5DQDH

Structure of s55-5 fab in complex with lipid a carbohydrate backbone
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
222
Chain Sequence
b'EVKLVESGGDLVKPGGSLKLSCAASGFSFSSHGMSWVRQTPDKRLEWVALISRGGSYTYYSDSVKGRFTISRDNAKNTLYLQMSGLRSEDTAIYYCTRHKGLRRGTNAMDYWGQGTSVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S55-5 Fab (IgG1 kappa) light chain
publication title Lipid A-antibody structures reveal a widely-utilized pocket specific for negatively charged groups derived from unrelated V-genes
rcsb
molecule tags Immune system
total genus 43
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2015-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dqdH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dqdH01
1KCVH 5D7SL 1R3KB 2F74B 5FM5O 5C09B 1EH9A 2UY6A 4WIQA 1H0DB 4TSAH 1FVCB 1C08A 3MCG1 3C60B 1P4BL 3QUZB 4JM2C 3HKFA 4DK3A 2C1OB 1TJGL 3TM6A 4HV8A 3L95A 5D96B 1JWSA 5ADPL 4PJBA 1UKTA 3TWCH 3MNZA 3KR3L 5EZLA 5FYLH 4R8WL 4HPOL 1LEKA 5T1LD 5DR5L 2ED8A 3BW9B 2DKUA 3C5ZA 4NHCL 1D7FA 3VI4E 3PWPD 1LEGB 4P3WA 3O3UN 4LHUA 2QL1A 2YRZA 1BQLL 4YAQB 4JFFB 4DZ8B 1MQ8A 4R6UA 4A6YL 2VLRB 2VQUA 1CFQA 1NC2A 4XPGL 4F2MB 4P2QA 1IZJA 1TITA 1TPXC 2CD0A 1AP2B 1I3GH 2NY0C 2MCG1 4XMKL 2BDNL 1I8MB 4MD5B 2ORBH 2CO6B 1FFNA 4JCMA 3JV4A 3V79C 4WJ5A 5DFVC 3FTGA 1I85C 4P2OC 1UVQB 3MGOB 1KTLB 2XWTA 5L8KB 2XRAH 4IIQA 2Q76B 4ODHL 4CKVX 4W68A 1OVZA 4X6FA 2VZVA 4JFDA 1QO3B 4JKPL 3SDXB 3TT1L 2IGFL 4PJXE 3IXTA 3F6IA 1NJ9A 2VQTA 1KBGH 3PL6C 3ZTJH 4WO4C 2FZ3A 1FIGL 1GH7A 1XGRA 4S2SA 1RFDH 1QPPA 4YEFA 4OF3A 4WU7A 2XZCH 4CW1B 4Y19B 4YR6B 1ZTXH 4MAUH 1AKJA 1OF2A 4BJLA 2Z8RA 2QSTA 4NQEB 4ONFH 5SWSB 1X5FA 1RK1B 1KCKA 1PX3A 3FMGL 3BGFB 3CFBA 5F7NC 2DJSA 1WF5A 1BLNA 2CRYA 5KS9B 3C2SA 4NUGL 4QHUA 2G75A 3GMLA 2P8PB 3IJSA 4F15C 2QKIB 1U93A 4JDTH 3CVIL 4JQIL 5CGYD 1JCKA 1BHGA 3OZ9L 3V4UL 5DGQA 2VDOL 1G9NL 3U46B 1YA5A 1H3PL 1A9EA 3DX8B 3BH9A 1FO0H 3OG4B 3H3BC 3FHQA 3CSGA 4O2CB 2DAVA 3MXVH 4MB4A 3TA3C 4PJIB 1D9KA 1UFUA 3TO2A 3VFSA 1FZJA 4LFHG 3SGJC 3MBXH 5BJTA 4WFHE 4YPGB 1LDPL 4G6FD 1X44A 2X4NA 3SJVB 2R2CA 3BWAB 2WMPA 4WHDA 3T1FB 3ZKSD 3JTSB 5TPWH 4ZO6A 1WCBB 4KPHL 4ZFOB 3FQNB 1V7MH 4ENED 5F7EH 3B2UD 1RURL 4BFIB 5C6TL 1EEYA 4QHNA 4G80B 3QCUL 4NJAH 3V9FA 3ARGB 1MI5D 5GJSL 4GS7B 4DKFH 3MLTA 3WXWL 2OXHA 1MJ7H 3LN5B 1P4LB 1RHFA 3VRLE 4PB9L 3QFJD 4TQEH 3WNPA 2Z9TA 1UZ8A 3BDBA 4FTVA 2PO6B 2VQ1A 4CL7A 2GAZA 2AVGA 3O2DL 1M7DB 1QYGH 5CAYB 5IG7B 1CLYL 1D5XB 4KMTL 2CLZA 3LKRA 1MHCA 4ZO9A 1UJ3C 3RWGA 1WBYB 3ZHLA 5JR1H 2F58H 4KI5D 3VD3A 1SYSA 3I02A 4KVCH 4MGXA 3QNZB 2FEEL 3FHAA 1H15A 4PJGE 1BEYH 1LNUA 1WBXA 1WC7B 1DDHB 1O7VA 4Y4FA 4G42B 5C0FB 1Z5LA 4AEEA 2KUTA 2ICWA 5C2BH 1TDQA 3F62A 3DX7B 4G8IB 1IVLA 4GW1A 1BQUA 3ES6A 3IKCB 3ZE1E 4F9PA 2IMNA 3O6FA 3BP6A 3RWFA 3JWOC 1PYWA 1TJGH 5EU7C 3NCYP 1IAIH 2RQ8A 1YYMH 5F7KC 5J12C 2B39A 4R8WH 3RVXD 4HPOH 4MSWB 1J8HE 4PGJA 3SDAC 3I6LE 3OXSB 4NHCH 4OM0L 5CEXA 1BQLH 3MRDB 5IB5B 3DXAD 4DFHA 3QIBA 4X6CB 4Z7NE 2HRLA 4KK5D 4XPGH 1W72L 4KI5F 1T04B 3BGAA 3WFCH 1Q9WA 5EZOL 4Q0XL 2DM3A 4KZDH 4OTXH 3WE6A 1QSFA 5T33H 4EDXA 5AD0A 3VGBA 1YMMA 3ARFC 4XMKH 5ESQB 5FHBL 4OI9A 5TH2B 1LO2L 3L3GB 4FZ8H 3DSFL 4PGDA 2ARJB 4TYUA 3IU3A 4DEPC 2LFGA 3LN4A 3NIGE 4WCYL 4OAWA 4ODHH 2Z4QA 4NT6B 4JFZL 4JKPH 2HRPL 4LNRA 4WY7H 3U0TA 2IGFH 3BO8A 2X1QA 1INEL 3K3QA 4RMQA 2XYCA 4GBXA 4FQXA 4HC1L 3OR7B 4XXDA 3MRIB 2A74B 3IXAB 5IEKB 5KSUB 4LU5L 2PN5A 4R0LA 4CN6A 4NYLA 2AXHA 1NFDE 5EBLB 3X13B 1KCLA 2EYRA 2V2WA 1DZBA 3UTTB 4HJJL 3O4LA 4ALAL 1L4IA 1GRWA 3BN9C 4I9WD 4F80A 3WCYA 4HWEH 1D5BB 1JPTL 4OZHF 5JW5B 1Y6NR 5TDPA 2FL5B 4OFIA 3FMGH 2YD7A 1S3KH 4JJHA 1HEZB 3MRGB 4H25A 5IJVB 2VE6B 1OSPL 4PTUB 4FXGA 1NPUA 2O93L 4R4ND 2FATL 4NZDA 3WKML 3VW3L 3C08L 2WSKA 4PJ5D 2AJSH 3IYLW 4CNIB 4OIBA 3X14B 2AV1A 3IAPA 4G43B 1G9NH 2V9QA 3QUKA 5C0RL 3FAXA 1CG9A 1RVFH 3HG1E 1Q9LA 5JUEH 3JV6B 2Q86A 5I1HL 1NKRA 1OL0A 2BNUB 4L3EA 1MCKA 2WINA 4MA1C 4PLKD 1RV6X 3MTRA 4RQQB 1Q0XL 1F4AA 2GJ6A 1YNLL 1KELH 5A16B 5I66A 5J11B 3FO1A 3QWQB 2X40A 5IP4A 5T1LB 1AGBB 4JG0L 3PWPB 3C8KB 4P9HC 3HE7D 5I2IA 1RURH 3SDDA 3I84A 5KOVC 1EHLL 3MRCB 4CDHA 2FH8A 1Q38A 2OR9H 5KZCD 5GJSH 1CI5A 4JFED 3WXWH 3GJFA 2NW2B 1I7TB 3BPOB 3T09A 2UZIL 3PGFH 2JB6A 3VDAA 1G6RL 3PHSA 3V5KB 5D9SA 2Q7NA 1JBJA 4YBQC 3O2DH 1EBPA 2ERJC 2V2TA 1CLYH 1BM3L 3NFPB 3ROOA 2D7OA 4BK5A 1HWHB 3V4VH 2EKJA 1DVFA 5DJAB 2GK2A 3U0PB 1KENL 4NZTL 3MV9A 4JQVA 5H35A 5MEND 2GSGA 1AGCA 3D6GA 4KXZI 2Z8VC 4HUWA 2F19H 2PW2B 2IPKB 5IBLC 5DVOA 2IAND 2V9TA 1X5KA 2W91A 1QLFA 3OJMB 4OIAA 2I25N 1T0NB 3MRFA 3KLSA 1T4KA 4KRNA 1NGQH 2RFXB 4WW2F 1TZGH 3N1MC 4XVJH 4HGWB 2A6JA 1WZMA 1MREL 3UJIH 2AKRB 1GZQB 3ZKXB 5BCAA 2GUOA 2D0HA 2W65A 2HN7B 4PRPA 3ZDXE 4QRUB 2IADB 2ZSWB 5ERWA 2GW5A 2ADIA 2D7NA 4E41B 5HPOA 5E24E 3X12B 1CFTA 1XIWC 3QEQA 2J6EA 4BYHA 3RKDD 4M93B 1W72H 1OY3B 4GSDL 3IETB 4XCNA 4M3JA 4Q0XH 5J13B 5HBBA 4GKZA 4QF1B 5EDXA 5EORH 2P44B 3GMNA 4H8WH 3EW3B 4OV6F 1WAAE 1KTKE 2GFBB 1N3NA 1PKQB 1OW0C 3ULVC 3DMMC 4YX2L 3SCMB 3LKNB 3VFPB 4QNPE 2X4PB 3D39A 5J1TC 4UNTA 4NN5C 3OF6A 1FC1A 4E5XB 2VKWA 4YHIA 1VKXB 2W0PA 5L2KA 