2AQNA

Cu/zn superoxide dismutase from neisseria meningitidis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
155
structure length
155
Chain Sequence
b'ASIEVKVQQLDPVNGNKDVGTVTITESNYGLVFTPDLQGLSEGLHGFHIHENPSCEPKEKEGKLTAGLGAGGHWDPKGAKQHGYPWQDDAHLGDLPALTVLHDGTATNPVLAPRLKHLDDVRGHSIMIHTGGDNHSDHPAPLGGGGPRMACGVIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title CU/ZN superoxide dismutase from neisseria meningitidis
rcsb
source organism Neisseria meningitidis
molecule tags Oxidoreductase
total genus 40
structure length 155
sequence length 155
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2aqnA00
2WYZA 1U3NA 3L9YA 3K91A 3HW7A 3ECUA 3T5WA 1JK9A 2AQTA 4L05A 2LU5A 2XJKA 2WKOF 2WWOA 1YAZA 3KBFA 1E9PB 4B3EA 1F1DA 2V0AA 4BD4A 3H2PA 1B4TA 2SODB 3QQDA 3S0PA 1SXZA 1JCVA 1SPDA 1SXCA 2JLPA 1OZUA 3CQQA 1XSOA 2C9VA 1F1GA 1ESOA 1E9QB 2AEOA 3F7LA 2WWNA 2ZOWA 3KM1A 4A7TA 5KBLA 2Z7WA 3MKGA 2WKOA 1DO5A 1RK7A 1SDYA 1E9OB 1SXBA 3KH3A 1EQWA 4MCNA 2ZKXA 2GBTA 1SOSA 1F1AA 1OEZW 4N3UA 2Z7YA 3GZOA 1AZVA 4A7GF 2APSA 1JK9B 1SXAA 1IBFA 4U4IA 1SDAB 2VR6A 1UXMA 3ECWA 3GTTA 3QQDB 3CQPA 1B4LA 1PZSA 2AF2A 2WZ5A 3MNDA 1S4IA 1HL4A 4A7GA 2GBUA 2K4WA 2VR8A 2WYTA 1Z9NA 1TO4A 5CU9A 1Q0EA 3RE0A 1P1VA 2AQSA 3HFFA 4OJAA 2AQNA 2JCWA 2C9UA 3KH4A 3LTVA 2AQQA 4A7VA 1IBBA 2ZKYA 3KBEA 2VR7A 1UXLA 1F18A 2Q2LA 1OAJA 3PU7A 1QUPA 1DSWA 4OH2A 1BZOA 2E46A 2XJLA 1IBHA 1E9QA 4MCMA 3KM2A 4FF9A 1OZTG 3L9EA 1PU0A 1SXNA 1SXSA 1FUNA 1XTLA 4BCYA 3H2QA 1CBJA 1YAIA 1Z9PA 1L3NA 2AQRA 2Z7ZA 3CE1A 1N19A 4A7QA 2GBVA 4BCZA 3SODB 5KBMA 4A7SA 3ECVA 3GZQA 1E9PA 1EJ8A 4A7UA 2R27A 1N18A 1PTZA 2AQPA 1BA9A 1TO5A 3F7KA 2Z7UA 2C9SA 2E47A 2ZKWA 1COBA 3HOGA 1XTMA 1KMGA 2NNXA 1IB5A 3GQFA 1OALA 5KBKA 3GTVA 1SRDA 1E9OA 3GZPA 2WZ0A 1IBDA 4N3TA 1HL5A 2WZ6A 1YSOA 1MFMA 1CB4A
chains in the Genus database with same CATH superfamily
2EXWD 1QSFB 1QRNA 1TTFA 3KPPB 5F96L 3WFEL 4FI6A 4YDVA 3ZMRA 4UUJB 1Y6NR 2JQMA 3H2PA 1TITA 4NNXB 4WFHE 2Z31D 4XMWA 4U6VH 3AUVA 3ARTA 2EACA 4GAAA 2DTSA 2Y2TA 3I6LE 3NTCL 4F8QA 1A1MA 4JG1L 1F1GA 1MHEA 3MGTB 2EDHA 5KBLA 1KBBA 1NBZB 4XNUL 3RZCB 5I19L 4FERA 2XPZA 1CXEA 4LSSH 4XMKH 4U1SB 4Y9BA 2XZCL 2WVVB 3NRFA 2DBLH 3AXIA 2AQ1A 4R84A 2XTJD 7CGTA 4S1QL 1JN6B 4FL4C 4NBXB 3QORC 2CJUL 3O6ML 3TT1H 5KVFL 3I9PA 3DX4A 3A3YB 1MJ7L 1C7SA 4PRHB 1AXSB 1HK6A 4KKPA 3V0WL 2VDRL 2V3EA 1JNHA 5CJOH 3WFZA 2A6IA 4TTDC 5I1GH 2WN2A 4DK3A 3QORA 4OJYA 2Y7LA 4RNRA 3D5OF 4WTXA 3FU6A 1D5XB 3KH4A 1QRNE 2AQ2A 2DL9A 4S2SB 3EJRA 2XVBA 5TTRA 3PJLA 2EE0A 2Y25A 2HVKA 4WFEE 5KVDL 3AQYA 3OXRA 2O5XH 3GRGA 5T1KA 4EDWL 3SGKA 1OVZA 3GS7A 4X7DC 4YDZA 3I9IA 5I8EA 4AL8C 4G82A 2XZZA 2MOGA 2JELL 2X4UA 1G9MC 3R0MA 5L8LB 4FF9A 3I75A 1NBCA 5DUPL 5TDPA 3MOBL 5JNYA 5D7EA 2EXWC 1NUDA 4NN5B 3G7TA 5E9DA 4NRZB 3KBPA 3QIWB 5FYJH 3SE8H 2YBRB 2DWEA 3NDZE 4L4VA 5T1MB 3U7AA 2BSEA 1D5MA 3V6OC 2LAGB 3CU1A 3GBNL 1JTPA 2ZJSL 4P49A 4QWWD 4Y8AA 1R6VA 4N4YB 1BZ7B 2CMRL 3EJYC 2Z31C 4HWNA 1SQMA 3TN0D 4QHMB 3WFHA 4UQ3B 1OAUH 2NY7H 2Q8BH 3E2HB 1TVHB 3QG6B 5DURD 1DJYA 3C08H 5DWPA 1RK0A 2EDXA 2VLMD 3NJJA 3KEDA 5E24E 1L4IA 3GHEL 1QO3A 2OMZB 3MN8A 2MOQA 5L0QB 4YHIA 4X4XB 1HHHA 4M56A 2IALA 5C0JB 1FHGA 3FZUD 4MXQC 1KCUL 2NSMA 2XJKA 3BVNA 4WI5A 1HNGA 5AW8B 2XTJC 4HG4J 2OSLB 2N01B 2MEJB 3ZRCC 3TO4B 4FG6D 3DA0A 4KOCA 2X1QA 4OZHB 4R90H 3QUYD 2IPKA 5FGCE 2IGTA 1J8KA 2WJ7A 2R0ZH 3ESOA 3X1FA 4N2DA 4PMEA 3LKRB 4H88H 4W9CC 1MXGA 1QRKA 4L3EA 1SDDA 5D71L 3EO9H 4G80B 3WS3A 1T5KA 3QPKA 1TJHH 5I2IB 2BIPA 1FFNA 1C5DB 3P4NA 4PGEB 5E9DE 5DJ2A 1JPSH 2Y1YA 4L4VE 3WXVH 3NZHL 1IGMH 3ENEA 1YN6A 2JJTC 2F7PA 2EIJB 2P8MA 4MNHB 2X2IA 2PPFA 5FDWB 3DYOA 1UXMA 3TS8A 2NQ3A 1M3IA 4FI8A 3BZ4A 4XWOD 3ALWA 3PHAA 2M8XA 1JGVH 2X09A 5D4QA 4WTWA 3ZRFC 4APXA 3GUTA 4ZNEA 3X13B 1VENA 3MRHB 3QJFB 4PH8A 4PCSA 4FG0A 3WIHL 1EUTA 3QWOB 5ABZA 2H1LM 2TRYA 3UPRB 4OTXH 1FH5L 4QJ5B 4M4PA 5DTFB 2A6JB 2L04A 5T5FH 4HAFA 3AQXA 4PJHA 3MV01 3QI9A 1JF6A 1U0QA 1YEJL 4LGSB 1KTLA 3Q2NA 4WO0A 4NO2A 3TN0C 3NOIA 1SJEA 4ETYA 2FL5A 3I9AA 3NCXA 1YMHB 1GGTA 4HCRL 3NIGF 2GTZB 3ULVL 1BPVA 4P04A 2E7HA 3UG5A 3HJEA 1MFCL 4QRPA 1UG9A 1OB1A 1S7RB 2EIMB 3HFMH 3VXUB 3VJ6B 4Z7QF 2J4WH 2GK0B 4E36A 3CLEH 3ZTNL 2DLGA 3L7FA 2VGLM 4L3EE 3AQZA 4WHTA 2VLKA 3NFNB 3FZUC 3QZNA 4XP1H 2R59A 2ZG1A 1OW0A 2FBOJ 3IJ8A 4FHKA 3Q01A 4Q9RL 2AVGA 4R0LB 4YSAA 4JZNB 3ULUD 4AZUA 1KNOB 1SZNA 5JIQA 4NNPH 1U8HA 4FG6C 3WE6A 3L2NA 3NT0A 2VE6B 3QUYC 4JO2H 2WUCL 5KJRL 2IGFL 2UVEA 3RWJB 1JNJA 2ZAHA 4PS4L 4KAQL 5TQ2L 4OZFB 1R9FA 1JP5A 4LLVB 3WOVA 3GMRA 5IMLA 5KS9A 2BP8A 4ZNEE 3TTSA 1MCQA 1IKFL 5HYFA 1CD0A 1A7BA 4HEPA 3GZPA 1J8RA 4G8FB 4XVSL 1J0JA 1UZ8A 2IPUK 5EOCJ 3FKUS 1V8HA 3LNHA 1DQVA 1WQVT 4PJ7F 4ZOCA 3UH8A 3IYLW 3IMBA 1FDLH 3GJFH 1QI4A 2IF7A 1MFBL 2W5PA 1YEIH 3BLKA 3TA3B 5LGKA 2WP3O 4LIQL 1BVZA 4FQIL 4XPGL 4BWWA 4PJHE 4XXWA 5I1AA 1MCPL 1TQWA 2ADIB 5EO9B 1OGPA 3WIAA 3PWPD 3DTUB 4XWOC 3MJ9A 1MLBA 3E6HA 3L1OH 4LARH 4L9LA 1S46A 1QHQA 2FIRT 2CIIA 4MQXD 1BM7A 2W0FA 4HIJB 4NENA 1W8EA 4IOSD 4CILA 1JI2A 3VFPA 4ZUVA 1BJ8A 4L29A 4QRPE 3U6XS 2ZPKL 2I27N 3ULUF 3EBAA 4AJ0A 1AGEB 3ZE1F 