1G7QB

Crystal structure of mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and muc1 vntr peptide sapdtrpa
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
publication title Crystal structure of a non-canonical low-affinity peptide complexed with MHC class I: a new approach for vaccine design.
pubmed doi rcsb
source organism Mus musculus
total genus 14
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1g7qB00
4P5TA 4KRNA 3EOTL 1BEYH 1CLZL 1S8DA 3E8UL 3VFOA 5IFAL 4QRRD 1YEIH 3FRUA 3GSRA 4NC0B 5EC2B 4MXVE 4ZUSA 4OF3A 3O4OB 4JPVL 1CLYH 4KK8D 4Y4HD 5MI0B 3PL6C 4NO3B 2FWOB 3QEQB 2ZP0T 4GRWF 4HGKC 4R4FH 4AMKH 3B9AA 1QPPA 1X5HA 3PWUB 2FECL 4JO3H 2V9QA 5DJXB 1J05A 1MCPH 4AT6A 4WCYH 1MHPH 2PUQT 4G7YH 1OAKL 3WNLA 3TP4A 1EO7A 3TA3D 5T33L 4FFYL 5DJ8A 5GGTH 1QFWH 3QQ3A 4PP2B 4AIXA 4R6UA 1HWHB 1G7LB 1YC7A 2X6MA 3CFDA 1TCRA 1LK2A 3O11B 1FVCB 3GMMB 4LKXA 1KTRL 4PJ9A 1A1MA 5E6ZA 5DVOA 5I71B 3WMSA 1VFAB 4RGOH 3FQNB 3RDTA 4BZYA 5GZOD 1S7VB 2Y5TA 4HWBA 3GB7A 4BZ2H 4NHCH 3VU2A 1MFDL 2O5XH 1IEAA 3V6BR 3DURA 5GGVL 1U8LA 3U7WH 2BC4A 1KYOJ 1MNUH 2YPKA 4GFTB 5IB4B 3QO0A 5IBLC 5BV7H 1HSBA 3WDHA 2BVUA 2W0PA 1BJMA 2DTML 3DI3B 2YPLB 3TBSB 2AJSL 2R0LH 3GRWA 1CFVL 4P4KC 4K7PY 4JQIH 1M71A 2CIKA 3GSOB 4M1CD 5HHXH 1ACZA 3KPMA 1QRNE 3NA9H 4F8TA 4QRSB 2F54B 3NOIA 1U2CA 4KI5E 1N0XL 3MYJB 3CPLB 4XGZA 1N3NB 1PG7L 4HBQA 4H5SB 3L7FA 4IOIA 3LV3A 4YFDB 4H26B 4DQOL 2DJUA 1IMHC 3K4AA 1AFVH 1QFUL 1V5JA 1U92B 2P8LB 3WLBB 2VIRB 2I26N 5HHQB 3RBSA 1CBVL 2EICA 2BVOB 5IEHB 3CMOL 3RWFA 4OV5B 2I9TB 2EEDA 4AEIH 3O6FB 2NNAA 3AY4A 4OM0L 3DGGA 5DT1H 3DTXA 4NM8H 2YD3A 2E8ZA 1ZE3C 1S9VA 3CVIL 1HXYB 1MJJA 2IANE 5DJZA 4Z7QF 3DVGA 4Q0XH 5T1LB 3OR7A 5CZVL 3ARFB 3JUZA 5JOFB 1I1FA 4QOKD 4KMTH 3WE6B 1RZIA 3AREA 4B7IA 3EYVA 5D7KE 3L5XH 1T89A 2VUYA 1G7IB 2XWJB 4JFDE 1XH3B 1A9BA 1QUNA 2L7UA 5AYUL 1ZGLM 3UBXB 3OZ9H 3BVNB 2VLRE 3F7QA 4TSBH 5B4MC 1F4XL 4GKNA 4P9HH 4ZPTB 3BZEB 4OGYH 1MAJA 4YFEA 3GO1L 2VXVH 2F19H 5CMAA 3VRLE 2ZOKB 4P23C 3ULVC 5HGDA 3T65B 3BWUC 1T1YA 3CFJB 4GRWH 4NKDA 4HDIA 1B4RA 3EYQC 4WFGD 3BAEH 1LE5B 5HBBA 2J6EA 4NO5B 2YZ1A 4JO1H 3P0VL 2VDOH 3BZFA 1BVLA 3R1GH 3STBA 4TULH 1YEFL 3AM8A 4GAGH 4OI7A 3EDFA 3ES6B 1RUQH 4X98B 4HCRL 1A0QL 1GC1C 5ALBH 2YRZA 4FQPA 5E2JA 3MCKB 2J88H 4JKPH 1MRFL 4XP5H 4YXHH 1ETZA 3QQ4B 1CD1A 5FKPA 2CQVA 1U8MA 5IMLA 4HS6A 3WHXA 4MJIE 1BQUA 5GGRA 1T20A 3OV6A 4UINH 2EECA 1FLRL 3JWOC 3IJYB 4OFKA 2DYPA 4ZYKB 2V5TA 3IFOA 5K9KA 1XGQA 4QEGA 1AO7D 4OB5L 1ITCA 4U0QB 4HJ0D 4K3JL 5F7WC 5D7IF 1AD9B 1IGCH 2FIRT 3VXUB 5DD0H 4KTDL 4OSUH 4GMSH 4AL8H 2RR3A 4ETYA 4XBEH 4PJDF 1EFQA 1WEJH 2R23A 4E41A 5EBGA 1J1XL 4HAFA 3MNVB 3IXAB 4GKOA 5CINH 3IU4H 2VLKA 4RFOH 2ADIA 3MRFB 5CBAA 3CLEL 5T1KB 2NY2D 4C58B 5GS3A 3I2CH 4HUUB 5C09A 3SKOA 1CL7I 1NC2B 4N0UA 4PRNA 1S3KL 4CVUA 5EB9A 2DLEA 1ZXQA 3PP4H 2GHWB 2PR4L 2NPLX 4LMQI 2XWBB 4NZTL 4OLVH 3QULA 3BN9C 3WFHB 2DM3A 2Z93B 4YAQB 4YHIA 4OD3H 1HWGB 4I2XB 6FABH 1MJ8H 4LAJH 3SDDB 2H41A 5BW7C 4Y5VC 1MI5B 4UIKL 3ARGB 3V0VA 3WUZA 1HILA 5HYJD 1FSKB 2K9UA 3V6FB 5KBNC 5TF1H 1IC4L 5M94B 1TQCB 5L2KE 2YC1B 1CGXA 4YDVA 1DBBL 1RIUL 4JO4H 5GRYA 4AG4H 1BM3L 1BJ8A 2IH3A 1BOYA 2DJ4A 1ND0A 3KS0J 1PLGH 4QRPD 3ZMRA 4L4VA 2DM4A 1NL0H 3EFDL 4C83A 4HPYL 5DQDH 1XR9B 5H35A 2Q3ZA 3UTSE 2AK1H 4CBPA 3QEGL 3MRQA 1BD2D 4NZUH 2DWDA 4E0RB 5C7XH 3S3JA 3IT8D 2WUBL 3KNBB 3MPCA 4FQXA 4U3XA 3MMEA 4FNLL 5C3LD 4PS4H 4X0KB 1LO5A 3WIFA 5FYJU 4LLDB 4RFEB 5IB5B 1QLFB 2IPKA 4FZEL 3GFUA 2FB4H 4K07A 2QKIB 4N0FA 2H1PL 3P3YA 4HQQL 5MEQA 4AIZA 2H2SC 4PJ5B 3VD9A 4R9HA 1EPFA 5DHXB 1HIMH 3VMNA 3CIQA 5IW1A 3G04B 4X7TA 5BZWB 3NH7H 3QQ9C 1AGBA 5AUMB 4M48H 4U6VH 4YDJB 1IQWL 3X13B 2O5YH 2OM5A 5J7CC 4XXCA 3GMOB 2JE8A 5LAXB 1CGYA 3TYGL 2YPVH 1JPGB 1MAML 4HKJB 2VXUL 3CZJA 1ZT1A 1KC5L 5IOPA 1IFHH 1MHCB 2Y6SD 3BKYH 1MCOH 3D87B 3H9HB 4KV5F 4ONOA 4OLEA 3FRPA 5ITBH 1YNKL 3WNNA 4G6ML 4KKLC 1SMOA 3WBDA 2I9LB 4XVUC 3MNWA 1FPTH 3FMGL 5I66B 4U6YA 5E2VH 3L5WB 1FG2B 3O8XD 5LQBH 4WI8A 4G8FA 1UYWH 5F88A 3CLFH 3CVHB 4UU9B 2IANA 2YS4A 3RWJB 3F7VB 1RJCA 5F44A 2WAHA 4OFYA 2NY1B 2VB5A 5C6WH 1JPTL 3IKCB 1JTPA 1H3UA 1NLDL 2JTDA 5CIPH 5FO7A 3K8LA 1FFPA 1CS6A 1L4IA 3HC3L 5F6IB 3QIWA 5KS9F 1FP5A 4JFDA 3VXOB 4X6DE 3C6LD 2RFXB 5IHZB 1YMMD 3QIBC 3SJVD 2VLRA 1HE7A 1YEDB 4KTEH 3MLUL 2G75A 2QQLH 5C0JA 2H2PD 5F3BB 2JKXA 3TBYB 1G9MC 1KOAA 2EKSA 5FGCE 2YRPA 1IM3A 4U3CA 3KYNA 2Y7QA 5E03A 4HFWA 5F96H 5BZDB 1NCWH 4NUJB 3QWRA 2PTVA 4PJAB 1JRHH 3S36L 2ADJB 4JM2D 1S7WB 3R8QA 5D6CB 5IT2L 3PJSA 5GGUA 4M3KB 1YYLL 3V4VH 1EUUA 4JQVC 4LRNH 5CP7B 4O2EA 4MXWH 4A2LA 3C6SB 1CG9B 4N9GB 2Q8BL 5FAAA 3R8BB 1JVKA 35C8H 1AHWB 5HI4D 4DFHA 4XWOD 1WLHA 2X4RA 4W81A 3MGOA 4MJIA 3D1MC 2VDKH 3KLDA 3ARRA 2EXYD 1K8IA 3FT3B 1N2RA 2VSCA 4MJ2A 4X9IA 1DVFD 2WWKO 4FXKB 5C07D 1JGEA 2EH8L 1MQKL 5DVLA 3X11B 4L3EB 1VACB 2DQGL 5GS0D 4TPRH 5ITFB 4EI6A 4HKZA 1EV2E 5E4EB 5EU6E 4OZGB 1F4YL 1XGYL 2YSSA 3OKDA 2C9AA 4WUUD 4CMMB 1OGAE 3PGFL 4L5FH 2COQA 2IGFL 4RAHA 1NCDH 4KTYA 1T5XB 4M61A 4CAGA 1TNNA 4IMKC 1KPVA 4HIXH 3FTGA 3U9UB 1GOFA 4ODHL 1F45A 1RJLB 3RNKB 