2AQNA

Cu/zn superoxide dismutase from neisseria meningitidis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
155
structure length
155
Chain Sequence
ASIEVKVQQLDPVNGNKDVGTVTITESNYGLVFTPDLQGLSEGLHGFHIHENPSCEPKEKEGKLTAGLGAGGHWDPKGAKQHGYPWQDDAHLGDLPALTVLHDGTATNPVLAPRLKHLDDVRGHSIMIHTGGDNHSDHPAPLGGGGPRMACGVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title CU/ZN superoxide dismutase from neisseria meningitidis
rcsb
source organism Neisseria meningitidis
molecule tags Oxidoreductase
total genus 40
structure length 155
sequence length 155
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2aqnA00
2WWOA 3L9YA 2WYTA 1S4IA 3HFFA 1F1AA 4A7UA 4BCYA 2WWNA 3QQDA 2LU5A 1SDYA 1SXBA 1E9PA 1PU0A 1UXLA 3LTVA 1TO4A 4U4IA 1FUNA 1PTZA 2XJLA 2ZOWA 2Z7WA 3QQDB 2VR8A 1SXSA 1XSOA 1CB4A 1UXMA 1E9PB 1SOSA 1COBA 2AQPA 5KBMA 3RE0A 4MCMA 4OH2A 2AQQA 3H2QA 2WZ5A 4FF9A 1SXCA 2VR7A 3GZOA 1AZVA 2XJKA 4N3UA 1SXAA 2AQTA 1Z9NA 1EQWA 1OALA 3ECVA 5CU9A 1OZTG 4A7VA 2JLPA 2AQNA 2Z7UA 2WYZA 3F7LA 3PU7A 1IBBA 4MCNA 1IBHA 4BD4A 3MNDA 1XTLA 2AQRA 3MKGA 2Z7ZA 4A7TA 3GQFA 3KH4A 1YSOA 1P1VA 1OEZW 1SXZA 1N18A 1XTMA 1OAJA 1BA9A 1CBJA 1YAZA 3ECWA 3KBFA 3KH3A 2WZ6A 3CQQA 3K91A 3S0PA 1PZSA 4A7GA 5KBLA 3KM2A 1TO5A 3H2PA 4BCZA 2ZKXA 3T5WA 1QUPA 1Q0EA 1MFMA 2Z7YA 2SODB 1DO5A 1HL5A 2E46A 3F7KA 1ESOA 1IBDA 2ZKYA 4A7GF 1JK9A 1JCVA 2V0AA 2VR6A 3GZPA 4OJAA 1F18A 2GBTA 1F1DA 1DSWA 1IBFA 2AEOA 1E9QA 3SODB 1JK9B 2C9SA 3GTVA 1RK7A 2AF2A 2WZ0A 1KMGA 1L3NA 1OZUA 2ZKWA 3GTTA 1F1GA 4A7SA 1N19A 4N3TA 2JCWA 1E9QB 3KBEA 2WKOA 1SDAB 3ECUA 3KM1A 1IB5A 1Z9PA 2R27A 2GBUA 2NNXA 3CE1A 2AQSA 1E9OA 3GZQA 2APSA 2E47A 1EJ8A 1U3NA 3CQPA 4A7QA 1B4LA 1HL4A 2WKOF 3HOGA 2K4WA 3L9EA 1BZOA 1B4TA 2C9UA 2C9VA 2GBVA 1E9OB 5KBKA 4B3EA 2Q2LA 1YAIA 4L05A 3HW7A 1SRDA 1SXNA 1SPDA
chains in the Genus database with same CATH superfamily
1LO4H 5D7JD 4YHPB 2GSGB 2R2HB 5FYLH 4F9PC 3QJUB 2IDCA 2COQA 3FT2B 5B39A 1OK0A 3H3PL 2UXFA 1NC2D 3BOVA 2ZWLT 5E2TH 5AYTA 3X13A 5GS0C 3BEVA 3FU3A 3AM8C 4NNPL 2XOTA 4AT6A 1LEGA 2DWEA 5EF1A 4IKJA 4E41A 2X4TB 4UZSA 3RFZB 2ZX5A 5CLWA 3T0AA 1WSST 4KVPA 4M43H 3RZCB 4F7CA 3AUVA 2A3TA 4EUPH 2HFGH 1RURH 4WHCA 2QVFB 3H9HA 1CYGA 3PNRB 4FNLH 1YY8B 4G8IA 4NQCA 5CSBA 4CMMB 1JPEA 4FMFA 1QSFE 5DC4B 5GHWL 4ZYKB 1HHGB 2J6EH 1EMTH 1WQVT 2P24B 4PM1A 1K3ZA 1HHKB 1NCJA 2IWGA 4RFEB 3RJOA 3TT1H 1MVFA 4DHLA 4Z7OB 3BPNC 3CSFA 1MOEA 4I0PB 2VT0A 2PW1B 3G6AA 3II1A 3WTUA 1ROWA 5EU3B 5D7JC 4FFYL 4BRVA 3RQ3A 4O02L 4Y5VC 4R7NA 1P0SE 4ONFL 4FXGC 2NTSP 1XF3A 4HX1A 5IB4B 3S3SA 3GS7A 2Z3FA 1Q9OA 3SSGA 3F6LA 3QXUA 1FFPB 5F3HB 4G5AA 3SYPA 4D8PB 2JQMA 4PS7A 1JYNA 4OLXL 3RGVC 4X8GA 5KJ7E 3NIDB 1A3LL 4N86A 1MFDL 2H47C 4M93C 4JCMA 2F1EA 2WBXA 5IUSA 5JYMA 1OV8A 4OZFB 5CWSB 1NMAL 4LP8A 2QSCH 4PVMA 1GZQB 1YC7A 1ZTXL 4JFFE 1OSEA 2DBJA 2VDOL 1QLEB 4GKOA 3UTTE 2JJSA 5GZNA 2AXJA 5CHNA 2YXFA 4FHKA 4DGIH 4ODWB 2XA8L 1KGXA 1W91A 1UYWL 3ZTDC 1J1XL 1NQBA 2NZ1A 3BLPX 3FW6A 4NZ8A 4AGNA 4HK0A 1YEFH 4RX4D 5EU7E 5DC0A 1WUNT 5E2WH 4IGBD 2J7LA 1XL4A 2H2SD 2ZOKB 3QI9B 5C09A 3EBHA 1BFOB 1MUJB 3J8F7 3VUAA 5FYLD 1MDAA 4ZX5A 1S5IL 1WFOA 3ZHFA 3D4GA 1LP9E 2F68X 3OXRB 1Q1JL 1H0DA 4WI0A 5E94B 4C83B 3U4BL 1BZOA 5IFAH 4YHOH 3CHRA 2HFFA 1T0NA 3O0LA 4ETYA 4I3RL 5EU7C 3C6EA 4WUUE 4YAQA 3QDJE 1S7SA 3MACL 2GB2A 3R0MA 4GSDH 1FYTB 2DWSA 4EKJA 2OJEB 3ZSSA 3T1WA 4M6NL 5I76B 5HP5A 3FO0L 3ARXA 5EF0A 2WY3B 1U8PB 2ZCKL 5EO1B 5C08E 5HGDA 2AV1A 1KLGB 3QEGL 4GYBA 2RA1A 2EUXA 4WI8A 2IH9A 4F1SA 3K0WA 4X2UA 4FQPA 5TE4H 1UVQA 3PDOA 4YHYC 1ZHNA 2V7NA 1DVXA 4HEME 4FNTA 4G70B 2ZXCA 4WFHD 3WNMA 4S2SB 4P2OB 1SQ2N 1RERA 2MWCA 3BQUC 5E6IA 5BNXD 5CUSL 3W1ZA 1OPGL 1R3LA 1M7UA 1R24B 2WB7A 3DO3A 1UWYA 3D2UD 5D2NA 3SE9L 4LSRH 1MCWW 3DOIA 3BHBA 5J1AB 1AXTH 2H26B 2XN2A 3Q6FA 4JPWH 5J11B 4O5LH 3B7UX 3VI3F 1MIEL 3CPLB 4QXTA 4R2GC 1ZT7A 4WFHE 3DIDA 2Y7LA 1Z9SA 2AK1H 3A6BL 1WGVA 1IGCL 3KYKL 5HBBA 4LPXA 1JBJA 1L7IL 3CN2A 3GQFA 3OMAB 4TQHA 5M94B 1NFDA 5KS9B 2C3HA 1URZA 3NSDA 3DV6B 1X9LA 1YPZA 4G6JH 1B2WH 2G3ZA 3H1ZA 4GKNA 2CXGA 4NKIL 3UPRB 4ZI8A 1FNFA 5ESAA 4ZD3L 4AJ0A 4YHMH 1DQJA 4K9JA 2AXWA 5IB2B 2MSPA 3MNVA 1JNLL 4FS0A 1UA7A 3FF7A 5K9KB 1J5IA 3VGGA 3QUKA 1RIHH 3L3JB 4Y89A 1HKLL 3OQ3B 3HC0A 3MV7A 5I6LA 4MA7L 5DUMH 1W9XA 2H3NB 3VXUB 3W81A 1BQHA 1PLBA 4ORGB 1XGYL 4PJXF 2DQGL 3PUUA 1A2YB 3VSVA 3R8QA 3O3AA 3P0YL 3QZWB 2EYSB 2VC2B 4N2IA 3KL5A 4NLAA 5T33H 2OMTB 3MXVL 4HMEA 4IEFB 4EOWH 3UBXI 1X7QA 2Y36H 5HDBB 5HHXH 1Z3GL 3ZDXF 3G5YA 3ZQXA 2VZSA 3AXHA 3O3EA 2IALB 3G6DL 3QPXL 2J1XA 1QFWL 4YSUA 4LCIH 2AABL 2J73A 4L4VA 2IV8A 3QDHA 2KDYA 4LSTH 3VXPB 5K1JA 5LDSA 2VDLH 2BH0A 2CO2A 5EU5B 4BFKA 4GAFB 1N8ZA 5CLTA 3SD5A 4H8PA 4X7CC 2BS8A 1ERNA 2PO6A 2GI0A 3CN4A 4PWIA 4X80H 2FK9A 1E27A 3FBQA 4UOJA 4IBUA 5JHDE 4RGMC 2CMRL 3ZDYF 3UBXB 2X88A 4KO9A 3CH1B 3LOWA 5C0BA 3ALXA 5DTFB 3ZL4L 1SGKA 2Y1YA 5DS8A 1FV1B 4U1NB 2YD0A 5I0XA 4IOIA 4WJKB 4HH9B 3GSXB 1JAEA 1D6EA 2KLRA 3ASOB 2VSCA 3ULAB 4LLMB 5F7YC 1N2RB 2LW3A 1AXIB 1J9SA 2M83A 1KCLA 2FNWA 2XXGA 1PX8A 3TBTA 3CQFA 4MDIA 2F7IA 2WIIA 4ODUB 2F61A 2F74B 3NPZB 5AW9B 1AQHA 5B1AB 