2VLKE 3H7BA 3KDMB 3KLQA 3UABA 5IOPB 4UI2A 2WK2A 3ZSSA 2B59B 2BIHA 5CUSH 1UACH 1RERA 3RWFB 4DETA 1JWUB 4YXHL 4K5LA 2FTAA 3F7VB 3QO1A 4NQED 3VFMB 4A66A 3QC5X 1SN5A 5FWRA 4DGIH 4P5TC 2WXRA 3GKZA 4K15A 4D9RD 1E5ZA 4ZTOH 4KUZH 4OLYL 2B4CC 4JGJA 5DZPA 5AB9A 5KS9E 2HKHH 1IZKA 2JI1A 3HCVA 1MCHA 2V7NA 2LAAA 3SYQA 1LO4L 1M56B 5D4JA 2X4QA 4P5TA 4RGNB 2C9UA 4KJWD 1J9QA 1F42A 4GB9A 2L7JA 3ARBD 4PJDB 1GTFA 5IF0B 4JO3H 2Q6WB 1FVDA 2WM0A 4WRLA 4UTAH 3PF2A 2NX5D 4JG5A 1BFOA 5EC1B 4UTCA 3L3HB 4N90D 1CLZH 1TETH 2YEQA 3FU7A 3LD8C 5F9WC 5FECA 3CVHH 1QABA 5D2LB 1P53A 2N59A 4GSDL 1FJ1A 1U8NA 3TC9A 2ZWKA 3B8SA 4PYGA 4JRFA 5B3NA 2AJ3B 2C5DC 2XPGA 2ICWA 3FOMA 5HDBF 1G4RA 3ARYA 4U6VL 1OCZB 1OAKH 4ODHH 2O26U 4FZEL 1F6FB 2IAMD 2FLMA 4NZDA 4PSPA 3UAJD 4ABVA 3OC8A 2FWOA 2KPWA 3WL9B 1BD2B 5CFHA 1T0MB 2OMYB 4MQXC 4YO0A 4CJ1A 2XV2A 1IEAA 1T21A 3C2SA 4PP1D 4Z0BL 1WAPA 4BELD 4F8NA 1IB5A 2XA3A 1AQKL 3K8MA 4QKTA 3C09C 4HWEH 3FTWA 1D6EA 3MRGB 2NNAA 2NY2B 3NEOA 3BGAA 5AVSB 4H20H 1T1WA 5DRWA 2YWYA 2XFGB 1M7XA 3EKCA 3MRDA 5D93C 1MVUA 4BA8A 4Z7NB 3LZFL 2NY0D 2WXLA 5G5DB 1E40A 2N7BA 5CJOL 4UQCA 2XFXB 3SDDA 5I1GL 1TZHA 2VDKH 1GGCH 3RHWF 4M7ZB 5E7FA 3BH8A 3DPBA 1L9OA 3THMH 3GBLA 2GCYB 4WWKA 1HHJB 5HHQA 1M42A 4KJWC 3ULVE 4GAJH 4ZO9A 2QSTA 3CLWA 3ARBC 2Q8AH 2BNRA 2A1WH 3OR6B 5I6XB 5L8KB 1OSPL 2RAMA 4A63A 2DYSB 1TYRA 1ROWA 2ADYA 1YECH 4WNQB 1EIBA 3U0WL 3D4CA 1AQ8A 3TESA 4X7FC 4ELMF 5DMKB 2UWEB 4XMLL 3OMZA 3HI1B 5SWSB 2A74A 1JTTA 3RB7A 3CGTA 2XHNA 3ESVF 4QRAA 4XMZA 5F7KC 3LPOA 3ZL1A 3H55A 4ODTL 1GGBH 3QJSB 2QTEA 2X2JA 2IAMC 3LXUX 3UAJC 1ZXQA 5AVWB 3WJMA 2OMXB 1IBGH 1QVOB 1AQDB 4FGMA 4KX7A 3RTLA 2H26B 4PP1C 2KZ1B 1VADB 3OZ9L 1ZWIA 4XN1A 3V79C 3S5ZA 4YHKH 3P11L 3BP5A 3KS0H 4G8AC 3OAZH 3STLB 1OZTG 5IVOA 5ACLA 4LIQE 2WXOA 2DLFL 4XVJH 5C0CA 4GNKB 1XHHA 2G2RB 3EOBA 1JDCA 3N44F 2NOYA 3VMOA 3CNKA 1GTNA 5EPMA 1PNCA 5F7MC 1E6OL 1KGXA 4ZO6A 3SZKC 5KUKA 2OTWB 5GHWH 3HC3H 3ZMNA 3IJ9A 3RKDD 5KBMA 1CL7L 2ZUYA 2Y07H 2PP7A 1MCSA 2MNWA 1ASQA 3P0GB 2BNRE 4HGWB 3AS3A 2NY0C 2XWEA 3ROOB 1BSIA 2VUOA 4WI3A 3C9NB 2RD0A 2J5LB 3EJJX 1I9IH 1NZRA 2ED9A 4Z3HA 1RU9H 1DJHA 3W9DA 1TJHL 3CSBA 5DJ6A 5B39A 5BW7C 4ADIA 2ZWSA 1BVLA 1G6VK 2FLBT 4HU8A 2AKRA 1DJZA 1JPSL 1NQBA 1JFQL 1WT5C 2R29H 3DVGB 3Q48A 4CN6A 4F37F 5J56B 1ZV9A 2GJZA 4JJHA 5C0DA 1JWMA 5GGTA 1CICA 1PZCA 3IDJA 2L7QA 3HNVH 4NQQA 5EULV 5FGSA 5H35B 4PY7A 1RJZB 1UJ3C 2JI2A 5I76A 1NCCL 1J8SA 4R5XA 1LWJA 3EG9B 3DX1A 4JRXD 4OKVB 3BX7C 4RMVA 1KFAL 2HJFB 3WNOA 1E9PB 2NXYD 3PWJB 3QUZA 1F1DA 2D3JA 1P84K 2OL3B 4OGAD 4YGVB 4AGQA 4IRJC 1T04A 3RZCD 1G84A 5CILH 4OTXL 3I6KB 1UJ3A 1OL0A 1XMEB 2V9QA 4NHUB 1DVUA 1UWEH 2ZX8A 3MKGA 4PJCA 4AYSA 4JO8A 4BRJA 4YC2C 5C0CE 3JWOH 1ODUA 2YRLA 3ARSA 4M43H 3BAJA 1E90A 3MUJA 3M86A 4IRJA 4FHJA 5GRJH 2KQMA 5BVPL 3M1BB 1BXUA 3DX0A 1RZQA 4YWGL 2YPLA 2F54B 4O02H 3PV7A 3DIVA 1I8LA 1SXAA 1IGTB 4R7NA 1VB9A 3NCYP 5FYKH 3VRIB 2UY7B 4IIQB 1CS6A 3HFML 5ANHA 1MHPH 4WQOA 4GYBA 3L4CA 3QIBB 3W39B 1LVEA 4JQIA 4TUOB 2MPAH 3GS4A 5GSVA 3VFOA 1FE8L 4XP1L 3QQ4A 4MS6A 4S0HA 2AF2A 1HAWA 1R3HA 2Y5TA 5F1NB 3K6DA 3F12B 4UBDC 4NFDA 3HAEA 2DQ6A 1FSKB 1IC5H 2FJUB 4JZOB 3RKDC 1JPTH 3IN2A 2YD0A 4LO9A 1F13A 1HCZA 5FA4A 3IDYB 3LXBA 4CGTA 3TT3L 2G2PA 4P46D 1X5HA 2XXFA 2WYHA 4ZFOL 5ERWB 4NM8H 3H7LA 1EZUA 2ARJQ 1OAJA 3AB0B 5BRZD 1E8WA 2YUZA 5LCVA 1A1OB 1KTCA 3ZDZE 4AC2A 4L0PB 1T7WA 2YGQA 5FC9A 3QIWD 3D0VA 1EJFA 5C7XH 1VESA 3QFJB 1FDLL 4MXWH 2E76C 1RKRA 1ZLUH 4HJTA 5I1IH 1J5CA 1AXTL 1QSFA 2R0LH 3CE1A 2J8OA 1BGXH 3L1OL 3U1PA 3HKZA 4LARL 3KPPA 2YPLE 3CFDA 3L4WA 2VITB 4UUJA 3FONA 4OGAC 4NNXA 1B2YA 4G9FB 5ESAB 5JQHC 5HPOA 1DVYA 3RZCC 4HH9B 3ZE2F 4F1ZA 1ZRUA 5E70A 4IBLT 4JE4B 4MAZA 3MMEB 2O5ZH 3MGTA 1FLRH 5JQ6H 4R4FH 1PBYA 1NBZA 4N3TA 2F1AA 1XH1A 4X6FB 5CUSL 4HOMA 1NIAA 3RZCA 2IBZY 2J71A 4U1SA 3LZOA 3UTSB 4JFFB 3VFRB 4GLRI 4WFGE 2P5PA 4GG6A 5CEZH 5MENB 3OVUB 2XT1B 4BE5A 4KUZL 4KFMA 4PQXA 1OP5H 3NIDB 1JN6A 5ABDE 2A9NL 2Y36L 1BYOA 1XVSA 4AKQA 4PRHA 1D2OA 1TJGL 1AXSA 3SKMB 1QPXA 5GIRB 2BWDA 1AGDB 3KH3A 1SXBA 1P4UA 4XHJC 5CGYD 1L7TH 4J2XA 3T77B 1R5WB 3VGDA 5IB2B 1A6PA 1X5AA 1CLCA 1D5XA 4P46C 5J6SA 4DN3H 5LQBH 4UTAL 4S2SA 4M6NH 4U3SA 1U8MB 2OAAA 1XSKA 5DA0B 3F58H 2C3XA 3EFDH 1CLZL 4NN5C 5IJVB 1QACA 3IS1X 3QIWC 2CO4A 4UZUA 1JJUA 4AM0Q 4B41A 1M2OA 4FXGB 3V4VH 4DUVA 3L9RB 3MFGB 3DXAA 3H3PL 2BVUA 1L5GB 4F24A 1JI1A 2KLTA 3E2HC 3HG1B 1HWHB 2F8VA 2PN5A 2FEJA 2YBRA 5T1MA 4KVPA 1U21A 1E5BA 5DC9B 3JQOB 1WAAA 4OFYD 2OTUB 2EO1A 1EXGA 2VC2B 2IAND 5D1XD 5JXAH 3QC6X 4GG6E 3CVDA 4QHMA 4UQ3A 5L0QC 3BAEL 4FNQA 2C3GA 5EU6B 1DUYB 1OAQH 4WNJA 1TVHA 2HMID 1ZVYA 4R4ND 3QG6A 4NIYE 3G5ZB 4HWEL 4MCMA 1DVXA 3S37H 1CGYA 4PRHE 2BHZA 4RA3A 2J1XA 3TO4C 2OMZA 3QQNA 4HJJL 1QSEB 4EI6B 4X4XA 4ETQA 5C0FA 1AS7A 1YUHB 5C0JA 4IIZA 4KJPD 2W9EL 3N42B 2JMRA 4R97B 3DK0A 1PMYA 3U30C 5F89B 2OSLA 3L16A 1KB5H 2F74B 3TO4A 4A6YH 4OZHA 1JGIA 2GAZB 2Y6SD 2VDKL 3ETBJ 3ZW3A 2H2PD 1XSIA 1RZ7L 1S7WB 4ZXBD 3RUGB 3CSFA 3THML 3BAWA 4G8EB 1NLBH 4GAJL 1BVKB 4M3KB 2QKIB 1F56A 5CGYC 2Q8AL 4P0DA 2A1WL 2HUEA 3REWB 3DXAE 4YDIH 5I2IA 2HTKC 2IPTH 1C5DA 