5TE7H 5IB2A 3ROLB 2APXA 1C08B 5B4MD 4EI5D 5JMOC 4D0BA 3BX7C 4ZAKC 3LN4B 4KKCC 3R06A 2DQEL 5SWSE 1NBVH 2QQKH 3CK0H 2DWEB 3AS1A 1JPSH 1FJ1A 3DGGA 5FUZH 4JHAL 4F9LA 4NM4H 3LKQA 3ARVA 1XGQB 1JNNL 3GIZL 2Q7YA 4HDIB 1RZFH 2DLGA 4Z18A 3TH4T 4Z7UF 5J6GA 4KY1L 2EKJA 1I1FA 1WV7T 3GJFB 3D2UD 4Z7WB 3KPQA 5T3ZL 1NL0H 1T66C 2JJTA 1KEGL 1CE1L 3ZL4L 3EDDA 3HLAB 5ITBH 4TRPH 2E7HA 4P46A 4JY6B 4HJJL 3CU1A 1BF2A 1LGVA 4IRJD 4KI5F 3MLWL 1C12B 4P3WA 2YPLD 3QIBA 4L29B 1UB6B 4M93C 1YEEH 4C56E 1VKXB 3R0NA 2VLLA 5FK9B 1QSEB 4I77L 5E99H 1IAOB 4MS8C 4N90E 4ZS6D 5IESL 2OL3L 3SQOL 2C1OB 1DQDH 1EAPA 2FRGP 1W8NA 3H9ZA 3C8KB 1FL3B 1WT5A 4PRHB 5KG9B 1I4FA 5T3ZD 3V5DA 4G6AC 4BQ6A 1C5DB 3IB4A 2DIBA 1RUPL 4BQ9A 3GBML 1DN2A 3FQXB 4MQ7A 3GMPB 2HJLB 1OTUC 4KHXL 1KPUA 5C08E 1MJUH 5JOPD 1BQHB 1RFDL 1NFIA 3BE1H 2V7HA 1U8NA 3GSRB 5FO8B 3RDTB 4ZUSA 1D5XB 1I7UB 2V9TA 2FX7H 5IW6A 5FYLE 5DLMH 2AVGA 5BCAA 3FQXA 4MQ7B 2BMKA 5KAQG 2PXYA 3HI6H 1X4YA 5DEZA 3C08L 4XMKH 1T20B 1KIQB 2ATKA 1TJGH 1UA6H 1KULA 3GMRB 3GJEA 5GS1A 3BKYL 5KBNC 5DUPL 1A7NL 1IQDA 2CH8A 5C0NC 4NRZB 3UO1L 4ZFOL 4NUGH 4U7SA 3V8CA 5AAWA 1DBAL 3ULVD 5T1DH 5EUOE 1B90A 2O26U 3F8UB 5HPOA 3RTQD 2H41A 4FQCH 4PJBB 2HT4C 5E99L 1C12A 2A77L 2X2YA 3MFFA 4NQEA 5CSZB 5I2IB 2W0PA 5A1AA 3MLRH 1F4HA 1KTKE 3QNXB 5FXCH 2AK1H 2VITA 4QTIH 5T1LA 4N9GB 2V17H 1NDGB 1YN7B 2H9GA 4LCCA 2PYFB 4PRID 3EOTL 4I2XE 5JR1L 5I0ZA 2Y72A 2X4SB 4FQXC 1RAMA 2DS4A 2ZUXA 3FO0H 1KIRA 1A2YB 4FQIH 3OXSA 2QR0B 4ODTL 1KPVB 2KZWA 4O2EB 3EJZD 1JYNA 4MDIB 3V79C 3ULSA 2F5AL 1D7FA 3U83A 2P8LB 3C8DA 4Y89A 3S34L 3WJJA 3WLBA 3MSPA 5DZLA 5D2LE 4TNWK 4IOIB 1NCUA 1ZVYA 4MNHA 4OZGE 3FFCE 4OBSA 2XY1A 3KWWB 3VRIB 1IBGL 2HFGL 4KJQC 2Z4QB 5K9KA 5EOTA 3B9KC 4XXDB 1R24A 4MD5B 5BVPH 2DLIA 1RZGA 1EMTH 1YMME 1KFAH 4WW2A 1EHXA 4GRLB 2VLJD 4K8RL 5BQ7A 2VN4A 3VFTB 4UI2A 1SY6L 5GHWL 1MFDL 1A1MA 2F74A 4QO1A 3T0EC 2X89D 4XBEL 3KPNA 4QHMB 3BH8B 3TIEA 2ITCB 3D85B 1JTTA 2F19L 1NBVL 1N0XL 4JFEA 1GGYA 5EPMB 4Y19A 3NCJH 1A6VH 3IVKB 2YOCA 1JHKL 4JG0H 4NM4L 1X5GA 2ESVE 4RAUB 1N7MH 1TVHB 1WIPA 2EDJA 1WCBA 4KRNA 3LPWA 4PJCE 3SKMA 3BAEH 2G5BA 3VXUE 3CFJB 3OXRB 4RZCB 4Y19B 2YD7A 4ZXBD 1IT9H 2CJUH 1RU9L 3G9AB 1DUYB 4FQIL 5JA9A 3RFZC 5ACZA 5JQ6L 2MHAB 2Z93B 4GW1B 5KTEL 5ELIA 4OIIH 5D1ZC 3VFTA 1GPOH 4M9OA 2IG2H 3BQUD 1UC6A 5I18L 2FBJL 2FX9L 4X4ME 3AC0A 2GSIB 3LS5L 4JZJB 1B2WH 1R24B 4MD5A 3PABB 1CGSH 2VXTL 5BXFB 2HG5A 4HUKB 4WO4D 1S78D 4UV7L 2ZUTA 4CVWA 3QIWB 2DQHL 3VXRD 3H7BA 3C8HA 3DRTA 1CZ8H 2X09A 1F2XK 1SJXA 1P4LA 4HWBH 4OLZL 4W4NA 3IDJA 4APQC 5A16A 4HZLA 4PLJC 2BDNL 3GEWB 3GMOA 5L8KB 4LMQE 5MEND 4L8CA 3EOYG 4FMFA 5JUEL 5E7BA 4IS6A 3ARGA 1KPVA 3QUYB 3V0WL 3STZB 4QRTA 1QFHA 5GS2D 3FO9A 4R97C 1H5BA 1DJSA 2QSVA 5FB8B 3GHBH 1N7ML 4MJIA 5CEYA 3FN3A 2C5DC 4L8SA 2A6DB 5KN5A 4TN9A 3ZHLA 3FQNB 4PJ9D 3IDNA 5D7IB 5DJAB 5GGQH 5BOPA 2OK0L 1AHWC 4MXQC 5EU5A 1TCRB 4YAQA 5EH1A 4PJDA 2ZSWB 3WDIA 1IQDB 2HFEB 3K80A 3QUYD 4LGRB 5FKAB 1QBLH 5HYEA 4RMWA 1OP5H 4NUGL 3DETC 5I15H 5CP3H 4Z95L 5EN2B 5C86A 1QSFE 3HZYA 4IIQC 4WEBL 4ZDHA 1AXSA 4LOUC 1SYSB 2X4OA 4QXWA 1ITBB 4FN0A 3CXDH 3EYUH 1CE6A 3HZKA 2VLRD 4MB4A 4YQXH 1EBAA 3IFOB 4XCEA 4JO1H 3NA9L 1N5AA 2X42A 4UT6L 4NKDB 2YN3A 2ZSWA 2DJ4A 1EBPA 4GXVL 4HUUB 4XNXL 3CZJA 4IRJA 4N0UA 1Y18B 4TYUA 5D6CA 5DS8B 1S7QA 3NFNA 3T3PE 5I8EB 2CRMA 5AEAA 3U4EB 5LGKA 4W6YB 1NKRA 1HHJA 1A7RL 3V4PH 2MTPA 2VDMH 3WIFB 3KLAA 4QF1A 4C54A 2NZIA 5JMRA 1A3LL 1JPTH 2VZVA 3MRGB 3BD5A 2HJKA 4PGBB 2DI7A 1K2DA 3SDXF 2CKBH 4JFQB 4JFYB 1FN4A 4IIQB 4GT7A 2YRZA 3X3GL 5EBWA 4OFDA 5TF1L 4NZUL 4LFHD 4NIKB 5F9JB 2YMXL 3S37X 3IT8D 1EEQA 2EDBA 4QRQA 5JW4N 2B2XH 4H26A 4P46D 3UTZB 2R9HD 3DTXB 1URLA 5D7SH 5GS0H 1G7PA 4UQ3B 3C60A 1I8KA 2APFA 1P5VA 4RAVA 2A9NL 1ZKAA 3RKPA 4P9HH 1AGEB 1T7YA 4ZS7L 1S9WA 1JPSL 3LKOA 4O00A 3QPQD 5DO2C 1T03L 1T4KB 1ZV5A 4PRPB 5GGRA 3B83A 3UPRB 1TDQA 2DWEA 1MQKL 1GZPA 3U0TB 2PCPA 3BPLC 1A6AA 2UZXB 3MR9B 2FJFB 3BIKA 4BK4A 2ADJB 2AXJA 1RZ8A 4ODWB 4QXUH 4UIKL 4EUPH 3TBWB 3LS4H 5DZOA 3WL9B 3KPMB 1QVOA 5DMYA 5DEGB 4JAMA 2HVJA 3LIZH 1BMGA 4RAUA 4XP5H 3CDGA 1OVZA 3F5WB 4CNIB 3AS0A 1TZHA 2OQJA 3P9LA 4J3WA 4XBEH 1NUDA 1MAJA 4ERSH 3HPJB 4JFEB 5F7EL 2W9LA 3FZUC 4NO0A 5CP7B 1DBKL 3BZ4B 1KIUA 4LLYA 5FFLA 2VR9A 5EO1B 3QFDB 5IHUH 3AAZB 