5DQDH

Structure of s55-5 fab in complex with lipid a carbohydrate backbone
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
222
Chain Sequence
EVKLVESGGDLVKPGGSLKLSCAASGFSFSSHGMSWVRQTPDKRLEWVALISRGGSYTYYSDSVKGRFTISRDNAKNTLYLQMSGLRSEDTAIYYCTRHKGLRRGTNAMDYWGQGTSVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lipid A-antibody structures reveal a widely-utilized pocket specific for negatively charged groups derived from unrelated V-genes
rcsb
molecule tags Immune system
molecule keywords S55-5 Fab (IgG1 kappa) light chain
total genus 43
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2015-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dqdH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dqdH01
1LDPL 4TUJB 2IFGA 4L29B 3OXSB 1A1MB 3AFLA 4I18C 5IEKB 3OAYK 4OD2A 5CP7A 5DJ6B 1RUKH 4JDZA 3K46A 3ELAT 3GDBA 1MF2H 2CSPA 3KGRA 1DJSA 3LEXB 5CINH 1I3GH 1YPZB 3RIFF 4OGAC 3LV3A 3MV8E 3CD4A 5D6DC 1BAFH 1XZ0A 3CH8A 1IKFL 1Q9KA 2ADIB 3VFGL 3KJ6L 4MB5A 4O51A 4HF5L 1KLFA 3RHWK 4KJWD 2UWEB 3MCG1 4LCCB 1MCWW 5E0QA 5L8LB 1D5ZB 5E8DH 5IWLC 3OR7B 4Z76B 1FAKT 2HVKA 3L3DA 1DR9A 4GW1A 4L9LA 2ARWA 4YBQC 5KJRL 4U1LA 3DX8A 3NN8B 3EGSB 4RGOH 1QBAA 2YRPA 5D2LE 4E9LA 3DV6A 3CVHL 2YUWA 4M61B 3SGJA 1NBZA 2BJML 3FT3B 3PXHA 1F58L 1G9MC 2PYEB 2ZG3A 3QUML 4APQD 3SDXB 3VFTA 1JNHB 1RJZB 4YQXH 4PV9A 4WTXA 3WIHH 3J7HA 4HXAH 4JFEE 1Y18A 1E4XH 1ZGLP 4QGTA 3UTQA 3QR2A 1I8KB 4H8WC 4LCCC 1DVFC 4PGDA 4MLSA 5E8OB 2CO6B 3EYSH 5IOPA 4G7VH 3C8KA 3EDFA 4S2SB 2ADFL 1OAXH 4HWBH 5C7XH 1C08A 1LO3H 1EDQA 5ACZB 4FZ8L 3ES6A 3DBXB 3WD5H 4K07A 1CTNA 1OAUL 1I1AA 3BE1L 3IDNB 2BFVL 3PG2A 3DROA 5EUOF 4JZOA 1QLFB 3HNVH 2Z8VC 4IS6B 4NC1E 2NYYD 3G04A 5TDOB 2FR4B 2IBBA 1F6FB 3AM8C 4QOKB 2YC1B 3EDJA 1AGFA 4KMLB 1L9NA 5DD1L 5C70A 3WLBA 1AGEA 2FB4H 3QDMA 5IVZA 2JCCA 4C58B 1QRND 2J8OA 3QB7C 1MJ8H 4OJFL 4QHMB 1T0PB 4PD4J 2I9LA 2IH3B 4F7TB 1KPVB 4UB0H 3QDMD 2DYPB 4Y4HD 4XMKH 4C4KT 3NAAL 5D6CA 3KPSB 3F65A 3WE6A 1K8DA 3DECA 1YPZE 4LOUC 4P2QB 4KK5C 4EDWL 2VB5A 3DUSB 2W59A 3QIUD 4WGWB 3T2PA 3GIVA 3W0WD 3X14B 1F8TH 3H0TB 1IAIL 1VGKB 1IQWL 1RVFH 2FCBA 3MLUH 1BQSA 4Z7WE 3VFRB 4DW2L 3WJJA 4OV6F 5J1TC 4JDVB 5EIIA 2IBGA 1OPGH 5ILTL 5SWQA 5DJDB 4K2UH 5DMKB 3WKML 1X3DA 1EPFA 1DQLL 1SJVA 1YDPA 1R24A 2PO6D 5F8QC 3QDHA 1IE5A 3U30B 1B4JH 4Y8DC 1YYLL 2FL5A 3PGCA 4ZO6A 1A3QA 3HE6B 5IB4B 1A7NL 2XTJD 4I48A 4ZYKA 4JZNB 2H2SC 1EZVY 3RKPA 1FO0L 1RSFA 5EPMB 2VQ1B 3EFFB 4CDGC 1JCKA 1HCFX 1Z9OA 4OGZA 4RAHA 1INEL 1YN7A 2W0FA 3T0DA 4XP9H 3F62A 1BWMA 5I1IL 1Z9LA 4QTHB 12E8H 4XBPB 3A67L 3D39D 1TJIL 2FDBP 3VFGH 3RWGA 5B3NA 4P23D 4DCQA 1BJMA 4KV5F 3RL1B 3PIQB 1TETL 3LN5A 1K4DB 3Q2CA 2VISA 4ODUA 3RIAK 3LSOB 1S9WA 3RX5A 3PHOA 4L1DA 4H26A 4FFWC 4Z7UE 2OSLB 1XF3B 3PWVA 4KDVA 3VXSE 4N9OB 5ENWB 3MR9A 5CSGA 1HXMB 3HUJA 4YR6B 4XAKD 1LP9F 3MRPA 3GHBL 1IGIL 1D6VL 1LEIB 1NFIA 4MX7A 3S6CA 5GGUB 5HGGS 3S96B 2A1WH 1H8SA 4O2EA 4FFVD 1KCKA 3MV9E 3FN0L 4ONOA 1SEBA 4OLVL 1X5ZA 1BVKB 5DJ0A 3B5TA 4NQXA 1VFAB 1MNUH 1CE1H 5IESH 2ZCHL 4Z0XA 3AC0A 4D0DB 1NDGB 1J8HB 4FOMA 4LPTA 2FX8L 3SKJH 4R0LA 1U8QA 4HHAA 1QSVA 1CXIA 3A67H 2K7PA 4XNQA 2ZSWB 5EZOL 4Y4FC 1ZLVH 4XPBL 3B9VA 5T3XD 3G6DH 2LV4A 1JPST 2J88H 1IBGL 4F15C 2O26U 4X98B 4PV9B 4Y2DA 1XGYH 4BZYA 5ICXB 1T7YA 1S9VB 3KNBA 3LQMA 5C07B 5DTFB 4R0LC 4AQOA 4HAFA 4NYLB 1Q94A 5CJXC 4PJXA 1C08B 3C5ZA 1FNHA 4HH9A 4OGXH 5MEQA 5C09E 4HCRH 3BEVB 1MUJA 2VZ3A 3OX8A 4NC2B 4QOKD 4X6BA 4XP5H 2FSEB 5J6GB 1LE9B 4NQVB 4EUPH 4N0FB 5L2JA 1FO0H 4Y2DC 4Z95L 2CLVA 5KS9E 4G8GA 3RUGF 4FXKB 2FATL 3R0MA 3O3EA 4PRHD 3CUPA 1FBIH 5ISZB 3OAYH 5T5NF 5IFJA 4MMXC 1S7WA 2DKMA 5C9KA 3NIDF 4UUJA 2V9RA 4GKZB 4NO3A 1YNKL 3MRFA 1EJ6A 1V7NL 1ZLWH 2PR4L 3IXTB 4OBSA 3VXPB 1BX2A 2HP4A 3ALPA 3G9AB 3MJ8A 2QBWA 3MJGX 4XBEH 3S9DB 4JZOB 5JQ6H 3OMZA 3BH8A 5D1ZB 3ROOA 3QFDB 2BVUA 1UXWA 5GGSA 4PUBL 1Q38A 1IGTA 2ZKHH 3MRLA 2MWCA 2A6JA 3SKNA 2XTJB 2W0PA 3D69B 4OD1L 5JPMA 2VABA 3MRCB 1A21A 3STZB 1E27A 2I60H 2LU4A 4FQLL 5GISH 5FGSA 1FORH 4YGVA 3EYQC 1EFXD 4R2GC 2DIBA 4OZFH 1PZ5B 2UZYB 4G6KH 3ROLA 3FFCA 4NO0D 3HNTL 2EICA 3WIHL 5DRZA 4LKCA 4K55A 1CLOH 4P3CL 2V9TA 4NP4L 3DLQR 4FQHB 3V6ZB 3QDGB 3VCLB 3DHMA 1AC0A 1K6QH 4JY4A 1IGJA 2UV3A 4NKDB 3KYNA 4GG6A 3FT4A 3JWDL 3MV7E 2OP4L 2JB6B 1UJ3C 5T1DL 4Y8AA 5BRZB 2P24A 3NIGF 3BESR 1T22A 2O5XL 4JPIA 4NWUH 4M7ZB 1V3MA 4HIHB 4W6XB 4E5XA 1N59A 1EFXB 3KVQA 4PJXE 4L8CB 3UYRH 1A9BB 3ULVL 3MTRA 4P9ML 5IR1B 1W0YT 4G6FB 4XHJC 5BV7L 5I1DA 1CT8A 4MD0B 2DN7A 5EOCL 1HXMA 1NUFA 1X5YA 5D7KD 4JR9L 5BMFH 4O4YL 4EQ3A 5C0RL 4LDOB 1CICA 4GBXC 3CXDH 5EU3B 5DEGA 1CDUA 3GZKA 3MXVL 5TPWL 1A6ZB 5IB1B 4TVPD 2NY5C 3H7BB 4PBVC 1FV1B 2EXYC 1RUPH 2E7MA 3U46B 4WIQA 4ZUSA 2H9GB 4ACPA 5IVNA 2BCKA 5FYJE 1JFQH 2V7NB 1CFQB 2NW2B 3TO2A 4X9GA 5C0AB 3O9WB 4G6FD 4XNYL 3RDTC 5SWSA 4M7LH 2OR7A 3D9AH 5I17B 5E2TL 4PTUA 1H5BC 4WEMB 4LLUB 3HC0B 4RCAA 3DI3B 2Y07L 4GMSH 5IB4A 5KTEH 5I76A 2BNUA 4JPVL 3WFEH 1D5ZA 1GGBL 4PTTA 5GS0C 4PY7B 1ES0B 2XA3A 3B9KC 5BS0E 4KKNA 1KJVB 3QUKA 3RNKA 4HJJL 3SO3B 5FGBA 2I9TA 3N0PB 1SVZA 3PP4L 2QHLA 4C56D 3UDWC 4NZUH 4EUPG 1CBVH 2EO1A 5EUKB 1OQXA 