5IK3B 1R3KA 3HI6H 2X1XR 3OPZH 2H41A 3JV4A 4CSTA 1HXMA 1AIZA 3CXFA 2VDML 3WBDA 4B0MM 4G8FA 1A7RL 3GINA 1OE1A 1Z5LB 4X9GA 1CWVA 4PV8B 3US9A 4OZIF 1RHHB 5L2JA 5EA0H 2YEVB 5FDWB 3ZN6A 2F18A 4IRZL 3IJYB 1X5HA 3PWPB 4QXUH 3HN8A 2AK4A 3P2DA 4NXSA 2K4AA 4ZZFA 2D0HA 1YUHA 2DQCL 4ISVB 1LO0L 4XMLH 4QHPA 3D12B 4LHQB 3LQAL 3QIWC 4BQCA 5MHSD 1EJFA 4JFOB 5F8RC 1JOIA 4PI2A 4NO2B 1O75A 5I1KL 2VDKL 3L48A 5G5DA 3TM6A 1T1ZA 5DD3H 3CV5A 43CAA 2WZ6A 5CKAA 1TTAA 1QKZL 3IRPX 4I2XB 4ANVA 3RIFK 2A77L 1QPKA 4FNRA 4F91B 3HMXA 2Y3NA 4OBRA 4QJ4B 2CO4A 1BAFH 4DP2X 2ZX9A 5FYJU 1T1YB 3L81A 3PHSA 4NUQA 3AVEA 4UT9H 1ES0A 3NUKA 3T3ME 4ALAC 4WK0B 1BIIB 4XMKH 1I31A 2PPCA 2XRAL 2BVTA 2WOYA 3ETTA 4TVPL 1EEZB 2Y72A 3SJVB 4L3CB 4GAAA 3OHXC 4BSWA 1NAMB 5F1KC 1BIHA 2EXWC 3GSVA 3OPUA 4F58H 4OI7A 3O6KL 5GS2H 3UJJH 4RIRB 1RSYA 1GMIA 4NSKB 3GSOA 3VXRA 3INUL 2BSCA 1DVTA 1C5DA 5C0FA 4L29A 4X4ZA 2VDNH 3LX9A 4JN2A 1I8LA 4KQ3H 4XCYB 4AYFA 5JPMC 4ERSH 4LHJB 1JD9A 1HIMH 5LBSA 4QRSB 2WMPB 1WZMA 4LIQL 3VFTB 4TNWF 1KXVC 2P42B 3L1OH 3INOA 1BYPA 1QABA 4PMEA 1PY4A 3JXAA 1UURA 5MERA 4PBDA 1HJBC 1M3IA 3MCG1 4QRRD 4PJ5A 1WA0X 4HU8A 3UTSB 4ZMLA 3WJMA 3D39D 3TO4D 4IMKC 1NCNA 4NI6A 4QHMB 3IMUA 5BMFL 1V7ML 1JV2A 1ZT4B 4LKCA 5E4IA 4DAGH 4Q7DA 3LXCA 4DVBB 2ETWA 1KJMB 3W2DH 1N5AA 2R29H 5BPPA 5JQ6H 2GHWB 1CDUA 4AJVA 5EC1A 1KF9B 3H6AA 3KHQA 1VLXA 1JPFA 3D39E 4U3HA 4EN2A 4YBLC 2F7QA 1OAQL 3BDYL 3DX0A 1TQBC 5ETUA 1CJYA 3TURA 1PJWA 4Y2DA 3LIUA 2CE6A 4NZFA 2EDEA 2ZICA 3HE7A 3P11H 4PJ9B 1T21A 1AI1H 2EE9A 4XB8A 4J7RA 1AGDA 4TNVF 4AL8L 1MRCH 5E6ZA 4A2LA 1G1KA 1DJYA 3TF7C 2PPFA 4K0OA 1YEKL 4BQ6A 1XXDC 4KV5F 4BELD 5HYSG 3P4MA 1EZVX 4PJDF 4LDCA 4PWGA 1G9HA 4YLBA 3TO4C 3L4UA 1AZZC 1TYEB 2UUDK 5TH2B 3DJRA 1TVHB 2AEPL 4LCWD 3UL4A 4X8JB 5DQDL 5GRZA 3ZE1B 5I30L 3GLZA 4N87A 1UZ8B 4AGLA 1E30A 4Q8BA 3B34A 4A63A 3PXLA 4AWJC 1EFQA 4XMWA 3HZMB 4PLJD 1IC5L 5L7XH 1Q94B 1JDAA 3GSNH 4W9GC 5ACZB 3AXLA 5B7EA 1G7HA 4KKCD 4LCWE 5EN2B 4JFQB 3V4UH 2BNRD 4Z7UB 5T3XH 3QC5X 4FQJH 5E0QA 5E6SB 1TZAA 3DX3A 4LL4A 1FRGH 2P45B 2E46A 5GS2D 4DTGH 1GZHC 1O7DE 4FKKA 3PS6A 4XCNB 4G9DB 4OLYH 4XI5C 4U3SA 2X28A 4HJJL 4CU7A 2X5PA 3HNTL 3EH2A 4B9KC 1QFUH 1VHPA 4X6CF 3RKDD 4GAYB 1SMAA 5SWZD 2VQ4A 3BH8A 1P7QB 2F5AL 1CG9B 1H3WM 3E1F1 1HEHC 1FP5A 4OD1L 1O6SB 4FZEL 5D5MA 3S4SA 4IDJH 2X4RA 1F45A 2XPYA 3KJ6H 4TV3A 1A7PH 1BWWA 4LGPB 2FJHA 3H9SA 2AXHA 1O7DC 4PLJC 1BOYA 1P7KA 3MJ9H 3T4YB 3AQZA 2IBGA 5DGRA 3R7QA 4KKCC 2IG2L 3WFEL 3ES6B 5D72H 3KWTA 3PYCA 1KCVH 3QUMB 2WUCH 5E95B 3SPIA 4I8DA 1AP2A 4M48H 5I5JA 4NNYB 4H20L 2K78A 5ACMA 3TN0D 4D0CA 1BMGA 5EEVA 3BH9A 4XX1G 3K81A 2WYTA 4M6OL 2NSMA 4PSPA 4OCSL 3S3CB 1FZOA 4JQIA 2BNQE 1FZMA 2J88H 5D8JL 5DJ0B 5FOJA 2YO3A 3MOAL 4P2QD 1ZANL 2P26A 4IKIA 1TQCC 3STLB 1YYCA 3UO8B 1DO6A 1ETB1 4YFLF 3MV8E 3L5JA 3H85A 2BC4B 2JIXB 2UWEA 3O4LA 5C70A 4OCYL 4OD3H 3WFDH 3VFWA 3D52A 1OP9A 5DJAA 3GI8H 1G6RH 2YC1B 3UZVB 1I3GL 2XWBA 3HNVH 1V8HA 3DDGA 4MQ7A 3VI4E 2C5DC 3D3VA 2EYRB 1FQ9C 3D7PA 2NZ9D 3DVNB 1ZGLA 1CGWA 3GNML 5AENA 1LD9B 3GKWH 2L8AA 1T83A 1S7XB 4CKVX 1ZE3H 4GO9A 4HWZA 4FC3E 5LHDA 2FSEA 5IJDC 2M2DA 2QQKL 1ZY9A 3VD4A 2ZAHA 5T3XD 4POYA 1LQSR 3ZDZF 1Y18A 3K5RA 4OFPA 4P04A 4D0BB 3OAYK 2Q3XA 5D96C 2B7DT 2JJTC 1ZDQA 2FIRT 2CK0H 2NY3B 4YZFE 4IU3A 4JY4A 3RY4A 1M1XB 1RK0A 1PX4A 1I1FA 3GJFH 4PRNA 4BHUA 1F90L 3MLWH 2DMBA 1KEGH 1J8HD 2APVA 2J2ZA 4CA4A 1A02N 3BWUC 1A7QH 2W60B 1Q9WA 3DVIA 3QVAA 2PWGA 2ICEB 1DQML 3ZZQA 2NZ9C 4UOQA 1RAMA 3KWVA 3PY9A 3W39A 2WTPA 2EO7A 3QNYA 2VIRA 2ZYSA 3O41B 4LE8A 3PQYB 3EBAA 1HEZB 3DTDA 1QWNA 4JFPB 5GGSB 4WW2A 1CDGA 4AM0A 5AW8B 4IRJB 3VFVA 3ZX1A 3FMGL 4Y1AB 2FCBA 1EX0A 3D85A 3JTTA 2YPLE 3QG6A 5FM4A 3KPPB 3WY4A 4F33A 4PJIA 2B1HL 1RUAH 2K8MA 5KBDA 1KG0A 3FFCB 4QTHA 4JO1L 1AR1C 3CWGA 4D9LH 3Q6GL 2L7JA 4PB9L 4PJBF 3HBZA 3I3EA 3GC3A 4F2MA 2RR3A 4OLUH 3B37A 4NRXB 1GW0A 2QGBA 3HG5A 1U3ZA 5C6TL 3KPMB 2CR3A 2OCCB 1U3HB 1BMZA 1FG2B 1JN6A 4R4BB 1BXAA 1KJ2L 1DN2A 5FOBB 4ZOAA 2GK0A 1IEHA 4AVJA 1GOHA 2J12B 3ELAT 1CFTA 2YWZA 4Z8FH 3SKNB 3B6SA 5MENB 5GGTL 3DVGA 4PW3A 5FGBC 1NFKA 1EUTA 1SLVA 3S96A 2EECA 5DJZA 3DHUA 1GZPA 1YNTB 1JUFA 3D87B 3L08A 1UWFA 2YA1A 2EVFA 1E9PB 4JO8A 2VDQH 3RPBA 5K39A 3RUGB 2OV0A 1USZA 4MZIA 2LLNA 4GRLA 3VFGL 2ZUSA 2ZWZA 1IC1A 4LVOC 3SE6A 3ABZA 3MLPA 2VR7A 1XF2A 1KB5L 1G84A 4AXWA 1L0YA 1TTBA 4LSPH 1SMDA 2NY7L 4MSWA 3VXQA 4O51A 4JO2L 1E65A 12E8L 1IT9L 5DK2B 5D2LA 4JHAH 3HI5L 4YOKA 4F9PA 2CRYA 3W57A 3OSKA 2BW5A 1DVFB 4FI8A 1NIBA 2C7UA 1HQ4A 3AM8A 2XZQL 3DRQB 5CJ5A 4XB7A 3ZYZA 4ACTA 3CFKA 3MU3A 4BM7A 1D5IL 5FA3B 5E00B 4R83A 4TS6A 2VL5A 2E56A 3L95B 1CICC 4BFJA 4EZLA 4X99B 3CIQA 3VH8B 3F2LA 4KAQH 1KGUA 2EIDA 2P5PA 5D70H 3O9WD 2G5BA 2AZUA 1Q0XH 1DE4B 3HI1A 5IV2A 2J72A 3U7YL 3QORB 3ZJAA 3P77B 5CMAA 2YUWA 3FOLB 4JUSA 3FRPG 2VABA 3Q8FA 4K4KA 4HG4J 5ITFA 3BQVA 3DXAE 5D7JA 4I85A 1ZA3B 3V0HA 5DHVB 4Y5VA 1CT8A 2OAAA 5EZLA 3FONA 4RWHA 3NPSB 1TJHH 3PWNB 4FXGA 4X5WA 3MRFA 2H32H 5BZDB 2ZKHL 1G4MA 4OKVA 1Z66A 4WTZG 1LHZA 1NC2A 1OK8A 5T5NF 2DH3A 4QHKI 4WNQB 4KZDL 4GRWH 4R96B 4XN7A 1QSFA 5DFVC 3M1BB 3BT0A 4EI6A 4WQOA 3LZPA 3RGVA 2XN9B 