4DSYA 4GRWF 4M6MH 4PGEA 5CCGE 1EAQA 3LZPA 4PGDB 5IWLC 1GHFL 2Y1AA 4OJCA 2GIXA 3GRWH 4K5MA 1WAAE 4MNHA 3LS4L 1K4CB 4E9LA 4JRYE 1DBBL 1EGJL 4KNUA 1JPEA 1USZA 2BDNH 1B4TA 2EABA 3VYNA 2XWJB 4XAWH 1SPDA 1AZZC 3EYOB 5ID0B 3X13A 2BOCB 3C6LD 5IWLA 1N8ZB 3MRHA 2F9BT 3NCYS 3QJFA 1ZIAA 3L4VA 4GBXB 3NQKA 3QWOA 3SO5A 3HKFA 2A6JA 2X2YA 1IBGL 1YJDH 3CVBA 4AE1A 4OJEH 1SOSA 1HHGB 4HLJA 4K3JH 2P46B 1YNLH 3SYCA 2IG2L 4WCYH 5AUMB 4GT0A 4MVBD 3FO0H 2ODHA 4HK3N 3FUEA 3BVXA 4F27A 1YMHA 4OCLC 5F7WC 2YRBA 4FA6A 2HMIC 4R4NC 4MASA 2GTZA 2ITDB 4OZHE 2EVIA 5E4OA 5EUOF 4NZRH 4R0LC 3GO1L 4CKQA 3VG0L 4U3CA 4WI4A 3SD5A 2ESVD 1U8PB 3T3MB 2I9LA 1S7RA 3VXUA 3WTYA 5KWYC 3VJ6A 5BZDB 3BUTA 2GK0A 2VLRB 2O61B 3HC3L 4JPIB 3RVTD 3O2WL 3SOBH 4F15B 3SE6A 1Q9WB 3NFNA 4UQIM 5D6CB 4KJPC 1TDQA 4R0LA 4JZNA 2UZYB 4YE4H 1KNOA 5DLML 4YHOH 2HFGH 4TNWK 1RU9L 2BXYA 5CGBA 2VE6A 2Y6SC 3PPEA 1FQ9C 3L1GA 4UNIA 2H2PC 3PABB 3RWJA 1XH3B 4ZMXA 2ADFL 2B2XH 4OIBA 3PJNA 5E7BA 2HYMA 2PPEA 4OZFA 1MRFH 4V2CB 1DSWA 5I23A 2AXJA 5I1LB 3TIDB 4LLVA 3KG5A 3TA3C 1FZMB 4I88A 1F11A 2D4DA 3G6DL 2VN7A 3BT2L 4W6WB 4G8FA 1GCYA 2EXTA 3H0TB 5K1NA 3C6EA 3TBWB 5D7SL 1JAEA 3BPLB 3D33A 3TA3A 1AZCA 4G42B 3Q6FB 5EH1A 3AAZB 2APWA 5CILL 2ADIA 2BCMA 5EO9A 3HEIB 3S4SG 5I8OH 1EJ8A 4AVHA 4Y7MA 2YD4A 1LEGB 3VSVA 1UWEL 1DJGA 2WLKA 3UADA 4DH2A 4PJDF 2PO6B 4HIJA 2Z7UA 3MLSH 1XTMA 1X6NA 1R34A 3VXUE 1ZJAA 5K9OB 3J07A 5FCUH 2Y72A 2BZDA 1KCSH 2WV3A 1MFAL 2VXUL 1AGEA 3J27A 2R2HB 3KDMA 3O0LA 1H9DA 5IOPA 2I60H 1MHPL 5F7YC 1S7QA 4H5SB 4O58H 4HG4K 3O4OC 2B59A 2PCXA 3RWFA 3DTDA 1JWUA 2MPAL 5C3TA 3P1VA 3R4DA 1SLWA 3F7VA 4MNQB 3VFMA 4KTDL 1INQB 3O8XA 3LZRA 2V37A 4M9PA 3QJQB 2ENYA 4TXVB 3RVTC 1JPTL 5I15L 4M8QB 2AEOA 4XN5A 2WWNA 4R8WL 1JRHL 1EGJA 5DC4B 2CGZA 4W9HC 4MMYA 4NOFA 2VDPH 4ODVH 1IQDB 4QRSA 1OEZW 3GZOA 5HJGA 4ADJA 1JK9B 5IF0A 5C7XL 2ZYSA 3TV8A 2Q6WA 3VXSB 5JUEL 3CFQA 3EH4B 3UJJH 2ZXBA 3S35H 2CR0A 5EC1A 5I1IL 4CGUB 3L3HA 4KX9A 2DMCA 2BNQD 2JKXA 3ZHLA 1WGVA 1V7NH 1KY7A 4XN8A 5D2LA 4N2HA 3RIFF 3F64A 3IKKA 4A7GA 4Z0XB 1IT9L 3T71A 1SUHA 2R8SH 3ZX1A 4Q6YA 1CFVH 4ELKB 2WXJA 1DEDA 1DQDH 1GAFH 1S9VB 1WZ1L 3K8LA 3LPGA 5ESQB 3WY4A 1KENL 4M8RA 4UIKH 1T2QL 4OCSH 1TPXC 1CLVA 1HILA 2QDWA 1TTAA 2E27H 2O5ZL 4CDGC 3WL9A 1FLRL 5FM4A 1BD2A 5SX5H 1T0MA 4R4FL 1QR1A 5GS0D 1WSST 4OFPA 4ISVA 4GXUN 4HK0B 4MMXC 3A6CH 4CN1A 4PRDB 1UVQB 1WTGT 4E9XA 4UV7H 4YSEA 3LB6D 1LK3L 5CCKH 3ELAT 1UFUA 1HDMB 3MRGA 3KWTA 5SWQB 4EIBA 2EYSB 4XCCH 3ELQA 4RGNE 3NCCB 3MOAH 1XBRA 1VERA 1I7RA 4H0GA 1EFQA 1DBML 2A73B 1NC4B 2H5UA 2ZUQB 3UIYA 1AQMA 4F20A 3LDBB 3FSVA 5G5DA 1DL7L 2X53A 3NESA 4DEPB 2XFXA 5MHSD 2F2HA 3GK8L 5DEFB 5LN8A 1L7TL 1FIGL 3RGVD 5I6XC 4DN3L 4ZFQA 3D0LB 1PJ9A 4HLZG 4CN4A 1J9TA 4P3CL 2VRQA 5D2LE 4FFTA 4JFZH 1RUKH 1SFDA 1HHJA 3CHPA 1GS6X 4NN7C 4D0CB 1JOIA 5I18L 2FUQA 2UY6B 3UZEC 5HHVH 3GHPA 3T0ED 1W15A 1T83A 3OR6A 3V7MA 4TN9A 2J7LA 4GKSB 2VLJD 5FO9B 2UUDH 1C7TA 3WDIA 3B1UA 3D3VE 1BYNA 4HUNB 1L6PA 2LQRA 1BD2E 1X5GA 2C7UB 5FV2A 2AERT 3FB7B 2H6PB 1RZGB 4JMXA 2UWEA 5DMKA 3NN8B 1S5IH 2DKMA 5TE7H 5LKNA 3HI1A 1YEGL 3ERXA 5SWSA 1SEQL 4A7TA 2CBTA 4FQCH 3A4AA 4GKZB 5CNHA 5D8JH 3T4AC 2Y7NA 3E8UL 4K4KA 4KKAD 3FRUB 5I82A 3QIBD 3LH9A 3ZDYE 2IDQA 5HBBA 1MCKA 2K9FB 4NWTH 4FA8A 5JQIB 1BLIA 2OMXA 3DBSA 1AQDA 2IWFA 4KWUA 5DC2A 3NPZB 2H26A 5AW6B 4XP5H 1VADA 1DCLA 4KQ3H 4W4OA 3S37L 3UEQA 4Z7NE 5GS0C 4LAQH 3LVTA 1AP2B 5KYNA 2HFTA 3BIBX 1GVIA 2F5BH 3STLA 3V7AG 5SX4I 3LB6C 1UXWB 1KDIA 4O2FB 3CDFA 2NLJB 4N2KA 2A77L 3NIFE 5B8CB 4V1DE 5TQ0H 5KSVB 1OAYL 4A6YL 1SOQA 2GJPA 2OTWA 3KPSB 3RAJH 3ZKXB 1CDGA 1YEDB 3VI4F 1C1EL 1MNUH 1AQHA 3H9ZA 1JXDA 2ORBH 4PCTA 4QCIB 3IDUA 1F90H 4HGWA 1ZGLP 3ROOA 1OM3L 4ZTPL 4N68A 4UILL 3C9NA 3FQWB 2W92A 4N8UA 3RGVC 2IPTL 3D48R 1ITBB 1U8KB 2UWEE 4DP6X 2ZUWA 3DVGA 4WLCA 4HJEA 4P2QB 1EHXA 4PWGA 3GRWL 4D2NA 4G9FD 5DFTA 3EGXB 2P45B 3T0EC 5H35A 2C4XA 1RJZA 1CWVA 1TJMA 4WFFD 2BDNL 3FUDA 2BOLA 5EOQH 2WQAA 3EG9A 5K59E 4OKVA 3MXVH 4XAWL 5EZIH 2DDQH 2HJFA 5JHLH 1E9PA 2HT2D 3T2LA 3UYOD 3OGCA 4XNXL 4EUPH 2OL3A 1OSYA 4RMSA 2VL5B 3JSSA 4B9GA 2GEQA 4GO8A 4ALAH 1BA9A 3L48A 5LUMA 3PLYA 2W8CA 3I6KA 4WI8A 4EI5A 1G6RB 4NHUA 4X5LA 5CSGA 1TU2B 4CVUA 1JGUL 1YNLL 2CXKA 3G5XB 1INDH 3M07A 3QIBC 3M1BA 4Z3JA 3WENA 2Y4SA 2F54A 3HW7A 5DHYB 4QRRE 4C47A 2DQEH 3VRIA 1KBPA 2PP9A 2UY7A 4IIQA 2CHNA 5ID1B 4N8CH 2OR9L 3DKHA 3TBTB 3BDBA 2PR9A 4WGKA 3W39A 4HJSA 4PFEA 1G1YA 4FNSA 5CD3B 4KZEH 2WC7A 2VZUA 3T2NH 5F1NA 4F2MB 2D7QA 5IZ7A 3GMNB 3AT0A 4M62H 2ATPB 3CZUB 4JZOA 4Y1TA 3SHSA 4FCHA 4Y19B 4Y5XB 4GQPH 4F7KA 2Y1ZA 2H3KA 2NQCA 1QYGH 4FKEA 4NUGH 1QPPA 1JS4A 1PLBA 2D7NA 3I6LD 5ERWA 4R5VA 2GUOB 1KN2H 1A1OA 2JF1A 4RLDA 1MF2L 1T6VN 4C58B 4MJ2A 2X1WL 1WIPA 1J1PH 3QFJA 5I1CH 4QXWA 3X3FH 2AZAA 2YAFA 4BKSC 1FCCA 3I2CH 1WP6A 2EO9A 3FQUB 1H0DA 5F0JB 5I8OL 3M1OA 1J8HA 3S8FB 4R7LA 3VFWB 3U1QA 2XG5B 1RVFL 3PP3H 2HT2C 4F7EB 5J06A 2F54E 2CPCA 2H41A 1U6AH 4UNVA 1SLUA 2ROYA 2VITA 5I74B 4JG0H 4PM1A 3JXAA 3VI3F 5ESAA 1RV6X 1A14L 4LPVA 4HH9A 3ULSB 1B6UA 2OCCB 4K8RD 2E4FA 1KCSL 2ZAGA 2XVLA 3MMEA 4YHNB 3UGXA 2ZUSA 3HA0A 3E8VA 4KZDH 2W0KA 4O58L 