5DQDH

Structure of s55-5 fab in complex with lipid a carbohydrate backbone
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
222
Chain Sequence
EVKLVESGGDLVKPGGSLKLSCAASGFSFSSHGMSWVRQTPDKRLEWVALISRGGSYTYYSDSVKGRFTISRDNAKNTLYLQMSGLRSEDTAIYYCTRHKGLRRGTNAMDYWGQGTSVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords S55-5 Fab (IgG1 kappa) light chain
publication title Lipid A-antibody structures reveal a widely-utilized pocket specific for negatively charged groups derived from unrelated V-genes
rcsb
total genus 43
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2015-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dqdH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dqdH01
1YUHA 2NTFA 4ZOAA 5IVXB 2BHUA 5D6CA 1S7UA 2HTKD 3TO2B 1A8JH 1WF5A 2HLAA 3U4EA 4JGJA 5HDLA 3MRJB 5JR1L 1YEKH 3CC5A 2BOCB 2IH1A 2FJFA 3QCTH 1MPAL 1KEGL 2WUCL 1IC1A 4CN4A 3W11C 3QNYB 2A73B 3OB8A 5HPOA 3BKJH 4FQLH 5BQ7A 1OAKL 1HKFA 3RA7L 5DO2D 2V17L 4CMHB 3WV0A 3KJ6L 3OAUH 1ZVHA 4GRWE 2F54B 1AJ7L 5DEGB 2EKSB 2Q6WB 3CLEL 2XN9A 2FJHB 1FIGH 4JO1H 1FORL 4X6DA 4P2RA 4GFTB 4PGBA 1QFOA 1KELL 5DGQA 1K2DB 3MODH 1IAKA 1MQKL 3FO0L 1J86A 5CWSA 1DDHB 3EFFA 1U36A 1MCPH 5IP4A 3L5HA 1YEIL 4PLJD 2QQKL 4I9WD 2CSPA 5C0IA 2WLZA 1R0AL 4LQFL 2JJSA 3NA4A 5HTSA 4TSBH 1ZVSA 1X6NA 3C2SA 1ZEAL 1CICC 2BDNL 4XP9L 1NCDL 2H45A 4PJ9A 5JQHC 1CL7I 4E41D 2OBGA 3PHQB 3CFDA 4NN6C 3IDUA 1OP3H 2CLRA 4WGWB 3RKDD 3UYRL 3S7GA 4K7FA 4EUPB 3FO2A 2YA1A 5MENB 5A2LH 4G8GA 3M1BA 1T83C 2XQBH 4ALAH 1GGYA 3ETBF 2ZSWA 4OM1L 4R2GC 3RWDA 4L1HA 4LCUA 2W0FA 3C6LA 4N0YH 5EUOA 3HC0A 3KVQA 3RNKA 3Q5OA 4GAFB 12E8L 3VFWA 4L4VB 5F97E 3FFCE 1IGIL 1MI5E 5CIPH 5SWZD 5DJAB 2DKSA 3TN0A 2BVYA 3GI8L 3NOIA 3F6LA 1FFPA 2CD0A 3VI4E 5T1KA 3QXAB 2EEAA 3GJFA 1TQCC 1T21B 1FRGL 2VH5H 3UAJC 4XPTL 3MRGA 4C56B 1BBDH 1KXQE 2E7LC 1P1ZB 2H41A 4LSPH 3VXQA 3AREC 2FATL 3CMOH 3QQ3A 1SY6L 2CLVA 5FYKE 4U1LA 3SO3C 4K3HA 3QIBD 3PG2A 5CMAB 5GIRA 5IEHB 5C6TH 1AQDB 3MOQA 5BO1L 3UTSD 4LCIH 2IBZY 4N1CA 1XGPA 1U8KA 3U7AA 1RIUL 2DQHL 4N0CC 3BHBA 4NUGL 4P4RB 4ZXBB 2CDEA 3MGTB 2NX5E 4G8FB 3PV6A 3GMRB 3GKZA 5F7LB 1KYOK 2J8UB 3TYGL 4JDZA 2VIRA 4MGXA 1UCBL 3V4UL 5F3BA 3DVNA 4P59H 3RVTD 2X9XA 2F9BT 4XX1E 3KYMA 2BSSA 4QCIB 3T77A 1IGYA 2FHBA 5J56B 4Q9RH 1AXTL 5CHNB 4MWFB 4OFYD 1IGML 3CX5J 5CBEB 3FQXB 5L88H 1TTGA 3QUYB 4ODUB 4NQCB 4NBXB 3ABZA 1GZPB 1G6VK 3P4NB 1CFSB 3WMSA 4QXTB 4F15C 4UTAH 4PY7B 2FX7L 1N5AA 4FTVA 4ZQKA 4BQ6A 2DTMH 2R0WH 3BAEL 2R2EA 3FN9A 4DGYH 1A1MA 1BIHA 2HTKC 4ZS7H 3D85D 1IKFL 3B3IB 5IK3B 4OCWL 1CFTB 4OLYL 4X7SL 1KIPA 5HYJD 3AMKA 5L0QC 4NO2A 3QDGE 4L4TE 1E4KA 5TDPA 3PHOB 1DSFH 1Q94A 3MV01 3SDYH 1RAMA 4JFOB 3C5ZA 5JXAH 3PWVB 3B8YA 4MD4B 1MY5A 3Q6FA 3HUJB 1S8DA 4N8VA 1U8NA 1JGDB 5DO2C 4F7EB 4PRHE 2H26A 5EB9A 4PJ7F 1D6VH 4AG4H 1KJ2A 4LASL 5I66B 2EYRA 4LDOB 1R3HB 3RWGB 4PJBB 3HFML 4PGEB 4KKBD 4NRYB 1VFAA 1OTTD 1C5CL 2LAAA 2HKFL 4ZFFB 5KVMC 3R0MA 3V52L 3MLYL 4KQ3L 5EZJA 5T1MA 1NMAL 3JSSA 4GAGL 2W60A 2DDQL 4ELKB 5LVEA 4D9LL 5K9KA 1IL1B 3OB0H 3LKQB 3MXVH 5F1NA 2X4OA 4W4OC 4PRAA 5IR1A 3PWLB 3UC0L 4JKWA 4RRPG 1TNNA 1YEJH 3D0VB 3T1FA 1TZIA 4HCRH 3PGCB 3KYKH 3SGEI 4HS6A 5D5MF 3D3VE 1NCAH 3RKDC 4P99A 5T5FL 1FDLL 2BRRL 4GRWB 1XF1A 5F9OH 5ITFA 2AI0H 4M7LH 2DQEL 4PJ5A 3UZEA 1FNGB 2CDFB 3CVIL 1F00I 3O3UN 5D72L 1UACH 3DBXB 4P2OB 5EO9B 4U1HB 2OK0H 3HE6B 4PJ7E 4PJEB 1C16B 4WDIB 4EBQL 3IXAB 3RDTD 1KEML 5C86A 1DQLH 1XT5A 5JDSB 2BP3A 1ADQA 1WVZA 1AO7A 1MJUL 4XPGH 4YBLC 2F5AL 3VRJB 1I1FA 4WTZG 4N1HB 3V4PL 1QSZA 3IFNL 4M7KL 2Z8SA 3U6RA 4JFQA 5JHDE 3PNWA 2X6MA 2LTQB 4GAYA 3THML 1RJZB 4HWBA 4MCYA 3VXMD 3OX8A 3LPFA 1FBIH 5MEOB 3AY4A 1KENH 1KPVB 4JM2F 4TNVK 2GIYA 2X70A 5JUEL 3WXWH 1MCBA 3ZE2F 1CGVA 5D7KE 1WC7B 3T0XA 5DUML 1HZHH 2IFFH 4HKJB 5J12C 5C09D 3C60B 2VLRE 3A6CL 4UQ2A 5DJ2B 4U6HA 1PEWA 3ARFD 5DC4B 5EZOH 1MIMH 2VDPH 3SY0B 2VR9A 3VG9C 2Z93A 3P9MA 1A3QA 1G9NL 1QPPA 1T1WA 4I77H 2AW2A 3ILPA 1JNHA 4TUOA 2YZ8A 4EJ1C 3QDMD 4D8PB 1B4JH 3GIVA 3U46A 1RK1B 2GK2A 3WBDA 3RVTC 3IJYA 4YHML 3KDMA 4QXWA 3G5VA 1C5BL 4JPWL 4NNYA 3ARGB 3VG0H 4BK4A 3V95A 4OKVB 4CL7A 2VDOH 5F96L 2Q7YA 3I50L 1C7SA 4WEBL 4HGMA 2BY2A 3Q3GA 3H3KA 1HK6A 4HS3B 4NCC2 2A83A 1R5VB 3CFKA 3SE8L 3CCHA 4AK1A 5IHUL 4WFED 4F7CB 1JV5B 3L3GB 5AG8A 1KBGL 3PXJA 3NCMA 1NFDF 2Z8VC 1CG9A 3MMEA 1VACB 2NW3B 3QEUA 2BXZA 1FJ1B 3UZVB 5J13C 4HUVA 3MCLH 3O41A 4ODHH 4MJ4A 3BZFA 4IS6A 4NGHL 4JZJB 5ICXB 4U7KA 3I6GB 1RFDH 1R3IL 4YBHA 2RGSA 5FYKL 5D1QD 1LWRA 5FK9B 1C1EH 4JANB 2PYFA 2BCKA 4GSDL 4ZOBA 3G9VA 2P8MB 3IDMB 2HWZL 5JPMA 3MRIB 2QR0A 4C55A 4D9QE 3WFCH 4A2MA 1BMGA 4LSUL 3VWJB 1UC6A 1YNTA 4KKBC 5EZIL 1NGPH 1WFTA 1BFTA 1OTTC 3WO4C 5CEYA 2DD8L 2VDLL 4CVZA 4Q97A 1XF4B 2JIXD 4M48H 4N0UB 5IB3A 2Y72A 3FQWB 3WS6C 4DW2L 1CICA 1NAMH 1KB5L 2DWEB 4HUXA 3QUMH 5JNYB 1W0WB 4S1DD 2HVKB 2XPGB 1G0DA 1P4IH 2APVA 4BFIA 1U8IB 1SBSL 1CE1L 2ESVE 1NFDE 3KLDA 5D93C 1LEIA 1IGFH 2GUOA 4G7YH 1JTOA 1CR9L 3N06B 1T5WB 1F2QA 2C7UA 3X3GL 3RTQB 5HD8D 1NDGA 4QRPB 1G7HA 4ODXA 5KSVB 5GRVL 3ARRA 2RCSL 1FL3A 1T83A 1QR1A 2UYLB 4XBPB 3SGKA 2DQIH 2I60L 3Q0HA 4Z7UB 2IQ9L 1A4JA 