2AQNA

Cu/zn superoxide dismutase from neisseria meningitidis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
155
structure length
155
Chain Sequence
ASIEVKVQQLDPVNGNKDVGTVTITESNYGLVFTPDLQGLSEGLHGFHIHENPSCEPKEKEGKLTAGLGAGGHWDPKGAKQHGYPWQDDAHLGDLPALTVLHDGTATNPVLAPRLKHLDDVRGHSIMIHTGGDNHSDHPAPLGGGGPRMACGVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
publication title CU/ZN superoxide dismutase from neisseria meningitidis
rcsb
source organism Neisseria meningitidis
total genus 40
structure length 155
sequence length 155
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2aqnA00
2AQTA 2GBTA 1SXZA 4OH2A 1UXLA 4A7QA 4A7SA 2AEOA 3KH4A 4N3UA 1OAJA 2AQPA 1JCVA 1U3NA 1OEZW 1SXSA 1MFMA 1L3NA 5CU9A 3HW7A 3HOGA 2WKOA 4A7UA 2C9UA 3QQDB 1XTMA 1SDYA 1XSOA 1YAZA 2WKOF 1E9OA 3ECUA 2VR7A 1F1AA 2WYZA 4BCZA 2SODB 1TO5A 3CQQA 2Z7UA 3PU7A 3F7KA 1SXNA 2ZKWA 1XTLA 3KM1A 1E9PB 1F1GA 1E9QB 1N19A 1OALA 4OJAA 2AQNA 2K4WA 1N18A 1PU0A 1P1VA 1AZVA 2WYTA 4MCMA 4U4IA 1BZOA 1PTZA 1RK7A 4B3EA 2ZKYA 5KBKA 1B4LA 1OZTG 2WWOA 2AQQA 3LTVA 5KBLA 1B4TA 3K91A 3KBFA 3QQDA 2C9VA 1S4IA 1EQWA 1BA9A 3GZOA 1IBFA 2Z7WA 3KM2A 1SXCA 3GTVA 3MNDA 2APSA 1E9PA 2ZKXA 1Z9PA 2JCWA 2AF2A 1SDAB 1QUPA 1YSOA 2WZ5A 4BD4A 3GQFA 1IB5A 1SXAA 3CQPA 1HL5A 3GZQA 3GTTA 1PZSA 1DSWA 1CBJA 2C9SA 3T5WA 2V0AA 1TO4A 3H2PA 2E46A 4A7TA 2Q2LA 2VR8A 1ESOA 2GBUA 3SODB 1HL4A 1CB4A 1F1DA 2XJLA 1EJ8A 1SXBA 1YAIA 4L05A 2R27A 1SRDA 3F7LA 1Q0EA 3L9YA 1E9QA 1FUNA 3KBEA 1COBA 1IBHA 1SPDA 4MCNA 1KMGA 1IBDA 4A7GA 4A7GF 4A7VA 3L9EA 3MKGA 2LU5A 1JK9B 2GBVA 4BCYA 1Z9NA 2AQSA 1IBBA 2WWNA 2AQRA 2NNXA 2Z7ZA 3RE0A 2JLPA 2E47A 3KH3A 2WZ0A 1UXMA 3CE1A 1F18A 3S0PA 2ZOWA 1E9OB 2VR6A 3GZPA 1OZUA 1SOSA 4N3TA 1DO5A 3H2QA 2XJKA 3HFFA 2Z7YA 5KBMA 4FF9A 3ECWA 3ECVA 2WZ6A 1JK9A
chains in the Genus database with same CATH superfamily
3RWFA 4LHUD 3WKNA 2H1LM 5C7XL 2FYYA 3PPEA 1BYNA 4H26B 2P5ED 3PJLA 4BSJA 4S1QL 4DN3H 4JFHE 1DR9A 1B88A 3P2DA 4QRUB 3IDIA 1K5WA 3P40A 3S5LB 2KQMA 4ODVH 5D96B 2V17L 4RGNB 2PYEE 4G9FA 3ZRSA 1Q90A 5KG9A 5CKAA 1IQWL 2LU3A 2BY3A 1U0QA 1A3RL 5AD0B 3T0EA 3GMNA 5L0QC 3AMLA 4LARH 4NFDA 1JNHA 3VGAB 2VSKB 4JJOA 4GRWE 1FIGL 1B0IA 1BREA 3RWEA 1EXUA 4OT1H 3VI3B 4PVBA 3L16A 4JM2F 4XPTL 1A8JH 1RUQL 4WFHD 4CC4C 3Q9QA 4ODXA 2PP9A 5E8NA 4OUOA 1QRNE 3P4OA 5H37G 5ICZB 5D7EA 3U0WL 5AW5B 4M1DL 3AW5A 4P59L 2G30A 5I2IB 3VI4E 1BIHA 2C3GA 1MJ8L 3NJIA 4Z78A 2CLRA 5G5DA 2JJSC 3AQYA 4XX1G 1XXFC 3ES6A 4W6YB 3D69A 5ESVA 1OAZH 1UA3A 2NYZA 1BVNT 4L4VD 5CUSH 3MCYA 4K9JA 1LILA 3K72B 1OKEA 4I1NB 4R5XA 2WBXA 4JO8A 3SE4A 4DKTA 1BYPA 3N43B 4DZBB 1L5GB 4KDTA 4MQ7A 3IMBA 3DHMA 3VO0A 1G7IA 4HFUH 3ARBC 1KPRA 4UI2A 1HK6A 1NCWH 3QJVB 2Z8SA 4F7MA 5FUCC 3QUGA 3P4NA 4ZS7L 1XR9A 3ORJA 3F7QA 3TP4A 3HE7A 3LPGA 4Y4KD 3MO1B 4GG6E 5DZ9A 2JI1A 4EDWH 2UXTA 4GI8A 4DPAX 2GBVA 4PUBL 2PCPA 5CBAB 3UJJL 3A4EA 4KY1H 4KRMB 1OARH 3ZHLA 1KCSL 1S9VB 5TFSL 1X7QA 3MTRA 3TPUA 4K5LA 2YJQA 3W0WA 3LIUA 4LGPB 4X6DA 4HFWA 3M88A 3IJ9A 1QEWB 1ETZB 3D4YA 3OB0K 2VR6A 3CC1A 5KSAB 1GSMA 2Y23A 4TUUA 2CIIA 1SNRA 3MQIA 2FZ3B 2Q9OA 2NCMA 3AQZA 3QNXB 4LIQL 5A7BA 3T3PB 4IIZA 5A3IC 4QTIH 4I3SL 1XGYH 3ARYA 4KK9C 1W91A 1XCTA 2A1WL 5DZNA 3BN9D 2ORBL 4BYHA 3RNQB 4AE0A 2Y07H 3PP3K 4NNYA 3ARTA 3SKJH 3N85H 5HHOA 5IJCC 4ZPTB 3V9CA 1A47A 3C60D 4PWEA 1JGLL 1ZT7A 3P1VA 3TEZA 1SLXA 