4Z3IA 3P4OB 3C87A 4X6FA 3PNRB 4PJ5B 1PX3A 1B3IA 3B5TA 2Q0ZX 3P3YA 3UTSA 4JFFA 3VFRA 3A23A 1XCTB 3D6GA 3O2DL 5MENA 4QR7A 1SY6A 4JCMA 5GISL 3ZYJA 3QNFA 4LHJB 4JZJB 4AGLA 1CFBA 3AWEA 4WUUA 1JDAA 2G9KA 4ODVL 4YSSA 3SKMA 3QFJE 3QUXD 2E7BA 1T03L 1AGDA 1E4KA 3QZMA 4LEEA 3SYOA 3T77A 1R5WA 1I82A 2F6AA 4LOFA 3ZTJG 5IB2A 4NP4L 2EDOA 2VXTH 2WKGA 7FABH 1J8HE 4FXGC 5DR5H 2OCJA 3T5WA 1U8MA 3PXLA 2X6BA 3E1F1 3KR3H 4POYA 2AMUA 3EFOB 5KAQF 3S6CA 4Z23A 3V6BR 4BD4A 2HG0A 4H8PA 4N2NA 4R7XA 5HHPA 2MKLC 1CFVL 4FXGA 3ZDXF 1JZ6A 3RDTD 1KYDA 3PWNA 2C9RA 2H32H 3T0AA 3BAXA 1L5GA 3CFKB 2AK4B 3HG1A 5KG9A 3JT2A 4N28A 1WEJL 2IWEA 3DVNB 1UYWH 5E4IA 5D7JB 4NUPA 4W9DC 2O72A 2OTUA 3BDYL 4PJIE 3GT6A 3PFUA 1PG7H 4JFFE 3UTSE 4W70A 5DUBB 5MENE 2JLLA 2RQ8A 3N43B 4F33B 5EU6A 1DUYA 2WLYA 5J6GB 4UV7L 3G5ZA 5D6DC 5CCKL 1MFEH 3EDFA 5DEGB 3R06B 4K7PH 1QEXA 3NJMA 4XCCL 4ANWA 4WUUE 3RX9A 2DYRB 1EAPB 1CFQB 5IQ7L 5KJ7E 1HL4A 1DDTA 1QSEA 4FNLH 5B7MA 1YUHA 4IDJL 2EDLA 2RTTA 4FEIA 3BSHA 5DLLA 1BBJB 3ORJA 3HC2A 5F89A 1U93B 5IB3B 5D5MA 4X9YA 2F74A 2HKFH 2QKIC 4D3CL 1A7QH 2H1PL 2EKJA 2JQAA 3FTZA 3M7FB 4KKLD 3O3EB 1S7WA 4OLEA 3RUGA 5IW6B 1RLWA 4JFZL 2ZD0A 3CFNA 4MFHA 4YVUA 4G8EA 5IFJB 4YFDB 4Z1PA 1BVKA 1AVAA 1KCBA 1MWOA 4JPWH 4LLUB 5DHDA 2WXIA 2QKIA 4Q8BA 5CZVL 5GQBA 3REWA 4OVVA 4K3DH 3S3JA 3HG1E 1T0PB 4GOSA 5HGHB 4ICWA 3VD4A 1JV5B 3RA7H 1MFDH 4PGDA 4Y1AB 2CKBH 3QS2A 1QLRB 1KIQB 1BEYH 1TF4A 2ARJB 3X1NA 4RVBA 4F8PA 1K4CA 4LASH 4FQ2H 4BK5A 4FAAB 3FYEB 4UAOB 4A7UA 3QXAB 5DJZB 2H45A 3GJFK 1EEYB 3SDAB 2XWJA 3MOQA 4HX1B 2EH8L 5E4AA 1ZS2A 2GK2A 5EU6E 5INCB 5T3XL 3EYOA 3TJEH 5I1KH 3VB9A 5ID0A 2BOCA 5JIDA 1N8ZA 3O2DA 4GBXA 1FYHB 1B88A 5C0AB 1MI5B 3VDAA 2X6CA 2GJRA 2DMHA 4OFIA 1QSEE 2WLZA 3KGUA 1XF3B 1E50A 1HHGA 4LEOB 4XP5L 4GXVH 3O3UN 2FD6H 5JW5B 4TVPL 4RSVA 4XO5A 5D5ME 2F5BL 3L5HA 2ITDA 5ALCL 5KOMC 1PG7W 4S0SD 4YSPA 1BJMA 4MD4B 1TZAA 1U8PA 2JLPA 4K5PA 1XFPA 3RUGE 1XGUA 3CZFA 5BZDA 2VLRA 2O61A 4ICXA 4JPIA 2W0PA 4K55A 3UC0H 1VEMA 3GSQB 3QJVB 4D0BB 1Q9WA 3ZKQD 5D6CA 3BLBA 5AZEH 4Y4KD 1F90L 5EBGA 3OMNB 4P5KB 5LLIC 1QFUL 1L6XA 3S96B 1YNTB 5E56A 2LVCA 2X89D 3TEXA 5BV7H 4KKLC 5E99L 1XH3A 4Q14A 2VDLB 5EF3A 2HT3D 2J44A 4KOBA 4XXCA 5I1LA 4M7LT 1FZMA 4ZODA 1K9TA 4JO1L 2X9ZA 3H9SB 1UB5B 3IMTA 1JVLA 5E5UB 5EFIB 1I7UB 1LEIB 4LSPH 3H0TA 2DDQL 3BCFA 3TBWA 4Z78B 2VKWA 4MJID 2XICA 3IGKA 1EO5A 3N41B 5H37G 3S3CB 3DRTB 1XGPA 2WGNB 2PO6C 5DU7A 1CD8A 4G42A 2O30A 4LFHD 3Q6FA 4AG4H 3AAZA 3M46A 4ALAL 2Y5EA 1OGSA 2YN3A 5HGGS 3IDNB 2AEWA 1PLGH 15C8L 1LEGA 3GJFB 1E7VA 1OOWA 1W2KT 3QCVH 4YFEA 3BKJL 1INDL 1NEZB 2PO6A 3IFOB 4Y5YC 5EU5B 3S48A 3NJNA 2W80C 4RFOH 3T3ME 3S34L 5K9OA 5AVYB 2VLRE 3HRZA 2PCFA 4YR6B 2DQEL 3GJEB 5C6TL 4NN6C 2Z0BA 2R2HA 1Z9PA 2DJSA 4H5SA 3DGGB 1AS6A 3FNKA 1UH3A 2EQDA 2BVTA 4N85A 4MNQA 1QW8A 4JPVH 1INQA 4JLRB 2TSAA 4M62L 5D1QB 2WCGA 5E94A 2P7TB 3MJ8A 3KWUA 1P5UB 3RY6C 4ZFGH 4M8QA 3QWRD 2A9CA 4Y4KC 3ABKB 1LD9B 1KEML 3F05A 1IQDA 5F6IB 1M05B 4GSUA 1KN2L 1NCDL 3BZDA 4Q9QH 1ZXKA 5JHDD 1C5CH 4HIQA 1JK9A 4MLSA 3FUHA 2PTTB 1K8DB 4WK4B 5JOFB 1KV3A 1J1PL 2HT3C 3VXSA 4QHKJ 5DHEA 4A2GA 1NFAA 3KEHA 3DV6B 4TM9A 4PHZA 3S0PA 1CDIA 4ZS6C 2DW5A 3AXHA 5A43C 2K7PA 2E8ZA 2XPYA 1GIGH 4Z0XA 3OM3B 2ICEB 4K07A 4PJXB 2UVFA 1WE5A 4ELKA 3WTSA 5ESQA 2ZWLT 1T6BX 1DUZB 1IAIL 2PXYB 4GFXA 3Q1SH 1FV1B 3CVHB 3HJ0A 3VDBA 1N64L 2V5MA 4TLUA 3T0WA 1ZT4B 4U4IA 4KZDL 1VDGA 4MNQE 2X28A 1YCSA 3K2UL 4LNRB 3PIQB 2DIEA 4B3VA 1AH1A 4HK0A 1QKZH 1PSKH 3LRHA 4NKIL 3TF4A 4PRDA 2ITCA 3TNNA 2XA8H 4HIPA 4OCWH 1HDMA 3D08A 1XD0A 5SWQA 1HZHL 2FECL 2EYSA 4DEPC 5HVHB 3OAZK 1G6RL 2NT1A 2WVUA 1QEWA 2YKKA 4QRTB 5T3XE 1C9SA 3MLWH 5D7IF 3V5DB 2A73A 1NC4A 3VACA 4BFJA 1MRCH 3PDGA 2OZ4L 3VXSE 2P42B 2PPAA 1UZ6F 5DSCA 1BREA 2CM6A 3OF6D 5DEFA 2XJLA 1BZDA 3D0LA 1CI3M 1GMIA 7FABL 4HAKA 4U2ZA 4LPWA 4NOBA 2W1NA 4TVPE 1OCCB 1UM4L 4IDLA 3NACL 4JFPB 4PW9A 5KYWB 4D0CA 4ZOEA 2UY6A 5CKGA 1ET8A 1OV8A 4JKWA 3ZHNA 5HYSA 1IBZA 5F7AA 5FV1L 3ECBB 3MV8B 1KYFA 2VSKB 1XBDA 1O0VA 4GKSA 4YHZH 1GCFA 5FO9A 2DLHA 4JY5L 5D1ZB 3S35X 3ULVF 4OZIB 2R27A 3RX8A 3VUAA 1D5BA 4CAGA 2JCCB 5L4IA 4L8SB 2C7UA 1HFUA 1QOKA 1YQVL 2H6PA 1RZGA 2XX0A 3FB7A 4MAYB 3NN8A 4IRSB 4OUUB 4PJGB 1HJBC 4HCGA 4KO5A 4N2MA 4WKXA 1KXQA 3VD3A 4GKZA 2DMGA 4MXVE 1OE2A 3FRUA 4J3OH 4I13B 2TAAA 1NFDF 2WO3B 4FFZL 4JFXB 2YKLH 4NRXB 4FLQA 4R2GB 1FGVH 2B7DT 4GY4A 1N10A 2DRUA 4QKXB 2VQ4A 3BGMB 5B8CC 2YSSB 1I3RB 5E5RB 5IREA 2VR5A 1AP2A 4FNLL 3MUZ1 5DZOA 4PRIB 3U0PB 3MZTA 4NZUH 1AMXA 3W9EB 2VL4A 5BJTB 3LKOB 1QWUA 1UXWA 1S5HB 4OJDH 3W3BA 1TEGA 3E9TA 2NLJA 4WJKB 5AOJA 5KSVA 1V27A 4NCDA 2BRRH 3W5MA 3FTVA 3V55A 2XQYG 3KPSA 3L5WB 5HDQH 1HYSD 1P7BA 1VGEH 3FL7A 1YEDA 3KLKA 3MTRA 3FU9A 4JHBA 4QCIA 4XE5B 1D7CA 4LVNB 1IBFA 2MQCA 4ZUUB 5FR3A 1CYXA 3GSWB 3IDXH 2BZCA 1A6VL 1KT2B 4D9QE 3OZKA 4ZMNA 4Z8FL 1ICTA 2BFGA 4CSTA 1BMWA 1U8KA 3HBZA 3RA7L 2IC2A 5E8EB 1MFDL 2ENJA 4NUQA 4P2QA 3D51A 5CJ8A 1KXQE 2P5ED 2MCG1 4AEHH 5I75C 1BEYL 1BOYA 4KPHH 4PLJD 3EGXA 1DDHB 5I6LA 4LASL 3BIAX 4NXSA 1KTBA 4GH7B 1DSYA 4TS6A 1ET7A 3QIUD 3PAYA 5I1KL 2UZIH 4U05A 4JPKH 3NFPB 3WLWD 4FMKA 