1INEH 3S3JA 4PJ8C 2VUYA 3OKEA 4MJ6A 3HPLB 4HC1H 3RTQD 5FHAL 1QSEA 4X6BB 4GH7B 1OM3H 2X4SA 2DMBA 1HHGA 4P5TD 1BWMA 5C2UB 2BVOB 4N0UA 1MIML 2J5LB 3RNQB 4W81A 4M6NH 4HJJH 4UTAL 3BEWB 3IKKA 1HXYA 1EIBA 1XGYL 4OV5A 1EXUA 5DRZB 1ZE3C 5D7LA 3QIWA 4M5ZL 3C6LC 5GGVH 4LCIL 3LCYA 5DA4A 4EJ1C 2FATH 3C08H 3GKZA 3GI8H 1NBYA 4JPWL 5JIHA 1DBKL 3S98A 3VFUB 1FBIL 5CZVL 1SJHB 3GBLA 4ONGH 2KZWA 2W38A 1AD9B 2ZJSL 3ARQA 4NJ9L 5C0RH 1NANI 3T0EC 4QRSA 5DK0B 4U33A 5DRNB 1NUGA 2AP2A 4ELME 1FNSL 3MC0A 2CGRL 4OD3H 4X5XA 4OM1H 3RRQA 1DUZB 3GMQA 3RBGA 2O5YL 3UEZA 1OGAD 2VAJA 2DM2A 1Q0XH 4B53A 4NQCA 2NY0D 3WO4C 4NNYA 1PY9A 1ZAGA 3ELAT 1CFBA 3G04B 4LARL 3PV6B 5HGDB 4DZBA 4JG0H 4OQTH 4U7MA 4P4KA 4HPYH 4J4PA 1P4IL 4S1DC 3BP5B 2PUQT 1EHLH 2DQJH 3L5JA 3PIQA 1N5AA 2NTFB 1NUNB 5GHWL 1AHWA 3RGVB 1G6RH 3VH8B 3ULUL 1KT2A 5A1AA 1BM3H 4TOYL 5L0QB 4DCQA 2Q8BL 2YK1L 1GGIH 2NX5A 4XHJC 4NZTH 4JO4H 4X9IA 4JY5H 3P2TA 1ZKAA 5EH1A 2P4AB 5DF0A 4PGZA 4WNQA 4TRPH 4XCYB 5IW1B 2RCSH 2DLHA 3RL2A 4MQTB 2HTLC 2E7MA 3F65A 2MFNA 3HNSL 3OKNA 4W6YB 3KPRA 5K59F 1HN1A 3LEYL 4G9DA 5AZEL 4HS8L 3HAEA 3IS0X 4Y4KC 1MRFL 1T7YA 3WNOA 4PLNC 1CF8L 4MMXC 3NBNA 1CYGA 4UUJB 2P8PA 4UB0H 5BVJB 2NCMA 2NYYC 5HHNB 4O9HL 2Y36L 2Y5TB 3O3EA 5EPMB 1AO7D 4HIEA 4LDOB 4Z5RA 3SE3A 4HIIB 1BVZA 1R3JB 5JXEA 1QFOA 1B4JH 3FQUB 4IRJA 3TA3D 4JO2L 3S34L 3FB6A 4KJYA 3OXRB 1CE6B 3A6OA 4JREC 4KHTL 4XWGL 4H26B 1P9MA 4YE4H 3VH8G 3B9KA 5JPMA 1LE5B 4LGSB 3ZDZE 2A73B 2E9BA 4NSKA 4PJ5B 3L3OB 3CLFH 4JRYA 2FR4A 2ZCKH 5E2UH 4AYFA 3N0PB 2HH0L 2BSED 1FFOB 4KK9C 1R3HB 4NO3A 4OKVB 3SKMB 1HHKB 1RUKH 3BESR 3OV6A 4YX2H 5FDWA 5KANG 5T5FH 4G8GB 1WFUA 2IFFH 4LVEA 4HKJB 3KLAB 2R8SL 4XVUC 5L6YH 4OCMC 1DLHB 3KPOB 5FHAH 3DGGB 4HWBH 4JFPA 3GJEB 3BXNB 5T3ZH 4PRHD 1PW3A 5B8CC 1MIMH 1LP9F 4QXTB 1BOGA 1F45A 2ZP0T 2ITDA 4LVOB 4IRSB 1BFVH 1RZFL 5KVGH 1KB5A 5DGRA 4WW2B 1HDMA 3TBYB 5I30L 1S7UB 1E28A 3U7YL 2I9LB 4N0YL 3H9SE 3RL1B 5KZCB 4Y1AD 4PP1C 5GZND 1W0WA 1C1EL 4HMCA 1NEUA 5D7KE 4ZAKA 2LV4A 5ISZB 1OAKL 1RZIA 4NUJA 1SBBA 4JPWH 1IKFL 1BREA 5H8DA 5MENB 3CD4A 3SDAD 4ZMAT 4M1GL 3WUWA 2VDRL 4IJ3C 3AAZA 3BH8B 5FGBC 4EI6A 5IIEA 5CKGA 2CGRH 3VWJC 5D1ZB 3FO0H 4POUB 3A6BL 3U79A 2GY5A 5CJXC 2MCPH 1V3LA 3WHXB 5TE4L 2PXYC 5K9QI 4Z7UA 3GRWL 3OR6A 5LBSL 3C8DA 2NY1C 3X3GL 3HR5A 5F1NA 3D3VE 4UT7L 2X4TB 3ARFD 4NC0B 3VG0L 4LARH 1T66C 5ESQA 4K8RC 2OP4L 4MD0A 2H1PH 3N50A 4LL9A 1PVHA 1JF1A 3UYPA 2A1WH 4N8PA 5DO2D 1TCMA 3HCVB 1T6VN 4RA0C 1Z2KA 5JORB 3LD8B 1INQA 4Q6IB 5FCUH 4OZGA 5IF0B 2O5XH 3BZFA 4XMLH 3KXFB 2CJUL 1I9RL 1P7KA 4JRXE 4TOYH 3BRDA 2Q8BH 5J6HA 4UIMB 5FGSA 3L6FB 2YK1H 1K4CB 1T0PB 3BN9D 2LE9A 4PJ9A 1IAII 2AI0L 2PCPB 3H7LA 2Y72A 2NXYC 1D5BA 3ZL4L 4RGMB 1DQLH 4LLQA 3JV5A 2WBJA 4JANA 4N0RA 5SWZD 4OZFB 3PP3K 5C0CB 3W2DH 3HNSH 4YDJA 4JQXA 5I16A 4P5TB 3JTTA 4FFWC 1EJ6A 2IALB 3QQNA 2VXQH 5DK3A 5BV7H 1PSKL 1VACB 3LEYH 5DZLA 4HS8H 2NZ9C 5DHYB 1MRFH 1OCWH 3GSNL 4Y2OA 3SGKC 3MFGB 3F6LA 3MFFB 3QO1A 4K55A 3RNKA 1SM3L 2ATKA 3QHFL 4M61B 4XTRC 4JR9L 3LKSA 1KCRH 2H32A 4G43A 3M17A 1A4JA 4JFXB 3CXDL 4RMTA 4XRCA 1JPSL 5I19H 3PWUB 4HF5H 2BNQA 1ND0A 2Z92A 4ZOAA 3TH3T 4K94C 4JO2H 2FBOJ 3S34H 4KHTH 2QQKL 1VENA 1YPZE 2NY2B 4Y16C 4XWGH 3M1BB 4G7YH 4JM2B 1T2QH 4Z76B 4OCWH 1UWEL 4AIXA 4U49A 2GIYA 4MDIA 4KTEL 4ZTOH 4PRAA 3UBXA 2BOCB 5DT1L 5LGJA 4OSUL 1KIPA 2A6IB 1YDPB 4NNXB 3S7GA 4H0GA 35C8L 2P5WA 1KB9J 4K3JH 2GHWB 5GGSB 4G8EA 1FDLH 1Q1JH 3IFNL 2DYPD 1U8MB 1NCAL 3MZGB 4OZFG 4RAUB 1H5BA 1EAPB 1RHHB 4E42A 3QEHB 1TPXB 4JAMA 4LVHC 4PJEE 2VXVH 2BP3A 3DI3B 1JTOA 2E8ZA 1JNHB 4YBQD 4UQ3A 4FXKA 5JW4N 3MJ9A 2FD6H 2Z35A 1AGFA 1BJ8A 1U3HC 4OFYA 1RZFH 4IRZH 4P2OB 3FRUA 1MFEH 1H3XA 2VXTL 3K74B 1JK8B 3L7FB 1NBZB 4LCYA 2Q7YB 3VE0B 3U7YH 1DLFL 3FQWB 3CMGA 5IBLD 4QXGL 4JFHD 4I48A 4D9QD 4RZCB 3MROB 5ICZB 2CDEB 4XCEB 3PL6B 2M1KA 4WO4B 1AH1A 2AQ3A 1PLGL 5A43C 3CUPB 4XT1C 3GSQA 4O4YL 5L2JB 1MAML 1JGUH 5IFJA 3FFDA 4Z78B 3KLHC 1T1XA 3CX5J 2YSSB 3QCTL 4Q6YA 5LG1A 1KN4L 3BZEA 4YNYB 3TVMC 1KCUH 4ZUUA 2HG5A 1XIWD 4LLUA 3TO4C 4KV5E 5CD3B 1FFQA 1N59B 2NLJB 2CIKA 3GRWH 5LBSH 5C0BD 3Q3GA 3X3GH 4F15B 1T5XB 3ZSSA 1DEEA 4YIQB 4P9ML 4XNQA 1YEFH 2ATPB 3TCXA 3RJDA 3VG0H 2UYLA 1AO7B 2IC2A 5IKCB 1HZHL 4YHML 2OP4H 4YDIH 2MQ0A 5AWNH 4U6VL 3LOWA 4GMSH 3ULVD 5FO8B 1J05A 3K1DA 4PJGB 3EO0A 5DHVA 3DMMD 5F71A 1LP9B 2VISA 4IOIB 1RZJC 2PYEE 1FFRA 4AM0B 2GTZA 3ULUE 4PJ7A 3SBWA 2Y7QA 4P49A 5FO9B 1R5IB 1RJLA 2YA0A 5C7XH 4LKXA 2VJXA 1I9RH 4AENB 3F7YB 5JIIA 1OPGH 4P5KB 3WEXA 5HHOA 3O6MH 4QCIA 4CAGA 1BQSA 5E8OA 2VIRA 3LIZL 1KNOA 3VI3F 1X5JA 2F54D 4LDLB 1MI5A 5DMKB 1QA9A 1JJUA 1QFWM 1URLA 2GCYB 2ADGA 2M26A 4RNRA 4LSVH 4X4ZA 4PRHB 4TPRL 3U7AA 5HHPB 3C6LD 3QFJA 1PSKH 3ULVF 4U3XA 5ILTH 4AK1A 3O41B 1RJZA 1UJ3B 3LSOB 1MCWM 3DYMA 4GAYA 5KW9H 1SM3H 1TZHA 3QHZL 1I9JH 1U92B 2DQIL 5A2KH 3V0VB 5DQ9B 3C5SB 2ICWI 3T0ED 1CDJA 3CXDH 3HHRB 1JPSH 4NQVB 1TQCC 3TIDA 4GRLC 3BYYA 1D6VL 4XNUH 1MRCH 2UWEA 5IB4A 3Q6FA 2ICEB 2WWKO 3OJDB 1SVCP 1UWEH 3A0OA 4HWNA 4MXVE 2A83A 2QSVA 1T2JA 1F6AA 4LPCA 5DT1H 3SDAB 2WK2A 1ADQH 3UPRA 4NP4H 2YMXL 1WZ1L 2K1MA 3HNVH 3PV6A 4HUUA 5F89A 35C8H 5MEOA 4DUWA 4L1DA 2DLEA 