4HUVA 4AEIL 3ZE0E 1XCQB 1VGEL 3RVUD 2WIIA 4P2YA 4NSKB 1UCBH 5IVXE 1J1OH 5K9KB 2DQDL 3I50L 1A6ZB 2OXHA 3ROOA 5DXWA 5LGJB 5F7MC 2NX5A 3IGAA 1F58L 5JQ6H 4OI8A 3SGKA 3QWRD 3O3DB 3BESR 4U1LA 5JPNB 2BFVL 4M8QA 2YEZA 3IJHB 1XZ0A 4NKMA 1XAUA 3ULSB 2Y07L 3HTLX 5C0AD 1DUZA 1QZ1A 2CDFA 1FYTA 5DJZB 2IPTH 4ZPTA 3QZWA 3O41A 3CFKB 2GTWB 4DGIH 4LSQH 2GY7B 2DBLH 4XP9H 1VERA 5F96H 4D3CL 1JWMA 2VDRL 4N9GA 4PJ8A 1K9TA 3O3AA 4JM2D 2YSSA 4KRPB 1CR9L 1X9QA 4M6NH 3SE4A 1K8IA 3T3MF 4ZYKB 5EOCJ 4OGYH 3HZMA 4MMZC 5I6XB 4WFHE 3T0WA 4KJYA 4P46C 4TPRH 4JFXA 1Z0NA 2WUBH 3L9RA 2VDPH 1DQML 4LCYA 2CPCA 4PRIB 1BD2E 3AGVA 2Q76B 4ZNEE 3EJYC 1P4IL 2DTML 4PBWD 3RIFF 3OKNA 1GHFH 1Z5LB 2XTJE 4LSVH 5C0EA 1YJDL 3OMZA 3JV0A 3L1OH 4YE4H 5I1LA 1XGUB 1ZVHA 2VLME 3UROR 4NKQB 4ORGB 3D3VD 4ZO8A 4I0CC 4CADB 3N0PB 4AY0A 5F7YC 5CWSA 4XNZC 1G6RL 4PJEB 2B4CC 2J8UB 1WZMA 2YS4A 1LDPH 4ETQB 3AY4A 1LD9A 3O4LE 4PTTB 3C9NA 1MSPA 4WU7A 1FIGL 3O3DA 3OKDB 3WE6B 2OZ4A 1XT5A 1G9MH 4IMLB 5IJKA 1YEIH 1EJOL 3SO3B 4FTVE 3MRLA 4GKNB 1A0QL 4PRAA 4C56B 2CLRA 4WEBH 2V2WB 3MGTA 1WICA 1FYTE 1QKZH 2GJZA 1XCQA 3NABH 1QR4A 2AI0H 4PFEA 3EYVA 4D3CH 4E5XB 2P43B 2P5ED 4CBPA 2JJWA 4HIIB 2BSED 2ZCHH 3LKNB 1CD1B 3IETA 3HMXL 3VXTA 5EORH 5CEZL 1ND0B 3PHQA 2C1OA 3ZMRA 3RVUC 1RZJL 3DVNA 5DTFA 3LVEA 1MRDH 3WYRA 3OKKB 1TQBB 4DZBA 5B4MC 2DYPD 5EU7E 4P2RB 4DKEH 1HINH 1OCWL 1UZ8A 3QIUA 1HH9A 4FQLH 5IJKC 5IVXA 3H3BC 4UOW1 1XGRA 2MWCA 1E27B 4JZJC 2ZWLT 3LEYH 1F3JA 1MH5A 2CO6B 3HUJA 1I3GH 5IB1A 2FATL 2I9LA 2HYMA 3E1F1 3QDMB 1D5MB 5HGAA 2R29H 1INQA 1KCSL 3WO3B 3U4BL 1CCZA 1QSED 3HPLA 3S36L 4XCNB 2YR3A 2VAAA 5F70A 3LH2L 4OCLC 5KTEH 5FKPB 3HG1B 5LGHH 1CLYH 1NAMB 3I2CL 3S4SA 5D1XC 1J05B 1IE5A 4U6TA 3B4NA 3PGFH 4MQXD 5TE4H 1WBYB 3MUGB 4LEOA 4P2OC 4JM2C 1QA9A 3LZFH 1DQJB 5KZCD 4LGSB 4NC1C 1GJIA 2IADA 1S7UA 4MS8D 3T2NL 1FPTH 4CN4A 5IB3A 3DYMA 5D93B 4MNGA 4NO0B 5CP7A 3KAAA 4C4KO 4NKIL 1KLUB 1WWBX 1YEKL 3PWUA 1U91A 1AR2A 5EBWB 1BQSA 4ZUUB 1KXTB 5ICYA 5DDHA 5M94B 3W0WD 4UDUB 3FONA 4U6HA 3LN9A 3VI4F 2CGRH 4TSAL 1H8NA 2D7TL 4JKLA 4EVNA 4QT5A 3P4OB 4D8PA 4WV1C 5HJ3A 1JFQL 1YEHL 1IGIH 1UWEH 2GITA 4XBPB 2ZSVA 4DGYH 3DX8A 3BIBX 4K7PY 4KVCL 4Y4KC 1V8HA 4JFZL 2OL3A 1PFCA 1EH9A 3N1FC 1H8SA 3DV6B 3ZTJH 5DRZA 1UXSA 3QUML 2C3GA 3ARGD 4PB0H 4ODTH 3IFOA 5TFSH 1CE6B 3HZKB 1YUHB 5H94B 4AT6B 3V7AE 4HH9A 2PNDA 4XVSH 1T7ZA 3LQAL 3DURB 1U8HB 4QRQB 1EFXD 4GMTH 5IVXF 1GGCL 2XI9A 3C2AH 3SEPA 4JN2A 2BY2A 3GKWL 8FABB 2HWZL 4XNQB 4MA1C 1BZ7B 4GAGH 3VWJA 4M7KL 2Z0BA 5DC4B 4A6YH 5IMMB 3MZTA 4HHAB 4HC1A 1I8LC 1FZJB 4PTUA 3CLEH 4PBXA 1DQQA 5IVOA 4UUJB 4AMKL 1LDSA 1J1OL 5BO1H 3PWPD 1ZGLB 3SDCB 3UTSD 1HOCA 3Q1SL 4I13B 2A6IA 3RWIA 3ULUF 4N8CH 5BJTB 5D6DA 4TRPL 3H0TB 4H25B 3GO1L 4JY4A 3TA3C 2FZ3B 4GLRI 1SBSH 2ZP0T 4H20L 1PEWA 4LHUD 5D2NC 3R0MA 4JM4H 1WJ3A 3GMNA 4R26L 4XPTH 3KLDA 1CU4L 1F6LL 2CXKA 2Z91B 3JV6A 3BP4A 5F6HJ 3DMMC 1GZQA 1DBJH 3GGWA 1JGDA 1HQ4A 4NQCD 4MA8L 4WW2F 1CL7H 4BM7A 4YC2B 4PY8I 1A02N 1MI5E 4LPUA 4NQDD 3F65A 2LFGA 3QHFL 2LTQC 3VFOB 4O2FA 4PV9B 4HD9A 1GC1L 5CJ8A 1IM3A 2HRLA 3FO1B 5FYKL 1CT8A 2XOTA 2R0KH 1MUJB 1OLLA 2BP3A 3B3IA 1WBZB 1A6PA 1XF5B 4F2MB 1WC7A 4M00A 2IH1A 4MJ6B 4OCYL 3GMQB 3ZTJG 4OQTA 4M03A 3TPUB 4KRPC 3S9DB 2QQNH 2EDOA 3G6JA 4BK5A 4XNMA 5DJXA 5EZOH 3EOTH 1M7IA 1L6ZA 3VFSA 1HXYA 4KROC 4WTWA 5ERWA 4PJ8D 1KIPB 3B5HA 1FP5A 3Q2CA 4R2GB 1K8DB 1OLZA 4U1KB 5GJTH 4HF5H 4V1DA 3CH8A 3V6BR 3ARSA 1U93B 2AI0L 1UXWA 1IGYB 3TJEH 1LK3H 2VQUA 3TWCH 4V1DB 2EXYD 1I1YB 5DD5H 1QFWI 1EO7A 3A6OA 3O2VH 3BEVB 4L8CB 2YPLB 1PQZB 2BNQD 2X1PA 4WO4C 1ZSDA 4HLZH 4HT1H 3EO0B 4X80L 1MI5B 4AIXA 5EO9A 1QRNE 2OJZL 2MFNA 2VDNL 2QSCH 3Q6FB 5C0AA 1NMCB 2X89A 4OI7A 3WFHA 4M7ZC 2R0WL 1KXVC 5DFVC 4NKIH 4JG1L 1FNFA 4TNWF 4RWHA 2XPGB 3D69B 3LEYL 2Y06H 1H3PL 2IWGA 4MGXA 5E24E 5KS9A 5DUBB 5HYJD 5EB9A 3GM0A 3WNNA 5DRXA 4HFWB 4PLKC 5K33A 3W9DB 1WBXB 1MRDL 3REWA 1YQVL 3QUXB 5SWQB 3EZJB 2AKRA 4KJQD 5DI8B 5CUSL 4NZTL 1BP3B 2X4UB 4JRXD 4OV5B 1IC7L 3OXRA 4QHKJ 1RHHB 5EZOL 5HHMB 1JF1B 1P5UA 1ZT1A 2BK8A 3UJIL 1CL7I 1NFDA 4PJDF 1A2YA 3T0ED 4PJAB 3W0WB 3NN8B 2HMID 4R7NB 3ZDYF 3MFGB 4YZFF 4KRPD 4TNVF 4J3TA 1RV6X 1LO5A 4MXVF 4H8WC 3TZVA 1EERB 1NC4D 3LHPH 4CU7A 4PG9A 3QNYB 3CX5K 4H1LG 4ZPVA 3TO2A 3D0VA 1VEPA 5ADPL 5TE6L 1CGSL 2VXTH 