4WHCA 1EH9A 2VL5A 1I3VA 2ZOKB 1RZIB 3IBEA 4Y5VA 1A3ZA 1G6RA 3LVEA 4E9RA 1I8IB 1DVFA 4YPGA 1TU2A 3QT2A 4HIXH 1BZQK 4NRYA 4UM9B 3G5XA 3ZQ9A 4GXVL 3K74B 1EFXD 2XN2A 2BNUB 4D8PB 2Z7ZA 3MRNB 5J89A 1KACB 3KPSE 4G7RB 1LE5B 4GT7A 2IBGA 2VN6A 5ID1A 3TBTA 4WV1B 4FS0A 4JM0A 2BHUA 2FO4B 2OJZH 3UC0L 4Y5XC 5CD3A 4ZMTA 3QJTB 3Q05A 1TLKA 2BVYA 5F93C 2QZQA 4MA8H 5GGQH 3FFCD 4F2MA 3MLVH 5KSAD 5I6NA 3GMNA 3RBSA 2AJYH 2WOYA 1UD8A 1EV2E 2ATPA 2HG5B 4Y19A 1PX4A 4Y5XA 3HLKA 5BV7L 1U8LB 3PV6B 2OMBA 1GW6A 4A2MA 4MDIB 3TH3T 4UV4L 3V0IA 4C56D 1OARH 3BPOB 3DURB 2IFGA 4N86A 4H8WL 2O6CA 1X5YA 3NJKA 2QQLH 4XPTH 2GUOA 5AYUH 4EOWH 5DD6B 1C5BH 2XVGA 4LSPL 4OF7A 4FFZA 1HSAA 5T1DL 2YAMA 2YD6A 5C0GB 5IMMB 5I74C 3KXFE 2C9VA 3CVIH 4PLJC 4QLRA 4XMPL 1LMKA 4WFGD 5T5NF 3ZDZF 3FQUA 2CPUA 4YZFE 1QR4A 5FYJD 3SD2A 2HH0H 3VFWA 3H53A 3QIUC 1UKTA 3FC8A 3QWQB 5GRXG 4F7EA 3EYSH 4OM0H 3WLWC 5FPIA 1G9HA 4OLVL 4K94L 2CA4A 5TE4H 1QW9A 1YDPB 2R39A 3AZUA 4FZ8L 4OD1L 3ULSA 5GS1B 3M1CA 3CFTA 3NVQA 3GI8L 4KXZI 4M61B 4YHNA 3W38A 1FCGA 3GSNH 3PHQB 4JFHD 5KAQG 4KFZC 3BDXA 2WNKA 1I8KB 2BWIA 2JB5L 3P4OA 1S4IA 4F2ME 2WB1A 2XV3A 4PJ5A 4Z7VF 4AH2B 4GUPB 1ZOXA 4JZJC 5CBAB 4WU5B 2YD3A 3RVWD 3VXMD 1NIDA 5LHDA 1XCTA 3PFQA 3M17B 2V17H 2B1AL 3VGGA 1RL1A 3MC0A 4LOUD 3SCMB 1CQKA 4N2LA 2IH8A 1P4BH 3C75A 3QHFL 1A4JA 4JZJA 1PFOA 3QEQB 3SYAA 4TSBH 5CWSA 3FT2A 3QR1A 3ARWA 1JZ5A 4JFDB 3RIAF 5IBTL 3KM2A 4JN2B 2FLRT 1RI8A 1C5CL 4L5FE 3NA4A 3TU6A 3OKYA 4KDTA 3PL6B 4MQSB 4OGZA 5CEYB 2Z8RA 3FW6A 3FMGH 1AAJA 3NH7L 1Z5YD 1CK0H 1T20B 3EFOA 1HHKB 3T8VA 2YFNA 5C0AD 3GXIA 3T09A 5DUMH 1J05B 3U7YH 3ZYZA 5D7JC 4WAFA 1KCRH 5IT2H 1FNLA 4XBEL 1HOEA 1H8SA 3BWUF 3Q1SL 5F3BA 3GYRA 3CFKA 2AK4A 3TZVB 1KJ2B 4ZW7A 2VDLL 2ZCZA 3LEYH 3GZKA 1YQ2A 3DVNA 1BQRA 1JGLH 1JXJA 5D7JA 3V4VB 2PWDA 4PJ5E 4DP0X 1TVDA 4A2EA 2JTDA 3JBG7 3CFMA 3ULUH 2XZQH 5DUBA 3N5AA 1QKZL 1PSKL 2FIKB 3EOYG 2MH4A 1CQYA 1RIUH 4JE0A 2XA8L 5J6GA 4ACTA 12E8L 2J3SA 4Q7DA 4OCWL 5DEGA 4L37B 3R06A 1DFBL 4KQ4H 1H5BC 1QNIA 2CALA 4EIUA 4FNUA 4CDHA 1X5MA 1EAPA 1CFQA 3B56A 1CD9B 4YEEA 4K9JA 2DD8H 2J6EH 1GW0A 1BBJA 3PQYE 1X44A 1Z6JT 3CFEB 1G9NH 4JRYD 2F19H 1T1ZB 4KO7A 3V52H 5IB3A 1H8NA 2NZIA 5B1CA 5I6KA 4BFGA 3WFCL 2ICWI 1FYTB 4GRLB 1ZANH 5MERB 4C4KO 3DYPA 3O3EA 3KE0A 1E67A 1Q1PA 5FWQA 1U4FA 3O41A 5IW6A 4X42A 1DN0B 1OWRM 2BIOA 4Y2OB 5E08L 4P23B 1PL3A 5IFJA 2VM3A 4LLUA 3SBRA 2AHIA 1WK0A 3LV3B 1ACYH 4UAOC 1GGYA 4MMZB 4GLRH 2AK4E 4ZT1A 5TJWK 4QNPE 3TBVB 1SNRA 2OXGB 1AZBA 5HGHA 4PG2C 4GI8A 1JV5A 5JO5B 3FN9A 2BIMA 4J2QA 4Y1AA 3CX5J 1QLRA 3QPXH 1KIQA 5CLZA 1BF2A 3K3QA 2ARJA 3DX6B 3IAQA 3EOAB 3PDDA 4UT9H 1WHOA 1AI1H 2IDFA 2Z8VC 1XGQB 3QXAA 4N1CA 5DJZA 1EEYA 3SDAA 1MDTA 4HX1A 1C8PA 5INCA 3R8BB 4YMPA 3HIZA 3UO1L 1IGCL 3FRPB 5HJDA 1UGKA 1BIIB 1WAAF 2K3TA 2WLIA 2HB0A 3DJZA 5AAMC 3VU2A 5C0AA 1MI5A 3UX9B 3MRLB 4OV6F 5C09D 5C0BB 1WBYB 3RG1C 4QOKD 3JVGC 1GYWA 4E9VA 1AIFB 1FGVL 2F7RA 3DI3B 1XF3A 2EDBA 4LSUL 4OCNC 5BMFH 1A66A 4OGYH 2DJUA 4LEOA 1PG7X 1Q94B 4AMKH 3LQAH 5JW5A 2WZPD 4FE9A 1WDAA 3VCLB 4NZUL 1ORQB 1W0WA 1PQZB 1BHGA 4XCEB 5T5FA 3ZUNC 5KSBF 3GI9L 4G7VH 4MD4A 4LQFL 4K7PX 4G6MH 5IMOB 1FPTL 2BW5A 2IXQB 2BRRL 4KXBA 2AQ3A 4F7MB 1VGEL 4LDOB 4D0BA 4ZPVA 4ZOAA 4IBVA 2CZNA 1W0YT 3GPEA 3RWIA 3OAYH 4P5KA 2VMEA 4I7ZC 1UA6H 5AOZA 3S96A 5H2BB 1TQSA 1YNTA 3EOTL 4AE0A 3C8DA 4J28A 4Y1AE 2K8QA 3IDXL 4QHUB 3WE1A 1Z9OA 3SKJH 5B3JE 4TNFA 2QGBA 4X7EC 4P2RB 4P59H 5DMIL 2JXMB 3T3PB 4F8TA 1G5AA 4P4KB 4NUJB 4OV5B 4KTEH 3D69B 1J48A 2PXYD 4AEHL 3ILDA 4KPHL 2CK0H 4OCXL 5JW4N 1IQWH 4PTUB 3H9SA 5I71B 5KZCD 1UB5A 1LEIA 5ICXB 1I7UA 3DJ9A 1VJSA 3O6LL 4UTBH 3MRMB 1MI5E 4N1HB 2JKRM 4Z78A 4KV5F 4JHWH 2RB8A 4LFHG 3DRTA 4KROB 2XY1A 3WEMA 2HWZH 4G6JH 1IARB 3CMGA 3LOWA 4AUJA 1TQCC 2P48B 4AJWA 4KKCD 2VABB 1K6QH 1T4KB 3IDNA 5B38B 1P2CB 3UAAA 1KLGB 3GJFA 2EICA 3E80A 4I77H 1H19A 4WSKA 5BUAA 1G7JB 1NEZA 3IFOA 4PEEA 4L8DB 2JQZA 5EU5A 4BWUA 2BJMH 5IBUG 3P4LA 4X50A 1CE1H 2YAHA 4D9LL 5J12B 4UIMB 4AIZB 1DQJB 4QRUB 4YR6A 5SX5K 3GJEA 2A4CA 2GFBB 3T8MA 2D7OA 3MR9B 5GS3A 3MLUH 1JF1B 4ZD3L 4I1PA 4OCYH 2RA1A 3TLRA 2NCMA 3CFCL 2D0HA 5D1QC 3DGGA 3WMQA 3HG0A 1DBAL 4QPEA 2OJZL 3T2QA 4NAQA 3QDGD 1YPZB 2X10A 1QZNA 1W0VB 2VZVA 3QJRB 1U8IB 1F4XH 5GGQL 4PVMA 4PJAB 5AW0B 4URKA 2AJYL 3OB0H 5D1QA 3SB3A 5D7KD 4M7LH 3EJTA 2P7TA 1SJHB 3HUJF 1P5UA 1PY4A 5T1LB 2B15A 3HE7D 3UFIA 1X6LA 1CFMA 3H9SE 3HNSH 4JHAH 5JXED 2CCVA 1LD9A 1OARL 1FNEB 4F57L 3WSQH 1M05A 1MQKH 4XPTL 3VTAA 1R4XA 3D09A 5AYUL 1P7KB 3K7UA 4HUKB 5KBNC 1C5BL 1NUNB 1ROCA 5L8JB 1CFNB 5KSUB 1K8DA 3GDBA 2ICEC 2VDQH 2VDPB 3DV6A 1T7XA 5CJXA 4EKXA 5H8DA 2PXYC 3FQRB 4DF9A 3FH7A 4XO9A 1OD9A 5C86A 4FG2A 1FH2A 3GLDA 1YEFL 1NBQA 2HH0L 3FUKA 1JZEA 2BRQA 2WYIA 4UDUB 1U58B 2E86A 2ICEA 4PJXA 5AG9A 1AJ7L 1NGZB 3EYSL 4H0LC 1WZAA 3MV9B 4XVOA 5DDHB 4AV4A 4MS8D 2NT0A 1DUZA 4IU2B 5EZPA 1LO0L 2F68X 1UD6A 1W91A 3POHA 1DEEB 3CVHA 4JFEB 2VISB 3QGVA 3VMPA 2ATAA 4HD5A 3EYUH 2FAUA 3D85B 1ZT4A 4D7PA 4KHXH 5CJQH 5FO8B 1L0QA 4E41B 3CK0L 3NJIA 4LNRA 5HVHC 3PIQA 2N1TE 2P80D 4U1JB 3P30H 2Z1KA 1IM3D 4NO0B 4XPFH 2G75B 1FBIH 4DZBB 3WUWA 3BXNB 1I9JL 