4AQ1B 3DKHA 5T5NG 4NZRH 3BAXA 3MCLL 1JTPA 1L9QA 2CDGA 4UCFA 3ZY7A 4G7YH 5DJYB 2E27L 5ADPH 1AE6L 1FL5B 5JHLH 3DX1A 2X4UA 2OMYB 2WXMA 4G5ZL 3V0VA 4DKAA 1B6DA 2VITB 3HHMA 2QEJA 4Z78A 3ETSA 3TBVB 3OKEA 4AQAA 3BP6A 3S3JA 2Q86B 3FOMA 2E7DA 3EHBB 1K4CA 3O4OC 3U9WA 1EHLH 4JK0D 5EPMB 1O9VA 2CUAA 4NZJA 5IHZA 3SGDI 4NWTH 1WFNA 5F1IB 3MRHB 4P23D 5D1XE 3SCMB 4H25B 2P8LB 4FXTA 5E23A 4TRPL 4X8XA 4BH8A 2FWOA 3BKCH 1K4DA 1CTOA 2XJLA 4LMQE 3CZKA 4XNXH 5AOKA 5J3HC 4A2HA 5AAPA 2O6DA 1SXSA 3MXWH 4BZYA 3EIFA 4Y5YB 3UTTA 3WEXB 3QUGA 4MMXB 5DO2C 3LV3B 3VGAB 5IW1A 4Q9RL 2BRRL 5EFIA 4QT5A 3ZTNL 2GC4C 4ZAKD 4H5SA 3PWUA 3G9AB 3OTTA 3BW9B 5D7SL 2EDLA 2Z34A 2ZCHH 4BQ9A 4PRHE 1ADQL 4NKDB 5BV7H 2WYZA 5KVEL 1UKSA 1RVFH 2JB5L 3VO0A 4YSEA 1MHCA 4PJHF 1MFCH 4OJDH 1DCLA 5AZ2H 2D2OA 5JUEL 3ULVH 5BS0E 1ZLWK 1WZAA 2ZCZA 3K2MC 2J1KA 4YDZA 4AW7A 1G9EA 2BNUA 4JGMA 1M57B 2CJTA 1FLTX 2JKIS 2X44D 2IFFL 3HKFA 3PG2A 2OL3H 5DSCB 5JOFB 2Y7QB 4AENB 2R4SH 2UY6B 4APQB 5L8KB 1OGAE 5DHYB 4RCAA 3JZYA 1JZ2A 2P47B 3BQUA 1S3RA 4HUMB 4WUUA 2F8VA 2WXLA 3QDJA 4JL1A 5EH1A 4XPHH 1KYAA 1ZXKA 2GT9A 1QLRA 2MKLC 3FQNB 4M29A 4ZAKC 1NANH 1F56A 1MQKH 4NHCL 4HJ0D 4X0KB 3RAJL 4P57A 1IAIL 1CLOL 4TL5A 5AYQA 5C08A 3RVVD 3ZUCA 3VRIB 1NGZA 3CJJA 4JJ5A 2M8XA 1YN7A 2B4CL 5EZOL 4Z7NE 2H7WA 4UQ9A 1NGYB 3H42L 2FL5B 3LZLA 4HEMA 4JY5L 4K9EL 5CBEA 3CVHA 3VGDA 2OR9H 3QWQB 4FXKA 3KWUA 1KCSL 1C16A 3SD2A 1VPOH 1HILA 4XE0A 4NHUB 5A2IH 4LMQI 3X2QB 3MGOB 2B2XH 3U1SL 2PXYD 1AH1A 1XBDA 4G7QB 1A6AA 3SPVB 1U8JA 3KLKA 5F2FA 1FFQA 3VVVA 3DUSA 2N01B 1RJZB 5ALBL 2OMUA 1OM3H 1CU4H 2CGRH 2IOOA 3LRGA 2AJVH 1GC1H 1TT6A 3D2UA 1KC5L 1FI8C 1NH6A 4DQOH 4EQ2A 3FTSA 4UF7C 4K7PH 6PAZA 3KXFB 4HJ0C 1K6QH 3PAZA 1VCBC 3DBXA 3QQ3A 2V8LA 5IG7A 3N41B 5IVXF 4B9ZA 4M62L 4DEPB 4HHWA 4TN9A 4HLZG 1PS3A 3HE6D 3KPNA 1F8TL 2WB1A 3LD8C 3WIHL 4CL7A 1CFQA 2C4FU 4BWWA 1WWAX 2EKSB 4JPVH 3KEHA 4JHWH 3VMPA 4YUEH 2V17L 3HUJE 3MBXL 3DHPA 3V5DB 3DMMC 1BLIA 1BFSA 1KIUA 1YJDH 4MCMA 2R23B 2GSIB 4DT2A 1U8KA 1GCYA 2CJSA 1QTYT 8CGTA 2NNAA 3FT4B 1MHHA 4FQIH 4C56D 4XWGH 2ITCB 1Q0YH 1JPSL 1UASA 3EADA 2VM3A 1PYWA 4R7DB 2A6KA 1ZAGA 2JKLA 3MCYA 5I24A 2D7OA 2I27N 4JQVC 4YC2B 4ZMWA 1EH9A 1KB9K 4HDIA 4YBQD 5JHDA 1CI5A 5KVDE 1KGYE 5DRNB 4CN4A 1CZ8H 2FJGB 4OT1L 3CZFA 4WF7A 2XWEA 2FQDA 4B95C 1VGEH 3NSXA 3CZUB 1H3PH 3ZT7A 3QWOB 5ECJE 1YEGL 4YGVB 1RZKH 3NEEA 3IFOA 3WXWL 4LRNH 5I9QC 1BGXL 3B56A 2ZUQB 1DJXA 1K5NB 1HXYB 5CU5A 2ARJA 4LDOB 3SQRA 1IGTB 4KOCA 4LOFA 3VRLE 3BZFB 2PYEE 1ZEAH 1CXHA 1VFAB 3QIWA 2KKQA 1H9DA 4N0FB 2B0SH 5CINL 4FEIA 1A6TA 3EOAA 3FN0H 4XC1H 2WBJB 1T3FB 4HWEH 4LCUB 1A14H 1S7VB 5BVPH 6PCYA 3V5KB 1FFNA 1S7QA 4A2MA 1IKFL 5IHHA 1IB5A 4HPOH 2BDNL 3PL6D 5E9DB 8FABB 3O8XC 3RGHA 1MCCA 3HVNA 3S37H 4DEWA 1ONQA 5ICXB 2AQ1A 2NX5B 2P5EE 4JM2F 4TUJB 3NJKA 4JKNA 1KXTB 2J56A 2IDFA 4WUKL 2MOVA 1U6AH 1KJ3H 5A6MA 4NZTL 4XAKD 2ATPB 4QYOB 4W68A 3NRQA 4FFVD 3GTNA 1BQKA 1NLDH 1QSEB 2OMBA 3SBWC 3OHXA 1LTXA 3X11B 5FKAA 1RMFH 2X4QA 4XOEA 3HC3L 3UCRA 2WWOA 4M56A 3EFDL 4JRYE 1E6JL 1F1AA 2F58L 3GBLA 3VQ1C 3NCFB 1P84J 5BVJB 3QW9A 4BSVA 1AZRA 1X5MA 2Z64C 4GI6A 5I6XC 1G0XA 4Y4HB 3TFBA 5JPMA 4N25A 1AGEA 4P3WA 3HG4A 4J3TA 4M3KB 4OJFL 1AZBA 5IEKB 1LDPL 2A9MH 3WNOA 4PU2A 2C7FA 1KXVA 4ZS7H 4OCWH 4ZPTA 2A6DB 3IMSA 4X4ME 1VB9A 4ZUVB 5C0CD 5KSUA 1A0QH 5FYKL 4MZ2A 3GB7A 4PJAF 3EXJA 2VXQL 1T5KA 2BVPA 3W37A 4X4XA 1A9BB 1KYOK 1IC4H 4HS8L 4IMKA 1UFGA 3IGLA 1XCQA 4HGKC 4PRPE 4BQ8A 3KJ4C 2JCCB 3LH2H 4FFVC 3HPLA 2XC8A 4Y4FB 2AJYH 3DI3B 3ZIMA 5HI4D 3ATFA 5CAYB 4W6WB 3VA6A 1INQB 4YX2L 1M9WA 4DP4X 2IH1A 3OLIA 4XBGA 2XZAH 2HMID 3OKYA 3T77A 4NYLB 4XHJD 1NCBH 2J4WL 4NUJA 5IJVA 3P4NB 4A04A 1NZRA 4HSAC 3KM2A 1KV7A 1UADC 4U3CA 5EOCH 2GJZB 1ZLWH 1ODUA 3X14A 3ZKMC 1ZLSL 3LNDA 2NYZA 3ZKND 3CSTA 3GIVB 3WDIA 3ZMRA 3NJIA 1BAWA 3DX9B 2ZUVA 1BYOA 3OGCB 3ME0B 2YGOA 3D39A 3TO4A 3U7WH 3V7AE 4CSZA 3BP5B 2AJUL 3EJZC 5CEZH 4NAMA 3QUYC 1J11A 3AABA 2VMDA 3EG9B 1TYJA 1U33A 1TYRA 3TCXA 5HI4C 5TE7L 4AQ8C 3T0EE 3SKOB 2R8SH 3F58L 3EO9H 4IHOA 1Q9LA 3MGTA 3S48A 1N0LB 1U8HA 2H0FA 5HYQB 4ZFZB 4QNPE 1GGIH 1GVIA 1FH5H 1D6VH 5D4HA 2MHAA 2BS71 2ZCLL 2PCYA 5I1CL 3Q2CA 1TVBA 1A4KB 2A9CA 4U2YA 1DLFH 1AD9A 3RBGA 3ZKNC 1GZHA 5ID1A 1A5FL 4KK9D 2F6AA 1T89C 1CLCA 2C9UA 2K9FB 2PTVA 3DJTA 1RD6A 4KTGA 3SPJA 3MODH 3G6JA 2NXYC 2MQ0A 3MRCA 3T0EC 3TZVB 1LXMA 5AUMB 2DY2A 3QJQB 4QRPE 4K94C 1I9JH 4JO3H 4OQTH 3FSZA 1BZ9B 2G4EA 2V5MA 3V4VB 1S7TA 2BY1A 3K0YA 1MJJB 3WN5C 4BGDA 3WY1A 3IXAB 4LCWA 4QRTB 3W82A 1SBSH 4D9RD 3P3YA 1ZRUA 4N2OA 3N44B 3T2OA 1URIA 3V4PB 5F89B 3LTVA 1AGCB 2ENQA 3FUMA 4I3SL 4PJFF 4U4IA 2AZAA 3VE0B 4UQIM 2JQZA 4HAKA 4PG9B 3IT8D 3VXMB 4X5XA 3G5VB 4MJIE 2BNRA 4HKZB 4N4YB 3E6HA 5ERWB 1F3DH 3ZKSD 3UG5A 1UD2A 3UIYA 1KCWA 4P46B 2V2TB 1IZJA 4XO4A 4P4RB 5AZUA 3RKPA 4DJMA 4KK9C 4OZFH 3WKQA 3F12B 3MRPB 4JY6B 5FUCE 3NQKA 3GJEB 4WY7L 5I0DA 2X4SB 1JD7A 1ZVYA 1BLNA 2VLJD 1QLEH 2CIIB 5SWZA 1A4JB 3ZE2B 2FJFB 1J8RA 2Z8RA 1RI8A 3A4FA 1MHPH 5I1LB 4D9QE 3P3SA 1BJ8A 2Z65C 4QXVA 4HETA 4LFHG 2N7SA 1OL0A 1TJGL 2BFVL 1MCKA 1U0QA 4Y4KD 5I0VA 2JKWA 4KX8A 2DTML 4RH4A 4YHIA 4RNRB 3FUHA 