3U1SL 3MCLL 4PRIE 1IKNC 1T1ZB 4LPWA 1P7QA 2VTFA 4FXGB 3UCRA 1ACZA 3M07A 2FB4H 2H32A 3CPLB 4JJ5A 3DSNA 4NN7C 4BFBD 2ADFH 4I4WB 4K2UH 3BIAX 3LQMA 4HIEB 4YR6A 4I2XA 3QCUH 2FEEI 4JN2B 2R23B 1MHCA 4J2XA 2ESVA 1H3UA 2QHRH 5D1QB 3QI9A 3MC0A 5F7KC 4K3DH 1A5FH 4QRPD 5IKCB 5B38A 3TESA 4TULH 1OSPH 3MRNA 1U8QA 4C4KT 1DP0A 4GUPA 3GBNH 1SMAA 1NSNL 2NY4D 1GAFL 1CXLA 3D9AH 1JF6A 5ID0B 3QDME 2AGJH 4UNUA 4LDEB 5DD1H 3IDMB 5LQBL 2QJDA 1DN0B 2KPNA 5SV3A 2ADGA 5DD6A 4TUKH 4G9FD 3D3VA 4LRNL 4FFVD 2NXZD 2A9ML 1OPGH 4OZGA 5ACLA 3IFLH 1M05B 5AG9A 3A6CH 1EAPB 3PQYD 4YPJA 4UDUA 5HHVH 2Z31B 2VDOH 2W60A 3BEWA 2HN7A 4HGWA 3LEVH 4NJAL 5FM5M 5F7EH 2B5IB 3M17B 4PJBF 3OPZH 2RCSH 3VXSE 4OFYD 5GS1C 4KMTL 1KF9B 4LBEA 5CJQH 4PJBE 4AEIH 3VXUD 4FQ2H 4Z77A 4U1GC 2V17L 1JTPA 5LBSH 3ARQA 5AZ2H 4JRYB 1FAKT 2UZYB 2PR4H 3W2DL 4PJ7E 1CICC 2DB8A 4HWNA 2E9WA 3S4SB 4NFDA 4P2RE 2AQ2A 5EU3B 5ABDE 2J8UE 3UC0L 2P5WE 3VWKA 5MENE 2FHFA 2UZIL 5ANMA 1INDH 3VG0H 2R1YA 1RJZA 4YDJA 5F88A 1BEYL 2AXHA 4Q9QH 2B1AL 4KTEL 5F7DA 2R2CA 4XP1H 5E4EB 4PJXB 4WCYH 4Y16B 1FPTL 2Q6WB 5EFIB 3V5KA 2NTSP 5C8JB 1QSEA 5ICYB 4Z76B 4XPBH 1FGVH 5HDOA 4HBQA 4PRBB 5L7XL 3QO0A 3TJHC 1JV5B 4P2RA 4K7PX 5CD3B 5EFIA 2HP4A 4XT1C 3H42L 2ZG2A 1HNGA 3MJ8A 3VFPA 1R5IA 4KUCF 2CRYA 4YHLH 3HZVA 3RX7A 1EFXA 5EIVA 3P40A 4QHLA 2BHZA 4TUJA 4M48L 1S7VB 2HTLC 2E7LA 3VXSA 2EXWD 4XP6H 5E6IA 5JXED 4FRWA 2VDML 5D7KE 2B0SL 2WUCL 4KKCD 4OZIA 5KVGH 4BH7A 1V05A 2R9HC 4NQDA 2ID5A 3I9GH 4JM2A 4QOKB 5DJ2B 3VFUB 5AYUH 5E1AB 3NZHH 3CFDA 3VE0A 3GM8A 2GSGB 3WE6A 1IEAA 3U0PB 4Z77B 4WU7B 2VLJB 2AEWA 2F53B 2C4XA 3ARDC 1INEL 5CINL 3DECA 4NO0D 5IB2B 1MJUL 3OR6B 1FHGA 2BHUA 2XXMB 3AS3A 4ZNCD 1HH6B 5HGHA 4KK6D 4F7MB 3QEHB 1HDMB 2IGFH 3MROB 4YZFE 5IVXB 3DVFA 3TBSA 1YYLH 2Y6SC 1KJMA 2VZSA 3DYOA 4XNYH 3L3GA 1F4WL 3OKEB 2NMSA 4HT1L 1A6TA 3SDCD 2M1KA 3KG5A 4WV1A 3T4AA 1CD1A 4ZXBB 4UZGA 4RQQA 1HHGA 2DDQH 2P5WA 1IJ9A 1KCVL 1J18A 1FCGA 3MGOA 3OHXB 1EEZA 1G7LA 1P6FA 4YGVB 3J8F7 1CGVA 4DKDC 3HZMB 5DMKB 1WFUA 2KQNA 1A5FL 3DWTA 4OF6A 3REVB 1DEEB 3LN5A 4P4KD 2R0LH 3BZEB 5C0BB 1MCQA 1NUNB 3WUZA 4GKNA 1R5VB 4PGCB 4OQTH 5GGRY 3Q1SH 3QCVH 3CVHL 1FVCA 4UT7H 4FQQB 5EG6C 3O41B 5IG7A 2FR4A 3BP7B 1A4JB 2DI9A 2FEDC 4O58L 3P30H 4C59B 2JJSC 1K5NA 3HC3L 4ZUTA 1X7QB 4V2BA 2OK0H 4J1UA 1UZ6F 2XWTA 4G8FA 2CRZA 4HMDA 3C5JB 1Q9WB 3LH2H 5EO0B 2N7BA 3MV7E 4XXCC 4IOSD 3KJ6L 2DBJA 4WI3A 4JDVA 4Y2OA 3HFML 5KSAD 1DANT 1H3GA 2NW3A 2ZKHH 3BI9X 3QAZB 1U8OB 4JJ5B 2VNCA 4I0PB 3JXAA 1I1AB 3GUTB 4JDZA 2XTJD 1X3DA 4X99B 4XNYL 4KUZL 1JHLL 1I3UA 3ME0A 4U33A 4Z0XB 3RNKA 1QACA 1JGUH 5DMKA 3VXQA 3TBTB 3V5HB 3CAFA 4F7TB 4PRNB 4KI5D 1QEWB 1AO7E 1X5IA 4WV1B 4O5LH 4J4PC 1I3VA 4ENED 1HHKA 3Q6GL 4Q9RL 3DSFL 3CFIC 2RR3A 2GJ6B 35C8L 2K7QA 5AUMB 2BVTA 1X5YA 3ZKSD 4LDOB 32C2B 2GUOB 1S3KL 3FQRB 2IPKB 4ZUWB 4LSUH 1DL7L 1R3LB 4L4VB 2VDLL 1VPOL 1RUQH 1ED3A 2HH0L 3VFWA 4YHIB 2ADJA 2WSKA 4Z7WE 1J8HA 1B2WL 1TNNA 3QFJB 4GXUN 5EC2A 5DI8A 4NNXB 3G5XB 1A6AB 3NCYS 3LQZA 4LLMB 4P2OD 1U8MA 4YEFA 4IRJC 3KLHD 1QNZL 4HPOL 1CS6A 4J3UA 3R4DA 4JHWL 4S1DC 4HEPG 4JM2B 1ONQB 3L7EB 1CDYA 4QRRE 2ATPA 4QTHB 1NCTA 3ARBC 4RGMB 1V7ML 2IAMA 1NCWH 4JPKL 1H3PH 5FUCC 1EA9C 1WZLA 4MB5A 5J12C 4G5ZL 3QPQC 4S1RH 3BGAA 2XZZA 2G9HA 3DJ9A 3IJSB 4F15C 4ISVB 3SDXA 1BIIB 4ODUB 3MJ6A 4K3GA 3G6JE 1KGCE 5CBEB 3MOAH 2O5XH 3QG7L 2VSDA 4JQVC 5HHMD 4NO2A 3QXUA 2PW1A 3MLRL 4EI6A 1ZT7B 2AQ1A 3GMLA 4PB9H 5E00A 2FH6A 4X6DE 3EJJX 2CQVA 5LG1A 1QG3A 1H5BC 5A2FA 2AJYL 5I6XC 1T7VA 4D2NA 4QF1B 1JPGB 1Q0YH 4X6CF 4XCFL 4Y5VC 1JWSA 1TJHL 3ARGC 2AXGB 3RZCA 4LASH 2NY1C 3G6JB 1KYOK 3Q5TA 3DUSA 3A0OA 5DA4A 4CL7A 5E2JA 1O7SA 5DVKA 3MRIA 3IDYC 4GW4B 4QHNA 2CUMA 4OF7A 4YWGL 4UB0L 5CEZH 5HYJB 3TCLA 2VXSH 1EHAA 5E8OB 1DBKH 3HAEA 4HJGA 1ZXQA 1HINL 1IBGH 1QFUH 5J1AA 3JTTA 5C0FB 5F7NC 4IJ3B 4FQLL 3CDFA 3FQUA 4H26B 4JO4H 1PKOA 2FHCA 4BA8A 5HD8D 2BSTB 3A67L 2NY5L 3QXTA 2WLYA 4Y8DC 3T65B 4AENB 1NGWB 2ED8A 2UVFA 3GSXA 4P4RA 2ICWJ 1PSKL 1EK3A 4P3CL 3BPOC 4RGND 3I75B 2EYSA 3EDKA 1FNGB 1A14L 2NY3C 4GFTB 1UH4A 3EHBD 4IRSD 1MF2H 5DHVH 1PVHA 3C6LD 1UM4L 2UY6A 1M05A 5A2IH 2CUIA 1NFDE 1BAFH 1G7IA 1QTYT 1DVFC 4OFKA 4R4FH 2AGJL 3IDYB 4J4PD 4NM8L 1AQDB 5C08B 3T0VA 4MHHG 4E42B 2GAZB 3RJDA 3UYRL 1ZANH 1TENA 4L3AA 3T1FB 1YMHA 5JIKA 