3NAAL 5HGHA 4X7TA 3PQYA 5B38B 3TZVA 5C7XL 2X4UA 1VADB 1YZZA 2VXQH 5C0GB 4IDJL 2CK2A 2DQFB 4OGAD 4G6KH 4N9GB 4RMRA 3LVEA 5C0DB 1KG0A 5EN2A 4ESKA 4QHKI 5FYLE 1KEGH 2WUCH 2VL5A 3DUSA 3KPSD 4JJ5A 4YHZH 3ESVF 5CEXA 1XR8A 3HE7D 5D2LF 3KYAA 3RA7H 2E7LA 1LEGB 2V17H 3KJ6H 2B20A 35C8H 2P24A 3GNMH 1NC4A 4YDLB 1TJIH 4GS7C 5TH2B 3JWOL 4QRSA 4H26A 4L3AA 4CVXA 1T20B 5IFAL 2ADIB 2AXFA 2BNRE 2FCBA 1L0YA 3MV9D 1UM5L 5JLZA 2CK0L 5ESQB 1NCBL 3LQZB 1PSKH 4I3RH 1CLOL 2EDHA 3DXAB 4MQTB 4TULL 3DRTB 3AFLA 2ZG1A 4JFHE 3DTXB 5EG6C 3FO0H 1MQKH 3QXDA 4OFPA 3S37L 3X14A 5HBBA 4R96B 4QOKD 3ARFC 3DROA 1CDGA 1TZHB 4I5BB 4OV5B 1R0AH 4LQFH 1FNEA 1FL6A 3OKMB 4S2SA 1ZEAH 5L2JA 1OP5H 4PJAA 2FGZA 4HZLA 2E9BA 3MUGA 2P8LB 2V7NB 3S4SA 1WJ3A 3HZMB 5FA4A 3QZWG 3AAZA 3N9GL 1NBZA 1I7ZA 5DURD 3ARDB 4BFEA 3H9SA 5C0AE 2X09A 3LS4L 4DN4L 1ITBB 1AP2A 4YXKL 3MJ8A 5JHDB 2EEDA 3PABB 2H32B 3BPOB 5IB5A 4OCNC 3IVKB 1A6VL 2FZ3A 4XVJH 3TH2T 5D2LE 3LMJH 1DEEB 4M03A 4QTHB 4N5ED 4X5XA 3MRBA 4PJHA 1OP3K 1I8KB 1ACYH 3DX8A 1XZ0B 5BV7L 3D2UB 3O45A 4GQ9H 3DETD 4OLWH 1IGIH 1HSAA 4HJJH 4M1GH 2NQCA 1KOAA 1YN7A 4YHIA 5HHOE 1ONQA 5D5MB 4AENB 4ODTL 1FVEA 2EDRA 1JRHI 1PD6A 2PXYB 3WIHA 3H9HB 5F6IB 4KVNL 1IQDB 4QEGA 3JTSB 3VFOA 1NCCH 3STLA 3EOAB 5E8OA 2FATH 2IPTL 3B2UD 3I2CL 5GS2H 5D1QC 4LAJH 32C2A 3W0WE 2EXYD 4PP2A 1SY6H 1ZGLB 2X9YA 5HHXL 4KKLD 2EECA 4TSCL 3U2SA 3BP7B 4FQ2H 3NCJH 3IDGB 4YNYA 5ALBL 2EYTB 4Z0XA 2DQHH 3GHBL 4XCNB 5I76B 4NOBA 4NUGH 3QEHB 2WP3T 5CEZH 2NYYD 1FIEA 5GQBA 3C5JA 4LRIC 4RGNE 4PRPD 3VH8B 3O4OB 3IJSA 2Y6SD 3VMNA 3MV7B 5I8KL 4JM2B 1UWGH 1F6AB 4W4OA 5ITBL 3ALWA 4KHTH 4OZIA 4LLVB 4S1DC 2FHCA 1HINH 3HRPA 3C2AL 4LLQB 2YEZA 1AXTH 5D1ZB 4E41A 2DM7A 4Z5RA 5ID1A 4Z95H 2OZ4A 5HD8C 3RIFF 3K1KC 3OHXA 1RJLA 3WUZA 4X9IA 3ET9F 3VXTB 3GIZH 5EBMA 3BAEH 4K8RL 4HIJA 5IB1B 1JWMA 4NQVA 4QHNA 4X7SH 4OLYH 4C54A 4PS4H 3LIZL 1H5BB 4Z78B 4LLYB 5IQ7L 2XQYG 2X4QB 5KVGL 2FRGP 5SWZA 4NNXA 4OGAC 4JM4L 2X7LA 2Z4QB 4EN3D 1TDQA 1A6WL 5BRZB 2R2HB 1NCNA 3IGAB 4GAJL 4Y2DB 1AKJB 4G8IA 3WS3A 3HE7C 8FABB 3ZHDA 1C8PA 5D1XB 3L5XH 3FT4B 4JPIB 4NYLB 4PV8B 4JY4B 4BSWA 4P2CG 2A9NL 4LASH 3GMMA 3Q48A 3QIBA 3S37X 3IFOB 4PRIE 4PJXB 3UTSA 2OQJA 4YAQA 5AWNH 4H25A 2DI9A 4L9DA 1DLHB 2WBJD 4YPGB 2BVPA 4DJMA 4OTXH 2VSDA 1HSBA 3UJTL 1EHLL 2HKFH 5JOFA 3GMLA 1P7KA 2GTZA 2BSED 3FFDA 5HHME 3V52H 3MLYH 2QEJA 1GH7A 4QO1A 3FZUD 1NMAH 4GAGH 5KVFL 5LCVL 4I3GA 3PL6B 3DV4B 4PGCA 4OD2A 4KRNA 1CFBA 1NGWB 2LU7A 4ELMF 1AHWB 3PHSA 5I1LB 4PLOB 4S1QH 4R97B 5K9QG 1BJMA 4UBDC 3QG6A 3JUZA 5GISH 2Q3AA 4OFYA 4OJFL 5A16B 1EO7A 5TDNB 4ZFOB 3G04A 4NQEE 4MJ5A 4GW1B 4Y5VB 4RGOL 4LIQE 3FMGL 5C0BE 3GSOA 5T5FH 1EERB 2BRRH 5I9QC 1KN4H 4BFGA 2DQEH 5D7LE 5A3ID 4FFYL 2GQHA 5DUBA 3NZ8B 3CVIH 1H8SA 3D25B 3QIUD 2V6HA 1YEHL 5D72H 2BNRB 1UA6H 2YBRA 4N5EC 2VB5A 3D85A 1DUYB 2JCCB 4ODBD 1BECA 3QUZB 3DETC 5HYJA 1NGYB 1KEMH 1IEAA 1G0XA 4QLRA 1T6WA 3IDNB 4HHAB 2R8SH 3WNOA 1FLRL 3MRNB 2VAAA 3O3AB 4LMQE 2BVTA 3WE6A 2QQLL 2F5AH 5C8JB 4LSTH 4GRWH 4OF5A 5I8CA 1A3RL 3VCLB 4FQQA 3IFNH 1IQWH 2CIKB 3O6LH 4KUCD 1T1XA 5BS0E 5KANI 2B4CL 1RJYB 2QADB 1EJOH 1I9IL 5DMIH 4QGTA 3HCVB 3B2UC 4Z7WB 5F1IA 5KJRL 5FDWA 2VE6B 4MA3A 4ELME 1I8LA 1S7WB 5F88A 1BZ9B 5ABDE 3HI5L 5JUEH 1F8TH 4FQCL 1H15B 4YFDB 4M8QA 3JV4B 3A6CH 4L8SB 4HK0A 2NYYC 1MWAB 4JREB 4XP6H 1OARH 4ZFZB 3WS6A 4LSVH 1G9NH 5GZOD 2VLME 2NZIA 2Y6SC 5F7YC 1I3GL 3LKNA 4I0PD 3EO9L 1UXWA 1WT5C 4MAYB 1B0GA 4U1KB 3P0GB 1M7IB 5I1JL 3L3KB 3MLUH 2A74B 4MX7B 4ZOCA 3D48R 2LFGA 4BFBD 4GT7A 2MSPA 5F96H 3ELAT 4KFZC 1DQML 2R4RL 2FSEA 3QG7L 5A40E 2VC2H 3W0WB 3GUTA 2AK4B 1GOGA 4V2CB 3SE8H 2YD1A 4HUKB 4PY8I 1E27B 2A6DA 5IHUH 1ZWIA 1IBGL 4XCFH 2AJYL 3KWWB 3PJSA 1KBGH 2X40A 4WHDA 2OMNA 3BD4A 1EAPA 5ERWA 4G8EA 3RDTA 3INUL 5T33L 1SYSA 4RGNB 2EIBA 4EN3C 4TUJB 5E8PA 4BKLB 1GJIA 1R3IH 5FYKH 3VGBA 2EIDA 3WHXB 4LCWE 4G6JH 4QGYA 4KPHL 2PETA 4PG9B 3BP6B 1VPOL 1MCDA 1DE4A 1HILB 1NLDL 1E28A 3VXMA 4MA8H 1S7VA 1DANU 2R9HD 2Q7NA 4FXKB 3T4AA 3KPMB 3QO1B 2CJUH 1K3ZA 2XICA 2F54D 2W91A 1OSPL 4LSUH 1U8LA 1YPZB 1HKLL 1J87A 2YMXH 5C09A 3D87B 5EZIH 2WBJC 4TNWF 3ULUF 3ARFA 2IADA 5CLWA 4IRJD 2VISB 2DL2A 2HT2D 2MNUA 2XZCH 2J4WL 2DIAA 3FZUC 4DW2H 4DUWA 3TF7C 5F70A 5FHBL 3TBTB 1WQVT 5IMOB 2FECI 5C0JA 3QDMA 4QRQB 1ZA3B 1SBSH 1CE1H 5C2BL 1LNUA 1CR9H 2V5SA 3G5XB 5HYSA 2BVOB 3LRHA 3X3GH 5DJDB 3HMXA 4XNMB 2RCSH 5KVDH 4KZDH 3NGBB 4HUUA 3DO3A 3QPXH 1BF8A 2A0LD 3T2OA 2G5BB 3NAAH 4V2BA 1RZGA 4X7CC 4GMTH 3EYSL 5A3IC 3VFTB 4JKKA 1K4DA 4WIQA 3OKDA 4WUUD 2ZOKA 2CUMA 5GSRB 3EGSB 4BQBA 1NEUA 3RL2B 3UJJH 3GMOA 1Q9WA 3CFBA 1RQ5A 5FCUH 4F3FB 4U1IB 2WIIB 5J6HA 3NABL 1J18A 2RJMA 5GS2D 1RUPL 5KAQF 1AR1D 3B2VL 4YDVB 3BT2L 3TVMB 4IRSB 1FZMA 2EDFA 5FGSA 3BPCB 5EOCH 3QXUA 5EO1A 1HQ4A 3C09B 4DWHA 5IB2A 4XC3L 4ZO8A 2G75A 5IG7A 1YN6B 4M5YL 1JPGB 1KTLA 3S3JA 1J9CT 4PGZA 5EBWA 5T1LB 1XGTB 1NBYB 4HV8B 3MUZ1 4ONOA 4ETQA 4JJHA 4X4ZA 1HNFA 1NCWH 3BGAA 5I30L 2QSQA 4TOYH 3ZDZF 5IHZB 3SGDI 4ERSH 4GXUM 5SX5H 5C0BB 3S37H 4LRIA 1JL8A 2I5YH 4PRNA 4XMKH 5CLTA 5CZXD 3T0WA 5D7LB 1FV1B 1K5NB 2EDEA 4CMMB 4YHNB 2JE8A 4R7NB 5BMFL 3L95A 3BZEA 2CIIA 2JIXA 3GMQB 1VESA 