5CEZD 5I8KL 4M8QB 5FUCC 1U3JA 3A3YB 4UB0H 4UILL 3WIFA 5ALCH 2LTQB 4XMUA 5KBPA 1DZ0A 3L1FA 1KBWA 2WWKT 4HJGA 4UUJA 3MCKB 5DFAA 2ZKMX 3T6ZA 2AFNA 1JCVA 2EEDA 3X1BA 2Q7YB 1WV7T 5LBSL 2ADGB 4JPIB 5AQ0A 3IKCB 1JWUB 3IJSA 3RVUD 5FO9B 4HUVB 3IRCA 1SLWA 3ARUA 3MV8A 4P2RE 4TUOB 3RZCD 4W9IC 1IVLA 4X7SL 4LO9A 2EDYA 3B2VH 2JJTA 4XP9L 4A2GA 1WC7B 4X6DF 4K5NA 4XO9A 1HXKA 3VI4A 1IGJA 3C08H 3CCHB 1C08B 5ICYA 4OR1A 4PGDA 2V8MA 1AO7D 4I0PD 1E9OA 3OL2A 5FS5A 2APSA 1XL6A 1GPOH 4L8SB 5GGQH 4S10A 4QRFA 5E99H 4RVBA 3A4AA 3IJHA 3IU3B 3Q44A 2B39A 2NY6C 3EW3B 3VAEA 2AJXH 4S1SL 1MXDA 2DWXA 1AO7E 4WKXA 3SIKA 3U4EA 2VXUL 3TH3T 1G7IA 4P5SA 2HWZH 3U82B 2OK0H 5JR1H 5I66B 1T5WB 5K33A 2BS9A 4UBDD 4ENED 1TO4A 1LILA 3GSRB 2WVUA 1CK0L 3RHWK 4LLYA 2JB6B 1T22A 4IJTA 4R4FH 1NUDA 4G6MH 4ZFFA 3HG1D 2XWJA 3F84A 5DEGA 1EO5A 4A2FA 4U1HA 3HBQA 2G9HB 3ECQA 1JZGA 2JKJA 4XN9A 2XLLA 2UY7B 3UIZA 2AQQA 2WZ5A 1OD7A 1DQVA 4WEBH 2QHRH 3FUIA 1M2VB 2HH0H 4P2AA 5G2NA 5C3IA 3BUPA 3LRSA 3ZBMA 2XG4B 3HG1E 4HAFA 1NKRA 1K85A 3WNPA 1WHOA 3QG7H 3QWNA 5KN5A 4R0LB 1I9IH 5MP6H 5TFSH 2WHVA 2YPLA 3KMDA 3FTWA 1MEXH 1ZWIB 2VC2H 5B8CC 2YPVH 4UQDA 1I7TB 3D4ZA 5FGBA 3EYSH 5C3LD 1NAKH 4F7PA 1QR1A 4QI3A 4AMKH 3OF6D 5EIVA 2Y06L 2X38A 1KLUB 1XB3A 3OKMB 4OFYA 4UBDC 2AAVA 4ENEC 3I6KB 4K7FA 4F24A 1SMOA 4A67A 2HJKB 2VDRB 4JLRA 2GIXA 1UG9A 4MKTA 1HE8A 2D3JA 4TPRH 2F7PA 1MJ8L 1UHVA 1XR8B 3NCJH 2NTFB 4KRMB 5FGRA 5CCGE 4WW1A 1KXQE 5TQ0L 1ZS8B 3VFPB 1N3NB 3GHPA 3WXVL 1FYTD 2XZCH 2WNWA 4XPFL 1IQWL 2V4LA 3MX0A 1CO1A 5IFHH 3FSOA 4OM1L 2HUHA 5DJ8B 3QPQC 3OKNB 3TXAA 3L3GA 4NQSA 3EYQC 4ZX4A 2IMNA 4PTUB 5BOJA 1U8OA 1W0VB 3VI3E 2J71A 3B5HA 1UEYA 4F37F 2ZTBA 1A1MB 1UWGH 1R19A 3ZO0A 2VKWA 2QSTA 4UQ2A 1H5BB 4E36A 1FNAA 5AAMC 2PR4H 3ROOB 1CICA 4JGUA 4Z7QB 1FL3B 2E9GA 3EUDA 4I5BA 4HW6A 4JFDB 4GO6B 1MCPH 4Q6IB 4RISH 4Z9KB 1Z9LA 2H1XA 3NCWA 1M6OA 3AQYA 4KJWD 3PAUA 3BC9A 1EXUB 1F11A 3ILDA 2BIPA 2WP3T 4X9IA 5FXCH 2IOIA 3UP1A 3MNMA 4RBPH 4G6AD 1IGYB 1GGTA 1OOWA 4S1QL 4WVRA 2WSPA 1IZKA 4PJXE 2IPTH 5IBLC 2Q6WA 5I18L 4NS0A 5IOPB 3MJ7A 4N0CC 2AI0L 1INEH 2QR0A 1EAQA 4H0IA 5DRXB 1ZVSA 4BKLA 3AS2A 3VXUD 2JK5B 4GW5A 3WIIL 3RWIB 1RZFL 1OGSA 3DXAA 3VMOA 1JK8A 5ANMB 5K1VA 4X9FA 5D1ZC 3ULUL 2AKRA 1URLA 1LK3L 1PIFA 1S9WB 3RTQD 3H2QA 2IJ0C 1QX1A 1EO8H 4GXUM 5DJ6A 4CUCA 1RU9H 2YXWA 3IPEA 1DBKH 1H19A 4M9PA 2J5LB 3ZDYE 4DKTA 1OVZA 3TA3C 2DQIH 3DV4A 4AK2A 4Z7WF 3FTGA 3PP4L 3I50L 4TULL 4QRQB 3LZOA 4I48A 3MYJA 3NFNB 3VQ2C 2X87A 1DFXA 1IBBA 1OE3A 2IAMB 2AEQH 4YSOA 2TSAA 5JHBA 3QYCA 3IMWA 1I3RA 4KC3B 5FYJH 1DANT 2ATKB 4HZLA 2VR5A 3N42B 4FAAB 1AHWB 1ACYH 4X6EB 1SZNA 3ARBD 2ESVB 1W72B 1U8NB 4DSYA 4XN8A 1MCSA 3BMWA 3OB0H 2YAHA 1DJZA 1A21A 3WCYA 1S7WB 2GI7A 4NRZA 2Z31B 3ATEA 3PIQB 1JTTA 3FCUB 5KSVB 1DDHB 5FW7A 3RTQC 4OZIE 5EN3A 1WBYA 4MLSA 4B53A 4HFWB 2WNGA 4FD0A 4U2ZA 1HHJB 4JVPA 2Z93B 1I4FB 5D1ZI 4M4RA 1HX0A 1B0GB 3LEXA 3WTSA 4MXQC 2YRLA 3DROB 3C12A 3G5XA 2WXNA 4JAMA 1HOCB 2NW2B 1CL7H 3ILPA 2FEJA 4QOKB 3QZBA 2I24N 2QV2A 1MELA 2EYTA 2GSMB 1FORH 3HG3A 3ZKXC 1J05A 2F15A 1VSCA 5T5FH 4GW4A 1XEUA 6FABH 3ARBC 2W9EL 1UWXH 3O2VL 1L5GA 3PWPD 2EH7H 1CXIA 2JFCA 4PRHA 3FO1B 5KYUA 2DQUH 4P5TB 5J9PB 1AQDB 3UFIA 2KYIA 2HG0A 3IPBA 4ZAKA 5I1AB 4DERA 3QDAA 2HRHA 1B4LA 4M7ZB 2UXTA 3KPTA 4LEEA 3ZDXB 5ITBL 3IXTA 4NQVA 2DJUA 3QC6X 5F6HJ 5K9QG 3BAIA 1OGAA 4PRAA 1JGIA 2A4CA 2WPGA 4GMTH 1TJXA 3VXNA 1D5ZB 4QF1A 5LQBH 5IM7B 4YVNA 1XGZA 4DK3A 4F8PA 4R97B 3SY0B 3MAWA 3WE1A 3QA3A 1T80A 3K2UH 1MQ8A 4FULA 2ADJB 2BSRB 2CGZA 3MRRB 3VWJB 3TBYA 4N2BA 1QLFB 4NJ9L 1ZVHA 2X1WL 4PWFA 5B38G 3VNYA 4QHUB 5GS0L 4WWKC 3SJVD 1CD0A 3TU6A 1A1NB 1C7TA 5FYJD 1AY1H 2H6UA 4XZ4A 4YWGH 5CILH 3BI9X 2I5YH 1DL7H 4KROB 4JG0H 1JHTA 4NO3B 2JJVA 4AYGA 4FTVB 1G9NH 1RZ7H 5FWRA 4YHNA 3T8XA 1I1YA 1Y6MR 1ZK5A 1FO0H 5KYYA 1JMZA 2BVQA 3DGGB 4FEMA 2GEEA 3NN8A 2DDQL 2QTEA 1S8DA 2DLFH 1E8YA 2SEBB 3L3IB 4KVNH 5FHBH 1PLGH 3DMMA 4FQQA 3UTSD 4B9IA 3CC1A 1RZGB 2D3VA 2ZSVB 4FLSA 5C6PB 3G7TA 5J12B 1JNHA 4K15A 1GIGL 5KYNA 2GAZA 1MAML 2ORBL 2AAAA 4YEFA 4N9GA 3IAGC 4MJ6A 3KNBA 1O7VA 2KERA 3A0OA 1U21A 4KV5E 2IFGA 4MNQE 2Y3AA 3PV6A 3HUJA 4JQVA 1DBMH 4TQEL 3SDYL 1JMXA 3WE6A 4DETA 3FQ2A 3ALWA 4Y16B 2X9XA 4RGNB 4DUWA 1RJLB 4JDZB 4BWUA 3EYOA 1O7SA 1AXSB 1SDDB 1YMMB 4NP4L 4KKQA 4XRCB 2FLBT 4B5EA 3EDEA 3QJFB 4M7KH 5HYIA 1IM3B 5MI0B 4OUUA 4PREA 1FNLA 4JFTA 1G9ML 3CZLA 3IAQA 3C9NA 4YIQB 1MFBL 4UT7H 2E6JA 2AJZB 2X12A 4BV1A 4P4KB 5ID0B 2L7UA 4KJQD 3TPKA 4HJEA 4ZMTA 2D3NA 4XPGH 2RQEA 4YDIL 2O30A 5LGHH 1SYSA 5IEHA 2E4FA 4JRXB 3GUTA 1VGKA 1WFTA 1JPTL 1ZHBB 4X6CE 4JR9L 3QXDA 3SEPA 4LVHB 5E08H 2V2XA 5FR3A 2CU9A 2X10A 4UM8A 1CFNA 5CXPA 4NDMA 3RDTB 4HIIA 3QARA 5IQ7H 5KSBF 3O8XA 2QVKA 1RP8A 5B1BB 1ZSDA 1UM6L 3OLGA 2BJML 3GBEA 2X4NB 4BZ2H 4N26A 5IESL 2PYEA 4TVUA 5GS1B 5LWYH 3I02A 2XV6B 3QUHA 4LLDB 1P7QD 4RWYH 1JGLL 3W0WB 4MAYC 3SYCA 1NFDF 3SBWA 2E7LC 4XX1E 2XKSA 2Z35B 1YPZF 3GBNL 4ONHA 1LO4L 2ERJB 2P80A 3OZ9L 4HUXA 4P5KA 2WQWA 3PJSB 5FYLL 4GG6B 1XGTB 1C8PA 4LKXB 3TBWA 3BGFC 2X3CA 2VJXA 4C59B 3X1EA 3BWAB 5F7BA 4D7BA 4MVBC 3RILA 2YK1L 2UZPA 2EXYC 1XTMA 1XT5A 1QBLH 4PBXA 