3VMOA 5E94A 3RWCA 4P9HC 1OP5K 2X41A 3MBED 4OIIL 4D9QD 1W72H 1NMCC 1YNTA 5CINH 1VEOA 3T2PA 3JWDC 3STZA 5FHBH 1U8PB 2XA8L 1AO7D 4HPYL 4BFIB 2BC4A 1CICA 1SYVB 4UT9L 3ZKMC 1BGXL 2VXUL 1NMAH 4YHPB 4O02H 2BOBA 4EDWL 4NJAH 5I30H 2LVEA 3EGSB 5EDXA 1MCRA 2BSTA 1T22A 3CVIH 4OQTL 1YC7A 4J3XA 1F4WH 4Y1AA 1A6VL 4OZGF 4ZD3L 4JE4B 4Y19E 4JKPH 2VUYA 1IGIL 1UWEL 5EZIH 1G9NH 3DRTB 3CDCA 1NCNA 3MV11 4AQOA 5DHYB 4PIRF 3UTSB 2DD8L 3TFKD 4C58B 1RZIA 1UGNA 2AQ3A 2VH5L 2AV7A 3I3BA 1CI5A 1F3DH 4YAQB 1BF8A 3MLXH 2EEAA 2RQ8A 3DVGB 2VB5A 5F3HA 1VFUA 1OWRM 5EU4A 4MLSA 5E5MA 5EA0H 4Z7QE 5L9DH 1MLBB 1BOGA 4HLJA 3QG6A 5KSBA 1FVCB 5B3JF 5F7HA 1L0YA 2H2SD 3VG9B 4O4YL 5DJ6A 1IC1A 5E5UB 3ESVF 3UEZA 4NOBA 4OIBA 3OKOB 1S8DB 4DKFL 2HWZH 4BYHA 4NO3B 2BNRD 4DK3A 2WIMA 2EDLA 1KUMA 4M6OL 5FHBL 4PJGE 3VWKD 1N4XH 1UM6L 1BFOB 4XNUH 4KK6C 35C8H 3W9DA 4NT6A 3QEGL 5FECA 3JWDH 3SE8H 4KTDH 4YHLL 5JORB 3MUGA 3EYOA 3BPOB 1ZT4A 2JB6A 3HE6B 1MCDA 4Q6YA 1NUFA 1CVSC 5BXFA 2CKNA 5C1MB 3TA3B 3PE9A 1J0JA 4GMSL 3HMXA 4HG4K 4F8TA 3MA7A 1P6AB 4G6FD 1BWMA 5DSCA 2I07A 4JPIB 4F3FB 4U1JA 4L9LB 4YO0A 5HGBB 2F8XC 3ARFD 5TDNA 5IB1B 3VRLF 1F3JB 1MH5B 2D31B 1T2JA 4B41A 4X7SH 4PRHE 4R3SB 3SGKC 5EA0L 1UZ8B 2O5YH 3HMWH 4R8WL 3D39B 2RAMA 4XMLL 2X9XA 4I9WD 3CMOL 4YXKL 4KRLB 2Z31C 4OD3L 1J8KA 1ND0A 3PHQB 1HXYB 4DFHA 5HYJE 4W4OC 3QG7H 3EDFA 1F45A 3O4LA 2F5BH 3VFPB 4EDXA 3PXHA 3TO4B 2RFXA 3Q5OA 5BQ7B 2R2EA 2XNAB 2EDWA 2ICWB 3QPXH 3M45A 5SWZD 2FO1A 4QCIB 4KI5E 2ZPKL 5I8CB 1IAMA 1WC7B 3S88H 4Y4HA 4LLVA 4WW2C 3V5KB 5C8JA 5K9QG 3MV7A 4UIMA 2YD2A 1FL5B 3U30B 1JK8B 3DGCR 4XVTH 4MNHB 2IANB 3V2AR 3KYNA 3B9EA 2R69H 5CZXD 3VXME 1LK3L 2OJEB 4OUUA 1PG7H 4RMTA 1HYSD 1AGBB 3T2QA 3WSQL 4FQHB 3JWOH 4ZUVB 1JIBA 2V2TA 1A4JA 1NQBA 2IC2A 4P2CG 1P7QD 4KQ4H 1BZ9A 1CFSA 3UTTB 3ZHKA 3U79A 1Z9OA 4FFZH 5IQ9A 2UWEE 4HEME 2E8ZA 2BX5A 2YPVH 2XA8H 4HPYH 4X6EA 4XPHH 4LCYB 5I1GL 3MRPB 1Q0XL 1G0XA 1HOCB 1A7NH 2IMMA 2C7UA 1ES0B 5FCUL 5B8CA 1QLFB 5FIEA 3IKCA 2EDDA 1LO4L 4NQEB 2P5EE 1LO3H 4RMVA 4TTDC 1E6JH 2G2RA 4MX7A 3RI5F 3MPCA 4F37F 5F8QC 3P4NA 4XP1L 3QH3B 1AGDB 1LEKA 4Y0GA 3U30C 4Y4FB 3O3AB 5LCVH 5IP4A 3LV3B 1RUKL 4OZ4A 1QKZL 2EKSA 1KPRB 4LDLB 5FCSH 1EUTA 2VDQH 4Y4FA 4N0RA 1Z3GH 3P4NB 5DJZA 4NRXA 3NH7H 1DQTA 2NPLX 4PLNC 5GZOC 5M95B 1G9EA 5F97E 1T1XA 3ULUH 3BWAA 4RDQG 2PXYB 4DKEL 4G6KH 4X6DF 4JFOA 4RGMC 4WFFE 1JPFB 4M48H 1IGML 2VLJA 3QWOA 4F58H 5FYJH 5D7LB 4WI7A 3FB8A 1OARH 4V2CB 4PBVC 2P4AB 4AEEA 4HPOH 1LP9B 4NM8H 5I30L 3BPCA 3G04A 4ERSL 2P49B 3NZHL 1C1EH 5B39G 1BX2A 2I9TB 5DQDL 3H9SD 3QI9B 2H2PC 2QKIB 4K7FA 2AABH 4WVRA 3AB0B 5T3XD 5HGDA 3QXAB 1KN2H 43C9B 2E9BA 1VADA 1KV3A 1T83A 1JPGA 3MLWH 3ROLA 5E6ID 1CD9B 4JLRA 3O0RH 4ZAKA 3PIQB 1DBBH 1ZHBB 1QRNB 2DQGL 1KB5B 4JGJA 5FA4A 4C83A 5FO7B 1UWGH 1W0WB 1N0XH 5AWNH 3RWGB 4I18B 3OF6A 4F9PC 4HKZA 5DEGA 4OZIF 1T66D 1RUAL 1CXEA 2HTLD 1D5IL 4E9LA 4MNGB 3TO4A 2CSPA 3MBEA 5C71A 5I1HL 1I8MA 2EIEA 3VXRA 1AR1C 3FHQA 4NN7B 4DEPC 1ZA3B 4BUHA 3QDGB 1GZPB 3RIFK 4OKDA 4LCIL 4IRSC 4PJAA 4HWBA 3WDJA 2XICA 2ED7A 3LKSA 1JGVL 5GRXG 3TN0A 1FIGH 1RULH 4IHOB 1ZLUH 4JZOB 2FIRT 5FOJA 1X5XA 3DGGB 2FX7L 2HRPL 3O2VL 3WUWG 4K7PH 2J3SA 5GQBA 3SHSA 5MEOA 5FGCE 3R06B 4YBQD 5SWZB 4L1DA 3RWDA 4X6CA 2MOVA 1C16B 3DI2B 4GKSA 4I77H 3FT2B 4Y7MA 1L7TL 4LBEB 2J7LA 4XX1E 1ZLWH 5CLWA 3LCYA 4URTB 2V7NA 4K71C 4ZFGL 2GUOA 2F9BT 4H5SA 4IIQA 1MVUB 4HAFA 5JXEA 4G8GD 5IFJA 3CLEL 4DZBB 5JORA 4XNUL 4UV4H 2IPUG 1LQSR 5HD8C 2XZQL 4HS6A 3WXVH 3N1MC 1FE8H 1JHLH 4ODSH 4Y5YC 2C3XA 3IFNL 3RWHA 1FLRL 4M7LL 3UC0H 3GSNL 3GKWH 3C5ZB 2HKFH 1IM9B 1ZTXH 1S8DA 1G9NC 3GB7B 1FAIL 2ORBL 4U7MA 1A1NB 1OTSC 4ZO9A 5FGCB 1EDQA 2CLRB 1I7RA 1PY9A 5IHBA 3MRRB 1P7HL 1FZOA 5J56B 1JF5A 1NJ9B 2PO6D 1J11A 1M1SA 1RUQL 2HH0H 3BQUA 4HIXL 3BVNA 4PJEA 4KKLC 5CGYD 4OLYL 4XGZA 4UAOB 5FOBB 2FDBP 4K9EH 1D6EB 1IGTA 1XGUA 4AL8H 1N5YL 3P4MA 5DRWA 5CBAA 5GGVL 3W81A 4U1MA 1IEHA 1DANU 2XQYK 1KCVH 1R3KB 1WIUA 4DGVH 4PRIA 4JPKH 2BVUA 3CFBA 1DVFB 3LN5B 2EYTA 3VFRB 4XGZB 5FOBA 3I9GL 2XRAL 1Z9LA 2HLFD 2XNAA 4KK5D 4KQ3H 1HHIB 2A6DA 3PV7A 1S9YA 1T3FA 1IAIM 3T4YA 3JV6B 3NCJL 4NYLB 3KXFE 1NCDH 3NIGF 3GBNL 4LLDB 2NXYC 3K46A 5C9JA 1KLGA 3JTSA 2AS5M 1NKOA 2X5PA 1FRGL 5IJVB 4E41D 1G7JB 3P30L 3U0WH 3O4LD 5ACMA 1FZMA 1ZMYA 3DPBA 4X7CC 