5FCSH 5GZOC 3MOAH 1AIFA 2FR4A 3LQMA 1EBAA 1OP9A 4B7IA 4Z9KB 2E5EA 4OD1L 5H35B 4I0PC 4LIQL 3ZT6A 5CD5D 1NC2B 3K0WA 3W9EB 1WWAX 4OIIL 4DN4H 3U9PH 5EU5A 5GS1C 4XNUL 4YXKH 1KJ3L 4LL9A 3W9DB 1OP5K 1A6VH 4OBSA 1J11A 4F80A 3RKPA 3H7BA 2X05A 2ZWLT 2ZPKH 3D0LA 1MHCA 5CIPA 3VFSA 3QUYD 1A4KA 3SQBA 2VWEE 4NQCD 1MCIA 5KSAD 4LPUA 5JO5B 2HRLA 3Q5YA 1U8JA 3AS0A 4MMXC 4MAUL 5GGVY 3MNWB 2H32H 3GRWL 1F45A 2IBZX 1U41A 4XGZA 1X5XA 3VFPB 4ODTH 4CNIA 3ZDZE 4PJFA 3KPSA 1A6TB 1HHKB 3STBA 4XXDA 1F4YH 5E2VL 3HE7A 4KGLA 4YH6A 1FNHA 1OF2B 2FJGB 4H5SA 5L2KE 2VMFA 1KT2B 1CLZH 1K8DB 2H3NB 4U1NA 1OL0A 4GQPH 5C0CD 1IC4H 2R9HC 3MV9A 2WNGA 4LLMA 1X5ZA 3UYOD 5GGQL 4CMHC 3GHBH 5C07B 4R6UA 1NL0L 1RZIB 3NFPB 1EEUA 2XG4A 4X6BA 2Y9RT 3E2HB 3BIKB 3AS1A 3SQOL 5E2WL 1UZ8A 5B39G 4XPHH 1FPTH 4LSRH 4O9HL 5E2TL 4QOKA 2VZ1A 5EU6B 4IRJC 4OFVA 2HT2C 1YDPA 4Z7OF 3EYUH 5DJXB 1QLFA 3Q6GH 3FT3B 5ITBH 5DD5L 1KCUH 3C2AH 2AVGA 5IF0B 3U7YL 4N8PA 1TETL 4JN1L 3F7VB 4L4JA 1AGFA 3ISWA 1U8QA 3A0OA 4OLVL 3AGVA 3WFBH 3KPQA 2A0LC 1WZKA 2Y7QB 1ZE3C 2HH0L 2AV1B 1VHPA 1Q9KB 3AROA 4Q2ZB 4R4ND 1N59A 2IEPA 3DURA 3ILQD 3BO8A 5KVGH 3DUHA 4JQXC 1K6QH 4P2OD 4XPFL 3HE6D 3EAKA 2NPLX 3VRLF 3SGJC 1T7VA 2CKBB 2EDOA 4GUPB 1AR1C 3D18B 1F90H 1TJGL 5I1EL 3P3YA 2X4NB 4Z7OE 1EGJH 3UBXI 1MLBB 4OT1H 4KK9D 3RZCB 3TCXA 5GGRB 5IESH 1O0VA 3K1DA 3MZTA 3DX6B 1CXKA 2YD8A 3AMLA 3ARZA 1MCNA 5IOPA 5HVFB 1S7QA 1EEYA 1M6OA 2WUBL 4J3TA 1EHLH 2HP4A 4RCAA 1BAFL 1TVBA 4PRPA 5CZXC 5H37G 1J05B 3TBYA 4UV4L 3TNMB 3VFUB 5ACLA 1BQLL 2DQCH 5FFLA 4S0TD 3T8XB 1RUMH 4HCRA 4Z6AT 4LLWA 4LEXL 2MCPH 2PNDA 1F4AA 2XKSA 4Y0GA 4NWTL 3CDCA 3FFCD 5ACZB 3B5TA 4OJFH 3RU8L 5CD5C 4LLDB 1EPFA 2RFXA 1CLCA 2R0LL 5K9OA 2QV2A 2DQJL 1ZHNB 1QRNE 4RGOH 1XIWB 3FMGH 3VRLE 1BVZA 4M9PA 2J12B 3OKOA 1YEFL 1MCKA 3VFMA 5F7HA 4FFYH 3D9AH 4HWEL 4XH2B 1PFCA 3MRFA 5FYLH 1YEHH 5EBGA 5HY9B 1CTNA 2EE9A 1RD6A 1HYSD 2V2WB 2J6EH 3QUYC 2GSIB 1BM3L 4NRXA 5KSAC 2IPUG 1D3CA 5FYKD 4WJ5B 1Y18B 5AYUH 1CIDA 1VGEH 3QDJE 5IW1B 5SWSB 4HKBA 2D4FA 4MD0B 3LOWA 4X98B 4XCYB 4EN3A 3QP3A 4OD3L 3WFZA 1ZT4B 2NLJA 4QRRB 1WUNT 3PGDB 2B4CH 4G6ML 4X9HA 3KLAA 1FP5A 2NX5D 3KPOA 3EO1B 3QQNA 1NEZB 3TGXA 1FZKB 3S9DB 3BWAA 3SJVE 4JFPB 4U6VL 5KJRH 3LKRA 2NNAA 2D03H 4FXGA 2C3HA 3OV6A 2K7QA 3HI5H 3N1FC 1LK2A 2VXSH 5EA0L 1DVFD 2BSTA 3TWCH 1IC5L 5HHNB 2BMKA 1F97A 2WBJA 5E56A 1BD2A 2KDGA 1BIIA 1GXEA 5J11B 4ZNCD 4I3SL 4BZ1L 2P49B 3VWJD 1S9YA 1EHNA 2L7JA 1I3GH 5KTEL 3LKOA 4MA7H 4WVRA 4PPTA 3BISA 2Q76A 4YFEA 2O5ZH 3W5NA 1UXSA 3RWJA 1MQ8A 4UT6H 1RIVL 4UIMB 1MWAH 5J7CC 3VD9A 4E42B 2D2OA 3MPCA 1QBMH 3QDGD 3F7YA 3GSWA 4KV5F 3HI1A 2ED9A 3B5HA 2JK5A 3EYOA 4UDUA 2DQUL 4XP4L 4OLUL 2YPLB 1DQMH 2R4RH 4ZNEA 4OF6A 1P7HL 4AZ8A 3KPPA 3CAFA 1JNLL 1UYWL 6CGTA 3CFCL 1JK8B 3QIUA 4NIKB 4IIQB 2HN7A 3VXPB 4LSQL 1IBGH 5FB8B 2P45B 1MNUH 4PRHD 5IFJB 5GPRA 4R4NC 3V0WL 2FWOA 3INUH 1WIOA 4MNGA 5E70A 3ILQC 3MLTA 3U0TB 4EDXA 1OD7A 1QBLL 5T1DH 2QHRH 4P2OC 3H0TB 3HE6C 2AEQL 2HKHL 4D0DB 1J0HA 3MRQB 5TQ0L 4KMTL 3MYJA 4KPHH 5FDYA 1CZ8L 4OI7A 4CKVX 2ZNWA 1NLDH 5EC2B 4ZG1A 4YHLL 3DVIA 1G7LB 5HGAA 5IW3A 3MR9B 4G42B 4LGRB 4CVWA 1MIEL 4I2XE 4KK9C 5DDHA 2LTQC 4KRPB 3KPNB 3MLVL 3GBML 1OSPH 1HKLH 1T3FB 3FOMA 3ME0A 3NACH 3BVNB 4ZPTB 1G9NC 4KV5E 1NAMA 4YDJA 4GKSA 5JW5A 4CGTA 2XTJB 3PDDA 1B0RA 2HJFB 3TBVB 5K93A 5MI0B 4MJ6A 4D0BB 3EO0A 2A6KB 3IYLW 2KH2B 1INDL 1X5YA 1PY4A 4I0PA 5CZKA 3OGOE 5IVOA 1A22B 5F7UA 3MJ7B 5LGKA 4N0FB 3QEQE 4QT5A 5L8KB 4KDWA 1KJVB 2PCPB 1QLRB 1UH4A 1EXUB 1T03L 2ERJC 4E5XA 1CIUA 3DHJA 3MBXL 3P9LB 3ARDD 3LB6D 5E6ZA 4LBEB 4Z77A 3HZYB 1U8PA 3BSZL 2VDKL 1VENA 5JHDD 4MSWB 1T5XB 3EYSH 3TEUA 1I8MB 1JYXA 1IAIM 4OFIA 1YYML 4G5ZL 1AE6H 4WW1B 3MRDB 4Y4HB 1HYSC 5IVXA 3IRZA 4K3EL 5DVOA 4XHJD 3G6DL 4XB7A 3D2UD 3IDIB 3DI3B 4D0CB 1CI5A 2XACC 3MRJA 2OJZL 3UTTE 1RUPH 4NZDA 4JZNA 4U0RB 3BT2H 3PWNB 5D7KD 2AJSL 4NUJB 4X0KB 3S5LG 2BSRB 4HIXL 2VLRD 2EDXA 5KSUB 1HHJB 1KIRB 2PXYD 2XWBA 3QNYA 1JPTH 5ALCL 4JZJC 4XC3H 4Z76A 5HYFA 1T1YB 5GHWL 4ACPA 4UOJA 4LHUG 1GC1H 2XZZA 4S1SH 3I9GH 3JV6A 1WFUA 2ZSVA 2ICWJ 2XNAA 4CU8A 1D5ZB 2F54A 2M2DA 5E94B 3WUWA 4JQVC 4YHOH 5EU3A 4BH8B 4XAWL 1DVFC 1SYVB 2IQAB 1NQBA 2Z0BA 2NCMA 3FB6A 5DEGA 2C1OB 4YPJA 1IM3B 4DVRL 4MDIB 4FQXD 1A21A 3AUVA 2NY1D 1X5KA 2GJJA 2FJHA 3GZKA 3RPIB 4Q74A 1S3KL 3GSXA 3R06B 4IRJA 1MCRA 4WHTB 3KAAA 4JKPH 1FFOB 1FAKT 3VWJC 4F2MB 4I4WA 5SX5K 1QO3A 2C1PB 2D7TL 2YR3A 2MTPA 4AYFA 1WBZA 4QY8A 1UM4H 4RNRA 2ARJB 4KGJA 3QXWA 4OIIH 1T80A 1U8OA 4JM2D 3ARPA 2WW8A 4P57B 3VXNA 3TA3D 5D1ZD 4NHUB 3PHQA 5JHLH 1ZHBA 3CX2A 1AGBB 2VR4A 1R24A 3AU1A 3DGGB 3QSKB 3FRPG 3SCMB 3QCVH 1GZQB 2VLJB 3NCBB 1RZ7L 4WUUA 1SM3L 2ICCA 4MAUH 1J0JA 4JQXA 4EVNA 5I2IB 3T0EB 1FSKB 3KPTA 3GRWH 2R0KH 3NIGF 3BH8B 4XWGH 4D9QD 4RMQA 2LABA 4R90H 3SGJA 1B9ZA 1QNZH 1SY6A 1T6VN 4JFYA 1IFHL 3W81A 4UNVA 3BEWB 1NFIB 5BRZD 2ZG3A 1CTOA 1F4WL 3LEVL 1Q9OA 4PTUB 5GRXG 3X13A 4Y2DD 1T1ZB 3MLWL 3VMOA 3N1MC 4GW5B 5GJSL 3G5ZA 5D1XD 3ROOB 1JRHL 3F65A 1HXYB 1X9QA 4WTXA 4YDLC 4DK6A 3EFDH 2R29L 3DSFL 5CMAA 3SQOH 4PJCA 1AQDA 1MFBH 2P5EB 4HJGB 4C83B 2QSTA 1DN0B 2AGJL 4UDTA 3FHQA 2EIEA 4P4RA 4OZ4B 3MGTA 