1BBDL 5I1EH 5ISZB 3SJVB 4MYWB 4QF1B 4Z95L 3ZGIA 3D3VD 3KBHE 4QRTA 5AYQA 5TK2A 4X7SL 1IFHL 1U91B 1ZHBB 4TSBL 4I48B 3V5DA 5ITBL 1VAHA 3KLAB 3C12A 4J8QA 5DZVA 3IFLH 3O2VH 2QV2A 3A4DA 3D4ZA 2NZ9D 3HE7C 3GMQA 2A9BA 3HZYA 1GC1H 4YXKL 1KTRL 4HISA 4NT6A 4P9HH 2MHAB 4FP8L 1CL7I 4JFPA 5D1ZC 1UJTA 5L2JB 5KYWA 4PJXE 2K6ZA 1INEH 1DP0A 1SOXA 3HHMA 5L9DH 3U1SH 4B50A 2CUMA 1AR1B 4WNSA 3KCWA 4IRSC 3U7YL 3B37A 3KLSA 3ECBA 1IILE 3MV8A 4AV0A 4F2FA 4GP5B 4P3DB 3EFFB 3D8MA 3K5RA 1YYLH 2YUWA 1RFDH 1CDHA 3VG9B 5D1ZA 1XWVA 1ET5A 3WMPA 4OZIA 4JFSA 3QFDB 4H1LG 2JCCA 5DWUH 1MWAB 3H85A 4L8SA 4BHUA 3IMWA 4RESB 4GAGL 4MAYA 1KPUB 4IRSA 3LEYL 4IOIB 4PJGA 1JGLL 4Z7UB 1E9QA 2P28B 3F5WB 2R0KH 4PRPA 4GW4B 2VIRB 2X6AA 3K6IA 4MS8C 5DEZA 3BQUD 3VA6A 3ZPDA 1JYWA 3ESUF 2XZQL 4H8QA 2V8MA 2PTVA 1A7NL 3CTTA 4JFXA 4NRXA 3ZHFA 5FYKD 2DMKA 3A67H 2DM3A 4KQ4L 4ODXB 3X3GH 3BGMA 2YSSA 1MDAA 1I3RA 2KL6A 5BZXA 3IMUA 3ZDYF 3FTXA 1S7UB 1ZTXL 4PRIA 3U0PA 3W9EA 3DV4B 5BJTA 3N6YA 5E5MB 2N1KA 1JSYA 3LKOA 4DAGL 3IFPB 1S5HA 2WQRA 4O9HL 1E4WH 1UGNA 2F19L 4Z7WB 2P43B 3MZGB 3V52L 5EB9A 1KCWA 2K1MA 2NY3B 4I5BB 1ONQB 3L5WA 4PRBB 2OJEB 2VXQA 1AR2A 5DVPA 5K33A 1YEKH 1R3IL 2FWSA 5DS1A 1NCWH 2FUTA 3NIFF 3MV8E 3WHE0 4ZUUA 3R0NA 5J6HB 4GSRA 2NZ9C 4OZIE 3GSWA 4LL1A 1OPOA 2SODB 2JCCE 4IGBB 4CADB 4NEHB 1SYVB 2D3VA 5JTWA 3PAUA 3MA7B 4PJGE 5E8EA 4TRPL 5GGVH 4E2OA 3QPXL 3F7RA 4PRPE 2A9DA 4I0PB 1DDHA 4UT9L 1AI1L 3K2IA 4N2AA 4PW3A 5CZXC 1VFBB 3DHJA 4KO6A 4X6CA 2R29A 3VFNB 4G9DB 1K3ZA 3NFPA 4RZKA 1AZRA 2GC4C 5B39G 1HXYB 5DHVH 2VW4A 1RZIA 2ZOKA 3D2UB 4B95C 4LPTA 4FJYA 1MAJA 5IVNA 1AG6A 5H94B 1I8IA 3K6FA 3QUGA 3O3BB 4PRIE 4ZX4A 3JWOC 3BQUC 1NGPL 1NANI 2ALWA 3D9AH 1THAA 3HS0C 3QNZB 4UM9A 3LQAL 4B5EA 4Z7OB 1RCYA 1SHWA 2EH7H 1UEMA 4NJ9H 4NKDA 3K4DA 4WV1C 4YL9A 4CVXB 1ACXA 2BNUA 4D8PA 3MRNA 4DPBX 1BAGA 5T5NG 4DERA 4XMXA 1LE5A 2PW1B 4G6ML 4M48H 5CEZD 4JY6B 1GS7A 2X12A 4JFDD 2XQBH 3QDMD 3BSGA 2R0WH 1JYVA 1QWHA 3VFGH 2I9TB 3BESR 4WV1A 5AKTA 4N8PA 1JXGA 1F02I 2FO4A 2LU4A 1NH6A 2WVTA 3JWNH 1MUJB 1K72A 4LGRB 2FWUA 3PL6D 2CA3A 1DQML 3C8KB 5GRYA 5K9QG 2Y24A 3HG5A 4G6FD 4OY9A 3VGAC 1GOGA 3TCLB 5JYMA 4KGLA 2HG5A 1WISA 4PGCB 4YDKH 1U8LA 3PV6A 5B1JC 4LL4A 4MDIA 4P59L 2FJGB 3L08A 1AGFB 4X6CE 2Q86A 3QK0A 3DURA 3P77B 4LEXL 4FFWD 3CAFA 5F97E 5CO1A 5DD6A 4JKPH 3V9EA 5E6UB 3LH2H 5SX4H 4IHBA 2J88H 3D12B 4Z76B 3H1ZA 1TO5A 3SE9L 5C0GA 3RY4A 5IMMA 2KZKA 3GXNA 3I50L 4G6JL 3NPSB 3NCJH 2EE6A 1IGFH 1EO8H 1M6UA 3K6SB 5B1AB 2CUHA 4KTGA 4BBWA 2P47B 4X6DB 2ATKB 4BZYA 4CSSA 5D55A 2IWGA 2X4RB 2BJML 3QZWA 1H15B 1YDPA 4FC3E 5GS1A 2BWQA 5F1OB 3JYBA 4M61A 3U7WL 5E23A 4Q0XL 3PHQA 1B90A 1MEXL 1A6WH 4WDIB 3MLUL 3G5YB 1A6UH 3M8OH 2KLSA 4U4BA 1I8KA 1P7QD 4OT1H 2QHRH 2V9RA 4LCWD 4PBXA 4GUPA 5IFHL 4KKBD 3GSUB 2VAJA 4NZ8A 1VKXB 1OAZH 3PHSA 4WU5A 1NGQH 1UATA 5CBAA 1UA3A 1GYCA 3SKOB 2K4AA 3AC0A 3M17A 1NFIB 2YC1B 3BJLA 5EIVA 1DBKH 4U7MA 1VHPA 3SCMA 1GOFA 5GPRA 3SPJA 5EO0B 1JIBA 1D9KD 3INUH 1B3JA 3B2VL 3FUFA 4TQIA 1KJ3L 3V0JA 3PL6C 4LKCB 3QEQA 2VR6A 3HNSL 4JHAL 3MDJA 5D7LD 3FT4B 1NCOA 2CH8A 3CQPA 3TIEB 3WSQL 1MQKL 4FXKB 4JN2A 1JGDB 2CNZA 4K9EH 5IUSA 3MRKB 5IM7A 1CE6A 1A9VA 1XB8A 2DM2A 4HS3A 4TNEA 5DFWH 1NC2B 2WBWB 5CEYA 1CTNA 4Q6KA 5D96B 4AWJC 1ZTXE 2J5WA 5IHUL 3BPCB 3QZLA 4FFWC 1T20A 1HHKA 3RVUD 4FQXB 5FLVA 2NYKA 2JNZA 1ZLVH 1J05A 2C9PA 3BGFC 4DEUA 4PJ6A 2WMPB 2BS71 4WI0B 4R96B 1F2QA 1CXIA 4WEMB 5A2JH 5HYJB 2L8AA 1MY5A 2W9DH 1E28B 1KXVA 2H0PA 2OBGA 1U8QB 4KZ0A 3TZVA 1KJ2A 3WKYA 3PAZA 3P9MB 4B6ZA 3V4VA 4NQDD 2FQFA 5DZJA 2OX5B 4FQHA 1HCVA 1UC6A 2NY4D 3JWDL 2H32B 3HG4A 3MLZH 3N50A 5L4FA 4UM8B 2PWGA 4KVCH 1ZVHA 5JOPE 1J5HA 4DGVL 4NC1E 1JHKH 4UOW0 3TYFB 5C2UB 1JYNA 1KBGL 2FH6A 4QYOB 4C4UA 4TL4A 1MJ8L 5LO7A 2FNBA 4L37A 4PJIF 4XR8C 5I1EL 5KYXB 3BO8B 1UM5H 1A65A 1WFUA 1W80A 4POZD 1MHHB 1NDTA 2CHZA 3MACL 2EVGA 3O6KH 3ABMB 1BECA 1NBVL 4KKBC 1SOKA 1DVZA 1PNDA 1O5DT 4OLUH 1KV7A 3CFEA 2YJQA 2E9WA 3BWSA 5T3ZH 1RHFA 1T1ZA 4RIRB 5E03A 3QEGH 3IFLL 3S36H 3GMMB 1EMTL 5TK4A 4YBLB 1FYTA 4GRLA 4AIEA 5MERA 3HI6H 1T0NB 2EC8A 1JPFB 1BAFH 4LDLB 2EYTB 3IM1A 1DN0A 3WTTA 2X3CA 5IVXF 3VRLE 4DVBB 3W2DH 3WIIH 1G87A 4Y2OA 6FABH 4P23A 2JJSC 3QYCA 1Q72L 2D7TH 5C8JA 1RURL 1TIUA 2G5UA 2CBOA 3LV3A 3SPCA 4MMZA 4F1SA 1V3JA 3MBWB 2LU3A 1U8OB 4F9PC 3TBVA 3E7JA 2OXGA 3ALPA 1RFDL 4I2XB 2B1HL 5JO5A 2OYLA 1L9RA 2COQA 4WK0B 1AYRA 3DX7B 2JJSA 3RL2B 3DMMD 3DX6A 3RVUC 2LE9A 3EOAA 4QTHB 2G5BA 2D31B 1R5IB 1XGQA 2C8NA 1A0QL 4M6OL 1URIA 4OGQC 5AB0A 3UPAA 4FQ1H 2IDUA 1UCBH 4KXDA 4XCFH 3O0RL 2CKBB 4N9OB 2NSXA 3FRPA 3ECWA 4JRLA 1A1NB 4UT6H 1BIIA 2O93L 2HKAA 4OIAA 4PS8A 3MRLA 1YJDC 2X5PA 4AW4A 4HWUA 1WBYA 5C0BA 4I9XA 4XNZC 3WJLC 1AIFA 2C34A 5LAXB 3FYIB 1XL6A 1TR7A 1JZDC 1DYZA 2IQAB 3I3DA 1Q94A 2PWFA 3Q8FA 1CU4L 4QXTB 2ZXDA 5CR8A 4MNGB 4GSQA 3VCLA 1ORQA 3L4XA 1PQZA 3EW3B 4XCEA 2Z92B 4H2AA 3WJLA 1A5FH 3PG2A 2DQCH 1WH0A 1E4WL 1FYTE 1RUAL 2XKNB 4BFNA 3CXDH 4POZC 2DYPB 2IXQA 4GMSH 4F7MA 4PSRA 3N1MC 5D5MF 1YYMH 1N26A 1UM6H 2E3VA 1YEKL 3EADA 5BZWB 3AGWA 3AU1B 2NR6D 1A3LH 4K7FB 4WHDA 5BS0E 1N3NB 3G6JB 3Q0HA 1E5AA 1W72B 4PVNA 4ZX3A 1HE7A 