3V5KA 2ENYA 3WIFA 5D1QA 1UB5B 3RU8H 3NFNA 4PRBA 3C2AL 1DVFD 4Z6AT 5DMKA 2E6PA 5EU6A 4A6YH 2J6EA 3S36L 5IHLB 3X12A 4DAGH 4YBHA 1IL1B 2FH8A 3QYCA 1J0YA 4OD3L 3SDXA 3H8NA 3QIBB 2NY2D 5I1AB 3DARA 4AL8H 3U2SB 4APQC 3GGWA 4HLJA 3FO0L 3MODH 1P2CA 4TNWF 3C60B 4PB9H 1MRFL 3MRPB 4U1HA 2P5WE 4XVSL 4G8GB 4MXQC 5EU7E 3V4PL 1CFVH 4M7LL 1MELA 4KK8C 3VFSB 4ENEC 3EOBA 2YXFA 5E2UH 1DQDH 4NZTL 5B39G 4XCFL 2H2PD 2QHRL 4TULL 1MFEH 1MH5A 1J1PH 4NQEB 3GM0A 3WKNA 2R0ZH 4PG2A 4PJXB 5I74C 4GKSB 2BDNL 3DTXB 5JW4N 2NYYC 4Q0XH 5HJ3B 3G6AB 1Q0XH 2ICWA 3QXWA 1SYVB 3TWCL 4EEEA 1A2YB 2FIRT 1TNMA 4HEPG 1JJUA 1IM3A 3F5WB 1KB5H 3AS2A 2X4RB 4LSPH 1L0QA 1K4CA 5F9JB 2G5RA 1R5IA 3UTTA 3PWUA 4Q6IC 1H8OA 3CZFB 2DWDA 3ULVH 5EN2A 3DNKA 1OQOA 4LPYA 2VXSL 1HHHB 4AMKL 2F74A 2VE6A 5E24E 4U6HA 5GS1A 3DRQA 3OHXB 4KROD 4P5TD 4H20H 2BNRA 4CDHA 2F54E 5DFVC 2BERA 4G9DB 3K1DA 5I74B 3QG6A 3ZMRA 1CXKA 4YHZL 4HIEB 3VXTA 2A9NH 3CSYA 3P9MB 4P2QD 5MEQB 3AU1A 4BZ2H 3ZYJA 2B2XL 5BQ7B 5FF6B 3WHE0 3IJHA 4JJHA 2JLLA 2OS7A 5K59F 2VLLA 3UROR 4RGNE 1D7FA 3N1PC 1ND0A 1SJXA 5FCSH 3QT2A 4LARH 3GMRB 5LQBL 1CZ8H 2VQ1A 1GHFL 5GHWL 1KPUB 3L3KA 2D31B 4E0RB 1DANU 3QDME 5SWQB 1FDLL 3JV4B 1OGAB 4QHLB 1EGJH 1S5HA 3V0AC 4OBRA 4MB3A 4ETQA 2ED9A 1K4DA 1VERA 4QRSA 1RZ8B 4PV8B 3LSOA 1BJ1J 5J1AA 1NGPL 3O2WH 1X5XA 4JVPA 4KI5D 4EKXA 3EJYD 1TZGL 2DBLH 1A14L 1FGNL 1FVEB 3O6KL 4UT7L 1XCQB 3GSUA 2DD8L 3LS5H 1GGIL 1YMMB 1U58B 4M6OL 3QJHA 5HYIA 1CL7H 1DCLA 2DQFB 4P3DB 3T77A 4M5YL 4H8WH 4KTYA 5GGVH 3LKSA 4XC1H 4FZ8H 3UTSD 4OV5A 3AMKA 1F90H 5AD0B 3CX5K 2Z91A 2IEPA 5TF1L 1X6LA 2DTMH 4FQXB 2OZ4H 4JN1L 1G7JB 3MLPA 3GMOA 1HHGB 2BNQB 1OCWL 1BJ1H 1QBLH 2NPLX 1NBVH 1JPFA 4QXGL 2J7LA 4UTAL 3E8UH 3REVA 1LGVA 1NAKH 2V7NA 4IOSD 4LHUB 4WDIA 1GHFH 4Q9QH 1TCMA 1A1NB 2AEIT 2ZOLB 1V7NH 4PG2C 4N8VA 1T83A 1J11A 5DC4B 1UC6A 4QF1B 3KLAA 4L3EE 4AIZB 5B4MC 4NNYA 2H3NA 4J8RA 1DTUA 1E6JH 4LSUL 1HWGB 3RPIA 1Z3GH 2I27N 3T8XB 3GSRA 4PJBA 1PQZA 5JOPD 3HUJE 4L4TB 4FA8A 1AD9B 2VLKE 3QUKB 4XPHH 4S1RL 5C0BD 3QDGE 3RPKA 2CRMA 1AQKL 1X5KA 1EMTH 2JKXA 4XNQB 2HYMA 3S98A 3ULUD 4MMZC 1F11A 3K3QA 3WSQL 5DK2B 1OB1B 5EH1A 1QLEL 3MGTA 3VXSB 5T3XH 4YZFE 2VR9A 2C5DC 1RZIA 2N7BA 1PY9A 1QKZH 3Q6GL 2BOBA 4FG6D 5SV3A 4OCRL 3LZFH 4V2BA 5AZ2H 3HG1B 4C56E 5BVJA 4U6VL 1L7IL 1ZT7B 2A0LC 1CICB 4D2NA 3SGKC 4UUJB 4E41A 2EYTA 4JHAH 3LQAH 1SMAA 1T1YB 3EZ8A 5D7IB 1KNOB 1QA9A 4KJPC 4F33A 1WFOA 4TNVF 3K8MA 4NBYB 3KAAA 1MCBA 3MRMA 3SDYH 5I0ZA 3S37H 4KZDL 1UCBL 4JFQA 4MJ6A 4R2GD 4PR5B 3P0GB 5ADOL 3QUXA 3K8KA 4H8WL 2Y9RT 4DEPC 3SO3C 3IDGA 1I8MA 5ALCL 5ISZE 1J0ZA 1X6NA 4WEBL 1AHWB 5FA4A 3QG6B 1QFWL 4HUVB 2GJZB 3ZL4H 3BSZH 1R6VA 1UJ3B 1CICD 1D5MA 5GGRY 3V6OE 1N4XH 3BKML 4S1DC 3UYOD 3A6BL 2YBRB 1AGCB 3BP4A 1QFUL 5SWZD 1X4YA 5H94B 3P73B 3CLEL 1UWGL 1FNSL 2X89A 3TNMB 3NA9L 4M1CC 4P5TC 3MUHL 1T21A 3DMMB 3L7FA 3FONB 1MF2L 4PJ9B 2D7NA 4X4ME 1ZHKA 3BHBB 2NZIA 3QCUL 1MRFH 2O93L 3IFPA 3O8XB 4GAFB 1DQLH 1EHNA 2DI7A 1EXUA 4GRWB 1TQBB 5F72S 5SWSD 2R4SL 1IC5L 1U6AH 3THMH 1X5LA 3MRLB 1AO7E 3UYPA 4DVBA 4R4BB 5GGSY 4QRPD 4XH2A 3HCVB 1NAML 1T2JA 5CHNB 2VITB 3QDJA 1TCRA 3QI9D 4K7FB 4LP4A 1PX4A 2E7CA 4ELMB 4ZAKA 3E8UL 4QKXB 5C0EA 3S35H 2AJXH 3EO1B 3DMMD 3SJVE 4P2OC 4LVOC 3O8XC 1B0RB 4AEHL 4JRYE 5F96L 4R7NB 35C8L 5LGJB 1JWSA 3VDBA 4NQCE 2D31A 1FCGA 1AR1C 2ZSVA 5FHAL 5HYSA 5MEPA 1U95A 2CJUH 1VGEH 4G8IB 3T1WA 3IRZA 2COQA 1MCOL 3T04D 3BIAX 2NW2A 3UPAA 4P5KB 5D7JC 3TO2B 5CEZH 2J8UE 2XFXA 1NKRA 4QRTB 3K2UL 3ULUC 2C3VA 4HFWB 3NVQA 2JCCF 3DI2B 4UQ2B 3CFCH 2YD9A 2HVKB 3L3DB 4OZIA 4JO3H 4TUJA 3EZJB 1CGTA 3CDGB 1P7KA 4YHIA 2DB8A 1N5YL 5DEGB 4ZODA 1F3DH 2F8VA 1K4CB 3P9WB 3ARDA 1N6VA 1T04B 4NIKB 1WWWX 2OK0L 1N0XL 5JQ6L 2DQEL 2CKBL 2W65B 4JREC 4LK4A 4JN2B 4KZEH 1G0XA 4AEIH 1H3UA 3JZ7A 4XCEA 5IW6B 4U1NA 3PWJB 4XP4L 1HZHL 1DSFH 4MA7H 2VDML 5IJVB 4G43B 3JV4A 4LLMA 3D0VA 5ICZA 3GSVA 1K9TA 3I02A 2ZCLH 4Q6YA 2ATPB 1FZMB 3U6RB 2DQIL 2KBGA 3BIBX 2DQHL 5L2KD 4KK8D 3WLWC 5L6YH 3W11D 4P4KB 43CAB 5IHBA 4HIXL 4C56B 1J1OL 1ADQA 3GSUB 1ZHBA 2B1AH 3OSKA 3QQ3A 5EOCJ 2J5LB 2CMRH 1L4IA 5H35B 5IEHB 3VFNA 4O2CA 2VUYA 3HG1D 5J9PA 2PTUA 1WWAX 1CLZL 2AV1B 3KJ4C 1RU9H 4EI5C 4L8SC 3MNVB 3GO1L 5KVEL 5CEZL 2ADGB 1WZMA 3F58H 1BQHA 4DKEL 4AT6B 3U9UA 1MREH 2EDOA 4Z18A 4YFLI 1NGQH 5D7LB 3VXQB 1DL7H 3IJSB 4XNMB 5ALCH 2AJ3B 3OXRB 4F8TA 4PJDF 3MRQA 4AYFA 3S34L 4IM8A 4OUUB 1JK8A 5H2BA 1XCQA 3HUJF 2Z35B 4JFPB 1LP9A 4TSCL 4DGIH 5ADPL 1CVRA 4HUNB 2FHBA 2GJ6E 3MOQA 1T4KB 1EX0A 3DSNA 5EO1B 2J8UA 1FYHB 3MO1A 1G7PB 1HXYB 2ZUXA 4F9LA 4NRZB 5J8OA 2O5ZH 4QHMA 1X4ZA 1ODAA 4J8RB 1X7QB 5HYQA 1W0WA 1OARH 1RIHL 4DZ8B 2B39A 4ZYKB 1ZOXA 2R2CA 3HNSH 5D1XC 4U6XA 3CMOL 4QRRE 4X0KB 1FLRH 3TV3H 3V5DA 3FN0H 3UBXB 3DYPA 4K94C 1JUFA 4XAKE 5GJTH 2WIIB 5FYKH 1QRNE 2FEEL 1PKQA 1P9MA 3HI1A 5TGBA 3U30C 2GK0B 4QTHA 5B38B 3ZKXB 5I18L 4OFYA 4QRPB 5JHLH 5LXGH 1RU9L 3BDXA 4NZTH 32C2B 3KPLB 4DVBB 4ZXBC 4M00A 3TJEL 4WHYH 3CSGA 3KHOA 2YD7A 1U93B 2VXUH 4JRXA 4UBDC 3RU8L 5BZDA 5HHVL 4RFNB 5KVMC 2WWKO 3F8UB 3MRNB 4HWEL 4NZUL 1FZKB 1RFDL 1TDQA 2FX8H 4I48B 5D1XA 4ELMF 5DVLA 4HW6A 2QQLL 3OJ2C 4KQ3L 3HZVB 3VG9C 3VXUA 1A7OL 