2I24N 4S1DD 1UADC 3VXRD 3DXAA 4NQTA 3AU1A 3TBTA 1BWWA 3MREB 5GGSY 1GGCL 1MWAL 5E2TL 1I8KA 3KJ4C 5GS1C 4OZHA 3O11B 2ZCHH 3LKOB 3V5DA 4QRTB 5IB3B 3TJHC 1J87A 2H9GA 5FB8B 2IBZX 5F1IA 4K7PL 3QI9A 2P5ED 4PUBL 4RFNC 1JNNL 3TBSB 4DEPB 4POZC 5MEPA 1UENA 4HIHB 3MNVA 2XPGA 1Q9KB 2VDKH 2OK0H 1ZXQA 4TUOA 4JZOB 4GG6E 1DLFH 1S7SB 5HYJE 2MJWA 5BRZE 1HSAA 3KYNA 1JI1A 2QTEA 4PGBB 2HTLD 2DS4A 5B3JF 3R0MA 4LCCC 3CMOH 4L8SC 1DANT 2B4CC 2DQUL 1GCFA 3IFLL 4XP6L 2X10A 3ZYIA 1ZGLA 4O4YH 1MAMH 1XF3A 5FYJL 5F70A 4P4RA 4Q58C 2NYYD 3RIFF 3U0WL 1CGSH 1IEBA 1A6PA 4EN3A 3V6BR 2OL3B 1KN4H 3OKKB 5SWZB 2A38A 1M7XA 2VO5A 1FCCA 2XTJE 3JXAA 1T7VA 2FRGP 5GGUB 1HSBA 4MA8L 5IROA 3MUGA 5DEZA 4AH2B 3QIUA 3WJLC 1CLZH 3S88H 5DEFB 2F53E 4P9MH 3GSXA 2EC9U 4Z7VA 3E8UL 5HYQA 1J8KA 5I1AA 1I4FA 1I7ZA 4NC1E 2W9EH 5IMOA 3D69B 4YHMH 4P2RE 4ZYKB 2FNBA 2VL5B 4LRIA 4KK9D 1MRDH 3BEVB 2BHYA 4WI3A 1CXIA 3LV3B 5E2WH 4QRPE 2GI7A 5C70A 1FV1A 4MNQD 1DUYB 3D85B 3BSZL 1FPTL 1FN4A 1A7NL 3MUY1 1RI8A 3TNMB 2AJ3B 1WUNT 1R24B 4XVUD 1HH9B 2VLJE 2JKXA 4OLUL 3ZYOA 5CINL 2HJLA 2YD2A 5L8JB 2CH8A 3MLZL 4BELD 3GUTB 4WTXA 1ORQA 3HE7A 43CAB 5C9KA 3P0YH 1FVDB 4A6YB 4V1DD 3I9GH 1AR1C 3VXUB 3HRPA 4X7FC 4S1RL 4XP5L 3EOAB 3MYZA 5IB2B 1CS6A 5JHDE 4PREB 1C5DA 4HKXA 4NQDE 5EOCH 1CN4A 1DQJA 4PP1D 4JFEA 3FAWA 2JELH 1F4XH 4TPRH 1MHEA 1GZPA 4JPKH 3VFOA 2YPVL 1RZKL 1K8IA 4U1JB 1ETZB 4IHOB 1DBAL 2JJVA 1Y6MR 2DQTL 5L9DL 2ZCLH 2YUWA 4PGCB 3QHZH 4DVRL 4ZUVA 4JY4B 4R97C 3MYJB 2XQYG 5CP3A 3HLAA 3U36B 3VWJD 3BH8A 3B43A 4JPIB 3TN0C 2IANA 4LLMB 2C3VB 4C56D 5K9KB 2Q3AA 1K85A 3AREC 5CEZL 4LSSL 3O3AB 5E1AB 1EVUA 3BYTA 2PXYD 1MHPL 2NY1D 5DJCB 5EC1B 1MLBA 2XQYK 5T1MA 5TDNA 5AZ2L 4MVBC 4XGZB 3VXSD 4PRIA 1EMTH 4GKNB 1JGEB 3MRQB 3BPLC 5MERB 1KJ3L 3MV8D 4Y5XC 1T66D 4K8RD 5ANME 2DMCA 2YMXH 3ZLQC 1Q94A 1TVDA 2BVQA 3RBSA 3EO1B 5FYKH 2FWOA 2NXZC 4DWHA 5JA9A 1XIWB 3LQZB 4ZQKB 3T65B 1I1RA 5C0BB 2DRUA 5I9QC 5E2TH 5EBGA 5IF0A 1E4JA 5CP7B 1T1ZA 4EOWL 1QLEL 2NY6C 1A02N 2FEDC 4G6ML 4NQSA 3H9YA 4XC1L 4UU9A 1E4KA 3DJ9A 5HGAB 1MFCL 3EZ8A 1F6LL 2EICA 3DLQR 4WVRA 5HJ3A 4XC3L 1TNMA 4AY0A 2CDFA 2NXYD 1C16B 4FRWA 4NN5B 3V6OA 4DGVL 3MRBB 1JHKL 4PJ8B 4UAOB 1FNGA 3GSUB 5D1XA 5E5MB 1P1ZB 4NM4H 1EGJA 5IR1B 3RTQA 2B1AH 4FFWD 2DQUH 3L3JB 5ICYA 3HMXL 6FABH 1RK0B 3IFLH 4E0RB 3ESUF 5ALCH 1RZ8B 3OKOA 2P8LA 5C0DA 2MWCA 5FYJH 4LLWB 2M2DA 3U0WH 2C1PB 4EQ3A 5B38A 3ZYJA 3PQYE 4NKMA 5E6ID 4JFQA 4JFXA 4JHWL 5E9DE 3FT2B 1L9MA 5M95B 4Y16D 1B4RA 2XWBA 3C6LB 1ES0A 3P4LA 1ZA3B 1CQKA 2H8PA 1IGJB 3MLUL 1A3QA 2OR7A 1M6OB 1S7TB 1T1WA 5I74B 4Z8FH 4G8FA 3Q1SL 1BP3B 3CVHH 3B9AA 2HKFH 4LGPB 3MODL 4LIQH 4TSBL 4EDWL 2YPLE 4NRZB 2W0LA 2X9WA 1T3FA 3O4OC 3O8XC 1EEZA 8FABB 3BSZH 4OZIE 1CD8A 1YNKL 5C07D 1A7NH 1VFBB 4QHKJ 3D2UD 3KDMA 1EERB 3MOBL 3QQ9D 1OGAA 4HS6A 4NPYA 5I17B 1B2WL 5DJDA 5CZXC 3WO4B 4CBPA 1ZA6A 1CK0L 1YC8A 1HQRB 4ZS7H 4N9OB 2Q8AL 3DVNA 3GBNL 5CBEB 1U3HD 5EBWB 3SPVA 2YOCA 3E6HB 1KXVC 3ULSA 1WICA 3VXQA 3VXRB 4FFYL 2WBWB 4QOKD 4KDVA 1PKOA 2CXGA 4KDTC 4RAHA 5D2NA 3QPQC 3EFFA 4ONHB 1WV7T 3QUMB 4WFED 2P7TB 4N0CC 3C9NA 3J7HA 3GI9H 2KZ1B 4FHBD 2JJTC 3PUCA 4M8VA 3MRHB 4AT6B 1TIUA 5I75C 4EVNA 2P5EB 3AS0A 1DBAH 1U8PB 3FB7B 5L9DH 1IQWL 3GHBH 5E8DL 2XG5A 1B0RB 5JLZB 3KLHD 2NTSP 5FUCE 3HUJE 3C87A 5E6YA 1KLUB 4N9GB 2HAZA 2B7DT 5F3HB 5DK2B 2YA2A 1WWWX 3MR9B 4LGRB 1AQDA 1B90A 4MJ5B 1FCGA 3S35X 4HDIA 3TVMD 3QJFB 1ITCA 5D70L 5JHLH 5CEZH 4LSSH 3TO4D 5LWYH 3VFNA 5ADOL 1CDYA 1CD0A 4Y4KB 4TVPH 2EE6A 5I1CL 3BX7C 2BMKA 4YHOL 1IARB 2CKBB 2FLRT 2G2RB 3OKMB 4JVPA 3RAJL 1PD6A 5FYKE 1CGTA 1KJ3H 1TFHA 1XR9A 5HDQL 3MRJB 5FO8A 2KQMA 4L4VD 4I5BA 4JREB 3TA3A 4FQQB 3H9SB 1L7IH 1NAKH 2V7HB 4R96B 2EDFA 2NY5L 4IS6B 4YFDB 3S8WA 2OMNA 4F7CA 1TJHL 2YXFA 2ZUXA 1KIUA 5KSAC 1A6UH 4U0RB 3LH2L 5ALBL 2XI9A 1WFTA 2I5YL 5EOCJ 4EOWH 5KSVA 4M03A 3MRNB 3AB0B 2YD1A 2BOBB 2QHRL 4HUVB 2AJXL 1N8ZA 1CT8B 4G6KH 4PV8A 1MFCH 4F7TA 1TETH 1PAMA 5DMGC 4XC3H 2BRRL 5C86A 2VUOA 4G9FD 5IVZB 2HJKB 3VFTA 4L3AA 1D5MB 4WGWB 4F7MB 4I0CC 4YUEL 1RUQL 5I71C 5MP6H 4OUOA 5CJOL 4BKLB 1F2XK 1LMKA 2ZWLT 4LPXA 1XT5A 4PB0L 5FYJE 3HMXH 5I1EL 5B8CB 3F8UB 5EU6B 4LCWE 1LK2B 1FC2D 1YZZA 3C5ZC 1L0YA 5F96L 4C55A 1JNLH 3EO9L 3N85H 3D3VB 2LVCA 5FUZL 4MHHG 4M6OL 1AD0B 3GKWL 3K7UA 4V1DB 5IOPB 1JPFB 3NZHL 4WUUB 3WSQL 3QJHB 2DWEB 4Y1AA 1BBJA 3R8QA 4GRLD 3KPMB 3NPSC 4JHWH 3REWA 1OQOA 3W0WB 3CFEB 2GSIB 2MPAL 2I27N 2ZSVA 4GFTB 4HZLB 4I3SL 2NY4C 1MFNA 1R5WA 3HC4L 3GMOB 3B4NA 3Q1SH 3CFJA 4IIQC 2ESVE 1LEIA 1QKZL 3NABH 2HFTA 3MRRA 4MLIA 1FGVL 2G60L 5M7QA 2HVKA 4IJ3B 4NWTH 3MODH 4TSBH 1FH5L 4WTZA 1F8TL 4MMZC 3HC3L 1YNKH 2PXYB 3B8YA 1T1YA 5D7IE 5F9WB 1B0GB 2OBGA 1UWXH 5CIPB 2AXFB 5IMKB 2FO4B 3OKLA 1ERNA 2XKSA 1BIIA 1W8NA 3TJHD 3ARFA 2BY2A 5F6IC 2Q8AH 4JN1L 5CJQH 3VGGA 1CGVA 3TPKA 4POZD 2I9TA 2IAMC 5DVLA 4N8VA 1KJ2B 4JKWA 1VFMA 1YJDL 3RFZC 1ZANL 2C3WA 4JZNA 4NC2B 3G6JE 3JWDL 1G0XA 2M8XA 1JYNA 3G5YA 1DQDL 4JDZA 4QHMA 1KN2H 1JL8A 2IJ0C 1ONQB 1ZVYA 4Z7WB 1X6LA 4ISVA 4YGAB 2GT9B 1B6UA 2NR6C 1Q72L 2OJZL 4JFDE 2JJWA 5I1IL 3OPZL 1MJJA 4X6EA 1IQWH 1UCBH 3GSOB 3ZMRA 5K93A 1D9KC 2YBRA 1JVKA 2NXYB 1HHJB 3LKQA 5CHNB 