4G8FA 1ZLSH 1N7ML 3EW3B 4X7FC 2J8UA 3PL6D 1CN4A 4JZOB 5HI5D 3U7YH 4POUB 4NPYA 5DZOA 2DYPB 1GGBH 4JY5L 2VR5A 5TE4H 1WZ1H 3VJ6A 3O9WD 1G1CA 3NIGE 3BP4B 5FYLD 3R4DA 4QCIA 1ZANL 1CT8A 1EEQA 4P9ML 4OZFB 1BREA 1TITA 3WFHA 4ODVH 2R1XB 2KQMA 3ARDC 3LB6C 2YC1B 7FABL 4TUKH 3X11B 3W39B 2E9IA 1LO4L 3QUYA 3BPOC 4NQCA 2G2RB 1GZPA 5KSAA 2OM5A 4QXTA 1F3DJ 1T0NA 3VMPA 2BNRD 4KTDH 3MX0A 4XHJC 1FCCA 4PR5A 2E8ZA 5DVNA 3B3IA 1CFTA 5AZEL 2CXGA 1DBJL 3BRGC 1I8IB 4JFHD 3S35H 1CDUA 1ORQB 1TJGH 2EICA 1J5OL 5I1EH 2UZYB 3RNQA 1VSCA 4DZ8B 1P84K 1JUFB 2PXYC 4JFOA 1YMHB 1JGLL 2C3WA 3OPZH 3IDYB 1U91B 3PWVA 5C0CA 1JWUB 3QEQB 2QADD 4R4FL 5GRJL 3LKSB 4NSKA 1E6OH 5E00B 4F7EA 1KNOB 1DTUA 2C4XA 4HLZH 1GAFL 2I07B 5I66A 5C0AD 3RWGA 2R56H 4PJBA 5TJWK 2CR6A 4FQXC 2G60L 2HG5A 2NY1C 4JAMA 3OL2A 4PGEA 2IF7A 1WIUA 2OJEB 2Y5TB 4WUKL 2YD7A 4A6YB 4OCRH 5ILTH 1N6UA 1HNGA 1J1XL 5HI4D 4ZFFA 3GSRB 2HYMA 3IF1B 3SE9L 5DHVA 1JP5A 2A6IB 1DFBL 2B2XH 1XGRB 2ITDB 4L5FL 1F11B 4NWTH 4DOHB 5TF0A 4L8CB 1GCFA 2ADFL 4UI2A 5HHQB 3VXRE 1IL1A 3LKQA 4XVSH 1RMFL 1A7RL 2R0LH 5GJTH 4MAYD 4JM2C 5HHOD 2FL5B 3GI9L 2MOVA 1K85A 4X4XA 1N2RA 3TA3C 5D1ZC 3A6OA 3PGCA 4MVBD 1MCOL 2ENSA 3R1GL 3OAZH 4O2CB 1K3IA 4WHYG 5DLML 1ZGLP 1OAYL 1M05B 3OKLA 2IWGA 3W0WD 1BM3H 2O26U 2W9EL 1FNGA 3MLRL 3RWHA 3ULUH 1OWRM 3F5WB 2D9QB 3MA9L 4L29B 4P2OA 5EO9A 3HE6A 4PJEA 4S11A 2XZQH 5H94B 1AGCB 1C16A 4KDTC 4WDIA 4YBQD 3RUGB 6FABL 1GHFH 3WNMA 1ZOXA 4IOFD 4RGND 3VRJA 1IKNC 1ADQL 4O2FA 4PJHE 4ENED 4G7VL 4WO4D 3IRPX 2D7NA 1LP9F 4KTYA 1RJZA 4Y2DC 1I85C 3HRZA 3BJLA 3MLZL 5EA0H 5DQ9B 3ARVA 4GW4B 5D1XC 4HWBL 1IC5H 4ZUTA 5MEOA 1QQDB 2YKLL 4AT6B 1OGTB 1UB5B 1W0VA 4XMLL 3UPAA 1I1YA 1MREL 4M8VA 4FG6D 2X44D 4IHOA 1WCQA 4N8VG 5FECB 5DA0B 4BZ1H 5AUMB 2X42A 2ORBL 4HKJA 3OGCA 2FD6H 5KTEH 4Y7MA 5H2BA 3SY0A 4KKCC 5DWUH 5I1GL 5FOBB 4NN7B 3WIIL 5I8OL 3LS5L 3PL6C 3FFCA 2Q87A 3SKMB 3V5KB 5DUPL 1UQSA 3O9WC 4Y88A 2DQUH 4OLUH 5GGVL 1RZKL 4R97C 3L6FB 1J0KA 2B0SH 2X4TB 3CFCH 5E8DL 1MCEA 2DQDL 2VKXA 3F7QA 4GBXD 3STZA 4OKVA 1HXMB 1RIHH 2GSGB 4K23H 4CW1A 4OZIE 1LP9E 4OSUH 5E6IB 3V0WH 3WL9B 1QSEB 3EHBD 1R5VA 1R5IA 3O4LB 2H8PB 1QLEL 2V2TA 2HAZA 4PRID 1L6XA 2RB8A 2B4CC 3SDCB 2Q8AL 4HH9A 4Y1AE 2HKHH 3FB8B 4XCCH 1JZ3A 3T3PF 3CVHB 5I17B 1NLBL 1FJ1A 1IMHC 1SMOA 2LVCA 2NX5A 4JZJA 5HHMD 3DV6B 2AJ3B 3GB7B 4IRSD 5CP7B 5BXFB 4DKFL 5EC1B 4JN2B 1XF2A 2C4FU 3GBMH 2QADC 2XZAH 3OJDA 5FK9A 4MXWH 4JQVA 4FQPA 4HT1H 1DVFA 4U1GC 3CVHL 1IJ9A 3K7UA 2FEEI 4I13B 5T1LD 4Y4KB 5INDB 3KS0H 1LD9A 1A47A 1C12B 2NW2A 4F9PC 4ZPVB 4NQED 5KANG 1RV6X 3P11H 3VWJA 5C0BD 3OQ3B 4X80H 4HF5H 1OTSD 1H3WM 3HZVA 3S3PA 5D7LD 4L8SC 2DQGH 5LBSH 5HI4C 4JREC 3MA7B 2MMXA 4F8QA 4TNVF 3UTSE 3FQWA 4P5TD 4RQQA 2DWEA 4WGVB 1MCHA 3BD3A 5DI8B 5JNYA 4X6CF 1W0WA 2HVKA 3QDGA 5SWQA 4L4TA 5C3LD 4MAYC 3MV8E 4I18B 5KSBF 2VDKH 3T3PE 5HPMB 1T5WA 4X4ME 1EBPA 5BS0D 4BQCA 2FECL 1YYMH 3X3FL 3SDXF 1RZFL 3GKWL 4OUUB 5EOQL 1U58B 5IM7B 4PRHA 3PDOB 4JHAL 4K3EH 4RZCA 2X2YA 5DJYB 3L3HB 5E4IA 1WBXA 4NKIH 4GH7B 2OJZH 5JIHA 4NN5B 2CR3A 5CGMA 5I19L 5C0DA 4HIXH 5LG1A 3LRSA 4YBQC 1N6QL 3T2NH 2OXHA 4U1JA 4IOFC 4RGNC 3FQRB 2ZOLA 4ENEC 5JOPE 5HYJE 1PVHA 5ECJE 2JELL 1G7JB 1QFUL 2ED7A 5TH2A 4PREB 1WZMA 1Z6JT 4UT9H 4CN1A 4X6CE 1PYWA 4RFOL 4NZUL 5ESQA 1SJEB 1G7MA 4FG6C 1S3KH 5C07D 3L9RB 4XNZB 3S34H 3DRTA 3VFNB 3FT2B 3SDXE 4RX4D 1K8IB 5ESVB 4NP4H 3REWA 3BKCL 4OV5A 3HTLX 1LMKA 4M6OL 4PJ7A 3FN3A 4RMSA 1OGAE 1FO0B 3ZYZA 3PWJA 5EIIB 2LVEA 1HI6B 3HZMA 4QHUA 2J88L 3IS0X 2P8PB 1A0QH 2NXZB 1UJ3B 2R1WB 3ARDA 2OL3B 5HGDA 4K7PY 5EUKB 5JHDA 1JI1A 2H32A 5HGBB 3U79A 1VEPA 5DK2B 3NGBC 4NQXA 1SM3H 43C9B 1WAAF 4NJAL 1X3DA 4HKZA 1DEEA 4Y19B 3CK0H 1I8KA 4UINH 3D2UA 3EHBC 3BH9B 3RBSA 1QFPA 1KLGB 2VDRL 1XCQA 2W92A 3P4MA 4S1RL 1IFHH 5EO0B 3CFEB 2F53B 3NCCB 2VLRA 4G80B 4Y5YB 5EBLA 5MP6L 5FUCC 2XI9A 1F4WH 4LGSB 4HX1B 1GC1C 2PXYA 4OZHF 3HR6A 3VXSE 3SDAB 1JGVH 1IQDA 3WIHL 3WYRA 1EA9C 4CUCA 3TVMC 5CJQL 5GJSH 4IRSC 5FEBA 2V5RA 3UJIH 3GM8A 1GGCL 1ZGLA 4LVNC 4PJIF 3DX9A 2R29H 1BLNB 4FQXA 3IDGA 3BKYL 4UQ3A 3H3PH 3JV0A 1YEDA 5I76A 2W38A 4HKXB 1T4KA 3SDDB 3S6CA 1TCRB 3ZO0A 3CH1B 1OTSC 3VH8A 2D0HA 4XNXL 5DSCA 1WAAE 3VD7A 4DVBA 4HJ0D 3ZT5A 4JY5H 1RUAH 4Y1AB 4JM2A 4P5TC 1FG9C 1CD0A 4NQTA 5C3TA 5FAAA 1AGEA 1FLTX 4JRWA 3TA3A 5D1ZA 2OI9B 5EPMB 4TQEL 2UVEA 1LO5B 2Z9TA 3J7HA 1KFAH 3BFOA 3ULUD 3S4SG 4CDHA 1EHXA 3CMGA 3B9DA 4E9LA 4U33A 3JWNC 5B39B 2ZG2A 3LKPA 3VXTA 1OAXL 3FTGB 1KULA 2GI7A 2BNUB 4OZFH 3BXNB 2RHEA 3MCG1 3UTZB 5BVJA 5IB1A 4PJIE 5DTFA 5AZEH 2P48B 4KDTA 3ZTNH 5ISZB 4Z78A 4LLYA 5GS0H 4YR6A 3E8UL 1YMME 5DJZB 1PG7H 4LNVA 5ICYA 5BRZA 4M61B 2R2HA 3WO3B 4PRBA 1JGLH 1A7OL 4QRRD 1N4XL 4JDTL 5F6HJ 4Y2DA 3UPRA 4R4FH 1KXVC 3DVGB 5D1XA 4BH7A 3RGVB 3DHMA 3FT4A 2YZ1A 2HVJA 4NYLA 3GJEB 4AEIL 3MV8B 1NFDA 3O11B 5TFSH 4KZEL 3WKMH 3QHZL 3BX7C 2R1YB 1BZ7A 3W82A 3G08A 4WUKH 4WI6A 1FFNB 2UWEF 1T04B 1XR9B 1MRFH 1NJ9B 3DPBA 2JLLA 1M4KA 4OKDA 4MD5B 4UV7H 4ZTOH 1BBJA 4JO3L 1P4BH 2ATKB 1YEEL 4C57C 3PL6A 2ADFH 5DRZB 5CSGA 1UVQB 1RPQA 1RMFH 1A7RH 3O9WA 1VFOA 1I3RB 4OI9A 1IE5A 3E6FB 2GY7B 1KPUB 1H3GA 3MFFA 2FYYB 1F13A 2J6EA 3R1GH 5DJ6B 