5FHBH 4P59H 5ESVB 1NKRA 1WCBA 5FUOL 4HCRA 3NFNB 1YEKL 3U0WL 5C0CE 2IH1A 5A2IH 5C2BH 4LSQL 2X1XR 2FR4B 4FQQB 1MWAL 3I6GB 2VN7A 1AY1H 1KTLB 1NBZA 3HNVH 1NLBL 3H0TA 2YD2A 1O0VA 4GW4B 3KJ4C 4M02A 2VR5A 3TT3L 3DJ9A 1B0RB 4NO2B 3HS0B 4PJXE 3ZE1E 4Q2ZB 2LTQB 2F8VA 4LCYA 4Y7MA 4UQ3A 1NFIA 5D2LE 5EORH 4QWWC 1DBMH 3D2UA 2ZPKL 4N90E 5TQ0L 1E4WH 3MOAH 2NY5L 2X05A 1R5IA 5L2KA 1JZ6A 2A0LD 1V7NL 1KPRB 1F42A 3WJJC 1NGZA 2F53B 3CCHA 3MRHB 1X6NA 5GSVB 4UTAH 5E9DE 5IESL 4OIAA 1LE9A 3QIUA 3DSNA 5F1NB 3UTSA 4GAYA 4L9LC 1KIRA 2I25N 2IWGA 5T5FH 2VLME 2CDGB 5C8JB 3I3DA 4Z6AT 4TSAH 5I75B 5I1EH 1FFNB 1OLZA 1KN4H 5I1GH 4PIRF 4GAJL 5J6GB 2AERT 4FMKA 2PO6D 2ILLA 4S1RL 5CKAA 5GGSA 4LLVB 5FB8B 3KXFD 4NHUB 1X5ZA 3OX8A 1TJHH 3RL1A 3OAUH 3SY0B 1HZHL 1YY9C 5LCVH 5E8DH 4NQCE 3I50L 1QFHA 3WFBH 4IBLT 5ERWA 3O9WB 1W72B 1GYAA 1ZHLA 1VDGA 2FHFA 5GRJH 1UXWB 5C2UB 2VZTA 4O5LH 4G6JL 5EC1A 3HR6A 3IAGC 3TO4A 1AP2A 5JW4M 2GYSA 1MCNA 1EEYB 5KSBB 3VXRE 3CFBA 4GG6B 1CN4A 2MJWA 3MLXH 3SE4C 5DF0A 1AGEB 1HYRC 1JPSL 1BFTA 5D7LE 3T2OA 1RY7B 1DANU 3NBNA 1Q1JL 5IV2B 4IJ3B 3QG7H 1JHKH 4M1DL 4UB0L 4IRSB 4P46D 2VABB 1JF6A 3Q5TA 4NQEB 2CK0H 3TZVB 1VGEL 1UVQB 3DSFL 1A6ZB 3AS3A 4PRIB 3EO9L 5ELIA 1S5IH 1TPXB 3ET9F 3CDYA 1U8IA 5IFJB 4L3AA 2OCFD 3DUHA 5HVWA 2CO7B 3WLWD 2P5EB 1J88A 5TGBA 2KPNA 5MEOA 4WWID 1DQTA 1QYGH 3Q3GB 1B9ZA 4UDUB 5I73B 2EDDA 3SDCA 1JNHA 5I1LA 2CR6A 1HSAA 3ZDZE 4ODXB 3HMWH 1EJOH 2XICA 5F7MC 4WDIA 1G6RH 3GIZH 4LKCA 1K6QH 3DO7B 4JRYE 2EYTB 5FGBC 5LVEA 3CSPA 3PWNA 2AEIT 4FZ8L 1G7PB 3W0WB 4MXVF 1SBSH 2O61A 4X6CB 2DF3A 1ZVYA 5HI5D 4JDTH 5DS8A 3TH4T 3VG9C 2APFA 3TPKA 4HKXA 4JFPB 3U7YL 4Q9RL 4C55A 1ZANL 2H3NA 5DD5H 2WWMC 5JHDB 5IMOB 2K7QA 2DM2A 4XZUB 4O2CA 4MAYD 4NYLA 4Z7VE 5B3JE 3O3AB 2FEDD 2ORBL 4KY1H 5CCKH 3C5JB 5EOCL 2MCPH 4BQ9A 4X8XA 4X7DC 4CADA 2R1XB 4DUWA 1FN4A 3LHPL 3U4EB 4C59B 3BGMA 1NDMB 4TRPH 1EHXA 2NX5E 4RMUA 4XNUL 2HAZA 3L3OA 4GRLD 2JJWA 3FKUS 5DMJB 3HZMB 3BH8A 4XX1E 3ARTA 3UTQB 4OQTL 5CJOH 4YLQT 4S0SD 4Y19D 3ZHLA 1P4LA 3MZGB 4N8CL 4Y1AB 3NAAH 3D9AH 1JMXA 2BSRB 4G5ZL 4KJWD 2WUCL 3KPLB 4F33A 5I1IL 1VEMA 4YH6A 4Y16A 4X4XB 2QQQA 5F7NC 4MXQC 3BQUA 4MSWB 1BZ9A 3HZKA 4UT9L 5EU6A 3CH1B 2J6EH 2DIBA 1EGJH 4WUKH 3U0PB 3V6OC 5F89A 1OGAA 4P2QB 2I24N 3MCLH 2CIIA 4PV9B 1FZOB 4FQ1H 1GZQA 2IG2L 2NY0D 1RQ5A 5DD3H 3B3IA 2VISA 1UM4H 4KI5F 2XKNB 3FHAA 1UACH 2E7HA 5E2WH 4ZAKC 2Y07H 3WYRA 4IMLA 3ARBC 4ZSOE 4HUVB 3VFUB 2GUOB 2C1PA 4HV8B 3WSQL 1BQHG 3BW9A 4RWYL 4DW2H 1XEDA 4YDIH 4GG8A 1KIPA 3KLHC 5C0CA 2B1HH 3A6OA 2VITB 4WV1B 3PDDA 3QCUH 1R3KB 1EFXD 2LABA 3O2DL 3PG2A 3VFWB 2BNUA 3GSNL 3I6KA 3TJHC 3B9KD 3NVQA 4XP6H 3V6ZA 2Y6SC 5FA4B 2QV2A 4R7NB 5J9PA 1LD9B 3IYLW 5GRUL 4PJXA 4V2BA 4YX2L 5AZ2L 3MV9E 2OZ4H 3GMPA 5SWQA 2A38A 2YPLD 3MR9B 3VFSA 4ACPA 5AWNH 1RPQA 3S3PA 4ODBD 3HI5H 5E9DA 1EHNA 3FQUA 3CFKB 3MODL 4Y5XB 4U1IB 3MA9L 1LO2L 4K8RC 4U6HA 2H9GA 4MHHI 3VFTB 1J5OH 3NACH 4KAQL 4R4BA 4PJGE 3BPCA 3JVGA 4ETQB 4BFIA 1MVFA 3GKWH 4RQQA 3P9MA 2ARJQ 3I85A 3HG1D 5F7FA 5DC9B 4NM4H 1HEZA 2YD4A 1LQSR 1BLNA 1UB6A 1YECL 3VWJA 4PLKC 2E7MA 1I8IA 2BNRE 1T1WB 1HQ4B 2KL6A 5I8OL 4XRCA 3QUYB 2VDLL 4J3SA 1KJ3H 3QDJD 4HZLA 4M62L 5KOVC 4IHOA 3STLA 1WTLA 4ALAL 3REVB 5K9OA 3VFRA 1A9EA 2H2PC 4ZFOB 3ZKSD 3H42L 4NQCA 4AM0A 2FX7L 5JORB 1MFEL 3T2NH 3ARFD 3TFKD 5I1KL 4UBDD 2GFBA 1OTSD 2A9MH 4HK0B 5DURB 1JRHI 4N5ED 2ZUUA 3HMXA 1QR4A 4YQXL 2GTZB 1CGWA 1I7UA 1QEWA 1MUJA 2CXGA 4JM2C 4NCC2 4U33A 4JKLA 2QHLA 4PRBA 1DUYB 1WV7T 3VXRA 4DK3A 4WWKD 5D7LA 5EU4B 2UY6A 4ZNEE 1I3RB 4LCCB 1NMAH 2BNQE 1HNGA 2AXFA 3DVNB 1S7SA 4UI2A 3P73B 3EOTH 3E8UH 1CLZH 5IFAH 4M4RA 2D2OA 2VE6A 1MFNA 5HI4C 3QI9A 4CVXB 4HPOL 3ZE0E 1QACA 4XMKL 4JPVH 3KG5A 1K3ZA 4WFFD 5C86A 5HHNA 2ARJA 5FYLH 3SO3C 5L9DL 1N6VA 4M7ZC 1QD0A 3G6JB 4ONGL 2WBJA 1U0QA 5FYKD 3G6AB 4M9PA 2DKMA 2FEEI 5DJYB 1E6JL 1EXUA 1OAKH 4G80A 1I8LA 3TF7C 3ZKMD 3HLAA 5T33H 4BFGA 4FFYH 1U95B 4LASH 3UJJL 3QQNA 5INDB 4MNHB 3RUGE 1S7QB 1FC2D 2P5WE 4JRYA 3D39D 1S9YB 5DQJB 2ZSVA 4Y2DA 2XKUA 4PRPB 4ZOEA 2XWTB 1LNUA 1KLGA 1MFDH 1SM3L 4OUUA 1YJDL 1IT9L 5GGVH 3UAJC 4NWUH 1Q94B 3ZDXE 4LHQB 3O3DA 4I3GA 1A4KA 4L3CA 3FN0L 5J0BA 3GSWA 3QFDB 1SVZA 2IAMB 4M5ZL 5IK3B 2DTMH 3TGXA 1F4HA 1GGCH 2D03L 3NIDE 1TDQA 3MRNB 4GRWB 5MEPA 5IVOA 2AJSH 3MC0A 1JHTA 1P53A 2G2RA 2V5SA 1CDCA 1CFVH 3B83A 3D5OF 3C09B 1VFUA 3WUWG 2BDNL 4L8BA 4DEPB 4F15B 1JUFB 4NJ9H 1N0XH 4HIJA 1PG7H 3D85B 1ZVHA 3N1MC 1HHJB 4DKEL 1JGUL 4OF0A 2ICWA 2A83A 4DQOH 1SYVB 5IMMA 4D0BA 2D0HA 5I8CB 3VDBA 1IGTB 5H37H 2N1KA 4MAUL 4BYHA 1CVSC 5C0RL 4N8VA 2GK0B 1DEDA 1UJ3C 4U1NA 4OD1L 4NZDA 5FYJD 1FAIH 1JNNL 3W11D 1K5NA 1CBVH 1R3IH 1TITA 3ARPA 3EOAA 1D6EA 4EXKA 1P6FA 2CKNA 2VZ3A 1MCFA 5D7JC 3UYOD 3L5JA 3TPUB 2A74A 3QUZA 4EZMA 3EOYG 4OM0H 1UA6L 3JXAA 3LRSB 1EUTA 1H9VA 4LSUL 3P30L 4BA8A 3CVIH 3MJ8A 3ARGD 4V2CB 1MCLA 5CZVH 5I74C 1IEBB 4R0LA 1A6AB 4P5TD 2HH0L 3OWEA 4ZSOA 4NC1C 1YY8A 3VXQA 1FHGA 1ORSA 1L6XA 1TMCB 3NABL 4HH9A 5IBUG 1S7UB 1CVRA 3JSSA 3QSKB 2FZ3B 5IB3A 2GW5A 3K2MC 5AYUH 4QF1B 2XOTA 4MB4A 3OKMA 3IAPA 4OCNC 3NFPB 5IMKB 1AXIB 1F4XH 3OKEB 4EIGB 4MA3A 