4FQPA 5GIRB 2VWEC 5SV4A 4BSJA 2VZ3A 1LO2L 2BVEA 1NLDL 4LF3B 3S7GA 1X4ZA 1ZGLA 5D96B 1I1CA 1L7IL 2EDXA 2P8PB 4XC3H 4LVOC 3X3GH 4YHZH 1JZ3A 3ARBD 3G5VA 1MCSA 4OGXL 3E3QE 5I1DB 1OTSD 1OB1A 2EIBA 2JCCB 4L5FH 1JUFA 3MUY1 3IXAB 5KS9B 3IAPA 1PDKA 3KYMA 2X4TA 2KH2B 5ALCH 5TQ0H 1YEFL 1A9BB 5HYFA 2I25N 4DUWA 5FV1L 1A3RH 5C0AB 4JFHE 4DUXA 4MNQD 3PUCA 1MPAH 2D9QB 3SCMD 4PJHA 4CMHB 2H26B 4DVRH 3GMMA 4GRWE 3GSNA 3UTTD 3WFEL 2VXQL 4PLOB 2VE6A 1AE6H 4U3CA 4PJ7F 5L6YH 4CW1A 4Z0BL 3MOQA 4CVXA 3MV9E 1JV5A 3UDWA 1FVEB 3MV7D 2YC1A 4P49A 2DQFB 3MRIB 2X7LB 1A7PL 4NZTH 5ESVA 4QRSA 2XWBB 2VIRA 3KXFA 5H2BB 5A40E 3BISA 2NY1B 1GOFA 5I71B 1M71B 3IVKA 3OTTA 5JTWA 3OAZK 5B21A 3MJ7A 1GGUA 2XZCH 1TZGH 3MR9A 4TUOA 2Q86B 3B8SA 4S1SH 1KJ2A 3FCTA 1U8JB 3C5ZD 4X4YA 1G0DA 4UV7H 4KTEH 3FB6A 3GSOB 3INUL 1X6NA 4GRLA 1KBGH 4CDGC 4LP4A 5DHVA 4HQQH 3EFFB 3MBXH 2JCCE 1VFOA 5EU6D 1S7TB 4FZ8H 1IQWH 1K6QL 3CJJA 3QIWD 4MXVE 3BP6A 4PGEA 4PR5B 1NCBL 2PW1B 3HA0A 4KJPD 4HUNB 1RZKC 3RWJA 1NLBL 4OF8A 1ZGLP 1RIVH 2AJXH 4HFUH 3BSZH 4EXPX 3WXVL 3B9KA 1CXFA 2H26A 1FBIL 1PYWB 4FTVB 1VADB 4LCWB 2ZNWA 3KPSD 2VDKH 4NN6B 4NQTA 2CMRH 1F00I 1FORH 4LEOB 2FSEB 4HK0A 4QRPB 4ZQKB 4XP6L 3WJLC 1MPAL 2CXGA 4JFYA 3MLPA 1U8PA 1XIWB 4Z7NF 3TYGH 3EFFA 3AMLA 3TV3H 2R15A 1OAUL 1UZ6E 4BZ2L 1FL6B 2IH3A 5EC1A 4MD4A 1DBJL 3GKZA 3RWIB 3QDJA 1MRFL 4LVOB 1A7PH 1DFBH 5D2NA 2BNUB 4JFDE 5DJDA 5DQ9A 1IGCL 1HQRB 4HWZA 4ZFGH 3FN9A 3NFNB 4ODHH 3QA3A 5H2BA 4M5YH 3HE6D 2IGFL 2IPKA 3MA9H 4ZUWA 2YD9A 5IMMA 1REIA 4JFFA 2R2BA 4MD4B 3C5SA 4NRZA 1XGTB 2L4OA 4G6AD 2PYEA 2VLKA 2C9AA 5DJYB 5F1KC 3RWFB 3GI8L 1OSZA 5IBUG 1NAMH 1JRHH 2HFGH 3V8OA 3E8UL 3JV4B 2IBBA 4PRNA 3C6LA 2FSEA 2Z8VC 3TFKC 5DMGD 4RFNC 1YPZB 2D0HA 1A9BA 4U6XA 1B0GA 2XN9E 4NCC1 4R2GC 1T1WA 2EDFA 1I7ZA 1ULVA 2WV3A 4XRCB 1I7UA 1A4KB 5CJOL 1U8OA 4DWHA 2I24N 3RDTA 1UVQB 2D4DA 4LASL 1LILA 4XX1G 4M43H 1QBMH 1B0WA 3HI5H 1FLRH 3V6FA 1A7RH 2XFXA 1ZE3C 4X5XA 1KOAA 2E5EA 4G8FB 4KC3B 4WO4B 4ORZC 2J8UA 1FFOA 1X5FA 3ECBA 1N5YH 5KN5B 2W0FB 2G75A 1BBJA 1W72L 4U0QB 4UIKH 4IJ3C 4PJFA 1BOYA 5GJSH 2A1WL 4GS7B 2IANA 2XTJB 1CFVH 3LSOA 1MI5D 2QSQA 4NQDE 2A6JA 4BKLB 5F1IB 4ELKA 1S7XB 5FK9A 3K1DA 1OOAA 1E4XL 2DQIL 4RFNB 1BVLA 3V0VB 5I8CA 3GBLA 3PWPA 4XZUB 2NW2B 3QBTB 4XHJC 4NQVA 1NAML 3QCTL 3SDXB 3ZO0A 3WIHL 3UTQB 3SDAB 2EYTB 5A2LH 5D2LA 2GHWB 3PJSA 4PRPD 5H37H 1SJEB 5IW1B 2ADIA 1U3HB 3KPQB 4FNLL 3PWPE 4E0RB 3EKCA 1RPQA 3IAQA 4G8IB 2MNUA 1MVUA 43CAB 5TGBB 2HG5B 3D69A 3QEQD 2NY4C 4NCC2 3WJLA 1NAMA 3BYYA 5IMOA 1OAQH 3O11B 5HGHB 4LGPB 1EFQA 1XR8B 3NACL 1JGVH 4KMQA 5FYLH 3ARWA 5ICXB 3LN4A 5SWZA 3MYZA 1DUYA 1FZKA 3KPRE 4H88L 2EDQA 5ANME 3HUJB 5DO2D 4XBGB 2NNAB 3SDAD 4WFGE 3S96A 1ZEAH 5J57B 3MODH 3UZEA 4JCLA 1A6ZA 3FQRA 1J1PH 3OJVC 4MA8H 4DAGL 3SGDI 3P73A 2JB6B 1KTLB 2V5TA 3FQTB 1CGXA 4GQPH 4M6NL 5I1GH 3U7YH 1BREA 5CZVH 3ZZ1A 3U2SB 2FIKB 3TIEB 5C0JB 3HZVB 4PY7B 1NBQA 5FYKH 5MHSE 4KV5F 2ZUSA 4XMPH 3HPJA 1OSPL 2K1MA 1FO0L 5L88L 3WIHH 1BVLB 3V0VA 5DHXB 4FMKA 3O2WH 2V2WA 4HS8H 4ZFOA 4JFDD 4M1DH 1Y0LB 3MRLB 1RD6A 2L0DA 5I8OL 1V3MA 4WFED 3X11A 1RU9H 4X9GA 1K85A 4YNYA 3WIIL 2GQHA 3VRJA 43C9A 4HF5L 3U7WL 2BNRE 3RNQB 3KJ6H 1X7QA 1RJZB 5C09D 2P8LA 2A6KA 4ZMAT 5LWYH 4RBPK 3BE1L 4DN3H 1KJ2H 2N7AA 4PJCF 1TVBB 3RRQA 5JOFA 4NZRH 1ZVSB 5JIPA 4E41A 4D0DB 1FNLA 3C2SA 3QEGH 4MNQA 4X5XB 2EE2A 3TPKA 5CZXC 1ZLSL 4RGOH 3QZWG 4X80H 3BP5B 3MLVH 3EOAB 4GXUM 1XF4A 5H8DA 1P1ZB 4OCWL 4GAGL 4Y1AB 1AC0A 3SJVE 1RSFA 2NR6D 1FO0B 1P4IH 3BKYH 3FO2A 4PJEF 3STBA 3V6OA 4FZ8L 4UUJA 4WI5A 3O8XC 5F9JA 1B6DA 3DVIA 3TH3T 4ZTPH 1NC2B 2NY0C 2GK2A 1MY7A 1CICB 1SYVA 2YSSB 2D7NA 1JWMB 1QRNA 1NCAH 3MRCB 3CIQA 2ZZUT 4FFYL 4QY8B 1XGTA 3UTPE 3V7AG 3RL2B 3DIFB 1BQLH 3VFMA 3CLFL 2UZIH 4ZPTB 4WW1A 1NC2A 9CGTA 3QT2A 3L3JB 4APQA 1GOHA 4HS3B 3C60C 4N8VB 4QNPF 3VGDA 4G43B 2YD3A 5E2VH 2J8OA 1AY1H 5IM7B 1I7TA 4XMKL 5DC0A 3OB0H 1YUHA 3WNMA 3AROA 3ULVE 1N59A 3GSRA 4Z7VA 5MEOB 2VABA 3VE0B 1YECL 1VCAA 5E6YA 1H15A 1MRFH 2P7TB 5HHOD 4DN3L 4H1LA 3QQNA 5I9QC 5C6TH 3LKSB 5I17B 5KOVC 1BIHA 1EVUA 3GSXB 2E7MA 3DX8B 3X3FH 3BRFA 1AJ7L 3PL6C 3CSBA 4APQB 4RMUA 5EOCH 3ETBF 4NNYB 5FUZL 1M7DB 3VWJD 5JXAH 3OBAA 2X10A 3RP1A 4QY8A 1Y6MR 2B0SH 2WUCH 3QDJD 3S5LG 1W0YT 4KJPC 3MV7B 1SY6H 1CIUA 1OT1A 4R96B 4Z76A 4XAKD 