1KZYA 1OXYA 4KUZH 2WXOA 4LOUD 1HZHL 1BD2E 3ESOA 1JXDA 5ICZA 3V2AR 3MLTA 2YPKA 1WIUA 1WDAA 4JG9A 2B16A 3QJRB 4JKLA 1FZJB 3DRTA 5AOZA 4PJDB 3GSQA 1DVUA 1PX3A 1DVZA 2EKJA 4LAQH 3IRZA 3MRIB 1EMTL 1SEBB 3FUJA 4N20A 4Y8AA 4HS3A 3RL1A 3TT1L 2CCVA 2YD4A 1I7UB 2XUWA 5JQHC 3QQNA 3EJQA 1XR9B 5IIEA 3SQOH 4M8UA 2CHWA 2BSTA 2E74C 1H3VA 5HDWA 3VQLA 3CHSA 3K6OA 4X4MA 1ZJAA 3DUUA 3BSHA 4OZ4A 4IOFC 4TYUA 5L2KB 3ROLB 2EXTA 4J28A 1I1AB 3UAJD 3ZDZE 1I7RA 3EGDB 4JS7A 2NPLX 4AQOA 4AUYA 5FFLA 4PRPA 4HQQL 4WI7A 5DMKB 3C60B 2FX9H 1CFSA 5C0CA 1RHFA 5D7LB 1JF1A 5I8CB 3EJCA 1FCCA 4P9HH 5H35B 5EU6E 4K3DL 4NBXB 1IBGL 4PN6A 3C8HA 1A3RH 1B4JH 2BINA 3W38A 3UTQB 2EC8A 1C9SA 3QUYA 3DJZA 2MKWA 1FNGB 3ARWA 2WANA 3JV6B 5EBWA 5BJTA 4DGIL 2X4PB 2NY3D 4AQ8A 5KSAB 4ZMQA 3HFFA 5CKGA 5EF2A 4P5MB 2R2CA 3T0WA 3NTCH 1I7ZB 4KHTH 2K8QA 1YEFL 1U91A 1SF5A 4M3JA 2KZBA 2E76C 5E2WL 3ORJA 2CRZA 2VAAA 5FKPB 3UAJC 2H0EA 2FWLB 1DVQA 4YFLI 2AV7A 3CFBB 2AW2A 5EWIL 3VGHA 4NQTA 2CUIA 2HLFC 1T89A 4PJBE 2FYYB 1G5GA 4YHOL 3T0EA 4CVXB 1YYMH 2ED8A 3PQYD 4NWUH 4OF8A 1P6FA 2WLHA 3WEBA 4IRJD 4LBEA 1KBBA 3NJXA 3WN5A 1UM4L 4Y1AD 1CD9B 2V9TA 4B97A 4GSDL 1J5OL 2X3AA 5KVFE 4PY7B 2VLRE 5DHVH 3FFCD 4AIZB 2HT4C 3LAFA 1QBAA 4YE4H 3O2WH 2NT1A 3DK0A 3HFMH 4IBSA 1QSVA 5TE4L 3IGAB 2EICA 3CQQA 5AKTA 1U3HD 5JW5B 4QRPA 4GLRH 3AG2B 5LGJB 1R46A 5DUBB 4BKTC 4MNHA 3GHBH 2KQMA 3H7BA 3BO8A 2VDPL 1G7PB 3N43F 2C1OA 1AXTL 4JPWL 5MEND 3LKSB 1DJWA 4O5LL 2YAQA 3L4XA 4I13B 3N0PB 4AK1A 4HV8A 2AK1L 3NMEA 4IRSB 3RZWA 2R56H 1WWBX 4YN3A 2WV3A 1DSWA 4LF3B 1E4HA 4MJIA 1HI6B 3IFPB 2W0FA 1T4KB 2ADFH 3AC0A 3H9ZA 2QQNH 3P73B 1IJ9A 1B2WL 1NEZB 1SLUA 1SNRA 2DICA 3FULA 4XH2B 1LO5A 1BVLB 1OCZB 4N3TA 1IFHH 2VUYA 4B7LA 2IANB 5TGBB 4ELKB 1A7OH 1KCRL 5T1LA 1XXFC 4MTMA 1RIHL 3WL9B 1UTDA 4QTIL 2E9BA 3RYMA 3BFOA 5DUML 3BT2H 3FCSA 4MQXC 4M61B 4PV1C 2WKGA 1SVCP 1JIBA 3Q05A 3QJZA 3GSWA 1DVFD 3RWFB 2OI9B 3LN4A 1OAXL 4FNPA 2HPOA 3SGDH 1JWMB 1YO4A 5A43C 4EBQL 5HHXL 1EFXA 4EOWL 5T33L 1NFIA 4UZUA 2Y36L 3AREC 3ARSA 25C8H 5H94A 3WENA 5I6NA 1L7TH 3B9KC 4M02A 4N8VG 3TC9A 4PJEB 2APFA 1ZTXE 1U8MB 4NBYB 4KPHL 1OP3H 2W59A 2HG5B 3ASNB 2WLIB 5HPMA 2CLZA 5C07E 1HSBA 5IF0B 2FH6A 4ZPVA 3CNKA 3UGEA 3FHQA 2WSDA 3QORD 3GK8H 4KZ0A 4X5LA 3VYNA 3H9YA 4GQ9H 4X80L 4AGOA 2VN4A 1JWSB 1RPQA 1CE1H 3JWOH 2GSGA 4HKXA 4G8GB 2DQFB 2YAMA 4GAGL 5FO8B 1EV2E 2WCPA 4KKAC 1MG3C 2DZEA 4MNGE 3E2HB 1DVFC 1DN0A 2PN5A 1KYFA 2Y1VA 3IE9A 4LSVH 1IKNC 4KHXH 4MJ5A 2OR7A 2XN9D 2X4TA 2WBKA 1VEMA 3QEHA 2WQRA 5I2IB 2E7CA 2PLTA 1KELL 4PLNC 3DX6A 1FSKB 2C8NA 1SN5A 3NBNA 2HT2D 2QFRA 1AZNA 3HI6L 1AMYA 3OPZL 4EIZC 5HHOB 1FVDB 3DI2B 1IAKA 2GUOA 1FC1A 3QORC 1M7DA 1M05B 4EAEA 1AO7A 1TG8A 1JGEB 3QNZB 3PNWB 2QL1A 4MCZA 4NZUH 3VSQA 4HG4K 3RWEA 5I71B 3EHBD 4EVNA 2ICWJ 4JDEA 3H54A 1NDMB 4L18A 3CVDA 2QKIC 3TVMB 4ZW3A 1P5UB 4W9EC 4WHTB 3Q2WA 1YEHH 5B8CA 4XMLL 1EIBA 5F97E 3OKKA 3TP4A 2V5SA 2PCPB 3B7SA 3BWSA 4HCIA 3WTXA 4IDLA 3UYPA 1SOXA 4E9QA 4ZFOL 1DCEA 4XZUB 4MMYB 3SKJH 5DD3L 1GAFL 3I3DA 4HJUA 3QAZB 2XXMB 5DZ9A 1EXHA 4N5UA 3GMMB 3AS0A 3HG1A 3S34H 1C1EL 3I6GA 3MROB 1UOKA 3QQXA 2R27A 3L3DA 2VXSH 3U36A 4AGPA 3MRGB 1RZ8A 1EJOH 1WUZA 3NA9H 5F1SA 4RMTA 4DP1X 3O6FB 4X50A 2O5ZH 2E6PA 2ADIB 2CQVA 5A2CA 2ODIA 4DGVH 3MRDB 4L8DA 3QYMA 3BKJH 2BZCA 4R3SB 3WFZA 1TQWA 5ELIA 4LCVA 3SDAB 4WLCA 2YA0A 4GMSL 1V05A 1JYWA 5F71A 2KT6A 1NC4B 1CGUA 3DTUB 1FAIH 3RY6C 1JZDC 1AACA 4K55A 2XU9A 2KS0A 3R7RA 4APQD 3TEWA 4J1UA 3FQ1A 3GMLB 2ZOKA 1BFOA 4R5TA 5E8DH 4F58L 3HNSH 1KXQA 1EGJA 4X42A 4OGAC 3UJJL 2UWEF 1N67A 3OF6A 5AAMA 3QUXB 1PU0A 1UA6L 3QR2A 2VQTA 5C0AB 2BMKB 2X0WA 3KYMB 1NIEA 2VDNL 3FH5A 5FX3A 5HHNB 3U6RB 4NT6B 2FTAA 3II3A 2OZ4A 4BUQA 2N0KA 1PJ9A 3K72A 3MV11 1U92B 3VI3A 1RSFA 5C0EB 4KNQA 5HHPA 1S5HB 1T2XA 2ZNWA 3ULUF 5I76A 4U1MB 1LL1A 4XNYH 5KZCB 1AZCA 4X7TA 2UYLB 2R1XB 3JBG7 4H26A 1HAUA 2FGWL 5DMJB 4CDHA 4D7PA 1GOFA 3DSNA 1F2XK 4CBPA 4NO0B 2XTJB 3F7LA 3FDWA 1CF8H 1PG7X 4J5VA 3AITA 4APQC 3W2DL 5JQ6L 4MCNA 1R5VB 4F2EA 3VGFA 5FLVA 1XIWB 5IVXE 5B3SB 3UZQB 1EHKB 4L1DA 2KZ1B 2FUQA 1QAWA 4ZUTA 1UWEH 3SQBB 5DWUH 3V6ZB 3WD5H 3WS3A 5D1ZA 3KXFD 2EVHA 3L4TA 2DLIA 4H2AA 4PJXA 1SHXA 3P11L 3PHQB 3EF4A 3L7EB 1AI1L 3O3DA 3ZO9A 4UTAA 2XKUA 4BZ1H 2A7BA 3MRLA 5BRQA 1OSZB 4PJHB 3TA3A 2W38A 2ALWA 2X1OA 3FPYA 1BVKB 2J8OA 3VCLB 2DYPA 3V4LA 4NC2B 4N68A 4PS4L 4R8WH 4WTXA 5F1NB 3B9AA 1NDGB 2P8MB 3CFCH 1P4BH 3MRBA 5F9OH 5GS3A 4PJIF 3N0AA 1JK9B 1QWUA 2YBRB 2NXZC 2K7PA 1HHHB 1HH6B 2ZXQA 1TNMA 4L37A 2GEQA 4NO5B 3PWVB 3VXUA 1Q4NX 1R6VA 2A6IA 3GSNL 4LHUG 3QQ9C 4UNTA 2WCSA 1F97A 5CEYA 1BJ1J 4CSSA 1QFWI 1CC3A 5T3XL 2FYVA 5HHQB 3KL0A 4FQJL 3RTQA 3ISWA 1UT9A 4LOVA 4GBXB 2W95A 1T2QH 1VAHA 1HVXA 4G71B 5AB1A 4OLYL 3KBHE 4DPAX 2Q3ZA 1U41A 1WEJH 3CDZA 3V52H 1MWAA 1XMWA 1T03H 2CZNA 5EO9B 4XNMB 5HXMA 1G7MB 3HB3C 4PGEA 4HS6A 4RAUB 2F54B 5IR1B 3S8FB 1TXKA 3LQAC 2HT3D 4FQXB 4YDVB 4WSGA 1NWOA 1K2DB 3NEOA 4IDJL 4TVPE 5IROC 5IB3B 4OZIA 2HKHH 3ARBA 1FZKA 4WWNA 1IGIH 3KDPB 3QO1A 1B9ZA 3AY4C 3Q43A 5INCA 5IQOA 3MJ9L 4ZQTA 2Z9TA 3FQTA 2DJ4A 3KZ8A 4B9FA 3M45A 5D2LF 1X6NA 5D72L 3QEUA 4KO5A 5IVZB 3GMOA 