5I16B 3GO1H 1CE6A 1NMCB 4OQTA 5ID1B 1Y0LB 3ZKQD 3U79A 2Z0BA 2Z9TA 3TO2B 2V7HA 4DOHE 2VL5A 1KXQE 3MV9A 5B38B 4JVPA 3QFJA 2EXWD 2QADD 1NEZG 2R2EB 4U7MA 2GT9B 1CZ8L 3U2SB 2AS5M 4OM1L 3FZUC 4HAGA 1U58B 3P0VH 4PTTA 2NTFA 4BKLB 5K33A 1WT5C 4P46C 3S5LG 3JZ7A 5D96B 5JQHC 3RDTD 3KPTA 2X1WL 4HXBH 5ACZB 1YEFH 5I76A 3QJFA 1QRKA 4HCRH 4X6DF 3MA7A 1A0QH 4IOFC 4EI5A 3DVIA 2J1KA 4PJGA 1MRFH 1U36A 3WLWC 4G43B 4OLXL 3MBEB 3BHBB 2DQEL 2NLJA 1U93B 3MLRL 3MRKB 1MY5A 3MV7D 1H3WM 3IDJA 7FABL 5TDNA 2ZKHL 2BNRA 1F3RB 3GSNA 4XNMB 2DD8L 1XAUA 2MOVA 1QA9B 4WW2C 1MY7A 5F21B 4OB5H 1EAPB 4Y0GA 5HYEA 2BMKB 2Z92A 1PVHA 4BUHA 5JXEC 3OKNA 4KTDH 2PYEE 2FO1A 4I3SL 1RHHB 3R06B 4JZJB 3BO8A 4P5MB 5IB2A 5F9OL 4F2MA 4WHCA 3MNZA 4Q9BA 3HAEA 5EO0B 5C0DA 4O00A 2H32A 1RZJC 2AGJL 1CICB 1J1XH 4FP8L 3RI5K 2CXKA 1NC4A 1UZ6E 5CBEB 3BYYA 2DIJA 3MUGA 2P8PA 3FFCE 2GAZB 3IFNL 4LCWB 1B4JL 4MJ5B 3MRJB 4ZNEA 5I18H 1C5BL 2XQYG 1CGSL 2FEDC 2IADA 1WBXA 2BNQA 1G7QA 4KRPB 4LSVL 1S3KH 2A6DA 3QXDB 1PKQE 2XKSA 5EFIA 5I1AA 2ADFL 5F9DC 4ZO9A 2PR4H 3BP4A 2VDPL 4KJPD 4PRHB 4QTHA 4PV8B 2FRGP 4NZTH 4GRLC 5GGRY 3QUML 3X3FL 5B39G 3WXWH 1BREA 3DV4A 5ESAB 4Z7NE 3PQYB 4H25A 4PJIE 1I8KA 5IWLA 1FZMA 4P3WA 5D7IB 1UT9A 4JVUA 2ICEA 1EHAA 4WJ5A 2H45A 3D3VB 4UIKH 4HSQA 2K7PA 2C3HA 5DRXB 5IEKB 5SX4H 2P49B 3TNMB 1U3HB 3UMTA 5KSAB 3O4OC 3TVMA 4PJDB 1IC4H 4NRZB 5MI0C 3EYUL 1DBBH 4Z18A 1UQSA 4MB5A 1BM3H 3LY6A 2GJJA 3EYFB 1NUDA 4OLUL 4EVNB 3H7BA 3RUGA 4JFEA 5CIPB 1F4AA 2ZUSA 3FONA 2KUTA 3MRGA 3EFDH 5SWSE 4HPYH 1LP9A 2UZIL 4Y4FB 3QEGH 4APQA 2JCCE 5FDWB 3VFVA 3SCMD 2CPCA 2QSCL 2ZG2A 3QUXB 4FNLH 2PTTB 4JZOB 4I9WE 3WHE0 2P4AB 1OSPL 1DBAL 2FIKB 1ES0A 2Z31D 4PJXF 3ZE1F 1H5BB 1V3LA 1WSST 4ZO8A 2H1PH 2HG5B 5GISL 4HQQH 5D2LF 2F8OA 5I71C 1XGRB 4L8SA 2DQFA 5ICZB 1A1NB 4PLJC 1DSFL 5ENWA 1A64A 1U6AL 1IQWH 5E8EB 2BVPA 2Q76B 5C0IB 4CRPA 3IFLL 4YK4B 4ZQKB 4F9PA 4RISL 4EXPX 3TYGH 3OJDB 4QXWA 1MAMH 2HT4D 3MRIB 4HMEA 2VXUH 3BXNA 1KC5H 2CLZB 3CDGB 2CUMA 3UJTL 3L5IA 1TTUA 3T1FA 1YN6A 5C70A 1VADB 4LLUB 1X9QA 1RK1A 2HVJA 4PRAA 2AXGB 4TTGA 2ESVD 3GSQB 3V7MA 4G6MH 4P4RB 1P5UA 3S35X 43CAA 4JKWA 3M1BB 5CSBA 5IM7A 1U8JB 1BFSA 3FMGH 4PTUA 2GJ6D 4U2YA 5TPWL 2AJXL 2VKWA 1ADQL 3DO3A 4XTRD 4H0IA 3MRPA 4KK5D 3OB8A 4J3UA 1S7XA 4MWFB 5K93A 1JPTH 3VGBA 5MENE 1NLDH 5BS0B 2F53D 3O6FC 3HE7D 2YWZA 2HJFA 4OKDA 3UYPA 4FQJL 2E5EA 3HC3H 1T7YA 4ZUWA 3CSYA 3K74B 1MRDL 4LDLB 5T3XL 3WIHA 5DMGC 2A6IB 3ARFC 1DQMH 4UBDC 5JQ6L 1CDUA 1INQA 1BQHB 1MLCA 4X4YA 1ZWIB 3MRDB 4UT6H 3IJHB 4CW1A 5I6XB 1JZ2A 2ZOLA 1KENL 5TDOA 4ZS7L 3VCLA 3H9SD 4JHZA 4ODWA 1PYWA 1IE5A 3BKML 2V2XA 3S4SA 3CFEA 1AD0A 1BECA 5KVEL 4L4VD 5J1AB 1KJ2L 2Z35A 1KLUB 1PEZA 5GPRA 3S36H 1JYVA 4IM8A 1RJYB 3RI5F 5IT2H 5GGVY 4ELMB 1UWGL 1YYLH 5FECB 2XZQL 4FQXD 4P4KA 2UY7A 4MGXA 3ZDZF 5F3HB 5F7KC 1KB5B 4YBLB 5KS9B 4X5WA 3VFMA 4HIHA 1HHHB 5E95B 4G3YL 4NOFA 3MBXL 3WS3B 3B5HA 1IKNC 1I1AB 2DQIL 4YXKL 2E3VA 2EH8H 4NDMA 2DQGH 5HGHA 2BFVL 3TZVD 2Q20A 1GXEA 3GI8L 1KNOB 3P11L 3K81A 5DMKA 2PYEA 1F4YH 4JN2A 1M7XA 1I8MA 4WFEE 5IFHL 5B3JF 4Z7VF 2X4OA 4P2RA 2IGFH 1AQDA 4JGJA 5TE6L 3RZCB 1BVKA 2CRYA 1YN7A 3EBAA 3GSXA 3HB3C 1AI1L 3RIAK 3QPXH 2R29L 3QHZL 4ZOCA 4MA7L 3TYFB 3FFCA 4ODHH 4LEOA 3GSUA 2W65B 5DJ8B 2UUDK 3RWCB 3QQ3B 4EUPA 2PKDA 5FUOH 4XPHL 3CFDB 1PKQA 5K9QG 1YEKH 4NRXB 3U0WH 3WN5A 4LKXB 5C1MB 5HYFA 4KUCD 4TN9A 2Z4QB 2A6JA 2A77L 1MWAH 4OFYD 5EO9A 3DNKA 1NLBH 2Y5TB 5D7KD 4B41A 2ZUQB 2MFNA 3DURB 1G7HA 4PJIA 4K3EL 2BC4B 3TT3H 3PWPE 5MP6L 1V05A 4P23A 3FFDB 3QO0B 4MYWB 3EJZD 1HSBB 4HG4K 2X4NA 3ALWA 4P48A 5F97E 2W91A 3OGCA 3ARDD 2ZPKH 1CQYA 3PF2A 5TQ0H 2NY5H 3W11C 3RGVB 1CD9B 2SEBA 2BRQA 1M71B 2CIKB 5F7EL 3ESVF 3KPMB 2JB6A 4QRRE 2X7LA 1MCIA 3MGTB 1VFBB 3V5DA 2GQHA 2EDEA 4OD2B 4N8PA 5IESH 3L7FB 3CH8A 3ARGC 4IOIB 2JCCA 3LKPA 3QWRD 1FSKC 4GO6B 1Q9KA 2Z8RA 2NY4D 1TLKA 1KEMH 4OLWL 3ULSA 1TQCC 1M05B 2H6PA 3PUCA 4FTVD 1T1XA 4P3CL 1G6RB 3BH9A 5F71A 5CSZB 4GAJH 4OLZL 2IPUG 4L4TB 4CMHB 2VOTA 3T0WA 3G6DL 4S1RH 4CUCA 2NXYD 1AGDA 1HKLL 2WW8A 3DIFB 4PJHE 2NNAB 4LNVA 3OXSB 3DVFA 3VRIB 3DGGB 4UV7L 3ZTJG 2BSTA 3TIDA 3HNTL 2AJVL 5HHVL 1IC5L 1N59A 1T66C 2APTA 5TDPA 1FVEB 1HZHH 2D4FA 2F74B 3O41A 4XT1C 3I50H 5KSUA 2ITCB 5DJZB 3BKCL 3OR7B 2V7NA 2DBLL 3KLAB 1I1FB 3UTOA 1IZKA 2AI0L 5EBLB 5A40E 1RZIB 3AREB 5F9JB 2EXWC 4PREB 3S9DB 1RVFL 4LLWA 4G6JH 4PJGF 3WUWB 1YNLL 5IP4A 5F93C 3KYKL 1OARL 1A9BB 3FJTA 2EIZA 2I60L 3HCVA 4I0PA 4EN3D 1JPSH 4BFEA 5I8KH 4GKNB 3HZVA 1Q1JH 4MMXC 2DQJL 1PY4A 5DUBA 4M1DH 4UB0H 5CMAB 1FCGA 3SPVB 4OCMC 2W38A 1DL7L 4X99A 2OQJB 5HGDB 1VGEH 1FZJB 3DSFH 1KG0A 4HDIB 5IJVB 4R8WH 3Q1SL 3EO9H 3IS0X 1NH6A 1K4DA 5I17B 1D5XA 1MCHA 3AROA 1UEMA 3S37X 1TTFA 5BW7A 4HK3J 4Y5VA 1OT1A 3OXRA 3HRZB 4HIEB 3C87A 3E3QC 4JJHA 4LSDA 5HPMA 5IHLB 3RPKA 3IB4A 1P7KA 3O81A 5EOTB 3QDGB 4ISVA 4KJQC 1CIUA 5DD1L 2NY1C 5KW9L 1ETZB 1E4KC 1QZ1A 5HGBA 5LGKA 3PDOA 1U8MB 5IBUB 4HS6B 3VXMB 5EU5A 3WHXB 1I1RA 4FZ8H 1N6QL 4QYOA 1A6TB 1C5DB 1CXFA 5F6IC 5K9QI 5GJSL 3ZE0F 1RU9L 1MCWM 4RRPA 2DYPB 3L3KA 3O3UN 3SHSA 1PW3A 1LHZA 4Q9RH 3U7YH 4NBXB 1ZANH 3QIUD 