5CEZE 1UB6A 2Z31C 5KSBF 1HCFX 2HKHH 2OL3A 4C83B 3E3QC 4ORGB 2VZ1A 5IVXF 5A2LH 2NY7L 4U1KB 3WV0A 1AXIB 2ED7A 5T1KD 4BSWB 3A67H 4FABH 3SKJL 5H94A 2RAMA 5I8CA 5I1CH 2ILLA 3QFDB 4PJEB 2R0KL 4H88L 1G7MB 2YPKB 1ACYH 3K8MA 4GRWH 4PJAA 2BSSA 1FNLA 5HDQH 2EIDA 5I0DA 4ZPVA 1Z9MA 3UAJC 3UC0H 4DGYH 1HKLL 3AS3A 1A3LL 2I60L 2X4RA 3FT4B 2NY5H 3TH2T 5KVFH 5L7XH 4OFDA 1TJHH 4KRLB 4U1LB 3W9DB 4LSQH 3OX8B 2ADJA 1QLRB 4ODWB 5ALBH 2D31A 4U1SB 4L29B 1K2DB 4ZXBA 5FOBA 3VFRB 4IMKC 2APBA 3WLBA 4Y4FC 3KPSE 3LB6C 5GRVL 5JW3L 4CMMA 4U31A 1ZT7B 3NTCL 2P1YA 4WFHD 2JIXB 3WD5L 2BRRH 4H8WC 4F9PC 3C5JA 1A6TB 1AR1D 1I1CA 4PJFE 5D8JL 1L6ZA 1QRNA 5DRXA 2DYPA 3D2UB 5SWQA 3VMOA 4X7SL 5TQ2H 1HHHB 5CJOH 3D9AL 4PB0H 2WNGA 5I1EH 3ZKMC 3QUXA 1KTRL 5F96H 3WFEL 3EO9H 3ZSTA 2MMXA 1U3HB 3NCEB 3GKWH 5T5NF 3LAFA 2DLFL 5ITBL 5D6DA 2D7TL 3QIBC 4IOFD 4QOKB 3NZHH 5DUBB 2BC4B 4EKXA 3STZB 1PG7W 3TN0D 1G7LB 1NAMA 4X7EC 3O6LH 3ARED 1MFAL 4XP9H 2C3VA 2X6MA 3RZCA 3RY4A 2XFXB 3HZYA 1T7WA 1M7IB 2MPAH 4FG6C 4MVBD 1AXTH 3Q5YA 1Q8MA 6CGTA 1CIUA 2DLIA 3VRJB 1NCWH 1FGVH 1FFPB 2DI9A 3DX6A 3ET9F 5EUOF 4L5FL 1FH5H 5FYLD 3STBA 5KN5B 4FQXC 2NXZD 2DM7A 3R4DA 3QNYB 3TVMB 3VFVA 2FJHB 3TO4B 3G5VA 5BMFH 3IDJA 3HC3H 4IMLB 4OD2A 5EZIH 1OAUH 2E6PA 1E6OL 4UQ2B 4HIJB 5DI8B 4I2XA 4FA8A 4EUPB 2FIKB 2OS7A 4X80H 3CK0L 4AMKH 4U1HB 3RWHB 3VXME 4NZRL 3BP7A 3V52L 2IG2L 2NY6D 1HILB 4L3CA 2FEDD 4RFEA 4U05A 4JFYB 4U1MA 3NFSH 3P4OB 1BF2A 1BFOA 1MVUB 3IJYB 4DQOH 1OW0A 3T0WA 3B83A 1U2CA 2AJZB 3DMMA 1RZGB 1YJDH 4K7FA 4H1LH 4LSTL 1XF4B 5FM5M 3JWDH 3EOTH 5C0JB 3CLEH 3QDJD 3H6JA 1VFOA 2WIIA 2AXGA 5HY9B 1V7NL 3I50L 4JEGB 3H9ZA 1Q72H 5TDOB 5F7DA 3QDME 3OSKA 2ZUQC 4HQQH 3OPZH 3ZDYE 1CDCA 4I77H 1JWMA 3SQBA 3QDGB 5C0AA 3R1GL 1ZMYA 2OTUA 4AG4H 3TT3L 4G9FB 2VL4A 1T2XA 5DQDL 4JGJA 4Y8AA 5AG9A 3QULB 4F33B 4LBEB 3DO7A 1GJIA 4XVSL 3ZE2E 3H9HB 2F54A 4J8RA 4OI8A 4HFWB 4FMKA 3O4LE 4EUPG 2AK4E 4UINH 3MV7E 5I1KL 3DHJA 2BZDA 2X44D 1WTLA 2C7UB 2R0KH 3C09C 1ZA3A 5C08B 3RWCA 1IGJA 1A2YA 1MLCA 3RY6C 2CDGA 5CUSH 5TQ0L 3V0WH 1C5BL 2CK0L 2VOTA 2Y6SC 3IDYC 3WIHA 1QSZA 1KFAL 3T0EA 3O6KL 4FN0A 1JGVL 2DMKA 4GRLB 5IGXL 5D4QA 1A3LH 2XNAA 4L4TE 2X7LB 2BNRD 4PGEA 5HYJB 3O8XD 4X7TB 5KBNC 2LU3A 5BRZB 1FAIH 2ZOKA 3ECBA 2DN7A 1P84K 1JIBA 4XVTH 3PGDB 2V9RA 1DVFC 1AC0A 4DKEH 1N6VA 3HNTH 3WS3B 5CZXD 4JQVC 3H7BA 2XN9E 4M48H 4OLVL 1JN6B 4GUPB 4PJHA 4WW1B 2COQA 1F02I 4JGMA 4NN7B 3WIFA 3LMJL 3N1FC 1S9XA 2X4UB 4KQ4H 4MXQC 3T3MF 3TLRA 4F58L 5C71A 2J8UF 3B2VL 3MLRL 5DWUL 4K3GA 3F7VB 3QH3B 1N6QL 3LVEA 5LAXB 3BDYL 3BOVA 4XI5C 5ECJE 3QPQD 2LTQC 2W07A 4X7SH 4R90H 1WIOA 2O5ZL 5EU3A 4N0CD 4OGXL 2R15A 3IFOA 3KJ4B 1ZHNA 3QNXA 4WU5A 1FG2B 1ZHKB 3O45B 32C2B 3CGTA 4JVUA 4M5YL 5AYQA 5KSBB 4Z18A 3UTSE 3RUGE 2A2QT 5IVXB 1UZ6E 1BQHB 2F53B 1GGYA 4OKDA 2CLVA 4RFNB 4LKCB 4N8CH 1XMWA 3WKNA 4QHLB 5ITBH 2VDPL 2IF7A 2CRIA 1G7PB 3AM8A 3MCLL 2BERA 3WUZA 3ISWA 1UXSB 1SY6A 4LHJB 3E2HB 4GMTL 1UEMA 3BVNB 2XZQL 5GGQH 5KVEH 1OAQH 2VITB 4P3DA 3MQIA 1W0YT 4J6RL 3W81A 2EDOA 4P59L 2FX8L 4MJ5A 4LCCB 4L8SB 2ID5A 3MV9E 4Y89A 1IGFH 3U9PL 4D9LH 1ZLSH 1WZKA 3LEXB 2FLBT 4RGOH 2DIJA 2QSCH 4WEMB 2C4FT 3OKMA 3INUL 3MO1A 4R7NB 4YK4C 2ADFL 4L5FH 5E7FA 1JZ8A 3TYFA 3QEUB 3EAKA 2Q1EA 5DJ2B 3NCYS 1MCPL 4NN6C 4AJ0A 5BS0E 1AY1L 1A1MB 5BXFA 3B6SB 3GSNB 4TTGA 5IM7B 5TE6L 5F9JB 5FV1L 5KSAD 3LRSA 1BQHG 1T21A 4FQ2L 4BH8B 2VR5A 3H42H 3GMRB 2EEBA 3QEQE 2VWEE 2W60A 3MMEB 1H3WM 1FLRH 1WWAX 4HUVA 1QFWL 2ZPKH 5D2LF 1RPQA 5DMGD 2Z91B 1S7WB 2XA8L 1FNAA 2AEIT 4HAFA 5FCSH 3QIWC 4XCFH 2XZAL 4LSTH 4MNQA 1N0XL 1D5MA 3QISA 1J0KA 1FZMA 1L7TL 4ZSOA 2HT4C 4YHZL 3BKCL 1A6ZA 3MRPB 2ZG3A 4OB5H 3ILPA 1FNEB 3C5ZD 1KPVB 4PJDE 3IFPA 4NDMB 1RUAH 3R1GH 5GZOC 2C3GA 1F3RB 3TT3H 1JZ3A 3ORJA 5DQDH 3W82A 1XGQA 4TSCL 4NRXB 2VLKE 1I75A 4PJCF 1X5AA 3GIVA 2DTMH 1JWUA 2SEBB 2QV2A 4YHLL 1WWCA 5EIIB 5EUOB 4ETQA 2ZG1A 3EJZC 1MEXH 4ZUSA 2RB8A 5LGKA 4ZD3L 5EO1B 4Q9RL 1YYLL 3MJ9L 4Z0XA 2BSRB 5JO5B 4P4KC 3LPFA 2VAAA 2JCCE 4J4PC 4MNHB 3X11B 1DE4B 5BV7C 3MRMB 2YWZA 3CDFA 3ZT7A 3GNMH 5TQ0H 4UNUA 1H8OA 2EYSB 4QYOA 4X6DF 1CLOH 2P49B 4XB7A 4R97B 1T80A 5C09E 5D7LE 3O3DB 4ELKB 4LSRH 4JY6B 1AHWC 4QTHB 3ARSA 5T5NG 4P57A 4WWID 2HFGL 5FXCH 4WI7A 4QNPF 3VWJA 1ZK9A 1CICD 3AREB 4YHPB 4X98A 1RUPH 5LGHH 1U95A 3OKDB 4C56A 4KUCD 5CJXA 2Z8WC 1S7QA 3VU2A 3WNNA 2EDRA 1SBSH 2A0LC 3D25B 3SE8H 1NMCC 3EYFA 4KGLA 1X5HA 2FJGA 1AKJD 3MRLB 3VXSA 5E7BA 5J3HC 3K80A 3BPLB 4Z77A 4Y5XB 4OLVH 3IDGB 3NFNB 4WFFE 1UC6A 4JFFE 1IGMH 1MY5A 3MV8A 1DN0A 1MOEA 1QFUL 2ZUWA 3HPJB 3EKCA 3IJHA 1IM9B 3LMJH 2VLRE 4F58H 2IAMD 4NQCE 3L1OH 1A0QH 3BUYA 3TZVA 3GBML 1N6QH 3VXOA 1S5HA 5HI5C 1ZOXA 4NOFA 1LK3L 3T08A 5C6PB 1YEKL 2BHUA 2AJVL 3HS0A 4PRDA 5KG9B 1A22B 4YO0B 1IQDA 3MJ8B 4HUXA 3UTPE 1TVHA 4APQC 4JJ5B 3WN5C 2NR6D 2NY6B 3H3PH 4M5YH 3SE3C 5I1GL 1J0IA 1BJMA 5JXEC 2YWYA 2H3NA 1S7VB 5I1LA 3WDHA 4IRJC 3SDXE 3EYQD 3WHE0 2R29L 3MCLH 1BIHA 1D9KD 4WEBL 2ZKHH 1NCCL 1RUML 1P9MC 1C12B 4X99B 1WBZA 3B9KC 3FB8A 5DJZA 1LE9B 5TF1L 2Z31D 2YPLB 1V3MA 3REVA 5KVDL 4DVBB 3QDJB 2KH2B 1BVKA 2ZOLB 4OF7A 3OAZH 4P59H 1T22A 2FX8H 3KPNB 3TNNA 4MD4A 1CIDA 4Y19E 2DBLL 3U9PH 