4OFVA 1HH9A 3T1FB 1K5WA 3VJ6B 3RJDA 2WYIA 1N2RA 5B4MD 5LNEA 3HR5A 4QY8B 4L9LA 2JJUA 2WUCL 4RFOH 5LGKA 1SM3H 3REWA 5MEOB 1EQWA 4HJSA 1OTUC 4W81A 3CLFH 2QZ5A 1SQMA 4LIQE 4TM9A 3ZRFC 3LYRA 3R18A 3DX8A 2F74A 2WBJD 1T6BX 1LQBC 2HVJB 2XA3A 4FZ8H 4JFYA 3GZKA 3HVDA 2R69H 1SN0A 3BGMB 3KPSB 3PV7A 1AHKA 1CGSL 1QI3A 2J88L 4KK5D 5E9DD 4LCCC 3ZSTA 1TJMA 1XTLA 4MB5A 3ZT5A 4L4JA 2NX5D 4GW1B 3CFTA 4QHLA 3DPBB 3T8VA 2XKNB 3RG1C 3BPLB 3D69B 3QJHB 4N0UB 1QSED 4WWKA 3WFDL 2LVCA 4HJTA 3DX2A 3VG9B 3S5LB 2EDFA 3GI8L 1G6RL 2UZYB 3A23A 3JWDH 4WHDA 2GKIA 1YEIH 3HNVL 2XXCB 5DK0A 5EZIH 3SDXE 2B08A 4AC4A 1M53A 5G55A 5ESQA 4JHZA 4PJAE 3WNLA 4EPSA 5AOJA 4EXPX 3OVUB 1J0JA 1KNOB 5C8JA 3WHXB 4JRFA 4Y4HD 1ET7A 3B4NA 4OJAA 1UCTA 4KRPC 1AC6A 1KGCE 4G80B 5FWQA 3PHAA 3EJTA 1E9QA 1OP5H 4PGZA 3RNKB 3PJNA 3V4VH 1FGVL 2NY2C 3TCLB 3VD3A 4FXLA 4H1LB 3CMGA 5I1HH 5ANHA 2CK0L 1ZGLP 1F86A 3E1ZA 4XCFH 3WKYA 2VZUA 2X4OA 2I26N 5C2BL 5TD4A 4CU8A 4GUQA 1RKRA 1KWKA 4CGTA 4OF7A 4Y4FD 1KEGL 1D2OA 2OTWB 4L3CA 5IWLC 3QFDA 2GJRA 1A7QL 1G4RA 2CLRB 2H1PH 3LKQB 3QDMB 5AKRA 4AL8C 5GJTH 1NAMA 2YQ2A 4F7TA 4N90E 4P59H 2EEFA 4RIRA 1OCCB 3L2LA 2UZXB 3Q5YA 1P84K 1MH5B 3U6XS 1UD4A 2LU4A 4FCHA 3RY5A 4AQEA 3TYFA 3PGCA 1OHZA 4HJ1A 1XGUB 3NDYE 5DHMC 1WCBB 2EDBA 3QXVA 3CBJB 1VKXB 5JZ7D 3HJ0A 3BPOB 2CDFB 1CDJA 3EJUA 4G9FB 2HN7B 3MPCA 1FFTB 2D31A 1RK1B 3FH7A 1KENH 2HP4A 5HYSA 3UTSA 2WXHA 2XNAB 2K6ZA 3KVDD 3BZEA 1HCZA 2EO9A 4QHMA 2NY0D 2YS4A 1OB1A 1AYRA 4NLHA 2DWYA 4OLUL 4OZHB 4Y4FC 3BAWA 4DVBA 3EUUA 4TLTA 5E6YA 4A7VA 3NEXA 1GYVA 1C12B 1ZK9A 2BSED 1DSFL 4ZMAT 4GSRA 3SO3C 1ZVNA 2G2PA 2EILB 4DOHE 4Z8FL 5AW1B 4LRIC 2ZXEB 1LO3L 5EZJA 4BD4A 5JZ7C 4WSKA 4YR6B 1N68A 1JYXA 3J7HA 35C8L 1NBZB 5C0DB 1FAKT 4FFZH 5CF3A 3GBMH 3UBHA 5HHVH 3D2TA 4APXB 1HQRA 2VDQL 2CUHA 4IHBA 4PJ7E 3TZVD 1XH3B 2PYFB 32C2B 4L0ZA 5HDQH 2BOCB 5TH2A 4YDKH 2F5BL 2QHLA 2NY0C 2DLGA 5H37H 1BVOA 2BPBA 1EEYB 1LK2B 4MAYA 2VJ0A 1TVHA 3NCYP 3O6MH 4X6CA 1MCOH 5ISZB 2E7LA 2B1AL 4TOYH 4JHAL 2VSDA 1NGPH 1B88A 4EUPG 4PR5A 2CBQA 1NGWB 4J8RB 3SB3A 4FJ6A 1NCCL 2E59A 1R3JB 2ICWI 3VXMD 5MEQB 2NT0A 4HUUB 1WISA 4MCYB 1RK7A 3TCTA 5A40E 3P2BA 2I9TA 5LVEA 1E3ZA 1GHFH 1QRNB 3FT3A 4M9OA 3AAZB 4PJ8B 5IW3A 5C92A 2DM3A 3BZ4B 3X3FL 3QQ4A 4P46D 3FUEA 5FUOH 3KCPA 1XCTB 2ZWSA 1WBZB 4UWQB 2FT8A 1TMCB 4KAQL 2GJ6E 3RWJB 5D70L 1IX2A 1WK0A 1PLAA 5JOPE 3A5VA 1P7QA 3OR6B 1FVEB 3BVUA 4RDBA 2XPGB 3U6XA 1P5VB 2BM3A 2C9VA 4QO1A 2P1YA 3UPAA 3PGDB 3EGSA 5E8OA 3N1MC 2NLJB 1EDYA 2PTTA 1MVUB 2PPEA 4CW1B 3S88H 1AYOA 4ODBD 5EEXA 5DA0B 4YK4C 5K9JL 3Q1EA 2HTLD 2WJ7A 3P0GB 3QUMA 2OLDA 4NZRL 2KUTA 2VDRH 4LNVA 4F15B 4G7YL 3K71A 3A6CL 1KFAL 4KI5D 5GRXG 5JHLL 1V54B 2HLAA 4NCC1 2R0ZH 4ZDHB 3NVQA 4Z3JA 4LLQA 1VACB 3EOTH 2BCKB 2ZP8A 4M1DH 4JPKL 4KRNA 3TPUB 2OTUA 3D34A 3EOBB 2BY0A 3NH7H 5CP3A 3WJJC 2CKNA 4PJFB 1EHLL 2Z92A 3MO1A 4ONOA 3IFNH 5ILTH 2WLKA 4MA1B 4NWTL 5F88A 1U4EA 3NACH 3OKLA 3SYAA 1A6ZA 1G1OA 1UD6A 3CFIC 5I15L 2MMXA 2JMRA 5EU6A 2YEQA 3WY3A 2JXMB 3UAJA 1HNYA 2V7HB 1PDKB 3UZVA 1YNLL 2HX7A 2FECL 1F41A 2LTQC 2HYMA 3MXWL 5DYOB 2EYRA 4YHKH 1R47A 4ZW7A 5KUKA 2HTLC 5INDB 3PHOA 4HMDA 4NJAH 3EO0B 3S8GB 1JRHH 4B50A 1CXFA 2BLFA 1CXEA 4KI5C 1KCUH 1PKQE 2V37A 3QYNA 5IB1A 3VYPA 4D0BA 5F7KC 5BV7L 1U8LB 1DQLL 2K70A 4LNRB 4TNWK 2GTWB 1TENA 3IDJA 1MFCL 4XVJH 5AZ2L 3BPCB 1DFBH 3T65B 3ZQWA 2UVFA 4WFFE 3RVXD 2NUTA 1GYAA 2YQGA 5E51A 4H88H 4Z76B 1BXUA 1MI5B 4S1DD 2WZ0A 1QFWM 2OL3L 4K2UH 4UU9B 4JFHE 4U6VH 1OF0A 4IKNA 3EYUH 1KIQA 1KPVA 3MJ6A 1AS6A 2FAUA 2M26A 4ZXBC 3AXIA 5D1XA 3RJQB 2P5WB 5FK9B 5EC2A 5AD0B 2YKLL 3FZUD 4PTTA 2VDLB 1FN4B 2QPDB 2VR3A 4XPHL 2P8PA 3GZQA 4XVSH 2VLRA 4Y2NA 1F58H 4U05A 5FW6A 1XSKA 2Y5TB 3CMOH 5SX5K 2XWTB 1ZLUH 2GCYA 4ZFGH 2BWIA 1F4YH 4YZWA 4Y1AA 2BWDA 5ESVB 2VH5H 4X6DB 5KVGH 4M00A 4M7LH 4JFED 5AW7B 2OR9L 4FLRA 1S4IA 3V8CA 3RX8A 1S3KH 4IS6A 4BCYA 3SGEI 1BP3B 3FAWA 3GUFA 4YXKH 1H15B 5T1MB 5CP7B 2OSWA 4MD4B 4UOZA 4S1DC 1C5CH 3RHWF 3L4ZA 4NRXA 3I75A 3KPMA 4OJCA 4HIJA 5A7EA 2A73A 3FQUA 4JFEE 1R5IA 3HLKA 5C7XH 4N1EA 1OM3L 4I77L 1CU4L 5TDPA 1C8QA 3B7TA 1L3WA 2EDNA 4R0LC 5GSRB 3QO0B 4A37A 4ABQA 3SKNA 4K7PL 1KJ2B 4L8CA 4XT1C 2VXVH 3BEWA 2V9RA 1K6QL 1SF3A 1A9EB 1JZHA 1UH3A 4JG5A 3AREA 4FFYA 5HYJE 4O02A 1YVLA 3FO2B 4HBQA 2FEDD 3B9KA 3SE3C 4JFDD 1FE8L 3IF1A 5EF3A 5FO7A 3I9AA 1JDCA 2CUMA 2VXTH 3DJSA 5EEYA 1XCWA 2RTTA 2XY1A 1IQDB 2ALAA 2ZXAA 3KWWA 1HZLA 1MHEB 4I88A 4JPVL 1OP4A 3FRPA 4OIBA 3IDUA 1MNUH 1S9XB 1QA9B 2Y2WA 2YUVA 3KR3H 3UADA 2XVBA 1S7UB 5DI8B 1P1ZA 1YJDL 5IHUL 2J8HA 3RRQA 1KACB 4LASH 4WTZA 1YQVH 1X5YA 3T6QC 1YDPA 4FQIL 5F7DA 4XWGL 1Q0YL 3I9PA 3FQWA 1DVFA 1WHPA 2VSMB 3QFJB 5L9DH 1HDMA 1GGCH 1JVOA 1IKNA 1PAMA 1B3JA 5C07A 4Z7WE 1BDYA 4MA8H 4YH6A 2APBA 4LEOA 2H6PB 3SDDC 3UACA 5FA3A 3W9EA 1H5BC 5JORA 4XHQA 5KW9H 4BRJA 3ZW3A 2APTA 2AGJH 1JV5A 5E2VL 5FUZL 4KI1A 1R5WA 4Q6IC 4NX0A 3VXOA 4V1DE 3NJGA 2J8UB 1BBDL 5C9JA 3DETC 5D1QB 5KVEE 4RQQA 3GTTA 3VFMA 3IU4L 4HC1A 5IB5B 3V7MA 3IAPA 4ES9A 3S8WA 3EGXB 1YYLL 3BJLA 3QORA 4NM8H 1ZHKA 5A16B 4CKQA 3A21A 4XN2A 3G6JF 4NN7B 1RZKL 4JPQA 4NN6B 4YXLH 5GSVB 5EORH 3NAAH 3CAFA 3VRJB 