3O4LB 4DCQA 3GUTA 3S97C 4RGMB 1QO3A 3MLWL 4YBHA 3RIAF 2APBA 2OBGA 1NEZB 4YIQA 5EOCH 3PDGA 4LF3B 1FNHA 4MNQB 1V7ML 1OP5H 3LHPH 1U91B 2X4UA 2FL5A 4XC3L 5DC4B 2VLKB 3S5LB 1S9KC 3RUGF 4DGIL 5CBAB 5T1MA 4XNUH 1F6LL 3HE6B 1JPFA 1KJMB 3BPNB 1DDHA 4WEBL 1L7TL 1FIEA 2FD6L 5GZND 4HMCA 3ZKXB 3SKOB 4WFGE 2MHAA 3LRHA 4N0UB 4PRNB 4OQTH 2ICWJ 1ZA3B 1T83C 2CRZA 1T7WA 5T1DL 4X80L 4G5ZH 1SVCP 4ZTOL 2WUCH 3QNYB 5I1IH 1ZMYA 2AK4A 1AHWC 2F58L 4QHKI 3P4MB 1XR8B 2CDEA 4UT9H 3QEHA 2CUHA 3RPIA 4ZOAA 3RY5A 2XQBL 3NIDF 1WIUA 4YHIB 2XN9E 4MJ6B 4BUGA 4RGNB 4XHJD 1HCVA 1KJ2A 4LPVA 2IBGA 2ADGA 3V0VB 2UWEE 4ZUTA 3V5KB 5I1CL 3DRQB 3DETD 4MVBD 1ORQA 2MSPA 5GRXG 1EO8H 5E4EC 4WW1A 4JM4L 4JKKA 3SKJL 1RZ8A 4UIMA 5EOCJ 4DN3L 2ZJSL 4N5UA 3WSQH 3SBWC 2VTFA 1GPOL 2VZOA 3IKKA 1AO7E 4QRQB 3HPLA 4RWYH 3RWDA 2D4DA 2FBJL 2EC8A 2YUZA 4GW5A 5IG7A 4XP1H 3MRQB 3O2DH 3QIBA 3KPPB 4PRPD 3GSNH 2M26A 4J1UA 4FRWA 4MQ7A 3BZ4B 1QR1A 4U6XA 3UO1L 2APWA 1L0XA 4W6WB 5D9SA 4PRDB 1KLFA 4ZO7A 3WIFB 3PWPA 2QSQA 1NCNA 5GRUH 4JFZL 2DI7A 1FAKT 3B8SA 4MDJA 5A1AA 1F4WL 1C08B 4GS7C 3VXNA 2IAMD 4F7TA 5LJYH 2C3GA 3DX6A 3JBG7 5AZ2H 4XNZB 2AQ3A 1YQVL 5B39B 4EJ1C 5HHOD 1MF2L 4UMGA 1PSKL 2H32H 1A5FL 1QRNB 1ZS8A 4QRRA 4JY6A 2OTUA 1VERA 1J0KA 1KELL 3KJ6L 4JQVA 5IKCA 2C3VB 1RZGB 3LS4L 2YBRA 3D85D 3MODH 4F3FB 3VXSE 5F7UA 1LO2H 4H8WC 3A6CL 3UZEA 5DVNA 4G8EA 1NGWA 5IHUL 3LEYH 1MH5A 4GBXB 4M6OL 1DEEA 3QA3A 2OS7A 3REWA 5HYJE 3RX8A 4JPIB 4HJGA 3UP1A 1YECH 2Y4SA 3LIZL 1DQDL 3HUJE 4PJHA 2AP2A 4PGBA 5I8OH 1ZAGA 4OGAD 3C5ZD 4C56B 4PY8I 4M62H 5DVMA 4QRPE 4ALAH 1BZ7A 4G8FB 5F88B 5IBTL 2QJDA 5I75C 3FQXA 3SKNA 1G0XA 3CC5A 3H42H 4EIZC 2IANB 2FX7H 4YFLI 5L88L 1BD2E 1MFEH 5I1KH 1UZ8B 3AAZA 3K8MA 4PJFE 4AQ1B 2WANA 4YQXH 1UKQA 4IMKA 4JDZA 2EZ0D 5GS2H 3QIWB 4JFDB 4K9EL 3KPQA 5D1ZB 3GBLA 3BPLB 2APXA 1A7QL 4W4NA 3X14B 3ULUD 1NGPL 3QUKB 1MCSA 2G75B 4IEFB 3O9WC 5DWUL 4JRXB 5C0JB 4Q9QL 4LFHG 3VFNB 1WZMA 5GSRB 5I1JL 1QSFB 1BGXL 2X5PA 4HPOH 4NIKB 3S8WA 4XAWL 4XMKH 4DZ8A 1ZLVH 2F9BT 5DFWH 3EIFA 5L9DH 1AKJD 5K59E 4KROD 1H0DB 3KWWA 1QOKA 3L3DB 4IJ3C 3MUHL 4ODSL 3EDDA 4ONGH 5CAYB 1RK0A 5FM4A 1KJVA 3WEXB 4IRSC 3PJSB 5GGUB 4I77L 5L8KB 1UZ6F 3TZVC 1DP0A 1E6JH 4O2EB 4S1DD 5FFLA 3WJJA 1TPXC 1J1OL 1WAAA 2HKHL 2OTWA 4RIRB 4D9LL 2UYLA 1FNSL 2X4RB 4KXZH 4KRLB 5SX5K 4O51A 4Q6YA 5EBMB 1RI8A 5DHVA 3NN8A 4ENED 5I73C 5M7QA 4L9LA 4NNYA 1QBML 4QXTA 1K8IB 5B3NA 2A73B 1N2RB 4TTDC 1N6UA 1SM3H 3MACL 3R4DA 1MVUB 2WP3T 1YJDH 1IT9H 3LB6D 4Z7NF 4PJIF 4U1GB 4KQ3L 3UPRB 3FN0H 1KCLA 2CGRL 4HG4J 5DUPL 5HGGS 4M5ZH 5TH2B 4TVSa 1KN2L 4HKZB 4DVBB 4YO0A 2VLMD 1YMME 2D03H 1VKXB 3SJVE 4K7PX 5DJ2A 1T7ZA 1UB5B 3F7PC 4RAVA 3FQTA 3WS6C 1XMWA 2D3VA 4U3HA 4M61B 5GS0L 4O9HL 2RBLA 3KYMB 1FO0A 2BDNH 2UV3A 4OFPA 4U4BA 4QHMB 4K94C 4ZXBB 5IHBA 4JFXA 1IGJA 5HD8D 5CD3A 5L0QB 2JCCF 4DKEH 1JGUH 3WCYA 5DRNA 3QCVL 4XPGL 3MJ9L 4LPTA 3UDWC 2H26A 1H8NA 1U42A 1MHHA 4LCUB 4MAUH 4PRHD 1KCRL 3GMLA 5LWYL 3WFDL 3FT2A 4OD1H 4OZIE 1JNNH 2J4WL 3RVTC 1BX2A 1XF1A 1F3JB 2XN9A 2JIXB 1K8DA 1JN6B 1LEGA 1NJ9A 3QDMB 1UA6H 3L3IA 3VXRD 1W8OA 3U48A 3GEWB 1X4YA 1CD8A 3P30H 1XIWB 2GCYA 5DJAB 3D3VD 1T6WA 4XPBH 2UWEA 3H3BC 3D2UB 5ETUB 3UZQA 3V2AR 2VDML 1R5IB 5L2KB 2HH0H 2NXYC 3RL2A 3MRBA 1NGZB 3X12B 5C07E 3QI9D 3NABH 3L3JA 1AO7A 3EUUA 1UXSB 3UJIL 3KPOA 4Y4FD 1BZQK 4M7LL 1EDQA 4DWHA 4WUUE 3PV6A 2WBJD 4TUOA 2HJLA 3G08A 2EDOA 1KCSL 5FGBA 2BCKA 3IDNA 4OCLC 1YEJL 2OI9B 1HOCA 2FJHA 3MV8D 5D2NE 3QDHA 5I19L 2EEAA 1FIGL 1HQRB 4NN7B 3L95B 3BFOA 1ZT7A 1CZ8H 5E2TL 3W9DA 1XFPA 3MLSL 3QXAA 3RL1B 4XCYB 3AS0A 4OM1H 4PB9L 1WBZA 4RNRA 2EDQA 3QZWA 4GKSB 3W39A 4F37K 3GZKA 4BSVA 1JK8B 3KHOA 5FUCE 4EUPH 3VXSA 5FOJA 3H6JA 3M8OL 3GKZA 4KUZL 1JWUB 4MNGE 2BOCA 2DBJA 3TT1L 3MQIA 3MRCA 1ZSDA 3TO4B 1AP2B 3DX9B 4U1SB 3TBTA 1PX3A 2DQEH 3KAAA 4XPTL 5INCB 3MLRH 2D31B 1YMHA 1XF2A 1DANT 4WHDA 4GJTB 7FABH 2OMBA 2ZKHH 4Y5XC 5ESQA 1I7TA 3T77A 3U1SL 3HUJA 5I9QC 3OAZK 1OM3H 2DD8H 1V3MA 2XA8L 3E0GA 3KPSA 4CVZA 3BGFB 4MD0B 4IRJB 4QRPA 4LIQL 2Q8AL 2OX5A 4JPKL 3LPWA 3OKOB 1BD2A 4BM7A 4I3SH 3GNML 3V6OA 3BDBA 1G7MA 4PJFA 3V7AE 5JPNA 5D71L 1IAIM 5F9OH 5MEOB 3OJMB 4Y4KB 3V0AC 1O7VA 1B0GA 2AGJH 3QUYC 3KPRD 2B0SL 5F1OB 5D70L 3I3BA 2HMIC 2YK1L 3BDXA 3SDCB 3EO1A 2R1WA 1IAKB 4ZAKA 1Q9LB 4X6DB 1I1YB 3IFNH 1HSAB 3ARBA 3UTZB 2KDGA 4YDLB 1B4JH 4QCIB 4OF5A 1C5BH 3KXFE 3BP5A 4R2GB 4WDIB 2Q86B 5A2JH 3MV11 4LSVH 1AGFA 2ADFH 4LSSL 4XCEB 1VFOA 1D9KB 5F6HI 1OVZA 3PWNB 1IGFL 2VDPH 2J8OA 1T6VN 1OQOA 5DZOA 3PWJA 4NKIL 4Z95L 3QUMH 4X7EC 3IDIB 3X3FH 1ZA6B 4UQ2A 5DYOB 4XP9L 5DS8B 4LCCC 5DSCB 3H3PL 4HKXB 4J3XA 4K7FA 3FL7A 2DLHA 1IM9B 3UTTB 1KULA 4LIQE 2NW2B 1Q9WB 4YUEL 2VO5A 5E08L 4OBSA 1XCTA 4CADB 3EYUH 2R56L 1H8OA 3RFZC 4OLUH 1JZ4A 2VDQL 3D25B 3BGMB 4AH2B 4XHJC 1U3YA 1NGXA 3QFJD 3MRMA 4DVRL 2UZIH 4JFOA 3BH8B 1G9NL 3MXVL 1BHGA 3DETC 3O3EB 4MVBC 1PQZA 4G8IB 5GQBA 2DQTL 2EDRA 2QSCH 1I1AD 1IGIL 2BVQB 2VUOA 4ERSL 2NY6D 4YEFA 3RA7L 3OR6B 5CWSB 4Y16B 1OSPH 1DBAH 3L6FA 3AC0A 4PY7A 2E6JA 3BQUB 1NQBA 5HYQB 1BZ9B 1P2CA 5GISH 5ISZD 1YMMA 3CZFB 3P4LA 1QQDA 5D5ME 3ECBB 1CXLA 5F89B 