5TDNA 1XGYH 2DJ4A 2EE3A 3WD5H 3VA2C 4GW1A 5DLMH 2AQ2A 1B2WH 1OAYH 1NBVL 5L2KD 1A6PA 4FFVD 5BZDB 2RAMA 1IT9L 2W9EH 3MLRH 4BZ2H 2ZUVA 2BNRA 3ZSTA 5IT2L 3N85L 3MA9H 3OAZK 4YIQB 4PGDA 3RL1B 2QKIA 5JW3L 2EDQA 1M71B 4NC1E 5KSBB 5L6YL 1RI8A 1FC1A 6FABH 1RHHB 3IDNA 4FQHA 3UP1A 4TNWK 2EEBA 4YHKL 2VLKE 3SDXB 4QF1B 4DGVH 2GAZB 2UWEE 3ES6A 1KPRB 4G7VH 5LXGL 3GSVA 3VDCA 2CIKA 2PKDA 3P73B 2A9MH 3K46A 2FX8L 3GK8H 2YA0A 1JYVA 4XBEL 3HCVA 5D9SA 2DI7A 2YKLH 4YHPB 1ZT7A 3KPSE 1KLUB 3NIDF 2VE6A 4R0LB 2HT4D 4F9PA 5C0AA 3VRIB 1AC0A 3KLSA 1I1AB 1FYTB 2ORBH 4MNQB 2IANE 2FLRT 5D7JB 4QHMA 5TQ2L 3BYTA 3F7RA 1JN6B 3JV4A 1S78D 4L8SA 5D2LA 2AJZB 5IHLB 2N56A 3QDAA 4NZRL 1LK3L 1MWAA 3MV9E 1N64L 3VXUB 5K9JH 3WIIH 1KIQA 5I8OH 2CRZA 5DVLA 1DQQB 1ZMYA 4P4KB 4CADA 3KR3H 4HJ0C 1A2YA 4LARL 4MAYA 4U1KA 2R23B 5HHOA 1KCLA 3H7LA 5GGVH 1PZUB 4J6RH 4NO3B 3N1QC 1OTUD 4UU9B 2ADJA 1I1CA 3WXVL 2A74A 1SJHB 2DQDH 4LSSL 1DLFL 4OZGF 1JHKL 3ULUC 1P2CB 3BESR 2J1KA 5CSZB 1JCKA 4O58H 3W0WA 1LGVA 4RDQF 1WIPA 4JFEE 1PEZA 1U3JA 2Y06L 3HNTH 4Y16B 1LO3L 4MJIE 3KWWA 4AIZA 2Q8AH 3EUUA 2D4DA 3O3DA 5FOJA 4LK4A 4Q58C 5E1AA 1BZQK 1RUKL 1YECL 3PWPB 3KJ4B 1E4JA 1FGNL 4IMLB 3IU4L 3L3DB 2ITCB 4DFHA 1W72L 1BFVL 4BKLA 3HNVH 4WO4A 4AY0A 5HHPA 4XC1L 2LU4A 4HEPG 5CJBA 2BK8A 4F33A 3TBSB 2E8YA 1HILA 2NMSA 3HZKA 4NJ9L 4OCXH 4QHLA 5B3JF 4U6TA 3V6OE 1UWEL 2IGFL 4XVTH 3CVHH 3U0PA 3QUKB 3HPJA 4FXKA 4R3SB 1Z5LB 3DSNA 3KPMA 4Z0BL 5DR5L 3WEXB 1X5LA 2ICWB 2LE9A 4P46B 4G3YH 5FA3B 1PKQE 1QRND 3OBAA 2PW2B 4OZHB 4XNQB 3I6KA 1TPXC 15C8L 3EYVB 3TJEL 3BGMB 3BIAX 3DOSA 4OZGE 5C6PB 4NKMB 5B4MD 4M93C 2VISA 4B0MM 3L3JB 3GSNB 1KGCE 4RBPK 5DQDH 2BXYA 4PJIB 2HJLB 3QH3B 3WSQL 3CXHK 5IMOA 3UTQB 1K4CB 3BW9B 1IGCL 1V7NL 4QRQA 3QDJD 1YC8A 2CMRL 1ZA3A 3FQNA 4GJTB 4IOSD 1CYGA 4PRPE 3QPQD 2NY4B 3G6JF 1ZV5A 3V6ZB 5AD0B 3G5XA 1WITA 4ZAKB 3GHEH 2CO7B 2VYRE 5AZ2H 4NT6B 4GLRI 4L3EE 2EDTA 2P4AB 1VGKA 4GBXA 2YD4A 5DMYA 5EOQH 2G5BA 1A9BA 3LSOA 3KNBB 4JHAH 4LLUB 4G9FE 3I3EA 3TIDB 4FFVC 5B3JE 3SCMD 4PRIA 4YK4B 2GYSA 4IIQC 1YEKL 3HC4H 3QCTL 4XRCB 4L8DA 5GSRA 2CRMA 3EGSA 1ZA6B 1E4XL 2M26A 1Q38A 3E3QE 3QJFA 4M6ML 5A43C 4F3FA 3O0RH 3BKJL 3QAZB 2HMID 1JF1B 1L7IL 4YDVA 3WHE1 5DS8A 4P3CH 4TSAL 5D7IF 4IRSA 3OAUL 1F3JB 3OR6B 1BOYA 3X12A 4ISVB 1QFUH 4IRZL 4RGMB 1Z0NA 4JO1L 1FIGL 4F7TA 4L9LB 5T1LA 1NBYA 4HV8A 5DHXB 5TGBA 2HT4C 5EZLA 3G6JE 4ZUSB 4NQEA 3MODL 1CFQA 3QRGH 3SOBH 3CDGB 5C0BA 2E3VA 1MCPL 5HYIA 4HULB 5ANME 2P5ED 4KJYA 1MY7A 4YHNA 1NAKL 5D7LA 1DCLA 1S78C 3K81A 2AABL 3BKCH 5D96B 3ULSB 4RFNB 4K2UL 4P5TA 5TDOB 2RIKA 3IAPA 3PP4L 5MI0C 5CINH 3CZFA 1JMXA 1FZJA 4RAUA 4Y8DC 5GGSB 2J88H 4LHUB 2DYPD 5A2IH 4NQUA 1OTUC 2YPKB 5EOCJ 5BS0A 3HG1E 2W0KA 2XQBL 5GGTL 3W9DA 3GRWA 3ZKQD 2PO6D 4N0YL 1PZ5B 5D7IE 3KYNB 4NJAH 3P4OA 2AXGB 3QQ4B 5HYSG 5GS0D 5IGXL 4ELMA 5MEQB 3EYQD 2Q1EA 1BWWA 1OB1B 2HT3D 4UILH 4HUWB 2BVUA 5F89A 2VDRH 2OTUB 4Z7VF 4MQ7B 4WRLA 1U3YA 1CD1B 4M7ZB 4S1RH 1O5DT 3IS1X 5E03A 4K71C 5I8EB 5MP6H 3VFPA 2F8XC 1Z9LA 1OHQA 3LDBB 1QACA 3VWKD 2P7TB 4TN9A 1BBDL 5EU4A 4O5LL 2VDMH 2Z91B 5CJQH 4W70A 4X9FA 3RHWF 1FNAA 3UCRA 5D7SH 5ENWB 1OF2A 2V9RA 3FB5B 3VFVB 5C6TL 1K8DA 1ZSDA 4IJ3B 3QEQD 3WKNA 4YEFA 2FIKB 4UMGA 5GRYA 1J88A 3BKYH 2GCYA 3DMMD 2WZPD 3U36B 5C07A 1OT2A 4KQ4L 3QFJB 2E7BA 3NFPA 1FC2D 3BKML 2J8HA 2YN3A 2I24N 5ESAA 4NOFA 2MPAL 3BIKA 2IG2L 4YGVA 4JEGB 1YUHB 2NTFB 5D6CB 4RX4A 4OAWA 4XNXH 1EFXD 5B4MC 2COQA 2OS7A 3FT3A 1DQTA 3BPNC 4JR9H 5C9JA 4Q9RL 1ULVA 4KVCH 1P6FA 5MERA 3CC5B 4HDIA 3T08A 2IH1B 2FJFB 4ZFGL 3UTTD 5L9DH 1P6AB 4TQEH 3QPQC 2V5TA 4K94H 1HHIA 2VABA 1EK3A 5GZND 5BQ7B 4UTAL 2WAHA 4F7PA 2DTML 2R0WL 3QEGH 4LOUD 3L5WB 3DYPA 1OAXH 4LNRB 2AV1A 5IVZA 5F7DA 1B88A 1UM6H 4Q2ZA 3SCMC 2XN9B 3F6IA 1PKQB 1S7XA 3E8UH 4L3CA 4P2RB 4X6DB 1DSFL 3CU1A 3T0EC 1FSKC 1EVTC 2Y36L 4PGBB 2GT9B 2XRAH 5JXAL 3DVFA 1IAKB 5DMKB 1A7OH 2HMIC 1N4XH 3FOLA 4JDTH 5FM4A 4GUPA 3K2UH 5IVXE 2FBJL 1ZVSB 1D6VL 2X4NA 4LCYA 5D71H 4AEIH 4KJPD 5GGRA 4PJ9B 3EJZD 4ZTPH 1DBML 2CLRB 1X5FA 1V3JA 1YQVL 5JORA 4K7FB 4NCDA 3FO2B 1FQ9C 4WWKD 4G8GB 4MCZA 3NH7H 3RWDB 4LCUB 1G6RL 1YEEH 5EUOB 3HC0B 3K2MC 4N8CL 3TPKA 1QKZH 1ZS8B 3VFWB 5C08B 5BOPA 5FKAB 3JXAA 4YZFF 4WI7A 1P84J 1YEJL 3A6BH 3TT3H 3DIFA 4HCRL 2DLFH 5E95B 3KYKL 3CGTA 1CXEA 5SV4A 1NCTA 5ACZA 1C08A 3UMTA 2OYPA 2YSSA 1FFPB 3WN5B 5T1KB 4KXZH 5SX4H 3BDXA 2H6PB 1ZHNA 5F9OL 3GJFB 2AI0L 2NY0D 4QRUA 5E2JA 1NBVH 3MRGB 2B1HL 1IT9H 1IGTA 2PO6C 1A7NH 1OSZA 4U49A 1AQKH 3QQ3B 5IT2H 2OK0L 2CLVB 3N85H 4U1LB 1G7QB 5GS0C 2V2WA 3NA9L 5GIRB 1DQLL 5GRUH 4BUHA 3EYQC 3P77A 4KJWD 2HT3C 4XPGL 1LQSR 3TV3L 1DBAH 1XGPB 3K8KA 3O4LD 1Y18A 4WJ5A 2CH8A 2G5RA 5ANMB 4YHKH 3W2DL 5KG9A 2LU3A 3SDCD 2CDEB 1T22A 2ZUYA 4HIEA 5MENE 1ZT4A 3VWKC 4QRRA 2VIRB 4O02H 4PIRF 2FEDD 1M7DA 4JVWA 4HG4K 4XBEH 1NEZA 3DVNB 3IDJA 2ICES 1XCTB 3MRPA 3BDBA 4L4VE 4YZFE 2EYSB 3IDYC 3C6SB 1HZHL 4YC2B 2GW5A 2P5WE 2WQRA 3DMMC 3MRCA 4P3WA 1KF9B 4UNTA 4DFIA 4U3XA 5D7IB 4HPYH 3KHOA 2Q8BH 1HIMH 4NZRH 1A64A 3MV11 1N64H 4MYWB 4C56E 5CEZE 4ZQKB 1N5AB 5AAWA 4JFXB 5D2NB 5IIEA 2R2EB 1TQBB 1A1MB 3EDDA 3GMNA 4K7PL 1B4JL 4LP5A 2I9LA 5CCKL 4LARH 