5D9SB 2ZCHH 1AH1A 2QQQA 1LEIA 1CDHA 3MRRB 3QEGL 3C6LD 1E6OL 2X7LB 4OD3H 1LEKA 3FB7A 5C0DB 3U0PA 2YK1L 1YUHA 3MACH 4ZXBA 3KPOB 4RQQB 4CW1B 5E4EC 3V6FA 1CR9L 4PJEA 2A38A 2VISB 1XGPA 3MRKA 4I9WE 4YNYB 5C92A 5IM7B 3AREB 3T65A 1MLBA 4DJMA 4IMKA 5F3HB 1QZ1A 3FRPA 4U1IA 5BVJB 5DJXB 3EDKA 1AR1D 2AV7B 2Q76A 2XQYK 1TETH 4MX7B 2YMXL 3TT3L 3DIFB 3LB6D 3D9AL 4Z7QE 1ZVSB 1RZGA 2VXUL 1Q9LB 4M6AA 4MNGA 3RRQA 4R96B 3V5HA 2Z31B 3TVMA 1UT9A 1FVDA 3GUTB 5EORL 4LCUB 1XGTA 4LSVL 4WDIB 3UTSB 2QLVB 4J4PD 1MCFA 1KT2A 5E2VH 3VMPA 5I1CH 1WF5A 4TNVK 4KI5E 3MLRH 1J7VR 4HXBH 3U4BH 3TGXA 1NUDA 5I1KH 4XWOC 3F6IA 1KPVA 3ARRA 2HRPH 2BSTA 5EBLB 3VXOA 4FQXA 4N68A 5I6XB 4NN7B 1WVZA 4LCYA 1NQBA 5KOVC 4P4RA 1MFNA 4N0FA 3SO5A 1CGSH 4JFEA 1B0RA 3BE1H 4JM4L 1KOAA 3ZKNC 4JM2A 3W9DB 5K9KA 4P59L 3OKDB 4G9FA 1D5XA 1HHIA 3SDCB 3NN8A 1PVHA 4HUUA 5ADPH 5DMGD 4OTXH 1F90L 3KLAB 5DTFA 2NY3B 1F3DJ 4OF5A 3QHFL 4KHTH 4XCNA 2YN5A 5I15L 5GGTH 3NAAH 2P5WA 4YHYC 3L5JA 4P3CH 5IB2A 1MUJB 2KZ1B 3WNLA 3BD4A 5GSRB 3QAZB 5F7DA 5EORH 1XMWA 1HOCA 3NABL 4UBDD 1FAIH 2EE6A 3BH8B 4G6KL 4WW2B 2UZXB 3B4NA 1FQ9C 1LO0H 1TZGH 3CAFA 2EDEA 3OB0H 5GGUA 4D3CL 2IWGA 5FO9B 5CEXB 4LDLB 3I75A 4G9FE 3SE8L 1JNLH 4XVUD 3GK8L 3RWJB 2W65A 2BK8A 3KPRE 4X83A 1SY6L 3FJTA 4YHNB 1NGZA 4ZTOH 1KFAH 4JY6A 3VXSA 2NY6D 1IFHH 3HS0B 4HXBL 1CGWA 4KKCC 2C3VB 2RIKA 2ZPKH 1K3ZA 1HKFA 3UC0H 3S4SA 4L8DB 4FQHA 1IILE 5KANG 2ZJSL 3KYNB 2FJGB 4UQ3A 1UKTA 3IXAB 1ZANH 3LDBB 5DS8B 1SBSH 3HRZA 5T1KB 4EI6B 5LGHH 2BSRB 4IJ3C 4V1DD 4FQQA 3KYMB 2A9NL 3O0RH 1P5VA 1R5VA 1UJTA 4PY8I 2BNRE 5HBBA 4XWGL 2XKNB 2GT9B 1RZJH 4HX1B 2BNQE 5DEFB 4RFOL 5ETUA 1ZS8B 4KQ4L 5TE7H 3VJ6B 3BP5B 1KSRA 3ARYA 4XPBH 3MRHB 5IK3A 2VZ1A 3BPNC 3AVEA 3HMXH 3EYFB 4K3DL 5AZEL 5AG9A 2P5EA 4XNMA 3QWRA 4I8DA 1I7RB 1DANT 4L1HA 2WIIA 2CUIA 3LPWA 4GKNB 1P84J 4FQCL 4YPGB 3U46A 4ZTOL 5IUSA 4R4NC 4XCCL 5BRZA 2XN9D 4ODWA 5HHQB 1NC4B 3SE8H 1T22B 5E5MB 2UZIH 3JTSA 1T21B 2IPTL 2HJFA 5D7JD 5ID1B 1G9NL 1S9YA 4GG8B 5C08B 4DKEH 1X4XA 3MJ7B 1LDPH 3D5OF 4YEFA 4XPTL 5IR1A 1WISA 4NRZA 4M1CD 1S9VA 2HKHL 2H26B 5FA3B 4HCRA 3UC0L 4KK9C 1BQLH 3MLSH 1NGWA 3GHEL 3QZWB 5DUPH 3EDEA 1FE8H 3RVUD 2JB5L 1NBQA 2VLJB 4F9PA 2LTQB 2RFXA 5E70A 4ELME 3T2QA 3P4MA 2NX5A 3TO4B 1R3LB 4JFDD 2DBJA 3O2VL 4YUEL 3VDAA 4D9LH 2C7UB 2A2QT 2VZOA 4N9GB 3FO2A 3RUGB 5BCAA 4DN3H 1YQ2A 3ABZA 5IMKA 1F13A 3WNNA 4NN7C 1FFOA 4KKAD 4Y5YA 4AIOA 5A2IH 4P2YA 3H9YA 5FKPA 2X1QA 2DJ4A 3FN3A 3BN3B 4Q0XL 1WV7T 3OKEB 1S3KL 2IMMA 1SHMA 5D7SH 1T1XA 3JWOH 4U1NB 3FKUS 1OP5K 1U2HA 4RAVA 2H1PH 1FZKA 4Q97A 3FAXA 2J4WH 3L3JA 5EA0H 4M1DL 2BX5A 1U92B 3UTPD 5KSBE 2RAMA 3TCLA 5TQ0L 3HN3A 4GH7B 3SDCD 2GUOB 3NCBB 5FCUH 5FM8A 2J3SA 4NQSA 5MEOB 4XWOD 4DTGL 2DQGH 4MDJA 3WIFB 3KPSD 4BFBD 5TGBB 3O6ML 1CL7I 4G8FA 4X6BB 1AO7A 3QH3B 4PRNB 4PGEA 3H3KA 2EDBA 1MI5E 1JTOA 3MOBL 4NQVA 1M7DA 3PQYB 3QDJE 4PJEB 5EO0A 4R7DB 5FK9B 4P46D 4JEGB 4LNVA 5DHXB 4OFKA 1ZWIA 2F15A 5KSBF 2YS4A 5J13B 5C71A 1I9JL 3CVHA 1DQTA 5IBLD 3QHZL 5E7FA 2C26A 1WAAE 1MHHB 4MHHI 1O0VA 1IQDA 5AUMB 3AREC 1T7XA 1RULL 2AK1L 1G1CA 5E1HB 2R1WA 1EO5A 1A1OA 4Q9CA 3ARTA 2CRYA 5JHDB 3CFEA 1MWAB 2FIKB 4I3RL 4CKVX 2RR3A 4JZNA 3ME0A 4TTDC 2I07B 2W0LA 5IMMB 5DO2C 5BS0D 4YIQB 3WL9A 3MCKB 1I1AD 1U8OA 4JFYB 3FZUC 5AWNH 1ZSDB 4KAQL 4LLDB 5D2NE 4X5WA 2IFFH 3DVGB 5IFJB 2OJEB 1IEBB 4XTRD 1PG7X 4OCLC 4F58L 3ARFB 3PWLA 1UH2A 4H1LB 5L88H 1BZQK 2NXYD 4LL9A 3CNKA 3DGGB 1Q0XL 3KPRB 5I8OH 1J8HE 4U4BA 1DQJA 4X6DE 3KXFB 4PP2A 5HGHA 2VDNH 1FNEB 3BO8B 4LRIA 1WCBA 2NQCA 4N5ED 5SWSE 3KS0J 1CFTA 3LD8B 3L3KB 2VXQH 5D1ZA 5FDWB 1EK3A 4U6HB 5GS1B 4YDIL 3NFNB 4PRBB 1J86A 5B21A 5C0AA 3ZKMD 4LEOB 2D0HA 2EDRA 1F3JA 2QQLH 4KQ3H 3RWIA 3UJIL 1OGTB 2X4UA 5I73C 3GMQB 5GRUL 2B1HL 2PKDA 1UM4L 4OLEA 2CKBH 4WNQA 4U33A 3L7EB 4JLRB 3WDIA 1OP9A 2BVYA 4C55A 3MRNA 2R8SH 4PJBF 1YJDL 5C6WH 5CGYD 4D9LL 4M1DH 4MA8H 4PJXF 1J8HD 1R3KA 3KYMA 3NACL 3K74B 2XOTA 1KN4H 5AYQA 2R0LL 5KG9B 5HPMA 3PGDA 2KH2B 3LIZH 5HD8C 2JE8A 1LEKB 2X7LA 1H3PL 5DEFA 1H15B 2O5YH 1QFOA 1TZIA 4G9FB 4HV8B 1JPGA 3RA7L 3DO7A 3LD8C 2VLJD 3RZCB 1T7ZA 2AEQL 1T03L 2EXYD 3TO4D 4JFDB 3IFLH 4KY1H 3L1OH 2V5TA 1TTUA 2E7HA 4GW5A 1V3JA 1WUNT 1T6VN 1QYGH 4N0RA 5IBTL 3MBEC 1AQKH 1N64H 5C07A 1DLFL 4LBEA 2H1PL 2QADC 5I1LB 3DXAD 3O11B 2VLKD 2EZ0D 1HHKB 1C7TA 1MIEH 5I18H 5JHLL 5LXGL 3BUYA 3SKOB 1CFNA 4LDEB 5J6GA 3T2NH 8FABA 3NCJH 5DK3A 3ARED 1NMBL 2ICWJ 2DJSA 4L4VD 4X80H 1RZ7L 4PRHB 3FO0H 2QKIB 4RNRA 3O3EB 4GRWF 1NCTA 2AXHA 4BZ1H 5E5RB 2Z93B 1QFWM 2FD6H 5KVDH 1NLBL 1I8IB 5AG8A 4MA7L 5IP4A 2SEBB 5HDBF 1EV2E 3W0WA 4P9MH 4NO3B 2R2BB 5AZEH 1TIUA 1O7VA 2Z31D 1NMCC 1CDGA 4QHUB 2DMBA 3QNYA 1T2XA 4G8EB 3MRJB 2XA8H 1ZGLB 1DQDL 4P9HH 3OKEA 4BQ9A 1MRDH 1XF4A 1YECH 4E42B 4M4PA 1U91B 3DRQB 3F12A 4KY1L 2ESVE 4FNLH 3QA3B 3MROA 3X3GL 2PN5A 5E00B 1DEDA 4NJ9L 3SDDB 5E8OA 4WTZG 1G7QA 3G5YA 3BGMA 2B4CL 5L7XL 4MAUL 3W2DL 3GRWL 4BSJA 3CSYB 1XGRB 2GAZB 1A7PH 4O2FB 1IAII 1I1AB 4Y5VC 5D7IF 4UV7H 4PRNA 4JANA 1QRNB 3OKOA 1IM3B 4Y16D 4HKBB 4HUXB 4MAYA 1AY1L 5FAAA 1S7RA 4G80A 3K4ZA 3LHPL 3RWDB 5K9KB 1P1ZA 4HS6A 1WGOA 1BLNB 3GMMA 1W8NA 4X8JA 1YYMH 4MSWA 1KXTB 5F7YC 