5B8CA 1DSFH 1U6AH 1GZQB 4P9HC 4YZFE 3IFLH 1TZIA 3F12A 3S88L 3B3IB 2VISB 4ZPVA 4PG9B 2HN7A 4RISH 2IAMC 5DLML 1C1EL 1JWSA 3WD5L 4JANB 3PHQA 2C1PB 3UJTH 1I75A 4HWUA 3RBGA 4JM2A 1KIPB 3C09C 5HYSA 5C0CB 1GCFA 4NJAL 4LGRB 4DEPC 3QG6A 2VZUA 3FQRB 4NCDA 3BISA 4KZDL 3F5WA 4OZIA 4PJEF 4JLRA 4LCIL 3OHXA 3ILQC 3BWAB 5BOPA 5HVFB 4LSTL 1CFQA 4PJXB 4GRMB 2Y5EA 2AJXH 1ADQH 4H20H 2JF1A 4KK6D 1TQBB 4FFWD 3IGAB 4UV4H 5D2LB 5EN2A 2EKJA 5EUKB 3C5SA 5C0FB 5SWQB 2BNQD 4X6EA 2W9EL 1DFBL 1SJEA 2AJ3B 3DROA 3VFSB 4M43L 4FQLH 5IVZB 1DVFA 5C07A 4OGAC 3F6IA 5D1QB 3T0AA 5SX5H 3DWTA 4FQJH 4LNRA 1FNFA 3CU7A 2AEPL 5E9DB 5T3XH 1EHLL 3VWKB 1BF8A 4U6HB 1LEIB 4R4BB 4WUUA 3BPCB 4JZNB 5JQ6H 3W5NA 1L0YA 2B39A 1QKZL 1GZPA 2VDRL 4RQQB 3VXTA 2X4PB 3WHE1 3MJ9A 2EZ0C 1KENH 4ODUA 1YQ2A 4L4TD 3TVMD 2HLAB 4A6YL 3LEVL 5M95B 1MWAB 2WBWB 3VWJB 3BKMH 2HWZH 4JJ5B 4ONFL 3THML 5CGYC 5ABDE 5HY9A 4JFED 1KJ2H 3RZWA 3STLB 3E6FB 3MLVL 1A9EB 1NMCC 1I85C 4LGSB 3W9EA 4HZAA 1DBJL 1NGYA 1UWGH 4MX7A 1VSCA 1MSPA 4LBEA 2CH8A 2XZQH 3RVWD 1CFNB 4FFVC 3LQAL 4EUPG 4MNGA 1IGML 1I7UB 2MNUA 3DOSA 1I4FA 4JY4B 5KVDL 4DUVA 2BP3A 1Z6JT 1TVHA 3BE1L 4GAFB 3JV4B 2ID5A 5D96C 4UDTB 5D7LB 2PW1A 3DXAB 3MRRA 2YPLE 4K55A 4G3YH 1E27A 3MBXH 1ZT4A 3IDXL 5D7SL 4I5BB 2DQIH 4YXKH 2W9DL 1T03H 1B88A 4KXZI 3MRLB 3IDYB 5E8NB 5ICYB 1R0AL 1M7DB 2F54E 3DV6B 2BFVH 2NYYD 3GI8H 3MBEC 3P11H 5E5MA 3C9NA 4P5KB 1FL6B 1UADC 5HHNB 2ARJB 2IALB 5DXWA 5D7JA 1QNZL 1MJUL 5CEZE 1Q8MA 4LLQB 5DRWB 4YHNA 5D1XB 5IFHH 2JELH 3FQWB 3RWHB 3LB6C 4FS0A 5TE6H 1OAYL 2NXZD 1AI1H 4WGVB 5FOBB 1OQXA 2R29H 3QHZH 5DQ9B 4MA7H 1EXUB 5C0ND 4MCYA 5DEGA 2ZCHL 1YC8A 4CN4A 2E7LC 3QDGD 1FNGB 4I18B 4JZJC 4XPHH 5FYKL 3QDJE 1K4CB 3HPJB 1JGDA 4QRUB 2YA1A 2HFFB 4JRYB 5DDHA 3OJVC 3PL6D 4LVOB 1CICC 5DA4A 1ZV5A 2A77H 1HH6A 2Q6WB 3L9RA 4Y2DB 4XBPB 3IU3B 1FJ1A 4YNYA 3BD4A 1KLGB 4OUUB 2FJGA 3TC9A 4R97B 2WBKA 2EC9U 1ERNA 4K3EH 4OT1L 4KRPC 5MP6H 4PB0L 1A4KB 2V5MA 5KOMC 3O4LD 1J8HD 4YC2B 3RWGA 1MELA 2X1PA 2Y72A 2EDJA 3BSZH 4JB9L 3QHFL 2OXHA 4Z7VB 4QKXB 2YEZA 1WBYA 3M07A 1SJHA 2G5BA 1ZKAA 3BJ91 3DX8A 1TVBA 3HFMH 5F7EH 4AQOA 3ORJA 5BCAA 4P46A 1UM5L 4Z7WE 2NX5B 2Z8VC 3KYOA 5DEFA 2F5AL 3HE6D 1A6UL 2J8HA 4NZRL 4WFFE 3OAZH 2HP4A 3VGFA 5KSAC 2EDWA 1NDGA 1OF2B 1KTDA 5IBLD 4OLWH 1OTUC 4D0BB 1X7QA 5E5RB 4P3CH 4TNVK 2DQDL 1OAXL 4MMZC 3BIAX 2ERJB 3A6BL 4GQ9L 5ICXA 4P4KD 3JV6A 3G6DH 3BEVB 1K5NB 3K3QA 1HKLH 4Y4FC 4ZO6A 5D5MA 1HINL 2A74B 3QUZB 4UV7H 3HNTH 2AJVH 3LKOA 5HHVH 4RGND 1IC5H 5HYIA 4O4YL 5H2BB 4L8DA 3QUXC 1BBDH 2PYFB 4U1MB 5FYJL 1KIUA 5JPMB 5JXEA 3BKCH 4H88L 2DBLH 1H5BC 2OL3L 3WJLA 4ZSOB 3F58H 4Z7UB 1YY8B 3PGCA 3IXTA 4YHYB 1Y18B 4BELD 1RVFH 1I3GL 4HH9B 2ATPA 1YNLH 3KYKH 5IB3B 1OARH 1F8TL 2PYED 2V9RA 5GRWA 2I60H 4YK4C 4MAYA 4NQDA 3VD3A 4P2RD 1NKOA 3SDXE 4RRPG 2DQJH 4M3JA 1CE6B 2GSIA 5I1DA 3HUJF 1DUZA 3DBXB 4LHUA 5H94A 5HDBE 1T21B 5IF0B 1CLOL 4PJ7E 3DMMB 3QT2A 4ZDHA 3L5HA 4GRLA 1OGTB 3Q1SH 4P2OB 5A3ID 3MREA 2UZYB 3FB6A 3HKFA 2A6KA 1GGBL 3AB0C 2JJTC 3D18A 4I0KA 4PJFF 3VD4A 1OL0A 5FYLD 1P4BH 5E6IB 2JJVA 5HDQL 4DKDC 5B4MD 2EE2A 3O2WH 5I2IA 3GK8L 5FYJE 2DWEB 3QJFB 4B0MM 1R5VB 3MA7B 3X3GL 3ZKND 4NO3A 4EI5B 4PJGB 2ZCLL 2PF6A 5KW9H 1INEL 3ULVD 1LO4H 3FO9B 4KRMB 3DHJA 4H0GA 3PWUA 4HWBL 4XPFL 5DJXA 3ZTNH 3FCTB 1N6QH 5GS1A 4QY8B 4OFDA 5DVKA 2R2HB 5GJSH 2BNRB 1A6VL 3GSNB 1UFUA 2QBWA 1DCLA 1RU9H 5DK0A 1SHMA 4EDWL 4XHQA 4V1DD 3O11A 1FVCA 1MCCA 1T4KB 1J0ZA 2XNAA 3GMMA 4YDKL 2Z92B 5I6XC 3GRWL 4UZGA 3OKNB 1EFXA 5ALCL 1VFAA 3FQNA 4J3OC 1S7VA 2YKLL 4F2MB 4I9WD 5C0DB 1V7MH 2H32B 1DN2A 4XC3H 2FDBP 5FK9B 2BY2A 2P8PB 5IB4A 3SGEH 3VFGH 3Q6FB 1BBJB 2FATL 4KJYA 2FD6H 2YPLA 1O7SA 4PJ5E 1QSZA 1G7QB 2CRIA 3P9LB 2A6DB 2DQCL 3UBXI 1MIML 4JRXD 5T1DH 4UAOB 4X80H 1U8HB 4ZTOH 5A16B 4QRSA 4QTHB 4YBLC 2F54A 3S98A 1ZGLP 2F58H 4Z76A 3INUL 3MYJA 3U0TB 2VLJD 3CPLA 1N3NA 3TIEB 3N1GC 3V95A 2ARWA 1U3JA 3DV4B 4OZFH 2XQBH 4H25B 3LKRB 1FZMB 3OQ3B 4H26A 1ZLWK 1I1AC 2ICEB 1U92A 4WJ5B 1J87A 3WLBA 2VIRA 1TETL 1QSEB 5HHQA 5I1CH 1A7NL 3VA6A 1HHGA 3HC0B 3MV7E 2HJKB 5IEHA 4JM4H 3SKJH 3HA0A 5T5NF 4OV5A 1LEKB 4DN3H 2ZJSH 3H7BB 3ZHKA 4F7PB 1GPOH 1T2QH 4AK1A 5EO1A 2P5WB 2FBJH 3E3QE 3MRGB 3CSGA 4JM2F 2IBZX 3FO1A 3RZCC 4TNVF 1HXYA 5T1LA 1F02I 3ARFA 4OZIF 3UO1H 3WE6A 2PXYB 2M1KA 4RA0C 3BMVA 4JFZH 1F4WH 5A43C 1U8OB 2XWJA 4IIQB 4CDGC 1XH3A 2CO6B 2WWKT 4L8SB 1YQVH 3BVNA 5E56A 5LXGL 1ED3B 4OI8A 1PSKH 1X5KA 5ENWB 1A5FH 2ZUQC 4XI5C 1SJVA 4HGWB 2G9HA 4E9LA 3DYMA 4Z7WA 3FB7B 5MHSD 3PGDB 2D7NA 3KJ6H 4Y88A 3T0XA 4KK6C 4FFWC 3CFJA 1FFOB 1OWRM 4ZXBD 2VMFA 2EIBA 1EVUA 4HLZG 2AABL 3V9FA 3PIQA 1LE5A 4NO5A 4PJAE 3RGVC 5IHUH 2IBBA 1Z3GH 4M6OH 4RCAA 2B1AL 1EK3A 4GKZA 2RCSL 3CFIC 3QQ9D 5C0BB 4F7CB 4J8RB 3LIZH 1I9RL 1DQDH 2DLGA 5JDJA 4HW6A 5HJ3B 3MCKA 4PJBE 1JJUA 3R0NA 3QQ4A 3ETBF 3ZDYE 5IBTH 1HXMA 4JQXC 1E28A 1T5WB 5JHLL 5L88H 1S7XB 1AE6L 4NNPL 5CJ8A 4CMHC 5KANI 5CJXC 2DLTA 1HDMA 3MOBL 4ZYKA 2AK4D 4KKLD 3O0RL 1N64H 4KK9D 4GOSA 4YBQC 5ACLA 3NCMA 4ZUWB 3CSYB 4XVUD 1AD9A 1EEZA 3QEUB 4H8WL 4K9EH 3WXVL 2AEWA 4X7CC 3MYZA 4F80A 5F1IA 4Y5YB 1A7QH 4UOW0 2DMBA 