1GA2A 2OSLB 4TNEA 3K6SA 4NN5B 1A65A 5JIQA 4LLWB 4CNIA 2OW7A 3N3EA 4DAGL 1WF5A 3DK2A 1AGEB 4HKJB 4GO6B 1CBVH 5IB5B 1AXIB 2J44A 2VC2L 5IBUB 3SYQA 2EDWA 3JV6B 1BJ1J 2C7UB 4QO1B 3LKSB 3L3GA 5E94B 1CXLA 1C1EH 2NXYD 5JORB 1IUZA 3VFRA 4FTVE 1K2DB 5E0FA 2A6DB 2ZCLL 1AZZC 4JFDD 1RHHA 4GAJH 4G1MA 4ZNCD 3HNVL 1IBFA 4KVCL 1OAUH 4KV5F 1NFIB 2EUZA 4FL4B 1LWJA 3DMMD 4JJHA 4AEFA 4G6JL 3S34L 1JFQH 2Q2EB 2XA8H 3MOBH 3ZZQA 1S9XA 1H15A 3H6JA 4CVZB 3WTUA 2D8KA 2O6CA 4XNQA 2JIXD 2N56A 5D7IA 3HHSA 3QIWD 2ID5A 5DEJA 1IGTB 1UOVA 2D31A 2QR0A 3V4VB 3TBWA 3V0JA 2R56H 2ZD0A 1IAIM 1O7DE 3O6FC 1KEML 4X5XA 1UWGH 4NM4L 2ZOTA 2ZYHA 1JRHL 1TG8A 4L23A 5I24A 1L6XA 4MD5B 4AYEC 1F45A 5D1QA 2Q7YB 4G6KH 1F58H 2JCCA 3MSPA 3WO4B 5GGVH 2JKRM 2OTUB 3V10A 3LSOA 4J3OH 2CA3A 1W0VA 2BZDA 4KQ3L 2X0VA 4L0ZA 5ADOL 4U49A 2PCXA 3RX5A 3IF1A 4RGMB 1MNUH 5I82A 3P69A 3BP6A 3FPXA 3GJFK 4G1EA 5CP7B 1IAOA 1D9KB 4J6IA 1J5IA 1PG7L 4O51B 1F02I 4TNWK 1U58A 1E43A 5C6TH 2FEDD 1CXFA 3BD5A 5DFVD 4MRCA 3T8XB 4EQ3A 2MQCA 2EH8H 2OMUA 4BFKA 4K9EL 4JFZL 4APQC 4P5KB 1SOSA 2J6EL 2YR3A 4QRRD 1HKLL 2LV4A 2PR4L 3JXAA 5I1IL 3BZ4A 1U42A 5MERB 1N67A 1U6AL 1Z5YD 2D7TH 3OLDA 4N1HB 3CZFB 1XIWC 3MBEC 4WUUE 5E56A 3KPQB 4PY8I 1M7UA 3VG0H 5BUGA 3VRLF 4HQQH 5AW1B 1ASOA 4MAYA 5CGYC 1RULH 4R26H 5DK2B 3DIDA 1ZIBA 3RRQA 4BCXA 3WD5L 1BVKA 2EIZB 3LZLA 2C9UA 4QOKB 2CO7A 4OQ1A 4W9GC 5IVZB 5ITBH 4YPJA 2H32A 3WG7B 1WGVA 4GOSA 2QADB 1KIRA 3JTBA 1XMEB 5FHBH 1KTLB 1KCVH 4OIIL 2GAZA 2CLVB 5J57B 5I1DA 1KJ2L 3GHBH 3OBAA 2VLLB 4RBPH 4RISL 3OKMB 5H94B 2NDGA 3LN5A 2GI7A 5I6NA 1YEHH 2GK0B 4TLUA 4QIRA 2QTVA 4B5EA 4CGTA 4G83A 5HHPB 3UJIH 2CLZA 1S9YA 4LVNB 1D5XB 3QUMB 1GGBL 1ORQA 3MV8E 1HIMH 4U6VL 2AGJH 4P5RA 4ZTOH 4WW2F 3GXTA 1SLVA 4MXVE 1UURA 2YRZA 4W4NA 3LOWA 3QNYB 3CFEA 4PLJD 1R3HA 2H47C 2VMDA 3US9A 4F57L 4LQFH 3VW3L 3HBZA 5KYUA 2OR9L 4KZ0A 3GNMH 4NZFA 4CJ1A 3OHXB 4WQOA 5T1MA 1QASA 5TF0A 2W1NA 2A0LD 4IRJB 5IVXB 3OAUL 1T83C 3ATDA 3PWLA 3QDMD 4YOKA 1A14H 1G6RH 4D2NA 4MMXC 1MREL 4ZTPL 1LE5A 2P42B 3KLKA 4ONFL 4UV7L 4C56D 5A3ID 1U2CA 2WQWA 1TJIL 4XMLL 4K55A 5CLWA 4LKCB 4R4NC 4HC1A 1QNZH 5J4MA 2CDEA 4RGOL 2BP0A 3DBSA 5IWLC 2VKXA 1WTGT 4BFGA 1E5AA 1OTSC 3ULSB 4XMXA 3VI3A 1EJ6A 4QRAA 2RCSH 3V4UH 2VDKB 5CMAB 3NFSL 1CIDA 4BWWA 1G7JA 5TE4H 4LSTL 2F0CA 2F1BA 2AJUH 1V8HA 2BIOA 2DL9A 3UP1A 1SN0A 2BDNH 2E7BA 4MRBA 3B7UX 4I5BB 1SEQH 3UO8B 3QJSB 4DO4A 4GKLA 5F6IB 3MRDB 3BUQA 3HN3A 4I48B 4P3DA 2FCBA 7PAZA 1G4RA 5I6XB 3G6JF 3QFJD 3ZE0E 1SY6H 4WV1C 3MLUH 3VX1A 1MQKL 2VLRB 4FQ2H 3S37H 5K9JL 1VEOA 1JRHI 1Y1DA 1XV8A 3GRWL 3BSHA 4JHBA 4HUVA 1PLCA 1MRFL 1O75A 3CBKB 3P3UA 1T7VA 3EO0A 4FNLL 2KUTA 3FO9B 2C4FU 4U1HB 3SDCB 4GXVH 4IGBD 2Z35B 3CMGA 3HZKB 1MW0A 1T80A 2DBJA 3O6FD 1L0QA 2EC9U 2UZPA 2VW6A 3QUXA 1LO2L 4HIIB 4JDEB 2FIKB 4X4ZA 1DZBA 1KOAA 1QLEH 3K6FA 4GXFA 5DEFB 4N2GA 3MO1A 1BQLL 1GXEA 5IR1B 2WCSA 2C7FA 1E4XL 5CBAA 3C8HA 2BVOB 1H19A 2ERJB 3OR7B 3VXSD 1RPKA 2Y5TB 4OCRH 1CR9L 3KWUA 1S9VA 6FABH 4LCWA 1RZGB 5AEAA 1MAML 2MH4A 1CD1A 3MLWL 3WN5C 1RJLB 5AW7B 1LO5B 1P2CB 3JWDH 4NT6A 2W8CA 5DD5H 4OLEA 1USZA 3WYRA 4Q9CA 1E9PA 1S78C 2FZ3A 3QIBB 5EZPA 3QNXA 2WXJA 4P2CG 3S2AA 1FP5A 2NY3C 5DD6B 2FHBA 1XWVA 2EYSB 1MHPL 3BUPA 4KAQH 2JNZA 1C8PA 5HPOA 3F7RA 2ENPA 3NJFA 4APQD 5DUPH 4URKA 3T2LA 1KZYA 3M17B 4X6CB 4NJAL 3UJTL 4BZ2A 1Y6KR 1OOWA 2E46A 1DSYA 4BDVB 