2MSPA 4M6NH 3OG4B 4PGJA 4FMKA 2HLAA 5FYLH 3ARFA 3PWLB 1A3LL 4ZQKA 1DQQB 1W72B 2J1KA 2VNCA 4L3ED 1VPOL 1U8NB 4I77H 3VFPA 3DGGA 4OZGF 4ZMAT 4PJFF 4M5YH 2EDTA 3RTQC 2E9WA 4LSRH 4NSKB 1YC7A 2YZ1A 1F4XL 1NL0L 1F45A 1WZ1L 2ERJC 3GB7B 4K8RL 1KLUB 3LRSB 4UILH 5DWUH 5IEKA 5IMMA 3U7YL 5DJAA 4QRQB 4X4YA 1TNNA 3HPJA 5I19H 3FMGL 4QYOB 4CMHC 3NGBB 2E8ZA 1ZEAL 4WWKB 2BOCA 2GW5A 4WWKC 3W5MA 4ZUSB 2DLFH 4FFWD 4XMPL 4ZFFA 4JO2H 1YQVL 5FYJH 5DDHB 2QQKL 1B6UA 3UZEA 4S10A 2F74B 1QVOB 1OPGL 1BBJA 2V9QA 4TTGA 1U8PB 4LNRB 2AEQH 1FG9C 4PJBB 1IAKB 2F9BT 1A7PL 4B50A 2Q6WA 4H0IA 4IIQC 3OKLB 4WFHD 3UPRB 1JF1A 4LSPL 4P23B 4CN6A 3INUL 1CD0A 2GITA 3TYFA 4EDWH 1OGAD 3LS5L 3QUMB 4OZHA 5GGRB 2BNUB 4LCWB 5JHDA 1FBIL 2IANA 4N0UA 1AO7B 4JRXD 1AXTL 3WS6C 4OIBA 3I6KA 3RHWF 4QXUH 3EYSL 4MD5A 3U48A 1YMMA 2XA8L 1MHEA 2VXSH 3C5JB 2OTUA 1LO5B 5IV2A 4Z7UB 2UY7A 2GEEA 1JHTB 2G60L 5F6IC 2VITA 4ZFZB 2AABL 2EDLA 5EZJA 1I1YA 3ZKSD 4XX1G 3KYAA 5JA9A 4IRJD 4C83B 2E7LC 4OLWH 2NY2B 4NKQB 3KPMA 4N1CA 2XN9B 2PXYA 5CWSB 4PJIB 4D0BB 3Q0HA 5C08E 3KLHC 1BMGA 1MJ7H 4HD9A 4I0PC 3NIFE 3SEPA 5L2KE 5LCVL 3GI8H 1AO7D 1S7VB 1ZTXL 4OZ4B 1LEGB 5HHME 5FYJL 7FABH 1Z9MA 2EE9A 3HAEB 3KPQA 1QBBA 4FABH 1GOHA 3B8SA 1MHCB 3F7VB 1FN4B 3MV7D 2J88L 4GRWH 2OTPA 4U1SB 3VWKA 3DETC 5CP7B 5BOZG 3IAPA 3WHE1 1Q9OB 5F7HA 4D0DA 5ICZB 4DFHA 3W2DH 4ZS6C 3FN9A 3U0WH 1FC2D 2CDFB 3CDGA 3E6HB 5HI5C 4KUZL 2P8MB 2ZWLT 4FNLL 1ETZA 3SE9H 4J3OC 3GNML 1NCBL 5LBSH 3WE6B 5H94A 1T0MA 1YN6B 2MTPA 4XVJL 5J12B 3DX7A 1ZT4B 4P57A 3C60C 4JB9L 3BPOC 2MCPH 3MV7B 1NC2B 4ODHL 1FIGL 5DJ6A 1XH3A 3SDCC 1D5IH 3S36H 1DUZA 1Z2KA 2EDNA 2XZZA 1OAYL 4G6AC 4HC1H 3GSVB 5JW3L 3BWAB 5J3HC 3I3EA 2DQCL 1AHWA 2FBJL 4MQ7B 3QUZA 1Q94B 1DEEA 5AYUL 3RTQA 1FNAA 4U6VH 1PEWA 7FABL 3MRQB 3ARDD 4PGZA 4ELMA 1RZJL 1TVHB 1RUPL 1WT5A 3LS4L 3HUJB 2R0KH 5DO2D 5GS3A 3AS3A 4J3SA 5D4QA 3U4AA 3TPUB 3U1SL 2EYRB 5EPMA 4Q9QL 4FQCH 3HMXL 5CLTA 2BHUA 2DIJA 2VMFA 3IFPB 4GXVL 4NCC1 5I1IH 1MCJA 3WFCH 4L3EB 1XR9B 5I73B 3T2OA 2FEEI 4RMTA 4H5SA 5I1GL 4WFFD 5JR1H 5TDOA 2FR4A 2PYEA 3U0WL 2XTJE 4G5ZL 3QFJA 4ZOEA 2Y4SA 5D1ZD 3RVXD 1ZSDA 2OTWB 2GQHA 1MIML 1AJ7L 5B8CC 4LVEA 1KFAL 2DYPD 5GIRA 5L88L 3FZUD 3BKJH 3JV6A 4LVOB 2BRRH 4ZUTB 1UJ3A 4WI7A 3WFDH 4LHUG 3TZVA 3VU2A 1UG9A 1T03H 4HKZA 2CLZB 2SEBA 4FTVD 4LAQL 4NP4H 5IHZB 1RIVL 1K6QL 3CCHB 3G5VA 3T2NL 4XB7A 4U6YA 1HI6B 2VLRA 5D7IE 3HE7C 2ITDA 1NLDL 2GY5A 5IBLC 4M93C 2DTSA 2XIDA 4HK3N 2HKFL 1CFBA 5JW3H 1T3FA 5F1OB 2MHAA 1ZHLB 4GW4B 4YGVB 3DPBA 4DVRL 3GSNH 1OAUH 3QCVL 5B8CA 3QG7L 4OF6A 2RCSH 5KSBA 3HG1E 2FWOB 2G2RA 4PJ9D 4YXKL 4NQCA 4X9IA 3DX9A 1A9EA 3B2UD 1WBYA 1ZTXH 3GB7A 4Y4FB 3FT4B 3Q48A 1MCPL 1QO3A 2NY5H 3H42H 5CJBA 1NCBH 3BRDA 2BNQA 5E8PB 4OLWL 4JJ5B 1UVQA 4PJIF 4P49A 4LQFH 3UP1A 2C3XA 4BQCA 3IU3B 5EBMB 3JWOC 4ZOBA 1AGBA 2KKQA 2ZUTA 3MMEA 5E56A 4N0YL 3HNVL 1OAKL 3BHBA 3ARGA 5IJVA 1GGIH 3L3GA 2ADGA 3WFDL 4BQ6A 1UXSA 2AK4E 2I60L 4FQLH 3LHPH 4ZPVB 1YEGH 3DV4A 1UEYA 2VAJA 4ERSL 4CL7A 1N5YH 5LVEA 4ZO9A 1VKXB 2WSKA 3TYFB 1KENL 4LSDA 5CHNA 5DD6B 3LKOA 1KJ3H 1EJOH 1XAUA 1CGYA 2C4FU 5LAXB 1FVDB 1UWXK 3GUTA 4PBXA 3V0VA 4ZFOL 3P77A 3ZTNH 5J7CC 4KZEL 5CD3B 2PR4H 4BZ1L 4J6RH 4P5MA 3SPVA 2P7TB 5GZOD 1BLNA 3GMMB 2Z8RA 1QP1A 1T2QH 3FO1A 4QT5A 5B39A 3C87A 1NCAH 4X6DF 5A2JH 2D0FA 4PTUB 4YHZH 2XV6B 4MZ3A 2ENSA 5T3XE 4WFGD 3VRIB 4FN0A 2FO4B 3LPFA 1KC5L 1MIMH 3LEVL 4PUBH 1T0MB 1AGEB 4GW5B 2FBJH 3SOBH 1WZ1H 3G5ZA 4OM1L 3FB6B 1FG2A 2H41A 3QCTL 4Z7OF 5DJCA 3OB8A 4KAQH 3D2UD 5GJSH 4LQFL 3S97C 1ZK9A 3CJJA 3NTCL 5C0CD 5DJAB 1LO2H 3KYKH 4X4YB 3VFWA 3QIBC 3UAJD 2NMSA 3R1GH 1DUZB 1PW3A 2H8PA 2DQUL 1CE6B 3LPGA 3JWNC 3KR3L 2Y06L 2IH1A 1MHEB 3C60D 3U7AA 1LP9E 2WBJA 4G8GD 4NJ9H 1W0VA 1UB6A 2J4WL 4Z7OE 3TCXA 3U2SA 2Q8BL 1QVOA 2RCSL 3FRUA 4QY8B 5F1SA 4MNQD 5C0BA 1BQHB 1U3HC 4ODTL 5HI3C 1HOCB 2DDQL 5F3BA 2ERJB 1FH5L 1P7HL 5EU3A 3C08H 4GSDH 2DIAA 5BV7C 4YQXL 2N7AA 3FQUA 5JDSA 3GFUA 4JANB 5GS1C 4OQTL 5DQJB 2IQ9L 2D03L 5LCVH 5ISZD 4XVSH 3MRJA 5IFAL 5JOEA 4UTBL 1J0JA 3RTQB 1JZ5A 3GIZL 3P30L 3MXWL 2BVOB 2X4OA 2AXJA 3MLZL 1OWWA 4MNQB 2DQTH 2GSIA 4Y5VB 3HI6L 2CO7B 3ULUL 2WBKA 1K2DA 1T20B 1TENA 2BXZA 2BXYA 3ARFC 3EKCA 1KJ2H 4TOYH 4XAWL 3WFHA 3GJFK 3RWEB 1JGVH 4DZ8A 1BOGA 2AJ3A 3OXRA 3RVXC 1QFWH 5CEXA 5JTWA 3GJEB 4OFYD 1S7VA 1MVFA 4MHHG 4PJDB 2DWEA 1I4FA 5CIPB 4U7KA 3G5XA 1CXFA 2EIBA 4OCRH 5D2NC 3O6FD 3V5DB 3RTQD 3UTSA 1CD1A 1RZKL 1P1ZB 2FWOA 4N8CL 1MJ7L 3D48R 3DX9B 1NFDE 5IROA 1J18A 3SE9L 1FRGH 4F3FB 2XZCH 1BWWA 4NO0B 1S9XA 1IAMA 1FH5H 5A2FA 3EO9H 4HUWA 1KXQE 2EC9U 3GBMH 4GAJL 5DD3H 1IAKA 3QDGD 1BHGA 3PNWA 4N1EA 1PY4A 1SQ2N 3DXAE 4ZAKC 2GYSA 2L7JA 3LCYA 4CAGA 1Q9LA 5D93C 3ZDXE 1NLBH 1CXLA 3MMEB 3UBXA 1TQBC 1U8HB 1F02I 3T0ED 1RI8A 4JFHD 2XQBH 2ZSWA 4ZD3H 1N6QH 4KJWC 1JZ2A 1F2QA 5CBEA 5CJQH 2ZP0T 4NM4H 2VO5A 4XP6H 4BYHA 2FNBA 4P3WA 1CGSL 3C5JA 2P5EB 4GKSA 1LO5A 1P7QA 5I1JH 2AJZB 5IV2B 1VEMA 1YEFH 3U9PH 4R97B 4AENA 4PJFA 1CXEA 4LPVA 3KWWB 1MFAH 1YEEH 2VDLH 2VZVA 1JGVL 3WS3A 4WFGE 1QR1A 1YZZA 4JFFA 1DP0A 2E7LA 1F8TL 5E2WH 4R8WH 3RL2B 1J5OH 3V0VB 1TVDA 3ILQD 3JUYA 4DKFL 1FPTL 1OAZH 3TT1L 3HZMB 5T33L 1MJ8L 4KMTL 