3WNOA 2X70B 2ZWLT 3SDXA 3C8KA 5CLWA 5DWUH 1MLCB 3LKQA 4X4YB 4Q9QH 4M93B 2W0KA 5I1JH 3MRFA 1BGXH 1N7ML 4DOHB 4LPWA 1JZ8A 5T1KA 4XAWH 3S4SB 3CFEB 4R26L 3V8OA 4HUUA 4JFFB 1DJSA 2ENSA 3DGCR 2DOCA 4WI4A 4S2SB 3ARUA 4ODSH 1YDPB 4FOMA 4HWEL 3QIBD 2GJZB 3NZ8A 5DMYA 1IL1B 4I77H 2ESVE 1RIHL 3I75B 3CK0H 2XWBA 5JIHA 1JHLL 2WV3A 3WFHA 2Z93A 1J1OH 1MHEA 4YAQA 5J1TC 2GJ6E 4XPAL 2DTSA 4D9LH 1L9NA 1FNSH 3I6LD 3VFMB 4HIHB 3ARGA 3SE9L 1OD9A 2BY0A 1QBMH 3T0EB 5CD5C 1F3DJ 1S78D 2YC1A 3MACH 5EPMA 2LVCA 1HYSD 2F53E 2UZXB 1OSZA 4KPHL 4NDMB 1X5FA 4KQ3H 5HGHB 5E7FA 2CGRH 5AAMA 5DUPH 4DGVL 1NBQA 1XR9A 4KVCL 4TSCL 1BWWA 1WIOA 1JCKA 5J6HB 3EJYC 3SGKA 5FO8A 1AQDB 5GS0H 4O9HH 4X0KA 4JG1L 1BVKB 1YN7B 3MOQA 4LLDA 4RFEA 3IF1B 4AEEA 1QLFA 3ARZA 3H9SE 1BAFL 5D8JL 4D0CA 4LEOB 1WC7A 1D6VL 2QKIA 4RGMC 4ELKA 2MQCA 3GSUB 2Z8WC 4PJ5A 3WIIL 3NCJH 1YEHL 4EUPB 4L4VE 5B21A 1FCCA 2BSSA 3QCVH 4XPGH 4G9FB 5BZWA 1PKQB 5AUMA 3WN5B 4YDJA 3X13A 4M6NL 3K4ZA 5IIEB 1F2QA 2JK5B 2A6JB 4O02L 5EWIL 3BUYB 3ARQA 5EO9B 4ZFFA 5LAXA 4GUPB 3EZJB 5LWYH 3WFDH 1GVIA 4HX1B 3HE6C 2JJSC 4HKJA 2J4WH 1ULVA 4LDEB 4KI1A 4XVSL 1QSVA 3ZKXC 4PJIB 2V5YA 3H9HA 5D5MF 4OZFG 1AGCB 4D94A 3CJJA 4PG2C 5HI3D 2DMCA 4PD4K 3EW3B 4NN5B 1IM9D 5CHNB 5KSBE 2R9HC 3OGCB 4MD4A 2BSED 1X5IA 3MV7A 4LMQE 2VDMH 4AENB 2GTWA 2I9LA 4NGHL 1D5MB 5I66A 3OKYA 2X7LB 3L5WA 2R69L 4UNTA 1FG2A 1HN1A 4RGNC 4MLSA 3V5DB 5SWSB 4J7RA 1Z9LA 4PRIE 3UJIH 4UU9A 3LKPB 4M7LH 1SEBB 2H6PB 2P5EE 4O58L 1HH9A 4RMRA 1T1XB 2VWEC 4QWWD 3BH9B 1KCSH 4K71C 1S9WB 3QDAA 1YEJH 2Y36L 4L8CB 5FDYA 4PJCF 4PR5A 2IQ9L 5L6YL 4QRTB 5I19H 4G6KH 2RFXA 1AGDB 1FGNL 2FHBA 4GMTL 2I07A 2FJFB 3QUMB 1YEDA 2VAAB 3TIDB 5E2TH 3O6KL 5TDPB 3MLSH 4NBZB 4PB9H 3O41B 3GMQA 1QTYT 5F3BA 1C7SA 3TBYA 5KSUB 1P1ZA 5BVJA 3AS2A 3LRGA 4JCLA 2AJYL 3NCYP 5GIRB 2IC2A 3OJ2C 1JI2A 1FFQA 4RMSA 1I9IL 4XNZC 4XH2B 1I9EA 5GGQH 3M8OH 5A3IC 4KUZH 3TT1H 1MCKA 5BZDA 4NUJA 3N50A 4PJAA 4TVPD 2ADJA 4FABL 1K2DB 3U36B 1RJZB 4I0PB 5JHDE 4KI5C 1NCTA 4M8QB 4XPTH 5CP7A 3TLRA 1YY9D 3IVKB 1T83A 1ZLWH 3U1SH 3L3HA 5DUBB 3ZKNC 1CG9A 2IPTL 3DI2B 4N9GA 1OP3K 4PJBA 2XA8H 2Z8SA 5L8LB 1W0YT 1AH1A 4GBXC 2HKFH 3MO1B 4LIQH 2Q8AH 2FGWL 3SKMA 1KG0B 2EYRA 1RUML 4JPKH 2VR9A 1NANH 1K4DB 1SYSB 1D5XB 5IVXE 3SCMA 3GNMH 4ONHB 3FT3A 3SDAD 2J8UF 3WO3B 5D71H 1BMGA 5MENB 4FTVE 2H8PB 4FQHA 3RVVC 4Y1AE 1CTOA 2B0SH 5D70H 4L3EA 1VACA 5DK2A 2Z31A 2ZG3A 5ITFA 1N4XL 3LD8B 1T1ZB 5AG8A 4OZGA 1BP3B 1P7KB 1CDYA 4Z0BL 5DJDB 2XN9D 1IZJA 1DE4A 4ISVB 4DZBB 3SBWA 4CMMA 3MLPA 1CD0A 2W0LA 4WTZG 2DLFL 3OB0K 3PDOB 2AV1B 4KKNA 4LSSH 1T5XA 5EU5B 2OR8A 1IGFH 3QBTB 5E5UB 4BH8A 1WUNT 4NKIH 5D1ZC 5JW4Q 4NQSB 4Z95H 3LPFA 4NRYB 3BPLC 2AJUL 3RNKA 1A02N 3WNKA 2J5LB 1JYXA 4XP9H 3PXJA 1YEEL 3L3KB 1XF5A 3N1QC 3H3PH 3K4DA 2V2TB 1UWEL 3NFNA 4DCQB 1S5HB 2FR4A 4FQQA 2KH2B 2ESVA 3FAXA 5KSVA 4YUEH 5EA0L 5T5NG 3KS0H 4NFCA 4H1LA 1W0VB 5F1SA 5EZOL 5E08H 4GW4A 2R56H 2GJ6A 2LE9A 2XZZA 2X4UB 5C71A 4NN6B 1DQQB 1B0RA 4Q2ZA 2YXFA 1OAQL 1XCQB 3SKUD 3EKCA 3G5XA 1WK0A 4H0HB 4DVRH 3PNWB 1IVLA 1G0DA 1FL3B 1G9NH 1M4KA 3MXVH 1WFUA 4YHLL 4XCFH 4EQ2A 1RURL 1U8PB 2BY3A 2DQTH 2WWMD 1IGIH 5KG9A 4ERSH 4ZNCD 2F53A 3LQZB 1R6VA 3RA7H 5J4MA 3HE7A 3MRHA 3NA9L 1EZVY 2BX5A 2VQUA 2E8YA 5GSVA 3VXSD 2XI9A 4MA8L 4B7LA 3QEHB 1EBPA 1JP5A 2C3WA 5FXCH 1G7JB 1Z5LB 2EIEA 1KJ2B 1AC6A 1MFCL 1J0YA 5BXFB 5CEXB 3S88H 4Z7WF 3H9SA 4Z78B 3U6RA 5HTSA 1ORQB 4R4NC 1AIFB 5DLMH 1C1EH 1X5XA 3WD5H 4LLVA 4G6FB 1CXEA 4WW1B 4YWGL 1F11B 3KPSD 4OCSL 5DGRA 5SV4A 5FB8A 4NHUA 4MXQD 3B43A 1DR9A 4N1HB 4NJAH 2YUXA 4KZDH 2YHGA 4J1UB 4LHJB 1QR1B 4LCIH 5IQ9B 4ZXBC 1F58L 4X9GA 3L5XL 5L0QC 1NPUA 3N85L 1ZLUK 1UXWA 4LSTH 4ZAKD 4OAWA 4MDJB 4QNPF 3ARBD 5KSBA 1JGVL 1AGEA 2W9EH 1DFBH 1DQLL 4WU5A 3LSOB 1QLRB 4M43H 3KLHD 5IV2A 2XTLA 2HFEB 5HHMD 4KKAC 3BRDA 2WLZA 4IRSA 2VABA 2OTUB 1DN0A 3TJHD 1G6VK 3OAYK 3TZVA 5IKCB 1XIWC 2YBRB 4PRIA 4Y4HB 4U7SA 1EHLH 3TEUA 4MA1B 5IFJA 3BAEL 4BQBA 1CXKA 4XCCL 2P5EA 1MH5B 3G6JE 4JO1L 3SDXF 3EOBB 1DEEB 2VDRH 3VI3E 1NCAL 3O3BB 3FO0H 4UDUA 4KK9C 5HDBF 3REWB 2CRMA 4GAGL 4PJEB 4PJ7F 4RFNB 4A6YH 3LEVH 4M1GL 3TA3B 4WI3A 4ONFH 5ALBL 4ODXA 3THMH 1T0NA 2Q7NA 4JKPL 2BVEA 1V3JA 1BZ7B 3AU1A 3MLVH 1BJ1J 3DO7A 1DTUA 3CC5B 3U46A 4K8RD 2OI9C 1DBJH 1PDKA 1G7PA 4HUNB 4PRPE 5DK3A 4X6CA 3LQAH 3FOLB 4UILL 1IGMH 3QRGH 4NN7C 5ANMB 3VXPB 5KVDH 4JFPA 2KZWA 3ZT6A 3BE1H 4PLKD 3KPQB 4XNXL 5C9KA 1T0MB 2AJZA 4D0DA 5IMOA 5JHDA 4OCXL 2WINB 4LVEA 3WV0A 3ZLQC 4XZUA 3QXVA 3ARDA 5HHOE 3U82B 3O3AA 1PG7X 2BVTA 3C5JA 3UDWA 3PABB 5D7SH 4QHLB 2R1XA 2ED7A 1R0AH 1NDMA 3TO4C 1W2KT 2WK2A 2VC2L 4AEHL 3DUUB 1JV5A 3ULUL 4P2OD 3TNNB 2AV7A 2DB8A 1QNZH 5IVXA 4UTBL 1NEUA 1WF5A 3KWWB 3MXWL 1S78C 3H3KA 3ROLB 1YUHB 4FTVA 4LPUA 2GSGB 3LKSB 1HYSC 4Y1AA 1A4JB 1Q72L 3BGFC 1P7HL 1OAYH 4IRJC 5ACMA 4FXLA 1WICA 4ZFGL 4MSWA 4OLVL 3OKKB 2ZCHH 3CH1A 1K85A 3VE0B 3I02B 2QL1A 4R96B 4JRWA 5FYKH 5GRVL 1MJ8L 5C0AD 4Y4KC 3FO2A 1FZOA 1RHFA 4X5XA 4O51B 2OR9H 1KCVL 3NN8B 2BHYA 1QFWI 3SDCC 1Z2KA 2Z91A 4NNYB 4TOYL 2J7LA 2XKNA 5KJRL 4QOKB 1JZ7A 4G6AD 4P3DA 4YDLC 5BRZD 4HUVA 2GUOA 5JNYB 5CEYB 