3FUDA 4F8PA 1TTRA 5GSRA 1CGYA 3BLPX 3OGCB 2HX9A 3L3KB 4LLMA 4DVRL 1HE7A 1SXBA 4Z7WB 1SBSL 4L3EB 2WCGA 4IOIB 4F2FA 2Z8VC 1QR4A 3Q6FB 4Q6IC 3V52L 3MFGB 4MCNA 3FMGL 3MRPB 3MRNB 2HFGL 4RZCA 4YX2H 2DS4A 3N91A 5DQ9B 3ROLA 4YL9A 3TO2B 4NXKA 2YN3A 1O5DT 4PRHE 3NIDE 2ADIA 2V2WB 4U1MB 5JW4N 1E8XA 4ZW8A 4L1BA 3TIEB 1UTDA 1J1XL 1K2DA 1J0JA 1I3RA 2A6DA 3D87B 4MX7B 4UT6H 1H0DB 3D3VD 3UH8A 1LK3H 12E8H 1LL1A 3HG5A 1HCFX 1UWEH 3D52A 4KMTL 3TYFA 4LBEA 2XG5B 2B08A 1AG0A 1YEWA 1NFIA 3QXAA 2IAAC 4OJCA 3CG8A 1A7PH 5ID0B 2B16A 4HWZA 3WUWB 4Z7VF 3BKJH 1JGIA 5CEYB 3TH3T 4RMQA 1IGTA 2H41A 2AQTA 4N2BA 5E0QA 5FXCH 4L0PB 3F8UB 3V0WL 2VXQH 4FQLH 1OTTD 2WBJB 3AADB 4U6YB 5ITFB 4AQOA 4ZMWA 3UZQA 1CN4A 1M4KA 2H2PC 4KZDL 4ZW7A 5JOPE 1Q0YH 4ZFGH 5JXEC 4A7UA 1TZHB 1LP9F 4MD5A 2Q7YA 1FNGA 4UAOB 4XO5A 1HT6A 4KVNL 2OTUA 2R9HC 1JP5A 2E7CA 2VUKA 5FWQA 5L2KD 3LPWA 4M00A 3DX6B 1TZAA 4R4ND 1NBZA 1YEKL 4KI5F 3R4DA 3P3SA 4DCQB 3H9SB 1A7BA 1IVTA 5KVDL 3K81A 2P5WB 4HWBH 4NI3A 5A16B 4RX4A 1OTSD 5CR8A 3M8OH 3RFRA 1EXGA 1HINL 2X9XA 4AC4A 1IKNA 2Z8RA 1HXMB 3QZWG 4U1GC 3GZOA 4LSUH 1A5FH 3BH8A 2OCJA 4KROB 3MROA 3L5XH 2GTWB 5IROC 1J9RA 3VSQA 2IPTL 5I0YA 3TURA 2A9CA 2HVJB 3V0IA 4LEOA 2JCWA 1N0LA 1OTUC 5JPMB 1WZLA 1S5IL 3ARFC 1ODAA 3UBGA 2WSPA 3CQPA 5IW3A 5IV2B 5EC2B 4P57A 1T2QH 4X9HA 4G7VH 2EIZA 5HYSB 4IKIA 4MNGA 4D3CL 1GW0A 4ZUVB 2GBAA 3TYGL 4TSBH 3P3YA 3U9UB 2DLFL 1E3XA 1X4YA 4IBSA 4J39A 4YDIH 5IVZA 4FFWC 4QRBA 1CWVA 1TVHA 2PETA 3UMNA 5AZEL 1E4XI 32C2B 3GBML 4P2AA 5FO7A 5JOFA 3IDUA 5GRVK 4PSRA 4ZFFB 1COBA 3OKMA 1H3WM 5H94A 4AGNA 2V9UA 2XTJC 1RMFL 2NZ9C 4UZSA 3M7OA 3PWNB 3IWUA 1HZHL 3NEOA 4MTMA 1JPEA 5HHPA 4NKDB 3RFZA 4JM2B 1KCRL 2GG1A 2FR4A 4D9QD 2VZVA 3QCTH 3W56A 3UIYA 1SVZA 2ICEC 2YO3A 3G04A 5C07E 1GTFA 4PWGA 3S5LG 5EF2A 3KYMB 3CFJA 4PJAE 1SUHA 4G42B 1MFCL 2VNCA 3T65A 4F7TB 5BPPA 3E3QE 1LTXA 1WC7B 3MYZA 2WGXA 2XFXA 4FS0A 3QUZD 3QUYD 1RIVH 4L4TD 3O6ML 5D7KD 3ARDB 2DQJH 3VTAA 4YQXL 4YDLC 1T6WA 3LN4A 3JV0A 4F93B 3UBFA 1S78D 2F2HA 1CFVL 3L4VA 4PWKA 5JW4M 5CR1A 4KTDH 3N0AA 2K6WA 5AYQA 3MRIB 35C8L 3C6LA 3DJZA 4WTQA 4XB8A 4KRPB 3UG3A 3GRGA 2HN7B 4UDTB 1OEZW 4DIXA 2X4PB 3TZVC 4CSPA 3WEXB 1RZKL 3LIZA 1GHFH 1S8DB 2K7QA 1PZ2A 4LKCA 4ZZKA 2BS9A 5DJZB 1LEIA 2GITB 3CH1B 4G7SB 2B5IB 1OB1A 2YA2A 1UD3A 3O3UN 4JRXE 4Y4FD 3NACH 3RZCC 4F27A 3DOIA 4AGOA 3KW7A 1BLNB 2PTTA 2ZKWA 4G9DB 1DFXA 3SD2A 4J3SA 4NEHB 4HLZH 4HZLB 4KH9A 5CMAA 2YA1A 4HJJL 4P9ML 3FSAA 3VSVA 3T3ME 4YSRA 4XCYB 4I8DA 3ZDYE 3ZX1A 1DQMH 5HVGB 5C7ZA 3DX7B 5F3HB 4MNHA 2XZAL 4C47A 4A2EA 5LGHH 1BQSA 2NQ3A 2JKIS 1ZGLB 4FHKA 4GFXA 1UD6A 2AKRA 4ACTA 4JG0L 1RUPL 3MRDA 2YLKA 4QNPF 2FEEL 5EB9A 5LGYA 4LCVA 1QX1A 3U7YL 2B2XH 4LNVA 3QIUC 3WSQL 1PS3A 4I48A 3ZVVA 2BMKA 4FOMA 4P4KA 1WA0X 5E08H 2VLRA 1BQHA 1AS7A 3REVB 1XO8A 5I8OH 1KBBA 3LXUX 4WK2B 4PJXA 4QJ4B 2WCPA 1I4FB 1URZA 1OT4A 4LEXL 1MNNA 3EHBB 3OAYH 4MKTA 3HG1A 2P43B 3D85D 3SDCA 4B96A 3ARGB 1OF0A 1SJEA 4QHKI 2O1AA 5EZLB 1RUMH 3WMQA 2J5LC 4B9PA 1WT5A 2YBRB 1NAMB 3AG2B 4HIIA 4KHXH 1QO3A 2H2PD 3LS5H 5IHZA 3HG2A 2EKJA 3PYCA 3MMEB 5ALBL 3JT0A 2EDYA 5DEFA 4WEUD 1KCUH 3VDAA 1IM9B 1FUNA 4H4NA 1ORSA 1EGJL 1QNIA 3IAQA 4QAMB 4RDBA 4NCDA 4NLHA 2R9HD 3OMNB 5IJKC 2EEBA 2H2SD 2Y5TA 3L9RA 4KGLA 2IG2L 2DQHL 1IC4H 2VDLH 2FJSA 5I6OA 1M05B 4JMXA 3FQUA 3ZE2E 3HRPA 4Y5XC 2UUDH 4ELMA 3RIAK 5AUMB 5E7FA 3SKMB 