4UV4L 2AW2A 2VL4A 2X4RA 5FDWB 2ICWA 3V0AC 1L9MA 3D0LB 4P46B 2EIZB 4Z7QF 4IRZH 3O8XD 3ALWA 3N06B 1P1ZA 3QIBC 4PY7A 4JO2H 2NY5C 4OCRH 4PG9B 4JHAH 4KVCH 1KEMH 3DX6B 4FP8L 1V5JA 4YDLC 5DQJA 3QEQE 3WO4C 5J9PB 1QA9B 2MJWA 1I1FB 4Z7WA 5MERA 3MV8E 3FO9B 1WZ1L 4O4YH 4NWTH 4NC2B 1NGYA 4LAQL 1I9JL 1OHQA 5GSRA 3OL2A 2ARJA 2XWJA 2ZUQC 1TJHH 3BJLA 4X8JA 4JO4L 3S96B 4XI5C 4W6WB 2P1YA 4RAVB 4WHTA 5T3XL 2C3VB 4K94H 5F8RC 4Q6IB 2VDRH 4CVUA 5TDNB 3D39E 5LAXB 3UJTH 4ISVA 4BZ1H 3FT4A 5BZDA 4YO0B 3GHEL 1KT2A 1DLHA 4M61B 4LLQB 1MJ7L 4U6YB 4Y5XA 3CH1B 3BT2H 4KKAC 3V6OE 4JFFD 4L8DA 3BDXA 1QFUL 1NMBL 3NACH 4YBLC 3K8MA 2HN7B 4OZHF 1ONQA 4PP2A 4XAWL 1HN1A 2R2EB 1F6FB 3GSUA 3I84A 1OB1B 4IDJH 5D2LB 5BMFH 1FNSL 2FL5B 4U3XA 1MLCB 1IGJB 3V52L 2YPLA 3HHRB 1A14H 4X7EC 3PWVA 1YEJL 4XB7A 5D96C 3U4EA 1Q94B 2D7MA 2W9DL 3UTSE 1XGYL 1IGFH 3Q3GB 4HUUA 1I8IB 3K4ZA 1V3JA 4OGZA 4OZFA 2EO1A 2FX8H 3QNZB 5FYKU 1EO5A 4FP8H 3RL1B 3HRPA 1AR1D 4DOHE 5IB5B 1HHKB 1OW0C 1AO7B 1WWWX 2PETA 4X9IA 1A0QH 5C7XH 1G7HB 5F7UA 3WD5L 2V2TB 5ICXA 4U0RB 4KROD 1AXSB 2CKBA 3O2WL 4HS8L 4XPBL 4L3ED 4YHNB 5J1SC 1KNOA 2DD8H 5IMOB 4P9MH 4S1RL 3Q6GH 4Q9RH 3GK8L 5E8PB 5JUEH 1MEXH 4RA0C 5E6ZA 4N0CC 3DX9A 3WCYA 3VRIA 3UTSA 4EXKA 3RKDD 1Z9MA 5KVEH 3IRZA 3H9SE 3GI9L 1IAIH 3HI1B 4WI9A 4P23A 4FABL 3HG1D 4OTXH 3CPLA 2F5AH 4H8WH 3BKML 4U6XB 1RULL 4J1UB 1HCFX 1DBML 1G9NL 4OZHE 2VZ1A 3JWNC 2RFXB 1GZQB 4X6CE 3ET9F 1M7XA 3IRPX 5T5NF 3BPLB 3F6IA 3OKOA 4PYGA 4O2EA 3QUKA 4RMSA 1RZKL 3RGVB 5F3BB 1LO5B 2DJSA 3ESUF 4LPVA 4MVBD 4N5UA 1L7TH 3E2HB 2Z8RA 4BKLA 3RWFA 3SDDD 1PAMA 4OCWH 5JZ7C 1GGBL 1YN7A 2H9GB 4LCCB 3SE4C 1FLTX 2FWOA 4RNRA 4CU6A 3AS2A 1NBYB 1MCOH 3WBDA 1GGIH 1BBDL 1W8OA 2EIDA 1I75A 4LEXL 2UWEF 2X6MA 1P9MA 1MCPL 3NIFE 3VXOB 5IESH 3NZ8A 1CDJA 4L9LA 3DBXA 1XR9A 4HH8A 3ILQC 2CDGB 2NY6D 3MOBH 2HKFL 3FAXA 1JTOA 3QUMA 3L6FB 4L4JA 4XNQA 4F80A 2EYSB 4X4MA 4YX2L 1DQLH 4XRCA 3QXDA 4QOKD 5GGTL 2V7NB 4QRPA 4ZQKA 4DCQB 4P5MB 4P2QE 4NQUA 1LHZA 3L3HB 4M1CC 1B3JA 1IVLA 4P9HL 2BMKB 2BOBB 4FTVA 4GG6F 4AH2B 1FORL 5E08L 2FBJH 3OGCB 4G6JL 1LEGA 2P44B 3BEVA 4MA1B 4JEGB 1UWXH 5GGTA 2PYEB 2VLKB 1BQHA 3VFNA 1ETZA 1AKJB 5L2JA 2F54D 3MCG1 3U9PH 4JZNB 4BZ2H 2OJZH 4JRYE 5E6IB 3D5OF 1F90H 2GAZA 4OF3A 1JP5A 3BOVA 4U1KA 4MWFA 3WS6A 5L7XH 3O9WA 4KAQL 3R1GL 4OCXH 3EFDH 4KMLB 3VXRB 2FL5A 4OKVB 2H3NA 2MKLC 1E4KC 4ELMA 5EU4B 4XCYA 3IKKA 2EDTA 3RY5A 5CGTA 2FB4L 3BD4A 1UACH 2CIKA 3O2DH 1IAOA 1MCPH 3WMSA 4WTZA 1UQSB 2AV7B 1OY3B 2F5BL 1J8HD 4WWKC 4XB8A 5T33L 5IROC 2FYYB 1BQUA 4XVUD 5FA3B 5GGSY 1BIIA 1PYWA 5AYUL 2VZOA 4GBXC 4PJHB 5T1KD 3ZHDA 4WTZG 1RIHH 2FYYA 1O7VA 3QUZA 3RPIA 4CMMA 3SPVB 3UJTL 4BZ1L 2LU3A 3GSQA 4M62L 3HPLB 1G6RA 4K7PL 1NDGA 2ZCKL 2Z8SA 5MENA 5DJ0A 4KGLA 4Q58C 3RWCB 2WLZA 4L3CB 3QNXA 3IYLW 5JDJA 3CFCH 2ADFL 1EIBA 4PJAF 4G43A 4E42A 2OZ4L 3MRKA 1NMBH 5DVOA 1IQWL 1K6QH 1OPGL 5C3LD 1AHWA 4ALAL 1MIMH 4HJJH 1CLZL 4R96A 4K8RH 3GMLB 4Y5VA 1E6OH 1A6UL 3OKMB 4CVXB 4LARL 1E4XH 2DQIH 1YDPA 2R56H 2LABA 4R97B 3VCLB 2VISA 3OPZL 1QEWA 1HSBB 2B7DT 1S9YB 4FFVC 5GSVA 4MX7B 1FFRA 3VXSD 1CFTA 2APVA 3DHMA 1RUKH 1U2HA 1J0ZA 2J8UF 2ENYA 5JHDD 1CG9B 3PNWB 1U8LA 1FO0A 2E6JA 2IAND 4NGHL 3PV6A 3F7VA 1D5XA 4U1SB 2DI8A 3GSWB 3RA7H 5C0CB 1DE4A 3QUMB 4JDVB 1YMMD 4X4ZA 3I3EA 5DD0L 5GRUL 3RUGB 1IGCH 1KPUB 4KK8D 2JF1A 3CXHJ 1U8QB 4CGTA 2DBLL 2OL3B 4K3HA 1BBDH 5J3HD 4U6VH 5CIPH 1MCBA 3FZUD 2YD8A 3VXNB 2NY0B 2DN7A 4L4VA 3L3JA 3BQUB 3VA2C 5CLTA 5D2LF 3U46A 2QSCL 1NGPL 1MHPH 5HTSA 2QQQA 5F6IC 4EUPB 5IB4B 2BDNH 1W0VA 4EOWL 4L4TB 2D3VA 2H32B 3REVA 4LVNB 3L3OA 3T0EB 1A6UH 1S3KH 4LVHC 5CGMA 2AJZB 4HUWB 3VDBA 5I1EL 1HHGB 1DVFA 3SDDB 5GZOD 3CZFB 2M26A 4HBCH 2DJUA 3PDDA 2BJMH 2NY4B 4G6JH 4LMQI 3QXVA 1GXEA 1S5IH 3O2DA 2JJVA 3NN8A 4M5YL 2N1KA 1KJMB 1J05A 4XVUC 1U95A 2NTFA 3I6GA 3OX8B 3CMOH 4OBRA 1LO2H 5EUOB 2C1PB 1ZLVH 3LAFA 2CKBB 1FJ1B 3HE7C 3K1KC 3EJYD 3ZSTA 1D9KB 3ARDB 4XC1L 2YEZB 1KN4H 5KSAA 4HUXB 3CFEB 4QXUL 2WBJD 1VGEH 4JPWL 7CGTA 3ARDA 5C6PB 1JZ7A 4JFDA 4Z5RA 3FFDA 4LSPH 4I48A 2YD1A 1R5VA 4OZIB 3E2HC 1WCBB 3K0WA 3PV6B 1F4XL 2DMKA 4LVHB 3NFSH 4WY7L 3K8KA 5I8KH 1UKQA 3W39B 3KPRB 3UTQA 1Q9KA 5EU6E 5K9JH 1J12A 3H7LA 4E5XA 3DUHA 1AE6L 1A6TB 5E1HB 1UYWL 1NCCH 4Z0BH 3L3OB 4YUEL 4G6KL 3I02A 1DDHA 4UILH 3SDCC 3THMH 