1KIPB 1XF5A 1BVKB 4M7LT 2W9LA 3L3OA 1A1NB 1H3PH 4GRMA 5HHVH 1YC7A 3WXVH 4UIMA 2YS4A 5TDPB 3U0WL 4Q9CA 3BYYA 1Q94B 3QULB 1IAIH 4E42A 4GRLB 3O2VL 4LSSH 5FUZL 5IJVA 3Q6FB 3S5LA 1SVCP 2FNBA 3OZ9H 5GZNC 3MLXH 3HUJF 1TCMA 5L2KA 1S8DB 2AKRA 4N8VB 1U8NB 4OI8A 4LOUC 1ZT1A 2GEEA 2OSLA 4LRNL 5I1AA 1JYNA 2MJWA 2Y06H 3I75A 5I73B 2EXWD 3VXPA 3I02A 1KJ2B 1LO3H 4R8WH 5GSVA 3K4AA 5IFJA 3MCLL 1SEBB 4ODHL 5D8JL 3ZKND 3FAXA 1RUKH 1YECH 1VFAB 1A3LH 1RFDL 1ETZB 1FGNH 1RVFL 1W72H 4O00A 5I1CL 4D0DA 5EZJB 5T1MB 4XC1H 2YUZA 3BD5A 1C1EL 3ZTJH 5EFIB 1LE9A 1AGDA 1UWEH 4NQSB 4HK3N 3MFGB 1G7LA 2X4OB 4G42A 4Z7VB 4LEOA 4Z0BH 4HWZA 3VXRD 5J3HD 1MFDH 5C0ND 3WFCL 3KPNA 1TVHA 3T1FB 1TZIB 1NDMA 2P1YA 1JFQH 3H9YA 3EJZC 1NGPL 1W0YT 5LAXA 5T3ZE 4OCSL 4WWKC 1Q72H 3NCYS 2ZP0T 4QYOB 4PJ5B 1NAML 4LVEA 3HUJE 3QUML 2HJFA 2FEEL 2GFBA 3WSQH 5F9JA 3FRPA 1P4IL 3OKKA 1XF3B 2A6KA 4BK5A 3OKYA 4Q6IC 2CMRH 2DLTA 4WY7H 1AO7B 1PX3A 5BOZG 4NN7C 2OTWB 1I1FB 1KUMA 4MA1B 3OR7A 1KJVA 2DQIL 3U6RB 3PNWB 1EXUA 4M02A 4LBEA 3MNZB 2NY0C 1XH3B 3OX8B 1T5XA 2VZVA 4MSWA 4WW2F 2VXQL 2X4PB 5DMGD 1I8MA 1MEXH 4FOMA 4G6KL 1Z3GH 2VITB 3SEPA 4R26H 1Z0MA 2X70B 3F7PC 1E4XH 4KJWC 4YHZL 4M6MH 4XPAL 5GGUA 3FL7A 4UQ2B 2EC9U 1L7IH 3REVA 4UTBL 1TZGH 5HJ3A 1NMCC 1H0DA 3SDCC 1J12A 4NUJA 4S0SD 4TSAH 3IT8D 35C8L 2F53D 1EZVY 2Z93B 2YRPA 3GNML 3VDBA 1TJIL 1HHJA 1JNHB 2VDQH 4M5ZL 4TUOB 4PLNC 2FEDC 3SDAD 3WNPA 3IJHA 2AS5M 4IRZH 3ZYJA 4B41A 3GIVB 1PSKL 5F9WC 4I3RL 4PJEE 1QD0A 3IJYB 5F44A 1ZLWK 2AXHA 5IV2A 3KDMB 3B9EA 3QXVA 5E94A 1QRNA 5I15L 1SYVA 2IQAA 1CDYA 4K7PX 4NNYB 2YWYA 1IM3A 2JB6A 1NAKH 4RISL 4M00A 4HD9A 3RPIA 1AY1L 3VFRB 1F58H 3Q3GB 5LJYH 3R06A 2AABH 4OCLC 3HC3H 1BOGA 2A83B 3CFKB 3OXSA 3QA3A 1JZ4A 4FQ1H 3LV3A 3SDDD 4LMQI 1S7TB 4K2UH 4WFHE 3PP4H 3WJLC 5ADOH 1KXTB 2C1PA 3MMEB 1I75A 3QDJA 5HYQA 3QEUB 1MHEB 2ARJA 4HUVB 3O41B 4Y1AD 1CXLA 3BZFB 4U7SA 1ED3A 4NCC1 1P7QB 1JNNL 1D5IH 5GGTH 5I71B 4XVJL 3LMJL 3BN3B 4KJQD 3WFDH 1ACYL 3QO0A 3SJVA 1AGBA 4GQ9L 4JG0H 1RK0A 3QJHB 5IGXH 1A02N 4OLWL 5DJ8B 2PYFB 2BCKB 4HJJL 4KI5F 5DD6B 1GZQA 4M1GL 5JPMB 2EXWC 1CE6A 1BX2A 3RAJL 2CLZA 2P5WB 2V9QA 3LQAL 5CS7A 5IUSA 4KAQH 1HHHA 1A6UL 1YNTB 3ZKNC 3BH8A 5ISZD 1NCCL 1DUZB 5L8LB 4CVZB 4NN5C 1ZTXH 4O5LH 1OLZA 5E8EA 5IB3B 2NTSP 2J2ZA 1IRAY 5TE7H 1HWGB 5FGBC 3ULVF 1CICB 3KPLA 4X4YA 1F3DH 5IMKB 5FKPA 4TVPH 3BP5B 4FQ2L 5B3NA 3NCJL 4NKQB 4BFIB 3WCYA 2VN4A 1LEIB 5DZNA 2AQ3A 2MKWA 4R4BB 5J3HC 3RGVD 3ROOA 5C0NC 1KSRA 2XA8H 5CEZL 3CXDL 4KQ4H 1NCUA 3FRUA 2ZUSA 3MV8D 4ODXB 3BKMH 5T5NG 1FL3B 3OWEA 1QR1B 2MPAH 5F3HB 2IG2H 4R2GB 2P5EA 4HJGA 3TNNB 4Z7UF 4W81A 3BUTA 1A4JB 5HGHB 1T89C 5ACMA 1QEWA 4X7TB 5HVGB 5HI3D 3WUWG 4KMQA 3T1WA 1VERA 3PQYB 5T3XH 1UWGL 4XNZC 2MKLC 3TZVB 3B6SA 2X4UB 1N3NA 4KHTL 2HRPL 1HINL 1RU9L 4KKAD 4FNLL 1KG0B 4AL8L 4ZFGH 4Z95L 3UX9B 1I7RB 4WU5B 2DYPA 4UUJB 5GXBB 4JJ5B 5CEXB 2JB5L 3CSBA 4X83A 3S36H 5IBTL 4HGWB 4OZFA 3GIZL 4HEME 4L8BB 2PO6A 4FQJL 2ARWA 1YJDH 3QUXD 4N0UE 2X41A 4K3DH 5JOPD 1MCQA 2YC1A 1D9KD 1LO2H 1NC4B 2DMCA 1KCSH 4I2XA 4H26B 4PS4L 1HQRB 4QXUH 4CVXB 1FZOA 2AXFB 5DMGC 2G2RA 5JLZB 5JW4N 2B8OT 3LH2H 4NQDE 2DAVA 4LU5H 2HFFA 2Y36H 4ZUVA 1X4ZA 5F93C 1CBVH 4QRPE 3X14B 2JJWA 3MACH 1T66D 3VGGA 3VWKA 4XXCA 1I8IA 4BQ8A 5E2UL 3DROB 3QFDB 1CDBA 4Z7UE 2FBJH 3L5XL 1ORQA 1FNEB 2IH3B 4S2SB 4Y5YC 5H8DA 1MRCH 3WLBA 4PJAB 4HZLB 1BFOB 1FG2A 1L7TL 3S4SB 3SDAC 4FABH 1O7VA 1UB6A 3AAZB 3QEQA 1NBZB 1OGAD 5AWNL 1MJJA 5T3ZL 4EEEA 5A2KH 3LKSA 1DBMH 3BUYA 1OOAA 3H9SB 5JIKA 4OTXL 1AP2B 3DMMA 5IBUG 2BX5A 3MJ8B 1KNOA 1YQVH 1QOKA 2AJVH 3IFLL 2I07A 5C92A 3TO4B 5KN5A 2FZ3B 2A1WH 1I1AD 2XV6B 5FM5M 3ECBA 2GK0A 1G6RH 5CD3A 1D7FA 4N8CH 1RHFA 5D7JD 1K9TA 2Y5TA 2OJEA 1EFXA 5FO8B 3DX8B 3QNXA 5J89A 3O45B 2GJ6B 3SDDC 4S1QL 2A6JA 3GSRA 2HFEA 3IF1A 3VGEA 4K94C 5GISL 4L8CA 1YN7B 5MEPA 1ONQB 4P4KD 3UTTA 4HWUA 3DXAE 3ARUA 4UAOB 3SPVB 1KN4L 5I18H 4LKCB 3ARSA 2PF6A 3STLB 2B1HH 3IU3A 3VXSD 3CFIC 5E8OB 1UA6L 4KJQC 2MHAB 1UZ6F 32C2B 4PP2B 1INQA 1B0WA 3NA9H 3U2SB 1M05A 4XTRD 2R8SL 4X6EB 2Z92A 2I26N 4YNYB 3TV3H 2QJDA 1CVRA 4LSTL 4Z0XB 2CPCA 1FYHB 4RFEA 5CKGA 3F5WA 1IQWL 3W2DH 3O6LL 4CBPA 1QBAA 3V6FA 3C5JB 1EJOL 3IJSB 1HOCA 1VA9A 3SHSA 4WI8A 3MLPA 4WW2B 5DMIL 2CRYA 3VGDA 1FVCA 1WFOA 4ORGB 2WWMC 4YXHH 2CXKA 1X5AA 1F8TL 4J1UB 5E8NB 1HEZB 3OG6B 5D5ME 2YUVA 3RGVC 1MRDH 4KI1A 3T3MF 1UB5A 1E4WH 1GIGL 1A9EB 3BPLB 4XP6L 4WWKA 1OARL 3V5HA 4LSVL 1CK0H 4P46D 4EXKA 2XWJB 4OGYH 3MUJA 2Z35B 4Y4FB 5AUMA 5EBMB 5BJTA 4K7PH 4HIJB 5HI3C 3WJJC 4DCQA 3N1PC 1JWMB 4QHNB 3KXFE 1EDQA 3HS0B 3Q1SH 4Q6IA 5DC0A 5CCKH 3TFKD 4HMDA 3RJDA 3LPWA 4YBLB 3MLUL 4NHCH 4KKAC 3BQUA 3U0WH 2BJMH 1JPSL 1MJ8L 5DC9B 3SKMA 3O2VH 1YMMD 5FUZH 5J1SC 4LPWA 1G1YA 2VC2L 2PYEB 3WS3B 5JIPA 3L6FA 3S98A 4ZAKD 4NO0A 1VB9A 2X4TA 4LRNH 3MV7E 4XCFL 3QUXC 3O6FB 1D9KC 4BSWB 4OM0L 1QVOA 3GMMB 2GSGA 3QIBB 4PJXF 1N0LA 3ZE2E 4YAQB 5D8JH 4WI3A 5J12B 3O4LA 4RIRA 4KY1H 1HSBB 4HWNA 1RVFH 3T3ME 3SDCA 2B5IB 2EIZA 5DK0A 1P7KB 4G6JL 2GTZB 5I1CH 3FFDB 3NZHH 1T66C 3CVHA 4U3CA 4MA8L 1KJ2H 3QQ9D 4POYA 4P2YA 2DBLH 1CQKA 2NY7L 1S9XB 3P0YH 4OD2B 2CDGA 2QLVB 3C8KA 3RGHA 2CJUL 5E7BA 5BXFA 