5CJOH 3HI1A 1ZHNB 1RJLA 5KVFL 3AUVA 5IEHB 3SBPA 5DFTA 1P2CA 5F3BB 4U1NB 5I75B 4FRWA 2ENSA 2EUVA 2WM0A 2VLMD 3ZE1B 3UC0L 3O11B 1R1CA 2EDQA 3EJQA 4UT9H 1SJHB 3EADA 3CDGB 3MV7B 1ZS8A 4YDJB 3ML9A 1TKWB 4PRAB 5IBUG 1J1PL 3FTVA 4DTGH 4IJ3C 3M17A 4L8CB 4OY9A 1X5YA 4PREB 2X38A 1JD9A 1CLYH 2R1YB 2I5YL 4R0LA 2BH0A 1O7VA 2IGFL 2L7EA 2VJXA 2DLIA 2ZKMX 2G0LA 4YHNB 2XKUA 4MMZB 1ID2A 2R4RH 1HEHC 4L3EA 4JRLA 1JYWA 1P5UB 3SDDC 1BMWA 5AAWA 1NCOA 3KPSB 1FV1A 3QPXL 4IOIA 4NO2B 5INCA 5L4IA 3WKQA 2WN2A 2ESVE 2R0KL 3MRFB 4WW1A 3UL4A 4UQBA 5GXBB 2PTUA 4Z7QE 5DQ9A 5D1ZD 3V4PH 3GMPB 1CI5A 1JHKH 4HIQA 4U1MA 5B4MC 4PJ8C 4MX7A 1TJGH 3QNZA 1HYSD 5F21B 1TTCA 5IBLC 5F1IB 3VRIA 4BHUI 4JCMA 5DMKB 3UC2A 3WEAA 1SF3A 1UJ3C 5IJVB 2NZ9D 2XG5A 3F12A 1U95B 3D0LB 5EEWA 1E65A 3OJVC 2UVFA 1I82A 5L9DH 2OI9B 3QORA 3VE0B 5ID0A 3GIVA 1J9SA 2DB8A 3QDJD 3WUWA 1KJ3H 3SE6A 5CCGE 4KKRA 4NLAA 2WTRA 4FLHA 3ARSA 5B38A 1WAAE 2AJYL 4O5LL 5HI4D 2A6KB 4Y1SA 1JPGB 1G1KA 2WBJA 3JWNE 4Y2DB 5FCUH 2ZZUT 1JE6A 5F2FA 2APTA 4RMUA 4B9FA 3E6FA 3ZYJA 1AQDA 1K8IA 2HJKB 4Y9BA 1IFGA 1G7HA 2ZTBA 5DVMA 4MA1B 3VFUB 3ZTDC 3S3DB 1TZHA 4GKOA 1DEEA 1ZD6A 3ATFA 3O4LB 5EZIL 1M1XA 4HW6A 4LVEA 4ZOAA 3WAKA 2RMNA 4ZPVB 2AJXL 2X4OB 2Y25A 3L3OB 3K71B 4JPWL 4MHHG 4HMEA 4PJ9A 2P4AB 3TZVD 3VG9B 5I0XA 4WRLA 4NUJA 5M7QA 1QSFA 1NEZA 4CN1A 1GS7A 4J1UA 1BJ1H 4DP2X 2N0MA 3U4BH 2XKNB 3H9SA 3U36B 1GR7A 4PS8A 1A6TB 1X9RA 5GGRB 2AITA 1TSRA 5A16A 2X6MA 3O45B 2WYHA 2FEEI 2VXTL 4ETQA 3MRCA 5TPWL 4NZRH 2CJTA 3UAJC 3H42L 1ZV5A 4NQCB 2KPWA 5GRWA 1RP9A 2RACA 1DBKL 1I9RH 3DUHA 4KRLB 1S7XA 3GXFA 1U8IA 4C4KT 1V10A 2GTWA 1HAUA 4ANXA 4OFVA 4WW2B 1RZJH 4ZD3L 4LZKA 2X1WL 2HVJA 1JNNL 4X8GA 2QVTA 5IB1B 1Q72H 4NRYA 5GSVA 5JZ7D 1NKRA 4J3VA 1H9DA 5C0DA 2BVYA 1QG3A 5H4ZA 3QIUD 5J11B 2ZUYA 1BOYA 2F19H 4KUCF 5JIPA 3D08A 5DA4A 3W39B 3IS1X 1CXHA 2BNRE 5HYSA 1KELH 2E4TA 4ZUVA 5B3NA 4XCCH 1BF2A 3U9UA 4WDIA 4XXDB 3Q05A 3QDGE 3RL2A 4GI6A 4H2AA 2QVFB 1KC5H 1U8NB 1CZ8L 3EYSL 4I1RA 1ZMYA 32C2A 2NX5E 3N44F 2X70A 5DS8B 3L5IA 4DEUA 1UM5H 1KTBA 3FQTB 4PJGB 2N01B 2ZWNA 4N20A 2E27H 4NAMA 2DYRB 4UU9B 1MI5E 4MCMA 5HYJD 4GS7C 4R96B 4K8RD 3LQZB 1JNLH 4JM2A 4JFQB 2NR6D 1XAKA 5JHAA 1UD2A 3NSDA 4BIKA 4J2XA 1IT9H 3DECA 4PR5B 2F74A 4P2YA 3N6YA 4P07A 5EUKA 1ZRUA 1JF5A 5D9SB 5ILTL 3OSVA 3PF2A 3QHFH 2APSA 4NQDB 4CKQA 4ZW5A 2PR9A 3G5YB 4JPIB 1B0GA 4QRQB 3NN8B 5C3TA 2BNQE 3SGKA 5EIQA 3SKNA 5JQHC 1LM8V 4BE5A 3G6JB 2OS7A 2QV4A 4HSAC 1BOGA 2JJTC 4JQIL 3BUBA 3UTQB 1HESA 1HL5A 4PJIB 2Y06L 2NY2B 3GSWA 4XOBA 4FFYA 5ECJE 3SJVE 4F2ME 3DX4A 5D6CA 2DIAA 2X88A 1SUJA 5LQBH 4LLYB 5DJZA 4ZFZA 5AVWB 1HL4A 5I19L 1CB4A 1DJIA 1L7TL 3CH1A 5BZZA 4J8QA 1IGYB 5C0BB 1OM3L 1QZNA 4L1LA 2QKIB 1EZVY 2JKJA 1LK2B 2D2OA 3V55A 2DMGA 2IV9A 4L8SA 4X80L 3UTSB 3AREB 5A2JH 1PMYA 2LQRA 4AZ8A 4JFFD 1F4AA 2GTZB 3S36X 3VWJC 3ZOAA 3MLVH 4DW2H 1CK0L 2Q5BA 3BSZA 1MOEA 3D9AH 3GI9L 4PJBF 5C92A 2VWEC 5FYLD 4ZX3A 5C7XH 5AAPA 1KTJA 3FU8A 3MVSA 4H8HA 2DZEA 3K1KC 4S1QH 4IYKA 3L48A 4WKXA 3L3DB 1BP3B 2H1PH 3KNBA 2V17H 8FABA 3REVA 5BZWA 1IQWH 2CKBH 3HPLB 3T77A 1AZVA 1KBGL 3HN8A 4KHTL 5IFHL 1I4FA 4XXWC 1G1OA 4MD0B 4P2RD 1FIGH 4TQHA 3UTTD 2GSMB 4XN2A 1JIBA 1WFMA 1FFQA 4K8RL 3ARGA 3U6XA 1MIEL 4TRPL 5C3IA 1KN2L 4M03A 2F5BL 2GUOA 4GW4B 4JG5A 2TRYA 2IWGA 4XPTH 4J6RH 1RUQH 1NAMA 1NMCC 1XZWA 2ENYA 3DRQB 4Q14A 1GGYA 3U0WH 