4M02A 3HAEH 1C5BL 5I19H 5FO7A 2A0LD 4K55A 1AFVH 1EPFA 4EBQL 1AGFB 3BN3B 3BW9A 5KJRL 4U4BA 3RUGF 1CFNA 1S7RA 4KDVA 4GKSB 1MLBA 4OGAD 4QHKI 3FT4B 4HUXA 3BMVA 5LQBH 3K74B 3PDOA 4NQXA 5D8JH 1G6RB 3OZ9L 4LSTL 4U31A 4WHTB 1JVKA 2AEQH 4OSUH 1L0XA 4Y8AA 4WO4A 2C1PA 4QOKA 4JZOA 4NQDB 1KN4L 1J0YA 2IAMD 1YECH 2QR0A 4G9FB 3ZDXE 5I1LB 1QLRA 5D70L 2R4RH 2X4SA 2MCG1 5C0CA 3NH7L 3GBMH 4PGCA 4F15B 2XKUA 2NY0D 1HNFA 1CGWA 1I85C 2FNBA 4QOKE 4PG2C 1ZK9A 1F8TL 1AD9B 3HKFA 3NFSL 2WWKO 5DMJB 3LB6D 1VSCA 5DMIL 3MFFB 3L5WA 3I6KA 4M7KH 3PWPB 3FN0L 5GSVB 4RQQB 3NIFF 1KJVA 1FDLL 3LRGA 4P5TA 4PJ8B 4H88H 3GMNB 1KPRA 5IFAH 4RGNB 3P4LA 4B7IA 4EUPA 3MRQA 4R0LA 4Y5VB 4JLRB 4ZAKB 5B39A 1FYHB 4M3JA 2X4NA 4WWKB 3WIFA 4JRYD 2CDFB 1QRKA 4X9HA 3HE7B 5BRZE 2O93L 4FTVD 2MQ3A 1N3NB 4YHML 3U0WL 4MJIE 5IEKA 2J8HA 1G9ML 4N1CA 2F53A 2H6PA 1EZVY 2C26A 5LKNA 3KPOA 4MJ5B 2D03H 2N4IA 1ZA6B 4NUJB 2B1AH 2V5RA 4JFPB 2A77H 3GSQB 3EUUA 1QSZA 1H15B 1VHPA 4Z7OF 3OGCA 2Z35B 4AZ8A 3ZYOA 2DQCH 4MAYB 3ALXA 1SYSA 1FVDA 4P4RB 1T1WB 1JI2A 5DURB 4YX2H 4P5MA 2OR7A 2VXVH 4AEFA 1P2CA 5I1EH 5DK2A 2DMCA 3RA7L 4LARH 4JB9L 5C0FA 1FL3A 1CXHA 2O5XL 5DJCB 3DIFA 1OGAD 3QUXC 5C2BH 1R3IL 3BZ4A 1NUGA 1JRHI 2DQEH 3EYSL 4Z9KB 2XTJC 3RI5K 3RWJB 4F37K 2R69L 3AM8C 4I4WA 3S34H 3WFCH 3L3KB 2XYCA 4G6FB 4GAJL 1U92A 2CUHA 5FUOL 1N2RA 1S7TA 4YBHA 1E4WL 2ED9A 5TQ2L 4GRWB 4KZEL 3BDBA 5C0CE 3I6KB 3D3VB 1RZ8B 4ODWA 5T1KA 4D9LH 1UJTA 3TCXA 4NC0B 1KB5H 4OCMC 1Q9LA 4L3CA 4LOUD 4WUKL 1JWUB 3DNKA 1JZ5A 2FECL 1CLYL 1WSST 3LD8B 3MO1A 4R7NA 5SX5H 2QADC 2VIRB 3HNVH 3L5HA 4G5ZH 4DW2H 5GGSB 2YUXA 3H3PL 4HDIA 3LKOB 2Q7YB 1S78C 4YHYC 1AJ7H 5J7CC 4TSAH 2CDEA 1RHHA 1ORSA 3AM8A 4HK0B 2D7TH 5EIQA 2ESVB 3HC0A 3QISA 1RK1B 3WHE0 3G08A 4S1DD 5HHXH 5T33H 3B5GA 4WGVB 3W0WE 1JPST 4U7KA 3IDJB 3F7RA 3HI1A 3MNVB 2AXFB 1FL5A 2Y1VA 5GS0L 3H6JA 3TT3L 5D1QC 2IAMB 4RGNE 1YPZF 4PRDB 1G6RH 1QOKA 4M4PA 4R90L 1PZ5B 2OP4L 4XPGH 1CLOH 1ZS8A 2VAAB 3TJEL 4BQCA 4DVBB 3QNYA 3IU4L 3FCTB 1YNKL 1S5IL 5ECJE 3VD9A 1CGYA 3BPNC 2FEEL 2V2XB 5JLZB 4MCZA 5CGYC 5D8JL 4HV8A 4LAQH 1UT9A 3FB5B 5F71A 4O2CA 12E8H 2XWBA 1YC8A 2YRPA 2AABL 2JELH 1JF1A 2DMBA 5C6WH 4WUKH 1PLGL 3PQYB 1T5XA 3RTQC 2D31A 3V4UH 1KCUL 2HT4D 4UT9H 3HUJF 5DTFB 4NC1E 1SEBB 2J4WH 1T83C 1I3RA 5KZCB 1B6UA 4PJAE 5EOQL 5KSAB 2YK1L 1T3FB 1OQXA 3LOWA 5ALCL 3MRDA 3SGEH 1YYML 3TBYA 1D6VL 4NCDA 5AWNL 3IDGA 5E2TL 2HT2D 4DCQA 5IHUL 5E9DD 5EUOA 1OAXH 3OG6B 1AD0A 3L3IB 1Z9SA 2IH1B 4MJ6A 1YY9D 4YH6A 2DLHA 2GTZA 4HIJB 4G8IA 2MSPA 4ZG1A 1U2CA 1A1OB 3OJDB 4YK4B 3QRGH 3MNVA 1PKQA 1TMCB 4NZJA 1T7XA 1F11B 4WFHD 4OAWB 3VFOA 3WN5B 4K23L 5J6HA 1M4KA 2VERN 5HDBE 1CFVL 1T2QL 2OTUB 4XPHL 2UWEA 3IFPB 1G9MC 1QBLL 2W07A 3D9AL 3ZT6A 2XZCL 4LL9A 5EWIL 3O6FC 1NGYB 3FHAA 1NJ9A 1UCTA 5C0EB 5F1IA 4N1HB 4Y1AD 1G7JA 4HMCA 4NZDA 3WLWD 4NFCA 2HAZA 5DFWH 5KSBB 3OKNB 2VR4A 4NJ9L 2PYFA 5GZND 5DQJB 4RISL 5J13C 4Y4HC 3OZ9H 3OAYK 4U05A 1A3RL 5EBGA 4GSDL 3T4YB 2IF7A 4G3YL 5BVPL 3HR6A 4XCCL 1OGAB 1RVFH 3ZKXB 3RVXD 1AQKH 4PJIF 4WEMB 4HXBL 3WFEH 5F3HB 2CLZA 4DKAA 2ENSA 3TNMB 3E0GA 3OHXA 3VFRA 4ZNEA 5GJTL 1NEUA 3DRQA 4NPYB 4D0CA 1R3IH 1P4LB 3UJJL 2F54A 2WUBL 4HCRL 1HIML 4NP4H 5FDYA 1IM3B 4QWWD 3U36B 5EUKB 5IT2L 3PABA 2IALA 1NH6A 1D6EA 1IGTB 1B0GB 4RFEA 3CH1A 1FDLH 3OR6A 3BQUC 2WWKT 1JZ6A 3R8QA 1A8JH 4N1EA 4X6CB 4MAYA 4YBLB 4G9DB 5H35B 1FZOB 2UVEA 5DJYA 2B2XL 3WV0A 5LGJA 4JFFB 1IGYA 4JN1H 2O5ZH 5GSRB 1YMHB 4M62H 3K4DA 1N6VA 3WFDL 4X6BA 1TTFA 1AHWB 3W82A 2DRUA 1N3NA 4YXHH 4XBPA 3TN0D 1JRHL 4Z7VF 5E2WL 1ZA3A 3SDDC 4ZS7H 3MNWB 4XWOD 1FCCA 1FG9C 1I8MB 3KR3L 4P2QD 4V1DD 2AJVH 5SWZE 3A67H 3O6FD 4JQIL 4KUCD 4JFHD 1U3JA 5K9JL 5FDWA 4BJLA 4AIOA 3WIIH 1JN6B 1JMXA 4M1GL 4F2MA 1WFOA 2WM0A 3PWLA 3NFPB 1QR1B 1ZHBA 2BY1A 1T1YA 1NGWA 1HXMB 3H2WA 1MREH 3EYFA 5I16A 25C8L 3FT2A 2HT2C 3T0EE 4B50A 2IADB 2W1NA 4RFOL 2PCPB 3NCEB 3GJFH 1QNZH 2VJXA 4JCMA 4G6ML 3H3PH 3QRFM 3QQ9D 4NWTL 1J7VR 3QUYC 4PR5A 3RVVD 4DN4H 5HYJA 5IBTH 3O6LL 3H9SA 1QLRB 3B43A 5T1MA 5HPMA 2C4FU 4YHZL 1KIRB 3RZWA 2MQ0A 3U7WH 1PEZA 1IILE 5FKPA 3E8UH 1Q0XH 4JRYA 4LHUG 3BGFB 4K94L 1NDMA 1WFTA 4B53A 2APWA 5DUPH 4D8PB 1I1AC 2J12B 3SDYL 4EVNB 5EC2B 5AG8A 3QR2A 5B38G 1U8IA 2NY6B 1IL1A 1CFNB 3OB8A 4K9EC 1RZJH 5I16B 4HWEH 3WHXA 4ZFZB 1CLCA 1VGKB 3DX7B 