3RZCC 3FMGH 5IB3A 2Y6SD 3PJSB 1HEZA 2HH0L 4HT1H 2X4TB 5I8EB 5M94B 5FB8B 3VXMA 3JWDH 5I16A 1ONQB 4GRLA 1C16A 1OLZA 2VZSA 2B0SH 1RMFH 5GS2D 4QXTA 4HMEA 2OL3L 3QULB 1V7ML 5EO9A 2APFA 3MNVA 3BVNA 3GBNH 4MJ5B 2A6KA 2HWZL 2M1KA 4NKIL 5GIRB 1JF6A 5EZJB 4F7CB 4G6JL 5D7LD 2XWTB 1H8NA 2ARJA 1IFHL 3WEXB 5F7UA 1LD9A 3MNWB 4JKPL 4J3TA 1XGQA 4ESKA 3SJVD 2PO6C 3I75B 3HMWH 1I3VA 2R1XA 2P45B 2Z31A 5FK9A 2AERT 3LRGA 4AMKH 3HS0A 1CD8A 1E0OB 1WIOA 5CINL 1AKJD 5DSCA 4H1LG 1WIUA 4F15B 2P5WD 3QIBD 3RJQB 3UAJC 1T0NA 1M05A 3SE4C 3ZE1F 1QPPA 2APBA 4RISL 1EBAA 3GMLA 1GZQA 3VXSD 3O4LA 4JCMA 1PZUB 4QCIA 4PJIE 5KN5A 1AC6A 1J5OL 2I5YH 1TVHA 4Z8FH 5GSRA 3C5SA 4NO5A 1HDMA 4IOFD 3BZEA 1VEPA 1L7TL 3BWUC 4F2MB 2P8LA 1M71B 2J5LC 1JWMA 3Q6FB 2CR6A 3R8QA 4UV7L 5JIHA 3ARGB 4E0RA 1XH3B 3MUY1 3P4NA 5J57B 4KK5D 2XZCL 3K4AA 4YHNA 1TLKA 1INDL 4CVXA 3UJJH 5BRZE 1PSKH 2CDEB 5FIEA 1RZKH 3NCEB 1DEEB 3IYLW 4M48H 4QNPE 2FGZA 2BRRL 3KPRA 4WFHE 1NEZB 1ZANL 3BN9D 1PX3A 5F7FA 5F7DB 3OXSA 3B2VH 4PLKD 3IDYC 1F4WL 3SBWA 5F44A 5C0FA 4RMWA 4JFQB 3TPUA 5E08L 1GGTA 1G7IA 1UYWH 3WUWA 4OF7A 1YY9C 4JHAL 5JUEH 1MCEA 3ARGD 5I8KH 1KJMA 2HFEB 3RWCA 5C0DA 1A7BA 1A6AA 1PG7H 2XNAA 1V3LA 3HHRB 1BD2D 4K23H 1IAIM 4Y4KC 2BCKB 1IKFH 3SCMD 1KGCE 5I66A 3ULVC 5DJ8A 3HE7D 3WFHB 4DOHB 3H9SA 3A0OA 3IAGC 5D2NB 3O8XD 4YO0B 4LPXA 1JZ6A 1H3VA 4HKXB 1GPOH 4FQPA 5E1AA 2QTEA 3LQAL 5HPMB 1RFDH 1QNZL 1MOEA 1KYOJ 3CPLA 1FZJB 4KUZH 4PLJD 4OLXL 3HZYA 1FNSH 3OG6B 1H3PH 1CE6A 4Y4KA 3TJEH 1CFSA 4BFGA 3MJ9A 3QCTH 2Q8BH 2AXFB 2XTJC 1NPUA 3PHQA 5C08A 3PP4H 3QHTC 1NC4D 3H6JA 4NZRH 1Y0LB 1OD9A 2FGWL 4RAVB 3REWA 1F4WH 4LRNH 4OT1H 3PNWB 5C08D 3P30H 4Y4FD 1SBBA 5CILH 3QO0A 3OBAA 5HHMD 2D9QB 3C8KB 4PJAA 4ONGH 4MNHA 1EMTL 4R7NA 5LGJA 1YMMD 3P9LA 5D7IA 5IB3B 3ZYOA 1LMKA 1GH7A 4BM7A 1H5BA 2HFGH 2YD5A 3AAZB 3TBSA 1XF2B 4GAGH 1XIWD 1M7DB 4QOKA 1CGUA 4LU5L 5SX5H 2AJZA 4P3DA 3TA3A 2ED7A 4HFWA 4X7TB 3KWWA 3D18A 4PREA 4TQEH 1TTFA 3NCYP 3VWJA 1JZ3A 4DEPB 2ATKA 2VH5L 3O9WC 5FA3A 1WTGT 1HYRC 2FYYA 2VUOA 5C3LD 5IGXL 3B8YA 4CU7A 4E41B 2OLDA 2YBRA 4YHKH 1NGXA 2YRZA 4XX1E 4CVZA 3MOBH 1OTSC 2YPVH 5FV1L 4TSAL 1CFNB 4L8SA 4XVTL 1IAIH 5IWLA 4ZG1A 4Q9RH 2CMRL 2HN7A 3G9VA 2VXTH 1TMCB 3VWJC 5GXBB 1QLRA 2VRAA 1L7TH 5LJYH 3FB5A 4LMQI 4KRLB 4PJGF 3TP4A 1IZKA 4HUVA 3GMLB 4JGJA 5HTSA 1NDMB 1J0HA 3QCVH 4OCWL 2A74A 5CBAA 3T3ME 3UJJL 1OVZA 5C0BB 1K8DB 3D3VD 2VDPH 1WITA 2ZCLL 2AXGA 1T1ZB 5C0CB 5J6HB 5DJCB 2Z4QA 5D5ME 1CDIA 2MKWA 1KTDB 4PYGA 5EUOA 4O2CB 3VXMD 1GIGH 5M95B 1C5DA 2OK0H 1CFTB 5D8JH 3FO9A 5J11C 3DX8B 2WM0A 1QBLL 3H7LA 4DKAA 1NAMB 5A43C 2B1AL 2HRPL 1BQHG 1OAKH 2GIYA 5JHDD 3V6BR 4R7DA 3VFPB 4L4VE 5I1GH 2AKRB 2WLZA 3MGOA 4YHYB 1AD9A 5CJQL 3BMWA 3MRHA 2IH3A 4F7TA 3I84A 5IQ7H 4MAYB 5IG7A 4G42B 1G7IB 3WUWB 2Y72A 3HR5A 2ZOKA 4XTRC 4G8GE 5I75B 3FQTB 2Y5TB 4R2GB 5HDLA 2UUDH 1FVEA 2A9ML 1MWAA 3HLAB 5HI3D 3MLRL 1WJ3A 3BN9C 4CADB 1RUAL 1I75A 5IW6A 3KXFD 5E2WL 1KIRB 4NWTH 2F53E 3FCTB 4LEOA 3V7AG 2NNAB 4M6ML 2AVGA 3NPSC 4NFBA 3BPNB 1OGTA 2X4UB 3OJVC 4HUKB 1E4XL 1J8HA 4S1SL 4F3FA 1VA9A 4LIQL 5FUZL 5DC9B 2XWTA 1DQMH 5CZVL 3GMPB 3KJ6H 4TNWK 5JA8B 1K8IA 4BQBA 4LCWA 1OTTD 3VA6A 3NIFF 3ZT5A 1CVSC 2E5EA 3S37L 4KPHL 3VG0L 2DWEB 3W9EB 3FONA 5IESL 3C2SA 4HZAA 4LFHD 1KCRH 5I75C 2A73B 2VIRA 1JHKL 4GAYB 5IVOA 2Q20A 5H37H 2YD6A 5I19L 1TJGH 3BD5A 3EOYG 4JG0L 4GAGL 4JM2D 4ONHB 1N4XL 5FUOH 1IGCL 3TH3T 1MEXH 3L7EA 4JLRA 4ZFGL 3RZCD 4J12A 5DRWB 2BY1A 1IGIH 1FV1A 3B9EA 3IDIB 4JO4L 1BD2E 4F9PC 1EZVX 2FEDC 4EXPX 5CZXC 4KVCL 5DQDH 1QR1B 4KGJA 3BZEB 2DL2A 3AAZA 5C0CE 3WFZA 1NGQL 3VWKB 4XT1C 2OTUB 3PGDB 2F8XC 2A6IB 3D3VE 4POZC 4MDJB 2W0FB 3DXAB 2E7BA 4Z78A 5CEZE 3IDYB 3MO1B 4OQTH 4WV1B 3V0WL 4CBPA 4YHLH 3ILQC 1FE8L 2YWYA 43C9A 1IM9A 3ZSTA 5DMIH 1EUUA 2MQ3A 3GRWA 1AGFB 4JFDA 3SKJL 4HC1L 3T0EC 4TUKL 3DIFA 5CAYB 3ULUH 5ACMA 4K3EH 3OX8B 1F4AA 3NACH 1JK8B 2E9IA 4TUOB 1LHZA 2IANE 3MLZH 3QXUA 4N0UE 4R3SB 4HJGA 1UGNA 1MQ8A 1CU4L 2R69L 9CGTA 4J6RL 1FSKB 4YXHH 2W9EL 4GRMB 1ORQB 5DFVD 2PUQT 4D8PA 5I1EH 5HHOE 1MRDL 1KNOA 1QA9B 3O81A 4JPKL 5IT2H 3ZKXC 5GRXG 3D69A 5H37G 3LIZL 3IDMB 1G0DA 4OFIA 2HLAB 3P0YL 1MJJB 1OTUC 5I16B 3OAZK 4UIMA 1C16B 2XXMB 1VFMA 2BY0A 2JF1A 2P42B 1ZE3C 4GO6B 3QA3A 3ULSB 2LABA 4JFFE 4LLDA 2XY2A 3CX5J 2Z4QB 2R2EB 4NGHL 2APTA 4FQ2H 4Y16A 3S36X 2E27L 4FXGB 5DD0L 1ZA3B 2P8PA 3MV8B 4PJGE 3MX0A 1A0QH 1G6RA 1BREA 2N1KA 4M3KB 4JFXA 5TDPB 2P24B 4QYOA 2FSEA 1SEQL 2DLHA 5BMFL 4DQOH 4JPIB 1BM3H 4CJ0A 3V52L 2VWEC 4TRPL 2ZUUA 3SKMB 3VGEA 2R9HD 1JHTA 1EEUA 5E94A 4I3RH 3HKFA 3OPZL 5FYLL 1QBML 1BOYA 3EYVB 1AXTH 1NBVL 2D0GA 2QSCH 1RULH 5DZLA 3HZVA 2Q76B 3QHFH 4UOW1 2ATPA 1FFNA 4FZEH 5C0NC 1RK1B 2NXZC 3UEZA 1OAXL 3ET9F 4HWBL 5C7XL 4O5LH 3KYOB 3UO1H 3WJLA 3OQ3B 2VDQL 2CKNA 1BZ7A 2MQ0A 5E9DD 3STLA 1A6TA 2UYLA 3NABH 3ULVD 1JZ8A 4MVBD 1QUNA 1EO7A 5TF0A 5CIPH 3TA3B 5GISL 5T1KD 3RVTC 3MA9H 1I9RH 1A9BA 3BPCB 3FHQA 1MLBB 1A6VL 4V1DB 1CDYA 3MRBB 1J1XH 5DRXB 4L8DA 1AQDB 2BHYA 1A9EB 2MPAH 4XXDA 5JLZB 4AT6A 1RQ5A 2CGRL 2V5RA 5EU5B 3STZA 2CJUL 1KJ3L 4WWKD 4NGHH 1Q1JL 1DQQA 1W72A 1NGPH 2P46B 2VZUA 5CWSA 1YEGL 4D0BA 3BW9A 4YBLB 5E2VL 3O6FA 