4AQOA 4HG4K 1DBBL 1O7SA 5HHQA 4TULH 2BSTB 5SWSE 4X7DC 5EO0A 5DVNA 3F5WA 2AQ1A 1BZ7B 1LDSA 4KH2A 1JMZA 1FYTA 2FSEA 1AXSA 1IAKA 5CSZA 4LMQI 5KS9E 5E6IA 1YEDA 4MNGA 5IQ9B 1I3VA 1KEGH 1F3JB 2DQFA 1XAUA 3OBAA 4Y16A 2J8UB 1U8IB 4ODUB 1DFBL 3FJTA 4HS3B 3RPIA 3BZ4A 5TE6H 2VABB 4FQ2H 5HYSB 5DEGA 5E08H 1J0ZA 1QHPA 4NKIL 4QXWA 1JYVA 4U1SA 4RMVA 2K7PA 3HRZB 3GSVA 3ARBC 1D5IL 3ARRA 1JFQL 4DFIA 4Y4FD 1OB1A 2MHAA 3VFRA 3VWKA 3S3PA 3LB6D 3ME0A 1G1YA 2H26B 3MCKB 4WFGD 5EBMB 2BNRB 5C8JA 3O4OB 1E0OB 2LAGB 3O8XB 3SJVE 1FO0B 1N0XH 1X4XA 4ZAKC 2FGWL 3LEVL 1QSVA 2R1WB 3BT2L 4LRNL 5C07A 3P77B 4JHAH 1C8PA 1L7TH 3L3HA 4YHZH 1A9BB 1FSKC 1ORSB 1XF5A 3U2SA 1M05A 4LF3B 2VDML 4RBPK 3RWJB 3NGBC 3V5HB 2HMIC 5J9PB 3LQAC 4WHTB 4ZOCA 4GAGL 1U8QA 4ZNEA 2OLDA 1F58L 3QIBD 4RAVB 2HFEA 3IDMA 4Y4HB 4JPVH 3T4YA 4X0KB 1U36A 5DC0A 5HVWA 5CJ5A 5D5MA 1MWAB 3CPLB 4YHLH 3FZUD 1YMMD 4OI7A 1VPOL 5DRWA 1MFBL 2Y9RT 4CRPA 4NIKB 4PP2A 5HYSG 4ZD3H 4Q9RH 5I75B 1GC1H 3KHOA 4B50A 5BW7C 3PNWB 1S9VA 1HNFA 1FGNL 4OIIL 1PGRB 1M71B 4QRRD 4DJMA 3RHWF 2CR3A 1NGWA 4S1SL 4HUKB 3GK8L 5E99L 5K9OA 1TLKA 1SHMA 3SQOH 5E5UB 5D7KD 5IMMA 2B20A 3P4NB 1NGXB 5D2LB 2R1XA 5IK3A 1FP5A 4EUPA 4J2XA 4YXLH 2NY3C 4WI4A 4I0PB 3IT8D 5E8NA 3V7AG 1T6WA 1W0VB 4X6CE 4Z7UE 4HMEA 3THML 3JVGC 2WBJC 5IV2B 3UTZA 4UV7H 3GBMH 4C57C 4L4VA 3FRPG 5A2IH 4GW4B 3U4BH 1BZ9A 1NGYA 4RISL 1ZHLA 5DD3H 4I4WA 3FL7A 4M43L 1SEBB 5EWIL 3RVWD 4PG9A 3FT3B 4PJCB 5KSAB 4Z6AT 3FQTB 3VFWB 4ZFFA 1JRHL 4KKAC 4H20L 3FN3A 1KV3A 1WITA 3DURA 4MJIB 5DURD 1EVTC 3ABZA 3ZO0A 1TTFA 1VGEH 5F44A 5F9AC 4WEBH 1A7QL 4L3ED 3S96A 4WUKH 1C08B 3CH1A 4EI5D 4HV8B 3L95B 1GGBL 1JWSB 3BKYH 5TE7L 5I71B 4PJBB 3MNZB 2CIIA 5GGTA 5EZLB 1MHHA 5KAQF 1LEKB 2QSQA 2XKNA 1R3IL 3UTTE 2OTWA 4B41A 2DBLH 2X1WL 2J2ZA 1LO4L 3EJYC 2V5SA 3C5ZB 5C0IA 4M9PA 4XCCL 4LHUB 5B4MC 1N64L 4U4BA 3NCBB 2HT2C 3SO5A 4NO0D 5I18L 3SDYH 1CFQB 1NC2B 3QWOA 2Y6SD 2D4DA 4P2QB 5I8KL 2CUHA 4NWUL 5GRZA 5HDBF 4LOUC 4YDLB 3NPSB 2VSCA 5FECA 1CTOA 2R56H 3DI2B 2QHLA 3UMTA 3BRFA 1JGDA 1IRAY 1FFNB 1YECH 3S5LA 1DFBH 2R0ZL 3JV4B 3KJ6L 4NZUL 5INDA 5ABDE 4WJ5B 2NY4B 4UOW1 3FTGB 1DVFD 2XWTB 4LAQL 4IIQB 1LO0L 2X4QA 4NKIH 2CMRH 3GSRA 4KHXL 4R7DA 4X6FB 1F4HA 4JFDB 4NFBA 1D5IH 1OTSC 3IDIA 1RIHL 1MPAL 3UP1A 3IVKA 3IF1A 3QQ4A 3IXTB 2E9JA 4Y0GA 4MXQD 4D0BA 1Y18A 5F72S 1QR1A 3MOQA 3O3BA 4ZFZA 5JOFA 1NJ9B 2XKUA 5BVPH 4D8PA 2EDNA 3OGOE 2FZ3B 3LEVH 4XI5D 4LRNH 1XGRB 4S2SB 3E0GA 4WU7B 4JKKA 1N6UA 5D6CA 4AL8L 2GJZA 4OLWL 1AKJB 3PWPE 3KYMA 4LHUG 1OF2B 5GS1A 3PDOA 1ZHKA 2VDMH 4PRPD 4U6HA 4KVNH 4WDIA 3RWEA 5T3ZD 4ZUTA 4GAGH 3CFBB 3RX7A 3RWDA 3GSWA 1CLCA 1WEJL 1BLNB 1F58H 1J10A 3L3DA 1Y0LA 4QHUB 2C3XA 2ZUUA 2G75B 3GMLB 4OJFH 5DMJB 3IJSB 1U93B 4PR5A 5B3NA 3K2MC 5TFSL 3QPXH 5MI0C 4LCCA 3CFDA 5KTEH 2DKSA 3FKUS 2NNAA 3BH9B 3CDGA 4PYGA 4QWWC 1FGNH 5E4EC 4HCRH 4S1SH 1KEML 3D39D 4K7PY 1D9KB 3GK8H 4PJXA 3TO2B 3VFSB 1FZJB 3BE1L 3SBWC 5BJTB 5D7JC 3NCJL 2Z31B 2EIEA 2X4NB 1QSED 1EGJL 4KROC 2FJFA 3U1SH 5T1KA 3WJLA 1AQKL 3MLXL 1EEYB 4QHNB 5IHZA 3B2UC 4O5LL 5LQBL 1G0DA 3MLTB 2J88L 4RGNC 4UILL 3THMH 3KYOA 3MMEA 1J88A 2QQLL 2F8OA 1UZ8B 3L3KA 4FTVB 3VJ6A 2VQ1B 4O51A 2GAZB 1MCOL 2CLZB 3T77A 3LKRB 1MHCB 2R0LL 2BY1A 4EXKA 3RWGB 2QR0A 4X5LA 4M43H 2HT4D 5EWIH 1SYSB 3I02B 3UDWC 3V6ZA 2VNCA 3GEWB 1H15B 1I8IA 4L8CA 1PKQE 1LNUB 1WBXB 5CBAA 3PABA 3X3FL 4Y4FB 2VTFA 2ICWB 5JW4R 1KUMA 4GW1B 4ZDHA 3ES6B 5FV2A 3O6FB 1EO8L 3BP6B 1HHIA 3RWFB 5F6HJ 1PYWB 2AABL 3VFMA 3CDYA 5TE7H 4S11A 4H5SA 4M8QA 1EO5A 3EJZD 3RIAK 4HHAA 1LO4H 3VXPB 2KKQA 3BZDA 5DJ0A 4J4PD 5A40E 4H0HB 5CEXB 1L0QA 4CVZA 4NM8L 3QIBB 2DIBA 4LLYA 5HVHB 4JM4L 3QFJE 5I8KH 5F7YC 1Q9WB 1ZHBA 3QQ3A 4LEXL 4NWUH 4WWKA 3WE6B 1QSFB 4EDXB 5AD0B 1RAMA 1YMMB 4M7KL 1EEUA 4Y5YA 4G7VH 3TN0A 4PTTA 4WEUD 1G7HA 4KI5E 1I7RA 4K7PX 1O0VA 4RRPA 4PGDB 2A0LD 3QI9C 2ZUVA 5IFHH 1QVOA 3IU3B 1A4KA 5F8RC 1UM5H 4LAQH 3LPGA 5J3HD 3LN4B 3PWJA 4HX1A 4NNPL 4OAWB 2Z4QB 2VDNH 1JZ4A 4LNRB 2XWJA 3U0TB 1RIHH 1MPAH 3D0VA 3BO8B 4I18C 1QBLH 4GBXB 4FQXB 3O0RL 4XXDB 1HH6A 1YUHA 1CE1L 3KPRD 2GK0A 3GIZL 4R0LB 5HI5D 4M7LL 4NYLB 4FNLL 5GS0C 2EYRB 2V2WB 3QO0A 1E4XI 1NBQA 3O4LB 1J8HA 3K4ZA 4AL8H 4APQD 4OLWH 1A7OL 2PTTA 3RHWK 4LEOB 4EN3C 4OLZL 5TDPB 4PS4L 3QZWA 5JXED 1KC5L 4KJQC 4P5MA 1WEJH 4H25B 3X17A 1DSFL 3NH7L 3MOAL 5IW6A 4FXGB 5FK9A 3QIUC 2X9YA 1XCQA 4TUKL 1P7QD 1UWGL 5TFSH 2AV1B 5CMAA 3KYKH 4OUUA 1CG9B 1F4WL 3GMMA 3BAEL 1DBMH 4LRIC 2ZUQB 5DURB 5IBTL 4JFOA 1Q9LB 5DLML 2Q86B 2BXZA 4YDKL 1KEMH 1ZS8A 2DQGL 4L3EB 4BSVA 3CSBA 2WINB 2APTA 4QY8A 3NCJH 2QEJA 3P73A 4GXVL 2GJ6B 5GRJH 2IPUK 5I66B 3FO1B 5TGBB 1NFDA 3VG9C 4OZFH 2N1KA 2DTSA 5IQ9A 4Y2DC 3C09B 3LRGA 1AQKH 5I2IB 3SDDB 2HWZH 5KAQG 3MLXH 3WJJA 4K07A 1FORH 3IDYB 1YQ2A 3MRKA 3NAAH 3ARBD 5I73C 2J88H 4UILH 4Z9KB 3GJFB 3T0BA 3L9RA 2JB6B 1GL4B 1LO3L 5D9SB 1MCOH 4GG6F 4PJ5E 4ZAKD 2V2TB 3ROOB 4M7ZC 1P7HL 2R0LH 3JWOL 3W11C 1DVFB 3B3IA 2OQJA 1BVLA 3MV9B 5H35B 1KACB 2GSGB 1AGCB 3HG1A 3PGCA 3WFBH 5HDOA 4HUWB 5DD0L 4X5WA 4G8GE 2YC1A 1VEOA 4D3CH 1YEJL 5A2JH 5DD5H 5J9PA 1QLFB 4PV9A 3I6GA 5IWLA 2IPTH 4G5ZL 3MRFB 1EO8H 1T4KB 1E6JL 2VLJD 2Y23A 1A14L 2X89A 