4MDIB 4OT1H 4PB0H 5DHYB 4PD4J 4BH7A 3OGOE 1D9KC 2YR3A 4PGZA 5DQDL 3ARVA 1B90A 2VITA 1CDHA 2AK1L 1MEXL 4YO0B 4EN3A 3QH3A 3QHFH 3VFWA 5C7XL 3ULUE 2ENYA 4RAVB 3FQTB 5F9WB 4YR6A 5FA4A 4R7NA 1LD9A 1M7IB 1JL8A 4OGXH 1UM5H 4LSRL 1R3LB 5HI3C 2CKBL 4G42B 1I7ZA 1CDBA 1D5IH 2CDFA 2F5AH 4J4PD 5JMOC 4KDWA 1A6UH 3LOWA 3UAJD 4JFXB 4NZRH 1KFAL 1IGJB 1WISA 1HIML 5E1AB 4I4WB 1NUGA 1T2XA 4OF8A 1OP3H 2X9XA 3BP7A 4U6VL 2A9NL 4BJLA 1WGOA 1CT8A 4GXUN 2DQDH 5C6TL 2X89D 1OAXH 3A6BH 4GQ9H 3GMLB 5B38G 3FT2B 1JYNA 5C08B 3CFKA 2FO4A 2C1OB 1R3JB 1BX2B 4U1IA 1WWBX 1HINH 3IJSA 2LQRA 3VFTA 1MCWW 1FDLL 3VRJB 1LEGB 4ETQA 1W0WB 2R0ZL 3GSVB 4BK4A 1PKOA 3QPQC 4FQCL 4O4YH 4NKOA 4XBGB 4I0CC 5FYJH 4DTGL 4Y16C 3HMXL 3H7LA 4H88H 1QBAA 1QSED 4GSDL 3BQUC 2OL3H 1GOGA 1EEQA 1T1WA 3BPOB 3LPGA 3QUYA 1I3GH 4U1JB 3SE8H 4ZFOA 2CLRA 1F8TH 5D7JD 2XPGB 3JWDH 5JORA 4UNVA 1CFSA 3PV6B 4TUOB 4OF6A 4HK0A 1OOAA 5HGAB 4XWGL 2GTZA 3HR5B 1DLHB 4PJBF 1HOCB 5DR5L 3LDBB 1EX0A 1MREL 1A1OB 3TN0D 1DUYA 2NY2B 3G5VB 3QJHB 5EU4A 1I3RA 5DI8B 5E00A 1ZT7B 1GGBH 3W9DB 4X9BA 3DVNA 4OZFB 3P73A 5EULV 4JREC 4J3TA 1A8JH 5HDQH 3GHEH 4RNRB 3ILPA 4PRHE 1FYTB 4CVXA 5KZCB 3GK8H 1YZZA 1TQBC 3IFPB 4N0YL 3K80A 3Q6GL 1DQJB 4ODTL 3X3GH 1UH3A 2ZCLH 3SDAC 4G7VL 5D7IE 3G6JA 4EOWL 5CJQL 4HWBH 5FM5O 5D1QC 3G6AA 3D3VE 5F1KC 1HHKB 4XPFH 3GBNL 3GIVA 5JIKA 5HYJB 5DJYA 2ZUTA 3FZUD 5FEBA 5ESQB 1A6VH 3VWKC 3KLSA 4L1HA 1D5BB 1U95A 1XGPA 3SDYL 4EDWH 1RULH 3RTQB 5INDA 1S7QA 3C60B 4YHKL 4YDKH 4YHMH 1OT2A 3GRWH 4IOFD 3KPNB 5DQJA 5ALCH 1N5AB 1TCMA 2C3XA 4PRPA 4D3CL 3ZSSA 2XWTA 5JPNB 1G7MB 2YKLH 4PJFB 4I48A 5HPOA 1Q94A 3JV0A 4U1LB 4XCNA 1IGYA 3EO1B 3MV8E 1T3FB 2IAMA 3MJ7A 5IK3A 1MCQA 2FATH 4MCZA 2FEEL 2RHEA 1MLBB 3LMJL 5HHOA 1UEYA 1WZKA 3NCBB 5LBSL 1A47A 2DQCH 1NCDL 1GSMA 1MIMH 2NY5C 1OY3B 5JXED 2FYYA 1IAOA 4CNIB 1JMZA 1AXSA 4WTXA 1H3PH 5C9JA 1HI6B 3G5YA 1MPAL 3D85A 1PZUB 1UCBL 4JFFD 4JVWA 4UQ2B 5FHBL 4P59L 4JY5L 1HHJA 4HFUL 4K7FB 3OAYH 6CGTA 3JTTB 4MS8C 1IGTA 3IDYC 3V52L 5I8EB 4NQDD 2MTPA 3T09A 2GK0A 1TETH 3QCTL 2X2YA 1A7NH 3RKDC 1KCUL 4N0CC 5D93B 1XCTB 4LHUD 1PZ5B 3TPUA 3C5ZA 5D1XC 3O8XB 2ZUYA 3LRSA 3EO0B 1NGXB 2AEQL 5AYQA 3C8DA 4HK3N 4JFOB 4J6RL 2VZVA 3T8XA 3MOAL 1IEBA 1PQZB 1U8NB 4POZC 1KB5L 2WM0A 2B5IB 4BK5A 4I18C 3KPRE 3L6FB 1VESA 4Z0XA 4LQFL 3IDGA 3BDYL 1S7UA 4NSKA 4UTAL 4RX4D 1HNFA 4LVOC 3C6LB 5KSBF 1WQVT 1YMMB 3QEQD 3SJVB 4HIIA 1G84A 1B3JA 1QQDB 5LXGH 3VGHA 5T5FL 3NFPA 5B8CB 3OKEA 4R97C 4JFQA 3UTPD 5I16A 1MAKA 4JFHD 2P42B 1I85A 5ID1A 3S36X 2PCPB 4ZPVB 3TO2A 1FNAA 3Q2CA 1NBYB 2HFGL 1JWSB 4YC2C 1TFHA 5EDXA 5MERB 2AABH 2R2EA 3QNZB 3UX9B 2GT9A 2QQKL 1AKJA 4G9FD 1FLTX 5JO5A 3TBVB 4QHNA 4U1HB 4AEFA 4BKLA 2B1AH 1E4JA 1DLFL 5FHAL 3WFBL 4ELME 2RCSH 3E6HB 4PLJD 3LS5L 5J56B 1F6AB 3MROB 3OHXB 1I9RH 5GRJL 2PNDA 3QWOB 5BO1L 3MJ6A 2B4CL 4LARL 3QFJE 3HI6L 2D0FA 3MBEA 4KUCF 3C5SB 5JHLH 1GL4B 2ERJC 1U93A 4H1LH 4X6EB 3RWEA 1AE6H 1SJEB 4NNPH 5EU7E 4ZTPL 4XNQB 2RB8A 3QG7L 1DVFB 4XNMA 5C07B 3IDMB 3MOBH 2F54D 1QA9A 3QUZC 2XG5A 3O0RH 1N5YL 1C16B 3FT4A 4H8WH 3WXVH 2BMKA 4NKMB 2EDFA 5CEZD 2CKBA 5ISZE 4W70A 3E2HB 2E7LA 3CXDL 4WUUB 3R06A 4JZJA 2UVEA 4P5MA 5TJWK 5EBWB 3EYOB 3CXHK 1TJGL 4KDTA 5FF6A 4FQIL 3VXTB 3VRLF 4YHYC 5DD6B 5CBEA 4P57A 5D2NB 1N7MH 2GAZA 4R26H 1BF2A 3O6FD 2EYSB 4MJ5A 1EJOL 4BFBD 1NBVL 5EZJB 1G6RL 5IVXF 3P4OB 2G5RA 5BV7B 5DJ0B 5T1LD 5DMGD 5FUZL 4JFYA 1NGYB 5J12B 4PRHA 3PXHA 3DMMC 4OZHB 4D9QD 1RIHH 4PV8A 4W6YB 1ZOXA 2HRPL 1SBSL 4E42B 1RMFH 1JHLH 4GLRH 4P2OC 1CU4L 4MNGB 5ESAA 5JOPD 1GOHA 4NQTA 3PQYA 4PP1D 4XPAH 3TCLB 1KBGL 3QYCA 5D7IA 4EDXB 3D3VA 5E6IC 4OKVB 1VA9A 3SE9H 4UUJB 5IEKA 3MRRB 3TNMA 2HFTA 3ZYZA 2MCPL 3PWVB 4NRZA 5J89A 4K3DL 4EI5C 4YXLL 4WO4B 2XIDA 1J7VR 4X7SL 4EVNA 2AKRA 4BQCA 5I1HL 4YHPB 4DGVH 1UCTA 3D69B 4KVCH 1UM6L 3C9NB 4TSCH 4Y4FA 5FDWA 5DZLA 2W9LA 5JOEA 4D9RD 3UYRL 3GMNB 5CJOL 3PV7A 1II4E 4G6AC 3QUXA 2IJ0C 3B8YA 2PTTA 1IEHA 4JG1H 1XZ0B 2OP4L 2ZUWA 2FIKA 1EMTL 4DN4L 3MV8A 4NO0B 3OKLB 4PBWD 4L4TE 1BAFH 2PO6B 5D8JH 3RNQB 1D6VH 2XG4A 1XGRA 5FM8A 4J3VA 4LU5L 3WIIH 3KXFB 4FFZL 4JFEE 4NFDA 1LP9E 5E8EA 2Q76A 5C0IA 4NC2B 2X42A 4O02H 2EH7L 2PW2B 5DD3L 5EWIH 4AJ0A 3L9RB 1IJ9A 2NZ9D 4ZQKA 4KQ4L 4KHTL 1URLA 4J4PC 3MRIA 4JCMA 3F6LA 4X4ME 4XVSH 3ZL4L 1FGVL 2CLZA 3HB3D 2MQ3A 2C4FU 5DFVD 3EYSL 3VXUD 2Y06L 1VADA 5FA3B 4R90L 4UAOC 1CFBA 1JF1A 2AXGA 4G8GB 2E27L 1LDPL 4K2UL 1KT2B 2YEZB 4P4RA 2MQ0A 2JJTA 3M1BA 4NGHH 4TUJB 2CLVB 3WIHL 3L7EB 4X7FC 5IWLC 2R69H 5EIIB 1S7RB 1OAUL 1KV3A 1RUAL 5T1KD 3KYOB 5DEFB 1U8QB 1XGTB 2LFGA 3TWCL 1NC2D 4WU7A 1NDGB 3LN5B 1KTDB 3GGWA 1QFUH 3OMZA 2C4XA 4EEEA 5JW5B 1X7QB 5BS0A 2VLLB 3KPRA 5GRVK 2Y36H 1T04B 4PFEA 3JV6B 5L6YH 3CMOH 1D5ZB 4QTIL 5HHPB 1FGNH 3DX7A 5D6DA 5DRZA 4PLOB 5D5MB 4Q6IA 2A6IA 3S3SA 3NACL 3QDGE 3SDDD 3LKOB 3O6KH 1BQHA 2PXYC 1MI5D 3LN4A 3MRDA 5KN5A 3IJHA 5GRZA 2AJYH 3TN0C 4IIQC 1I9IH 4L8SC 3D6GA 5J1AA 1H3VA 4WNQB 4HWZB 4QXUL 4PJ8B 4KH2A 4FABH 3G6JF 3O4LE 3SE3C 3VJ6A 4QT5A 1J8HE 4HUWA 4L9DA 4CJ0A 3VI3F 4ELMA 4NUGL 4MAYB 1T66D 1RZKC 3LKNB 3WDIA 2B2XL 2A9ML 2MCG1 2VR4A 3MUY1 4WHYH 2GSIB 