4LRNL 3W11C 3MV9B 2WSKA 1TFPA 1KPUA 2KQNA 3BN3B 4L3EE 3L9RB 4JREC 4WO4B 2QKIA 5BZDA 5IBUG 3UCQA 4LPTA 3BD4A 1C7SA 1U8QB 3EO1B 1S9YA 5EBMA 3ERXA 4ONGH 4F8TA 2LOEA 4L4TE 1UM5H 4X9BA 1VRSA 2FB4H 1QBMH 4L05A 4NM4L 5GGVY 3IJ7A 2JTDA 2X2UA 4JFVA 4MX7A 4E9TA 2B0SL 1NCDH 1QEWB 1NCIA 4JFZH 1G7QA 5DRZA 3FN0L 3JYCA 3TLRA 4XC1L 3CFQA 2Z31D 3K4ZA 3K6DA 2C9XA 4M6AA 5C0NC 2G0KA 2DF3A 2EIZB 2R51A 3MLYH 4RZCB 3MREB 1RH8A 5GJSL 4U6XA 2YSSB 4HPOL 3U2SA 4Q6YA 2VITA 3MNWB 2CHDA 3ATDA 3PGFH 4LLWA 3TBVA 3I6LD 3TIDA 4QOKD 5DD5H 1I8UA 1OCWH 3MUHL 1U6AL 1TQSA 2OXHA 2O6CA 1ZHLB 3DHMA 3HZVB 2Z8VC 1CIDA 2J1ZA 2OSXA 2N1KA 1NLDL 2DWDB 2VLKE 3RY6A 1RMFL 3FRUB 2ZG2A 5IBTH 1VFBA 1XSJA 4Z95L 4K9EC 2F19H 2W0KA 4ZMZA 3LB6D 4O2EA 2YLHA 1HESA 3QUZB 4P5TD 3ZE0B 3WLBB 4P3CL 4FYSA 4PGCB 5BXFA 4FYRA 4QGYA 3TJHD 2O5XH 2BP8B 1Q9KB 3BW9A 3NIGB 4JZOA 4ZO9A 1BXXA 5IW6B 1CF1A 1RPUA 5C7ZA 3RI5K 5IMOB 2EE2A 1A0QL 2B5IC 2JKRM 2X53A 4XMZA 1U8CA 4B7IA 1R3HA 1SJEA 1MFMA 3VFOA 4Z7VB 5E5RB 3T3PF 4JFUA 4B9YA 5F7NC 1IC4L 3L4CA 5LXVA 5AG9A 4MDJB 5D6CA 5EHFA 3LH2L 1V5JA 2GIYA 3QIUB 5JOFA 2EDRA 3SBPA 3TT3H 4GIPD 2DJSA 4ZTPH 4APQA 3TH2T 3OAZH 4IIQC 3VWJD 4HUWB 4OVVA 1E42A 1IAII 3P9MB 2GC7C 2X3BA 4KXZH 5HVHB 2XWRA 4CADB 2X0VA 4HWBH 1OZUA 3BWUF 4QGTA 1TJIH 1WE5A 2J21A 2OMWB 3PCYA 5FPIA 4X0KA 5J6HA 5EOCL 1YHPA 2IQAA 3U2JA 3VM7A 4I4WB 1HK6A 3VRIA 4KROD 4YZFF 4ELMB 1KBGL 4OZGB 1NGYA 4FTVD 1M1SA 5GIRA 1ETZB 4XMPL 2VO8A 5BRZB 5K9QI 1SJHB 3U7WL 2EH8L 4BH7B 5AL8A 2DQDL 2N59A 2ZJSH 4MJHA 5CEZL 4K8RD 3T8MA 3MGOA 4ATTA 3AU0A 2AXGA 2N3JA 3ML8A 1MFEL 2A0LD 2Q9OA 3KLHC 1FL6A 3SPVA 1G1CA 1GGBH 2R8SL 4HD9A 3QJTB 4U0RB 5SX5H 5CD5D 1JGUL 4GSXA 1GGIL 5C0IA 1FH5L 3KS0H 2OP4H 3PLYA 5B39B 4TSAL 3BEVB 4N8PA 1OTTD 4HF5L 4WI4A 5FECA 4XP6H 2L7QA 2PW2A 4AT6B 2F53E 4R84A 1NL0H 2W65A 3MODL 4E41B 2WP3O 4RGND 3WEOA 1DQKA 4PRIE 1X5FA 4F7CB 5JW4Q 1OAZL 3HS0C 1I9JL 1TTCA 1YMMD 3QJXA 4JO3L 4LEXH 2CKBH 3NG5A 4OQTL 4K8RC 4HUKB 4RMBA 4DKEH 3U1QA 1IM3D 4NQCB 3H9HB 3HPJA 4G8IB 3MUJA 4Q4IA 1SBSL 2NQCA 4C58B 3GYRA 3V5DA 1TKWA 5IROA 4AVHA 1FDLH 5DMYA 1N7MH 1TZHA 2R23A 4XNQA 2WTRA 4PGBB 4H8WH 2XQBL 3AY4A 4P2YA 2EVIA 3G6AB 4MXVE 4P4KD 4XVTL 3BXNA 4R7NB 1MLCB 3X12A 2X89A 4Y19B 1PZ5A 1XF3B 4HX1B 5KSBE 3WFHB 2TRYA 2OQJB 1MREL 1E4XL 4YS4A 1TU2A 2X6CA 3DX7A 4JRXD 5FFGA 3HZKA 1PG7L 5LG6A 3HZYA 2HZHA 4Y9BA 4M1GL 2LVEA 3K2IA 2JKXA 5E4AA 1ZV2A 2FJGA 3IDIA 4YO0A 1DZBA 1UXWB 3MFGB 1YPZE 3RDTD 4LCCA 1A4CA 5GZOC 5MI0C 5TPWH 2C9RA 2NSXA 1IFRA 2QLVB 3K2KA 1HYSC 2R0LH 3KPRB 4TNGA 4XBEH 1JI1A 1ZLVH 5KEZA 1MY7A 2BZDA 5DVNA 1QTPA 1TCMA 2KPNA 4M4PA 5E56A 1IAOB 3H3BC 3LN5A 5CHNB 1DDTA 3W0WD 4R5XA 3HLAA 2PP7A 4P4KC 2DM2A 5DLMH 4UB0L 5ALCL 1CVSC 3POCA 3VM5A 3DO4A 3F7VA 3C87A 4E9RA 1E43A 3BP4A 4GO8A 5C09B 4RMWA 3L9EA 3WTWA 4G1MB 4GEIA 3KPLA 5HJDA 4R26L 5JOEA 3SOBH 1JFQH 4FHJA 3DGDA 3VTTA 3QRBA 4BXVA 4WI0B 1H0DB 3RDTC 3E8VA 3B2VL 2HFFB 4KKBC 4P9MH 1FHGA 4AYMC 5KTEH 1T1WA 5LNDA 1MJ7H 4WK2B 3SDXA 4YAQB 7TAAA 1S7SB 3C08L 4PJAA 1MFAH 4AUJA 1PTZA 4DZBB 1XCXA 5CN1A 2FWSA 1T5XA 1W15A 3LQZA 3QDGE 5T1DH 5C0BE 4JKPL 5IWLA 3RB7A 2AQ2A 4XMVA 5EEZA 4J27A 1GPOL 2NY5H 2ERJC 4NENA 5HGDB 5IQNA 2AV1B 5E99L 5ABDE 4I9WD 3UYOD 3TL5A 1UVQB 1OE2A 1ZHNB 2V7NB 2A9NH 4E5XG 5L2KD 2AJXL 4DZ8A 2WLYA 5B3NA 1I1AD 4PP1C 3GI9H 2HVKA 4HIPA 4R7XA 2AQNA 2YARA 2Q8BH 5E6IB 5IEKA 1R3LB 2YN3A 2HWZL 5IJKC 5D2NB 4ETQA 5JR1L 5FYKU 3C60D 4DK6A 2A6DA 3BHBB 3V10A 5B7MA 3Q6FB 1UACH 1OT2A 3OJVC 5D7LD 4IW4C 4NEHB 3VGBA 1SOQA 4QXTB 3MA9L 1ZT7B 2BVOA 2DQEH 4BJLA 1Z9SB 3WKML 4BSJA 1CLYL 2HFEA 1OB0A 4R4NC 4JJHA 4ZRGA 4LBAA 1E5AA 4LZKA 1NFDB 2JCCA 1NCTA 4EZKA 4Y4FA 4AMXA 2QADB 2V2WA 4G1EA 4WEBL 4GKNB 2XN1A 4Y9EA 5KSAD 2BVEA 5ESAB 2HH0L 2ICWA 2D4FA 5FGCE 1XVSA 4KK8D 1P7HL 3QG7L 3MNVB 3IMBA 1NFAA 2VJ8A 5TFSL 1I9IL 3QUKB 4D0DA 1MEXL 3HC0B 3MV7B 3MOBH 5IREA 2CBPA 2VC2L 2YPVL 4LRIA 4WRLA 3KW8A 4Y5XC 1L9PA 1MW2A 1BQHB 4BDVB 3EYSL 1NAKL 2H6OA 5LB1A 3MLVH 4X98A 1ODAA 4AMKL 5EU4A 3PWJA 4D94A 1IKOP 3O3AB 3IM1A 2IGLA 3JT0A 2E75C 5IKCA 5E4EB 3LEVH 4TPRL 3G5YB 3NCJL 3O3EB 3SDCC 4UTBA 2MQ3A 3B5TA 4JO5A 2XX1A 5JXAH 3S36H 1QHQA 5T3ZH 4BFIA 2IGTA 2XFXB 4L4VB 4PCYA 4POZD 3ARGC 4QDGA 1KJVA 4LU5H 4UAOB 5IFHL 4XNZB 1H6UA 4NPYA 5KSAC 3QR0A 1N8ZB 3PPEA 1CLZH 1MW1A 4KK8C 3IDNB 2PO6B 2BSEA 3EYFA 5BO1H 4GS7B 2D9QB 5A6LA 2MPAH 2DIJA 4PJ7A 3LHPH 3TASA 1UWGL 4N2CA 4JE4B 3CFDA 3H3PH 1MVYA 5DS8B 5FEBA 2GABA 2O61B 4IOIB 4JZNA 3BVNB 4AZ8A 2AVGA 2O5NA 4RISL 3V0WH 1D6EB 1UD8A 4GRWF 5L0QB 5I16B 4AV0A 2EIBA 1MCEA 2X9YA 2WIIB 2FDBP 3CC5A 3F6JA 4IRSD 3VGEA 1VJSA 3V0DA 3ECBA 3LEYH 3IXAA 4QRTA 2BCMA 2O72A 5GHWH 1BZEA 1FCGA 2H8PA 3JV4B 1HXMB 4J3SA 4HZ1A 1J8KA 4PVNA 1A7BA 3GPEA 4G8FB 2IPTL 3CUPA 3QHZL 5L2JB 2FBRA 2IAND 4P07A 4OLWH 3L6FB 5T1KA 2GJ6A 1INEL 1MAJA 4JX0A 4O02H 3G5VA 4YNYB 5C0JA 5I8OH 1WLHA 2H2PC 1LMIA 2WLLA 2AK4B 2Z7ZA 4DCQA 3B9DA 4UTCA 1YUHB 4YDLC 3QCVH 1N18A 2WQXA 4ATWA 4QXGL 4ODTL 3TIEA 2APXA 2MH4A 1A3LH 5F7EL 4M1CD 1B4RA 1P4IL 1EO8L 1MFDH 3F7PC 3HUJF 3OV6A 1T2JA 1ZDSA 1T1ZB 2FJFA 3G08A 1F6FB 3IDYC 2AXFA 2PF6A 3NZ8A 4QRUA 1NMAH 4ZJ9A 5CCHE 3ZMEA 