2LTQB 3KPQA 5DS8A 1CXLA 2A6JB 4LP4A 3IGAA 1F11A 2DI8A 1ZT1A 2GUOB 2W65B 2JJTA 4PRPB 3FONA 5ERWB 1F00I 3NZ8A 2ADIB 5DFWH 2OMBA 4LDEB 4MCZA 3AROA 1EAJA 1XGPA 4NQXA 1ZVSA 4FFZL 5JHDD 4NM8H 1CFTB 4NQDD 3QEQB 1CL7L 2JE8A 1U8KA 1A7RL 2W0FA 2D03H 4JM4H 3ROLB 3RKDC 3NACH 4XCNB 4LEXH 5GRUH 1FYHB 5EOQL 3RDTC 4GKZB 1OSZA 5ISZE 2EYTA 1DP0A 3GJFK 3H0TA 3S35L 3GMNB 1RU9H 4XAWL 1U6AL 3OTTA 1N3NB 4PBWD 4ETYA 5MENE 1RIVL 3RVTD 1KTDA 1O5DT 2NY3D 1INDL 3D39B 4JKLA 1FZOA 2P8MA 3C2AH 5GISL 3V6OC 4YHIB 4Z7QE 2E27L 5L2KB 2YRLA 2WBJD 5D1XC 4F7EA 2OL3L 3O0RH 4MJ6B 2WM0A 2Y07L 1QSEB 5GIRA 5I1JH 1UM6H 1FL6A 2GKIA 2X4SB 2XACC 1HHGB 4NN6B 4MWFA 4Q97A 3GIZH 5D1QC 4OFKA 4M7LH 4N0UB 3UJTL 2QQQA 4FNLH 1LILA 4GW4A 4GOSA 2LQRA 3OB8A 2UZXB 3A6CH 2KBGA 3CNKA 1F6FB 1FNFA 1HXYB 1A7OH 1TQBC 4OZGF 4PJCA 3AXLA 5H37G 2CUIA 4KKAD 1AIFA 1CDHA 2JTDA 1FVEA 3KNBA 5HHXL 3T2NH 1WFNA 4OLZH 4OV5B 1KC5H 4N1EA 1EXUB 4HWZA 2BNQD 1T03H 1I9IL 3AFLA 1EHNA 5D7LB 3QIWB 5CCKL 2BY3A 5F6HI 3MOAH 3CC5A 3ARDC 3KXFE 3W9EA 5DJ8A 3VD5A 1A5FL 2FECI 2J4WL 2GTWA 5EOTA 1NBYB 3OMZA 3R06A 4A2MA 2UUDK 4X6DA 1BMGA 4Z95H 4N5UA 1WAAA 1V05A 4QRSB 1IC7H 3EJYD 2B1HH 1QEWA 43C9A 3G6DH 3HC0A 2ARJQ 2P5WD 5DLMH 5B4MD 3U4EA 4P9HL 3V4PH 3U4AA 4X5XB 1QNZL 4YDKH 3P0VL 2HT2D 2EH8L 2DQGH 3GMQB 5CILL 2EXYC 1IC4L 2J3SA 5C0CE 2O61A 4NQCB 4LOUD 4W70A 2ZUYA 3RQ3A 3EYSH 1AC6A 1U8LA 2MOVA 1N5YL 4NNYB 4O00A 3N1PC 2VZUA 4DZBB 2YZ1A 3IDXL 1R0AH 4P4KB 4OFYD 1WTGT 3U7WH 1J11A 4XBPA 1I8LC 3PQYD 4LQFL 4OLYL 5HXMA 4FQLL 1LO5A 3FFCD 3PIQB 5FGCB 1OTSD 5D2NC 1KGCE 1RIUL 1N5AB 3MNWA 3RX5A 2R2HA 5ACZA 1QFHA 1AHWB 1RZ7H 2DQDH 1LO3H 1NAML 1GOHA 1ZWIA 2Q6WA 2QJDA 2DQHL 1KT2B 1CICA 1JP5A 4DCQB 2EEDA 3JWOH 4GAFB 3TYGL 4NQUA 2NX5B 1T20A 2R9HC 3EUUA 3SKNA 3MUHL 2BFVL 4UDTA 4MZ3A 5FM8A 5D72H 1J5OL 5DD0H 1I3UA 4WNQB 4QT5A 2LVEA 4G6JL 3U30C 4L8BA 1BZQK 2VERN 3RL2B 3V8CA 3DUSA 1OGAE 3OKNB 2IAMA 3KPRB 1NH6A 4G9DB 3U82B 1UACL 3B5HA 3HAEB 1A14H 5GRVK 4UT9L 2G9HA 4PG2A 1MF2H 1K4DA 2A9NH 5JPNA 3O3EB 2APVA 4Z5RB 5K59E 4HIEB 3O2WL 1F5WA 2L7JA 2WIMA 1BAFL 4XNMA 4QWWD 5JZ7C 4FFZH 4IRJB 3ULVL 4CMHB 3VDBA 3FB6B 4KJYB 1CL7H 1I7UA 3JSSA 3O2DA 1A7RH 2QQNH 3B9KB 3VXNA 5JPMB 1K6QL 5D7JD 2R0WL 2VDLH 5F1OB 4B0MM 3O81A 4NSKB 3UO1L 3ZKQD 4U1IA 5GJTL 3MLSL 1FHGA 1CGUA 2Z31A 4R2GC 4JRYB 4MAYC 4WV1A 4KROD 5H2BA 2FR4B 1A3RL 3BP4A 3LKPA 3S35H 4XAWH 1U6AH 1NDGA 3NMEA 4NO3B 5FIEA 5GSRA 4M02A 1HOCA 5HHOD 1I3RA 5FDWB 2EH7L 3FB5A 1AI1H 3MJ7A 1CD1A 2HP4A 1DCLA 3AVEA 4RGND 2E27H 2FBJL 3VGAC 2V7NA 3MLVL 3HAEG 4GRMA 3PWVA 4KTYA 4DAGL 4JFPB 2KL6A 3UJTH 4N0FA 3E6FA 5FYKD 1P2CA 4UMGA 3RU8L 3TF7C 2IH3A 1BOGB 4NRYA 3STLA 1AO7E 2ITDB 1SJVA 1M4KA 3CFKA 1KB5B 1IFHL 4PJ7F 1A1OA 1JPGA 4P3CL 1HDMB 3DROA 1W72A 4JZJC 2Z0BA 1CXFA 1E28B 5AYUL 5HHXH 1LP9E 2AK1L 1FRGL 2YUZA 4IMKA 2B2XH 4NKOA 5T3XD 1I9IH 1W0WB 4XH2A 5D7SH 5GZNC 4CVXA 5CCKH 1NGPL 1OWWA 1YMHA 4ZAKB 3B9VA 2W9DL 5JNYA 3V95A 1P4BH 1RZIB 4NUJB 1Y6KR 2VWEC 3PXJA 5ADPH 5KANI 4KRPB 3KR3H 4YXKL 3WUWB 2H6PA 1DANU 1NMAL 3AAZB 5DR5H 1MCLA 4MLSA 4EI6B 3VXPA 5IIEB 2I26N 1VGKA 4HC1A 4P9HH 1QNZH 3CFCL 4ZO7A 3P0VH 4BQCA 5HYFA 3L5XL 1HIML 2EH8H 3D0LA 2DD8L 2IQ9L 1G9MC 4Z7UB 4A6YH 3OR6B 1S78C 4N1HB 4OGYL 4PRHE 3HR5B 5CLWA 3N9GL 5F1NB 4LCWD 3QUML 2DDQL 3OQ3B 4RDQF 4C4KT 5J89A 1J12A 5JA8B 2BDNH 3MBEC 4MD0B 3QI9D 2UWEF 1JUFB 1JF1B 3KPPA 4OLYH 1IEAA 3HE6C 1DQML 5DO2C 4QRRA 3PDDA 1KYOK 4KK8C 1INQB 3LS5L 3WFHA 1RIUH 4OZGB 4TNVK 3BZFB 3TT1H 1WIPA 15C8L 3H8NA 2VB5A 1P7KB 5EU7E 5LCVL 4OGAC 1V3KA 2GITA 5DQJA 2ESVD 5GS0D 5L88L 5CSBA 5J6HB 1FIGH 2EDQA 2AEPL 3WUWG 3TYGH 4K23L 4PJ9B 3RZWA 5JDJA 2CKBL 3EFDL 2YA1A 5DJXA 1LD9A 3C60C 3UZVB 2EO1A 5ESVA 3SHSA 4EN3D 4YGVA 4ACPA 2DJ4A 4BK4A 4LEOA 4WI2A 4LLQB 1S5IL 2WBJB 4KJQD 4JANB 4YDJB 5I16B 3CCHA 3JTTB 3HR6A 4RFOL 5GS2D 5IESL 5J57B 3QIUD 4OQTA 4NUGH 4AIOA 3QO1B 3FO2A 3CVIH 4JQIH 3RNKB 1OP3K 2ATKB 1NLDL 1H3GA 3LKSB 1Z9SA 3OZ9H 3V4UH 5IMLA 2H32B 4F9LA 2VDOH 3U83A 1SEQL 3M17B 1A4JB 1X3DA 1H3PH 4HLJA 4XRCB 4MB5A 1X5ZA 1S9WA 4JDVA 2BNQB 1ND0B 2Z92B 1U8HA 1G6RA 3AS1A 4JN2A 3ULVH 4KJWC 1VADA 1T0MA 4ZODA 4W4NA 4O02L 5DDHA 2R0WH 3K46A 2EZ0C 3G5ZA 3UO1H 4EI5A 1LDPH 2ED9A 4MDIB 4PFEA 4JRXA 2NW3A 4PRAB 3UBXB 3NN8A 3SKOA 5TGBA 4NO2B 4Y2DD 2EDHA 5LGJB 4ZXBC 3ZT6A 4KPHH 1KIPB 5C1MB 1WZLA 1A8JH 5EG6C 1NLBL 3OAZK 3CSYA 4X4XA 2P5WB 4G8EB 1QUNA 5C6TH 3RY6A 2D0FA 4TVPD 2WLZA 3WNMA 3QCUH 4HUNB 4JG1L 4NO0A 5SWZE 4GW5A 5DMIL 4Z7VF 1H5BB 1NEZG 2FBJH 4E42B 3MLVH 1OD7A 4JAMB 3M07A 4PB9H 4YHNA 4NGHL 4UQ3B 3QUXC 1PZ5A 5DZNA 4FXKB 4ERSL 1U3JA 4KMTH 2Z35B 4UI2A 1AGFB 4EQ2A 3W11D 4U7KA 3FRUB 3I6KA 4LCYB 5D6DC 1EHAA 3EYUL 5EU4A 2X9XA 2AK1H 4HZAA 4I48B 1CFSA 1YPZA 2RJMA 3UYOD 4XNYL 1U8OA 4HWUA 1WSST 4N5EC 1NGPH 3RZCC 2W9DH 3UBXG 2E7LC 4KZEL 3GSQB 4PRID 5IFJB 3FFDB 1KJVA 1EO7A 1V5JA 4NFCA 5JDSA 1T1XB 1CDUA 4YH6A 3GB7A 5D93B 1NMAH 1YNTA 4K8RL 3RWIA 3VXUE 3BZEB 1ZVHA 4R26L 3VFGL 5IB1A 4HWBA 4OM0H 3T0VA 1EJOL 3CFCH 1CD9B 4ZUUB 2HG5B 1CWVA 1UEYA 2WWMC 4LLUB 3L5XH 1HIMH 2VR4A 4HAGA 2IQ9H 1KJ2L 2CIKB 1PX4A 1FL3A 3Q3GB 3ROLA 3RDTD 1P5VA 3K0WA 5B39G 1DEEB 5EZOH 4XNQB 1ZEAL 5MI0B 2VN7A 