3RIFK 1CXHA 3EFFA 4MNQE 1DUZB 2IPTH 5F3HA 4PJCB 3J7HA 1KB5A 5E1HB 2FGWH 4PJ5D 1RUMH 2N7BA 5DJ6B 4F9LA 3FB6B 4N68A 2A6KB 4H1LG 3WS3A 5CZXD 4NP4L 1I1AA 2AW2A 4Y19B 5ECJE 2B20A 3WKML 5DUML 1YJDC 5I2IB 5IGXL 1CDIA 1N4XH 1E4XL 1KNOA 5ISZA 4F7EA 2D9CA 3T4YB 3GMRB 2XV6B 4Z0BH 1CYGA 3IS1X 2DDQL 1FRGL 5EG6C 2X9WA 5FYLL 3PHSA 1X5JA 4HD9A 2DLFH 4RGNE 1FVDB 2NY0B 5SWZB 3RZCA 3QO1B 3PWLB 2VXQL 4DGYL 5IJKC 4IDLA 3EDKA 4KGJA 4LOUC 5GS1B 3BN3B 1FLRH 3STZB 2I5YL 1FNEB 3T2QA 3TYFA 5ID0A 4P99A 1QVOA 4GW1B 1J1PL 3P77B 3ULVL 4X6BA 2AJUH 2W65A 3B9EA 4Y5YC 2VWEE 2X4QA 1YEEH 3MUZ1 5DK0B 2DS4A 4UOJA 2CMRL 3RWCA 4LASL 4K3JH 3HZYA 1UWEH 4NRXA 1RZFL 1CR9L 2IF7A 2XNAB 3X17A 2XA3A 2HVKB 5JLZB 3UZVB 1OAZL 2Z4QA 4ZFZA 4M93C 2WLYA 2C7UB 4KJQD 1EFXB 2NY1D 4S0TD 2J8UB 2NR6D 5EA0H 4P2RE 1VPOL 3B9KB 4ZUVA 3CFCL 3EHBC 5EZOH 2YRLA 4NWUL 2ATKB 1GC1L 3CLEH 3FFDA 1MCEA 4NT6A 1OAQH 3VFPB 4KJYB 2AXHA 1TZHB 1GGCL 2ITDA 5F7DA 5BQ7B 1TIUA 4YHLH 1MCJA 3ZHDA 1RURH 3RGVA 4X4ZA 5FYLE 4LQ1A 1P7QB 3JWOL 3ZYOA 5AD0B 2FHCA 5FO9B 4NJ9L 4Z76B 3MGTA 1H15B 1VFBA 2R0KL 5EU3B 4UT7L 4OD2A 5FKAB 3O45A 4MA8H 2X09A 4A6YB 2XFXA 5ILTL 3T0EC 4PGDA 3ULVE 3ULUF 1M05A 4JHWL 4PBVC 3K0WA 1IQDA 2P24A 4YPGB 1G6RA 4JQXA 1MFCH 1GJIA 3ZT7A 3HG1B 5CSZA 3DRTB 4LSPL 1ZGLB 1R3HA 4DUXA 1NUNB 2PTUA 5DTFB 4L4TA 1HHGB 1FAIL 3UXFA 5CJXA 1RIUH 1R3IL 1MFAL 4YWGH 4OCSH 3DIFA 5IW6A 3FRPG 3OXSA 3RVXD 4C56E 3VRIA 3QDJB 5EO1B 1FVEA 2R2CA 4V1DE 2F74A 4MQTB 3FO1B 4MZ2A 5EZLB 4ORGB 2W60A 3ROOA 1FH5L 2ITCA 1EIBA 4HHAA 3LEXB 4FXGA 5E94B 2WUBH 3KLAA 1MCBA 1U41A 4HUKB 5EBLA 5F9JA 2VDNL 4X4MA 2IMMA 5BJTA 3VGGA 1F58H 2LVEA 3CUPB 4YGVA 4L3ED 4PREA 3IETB 1ZVSB 3N85H 4FZEH 4JDVB 3K1KC 1ZHNB 3WUWA 1A6PA 3WN5C 1SQ2N 2ZNWA 4M6ML 3NGBB 1JGVH 3BX7C 4WWKB 2OSLB 1DQLH 3V5HB 1X3DA 4JRXE 1LGVA 4WI9A 2G9HB 3SPVA 1A3LL 2QR0A 4Z7WB 4M9OA 3D0LA 1QSFE 4Z8FL 2OQJA 1FZJA 2VLJE 4NN5C 4D2NA 15C8L 5IJVA 1BIIA 1H3TA 3PIQB 5I17A 5I15L 5EUOE 1CDGA 4XCCH 4LAQL 3RWIB 1EGJA 3C2AL 3CXHJ 1XGUB 3RU8L 4MQXC 4WI6A 3RIFF 1YNKH 4NQUA 1NCAH 3HRZA 4X8JB 5H37G 4GKZB 4HIEA 4HXBL 2Y1VA 4XXDB 1IC7L 1NAML 2WIIA 5C08D 3QNXB 4M1GH 4WFHE 1R5WB 2K3TA 1VEOA 5EOTA 3QDGA 4U2ZA 5E8PB 3WL9B 1KGCE 3ZT5A 1F13A 1IILE 2K1MA 4Q97A 1HXMB 3D39B 3VXMA 3PL6A 3HHRB 1EAJA 2YN5A 3BEWA 3HI1B 3RAJL 1E28B 3WO4B 5C0GB 3UEZA 1A6TA 1C5DA 1CGTA 5ADOL 2P7TA 2BK8A 5FV1L 2WMPA 3KGRA 4UILH 1HDMB 4F8QA 5ADPL 1FNLA 3O4LA 1EEZB 1VGKB 2C5DC 3PP3K 1J8HA 3BYTA 4XNXH 5TQ2L 4OCXH 5F1IB 4GLRI 5DJCB 1NEZA 3MLUH 1HHIB 1U8KA 3TJEL 2OZ4A 2EDNA 3SDXB 5FYKU 4ZODA 3C8KB 2IQAB 3LKQB 4LF3A 1RUPL 2R2BB 4MNQA 4KKCD 1U91A 4PP1C 2OJEB 4WHYG 3M17A 4PJ7B 3S5LA 5MHSE 4OGZA 4HUXB 3RX7A 2VC2H 5D4QA 4AEHH 3HE6A 1KJMA 2JJSA 4LDOB 3ULUH 4I0PC 3TH3T 5I18L 3IDUA 3NZHL 3BRFA 1IAMA 4UTBH 2XTJB 1ZA3A 3MXWH 4PG2A 1CE1L 1Q72H 3NZ8B 3QNYA 1FYTD 3GI9L 5KZCD 3P4MA 1XR8A 4ZFGH 3O9WD 3WXWL 2Q8BH 2FECI 5IW3A 2OL3B 1N26A 3DUSB 1MHEB 5C0EB 4KKBC 3O6ML 4MJ6A 1PFCA 3QDME 1BFOA 3N06B 4RAUA 3FB5B 1BOGB 1RAMA 2QEJA 3UROR 5KVFL 4HKBB 2FH8A 1KCVH 5FM5M 2Q7YB 1E0OB 1IAIL 3V5KA 3DRQA 4TOYH 3LD8C 2DL9A 1G9ML 4P5TB 5KJRH 2P8MA 4QGTA 1S8DB 3VFOB 4IRSD 1MQKH 5EPMB 3FRUB 3KR3L 3GSRB 1OSZB 3D0VA 2AK4E 4NQED 4ZUSB 3RTQD 4QRQA 3VG0L 5J3HC 3C60D 2Y23A 1FORL 1I7RA 4PRID 1A7PL 1FE8L 2RIKA 1XGYH 1MEXH 2NZ9C 3KPPA 4TUKL 3QXUA 2P5ED 3PGFH 1JNLL 3BZ4A 3ARXA 5FO8B 1WWAX 4PRDA 2J5LC 1W8NA 1XF3A 1J05B 1JGLL 4AT6B 4OIBA 1DBKL 4LSRH 5DFVC 4CU6A 2CKBH 4TTDD 3W81A 1C08A 4D0CB 1WC7B 4Q58C 4ELKB 1OWWA 4NQVA 1U9KA 4NFBA 1H8SA 2QADB 2Y25A 1KFAH 5B39A 3NFSL 1TCRB 1LK2B 2BSSB 4PJ9B 1A1MB 5A2KH 4HJJL 2A9NH 4LSQH 1QRNA 2L0DA 1P4IL 4NN6C 3RDTB 5C6TH 3W0WD 4ZFFB 3GB7B 4D8PA 1IEAB 2C3VA 3CX5K 1RZGA 4LP5A 1RUKL 1U8LB 4F3FA 1INDL 3SGDH 2YPKB 3MZTA 4LVNB 1FDLH 2R0ZH 4FQCH 5FV2A 4GBXA 5JHDD 1AC0A 3I6LE 2I27N 4DTGH 3HMXH 4MD4B 4IOSD 4JPIA 2RJMA 4GSDH 3MV7B 1V7NH 2FH6A 4YHOL 2GTWB 3DECA 4C56A 3SDDC 4XGZB 1A22B 4LLYA 4V1DA 3RVTD 3C2SA 3LV3B 5AAWA 4LPCA 4XMPL 4ELMF 1WTGT 1UZ8A 5L7XL 1HH9B 3P9WB 4Y1AD 1GHFL 3VI4E 4XWGH 4MJ4A 5DR5H 1MREH 4PR5B 4NCC1 5D1ZA 3RWFB 4PYGA 5HSFA 5HVHB 2I07B 3X14A 3I3EA 4P2QD 3DTXB 1DQML 3QUKA 1S9VB 4JRXA 4UT6L 1MJJB 5BMFL 3GMQB 1OLLA 5DO2C 4S1QL 3VFNA 3DVGB 1P1ZB 3OSKA 5BVJB 5GSRA 1QSFA 2VLJA 1QG3A 3CNKA 3EYVB 4N0YH 1RD6A 3Q6GH 4ODTH 1T80A 4I3RL 5EUOA 5TE7L 5CZXC 4G7VH 1H0DA 4L29A 4BQ8A 3L3DA 4EOWH 1JZ5A 5CJQH 1L0QA 3WEXA 5T3ZD 2ZZUT 4L4JA 5GJTL 3GBNH 2V17L 3CDCA 3UTTE 5J06A 3RY6C 4KK8C 4Y4HC 3HC4L 3L3HB 3VD5A 4TVPL 4MA1C 5A2LH 4PJBB 5HDLA 1SEQL 3SDYH 4RIRA 2ZCKL 1T1YB 4NKDB 3T0VA 4YHKH 3CMGA 1F5WA 4RWHA 3SKMB 2EYRB 3V4PL 2GITA 5EBMA 4RFNC 5GGSY 4D3CH 3SCMB 1FO0L 3K8KA 2A73A 3TA3C 1MVUA 4FQHB 3BZFB 1BVLB 4WHTA 4PGEA 5DK2B 2O93L 3UPRA 3QAZB 4ZUUA 2Z31B 5TH2A 2QSVA 4KU1A 4PGCA 3VGAB 4DVBA 2DQHL 1WAAE 1VKXA 1DE4B 3LMJH 1VHPA 4XAKD 2MKLC 3W82A 2NR6C 5GZOC 1F6FB 1CD1B 4F7MA 4P0DA 5FKPB 4K3HA 1UB5A 5IMLB 5LBSH 1WFNA 5GGRB 3ZZ1A 4A2MA 3KYMA 3UC0L 1T20B 1F2XK 3QPXL 1ZEAL 1MPAH 2V2WA 4QHMA 1Q0XL 4BH8B 1UCBH 4ZXBA 1NAMA 3IFOB 3QUYD 5F7YC 5K9KB 4OFIA 1XGQB 2HMID