4RRPM 1IAIM 1CIUA 1SEQH 5DZVA 3GO1H 5CM1A 4KO7A 2Y6SC 3WJJA 4IOSA 1QPXA 3WSQH 2YD8A 3OKOA 3MBWB 5IJBC 3UTPE 5I5IA 1ORQA 2AEQL 2B8OT 1UZ6E 1X4ZA 2RIKA 1UYWH 3CHXA 3US0A 4WEMB 5FYJL 3UJTH 1NAML 2B14A 3APMA 1J1XH 2FHFA 4LB8A 5DVPA 3OLEA 2FO8A 1UUSA 1O0VA 3KLQA 1C5BL 5DJDA 2LU7A 2QZQA 5AWNL 1Y1UA 5H2BA 4NQDE 3ECUA 4IJ3B 2Q7YA 3GSVB 3FTYA 4AYDC 2CXKA 4TMPA 3NGBB 3O11A 2FQFA 3GSOB 4JPIA 3IKCA 1S5IH 3VXRB 4JMXA 5DMGC 4MAZA 3EZJB 5FO9A 1Q72H 1C5DB 3NIFE 5C0FB 4L29B 4LSSL 1EZSA 4JN2B 1VERA 3U4BH 4OCMC 1HKFA 2WKOF 1DUYA 5DD1H 5E6RB 3LNIA 3AMKA 1ZCRA 3O2DL 1KTDA 1KOAA 1CL7L 5CBAA 4I3RH 4J4PC 5HHOD 4AVKA 2QQLL 2XV2A 4DIXA 2FD6H 3CFNA 5MERB 1BZ8A 1C08A 3FT9A 5GGTA 1B6UA 2X7LA 4H8VA 1FORL 1TDQA 1RFDL 3FFOA 4PJ5B 4G11A 3VRLF 3FO0H 1HNFA 3WJMB 3BIKA 6FABL 2ZCKH 4FNSA 1XH1A 3VA2C 3MA7A 1PKQA 1JV2B 3C5ZC 3SKMB 2VSKB 4CN1A 3CFJA 4ZXBA 2EH7L 5AB0A 3TVMD 1L9MA 1N5AB 2DQUL 4U0QB 1O9WA 3T2NL 1KPRA 5F9WB 1JPFB 3N06B 3H55A 4H8UA 4BKSC 5LCVH 3U2IA 1G7JA 3GIZH 4JHUA 4ZMNA 3GRWH 2CO7A 3U79A 5ETUB 3BGAA 2XYBA 2WGXA 2WBWB 3ARFC 3ABGA 3V0GA 5I1DA 4GMTL 1TQVA 1VEOA 1AGDB 2ZYHA 1IGCH 3G04A 3KYKH 5HHME 3UBGA 3K3QA 5LQBL 1TOXA 1IBHA 4IMLB 3MLSH 3NFPA 3MKGA 2ZF9A 3K2UL 1QYGL 4FL4B 4Y1TA 4NKIH 3UZEC 3WOVA 3LIZA 4KXAA 1R9FA 4EN3C 3P9LA 3ARQA 4JFSA 2MNWA 3SDAD 3TVMC 1JNLH 1JXKA 1P5UC 1Z5HA 3PXJA 1NC4D 4R0LA 5TDNA 3HC4L 3UMNA 4MA7H 2ZF8A 1AY1L 2NZIA 2OS7A 1XGYH 5HSFA 5A7BA 4LSQL 3AXLB 1DL7L 1G7HB 4JG0L 2DQGH 4BQBA 3ULUE 3QNXA 3J07A 3QUXD 5C0AD 3GRBA 3SE3A 1G9NL 1RZ7L 3QAZC 1X5JA 5F6IB 4JFEA 5DYFA 2WQ8A 4LK4A 2MCMA 4DO6A 3X3GH 5D7IE 3QPXH 3M8OL 4L3AA 4RFNB 1N3NA 2DLFL 4LPVA 1PY0A 4KVNL 5J13B 2NR6D 1QFWH 5FHBL 4Q9QH 1WWWX 3K5SA 3KBEA 4NFCA 3BH8B 5DJ8A 5KZCD 4UINL 2XT1B 5HD8C 3VFUA 1YUKB 4KNTA 5HYJA 4F7KA 2NY1D 5D5MB 3S4SB 4NO0D 2CMRH 2X4RB 2XTJD 2ITDA 2WQSA 3KPOA 5HVWA 2FJHB 3H9SB 4HLZH 2YR3A 4AGQA 3SDDA 1NBQA 1P7KB 3QUML 1UEMA 1H5BA 2UX6A 3BYTA 2X6BA 5LAXA 4B3EA 3ROOA 4PBWD 1DJGA 1XGQA 4Q6IA 2I32A 5J7CC 2UXGA 5I73B 2Q8AH 1DBBL 5IHWA 1AP2B 2COVD 4D0CB 3H56A 1E3FA 3LPPA 5SWSB 4C55A 3LKOA 2JNZA 3LH8A 5DD6A 3FB6B 4F2ME 1IGYA 1KCKA 1FZOB 4Z7WA 1FZMB 2QDWA 4UT7L 5DHEA 2NY1C 3HAEG 3QXAA 1JGDB 5IOPA 4XAWH 4V1DA 3SHSA 2IPKA 4IRZH 4DKFL 3EYVA 4Z0BH 4B0MB 1ADQA 3CDCA 2UWEB 2VERA 1MCBA 3O4LB 5DURB 4HYTB 5J8OA 4RAHA 3AG4B 3TNMA 5LGHL 3VFWB 2DQCH 1RLBA 3G5ZB 4UV7H 4J3OD 3UO1L 1KTCA 5I28A 3D09A 5CZXC 2Y0SA 2XWBB 1QI4A 3D3VB 4AEHH 1KN2H 4L3EA 5LNGA 5E08L 4BHUI 5L4IA 2DPKA 3MBED 5FCSH 3GXPA 2YAPA 4H1LH 3WKPA 5IQ7L 2FSEB 1ZLEA 2EVJA 1QKZH 5I1EL 1MZZA 3ZMNA 4IYKA 4QRQA 1E5YA 2C3WA 5LWYL 1Y18B 2ZKXA 4PJCB 4RWYL 1A65A 2F54D 4RRPA 1P9MC 4JY4B 6TAAA 1E5ZA 4EKXA 3LRLA 1RK0B 2YEZA 4NC0B 1I1FB 4K23H 4K71B 4WFGE 4PRNB 4UOW1 4X6EA 4FFWC 4H4NA 4TVPH 4PW4A 2VR6A 2OKMA 2OMZB 4LVNB 2ZX8A 1W72A 1U8NA 2EE6A 5A1AA 2J2ZB 2XYCA 3QH3A 2EUWA 3WUWB 4J3OC 1Q9WB 1LWJA 1L9RA 4WHYH 1YY9D 3EDFA 1DDHA 4PJGF 2G2RA 3WMSA 3INUH 4ZSOE 3BUTA 1JZFA 1TZOA 4KUZL 3MBEC 1FNEA 3QNYB 4N6RA 1HHJA 2WCGA 2UZIL 1SBBA 2VLKA 2YQ3A 5EO0B 4HUCA 1V10A 3DROA 1Z9PA 4XBPB 4WW2B 4AM0B 1EAJA 2P28B 4UYPA 3T71A 3BFQG 1PZUB 3KPSD 4HZAA 3LS5L 5AVQB 3VFVB 4X4YA 1OLZA 2YGVA 2B3RA 3D85B 3JTTB 3QG6B 3MMEA 4F33B 2VERN 1PPIA 4PJIB 1KYUA 1EBAA 1KG0B 3CX2A 3L3OC 4QTHB 4WSJA 4IIQA 1X4XA 1VFMA 2QGEA 5BMFH 4G8EA 5B38A 4KQ0A 1FGNH 5F7LB 3WIHA 3U0WL 2YBGA 4GI9A 3WIAA 1A7NH 1JN6B 4A6YA 2AJ3A 2IV9A 5I1AA 1WBXA 2Z4QB 2A74B 2GK0B 1J0YA 1RUMH 1LNUA 4PIBA 1CFTB 3WMPA 1PVHA 3BDYH 4JO4L 4MJ2A 4OVUA 2VN5A 4GRMB 3DVGB 4P9HL 2HPTA 3STZA 1ZS2A 4AV4A 1A3RL 3ESPA 3S96B 4RDQF 4ZW8A 1N4XH 5DJZB 3ET9F 1JUFB 4O2FA 1D5MA 4UOW0 5CFHA 1RZQA 5K39B 3SY0A 1PNDA 4GRLB 3MOQA 3JTBA 3B43A 4RDQG 2ADJA 1SYVA 1ZD6A 4HMCA 1XF2B 4V33A 4AXWB 5F96L 3NTCL 4MSWB 3VXQB 4O51B 4KHTL 4XOAA 4ZNEE 5I30H 3U9PH 3CG8A 2XG5A 4JB9H 5D2LB 4ZNCD 4EIUA 1ML0A 2B9BA 2DBLL 3QDMD 4CNIA 2NDGA 1IM9A 4OGYH 1G9MC 1S9KC 2FX8L 2B59A 4EI5D 4F37K 5DC9B 1ITCA 3AT8A 2C7UB 4B27A 3S35X 4LDLB 3CVBA 4WGVB 1CDYA 2OXGA 3CVCA 1H3UA 4MASA 2VZOA 2VOTA 3CFKB 4IBZA 2EDOA 5HDOA 4HC1L 3DGGA 5LJYH 5EIIA 2VL5B 3I2CL 3NIDF 3HS0A 4G9FD 2IDTA 1L6ZA 4U1IA 2DMHA 3L3IA 4KTEL 2G5BB 1LEIA 3KAAA 3HI1B 5IV2B 2DL2A 4PW9A 5FF6A 4YE4L 2XIBA 3AT0A 3BPNB 1M71A 3O2WL 4UQ3A 5CMAB 5FHAL 2OYPA 3Q9PA 2VABB 3UTZB 4FZEH 3HFML 4Q0XH 5ITFB 1LE9B 2WW8A 5FYLE 2CDEA 2F53A 3RX7A 2XY2A 1RIUH 4Y5VB 1CT8B 3REVA 4I7ZC 3FONB 2EZ0D 3Q5OA 1DBJL 4FXGB 4PRIA 4X5WB 5A2BA 4TKWA 4OKVB 1AS7A 2WLJA 1NC2B 4EI5C 3GHBL 2DQTH 4OI9A 1DHKA 1JXFA 5EZPA 5BW7C 4Y2OA 1QSFB 4XNDA 4EI6B 2BIMA 4PGJA 4HXBH 3CQPA 1AVAA 3RGVB 4IGBC 1HU8A 3ZUNC 5L4MA 2VR4A 2H2SC 3BPOC 1FIGH 1VIWA 4WEUD 5SX4H 1AXSA 1YMMA 2CDGB 4G7SB 4M93B 3ZRCC 2R56L 1IM3A 3BUDA 5GZOA 3FHEA 1U8IB 4X0NA 3C6SA 1I8MA 3CU1A 1UJ3C 2ADFL 1NCOA 1U3YA 2X4UB 5KSBA 1QTSA 4ZQKA 5D8JH 1RL1A 3V0VB 4PWKA 3MOAH 4FJZA 2YN5A 4Z78B 1IFHL 1TPXC 1E5BA 2XWXA 3OKEB 1NUGA 3BP6B 4AQAB 4MD5A 4P4KA 3FOMB 5ID0A 1JZ8A 1K4CB 5ISZD 1KDIA 1DJIA 4KXDA 5IHZB 1NMCC 4L5FH 3IK2A 3WKNA 1NBVH 3IPFA 4M8RA 2JI2A 3BT2L 4OCYH 2VXQA 3VFRA 2FWOB 3TJEL 1K4DB 3TO2A 1I3GH 4JFFB 5IGXL