1IGIL 2X2JA 1S7WA 4L5FH 1RZFL 3T71A 2P8PA 4XMZA 4JG9A 3UEZA 1ZA6A 1P9MC 1JXFA 3RX9A 4ZMAT 1MJ8H 1RLWA 1KG0A 5FWRA 1A7QH 2J8OA 1OCWL 4PGZA 1KN4L 1O7DC 3NCYS 2VZTA 1WBXA 4G6AC 4R5TA 1FNSH 5T3ZD 1IGCL 4NHCL 4Z8FH 2BK8A 2H3XC 3EH1A 4YWGL 1JD7A 4NKOB 2BFVH 2RJMA 1I85A 3BVNB 2E7LC 1UA7A 3MA7B 3NCFB 5HYFA 3GSOB 3MUJA 4JFHD 2XQBH 3O11A 5LG1A 3UAJD 3IBEA 1YN6A 4MDIA 4DOHE 1SJHA 2PYED 1CDUA 2PCFA 2VN7A 3C09B 3VXTA 4P5TC 2JK5B 2GY5A 1PLAA 3C8DA 4YDJA 5DLML 1TKWA 4XB3A 4AQEB 1JZ6A 4Z7VB 2ZJSL 4KKZA 1TUPA 2F08A 1NC4A 3FONB 3K6DA 3KR3H 1FFPA 5GGQL 1UGNA 2XWCA 3HS0B 4DQOL 3UACA 4AL8C 4XWGL 4U7MA 5AVQB 3BEWB 2IH8A 4N2NA 2VXVL 1LP9B 1QRND 1CF8L 3CZGA 4PUBH 2OMXB 3UJJH 1NM9A 2JKXA 5FYLL 1KTKE 3KPSA 3VUAA 4OSUL 3P77A 2QMJA 1K4CA 3P3RA 1KCSH 3FAXA 4M93B 4LPTA 4ODWA 5TQ0L 4MNQB 3WUWG 1KIQB 1G7PA 3GMPA 1WZKA 4PB0L 1XCQB 3LD8C 1HHGB 4P5MA 1VDGA 1NZRA 3U9PL 3PABA 4TQIA 5DMKA 1JHLH 4KX8A 5F1IA 1GZPB 4LIQH 5DJ6A 3WY1A 5KVEL 1TNNA 2NNFA 3TTSA 5IJVA 1Z1WA 3D0LA 1G7MB 4HCRA 2BS8A 1FZMA 4Y4HA 1GCYA 5DVPA 1AG6A 5JHDB 3I3BA 1E40A 3APNA 2A6KA 4TV3A 5D5ME 1MCPH 3SPHA 1JGLH 4LAJH 2K9FB 4DKAA 3U4KA 5DRWB 4WUKH 5HJBA 4DH2A 3FFOA 5F96L 5JDSA 5LGJB 1Y18B 3OZ9L 4P04A 4W9EC 5J9PB 3WTSA 4DAGH 1CLCA 5FYKU 2XQYA 1GAFH 3RZWA 3SPGA 2VC2H 3VQLA 4UOZA 5E6SB 3F84A 1L9NA 5D6DC 2IJ0C 2X4OA 5T3ZL 3WDJA 4D0BA 5LB1A 3K71A 4ZQKA 1BSIA 1I7TB 1K85A 1R6VA 5CSZA 3WNNA 3L95B 3SHSA 4I9WE 3BPOB 3NMEA 1CFNB 3WKYA 3TVMB 5TE6L 1WFOA 5CXPA 2V7HA 1MCKA 3HNTL 1A6TA 1AJ7L 1HC1A 3EO1A 4PIBA 1PCSA 5MENB 1NIDA 1OCOB 3OJ2C 4G6JH 5BCAA 1Q9OA 1D7FA 3DROB 5DRNB 1KXTB 2WVUA 2G60H 5KJRL 1IEBB 3D12B 1G6RB 4NQCA 3UYOD 1I1AB 1D2PA 5HTSA 4PJHB 5HYSG 3SPVB 3OMZA 3WEOA 3DPBA 4KNSA 3FFCA 2GC4C 3KVPA 1J0ZA 1U2YA 2AABL 4RVBA 1HU8A 4PS3A 4WW2A 4RQQB 4HK0B 4YBLB 3ABLB 1QA9A 1KEMH 4QUOA 1F5WA 3K2KA 3RQ3A 4NQEB 3T0DA 2A3TA 4QJ3B 1AHWC 4GG6F 3VQMA 4OLWL 3TTYA 1UXSB 2B7DT 1PAMA 1LLAA 3I9PA 2EDLA 3KWXA 2V9TA 3T1FB 4IOFD 5FGCE 2YD4A 3ESMA 3W39A 3PIQB 1A6WL 4NZUH 2J43A 2RB8A 4CVXB 3IVKA 4MDRA 1Q1JH 5SV4A 4NQSA 5ADOH 4XXDA 1MHCB 4G7YH 4D9RD 1BFSA 1IZJA 3HJ0A 3QHTC 3MHZA 1A66A 3ARBA 1FZJB 4E9XA 1N5YL 3Q43A 1AHKA 3RX8A 3WHXA 2NY0B 1R75A 1JPTL 3GWJA 4NC1E 4L05A 1PIGA 3MGTB 5CZRA 3EXLA 1T4KB 1PG7H 2IFFH 1I9JL 1EERB 2WZPA 4EBQL 1A4KA 3GDCA 3L3IA 3Q3GB 4XWOC 4HPOL 4UU9A 2YC1A 3FN9A 4Z77B 4R96A 3D4CA 4X5WB 5HP5A 4AMKL 2ZOLB 4K9EH 4JFZH 4B41A 4ZOCA 2J6EH 1PGRB 1QLRA 2PR4H 3QG6A 4XB7A 4QEGA 5FDWA 4PYGA 3HC3H 4WGKA 1MQ8A 2NZ1A 1L9QA 3AGVA 4GAYB 4KJPD 1GYCA 4G6AD 2NT1A 5IUCA 1YEDB 1P6FA 1CXEA 1NC2B 5LN4A 3WD5H 3NN8A 4XNZC 1DVZA 5BNXD 1DO5A 3G6JA 1QLEB 3O8XA 5C0CA 1CJYA 3ECWA 3MCKA 1YEGH 3NT0A 3GYRA 2N4IA 4OZ4B 2EEXA 2X3BA 2L7UA 1UD8A 4N0RA 5TGBA 1NGYB 5BJTB 1KJ2H 4RISH 4B5ZA 1HAWA 1OGAB 2XTLA 3QFDA 4U6TA 2DLHA 3GC3A 3TV8A 3WTVA 3BH9B 1XGUB 4HHAB 1IGYA 4RRPA 4HVBA 2QSTA 1K4DB 3E8VA 2SODB 2IALB 5BVPH 3UTSA 3IT8D 3ML8A 4U6VH 2GTZA 2EUWA 1F1GA 4PJEB 2AW2A 4NI6A 3PGCB 1KYOJ 3DXAB 4FAAB 1KB3A 3IU3B 5AVUB 4WUUD 1QSEA 4GKNA 3O2DA 4XP1L 4F57H 3VW3H 2E3VA 1BJMA 1XEDA 4JAMB 3BVXA 4HSQA 1KXQE 4KU1A 3C9NB 3E8UL 3R0MA 2GSGB 2CUIA 3B2DC 1JWUA 4YSOA 4G2AA 3L5JA 2VT0A 3OAUH 1SOKA 2V8LA 2FD6L 5ID1B 1MREH 2WK2A 2APBA 4ONFH 1E90A 1YCSA 3CFUA 1O9WA 2H26B 1TJIH 1KY6A 3BZ5A 3HI5L 4ANWA 4UM9D 4JVPA 3BO8B 4RGOH 2X1QA 4PWJA 1CPUA 3L4CA 3GTTA 3RDTD 