2UYLB 3RI5F 5FHBH 5C92A 2D0GA 1C7SA 1LO2H 2XOTA 3DSFH 1J05B 1AGEA 3EO0B 1GHFL 5DHVB 5E4EB 2PO6C 2VISB 4LPWA 1U58A 1DQMH 4JFHE 4JO3L 4RMSA 2AV7A 1EX0A 2GTZB 4WCYH 5DD6A 3LS5H 4JFZH 4PJ7B 2Y7QB 5E2JA 2EE3A 1RJLB 2HRPH 3QWRA 5D1XD 4G6FB 4LKXB 4KROB 1WWBX 1BOYA 1AFVL 5EA0L 5LCVH 5D1QD 2OYPA 2ZZUT 4LU5H 3WEXB 3TV3L 4F8QA 3DBXA 2AEPH 5HHOB 4QCIB 3DETC 4RA3A 4K23H 5E8OB 3V6FA 2CKBH 3EFDH 2VIRB 4ALAH 5DYOA 5DVMA 5I8OL 5E8PA 1KNOB 1JPTH 3B9EA 3SEPA 4UIKL 4RGNB 1MI5B 2FX9L 1QA9B 2X1OA 1BPVA 1G6VK 2ADGB 3L7EA 4OCSL 5C0BE 4RNRB 1KIRA 4QTIL 3AGVA 4HJGA 4K94L 2BVEA 1II4E 3QFJB 1OSPH 1QRKA 3ARDD 3VI3E 4LVNC 1RJZB 3QG6A 3WKMH 3VW3H 4GAYB 3NCCB 3BN3B 1NLDH 1TZHB 3ULVE 2YUXA 2WQ8A 1SEQH 4KC3B 2DLGA 2HT3D 4O2FA 5GPRA 2PYEA 3TIDB 3QXDA 4XP4L 4Q2ZA 1F90L 2X05A 4FQCL 1UQSA 5C0NC 3LRHA 5I1HH 2UWEB 5IB4B 3Q6FB 2EXYD 4K71C 1U91A 2EDYA 3HZKA 4BQ8A 2A83B 3FN0L 1AJ7L 4S1QL 1F6AB 1YNLH 1IAOA 2ZUSA 4QRQA 3UPRB 5F88A 12E8L 4HUUB 5F89B 5GSVA 5MEOB 4DUXA 3I2CL 2XA3A 4I3RL 1NCTA 5HGHA 2LABA 3DXAB 2EIZA 3AU1B 3TBTB 1GOFA 1ED3A 1Z9OA 1IILE 2AK4D 3VRIA 1I8KB 2IBBA 2UZIH 4OF8A 4OZHB 2APWA 3U9UA 2X1XR 3V5DB 2Y5EA 4NGHH 2H9GB 3FN9A 4OF0A 1U8JA 5F1IB 3QI9B 1FZKA 1NDMA 4L1HA 5MEPB 3T0EE 4RDQG 3MNVB 4X4YA 2XPGB 2R9HD 1F3DH 1KENH 3AM8C 4TUOB 5DJYA 2HFFA 4X4ME 2CR6A 1CDIA 1HSAB 3KYNB 4XNYH 1PDKA 1GOGA 4MYWB 5DSCA 3QXAA 3MA7A 1VSCA 3ZTNL 3QRFM 1HYRC 5SX4H 4OCYL 1ZGLB 5HHMD 1XF3B 5CIPH 4P4RB 3UJJL 5B3JE 5J6GA 4APQA 1MREH 4GRWF 1Z6JT 4XPHL 3WN5A 1IEBB 4W4OA 5F8QC 3CFIC 4Q7DA 3VXRE 4U1NA 1K8DA 4EN3B 5FA4A 1AGDA 2JK5A 1CVSC 5JZ7D 1MNUL 1MH5A 5EU5A 1HSBB 1RZJL 1KJ2H 5DHXB 2JF1A 5HI4C 3MUGB 5AUMA 1YY8A 1MY7A 2LAAA 3QIUB 5F1SA 4GSDH 3P40A 3UTSD 5BQ7A 3GGWA 4R2GD 1PZUB 3GSXB 1NC4D 4Z7VB 1C5CL 3QXWA 4MAYD 1HI6B 5HYQB 5I1AB 2P5EE 1I4FB 1I7ZB 1P7QA 3TIEA 5IMOB 4LSDA 3BPOC 1BD2D 3SY0A 5EFIA 4GG6A 1FV1B 4MCYA 5DJ6B 3WS6A 1GC1C 1FN4B 5HTSA 5GGTL 2AGJL 1QACA 4J3SA 3VG9B 1V8HA 4FMFA 2HJLB 2OZ4L 4D0DA 5FDYA 4HKZA 4FP8L 2F8XC 1PEWA 1IM3B 5J1AA 1KPUA 3OJ2C 1KLGA 4FFVC 1HXMA 1ORQB 3HE7B 5C6WH 4LPUA 4UTAH 2ICES 2A6KA 1IBGL 3GRWA 1J1PL 3QB7C 3DYOA 5BS0D 1C5DB 1XGYH 3BKML 4HKXB 3G5XA 3ARBA 1DQJB 2YD3A 4JFEB 4QTIH 4K94H 1MHEB 1GZPB 3HZVA 3SKUD 3VFOB 4M5ZH 1WT5C 4M7ZB 1EFXD 2RR3A 4LCIH 1K8IB 2XT1B 1PQZA 5I76A 4LSUL 5CLTA 1NL0L 1DBKH 4CU6A 1KJMA 4P2RA 4ZUVB 1FBIH 5CZVH 4RWYL 2ZJSH 4NJ9H 4QRPA 5J13C 2Z93A 3FQXA 2AEQL 3HLAB 1FNSH 2IANB 1F90H 2EKSA 1NCDL 2BY0A 1J18A 5M94B 4HEME 1S78D 3GHEL 1EHXA 2VLJA 1MLBB 2H2PC 2O5YH 5T1MB 5TDNB 1AJ7H 4HFUL 2EDKA 3SCMC 4PRIB 5EU6E 1YEHL 2EO9A 1VB9A 2IQAA 5GRWA 1XGUA 3P4MA 3NPZB 1GIGL 2VZTA 3MGTA 1Q94B 3MBED 1OGTA 3IB4A 2BVQB 4V1DE 3I2CH 4WUUE 5BW7A 2FWOB 1JUFA 1YQVL 1P4IH 3CXHJ 4I3RH 1NMBL 3HE6D 5JHDA 3TZVC 4NQDA 4KK8D 4J1UA 5ID1A 4JVWA 4U6YA 3RP1A 3W0WE 3SE9L 5GHWH 1XH3A 1T1ZB 1DBJL 4HXAL 4OGAD 3ULUH 4K9EC 5JIKA 4NQSB 2B4CL 4LLDA 3QXUA 5ID0A 4UU9B 3FCTA 5C09D 5HJ3B 4Z7OF 1RQ5A 2CDFB 5C0GA 3C60D 3BIKA 5HDLA 3MLYL 4N90D 3Q48A 1SJEA 4OCXL 5D1XB 3K4DA 3S37L 1FNGB 4CU8A 3JVGA 4P46C 2VZSA 4CADA 3RTQB 5ICYB 3VXSE 1ADQA 3ZTNH 1LHZA 1NEZA 5AZEH 4OCYH 2C26A 4HK0A 3OKOB 3TCLA 2P8LB 5C0DB 3T0XA 1CF8H 4JFFD 2VLLA 1TQBB 5ANMA 2VLRD 3EGSA 4O9HH 2Y36H 4TVSa 4WRLA 1XCTA 3ARWA 5B38B 4NKMB 2JCCF 4JFQB 4I0KA 4R3SA 5E6IC 2IH1A 4KJWD 5HPMA 3AC0A 2XWBB 1RZJH 3EYVA 4Z7WE 1VFAA 1ES0B 4CVWA 1CZ8L 4LPYA 2EZ0D 2H8PB 5DUPL 1YEIL 3OB0K 1S9YA 1T1WB 1C5CH 1X4YA 4G8FB 3BISA 2WUBL 1IGCL 2YKLL 4ZXBD 4MQ7A 4NO5A 4NO2A 5I15L 3VWKC 2HH0H 2A9ML 3JV0A 3RGVC 4LFHD 5IFAL 1T3FB 2PR4L 5E70A 2APXA 1EEZB 4PY7A 4ODSL 1QRND 4PJAF 1F3DJ 3KDMB 4NKQB 4M62L 5C0EA 2R8SH 1OGAB 4HK3N 4HS6B 4NPYB 4PIRF 2R69L 5DJDB 1L6XA 3QQ9C 5FKPA 2NY0B 1ZA6B 3WFDL 2OZ4H 4NQED 3QUXD 5B39A 4FP8H 1K5NA 3DVNB 2C3HA 4GJTB 4NOBA 2OR8A 3L3IA 3SPVB 3D18A 3ULSB 5B38G 4QEGA 3VXQB 2QLVB 3PQYA 4MNGE 1IBGH 1S7RA 1KG0A 5I30H 3FFCA 2Y4SA 3BKMH 5D2NB 3EFFB 4N0YH 5E9DA 4FQJL 3IDNA 3C9NB 2YXMA 3I3EA 5FKAA 1MJ8L 4N5ED 1F4YL 5EC2A 4R4FL 1C1EH 1S8DA 3RZCD 4ZO8A 1RMFL 4YHYC 2HJFA 4EVNB 4M1DL 5EUKA 1IKNC 1OAKH 4C58B 4YZFF 1NL0H 5IQ7L 1IKFH 5HSFA 4TSAL 4RWYH 4KRMB 2O26U 3U30B 4M1GH 1Z3GL 2VDRH 1QTYT 3SJVD 2VLMD 1AQDB 5I1DA 5C07E 1JTPA 5FYLL 4OZIA 4HDIB 2WWMD 3A6BH 2J12B 3VFNB 4GQ9L 3OKYA 1EUTA 1MIEL 3L5WB 5TE4H 5F3BA 4BH7A 5EN2A 1CXKA 2OX5A 1G9EA 2BMKB 5HHMB 1EFQA 2BK8A 5EULV 3ARGD 4UT7H 1XR9B 4U6XA 1GIGH 4ZNEE 4KKLC 4QOKE 3RGHA 4L4JA 1I3GL 5CEYA 4YC2C 1N2RA 2PO6D 3FOLA 1NMBH 4I5BB 3TA3B 4PLJC 4WFEE 2ORBL 4ZPTA 2FEEI 4ZTPL 4PJIF 3Q5OA 4F7CB 4IRSC 2Q20A 3PJSA 5D7JA 4R2GB 1TZIA 3Q2CA 3DIFA 3F7RA 1DBJH 3S4SA 2CJUH 3HI6L 5J8OA 5KSVB 2FYYA 3IS1X 1N8ZB 5DA0B 2FHFA 4PV8B 4F7TB 3DETD 4NKDA 3HUJA 5C0AD 1YN7A 5KOMC 4XNZC 2AI0H 3VFTB 1NGZA 3MLYH 4QO1A 1D6EA 3ZL4H 4UDUA 2XZCL 3VGAB 5TJWK 1ZTXL 4MAUL 1HQ4A 2PW1A 3P9LA 5E94A 1IE5A 5CS7A 4ONFL 2W92A 4U3CA 4TUJA 4Y7MA 3C6SA 1KPRA 4X9HA 5D1ZC 3PWNA 3U48A 3GSNH 1UH2A 4EBQL 3UDWA 1R3LA 3QHFH 4JR9H 4PRNA 4L4VE 5F7WC 4JDTL 4Y1AB 5MHSD 1XZ0A 1BBJB 1VA9A 3REWB 5ELIA 5C0ND 1FJ1A 3RJQB 4DTGL 2QQKH 3BHBA 4D0CA 4ZUWA 4L8DA 1FO0L 5F97E 5C9JA 2ZSVB 5DUPH 1YEIH 