3GKWH 2DQHH 2VKWA 2Y5TA 2NZ9D 4WFEE 5T1DH 4GLRH 1GL4B 2YEZB 5EBMA 3QDGA 4DOHE 1MVUB 4B5EA 4DQOL 1KCSL 3BP6A 1IGJB 5F7LB 4KDTC 3ZDZE 1FZJA 2C3HA 2QQNL 3TA3D 3DVNB 2XZAL 5KSUA 3NOIA 3EJYC 1F4YL 3P0VL 1RHHA 1P69B 4UT7H 3HE7B 4N8VG 1U8JB 1MHPL 3DYMA 4LLAA 2AXFA 3JXAA 4Y89A 4PFEA 4LSTH 4JRXB 2LU3A 5D7JB 2ADJB 2XQBL 4ZD3L 5FOBB 3B9KA 2YSSB 3T1FA 1M7XA 2Z92B 3U7WL 5GSVB 4PJHE 1KG0B 1ZMYA 3U4EB 3UDWA 2EH8H 3RNKB 4U1HB 4IMLB 1RJCA 3PE9A 2VDLL 3C5ZC 4A6YL 4GAYA 5IB1A 4P2OB 3QXAB 2A83A 5MI0C 3U83A 1JGLH 4X7EC 1G9MH 4LSSH 4NUGH 3V2AR 4NCC2 4NUJA 1FLRL 5GRVL 2R0KL 4Y1AE 5H35A 3RIFK 5E2JA 3T0VA 4PD4K 3HAEH 2Y23A 4Z7UA 1FNGB 4HK0A 3KR3H 1WWCA 4HS8H 4OD1H 5MENA 5ISZA 3D18B 5JXEA 1G0YR 3GGWB 4FQ1H 4JKLA 4FQ2L 3L3OB 3IKKA 3RX7A 2EIZB 2D7TL 5I71C 2PCPB 2AEPL 5HVHB 2OX5A 5DK0A 5JW4M 5HY9A 4HKJB 4BH8B 5E7BA 5I30L 3SQOH 4JAMB 4XP5L 1SJHB 5JMOC 1XEDA 2V2WB 3VMNA 4OLYL 4XXCC 1I9IL 4TSCH 2VXVH 1CYGA 4YDVB 2MHAB 4Z7VE 1DFBL 5SX4I 4PPTA 5IB5B 3T8XA 5KAQF 1S7RB 2D7MA 1EIBA 4KJYA 4PJGB 1XR8B 3FB8A 4D94A 2ICWB 2J8UB 4PREB 1YMME 4X4ZA 1ADQH 1NSNH 3VGDA 1B4RA 3TZVB 4XP9L 1U3JA 1F6LL 1D9KD 4PRPD 4KU1A 1O5DT 1O7SA 3AU1B 1BFTA 1G9ML 4LSSL 5I71B 5TE4H 3C09B 4I2XA 4NM8H 4D8PB 4TOYL 5IVXA 1BFOB 2AGJL 4R4FH 2IH1B 4J23A 1L7IH 4O02L 3HI5H 3VW3L 1HIML 1GPOL 3IDXH 3LKRB 4UIMB 3WNMA 3TNNA 1HKLL 3CFJA 2QV2A 1QYGL 6FABH 5L6YL 3BKCL 3R06A 1OTSD 3U82B 3VI4F 2G2RB 5FUCC 1H3XA 3V9FA 1NGWB 4KJQC 4PJHA 5IKCB 5AUMA 1D9KB 4PRPB 4J1UA 3D3VB 3VMOA 1QEWB 5DURB 5KS9F 3Q3GB 4U0QB 4N5EC 3ETBF 1NFDB 3I50L 5D1ZC 1P7QD 4V2CB 2XYCA 1UVQB 3MRMB 1CICC 3IJYA 3FO2B 2QL1A 3MCKA 4QTIL 4YHLL 1EEZB 3ZYZA 4FFYH 3T08A 1RUQL 4YAQA 5FGRA 3DOSA 2HJLB 4OZHB 1W72L 4LCWD 4YJZL 3IU4H 2JB6A 1QACA 3TBYA 4DVRH 1OT1A 4DGVL 4UZGA 3BFOA 5EFIA 1QSED 5TF1H 3SDDC 3PWNB 2QJDA 1ZHLA 5DGRA 5GRUH 4H1LA 3QFJB 3W82A 5HYEA 5ILTH 3DVFA 5I2IA 3QQ4A 5E6IB 5FGCB 5TDNB 2YN3A 4TTDD 2HA1A 12E8L 2X70A 3FFDA 2Q3AA 4P99A 3BZ4B 3DRTA 4MNQE 4ZUWB 1JV5B 2AJUH 4N9GA 2R0LH 5KSVB 2BSSA 4S1QH 5DHYB 1JHLH 2Q86B 4MJ2A 1FL3B 2IF7A 3GSOA 3BPCA 3O45B 4RDQF 4QXWA 4OI7A 2HT4C 3G08A 2XN9E 4NC1C 4WI8A 1X44A 5ERWA 5JXEC 1EGJL 2K7QA 3GBNL 1RZJC 5EN2B 2PW1A 1S9XB 1LE5B 4GW4A 4JHBA 2FO4A 3EYVA 4M8QA 1NAKL 1N3NB 5ESVA 1XFPA 1I7UA 4JPKH 2R1YB 1A0QL 3RL2A 1MCOH 1FFNB 1P4LB 4EI5D 1QTYT 2BZDA 5J1AB 1UZ6F 2GHWB 2X4PB 3WHXB 3QXAA 3GMPA 4LHUA 2EDYA 1NCDH 2ITCB 3IKCB 5E4EB 5T1KA 4EI6A 4PGEB 3HE6C 4P2RE 5HVHC 1G7MA 1IBGH 5BZWB 4AIZA 5IW3A 3SKMA 2VLKB 1A64A 5M7QA 2VIRB 3RNQB 4HF5H 1C7SA 3ARBC 3RZWA 2B0SL 3QNZB 4LEXH 5GGQH 4LSQL 4RMUA 3RFZC 5JLZA 3B43A 4LSRL 2BHZA 5AD0A 1KN2H 3OAUL 2WAHA 2YK1H 5TQ2H 2FD6L 43C9B 1IC7L 2WW8A 3RWFA 2IPUK 1CI5A 4L4VB 2FJHB 3PHSA 4MD4B 3HC4H 4I3GA 1PEZA 3DBXA 1A8JH 3CH1B 3NZHL 4Y0GA 4AEHH 5GRJL 3MBEB 3N1QC 4WWID 4P9HC 1FYTD 4J3WA 1VHPA 4LKXA 1S9YB 4JDVA 3UJTH 3O3AA 3D2UB 5C0JA 1UWGH 2X4OB 1I8MB 3QPQD 1QSFE 2EKSB 2X1WL 5HDBE 4ETYA 1JGUL 1WFTA 3ECBA 5GRYA 3ULUE 4XXDB 3EDDA 2H6PB 5A3ID 3MJ9H 1W0VB 5L7XH 2ARJB 1H3WM 2OXGA 5DEZA 1YNKH 3MRIA 4B0MM 3RJDA 1PQZB 4LSTL 3O41B 1I3UA 4NT6A 5C8JB 5DD0H 2VSDA 3CZJA 2WUBH 2YEZA 1BPVA 3SDDD 1U3HA 4L9LB 2YD4A 5C2BL 4HKZB 5D2LA 5BV7H 2ZJSH 5DSCB 3VFWB 4JE4B 1XGUA 3GBML 4GAJH 1S7SA 5DD3L 1UH4A 1A1NA 3FOMB 4YHMH 3R06B 2BSRA 4Z95H 4UT6L 4AH2B 1X5IA 3DV6B 1F3JB 4YFDB 5C6TH 1WBZB 5FHBL 2YPLB 1JGEA 2NXZD 4DGIL 3IJSA 1P7QB 4GXVH 1FNGA 4HK0B 4Z7VF 1EHXA 4HDIB 3RY6A 3EJJX 4JG0H 4PRDA 4O2FA 5KVGH 4OZFA 5EWIH 4PGDB 1R3KB 4MVBC 5C0FB 4MYWB 1ZLVK 1ZA3A 5F93C 4YDJB 2O5YL 5DQ9A 1ZHKB 3EO0A 2DQUH 3AS1A 3QFJD 2HTLC 4LLWB 3SY0B 4OZHF 1C1EH 5HHNA 3WN5A 4F7PA 4NFCA 2X4TA 4JJ5A 3V6OC 2BC4A 1MFEL 3GO1H 3EO9L 1I85A 4CVUA 5JW5A 1RZIB 4JFYA 4RIRB 3ZE0E 4IRSA 5JORB 1KBGH 4WO4A 3T4AA 4NKOA 4HGWA 4HGKC 2Y7QB 1NDGA 2OSLA 4PY8J 1Z3GL 1UXSB 4GXUM 4WRLA 2BVPA 1JNLL 3SBWC 1ACYH 3QZWA 1U8QB 4I13B 5IMLA 1N8ZA 1KCUH 5E9DB 5L9DL 3MNWA 3FTGA 2CR3A 5BXFB 3P73A 5JNYA 1DLHA 4R9HA 1N7ML 4X6EA 2OBGA 3QO1B 1FJ1B 2ZPKL 1FNEA 3BO8A 1I85C 3DSFL 1MCLA 4ZFOB 3RGHA 3X13B 4LQ1A 3WL9B 3CDCA 1MLCA 4LLMB 3IAQA 4YO0A 5MENE 2P48B 2E9JA 3O6LH 1U8KA 2F58H 4ORGA 1KCRL 3HFML 1OWRM 4Y5XB 5FA4B 1D3CA 3V8CA 4BKLB 2FL5B 3PGCB 4UOW0 3UCRA 4HHAB 3HPLA 5FO7B 2Z92A 3WFEL 3IRPX 1KN2L 4XVTH 3GSXA 1UWEH 3UXFA 2DMCA 1QRNA 3OKOB 4J4PC 1HZHH 4G9FD 4HIJA 5A3IC 5EZLA 4YE4H 4YHKL 4YDIH 3H3BC 4WW1B 4UIKL 4P2OA 5HI5D 4DTGH 3IB4A 1FSKC 3O8XA 5FO8A 4KK6C 3DO7B 1DBBH 2VLME 3MROB 4X6FA 1NBYB 4YX2L 1N3NA 3NPZB 4FQIL 2HFTA 4ODXB 4LHJB 3QJFA 3WV0A 4HQQH 2WWMC 1TPXC 4F58H 3ARQA 2QSCL 1NFDA 2P1YA 4U7MA 5CP3H 4V1DE 3M45A 2NY2C 1NCWL 4F2MA 2BSSB 4ONGL 4PGCB 4EVNB 4G80B 3RNQA 4IHOA 3FB5B 1E4WH 1L6ZA 4HV8A 5I9QB 3MRDB 1A7RL 5J12C 4XGZB 1U41A 1X7QA 1JPTL 4KHTL 3X3FH 5F7EH 4LNRA 1LK2A 1FIEA 1VSCA 2VAAA 3E0GA 15C8L 5GS0L 3KPNA 3VXPA 1NGXB 4CVZB 2R1YA 1OF2B 1AKJB 1NEZA 2B5IC 1WC7B 2CDGB 4NQED 1XIWA 4OIIH 1JNNL 5GJTL 4Y2OA 4ZS6D 1LD9B 1JN6A 3ESUF 4DKDC 1JRHI 2ZCKH 4DK3A 3ARDB 5L0QC 4L4JA 2VSCA 2CKBA 4AZ8A 4OF3A 3CVHH 4PGBA 4MQ7A 5DZNA 3V8OA 5KW9H 2H6PA 4X98A 4MJID 4Q2ZA 4ELKB 3VFRA 5E8DL 5J06A 5DR5H 5DD5H 2W9LA 3N1MC 1PYWB 