5H2BA 1X7SA 1ETB1 2Z9TA 3UROR 2NXZD 2UXGA 3L5XH 4QHUA 4JDZA 3RWHB 5L6YL 4W9JC 1HQ4B 2V3FA 4P2RA 3OG4B 1E8XA 4I1RA 3DUSB 4P4KA 2DLIA 4XB3A 4OV5A 1KXHA 4MTMA 1JRHI 1MVYA 2HJKB 1DANU 5KW9L 1SMOA 4N6RB 4PTUA 4BQ9A 2WLJA 2XVKA 2E47A 1SM3L 4J3TA 5ICXA 5JW3H 3MRMA 1CD1B 1WCBA 2CE6A 1ANUA 2CM5A 5C0BE 5E2WL 2ZUVA 3LEXA 4HXAH 2BFVL 3DMMC 4EXPX 1MFMA 5GZNA 4XZUB 2JIXD 1MCNA 5CP3A 2VABA 1T4KA 5J12C 3HMWL 3RGHA 5B38A 3BKMH 3FFOA 1EJOL 1KLGA 5DVOA 2Z0UA 4L3FA 3GNMH 3WJJC 1G7JA 1MCJA 4FFYH 4POUB 2G4GA 4L8DA 3L2LA 4PS3A 3D39B 4OIIH 3H8NA 4P2OA 5IQNA 1ADQH 2ZUTA 4R3SB 4UIMA 4AIZA 1DQJA 4MQTB 1XSOA 4QRUA 1IO4C 4UAHA 2GFBA 3RURA 3MR9A 4M48L 4DQOH 1CG9B 3HHRB 3WJJA 4HIIB 2XQBL 5DS8B 4PV8B 2R0WL 3W57A 3VFGL 3S3BB 3O4LB 4OF5A 3ZT5A 4DIXA 1EA9C 3BYYA 2DJMA 4I87A 3EJUA 2CHXA 1YPZA 1R75A 43CAB 4BZ2L 4IKJA 2J6WA 1F86A 1LDPL 1W0VA 4PG9B 1CBVL 5GGVY 4UOW1 2RCSH 2OJ1A 3DJSA 2CLVB 3APMA 2K8MA 3R4RA 4JM2D 2R1XB 4D94A 3T3PE 3UGEA 3FPYA 3KJ6H 4XPHL 4G83A 3V5HB 1SJHA 1EZLA 3NCWA 4YDKL 1AR1D 5T1LA 2J8HA 4HU2A 4WW2B 5E6IB 2GSIB 2NR6C 2K6WA 2WWKO 1QATA 3CBKB 2NY5L 1J1OH 3TL5A 4DEWA 2HX9A 3N9GH 4P99A 4MYPA 1KGIA 1FNEA 2CDGB 3CX5K 4J1UB 1BQLH 2BSRB 4HZ1A 2V5YA 1P7KA 4E42B 3TTYA 4IEFB 4JVPA 1JHLL 3IU4H 2NXZC 3LH2L 2RQEA 2I07B 4XZ4A 1CFNA 5KSUA 1UWXH 2AQQA 2EADA 2ZYHA 4R26L 2ZUXA 3BVTA 4ZSOB 4FQLH 4RBPH 3TF7C 1IGFL 1GY1A 2NUTB 3FQRA 3GRBA 2AZUA 3HR5A 1SHMA 4M5ZL 1LLAA 2W95A 4JDTH 4UDUA 1U58A 2XIBA 3ZR5A 5BUGA 1CIUA 1NGZA 5DDHA 3MV9A 2V2WB 3GINA 5F7UA 4IU2A 3GEFA 1B2WH 4HWBL 2JE8A 3VFVB 4IKLA 3P2DA 1DEEA 4YIQB 4JFEA 3AREB 2VISA 3LMJL 2IH9A 4JM2F 4MJ6B 3D85A 4Y16B 2CCLA 1YPZE 5FO8A 3WTXA 4E41A 4QTIL 5J11C 1Y18B 4OT1L 2XRAL 1GZPB 1IGJB 1XGZA 3MCYA 4TVPD 5E2TH 3EH3B 4U1JA 5EBLB 3TWYA 4NO0A 1MIMH 2G75A 1P0SE 1NOAA 2GT9B 4L48A 1XXDC 3QAZC 3R7QA 4DZBA 3RBGA 3ARPA 5C9JB 1NGQL 3AU0A 2FO8A 4JQVA 3BXNA 1OP4A 2Q1EA 4Y4FB 5ISZA 1DBKL 4N87A 4P2AA 4QF1A 2Y7MA 3SJVA 4Z7UF 1JD9A 4TUKL 1OTUD 3K91A 1U91A 1IKOP 3BKCH 1RJYB 1SVZA 4I48A 1OCRB 5IKCB 3J8F7 3KLAA 3NJHA 5BO1H 1XCXA 1GJUA 3CZJA 4JM2C 3UTZB 4K9EL 3WNPA 4GS7B 4I0PD 1AE6L 1AR1C 1RULH 2AABL 3IVKB 1SF5A 3SPVB 4WEUD 5DFVD 1A22B 3WAJA 1AXIB 1SMAA 3IJYB 1YA5A 2MHAA 1LO2H 3N55A 4TPRL 3VG9C 4Z18A 4M7KL 1LM8V 3MV9E 3SSGA 3D2UD 1WRFA 2DTML 4AYGA 5L2KB 3QUMH 1RZJH 2IDTA 1ZD6A 1HN1A 4JFEE 2NNCA 5AOKA 3EFFA 5IIEB 4HPOH 3RKPA 3UBHA 4P05A 2VM4A 2FJHB 1VPOL 1YC7A 1MWAA 1LP9F 3PGFL 4LP5A 4GW1A 2J1WA 2D3NA 2X1OA 4HW6A 3K72A 1KPUA 1UKQA 4IOIA 1RIHH 2B77A 5F2FA 1H3XA 3F5WA 3QW9A 5E8OB 4GW4A 2VIRA 3F65A 5I5JA 4KY1H 2CO7B 4I4WB 3RZWA 1FF5A 3BPNB 3VXTB 4HLEA 2XETA 1C12B 5A2KH 2K4WA 1GJWA 5FGRA 3BP4B 5LWYH 2A0LC 4BZ1H 1UOVA 4J6RH 4HUXB 4FL4B 4I3SH 4JKLA 3QJOA 3SJVE 5ISZE 1ZMYA 4A04A 5DO2D 1JZ8A 4X9FA 1ZS8B 1O6SB 1IVLA 4ODXA 3BFOA 4MXVF 1YEEH 1RD6A 3SGJC 2ZKYA 4YE0A 2F5AH 2NY3C 4BINA 3ILEA 1EEQA 4A55A 5IR1B 3O6KL 3IDIB 1S7UA 4HC1A 4PAZA 4XVUD 2LU7A 2RR3A 2F15A 1HL9A 2ZX5A 3DV4A 4HMDA 3ARZA 3AY4A 5E5MA 1NWPA 3I02B 1NCTA 1VA9A 5T3ZL 4X80H 3BD5A 3FH5A 4Z7WA 3VGEA 3QEGL 3N04A 4GXUM 4H2CA 3S36L 4I5BA 1LO3L 1FFRA 1R17A 1ONQA 1PU0A 4PRBA 2OJEA 3AWGA 4NC0B 4YN3A 3JZYA 1OTUC 5EBMA 1HESA 3HI6L 5ITFA 3TEZA 2B1OA 4CC4A 2HP4A 4QEGA 1IM9D 4M1CD 1BFSA 1VFAB 1GKOA 2D7TL 5J6HA 2PWEA 4I0PC 2K9UA 3IJEB 4HWBA 2A9MH 3TJPA 3CG8A 4AIXA 1MJJB 4IGBA 4CADA 5DFVC 1SYVA 2D2CC 2LHAA 4K8RH 5LXGH 5I30L 4DN4L 3MA7A 4S1RH 2NTFB 1G7QA 1PZ3A 1OGAB 1GOHA 1O9ZA 1Z66A 3DOHA 1HCFX 2Z31B 3N3EA 3QUKB 2GQHA 1VFBA 4OI8A 3DUUB 3BHBB 2D73A 4FQ1L 1UCBL 3VFNA 2BSSB 4G9DA 1JZ2A 4NZJA 4GUOA 4UT6L 2O6PA 3BUQA 3ZE0F 3IRPX 3PGDB 1J87A 4PREB 1AY1H 5JPNB 3U4EA 5H94A 4RX4A 3ALXA 3O3BA 2AEQL 2OMWB 1FWXA 1H8LA 3WXWL 2CGYA 2YK1L 3PUUA 3D34A 2XTJB 4CVXA 3DI2B 2ZOWA 3FQ1A 4FHBD 4Z7WE 2V5TA 4ODUB 4A2DA 4EDXB 1A5FL 5DO2C 1C08A 1GRWA 4AEIH 1QUNB 2PW1A 1NCGA 3KCPB 3TCXA 5DMJB 4JY6A 3CXDL 4CW1B 3FOLB 3H9HA 2VO8A 2X7LB 4J3VA 1II4E 1XH2A 4NIKB 4GMSL 2I9TA 4LLWB 4XVUC 4F58L 3KXFD 1IC7H 5BQ7B 4L4TA 1IKNC 1MUJA 5G4OA 4Y4HB 1WO2A 3L7EB 5JOEA 3C8KA 4WO4D 1H3TA 1VFMA 3FTYA 1DSFH 5I16B 2AJXH 4IRZA 3TCLA 1WPCA 1QLEH 3UMNA 2X9XA 4PGCA 5ILTL 1Q1JH 1HTYA 2VB5A 4M1CC 3Q2VA 1AGFA 3Q8EA 1NCHA 2BINA 1JPGB 3NPSC 3SDYH 3P77A 4HS6B 4Q2ZB 1NAMH 1F4YH 2B0SH 5DI8B 3BZFB 1XEDA 4Z76A 2Q7NA 5EEZA 3NZ8A 4LCIH 1X5JA 5HI5D 5A6IA 4JQXA 1E3ZA 3K6SA 3WKMH 4BGLA 1UUSA 2BOBA 5EZJA 3BKML 4X6DA 2ATKA 3K46A 4ZYKA 1CCZA 2VN5A 5DURB 1YAIA 3GNML 2X4RA 1DCEA 1U3HB 2YOAA 4F5CA 4ENED 1F58H 3KJ4B 3KZ8A 1H15A 4QXUL 1FFOB 4HHAB 1WZLA 4IBSA 5CINH 2ZF9A 4WDIA 4L4TE 2AQPA 3G5YA 1KEGH 4F93B 3KAAA 2WUBH 4JKKA 4OJFH 3OHMB 2WP3T 4TSCH 3GSNB 5EU7C 5ICZB 3GSUA 4MB4A 2VXSH 2VXVL 1VKXA 2AAVA 5E6RB 1ZJBA 4KI5E 4OLZH 4U3HA 2J2ZA 3NJXA 1P9MC 4RETB 3SKOA 4B9ZA 2VDMH 3W56A 1NFIA 2YC1A 3Q44A 3FHEA 3QXDA 4AK2A 4YSQA 3OSVA 3KJ6L 1N6QL 3EO0B 3NIGB 1CLYL 5FHBH 2XN9B 4UANA 5DT1H 3P0VH 2MNJB 5EO0A 4NHCH 2G3XA 1KIUB 4LKCA 5AD0B 1AACA 2WQXA 4JR9L 1J1OL 4WO4C 5DQDL 3FT4A 5FHAL 4Z7QB 3TIEA 4W6YB 2F53E 3WFEH 2E9BA 1BQLL 4FXKA 1JGDA 1KGCE 3VTMA 2IH3B 2WVSA 2XXGA 3MRKA 1XZWA 3IU4L 1NC2A 4BFIB 5KVEL 