5EC1A 4JN2A 4G6FD 3QG6B 2YMXL 1F02I 5IROC 3A67H 4JO2L 5F7EH 1LILA 5BRZE 4MJ5B 3B83A 5INDA 2XZCL 3GSOB 1C12A 4OCSH 4R0LC 2X4RB 3HAEB 4ZPVA 3DWTA 5TPWL 1I1AC 3WJLA 5D7JC 4Z8FH 4NQDB 3D85B 5C0EA 2JCCF 1IM9D 4APQB 3KG5A 1IEAB 2XWTB 2E7MA 3T65B 4XCEB 5GGRY 3CDYA 3SO5A 4PJXE 2RQ8A 2GTWA 2AERT 3CNKA 5I8CB 1TMCB 5KVDL 4KZDL 5DI8A 4P4KC 3UPCA 4WI2A 3QPXL 1FHGA 5DJ0B 1T1XB 1WZLA 1DQJB 2VLKD 4GMTL 4Q0XL 4PJ8D 1NGXA 2QQNL 1U95B 3MBED 2J5LB 3SKNB 4Z7WF 5DYOA 2OR7A 3UJJL 4PB0L 1U58A 5IM7A 5F88B 2WSKA 5FCUL 3KS0J 4XTRC 3ARTA 1ORSB 3L3HA 4XPAH 4ZD3H 4M8QB 2A77L 3C8DA 4EOWH 3WO4B 3CXHJ 5J06A 4HK0B 4UTBH 2QL1A 4ZMAT 5IW6A 3AREA 2IAND 5EOCL 2VXUL 4TVPD 5FGBA 3M45A 4FZEL 4M5ZH 1IAMA 1MHHA 3KJ4C 4OCYH 4RMWA 25C8L 4WFFD 3LKNB 4X8JA 1JHTA 4OLZH 3VD5A 1IC7H 1UXWB 1B0GB 5D93B 2JCCE 1NCWL 3VXRA 4TOYL 4ERSL 5E5RB 1G7JA 2I5YL 4XMKL 5I15H 3QIWB 2G9HA 4PREA 4JRXB 5T3XD 1S5IH 4RISH 2FSEB 1AY1H 1T89A 2BOBA 5B21A 1UH2A 3FB7B 1RJCA 2ATPA 3L9RA 3MOAL 4RAVA 4XX1G 1TJHL 4P46C 2A6DB 1ZWIB 1U3ZA 3EZJB 4UBDD 3VFNA 1ZAGA 4Z7WE 2EDDA 1MUJA 3M07A 3PJSB 4MLIA 5DGRA 4JFED 1EAPB 5ESVA 5ERWB 4LF3B 3RDTB 3TFKC 3U9PL 1R5WB 4MJID 3TP4A 3GM0A 1JNNH 3N50A 1YNLH 1CDJA 4H1LB 2DKMA 5E8PB 2IBGA 2BHZA 4F8TA 1HI6A 2ZPKL 3EYFA 5GS3A 3BZDA 2UZIL 4GS7B 3VXMB 1ZHLA 5EUKA 1I9RL 4ZAKC 1FL5B 5FGCB 4HAFA 4G9DA 5HGBA 5BZWB 5DK2A 4EUPH 1JPFB 5DRWA 3LEYH 1RURL 1SVZA 43C9A 3RAJH 5LGJA 1J10A 5FIEA 5HDQL 3LQAH 3O2DH 9CGTA 1TTUA 1YPZF 1U8LB 3L7FB 1SMAA 2XY1A 1A6UH 1QA9A 5C09B 4ZUWA 4MNHA 5KVEL 1F4HA 1F4YL 3BH9A 3EBAA 4MQSB 5E5MB 1U3HD 4YK4C 1D6EA 1EUTA 3UDWC 3S8WA 1S7RB 3ARFB 4FMFA 2UUDH 2WANA 5EO0A 2APTA 4Y5YA 1MOEA 2AK4E 3FJTA 3KXFB 1CLZL 3QQ9C 1IC4L 4PLKD 1KGCD 1CQYA 5E0QA 3SDAA 5C0JB 1R3LB 3QDMB 3VD3A 1Q9LB 4PRDA 1LNUB 4D3CL 3CXDH 5HYSB 4Q9BA 4LVHB 4XPHL 1FPTL 4RGMC 1FNSH 4PJ9D 5C2UB 1BLNA 4LSRL 4HFUH 2OX5A 3F12A 4H20L 1RZGB 1F2XK 3EYUL 4L3ED 3Q6GL 1CWVA 1JBJA 4BSVA 3SDDA 2HRPH 5J0BA 1TCRA 1LP9A 1Z9OA 2DLEA 1KCUL 5LKNA 3OXRA 3GO1L 4G9FD 3CH1A 1RU9H 2HFTA 4FNLH 1EJ6A 2GY5A 3GMOB 4AL8H 3HNSH 1CD8A 3GSUA 3ARQA 4PYHA 3MRRA 4JFDB 5C08D 1YPZE 4RFNC 4Y1AA 3G9AB 4NC1C 4DUVA 2JB5H 1BFSA 3QBTB 5IBTH 3WFBL 3CDFA 1FZMB 2WINA 4OF0A 4FQJH 2W0LA 2J7LA 4QRTA 4PJ8C 2D9CA 3NPZB 5IB2B 2ZZUT 2G75B 5IG7B 4JVPA 1OVZA 3MBEC 1PW3A 1K6QL 5L7XH 1U6AL 2LQRA 4P2QE 3MGOA 3BXNA 5D70H 2AV7A 4QXGL 3UTZA 4PRNB 3RWEA 1JGEA 3QWOB 5ISZA 1N5YH 1F90L 5E2UH 3L95B 5IKCA 3BZEB 5J1AB 2JIXB 4M7ZC 1XFPA 1EGJL 4OT1L 1CU4H 3LN5B 4M3JA 2BVEA 2FR4B 2ZCHL 5IESL 1MAMH 1L7TH 3UBXA 1G7IA 2NY6D 4FFZH 4X99A 4HUMB 5T3ZH 4TVSa 3RGVA 5FUCE 5EU5B 5GRWA 3GJEA 2WIMA 3MV8A 3WIFA 3IFLH 2SEBA 2D3VA 4IJ3C 4F9LC 4KTEH 4M1DL 5E9DE 4X4MA 3H7BB 3HG1D 4OGXL 2R1YA 2DQCL 3L1OL 2V5YA 3WJJA 1KJMB 1MHCB 1FFNA 1RUML 3VFSB 1A4KB 4F57L 2MCPL 1JYWA 1VEOA 1U8JB 3GBLA 4MD5A 1U92B 3CJJA 1QBBA 2ZCKH 4HXAH 3F62A 4HQQH 1RULL 1UVQA 3HPLA 4PJFB 4F7MA 3MZGB 4OF3A 3VH8G 1YJDC 5CGTA 4XXDB 1I3RA 3HE7B 3PV7A 4DAGL 3D9AL 3E6FA 1KPUA 4PBWD 5FYLL 4AJ0A 4R7DB 3QUXA 2M1KA 4GRLD 5DJ6A 2J6EL 1D9KA 5KZCB 2DRUA 2BC4B 2VJXA 5I1KH 3F8UB 2K7PA 4U1NB 1OAZH 4ZFOL 1RSFA 3C87A 5AYUL 5ADPH 4IDLA 1VGEL 3V6OC 3UTOA 4X6CA 1A6ZA 3QI9B 4X6BB 4YIQA 1Z9MA 3RL1A 3RWFB 1UZ8B 5KSBA 1EMTH 1U3HC 4QOKB 1MFNA 2X4SA 1YDPB 4K9EH 3GJFK 2D03L 3LEXA 3SDXA 5FO9A 3BWUC 1CDCA 5E4EB 4XNYL 1LHZA 4PLKC 4PB9H 4Y5XC 1J1OL 2VXSL 5IEKA 3TWCL 1OGAA 3D39E 5DD3H 5IROA 5E08H 5FYJU 3S3SA 2VLLA 4YHPA 1GIGH 1AGFB 1KLUA 1AD0A 2DIJA 4R0LA 5LWYH 1U8QB 4JDVB 4PJ9C 1YYLH 2XYCA 1ES0A 1I1AA 4NKDB 5D7JA 4MA7L 3S96A 2ZKHL 1JN6A 2O5ZL 4OUOA 4CJ1A 4ODWB 3DURB 2FIRT 4UT6L 1G9MH 1MWAL 2OZ4H 3QNZB 4J7RA 1QBML 5C07E 1MH5B 4P4KA 2EC8A 1JPSH 1MJ8H 4M6NL 4HG4J 4DKEH 2HFGL 1CCZA 2ZJSL 3MROB 4AIXA 4PFEA 4YUEH 4NRZB 4B50A 3E3QC 5IQ9A 3M17B 3VXSA 3WNNA 5EU6E 4IOIA 3AM8C 3RWIB 4OFKA 3NFNA 2B39A 4FHBD 3WN5C 1MNUL 4OM0H 3ZL4L 1I7TA 1I4FB 5DQJA 5CSZA 3MXWL 5MHSE 5CSBA 1W72A 1L9NA 1X7QB 5IOPB 2R39A 1F6LL 1ZLVK 5T1DL 5IVNA 4WNQB 1EEYB 1BEYH 2QHRL 5I0DA 3IAGC 2YXFA 3MJGX 4OIBA 1X4YA 2WBKA 1TVBB 2DJUA 2EC9T 1Y6NR 4QWWD 2NY7H 4IMLA 3L3DA 2ITCA 2Y4SA 4O4YH 4OF7A 4EDWH 1XGQA 3CH8A 3GSQA 1WAAA 4MMZC 2YPVL 2ZCLL 4GG6F 1KTDB 2NY6C 1KCRH 3NACL 3MRMA 4JO2H 1EO5A 2VXVH 2DQTH 1KV3A 3WEXA 5JPNB 5FV2A 4PJGF 2ICWA 5TPWH 4P46A 3N0PB 4OZHA 2NY2B 4XNQA 4YC2C 4LP4A 1J0IA 2VQ1A 3SE3C 3ARXA 3T4YA 4NRXB 4DKDC 3L3JA 4P2QB 2YK1H 1YY8B 5IMMA 5D2NC 3TYFB 1TQBC 4Z18A 4JKMA 2HJLA 4PJIA 4TTDD 3HAEH 4EN3B 3UTQA 2FB4L 1YY9D 2ED8A 4M3KB 3ULVH 3B9VA 3BW9A 2DL9A 1YMMA 2NLJB 4Y89A 4ONHA 4Q0XH 4U6XA 5AD0A 2JJTC 1P7QD 2QQNH 1EZVX 3KPOB 1VEMA 1E4KC 1AE6L 3CUPA 1NGQL 4ZAKA 5IFHL 5MEND 4UOW1 5ICZA 3BWAB 4NT6A 4GKZB 3RHWK 3LKRB 2NNAB 2FDBP 4GRLC 3OTTA 4KU1A 2VZ3A 4PB0H 4EI5B 4LLUA 1X5HA 3VA6A 4GG6E 1LK2B 4L4VD 1I7UB 3P4LA 2BSTB 3MRHB 3TIDA 4V1DE 4GLRH 4JFFE 5F7NC 1JTPA 4PUBH 2A77H 1BD2B 2EDBA 3GBNH 3T2PA 5E9DB 3UDWA 2GJZB 4OGZA 3O3BA 3D5OF 3JWDH 3ULUE 3D69B 4XRCA 1BIIB 2P5WD 2VXUH 5D1QA 2H9GA 1ZA6A 2F5BL 2KKQA 3MRKA 3IAQA 4FZEH 1JPTL 3O6KH 1DBKL 1S9YB 25C8H 1V8HA 2KL6A 3LKOB 4AMKL 1GC1L 4C56D 5CEZD 4S1SL 3I9GL 3ZZ1A 3HB3D 