5A2KH 4YGAB 1A5FL 1JTTA 3IDGB 3OKLA 2D4DA 2IMNA 5F7MC 5E08H 4XBEL 2NY1B 1U3HB 5DVKA 3ARBB 4WU7A 1CIDA 3FO9B 3HI6H 4KROB 3NMEA 2BJMH 5FYJU 3HZYB 1FP5A 1IGFL 4P2QE 3O0RL 2EIDA 4UTBH 2R2HB 4HWEH 2YKLH 4PJ9C 2V2XB 1DE4B 5EU4B 3R8BB 2EH7H 2GFBB 3PHQB 1RUML 4N1HB 4FTVB 1DBMH 1EH9A 3MRGB 1BVZA 3T4AB 2HJLA 1TJIH 4PJCF 3ZTJH 4Z7WB 5C0RH 3MA7A 4Z77B 3KLDA 2WBWB 1ZT1B 3KHQA 4MS8D 1JGLL 2HTKC 3SDDA 2Y1VA 3QUYD 4B41A 4XCFH 4UQ3B 3NH7H 1VDGA 4PJAB 2OI9C 4ODVL 4YDLC 4RFOH 5E6IA 4EZMA 1U8IB 3EO0B 3Q3GA 1YN6A 4LPUA 1ES0A 1VESA 2WWKT 4OAWA 2HT4D 3S35X 1CG9A 3MLWL 3VXUD 2VDRH 1Q0YL 2D7QA 4KJQD 4UI2A 1TXKA 4N8CH 4PS4H 3ULVF 2WWMD 4QRQA 4MQSB 3GNMH 4YNYA 1KYOK 1QSEB 3L5WB 4HGWB 4X5LA 1VB9A 5EU6B 3M17B 5C09D 2A6DB 3VD7A 1V8HA 2Y07H 2YPLA 1RIUH 4JR9H 3WYRA 1OSPL 1BZ9B 2X42A 4X4XA 5KS9A 1BBJB 2Q1EA 1KTLB 2QKIA 1PZ5A 1JPSH 4P4RB 4S1SH 5I1HL 3VXUB 3AB0B 2JIXA 3MV7A 1KIQA 5LWYL 4MNHB 4U3CA 1KLUA 3DJ9A 3EUUA 3MJ6A 2JK5A 4LLQB 4UNTA 5FECA 2EKJA 5D1QC 3V4VH 3QFDA 4QRPA 5C09B 4HUUB 4S11A 1ZHBB 4L3CA 3B6SA 3LDBC 2VLRE 3DV4B 3TLRA 3MSPA 1JBJA 3CXDL 4ODBD 3S5LG 4HIHA 3G08B 5ERWB 5GGQL 2WUCL 3ZO0A 1UENA 2VDMH 3MRKB 1C12A 2O5ZL 4I1NB 1S8DB 4D0CA 2P5WB 3T65B 3E6FB 5C9JB 4EIZC 4LCYB 3VI3F 4XMLH 3D0VB 2YXMA 5F6HI 3UPRA 4RAUB 4KVNL 4NYLA 3X11B 1B2WH 5F89A 3RX8A 1A4KB 3O4LB 4H0GA 4S1QL 4UNVA 4U31A 1J1OH 3OKDA 4KK9D 4RA0C 1U0QA 3U0PB 4OZ4A 3S34H 5KW9L 4LLWA 3SY0A 4E41D 2XT1B 4HSQA 3ZLQC 4N0YH 4X6FB 2Y36H 2DWDB 3IDMA 4R90H 5L2JB 1OD7A 3WKMH 5E8NA 2GSGA 2IADA 4UNUA 5A40E 5B8CB 5DUMH 5GS0D 2AV1A 5F8RC 4HS6B 1FFRA 3CVIH 3F58L 2VDNL 3CFBA 4RGND 3RY5A 1SYVA 1KCUL 1Z5LA 1LNUB 1HINH 3BQUC 4LASL 3RWHA 3LQAC 4HT1L 5ANMA 3E1F1 3M07A 1CLYH 4KC3B 4M7KL 5B3JE 4P48A 4WUUB 1I7ZB 2VJXA 3L5HA 3IXTA 4GUPB 4MJIB 3MJ8B 4FQXC 4U6XB 3RQ3A 2JTDA 2H9GA 3H3PH 3NIGE 3OGOE 4X0KA 4RWHA 2GT9A 3FL7A 1CLCA 4NKDA 1NC2A 4GG6F 2D2OA 1M7IA 4U1SA 4QO1A 5F9AC 4WO4D 3IS0X 1R5WA 4PJ7E 5D5MB 4LSQH 32C2A 5BV7B 4HPOL 4KTEH 1ORSA 1RUMH 5DI8A 3TH4T 3GSQA 4U3XA 3SCMB 3HMWL 2NR6D 1HKLH 1CQKA 1QHOA 4QNPF 3RY6C 1R0AL 1UZ8A 3BOVA 1UH3A 4TQEL 1WLHA 3CFEB 5DJYA 4TVPL 1R3JB 2I07A 2F58L 1IRAY 1FL6B 2FX9L 3TO4C 1LILA 1U58A 4HIJB 1QRKA 3JV5A 2MFNA 1H3TA 2BDNH 3D39A 3ZDZF 4YWGL 5TE7L 3VGBA 4FMFA 4GG6B 3FB7B 4HPYH 5I8CA 4GFTB 1SYSA 4IHOB 1HHIB 4WCYH 4JZJB 2NLJA 2R4SH 4OZIE 3I6KB 3MACL 3SDAC 1WWBX 3BWAA 2Z91B 5ADOH 2WIMA 4Z7UF 3UTZB 4LLYA 2VLJA 1Q8MA 3BGAA 5I1KL 2PYFB 3B3IB 3LS4H 4FFZL 3WNKA 4XVUC 1MCHA 1PKQE 5SWSB 3SGEH 1I1YB 3O2VH 4IRZH 5HHMB 1MVUA 1RD6A 2ID5A 4BSVA 3A6BH 1A3RL 2FJGA 3NA4A 4WW2A 4XHQA 4F37F 2HMID 3SDXE 3G6DL 1JN6B 3QI9B 3FTGB 2AQ2A 1QSEA 3L5WA 4XP1L 3WDHA 5CCKL 5FEBA 2WV3A 2GTZA 4N8VB 2PTTB 3KPTA 3WBDA 3K2MC 3LEXA 2WUCH 2F53A 5DA4A 3RGVD 2VDKH 3PABB 5HHPB 3NCYS 1QNZH 4LCIL 3CZFA 1X5AA 3MXWH 4KDWA 4FHBD 4NM4L 4CADA 4JPWL 2OXHA 1NMAH 3TF7C 2YA2A 5D96B 2UWEA 4LCCA 5HD8D 4M1GL 3WNOA 5HVGB 1U6AL 1OARL 4F80A 1U8IA 4P2CG 3KPNB 2Y06H 2C3GA 3X12B 3DURA 2AQ3A 4K2UL 2R2EA 5DUBB 4Y19A 1WFNA 2HVJA 4U1JA 4BKLA 5ICYB 4ZUVA 2CPCA 2AV7A 2P47B 5JIKA 1QO3B 4PJEE 4Z5RB 1E4KC 2WP3O 5JXAL 4PLOB 2VYRE 4RGNC 2H8PB 1CN4A 4PY7A 1OB1A 2P44B 3OJDB 5C2BH 3JTSB 4Y5XC 3CFIC 2H32A 5IMOA 5CZXD 2WUBL 5KOMC 4YX2H 1QSFD 4CN1A 4AENB 4NOBA 4KI1A 3VXUE 2EH7L 1PLGL 3TYGH 2RBLA 1FC1A 3N85H 4WTWA 3L6FA 2WZPD 1G6RH 1HE7A 1KIPB 3G6JE 3DX6A 1DQML 5IW1A 4KK6D 4ZTPL 1CL7L 4XP4H 4Y4FA 2CIKA 4CMHB 3VH8A 2VDOH 2A83B 4O00A 1G6RB 2WNGA 1HHJB 3NH7L 4NFDA 4PJDA 3SQOL 3OB0K 4BUGA 2X4RA 5FYKD 1ZGLM 4EXKA 4JO2L 2EIEA 3IU3A 4MJ6B 4RMQA 3GMRA 3L3IB 3OL2A 4JVWA 3QUXB 5ID0B 4NJAL 1E28A 3BPLC 15C8H 5GS0H 5MENB 1XR8A 4OCYH 3LN4B 5FGBC 3SJVB 4KKLD 4X8XA 3MRDA 3TBVB 3CVHB 3PL6A 4Z7QF 1EAJA 1VFBA 5DJ2A 1CGVA 2FBOJ 3HC4L 1I1FA 1WCQA 3MV11 3MYJA 5EU7C 5JW4Q 2LVCA 5LQBH 1P6AB 3BRFA 2VAAB 5JDJA 5K9QG 1DBAH 2YMXH 3TT3H 3NIDE 1JNNH 3G5ZB 4KH2A 4OAWB 2LE9A 5ALBH 2Q8AL 5T3ZE 1CDJA 4K3JL 4WJ5A 7CGTA 4WGVB 4APQA 2AAVA 5T1LD 5IMKB 3WUWG 3D85B 5E5UB 3EGSA 4U6YB 1SY6H 2VLLB 3M17A 4OB5L 1IC4L 3INUH 3TBTB 3HLAA 3L95B 3EYUH 3D3VA 3QDAA 4LIQE 3I6GA 1GC1H 4N0CD 4AG4L 2MJWA 1PFCA 1V05A 1G7HA 1HILB 5FKAB 2X05A 1GGUA 3B9DA 4JQXC 3NFPA 2HJKA 5T3ZH 4RRPA 4POUB 4N90E 3TNMA 1FNFA 3FB6A 1MHHA 3OF6D 3VXNA 4L8BA 3QUYA 4S2SA 1IEAB 4TVPE 4GQ9H 2KQMA 3LVEA 5EWIL 2EDXA 2XWBB 2VN4A 1YECL 5HHQA 5DRNB 3MPCA 4QF1A 2XZQH 1S7QA 5KANI 2XKNA 1NMCB 4YC2C 3U36B 2BVOA 4G6MH 1B6DA 1FDLH 4K7FA 3WNPA 5ALBL 5EBWA 2W38A 1A6PA 1VCAA 3L3OA 3CXHK 1D5BA 2XRAL 1ROWA 1BD2B 3RVTD 1S7XA 3VGGA 4EIGB 3VRJA 4L5FL 3QUMH 3S37X 1FFQA 2EYTB 2GTWB 5EULV 3WS6A 3KYOA 3O6FB 3OKNB 1KENH 3ALWA 1DQJB 4XC3L 1SEBB 4ODWB 2R1XB 3T3PF 4WI3A 5CJ8A 3BP6B 1QHPA 4I18A 3I9GH 5FDWA 4LRIC 3QQ4B 2DQFA 5E8EB 4YBLC 4Y5YB 5EIVA 3BJLA 2Q6WB 4X5WB 1ZAGA 3PWVB 5C2UB 3OKKB 1NEZG 4F7CA 5B39B 4ODHH 1GZQB 1IGYB 1P4LA 1P7KB 3BEWA 1YY8A 5DK0B 3HMXA 4M9OA 1KTLA 1HHKA 2DLIA 2G5BA 2WK2A 4G6AD 4XXCA 1ACZA 1A7OH 1BEYH 5HXMA 3THML 1QSFB 1L0YA 3GIVB 1T7WA 5EB9A 2IALB 3DMMA 3L7FB 1AXSB 2YKLL 3G5XB 2XXCB 2ZCKL 3VFMA 2F5BL 1SMOA 1HWHB 4OIIL 4DUVA 2W1NA 1AJ7H 1BECA 2AJXL 5DK2A 5D5MA 3MGTB 5D7SL 4P2OD 