3S96A 2NY7L 3DHPA 1N0XL 5FM8A 3FT4B 5GRYA 3RPKA 3MRKB 4JPKL 2HUHA 1UZGA 2VRQA 4UNTA 4PCYA 3NFSH 4IBVA 5DUBA 3NK4A 2ZWSA 3NYKA 3WIHL 4OLYL 3DRQA 2MFNA 1M3IA 1U8QB 3PQYA 1NDMA 3EUDA 5D2LF 4ZFOB 3MV8D 1M42A 2VR5A 3X2QB 3BEVB 2L7JA 3DBXB 3IFLL 4FQXD 2WW8A 4TLSA 1JZ5A 1E27A 5KOMC 3QSKB 1IBHA 3ZL4L 1RJYB 4JN1H 5E6IB 2GUYA 1HSAB 4A7GF 2C9QA 3H7LA 4LGRB 1FVCB 4QTHA 2Q0ZX 1BZDA 3BVNA 4AUYA 2XWTB 3WFBL 2NY4C 5K9JH 1FQ9C 3MA7A 1KLUB 3GRWH 4YFLF 5HY9B 1IVLA 4Y16C 3BAIA 3HS8A 2DIBA 1ZLSL 3QS2A 2FJHA 1XF2A 2CNYA 1MRFH 1E4JA 3CE1A 1IAKA 1XIWA 2JK5A 2BP8A 3CX5J 3MBEA 4NN7B 4WENB 5I74C 4JKWA 5F7DB 2GJRA 5HD8D 4AL8L 4Z7VA 4V1DE 3BP5B 3A23A 1DHKA 1C08A 1V55B 4JGMA 5HDRA 1L0XA 4YPGB 2BOBA 4UQEA 5EO9B 2HX7A 5IQLA 1VEPA 4HJTA 3C5JB 4JVUA 1SJVA 3CUPB 5D7JC 5A1AA 1BQLH 3VCLB 2V6HA 4ZNEA 4IRSC 1LP9A 3B2MA 4HGMA 1E4XH 4KFMA 2OMXA 4BK8A 3VXQA 1RZIB 3GLEA 1CR9H 4KX9A 5EBMB 1MAMH 3VQ2C 4JQXC 5CEXB 3FN3A 1KIQA 3FRUA 1V7NH 5I23A 1S5HA 1C12A 2YFOA 4IU2B 3UX9B 4U31A 5I0ZA 3KGRA 3X11A 2EILB 3CLFL 4G9FE 1BMGA 1GZPA 2YPKB 3FNKA 4P2QA 3PG2A 4EN3B 4FNRA 4DKEH 4XWOD 3OKLB 2H6PA 1I7RB 3CFBA 3T0EE 4Z7NF 5LBSL 1MHPH 1CTNA 1XGRB 3DIFB 1Y0LB 4PRPB 5JIKA 4H8WL 3KVDD 2FGWL 2IPUG 3ARVA 3CFDB 1O9VA 4NJAH 3UJTH 5JHDA 1O9ZA 5D7LB 1XFPA 3WFZA 2ZKXA 1E6OL 2MOGA 4U3CA 5E4EB 3TA3D 3OD3A 1J9QA 1MJ7L 5DRWA 2DWTA 1SBSH 2IADA 1RSFA 2YMTA 5FHAL 4CMMB 5JR1L 1LO4L 4PRBB 2NW3A 4LEBA 5K9OA 3GIZH 4LVOB 3VXUA 1N3NB 5DFWH 3CFCL 4X8JA 1TCRA 3NCEB 1GY1A 4AIEA 2IFGA 3ILEA 3K7UA 4U1IB 3WIAA 1CBJA 2HFGH 4N90E 4NO3B 2V33A 3Q13A 3POCA 3BQUC 3TIDB 3GF8A 1J1XH 1IEAA 5LDUA 4QRSA 4B6ZA 5JPNC 4NN6C 5DJ0B 1H3TA 1ZHKA 3OV6A 4FQ1L 3TVMA 3ZN6A 4KMTH 3SQOH 2ZCHL 2EEDA 3HC2A 2WQVA 4M4RA 3CGTA 3DROA 5JXAL 4Z3GA 3ZZSA 1A22B 3LQAC 4QRPA 4IIQB 3QWRD 5D4JA 2N3JA 1JZHA 4N0YL 4U1SB 3STLB 1TTGA 4C4KO 1WLHA 4GFTB 5GGUB 5SWQA 3V0WH 5T33L 5SX5H 1I7ZB 1OO2A 3B5TA 4I0PC 5ALCH 5EEXA 1H9VA 2HKFH 1JZFA 1QRKA 4NQEA 2LVEA 3GPEA 5DVNA 2QZQA 3PAZA 4FXKB 5I8CA 4KZDH 1UXSA 4JK0D 2VABB 2EDOA 2BLFA 4FG6C 3LAFA 3QGVA 3EGDB 3E7JA 4PB9L 4XMKL 3PIQA 4I3GA 4KVNH 4N8VA 2FBJL 3W0WE 4X6DE 3B9KC 4LPXA 4MA8L 3KLAB 4JO4L 3INOA 3HB3B 1KB5L 3CSPA 4PTTA 4BZ1L 1DJYA 1YEKH 3MACL 4PRHD 4ELDA 5IZ7A 1U8LB 4OJFL 4XP9L 1MVUA 1QTYT 3TN0B 3KYOA 3I85A 3FU9A 1BEYH 3FT3B 4YIQA 3F00A 3UG5A 3AB0B 1HINH 2OSWA 4AH2A 4AQ1C 3P9WB 3M6DA 4HSCX 4BH7B 3I9GH 2WQRA 5HHOE 4Y5YC 4X5WA 1BDYA 1MCCA 2IBGA 3FUMA 4YGAB 2R69H 2DWSA 1UASA 1ZLUH 4MZRA 4BKSC 5FM4A 2IPTH 3QWQB 4Y7OC 3UEQA 1NIBA 2HTLC 1KT2B 2RQEA 4FCAA 4K5NA 2ED8A 4AVHA 2A2QT 2WYIA 3I6SA 4O00A 2NT0A 5GS1B 1XGPB 4FQQB 5CO1A 1IEHA 3TNMB 4YAQB 2PXYB 5JOPD 1J8HB 3FB6A 4D3CH 2CM5A 3T09A 1WGOA 5E00B 1AO7B 2A6IB 2DLFH 1C7TA 1J9CT 2K3HA 1NANI 3JWOH 1EUTA 1QUNB 2FJUB 4ODTH 4XP4L 3VD4A 3FC8A 1QI3A 2XG4B 3VNYA 5AZEH 3GBMH 3TOPA 4NENA 1NGYA 4L37A 4WWNA 2VDLB 4BK5C 1OGAA 1DSWA 1FHNA 4HA1A 1H8SA 1OE3A 2FL5B 3BZDA 3D39B 1ONQB 1RL1A 1XGUA 3L3JA 2EIEA 5D7IE 1CLVA 2D9QB 1HZHH 4NM8L 2O5ZL 1K4DA 5AAMA 3FT2B 4JKPL 4GEIA 1RUAH 5IG7B 4Q6IA 5FYJH 2JB6B 43CAA 2IALA 2VQTA 1IJ9A 1A9EB 1T5WB 5HGAB 2XXCB 4ZO9A 5DRXB 2UYLB 3VFOB 5L88L 3DXAA 2MTPA 1JTTA 1MFCH 3F83A 2AJ3B 4RRPM 3FU0A 5D1QE 3CCHB 4QHNB 4OFYD 3C87A 2JCCE 3DJTA 5FW8A 2HRGA 1NTDA 5BO1L 4JAMA 5TK4A 3SYOA 5CCKL 3C9NA 5AENA 3B2PA 5SWSB 4UF7C 2EVGA 4K7PL 1JPFA 3ZZ1A 1WYJA 