1S7XB 5F21B 5SWZE 2QHLA 4JG1H 1CGSH 1MY7A 1NGWB 4X6DE 4X0NA 4AEFA 3BPCA 1CGTA 4HH8A 4N3UA 3NSCA 4FQXA 4XNUH 2YEZB 5FGBC 4F5CE 1XF4B 2EECA 1RZ8B 4JDTL 4HK3J 2WMPA 4YAQB 4WI0A 1K85A 2QEJA 3S2CA 2XZCH 4R96A 1W72L 3Q2LA 5HI5C 5JIKA 3ABLB 5KYYB 4DP2X 3VD9A 5HYJA 3EBGA 2H0JA 1E28A 3IS0X 3PQYD 1U8QA 5LBSL 4PJ7B 4S1QH 4NZTL 2ARWA 3PXHA 4XCYB 3P9MA 5AAWC 4EVNB 4N6QA 2OX5A 4MHHG 4HOWA 4JHZA 4XNBA 2H32A 1MJ7H 5ENWB 4FXTA 4ENEC 5IY5B 3ABGA 4UM8A 5E2TL 4WVRA 3V0WH 2LFGA 2VDRH 1B4RA 1ZHNB 5HJBA 1MIML 3B6SB 2I85A 3LTVA 4UZSA 3TYFA 3VRJB 3U4BH 1LTXA 4C83B 4QYOA 2NPLX 4PRNA 4PVLA 3VH8A 4PWKA 3P73B 3BOVA 4GINA 2HLFD 5KYXA 4YQXH 3BO8A 1A25A 2DOCA 2APTA 1HZLA 3VXRB 4YBLC 4F8LA 3ZE1B 3DVFA 3QDAA 5DXWA 1CDYA 2NY6D 1KELL 2W0LA 4RIRA 5LB1A 2PABA 4S1SH 3GMMA 5I1DB 3MOBH 4KXZH 5IGXL 3HB3D 3Q8CA 3LD8B 1T0NA 1JPFA 2LW3A 2ETWA 2EYTA 3RWDB 3ZQWA 5HD8D 1W8OA 4LCYB 4DVBA 3GBNH 3RHWK 5C0RH 2C4FT 1N5AA 2A99A 2BY0A 2MIZA 5HYJE 1FA4A 3QUML 3T6VA 1O9WA 3PWPB 3MBWA 3EYVB 5DK2B 3S4SB 3GTVA 1YMME 1U8OA 3MJ7B 3VSTA 3KGTA 4HPOL 4CBZA 3F7QA 4I2XA 2PLTA 1CGVA 1S3KH 1BV8A 3DX7A 3RL2A 2QFRA 4XPBL 3WKPA 1BP3B 3GIZH 4ZQKB 3ZK0A 4QTHA 3WLBA 3GHEH 2D31A 3HZMB 3MJ9H 1RIHL 4X5QA 4QNPF 4FJZA 2FCBA 4MJ4A 4HSQA 4H8HA 5F0MB 1A1NA 2VWEC 2E8YA 2ODIA 1O7DC 5E4EC 1JNLL 4BZ1L 3K6NA 4M1DH 5I8CB 1JFHA 4HBQA 4L0ZA 4WEEA 1V5JA 1CLOL 5D93B 4NKMB 2VMCA 5HDBB 4NQEB 1YEEL 3MCKB 2IQAA 1KPVB 3U0TB 3DVIA 1UT1A 1NCBH 2GI0A 4ZW6A 3QXWA 2YGOA 5D71H 5E5LA 4YXLL 1CR9H 2Z92A 1EK3A 4NPYB 4DKEL 1MLCB 4JO4L 1PIFA 1V3MA 2F8OA 3UDWA 1BOGB 2Y06L 4S10A 1TFPA 3HI5L 2XKNA 3ZYIA 1TKWB 3GMOB 2HLFC 3FK3A 3A6BH 1ECYA 4U1MB 4X4YA 2DYPA 2X4TA 5ICUA 3BH9B 2AEPH 4FQQB 5L4MA 5BZWA 4Q97A 3ARBB 3AU1A 3MGAA 4J3UA 4N0CD 2OK0H 4PCKA 1F4HA 4K7FA 4P5MB 2XN1A 3OB0K 1N3NA 3G6JA 3T4YB 3FCBA 1W72A 4P9ML 3FUJA 3KYKL 3WN5C 1AHMA 2NX5B 4I2XE 1JVKA 5BV7C 5KBPA 2HSIA 3HB3C 5J13B 2TRHA 2R9HD 5LBSA 3RWHA 2FB4L 4XPAH 1FH5H 4JL1A 1HQ4A 5E8NB 3KBEA 2DWSA 3DUSA 1E4JA 4MCZB 3LX9A 5DYOA 2HJKA 4NAJA 1H3WM 2CDFB 1PYWB 1S78D 1IEHA 4N6RA 2XWCA 4OH2A 2BCKB 1I1AD 3ARED 4WY7L 2XWXA 2FX7L 4GQRA 1MN4A 4F37K 4YLQT 2IAMB 2XX1A 4Y16D 4HCRH 1CD1A 2MCMA 3ULVH 4FA7B 2YBGA 5HVGB 5FKPB 2OMUB 3DJTA 4ZFFB 2QPDB 3C5XA 4XZUA 1KSRA 1ID5I 1JHTB 5JR1L 3ZTNH 2P8PB 4FLRA 3OG6B 1FVEB 2BSDA 3VAEA 3PWVB 3MSPA 3CUPB 4Q9RH 4ELMB 5KVEE 1R24B 3KPRD 3D39A 4EJ1C 5KTEL 3OSKA 2FX9H 5LGHH 1IAII 4R3SA 4JB9H 2Y3AA 4AEIL 2WUCH 5BRPA 2IGFH 5KJRH 4J4PC 1CG9A 2Q7AA 4KAQH 5HHOB 4QY8B 5TQ2H 4HIIA 3T8XB 1K8IB 2NY0B 4PV8A 5DS8A 5I26A 1HL5A 3O4LA 4NB7A 3G6JE 1CDBA 5JIIA 2FSDA 2ZYIA 5BPPA 2F61A 4WW2C 1JZGA 4HA1A 3BRDA 4PG9A 3E0GA 3MUUA 4XVSH 1CUOA 1FFPB 1U2CA 4J4PA 5CFAA 2CLVA 5IJCC 3FQTB 3FN3A 1SJXA 4ABUA 2R1XA 4B3EA 1MFBH 1NDGA 2AJXL 4OGXL 2VDOB 3D52A 4O2CB 3V5HA 3NUKA 4JKMA 4LIQH 4XPGH 2XYBA 3Q2WA 5HHMD 1MCPH 2FECI 4GAYB 3N44B 4H1LH 2J8UE 2GSIA 4LLMB 4WW2A 4YK4B 5E6IA 4ABWA 2VT0A 3QH3B 1ESOA 1OK8A 2CO3A 2CDGA 4J1UA 5J5EA 43C9B 2BSRA 4E42A 1CXHA 4IEFA 2ZKXA 2R9HC 4YSOA 4HUCA 3TVMB 1OHZA 2ZPKH 2EIEA 4PJ8B 3REVB 3WS6C 1S7VB 1ZKAA 3OLEA 4LCIL 1TMCB 3IEAA 4ZSOA 4QT5B 1MG2C 2NUTA 1KC5L 1KOAA 1S78C 3CHQA 2ZP9A 1I1AC 3AREC 4ZDHB 4AL8L 1Y1UA 2XZAL 2BVOB 3SGDI 3D39E 4Y16C 1BG9A 4YXHH 5FAAA 3UAFA 4CU6A 3L17A 2Y7SA 2V2WA 4WUKH 4J3OD 3OHXC 3VFVA 1EUUA 3ASWA 4LVHC 4YIQA 3H9YA 5B22A 4Y16A 2OKMA 1OLZA 1ZCRA 1BJ1J 4OJAA 4Q6IC 1F2XK 4NKOA 3ARRA 3BEVB 4Y4FC 4A39A 1Y18A 1S7TB 4OJFL 1GZPA 4XMTA 3UG3A 5AB2A 3BMVA 2GT9A 5DRZB 4DGYL 4DGUA 1DQQB 4NI6A 5J9PB 5C9JA 1MKFA 3WEBA 3GDCA 1BEXA 2VDML 4Y4FA 2CBPA 1F97A 5J3HD 1SXNA 4DFIA 3ESNA 4RGOH 3GXTA 4XNDA 1RJYA 3SBWA 3AFLA 2G3ZA 1MW3A 3OPZL 3OR7B 4GSDH 5GGUB 5KOVC 4A7SA 4DW2H 2XDHA 1QA9A 3UTZA 4L18A 3L13A 2DKSA 5MEQB 1OGAD 3MHZA 4ZSOE 4WTZG 4X8CA 4IOFD 3IVKA 4DVRH 2ZAIA 3SPVA 5CLXA 4J3OF 4FZEH 2H7WA 4JRXB 3EJCA 1TSHA 1CGSL 3OTTA 3CSGA 3IJYA 3LRLA 2NXYB 1KYOJ 3MODL 1R0AH 1QPKA 1NTDA 2BVPA 5GGTH 1K5NB 2AXFB 2R1YB 3HHSB 1KZQA 4HIEB 4Z0BH 1X4ZA 5L2KA 1AKPA 5C08D 2BIIA 3DSFL 2YLHA 2P4AB 4EUPG 1AQKH 5IIEA 5JA9A 2EZ0C 2ZWZA 4UF7C 4LHQB 3DARA 4B9PA 2CRYA 1LEKB 2FJHA 2OTPA 3BPNC 4PY8J 2QVTA 1C16B 2BY2A 3DX8B 5EWIL 1E4HA 3QZPA 4K3EL 4JCLA 2X42A 2YPVL 2I7OA 4OFVA 4TV3A 4D7BA 2EUWA 4OIFA 4DP1X 4WI7A 1PS3A 1T89C 5E8OA 4KXCA 4EZJA 2CO7A 4JGUA 3VW3L 3LZFH 4I4WA 4MX7A 3T6QC 4LPYA 1C12A 1X5FA 3BP4A 3CHSA 3WEXB 3AGVA 3U4BL 4HUXA 1ID2A 1WWWX 5D2NB 3HZKB 1FAIL 2ZKHL 3CZNA 4Y4HD 1ZS8A 1O6SA 4XH2B 4M00A 2LGNA 4HP5A 3D4GA 3ZE2B 2DQTL 4YQXL 4NQTA 3QUHA 3JZ7A 4BGDA 1M2VB 4B97A 4LSQH 3NCEB 2Y7OA 2K70A 4CSZA 2Q20A 1YYCA 3ETBF 1AC0A 4P46B 1OSPH 1E4XL 1PPIA 3I02A 4JAMB 4OVUA 1F4WL 1ZVNA 3HAEH 2NQDA 4XAKE 4S1SL 3AY2A 3AMKA 5IJDC 5JYLA 5BRZB 3U0WH 1ETZB 2PUQT 2WO4A 2YJLA 1J9SA 3MLXL 5I5IA 5AW9B 4XMLH 5L2KE 3MBEB 2X4PB 4BXVA 3NA9L 3S9DB 2QQNL 1VFAA 5C0RL 1OP3K 2E9GA 3SPIA 3KL5A 1FNSL 2VR7A 5LCVH 3IJEA 3T65B 2DEXX 1JCKA 4ODTH 1PLCA 4MQ7B 5GRVK 1QUPA 3GFUA 4AYDC 2J25A 3KPLB 1BZOA 3SGEH 1S3KL 2NTFA 3V6OA 2UX7A 3NZUA 1U3HD 3TBYB 1AKJD 5IB1B 2O5NA 1NSNH 3GIZL 2Z31A 3OZ9H 3QUKA 5C92A 7PCYA 2DPKA 3BN3B 3MJ9L 1SXSA 2J1ZA