2AGJH 4PJBE 4R4FL 3UJTL 3RBGA 4RBPK 5H8DA 2XI9A 3NGBC 1WBXB 3TN0C 4ODUB 1DLFH 1C12B 4JGUA 3FQXA 5IBUG 1J88A 2A77L 1RK0A 2WMPA 1S78D 3BEVA 4UAOC 1BFVH 4QY8A 2IG2L 4Y1AA 4XVJH 4NBXB 5DR5L 4WY7H 3CFDA 2PF6A 5CD5D 3QQ3B 1HH9B 3U0TA 1UCTA 3QZWG 3PV6B 3F7VA 2JIXB 1A4KA 3PDOB 4NQSB 2EDJA 5MEOA 5ABDE 1IGFH 2VXVL 1MEXL 1OHQA 4JFXB 5A16A 3C9NB 4LFHG 3KLHD 2ESVB 4OSUH 2VTFA 2ZUQB 1X5GA 1BFSA 2FRGP 5GZND 2AK4D 3O41A 4PJFB 3DX7B 1FFPB 2JCCB 5T1LB 1JNJA 5E1AB 5B22A 5C0BE 3EFDL 1YYLH 2W9EH 4X99A 3KPSE 2VLRD 4HAGA 3X11A 1ULVA 3L3IA 5C0JB 3FOMA 1D9KC 4JPVH 2JJWA 4X8JB 3PL6B 3L95A 4HH8A 3VXMB 4JDTL 1OCWH 4OIAA 4QOKE 4PRHA 5ICXA 2MMXA 4XNYH 2X1PA 5CGTA 5C8JA 2WANA 2XZQL 1BX2B 4XPGL 5DRZB 1T1ZA 3QPXH 1YDPB 2DKSA 2Y5EA 3I02B 4I2XE 5TE6L 3TIDB 1WZKA 3BKYL 1T80A 2D4FA 3C8DA 2X4PA 4R26H 2CIKB 5CSZB 4BQ8A 5IQ7L 3SDAB 5K9JL 4LMQE 3HPJB 2EDQA 3RVUC 1ZLSH 1MREL 3QQ9C 3DUSA 1OP5H 1I8LA 5BZWA 1Q9WB 4HS3B 3OZ9H 4DN4H 4NCDA 2VDQH 4YDKL 4E5XB 1XF4B 1MSPA 3I85A 4KKBD 3SKUD 4PJ7F 1U91A 4NHCL 1IVLA 4OFPA 4XZUB 1U8LA 1H3GA 4HLZH 1U8JA 4U1KB 1G7QB 3E3QC 3RWFB 2MOVA 1OY3B 1T89C 1C5CH 4GKZA 2XN9A 4MWFA 4WTZA 1SM3H 5K93A 1A6VH 5A1AA 3SDAD 3NZ8A 3VH8B 3CFKA 1VADA 4HZLA 3HE6A 3PWPB 1I8LC 4ZXBB 4WI2A 3OAUH 5TQ2L 4B7IA 3B83A 4HKBA 3QNXA 1S7QB 4A6YB 3U36A 3ARPA 1MFBL 1FL3A 3BKCH 3LAFA 5K33A 5D1XD 3KG5A 5CKAA 1S7UA 1ZHNA 2W92A 1MQKH 3SKOA 4HWBA 2R4RH 3QPXL 3Q5TA 4M9PA 3QEQB 1DBBL 1GGCL 5DFWH 1W0WB 5IF0B 1FNLA 3A6OA 5C6PB 2XFXB 3GSXB 4MA1B 5DVNA 3MLVH 4POZD 1KJVA 3IDJA 3S88L 3BH9B 4NQDA 1NKOA 4H1LH 2YD3A 5JO5A 3KPQB 3V52H 3D39E 3KPPA 1II4E 4APQB 3C6SB 2YWZA 5IVXF 1FIGH 4RBPH 3SE3A 1B0GA 2YD1A 4YK4C 1PAMA 4XCYB 2VDPL 4NQUA 2YA1A 4RGOL 1G6RL 2R29H 1G9NH 1IC5H 2F53B 3RI5K 4WHYG 1FYTA 5LBSL 2EC8A 4X6DB 2FATH 3VWKD 4P9HL 1MJUH 2ZUWA 4NUGL 1BGXL 5EBWB 4RNRB 2JIXD 4NRXB 3ROLB 1D5BB 1Z9SA 4OZGA 4TVSa 4YC2B 1GRWA 1P5UA 5CJXA 4G5ZH 3PF2A 3L9RA 1FZMA 2V2TA 1QFHA 4WW2F 4OLZL 1CF8L 3LKQA 1XT5A 3VRLE 3SPVB 3FQTA 4QHNB 2NY0B 1TPXB 1JRHL 2Q7YA 5IT2L 1G1YA 2RJMA 3T0EE 4JQVC 1S7TB 4MCZA 1HQ4A 4Y4HB 4Y4HC 2VL5A 1T4KA 5DGQA 3WFBH 1URLA 4KV5E 1Y0LA 5TE6H 4M7LT 5BS0A 5EZIH 4MSWB 2Z8SA 4KVNH 1WEJL 1H0DA 2X4NB 1HQRA 4LLUA 1J9CT 5IW1B 3F7QA 5I76B 3HRZB 3EOTL 4JGMA 3C5ZB 4HH9B 1DLHB 4DAGL 1I3RA 2G9HB 2DM7A 5JHDE 5F88B 4RX4D 3OF6A 4XHJD 4D9QE 2PO6B 4PRID 4W70A 1YJDH 4I18B 1BEYL 1MI5D 4LCUA 3B9AA 2HG5B 1J8KA 5KVGL 1XGUB 3N1GC 2VH5H 4PIRF 4X7TA 5T3XL 2Y7QA 1PLGH 4CUCA 1KEMH 2XG5A 3TBYB 1AKJA 2C1OB 3VD5A 3JV6B 2VABB 3FQRB 1U93A 3F5WA 1KCLA 2C9AA 2OJZL 4FXGA 4URTB 2BSTB 3IFOA 1U8PA 2YPLD 4LEXL 5GJSL 3JWOL 3CFDB 4C54A 4LCWE 4NZJA 1OTUD 4F7MB 5CMAB 5CUSH 1R0AH 2ZUVA 4FTVA 3MRRA 1KTRL 2AJSH 1JYNA 1T5XB 4UOJA 4OLUL 3W5NA 5KSBB 1MLCB 3KPOA 4RQQA 3TBTA 3O6FC 4ODXA 3HZKB 2XACC 1JGEB 3T0XA 2E9BA 2AQ1A 4ZDHA 2AS5M 1NDMA 1EHLL 3R0NA 1P6FA 1VACA 3BGFC 3H9SE 4FFVC 4MAYD 4TVPH 3NFPB 1AI1L 4M8VA 4TUOA 4K8RD 2XKUA 5F3HA 3FFCB 5DJXA 3MGOB 1TTGA 2R9HC 3MUGB 3UYRL 2OQJA 4GBXA 5EZLB 3MYZA 2B4CC 3FQWB 4NKMB 3TVMD 5IMLB 2GFBA 5DVMA 1KC5H 1DDHB 2X4QB 1RURL 2CXKA 4NRYB 3VD3A 4J3UA 2NTFB 2R56H 3DXAA 1BBDL 1T2QL 5GQBA 3QEQD 4NNXA 4LVHC 3L3GB 4HG4J 3RWJA 3CK0H 1YUHB 2H26A 1A6UL 4CW1A 4RISH 5GGVL 1T3FB 2R15A 1G7MB 3QEQA 5JW5B 2VE6B 3NFSH 3VXRD 1A6WL 1VPOH 3MA9L 3TJHD 4L8CA 1B3JA 4OCWH 5AWNL 1VEOA 4ENED 3P4MB 4TSBH 3H9SD 3TIEA 5AEAA 1CU4H 1ZA6B 3MREB 5JZ7D 3KPMB 4MA8L 2EDFA 1FPTH 3P77B 2GTWA 2ZOKB 1M6OB 3QH3A 5JNYB 5JIIA 1IGML 4JY5L 4ZO8A 3MBED 4M61A 1ZXQA 3G6JA 4X6EB 2GCYB 3EBAA 3FO1B 2QADD 1FYTB 4TSAH 5ESAA 2BMKA 2K1MA 5D7JA 4JM2B 3DVIA 3W9DA 1S78C 5E94B 1HHHA 1DN0A 1D5XB 1SJEB 1LO0L 3RVWC 1CQYA 4DN4L 4MXVF 4PJDE 2VXQL 4LVNC 2VKXA 3OR7A 4Z76A 5F1IA 1EJOL 2F8OA 5F3BB 3OKKA 1DUYA 3TA3C 4AG4H 5EU6E 4WI6A 1G7LB 1L9MA 1TVBB 2NY0D 2HT3D 4X5XA 4Z0BH 3MRIB 4YXLH 4QEGA 3IU4L 1P4BH 3GI9L 2BVQB 1P2CB 2WBJC 2QADB 3AB0C 2ICEB 4NHCH 1KJ2A 2V5MA 3S35L 1RPQA 5K9QI 3T4YA 4K7PH 5EO0B 1S3KH 4Q2ZB 1P53A 4P5MB 5D8JL 1I3GL 5ETUB 5CEYA 1FLTX 2GSIB 3NFSL 4V1DA 2VC2L 4NRXA 2XICA 3HG1A 3WXVL 3CVIL 4XZUA 5F1NB 4L4TA 3C5ZD 1S5HB 4HJ0C 2NXZB 4IOFC 4AK1A 1UKSA 4DN3L 4M02A 2X4SB 3RKDD 1VENA 1RJLB 4HEME 4IOIB 3RWEA 1KEML 3DTXA 4HDIA 3ZE2E 5DD6A 1XGQB 1VADB 3BJ91 1ZLUK 3GJEA 2NY4B 3ESVF 2AKRA 5J1SC 5HGHB 3X17A 5GS2H 5SWZE 5KJRH 3D0LB 1D6EB 5E5MA 1AY1H 1B2WL 1RZFL 2EYRA 2HG5A 4P2RB 5DC0A 4LSVH 5F9JA 2FH6A 4PB0H 2BOBB 2B7DT 1NGYA 3ZTJG 1KJ2L 4MNQA 4MB4A 3HE7A 3QXDA 5HDQH 5JR1L 2YD2A 4HCRL 4RMRA 4HXAL 1NGZB 5JOFA 2YPVL 1BIIB 5KSAB 3V79C 4XBGA 1MCRA 3B9KB 5HGAA 1MNUL 1KIRA 3OHXA 1Q72H 4I2XB 3ULSA 1YC8A 5D71H 3IETB 4LPWA 5BRZD 4BH7A 1MHPH 1DL7L 1FL6A 1OF2A 4NPYA 1ZKAA 2W07A 1YEKH 1WC7A 3VXRE 3H0TA 2V17L 1IKNC 4Y4KD 3IGAB 4P2RD 4LPCA 1JYXA 5TE4L 3MJ9L 4Y19D 4JZJA 1G9EA 5ESQB 3N1FC 25C8L 4U49A 1ORSB 1OAYH 2ITDB 2EDDA 3W9EA 5IKCA 4C4KO 2V7HA 1D5MB 3FFCD 5D72L 3QQ9D 1OLLA 4U1MB 2YSSA 3JVGA 1TJGL 3WS3B 5FGCE 2OR9L 1U8MA 3CC5A 1OGAA 4OZGB 5GRJH 1QOKA 5CMAA 2OQJB 4PS4L 1EEZA 3OJMB 1MCKA 1RK1A 2JJSC 1PGRB 4FQJH 1INEH 4W4OC 5EBGA 4PRPE 5C0AD 5HI4C 3O9WD 1ZVHA 3LMJH 3PWPA 4OCXL 1HEZB 2NLJB 4DFIA 1FORL