2W91A 3KPLA 3NFPA 5CCKH 3ZE1F 1NFKA 4HHAA 1GCFA 4UDTA 4YLQT 4MSWA 4C83B 3VFNB 4NO2B 3TZVD 1BVZA 3PIQA 1B9ZA 5D1XB 4O51B 3GSNB 2XKSA 5C0CD 4RRPG 4OFIA 3PP3H 5HGDB 1GPOL 2ARWA 3PWJA 4EI5A 2RIKA 4TULL 4F7PA 3DURA 3QDMD 5F96L 5B8CB 1WBYA 1JI1A 1I1AA 3GUTA 5IVNA 3EFDL 3QUZC 2ATPB 4QTHA 4DGYL 1LE9A 1ORQB 1JZ4A 4LNRB 3B9AA 2YUZA 3BGFC 1IAII 1Q72H 3AREB 1CF8L 1Q8MA 3CU7A 3L6FA 1YNKH 4PJXF 2JCCA 5INDA 1OF2B 5A2JH 5E2VL 5H35A 3QWOB 1R3JA 5HGAB 4F7EA 2UV3A 3TO4D 4FQHA 3UAJD 2JLLA 3JZ7A 4KKBD 3B2UC 1J1XL 3QIUD 4FQ2L 3MMEA 4X98B 3SCMB 2OJEA 2P46B 2J2ZA 5AZ2L 4K8RC 4RNRB 5TGBA 4HIHA 3UJJH 5HVHC 4GJTB 4JB9H 5D7JD 2EKSB 4UIMB 1AXIB 2YPKB 3O6KL 5HYSB 4OTXL 3RBGA 2K7PA 1T2QH 2VDKL 2VLLB 2RCSL 4S1QH 4ZUUA 4HIIA 1MHEB 5TH2A 4FXGA 3IDNB 5DJAA 4JY6A 1UJ3C 1WISA 1TLKA 1AD9A 2G60H 4GLRH 1K8IB 1IM9D 3CX5J 2FIKA 5D7LD 4R4NC 2ZJSH 4L4VD 5EBLA 5EULV 5DQDH 3QQ4B 1KB5L 3OKEA 3FQTA 1CFSB 3UTTA 4U1MB 3M1BB 5DRNA 3CFKA 5IR1A 4NQCA 4V1DE 3MCKB 1FYTB 3H42H 2YD4A 4JM4L 4NHUA 1BBJB 1HH6A 5E56A 5IIEA 2UWEB 3IFPA 1U6AL 5JPMB 4JO3L 3TGXA 4JFEE 2JB5L 4N8VG 5HGBA 1HIMH 2AEQL 3F7QA 1U3YA 3TT1L 4JKPL 1F11A 2R1WB 1JNHB 2AJVL 2GT9A 2QL1A 5HVGB 4JPVL 4FG6D 1G7MB 1A1OA 5DJ2A 1GVIA 3ALPA 3WUWB 2NX5B 2Q76A 1HH9B 4NBZB 1T21B 4A6YA 2V5YA 1P9MC 5HYIA 1AQKL 3SDXE 3Q3GA 4D9RD 3L9RB 2IJ0C 3B5TA 3D2UA 4Z95H 4L9DA 4JFXB 4K3EH 1S7VA 2NY3B 5J13B 4ODSL 4BH8B 4M7JL 5E6IC 1WTGT 2HT3D 2W65A 2BVOB 3X14B 5DD0H 1F4YH 1MI5A 4LCCC 4PP1D 5F1NA 2BVOA 1JNLH 4HS6B 4TVPL 1S7SA 4ZXBC 3K3QA 3HR5B 5AZEH 4UNVA 1VDGA 2IQAB 3BZFB 3S36X 3ULVL 4MZ3A 3QHZH 3BD3A 3SKMB 1T80A 3KLHC 4CJ0A 1QQDB 1FFPB 4ZSOE 3WNLA 2LVCA 4PV8B 2W9EL 4F9PA 3WUWA 5DJ6B 2BY0A 4IMLA 2ERJC 1QSFD 2JELL 3T08A 1B0RA 3QG6B 2EYRA 4U1IB 4EOWH 4S0SD 2X1QA 3V4UL 5HY9B 4PJGF 1GC1H 5EC1B 3ARTA 1MCFA 2R8SH 1MCNA 2GK0B 2R0LL 2VZTA 3KYOA 5JO5B 3QEQA 1XF2A 4CMMB 3LY6A 3WXWH 3OJ2C 3S3SA 5JDSA 3GRWL 5DVMA 4EI5C 1HI6B 5I74B 2L7UA 4OCSL 5MERB 2Y5TB 5C07B 4OB5H 3FMGH 3MV8B 1YJDH 2D2OA 3VFVB 4MHHI 4G7YH 5EO1A 1NCCL 3SDAA 4Q2ZA 5ID1B 1F3DJ 3DXAA 4KU1A 3R8BB 1N8ZB 5C0DA 5KVEL 2XQBH 3T0EA 1ORSB 1F4YL 3KXFD 1KJ3H 3BN9D 3EYSH 1NAKH 1Q38A 3KJ4B 2NY1D 1JZ8A 1OTTC 1KB5A 1MWAA 4R8WH 2BVQB 5IB4A 3NMEA 3SBWC 2FZ3A 3SE9L 4N8PA 4Q9CA 1M7DA 4XC3L 4M6ML 4KVNH 4KXZH 3U0TA 3F12B 4BUGA 3MOBL 3SCMA 3PL6D 5TDPA 1JE6A 5DWUH 5T1KB 2Q87A 1VENA 1FGVL 2DIAA 3DROA 1RUML 1RMFL 3LQAC 5T5NG 1J86A 5DD3L 3DVGA 1FZJA 3BPCB 3G04B 3O45A 2GIYA 3U1SH 5ICZA 1U3HD 5KOMC 4KRMB 1T0MB 3NTCH 2XRAH 5I1KL 1B4JH 2UYLB 1BZ7A 1DE4B 2LE9A 4MLIA 5BO1L 1MFBH 3J7HA 4KQ3L 5CKAA 4JREC 1WK0A 4NNPL 1T0PB 4Y16D 4POZD 1YA5A 5IM7A 3VDCA 4RAHA 3MJGX 4W70A 5MI0C 1RUAH 4YJZL 1HK6A 1BAFL 5KANG 2DM2A 3MRHA 1MJ8H 3SN6N 3ZSSA 4PJIA 2IBGA 3PQYE 3OSKA 2HFFA 3O6ML 5EN2A 2G60L 1I9RL 3JV4A 2Q8AH 5EUKA 1BWWA 1KCSH 1TQCB 3FRPG 3G6JF 2UUDK 4NDMA 4HIEA 1KELL 3QIWC 4YR6B 5EU6A 5I66A 1LE5B 5SWSB 1JUFB 1KEGH 1IZJA 2OTPA 2F54B 3G6DL 3MREB 1ZA6A 4NUJA 3DV4A 3DRQB 2XN9D 5EU5B 2VLRB 2BFVH 4GQ9L 2VUOA 3PGFL 3E6FA 1K4CB 3FO2B 4ZPVB 3TO2B 1RHFA 1RURL 2AEIT 5CS7A 2AXGA 5D6CB 3EBAA 1KJ2B 5GIRA 4QT5B 4X5LA 2Q86A 4TUOB 3C8KA 4X6EB 3KYKH 1J5OH 1BD2A 3MRQB 4R0LB 1XCTB 2A9MH 5GGRB 3FONB 1NC2D 4U6HB 4XCEB 1UH3A 1WF5A 1BZ9B 1RUMH 5M7QA 3O4OC 1XIWA 4N0CD 4S11A 3QUYA 4WDIB 4AG4H 1ZT7A 5B38B 1U91B 4X6FB 4K3EL 1AGBA 2X1OA 4XNXH 5JA8B 2PXYC 4MD0A 3RDTD 1G7PB 3HLAA 1F58H 3IJSA 4MQTB 3GMMB 3HE6C 3BMWA 1WBXA 5E2TH 1QSVA 5IMKA 1NSNH 4LKXB 1PKQB 4M1CD 5D9SB 5FYJL 5INCB 2KBGA 1J88A 5J06A 2ITDB 1NGQL 2RGSA 1QR1A 4WFFD 1HI6A 2X1WL 2R0ZH 5DRWB 5CBAB 3S35X 3ZT5A 3W9EB 2EE6A 2Y36L 4JFQA 1IT9L 1P7QB 3LKQB 1LNUA 3QUMH 2F15A 3BPNB 3UZVB 1GC1C 3BVNB 3MRDB 4WHCA 2ZNXA 1A6WH 4OKVA 2ZOKA 3CCHA 3EO0A 3LQZB 1D5MA 1AIFB 5D7KD 1I3RB 3FT3B 2J6EH 2EDYA 3B9KD 3G9VA 3H9YA 5CJ5A 2DM3A 3HS0B 1BECA 2BVYA 4UU9B 4P3CH 2W0KA 4DK6A 3ARUA 3UZQA 4LSPL 3KXFB 1XGRB 2VXVL 4E41E 4XMPL 1JGUL 1MCEA 3LMJH 3LPGA 2BCKA 1E4XI 2PYEE 2VLKE 3UPCA 4IS6B 1ETZB 2NNAA 4JFFE 1K8DA 4CW1B 3T77B 5HI5C 2CR6A 5FUCE 2AKRB 3KPNB 3AREC 2G9HB 4QHMA 5SWQA 3REWB 5JR1H 4N90D 5A16B 3TT3H 2Q1EA 2OTWA 2IFGA 4Z7UE 1PY4A 4ZDHB 5ISZB 4WW2B 2YZ8A 1RZKH 3W2DH 5LGHL 5KVDL 1CXIA 1SVZA 2BOCB 2QSTA 4M43L 3X12A 3CFBB 1OQOA 4GRMA 5LWYL 3W9EA 5IK3A 5HHQB 4ACPA 3IXTA