4M7JL 3MXVL 4R4BA 1R5WB 5HHVL 3H3KA 4LCUA 3CFJB 3JZ7A 2WUBH 1LEIB 5J12B 4KTEH 3MRRB 2YKLH 1NQBA 3QDGE 3MBXL 2PYFA 4DKDC 2HVKB 5IEHA 4AIZA 4G9FE 5I15H 4OSUH 1G7IA 1GAFL 4KUZL 5MEQA 4U7SA 4X8JA 4QGTA 3OHXA 3G9AB 2PR4H 4UBDC 3AMLA 2C4FU 3IFNH 1T1YB 1X5IA 4X6CF 2L7UA 1NCAH 3UTTD 3DUUA 5F7EL 4M62H 4ODBD 2X4OA 2R69H 3OKLB 5HVFB 4LCWA 3WFDH 5C08E 1BIIB 3ARFB 3I75A 3EOBB 4DKFL 4C4KO 5FUOL 3MBEB 1MJ7L 2VMFA 1H3TA 5GGRA 2I9TB 3QXVA 4TQEL 4PRBA 3DV4A 2FHBA 1S7XA 4N8VB 1MCFA 1KXQE 2VXTH 1QYGL 1WISA 1D5ZA 4V2BA 4HH9A 4JZNB 2E9WA 3G5YB 2F58L 2X5PA 4JDZB 4QHMB 3ZE0F 5CWSA 4QXGH 3DV6A 4ISVB 4I18A 1QPXA 1BEYL 4PJHF 3CVHA 3HZMA 3F7QA 4LSPL 1RMFH 1ZSDA 1PLGH 1P84J 4M1DH 3T8XA 2ESVA 5HI3D 5C2BL 1MJJB 4X6EB 5IQ7H 2NY2C 2YBRB 3HI5L 1FQ9C 3LPWA 1KULA 3NIDF 2KQNA 3TPUA 3LKQB 4WTZG 1Z3GH 1UB6B 1IAIL 3JUYA 3QCTH 3CZFA 1YYML 5D7IA 4GQ9H 5HI4D 1MIEH 2N56A 3F7PC 5H94B 5I8CB 25C8L 5KSBE 1JV5A 1JPST 1JHTA 5IVXE 4G6AC 4PJAB 1I1AA 3MV11 4OBRA 2BSSB 1WJ3A 1OT2A 1HI6A 3V8OA 3WFCL 4N8VG 2XV6B 4KZDL 1HZHH 2DKMA 4ZPVB 2PTVA 4OTXL 5T33L 4U6VH 4FOMA 4YWGL 3G6JA 2N7AA 2X4RB 2LU4A 5IT2L 5FA3A 4FZ8L 4ZTPH 5DJ6A 2H2SC 1BX2A 1VDGA 3DVGA 4OZ4A 2X70A 3BMVA 4MA1B 1G7JA 4RBPH 4KI1A 2ADJB 4WI6A 2D31B 3HI6H 2YEZA 3QDHA 3J8F7 4WY7L 3S9DB 4ZXBB 5FOBB 1QQDA 3AMKA 4Y2DA 1ZT4A 3WLBB 2E8YA 4F7PA 2FHCA 5SX4I 1IM3A 4CMMB 4JCLA 5C3TA 4FFVD 1JE6A 3C5JB 3LIZH 3OGCA 3EYOA 3VA6A 2YD4A 1QRNB 5DRXB 2DYPB 5SWQB 1FLTX 2W1NA 1DQTA 4HWEL 4AEFA 5I8EA 4MX7A 3DRQA 4UNVA 1F42A 3QUXB 1NFIA 2ERJB 4E41D 3JUZA 1S3KL 3GMPA 4J3WA 4P23A 3MX0A 4F3FA 4EBQH 1W2KT 2BVPA 2OCFD 4IOFC 2DQIH 1P5UA 4XWOD 2QADC 5HGBA 3LZFL 4JO1L 4WWKC 2AJSL 1T5WA 1NAMB 1XF2A 4Y5YC 1D6VH 4DTGH 1JZ2A 3RZCB 3HZYB 1RVFL 1JF6A 4MA3A 1TCRA 1A6AA 1OP5K 2H2PD 4M7JH 4EIGB 5JUEL 5HHVH 3SCMD 2H41A 2MNUA 4BA8A 5AAWA 3DX9A 2V5MA 4RIRA 3KPSA 4O2EA 3NCFB 3DX6B 2DL2A 4FZEL 1G7QA 4AEIL 1GAFH 1WZ1H 4WHYH 1KELL 4KUZH 3BPCA 4PJFA 1UT9A 3VFVB 4YDVA 3HMXA 3G5VB 3IDJB 3TZVD 5F7MC 4UV4L 4OD2B 2K7QA 5EUOE 3WYRA 4I2XB 3OG6B 3WO3B 1UXWA 3RDTA 1GGCH 1MWAH 2R1YA 5DFTA 2DLTA 3BP7B 3RY5A 3PV7A 1SYVA 2OR9L 4L3CB 4RFEB 4U1MB 5FUOH 3BD5A 4GKSA 1BFOB 3PGFL 4FS0A 1ZGLM 4K7PH 2ITCA 4PUBH 1JNNH 3F12A 1RJYA 3TBWA 3QSKB 3DMMB 4K7FB 2R2BA 4J3VA 5E8EA 3KLDA 1HNGA 3V4VL 2E6JA 3HI1A 4HLZG 1CCZA 2WIIB 3W39A 2AXGB 4P46D 1DEDA 1QBAA 5E00A 2YN5A 3ALWA 2F19L 4LSPH 5F7DB 4XP1L 2J7LA 5D1QA 4XP6H 1IT9L 4M3KB 1JWMB 2WWKT 5C0AB 2OI9C 2OTUB 3HI5H 5FYLE 5E0QA 4MDJA 5D71L 3DO7B 1AR2A 1NGQL 1FYTD 1TZGL 4XVJL 1RULL 2F54B 1SMAA 4J8RB 5LXGL 3UJIL 5ETUA 3P9MA 1ZGLP 3FQRB 4LVNB 4MA8H 3VXMA 4KKBD 25C8H 3ARDA 4KK6C 3RWCB 5EO9A 1Q0YL 4M9OA 4GG8A 1A2YB 1MLCB 1HCVA 3N06B 2CDGB 4KMLB 3WJJC 1TVBA 3UTQA 1H8NA 2YN3A 3E8UH 3LS4L 1UB5B 3ARTA 3T0EB 3VWKD 3PHOA 3RGVD 3PWLA 4YWGH 5EORL 2XNAB 5EZJA 4PGEB 5CSGA 3QDJE 4XPTL 4XZUA 4H8WL 5IT2H 4K71B 2ZOKB 1FPTH 3ECBB 5JIPA 4ZFGL 3GFUA 4LQ1A 3H7BB 3QDMA 5DC9B 1KIQA 4OLUH 5CINH 2DICA 4PJHB 4HG4J 3WIFB 1S9XB 1FL5A 2OSLA 3MLZH 4XAKD 1OM3L 3EJJX 3WL9A 4U2YA 5IWLC 4LASL 3DVFA 1I8LA 2V17L 4S1RH 4M6NL 4XP5H 3T3ME 3BGMA 2AK4A 5EU3B 3MV7A 2J8UE 3IFOB 4LLVA 3QNXB 1ZHNB 4WU5B 5E03A 3T3PF 5JQ6L 2A6DA 2DQEL 5ITFA 2P24A 2BRQA 4NCC2 1UCTA 2YPVH 2CLVB 3T4AA 1RZKH 4K2UL 5E4IA 2YD5A 1NFKA 2G5BA 4FQHA 2BCKA 2DQTH 5GGVL 3UROR 3QUYC 2N4IA 2HTKC 4DVRH 3UX9B 9CGTA 4C59B 4CGTA 2BNRE 3LZFH 3WIIL 3GI8L 4JO1H 4L4TA 3DNKA 3NIFE 4P3DB 3ARPA 1TXKA 2ICCA 4ONGL 2HVJA 3CX2A 5DTFA 5ESAA 4HULB 1OOAA 2VN4A 2XZZA 1MHPH 2APFA 3L5WA 4OD3L 5ICXA 2XN9A 3SO3C 4OM1L 3T2QA 4G8GD 5AZ2H 1DTUA 5AG8A 4DOHE 5D5MF 1IGTA 2HLAA 3MO1B 4BFEA 3V7AE 1CQYA 5IHUL 4KKLD 4FZEH 4U2ZA 3TYFB 4AEIH 3ZHDA 4HT1L 4Y5VA 5GRXG 4PLJD 3DGCR 4UV4H 2IFGA 4OQTL 5BXFB 1I1FA 4HPYL 4IRSD 1Z9LA 4KJPD 4Y8DC 2OJEA 3LRSB 1T21B 1TJIL 3UTSA 3RUGA 1OT1A 1NC4A 1MVFA 2DQJL 4MAYA 1T83C 2CLRA 3CAFA 5JQHC 2W60B 1QLEH 4HJ0C 3RX8A 3RIFK 4G6MH 1OARL 4XC1H 1XGTA 3KPTA 1BD2A 3CSPA 4MNQB 2Q87A 5FO7A 2CPCA 5ISZD 2EDLA 3KGRA 1CFNA 1FZMB 5D2LE 1GGIL 4ZSOB 4DGVH 1JHKH 4JO4L 4JY5L 1UH4A 2NMSA 3VXTA 3T04D 1A6ZB 4XBGA 4XP1H 3BD3A 3V2AR 4YFEA 1F2QA 4TRPL 3ILPB 4WGVB 2RCSL 1IT9H 3IFPB 5D1ZD 1XEDA 2UY7A 4GQPH 3FOMA 4BZ1L 3DPBA 1U8NA 3DRTA 1XGQB 1E27A 3SDCA 1IMHC 2VC2L 3CXHK 5IHBA 5D71H 4IM8A 4JZJA 1S9KC 3QXTA 3KWWA 3GIVB 1JWUB 1RULH 5BS0A 4UB0L 1NSNL 4HW6A 5LXGH 1EUUA 1G84A 3EDKA 4ETQB 3G08A 4ODTL 4NZJA 4PPTA 4ZOEA 4ZUSB 3S36X 4PJCE 4PBVC 4Z0XB 1B4JL 1EFXA 1Q0YH 2VAAB 3JBG7 3MLUH 4UT6L 2D3VA 2J1KA 4D9RD 4MJIE 2VXUL 1A6VL 4H1LA 4QYOB 3FO9A 3LS4H 2R2EA 4YE4L 1OAZL 1OTUD 3K4AA 4I3GA 1IL1A 5JW4M 2E9IA 3CLFL 3KXFD 4P57B 4EDWH 5INCA 3VWJB 2ZCKL 3BQUA 1I1YA 5E2UL 1G9NC 4UBDD 4X6DE 4X98B 4XPTH 1U95B 4C56B 4PJBE 1CICC 1S7QB 1N26A 4ODXA 1J1OL 4Z7QF 4RMRA 5GS3A 1RUKL 4ZFGH 2NY1B 3MOBH 3EYFB 4LAJH 3R8BB 5T5FL 2FJGB 3VXSB 4QGYA 2IFFL 1MCSA 1B2WH 3TBVA 4Z77B 4PJDA 1CK0H 3ZYZA 3MV8B 1DN0B 3IJHB 4P0DA 5L6YL 3EOBA 1MUJA 4UAOC 4DK6A 3MBEA 5BZWA 3GBNH 4HWBL 5C0CD 4P2QE 5T3ZL 1Z0NA 4LASH 2VLKA 2V2XA 3BUYB 3TZVB 3VXOB 1S5HB 4FFYH 2J6EL 3HE6A 2V17H 1Q9OA 3VCLA 1WQVT 3HS0B 4PRDB 3G6AA 2R23A 1BFVL 1IQDB 4PG2C 5KVGL