3CC5A 3D7PA 2AQRA 4ZODA 3SO3C 4ZX6A 1YYLL 1V7MH 2F9BT 3DX9B 35C8H 5F1OB 3IFNL 1W72L 1YJDC 5CN1A 1YNKL 2H26A 3SGEH 1SMOA 3FU5A 3X17A 4M8VA 3A5VA 3GZPA 1RZKH 2QGBA 3BAKA 4FFTA 2FHCA 3IJYA 5T5FH 1D6VL 1P84K 2Y6TE 3BVUA 3N41B 4YS4A 5E2WH 5I1EL 1L7IL 1MCOL 1OSPL 3V4PB 1CDIA 4I2XB 1ODUA 4PJ5A 5JXEA 3UABA 1CDJA 4H1LG 4HJJH 4P9MH 4Z7UB 1MCFA 1BAFH 3KL0A 2FT7A 1YVLA 2NNAB 5C07D 3QZNA 2FAUA 3DBXA 4YBHA 2VDML 3X14B 2MNJB 5KSBF 1SXNA 5EIVA 1RJYA 4E2OA 2Z93A 5E6IA 3VWKB 3U7YH 4J3OG 2D0HA 3D2TA 3JWNC 5EOCL 3WSQH 1GS8A 4PFEA 3TWYA 2MNUA 2WSDA 3MRRB 1QBBA 2XWTA 4PP2B 3QQDA 5T8IA 5HY9A 1X5JA 1ZHBB 3FQXB 1DUYB 2D7MA 1SJMA 4MXWH 1SMDA 1KTRL 4LEXH 2YUZA 4BELD 4DKFL 2W0PA 3ARFA 3H56A 4PGCB 4WJ5A 3BP5A 1FIEA 4AGQA 4YHZL 3KMDA 4JRXD 4BK4A 1PDKA 4YPGA 3SYPA 4KMQA 3NEEA 2O61A 1QAWA 5EO9A 4HWBA 5ALBH 4FFZA 5SX4H 2IMNA 3B8YA 3CUPA 3GKWL 2XSKA 4YEFA 3ERXA 3VGBA 4PRNB 3ZXAC 3V6ZB 3C75A 4MB4A 4LFHD 3TFBA 2ZUSA 3ARPA 3J7HA 1UWYA 5F9JA 3QZPA 5DS1A 4A66A 5BS0B 1E7VA 3K74B 4XOCA 2IG2H 2DQHH 1KYAA 1NGZB 4EDXB 5C08B 4P2OB 5EBMA 2W9LA 1TMQA 2PW2B 2HYMA 4POZC 2RR3A 1FA4A 4YSDA 4ZUSB 5MEOB 5I1GH 3LN9A 5IY5B 1KCBA 2YGVA 2FWUA 3SDXB 3AXLB 4BUQA 4RGNE 1PZCA 2CIKA 2YPKA 5DVLA 4EN3A 3MCG1 4PMFA 5EZOL 1V5JA 3AVEA 1XGRA 3DIFA 4KTEL 1URIA 3VXOA 1OSEA 3OKYA 3D18A 4GUQA 4PVLA 1J1PH 1N4XL 1XHHA 3CFDA 2GHWB 3SCMB 3VI3E 5D7LA 3GSVB 3G5VB 5I1CH 4UM8B 2IGFH 2NW2B 3FYIB 2WINB 3LKRA 1XR8A 4GRMB 4CMMA 2CJUL 3W9EB 4PRBA 5FDYA 1AS8A 3PS6A 1M6OB 3VVVA 1N3NA 2O5NA 5HI5C 1HDMB 1LEGA 2VDRH 3QPXH 3AWGA 4KJWC 4HJUA 1PL3A 4EI6B 2R0KH 3NIGF 3QRLA 4OH2A 4PI2A 4EIGB 4MAUH 1PZ5B 3TIDA 2XV6B 2WB7A 1FE8L 3RZCA 4JL1A 1IKOP 1MW1A 2E74C 4V2BA 2G4EA 1IGFH 3ECUA 3LEXA 2YZ8A 2KDGA 4XHJC 2BSEA 4G8GB 3ZO0A 5DT1L 3LPFA 3W5NA 3QA3B 5BRZB 3T6VA 3ULAB 5D4HA 2F7OA 3M46A 2X53A 3LZFL 3SGDH 1F6AB 4JHAL 1OGSA 1PTZA 4BGDA 4G8AC 4IIQA 5LVEA 3G7TA 3LPOA 1E4WH 1YC7A 4U1SA 1GOHA 4RFNC 3FL7A 2IAMB 4TUJB 3X1NA 5GGUA 2OK0L 3QEGL 2XIDA 2PYFB 4KKQA 5CCHE 2QLYA 4B50A 3PWPB 4Z3FA 1N6UA 4YDMA 4QRTA 3TLRA 2D0GA 3LMJH 4KQ0A 2GT9B 3NJXA 5EZIH 4LCWE 3EGDA 4XP5L 4BRJA 4YHLL 3L1OH 2AJXH 1HQRB 3MV9D 4ANVA 4JPWH 2ESVD 1BWMA 2VLJB 5A6IA 3DYMA 3MBXH 1DCEA 1TEFA 5CFHA 5E4OA 3X13A 4XBMA 1FJ1B 3EOBB 2P7TA 3IKCB 4ZDHA 5KEZA 2CO2A 4AV4A 3T3PE 4HD5A 1FYTB 2KC0A 2VO8A 3FT3A 4QR7A 1TQWA 4E9YA 3IGLA 4WWID 1ZT1B 5TPWH 3HMXH 4XPFL 5EN3A 5FIEA 1YAIA 1KNOB 3H42H 4G7QB 1J8KA 5JLZA 2BERA 1DBKH 4NPJA 5IJKA 4W4OC 4QKTA 1F4HA 2IH1B 3MZGB 5CJ8A 3TCLB 2CKBB 3EOTH 4N2EA 4ZD3H 2IPKB 1JNNH 2OCCB 2X4UB 3IJ8A 3T2OA 1KT2A 4M8UA 4F9LC 3TFKD 4PJBA 1CE6B 2PO6C 3VXMA 4M7LL 4TULL 4PU2A 2WGNB 3EG9B 1XGPA 3BAEL 4FQQA 4JEGB 2XWDA 3NPSB 3BD3A 3PWVB 1L6ZA 3BLBA 4YAQA 2YAEA 5DLLA 3LKQB 4AM0B 1AO7A 1DLHB 1AD9B 3BWUC 1QUNA 2WVSA 3NIFE 4K3DL 4DT2A 2G9HA 1X5AA 3W38A 3NJKA 5C09D 1CZ8H 2XG4A 3EYSH 4I89A 4PJCF 2IBZX 3OF6D 2JKNA 3OKDB 4P3CH 4R7VA 4X5PA 5AYUL 3JBG7 3ZDXF 1M9SA 3P0GB 4HF5L 1TZIA 1MAKA 4JGUA 4C58B 1PCXA 1UHVA 1RAMA 1R46A 2AK4B 4JN2A 3UAFA 5FFLA 1UVQA 2EYRB 4YC2C 4DZ8A 3D48R 2AANA 1QLFB 3SDDA 5KZCB 4S10A 4FJYA 3FT2A 1UGKA 3HW7A 5CBEB 1OP3H 5E9DA 1RUKH 3OWRA 1T5WA 2ZOUA 2VN5A 5D2LB 1WISA 1UZ8A 1YPZF 2UYLA 3QDAA 4PJ8A 1NPUA 2P26A 3ESVF 1VADB 4DSYA 4WO0A 2Q76B 4EI5B 4KKAC 5EU4B 4LCYA 2KS0A 2V37A 3KPRB 3R8QA 5ILTH 3CCHA 4POZD 4QHNA 4WWPA 2Q7NA 4JO1L 4M1CC 