4XI5D 1UXSB 2OCFD 4X6FA 3RWJB 4YHOL 1CDIA 4ZUUB 3FQTA 5SWSE 3ZKXB 1LEKB 3QR2A 1XGUB 2O61A 3F7YB 3GSWB 3HI1B 3MRLB 2JK5B 3EYOB 4DN3H 1HHGA 4YDIH 4QRRE 3KPPB 4JKPL 4PD4K 4ZXBD 5ID0B 2I9TA 1TJHH 3QIUB 3RWCA 1QFWM 4P3DB 1ERNA 2HN7B 5GRZA 1FVDB 1UM4L 1IM9A 4MNGB 5GGTA 3MLTB 4AIOA 3MCKB 2MQ0A 4EDXB 2VQTA 4LCCC 1V5JA 2AJXL 3TPUA 4C4KT 5JHLL 1Z9SA 3MYJB 3SE4C 2VLKA 4PJ8A 2UWEA 2UZIH 2YPKA 1EEZA 1I9RH 3QCVL 1VFBA 3MBEA 3NIFF 5HGAB 1N8ZB 2ZUQB 3D39B 5EH1A 1RURH 1PZ5A 2A38A 2R0KL 1I3VA 4H1LH 4FQIH 3QQ4A 5HDQH 4XWGL 4NWUH 5IJKC 4R90L 3DUUA 3FOMB 2K9UA 5KVEH 3B9AA 4HAGA 1QNZL 3DYOA 4MQ7A 4NO5A 4YDJB 2YPLE 4GKSB 2IANA 2V2XA 3IXTA 3U30B 5T3ZD 4QWWC 2Q86A 3EO0B 4OB5H 4NZJA 5EWIH 1F4XL 4I0PB 2P7TA 3JTTA 1TXKA 1D5MA 1MF2L 4D3CH 2CRIA 2UUDK 3EIFA 5ENWA 3EFDL 1FN4B 1CFNB 2D31B 1B6DA 1MFBL 4F9LA 1HH9A 4E5XB 2FIKA 3KHQA 1U8PB 4H20H 5JMRA 3LN4B 4HIIA 2F74B 3V4VH 1ZLSL 1JWSA 4OIAA 3TO4D 3SBWC 3GO1H 2W9DL 3AXLB 1J1PH 4YXLL 3HMXH 1IVLA 4JFEA 4AM0A 1GGBL 5DEFA 2Y23A 5TE4L 1WZ1L 7CGTA 4MJIA 1J8HE 2GJ6D 4DGIH 2OR9L 2WWKT 4AH2A 4TTDC 5I1DA 4JZNB 3MLSL 4ODVL 1YY9C 4RA3A 5J4MA 2W65A 4TUKL 2XTJE 2IPKA 2XWBB 4Z76B 1X44A 1NSNL 1S9KC 2P43B 4WEUD 4FFWD 2O5YL 3HR5A 5I71C 3LQAC 3JVGC 1IEBA 1H3XA 4KRMB 3JV6B 3V6OA 4KTDL 1Q0YH 2ZSVB 1DEDA 3L5WA 3SKUD 2XNAB 1U6AH 3CFJB 3WUWB 3EOBB 4WI5A 5EU3B 4QXGH 4MB5A 4LNRA 3FB6B 3B4NA 1V05A 3BN9D 4ZYKB 2KBGA 1U3HA 3S35L 1PLGL 1PKQA 3CPLB 3GSXB 4IRJB 1AXSA 1QSFE 4M62L 4H88H 3VI4F 2GT9A 3OPZL 2DS4A 4OZGA 5DMKA 2ZCHH 4NBZB 1VKXB 4XBGB 4I4WB 2X1XR 1QO3B 2JKXA 4Y5XA 1GSMA 4WEMB 1WBZB 4QY8B 4RNRB 1E6OL 5ETUB 4WFHD 3K4DA 2CKBL 3GGWB 3HB3C 4XI5C 1U8OB 3FKUS 1X5JA 2R56L 5JZ7D 1G6RA 2EO9A 3VXNB 4XZUA 3FQUA 4M1DH 3UTPE 3BEVA 2EKJA 4Q7DA 4OGXH 1WTLA 3C60D 1ZHBB 1GPOH 2I27N 3L1OH 4LFHG 1R24B 4OCRL 4L3EA 5ILTL 2FHFA 3AU1B 4U1MB 4ZXBC 1WT5A 2FLBT 1ND0B 3KGRA 4KXZI 4F57H 5SX4I 2B2XL 4WUUB 3DI2B 3SGKC 4GG6B 4TRPH 4YGAB 4G9FA 4RSVA 4Y4FD 1I9JL 4V1DB 4EVNB 4JFFB 4XVSL 2MQCA 1ZS8A 5GJTL 1RULH 3TZVC 3RX7A 5C08A 5FKAA 5ELIA 4PJGB 4DAGH 1ZHKA 4JFYB 1N0XH 4A2LA 3OMZA 3ARGD 3AM8A 1Q9OB 5IBUB 3U4BL 3WN5A 5FM5O 2EH7L 4OLXH 3X13B 2H6PA 2PYED 4AEHH 5DT1H 3ULUL 3WFEL 1RZJL 3G5ZB 2IBBA 3O6FD 4OQ1A 2XZQL 4JHBA 1G7QA 2IALB 4CAGA 4NKOA 4PJCB 5DEZA 1GHFL 4Z7QF 3G6JA 3K74B 4NFDA 3TJHC 1TFHA 4UDTB 5ANMA 4DQOH 2IMMA 4XNYH 2E9JA 4J3SA 1P4LB 2VLJE 4J8RA 1J1OH 5I1HL 43CAB 4CRPA 3T0EE 3EOTL 4NPYB 4KI5D 3G6AB 2DJSA 1S9VA 3VJ6B 5HYEA 2BVQB 1XCTA 1BQHA 4FRWA 2EYSA 1GVIA 1CT8B 4HLZG 1JE6A 1G84A 3H42L 3C6SA 1A6AB 3WFHB 1UGNA 2FD6L 5J6GA 4JY6B 3HG1A 1RUQH 4G6AD 3SE3A 1WISA 1IAII 2ZKHH 5D7IA 4BYHA 5KSAB 5DWUL 4M43H 3TO4C 2NR6D 3ULVD 4E0RB 4N0RA 4WCYL 1T0NB 1A7PL 4JFXA 5D2NA 4PR5B 4NQDD 4ZDHB 4M6NH 4NM4L 4APQD 2HFGH 1FGVH 2BNQB 2ZJSH 1BVKA 3BDYL 2P5EE 2B0SL 4Z7QE 1FCGA 3RTQD 1LE5A 5F1KC 1A1NA 2JJTA 4QRPD 3PXHA 1OQOA 1SBBA 3FCTB 3BZ4B 3RNQB 3QULA 1RIHL 4GRLA 1EIBA 4K23L 4UAOC 3ZL4H 2CQVA 3GDBA 3AC0A 3L7EB 4OSUL 4X9BA 5C0CB 4FFWC 3MXWH 2N4IA 1PG7W 3S35X 4NSKB 4NNPL 2APBA 4G43B 5LQBL 1DJSA 5DJCB 2JJUA 2CO6B 4XCCL 4K9EC 3BN9C 1SEBA 2HJKB 2HG5B 1T2QH 4JAMB 2GITB 2F15A 5J8OA 4YEEA 1ETZA 4KMLB 2X89D 5JQ6L 5EOTA 5AYQA 1Y6MR 2YPVH 5DHVB 3ROLB 4BUGA 2ZCLH 2XZAL 4MXWL 1EHAA 4HT1L 1NBQA 3EDFA 1J8HB 4PLJC 4WW2C 1EO8H 5EFIA 2F19H 4NQSA 1WCBB 1UENA 2C9AA 1JHLL 2ICWI 3U9UB 2E6PA 3VFGL 4Z7VA 3DXAD 3QUMA 1W8NA 5JZ7C 3CIQA 4X4XB 4MZ2A 1N2RB 5CILH 3P11L 4YE4H 1T7ZA 2HLFD 4N90E 1NEZG 1C5DA 4X80L 5JMOC 4HF5L 4YO0A 3QIWD 3C60C 4JRXD 2DQGL 1P9MC 1G9MC 5LBSL 3OKNA 1R3JA 3LAFA 4U1SB 2FH8A 3BPLC 3OKLB 4QYOA 4UT7L 4WWID 5GS1A 5IBLD 3RWHB 3PDGA 4Y4FC 4Z7NF 5KAQG 3AS2A 4GXUN 1NGZB 2EE2A 3DX7A 4LCCA 1DL7H 1L6ZA 4WU7B 2FB4H 1XF3A 5DK3A 3U7WH 3RUGF 3SE4A 1QSFB 1E4XI 1V3MA 3RX8A 2OTWA 1NGQH 4O2FB 5IFHH 1I9EA 3ARGC 5E1HB 4CU6A 1DN2A 1JJUA 3MTRA 3HRZB 2YUXA 3MNZA 3TO2A 4J3WA 1OCWL 2FO4B 5IJKA 2IFGA 4DOHE 4NKIL 1XH3A 2X4PA 4ZUTB 1W0VB 4XMPH 3T09A 3O6FC 2VITA 1I1YB 3H9ZA 5FUOH 2BOCA 4F58H 4PYGA 4IHOB 3QIBC 2AJUH 5F21B 3T2NL 2F5BH 5F1SA 2BFVL 1DBKH 2A73A 5M94B 3OGCB 4IBLT 4AMKH 4EIZC 4MDJB 2B5IC 5H2BB 3PP3K 5EULV 2F58L 3B9KB 1MFCL 2BRQA 3KXFD 4XT1C 3R8BB 3FFCB 4UT9L 1MI5B 4Z7NE 2EKSA 2Q6WA 1HE7A 4KI5C 4D9RD 2AAVA 2ERJB 1UQSB 4P9HL 3RUGE 4H8WH 5HVHB 3S34L 4GMSH 1ITCA 3C9NB 5EORL 1K2DA 1D5XB 1DDHA 4LPCA 3DECA 1B90A 4G6AC 3SBWA 4J3VA 5CJXC 3STZB 4NP4L 1OWWA 4CW1B 3CSYB 3MV7D 3VFRA 4JPKL 4JQIL 2NR6C 3JV5A 5DVKA 3ULVC 1R5IB 4X5LA 3P9WB 3RI5K 2V2TB 2QTEA 1S7TA 2VNCA 3RRQA 1UWXH 1A0QL 4HH9B 4OCMC 1U2HA 3WLWD 3FO1B 1BWMA 4APQC 2AJXH 8CGTA 1MHEA 2PR4L 2DICA 4JFDD 3RTQC 4EUPA 2NX5B 5C0RH 2F8VA 1P7QA 5MENA 3RVUD 2AK1L 3VXOB 3MJ9H 3O2DA 3JVGA 4RWYL 3CK0L 4XPBL 1HH6B 4W6XB 4JGUA 1XF2B 4UINL 3OJDB 3LD8B 4L4VA 3QJHA 1DVFB 3JWDC 1VDGA 3HI6L 5DJ8A 3Q2CA 2J5LC 3DO7B 2VERN 5DD6A 1LD9B 3QZWB 5DJAA 2NW2B 1KB5B 4ZOEA 1I8LC 2P5WA 5A2FA 1QPXA 1HN1A 3QXAA 1JGVL 2EDJA 2XIDA 3HZVB 1AKJD 1T21A 3I85A 4C56A 1F4XH 3UJIL 1DUZA 1P1ZA 4HC1L 1MF2H 1QSEE 3O4LE 4RQQB 1DR9A 5IEHA 5IMKA 3QDGB 3BP5A 2NY5H 2K1MA 5SWQB 4L4TB 3H3PL 4NZTH 4R4BA 4ZXBA 2HLFC 4ZO9A 5JOEA 4KKCD 3GMRA 2E27H