2CGRL 3OLEA 5IHHA 4YHML 1RK0B 3GM0A 5SWSA 1YJDL 2X0UA 5KS9F 3VXRB 4JQIH 1FZKB 5GRZA 4P0DA 3HUJB 1SN2A 4OGAD 2UV3A 5GGSB 3A6BL 1PZUB 1M7DB 3HC4H 1NGWA 3FQNA 1BD2D 1EHLL 4TKWA 2NNRA 2VH5L 4LHUB 4Z0BL 2DYPA 4BFIA 2VDOL 1EK3A 2BRRH 3POHA 2NX5D 1L7TH 4XVJL 4JL2A 1EAOA 1WWWX 1JZIA 2AVFA 5DJ8B 3ZIMA 2BP5M 4E0RB 5DTFA 2ED6A 3L7FA 1YA5A 2C3VA 2UX6A 1OM3H 5DI8B 1VKXB 3KS0J 4N6RB 1TVDA 2EP6A 3PHQA 3S35H 3ZJAA 4X5RA 1F13A 4AX3A 3IJHB 5HI5D 1TQTA 2VSCA 1UCBL 4KJWD 5D1XC 2CMRL 2XQYK 3BIKA 2ZG1A 5IBTL 3GI9H 3X12A 4FHBD 5ICYA 1NKOA 2YARA 2GJ6A 1U8CA 1J05A 3CFKA 4KK6D 1OW0C 2NQCA 4JDTL 4MNGE 1P69B 4NO0A 3NOIA 1N6QL 1GTNA 4O58L 4OV5A 1KLFB 2Z92B 5J1AB 2BNQD 2BSRB 2F8OA 2XXFA 5D7SL 4WZ9A 5EWIH 1TZGL 1CLOL 4PP2A 1JK9B 3REWB 1PY0A 2R1XB 2VC2B 4HJ0C 4M6MH 4Z7NB 3BPCB 1KBGH 1TVBA 1U4FA 1DUYA 1MJJA 5AB1A 5IFHH 5IFAL 1XSKA 1MCWM 5FLVA 4PW9A 5F7AA 2DJSA 4K8RH 5ADPH 1MIEH 3BMVA 4HHWA 4TRPH 4CN6A 2NY5C 1KN2H 4L4VB 2F5BH 3OXSB 4FQJL 4W81A 3MLPA 1CG9B 1BQ5A 3M1OA 4IBZA 4JZOB 4L29A 4TLKA 4HOZA 5ES4B 1JZ2A 1U91B 4KKCC 4X7SL 3NAAH 1IGIH 3BHBB 1Q9WB 3HE6C 5EU7E 4NBZB 1EEZB 4PRNA 4GUOA 2PW1B 4WI5A 1U3NA 1ETJA 1OCWH 4LAQL 3HPJB 2XIIA 3MREA 4NRZA 4DERA 4P2OA 1SEBA 1NGXB 1IGCH 4OTXH 2MKLC 2PW2A 4YMPA 3ARQA 5IB3A 1EX0A 1GVIA 1KXVC 2WKGA 4JDVB 3CV5A 4ZS6C 4Y4KB 2WYZA 1MN4A 3UBXA 3VFTB 5B3SB 3AXLA 2NY6C 4WCYL 3WFCL 1INQB 1ACCA 3P73B 4HS3A 4B9KC 1KEGL 4OV6F 1V54B 1ZK5A 2BM3A 3ZQ9A 3KE0A 3I6GB 4R7XA 2B0SL 2RBLA 1YECL 4NSKA 1KZQA 5DLMH 3WFEL 1N70A 1WA2X 2ZJSH 4YHKL 4LGSB 4MA7L 3B3IA 3L7EB 4KTYA 5GGQH 5HYEA 1JWMB 1VZGA 2OXGA 3GMMB 3GSVA 4DQOH 3G5VA 4NC1C 2CKNA 4Y5VB 4XNBA 4XWGH 4EKJA 2BJML 4MJIA 2LAAA 3NCCB 2KKQA 3CSGA 4GG6A 2JJTA 1HHHA 2X1PA 4PGEB 5J3HD 1S9KC 5HDQL 4AQAB 3C6SA 4MASA 1M6OA 1CF8H 2NY1C 4ALAC 1DBJL 1HDMA 5FYLH 4HXBL 5IOPA 1RD6A 3EJUA 4KO5A 4OSUH 3RTQC 2NDFA 2FJFB 3ZQXA 4HIPA 1XZ0A 2FLRT 2P8LA 4PB0H 1VHPA 2JXMB 3K0YA 4UDUB 5TDPB 2VLRE 3U6RB 5J56B 3NSCA 4PWIA 4PJXE 1MCHA 1Z3GH 4O2CA 5KUMA 4OB5L 4UBDD 4G8GA 3ZKNC 1SRDA 5E8PB 3QA3A 5BRZA 4E9VA 1T6VN 2NXYB 4LSSL 3HG1E 2OYPA 3Q7JA 3Q5YA 4EIZC 2ROXA 3NCMA 4H8UA 4HLZG 1H5BC 1HJCA 2NLJB 5DHVA 2IAMA 3DURB 2FJGB 1P0SE 2ZUQC 3PREA 4KKAD 3CSBA 5E7BA 1KJ2B 3DMMB 1M7XA 2JI3A 1X5LA 2RQ8A 3GXUB 4JPVH 5KN5B 4EI0A 4HIXL 4F91B 1L9PA 2YAQA 3BWUF 3V0VB 1DE4B 2JIXB 2GT9A 4A2LA 5EOQH 3RWGB 2FQFA 4Z23A 4ELME 1QSVA 3B3BA 2OCFD 2CDFA 4X6BB 3ZRCC 2XYBA 5I0VA 4WWKB 4XVSH 1UJTA 4M02A 5EFIB 3EOBA 5CLYA 3IKCA 5F9OL 5TE6H 1IFHL 3P2TA 3HNTH 4KO6A 5GIRA 3SDAB 1AJ7H 4Y0GA 4JHZA 2OMYB 1YNTB 3WMSA 2G0KA 2VQ1B 1ZT1A 1A1MA 2VW4A 2NYYD 3LNIA 5KJRH 4OF3A 4YDVB 1AGBA 3HRZB 3HKFA 4XN5A 5DVKA 4GRWH 2OJEB 1TO5A 4JG1L 5L0QB 2MMXA 1UXWB 3VH8B 1XGTA 2AABH 3IDJB 4LOEA 2CKBA 5EU5B 1JOIA 4LSVH 2IXQA 4QXVA 2IPKA 2FT6A 3MUY1 4GIPD 4OIAA 2DQGL 2I9LB 3I50L 3OZLA 4L3EE 3V5HA 4OLWH 2E7LA 3EG9A 3SOBL 2Z31D 2Z0UA 3L4XA 4NQQA 3TONA 3AITA 1A6WH 3TEWA 1PKQB 1MCSA 2UY7B 5DJ2B 1YO4A 5E5UB 4P5TA 1DLFL 4H5SA 1AD9A 3JYCA 2DICA 1MPAH 4YK4C 5K9QI 2QBWA 1QW9A 3GMLB 1X7SA 5DZAA 1BV8A 4PBWD 2N7BA 3DPDA 4ZX4A 4LCCC 4I9WD 4H20H 1P4IL 2KH2B 3DO3A 1I9JH 4EBQH 2J12B 1LMKA 2KI6A 2LLLA 4IM8A 5G4OA 4DO6A 3ALPA 4LNRB 4ZUWB 4PWHA 2BCKB 1SQMA 3LRSB 3BZEB 4IBYA 4AMKH 5IB4B 4ZO6A 3HE6D 4HS6B 4IDLA 4NQVB 4FEIA 2MCAA 2J20A 1DBMH 3L5HA 5F89B 1G0XA 1VADA 1ADWA 5EC1B 4EI5A 4ANUA 3NCJH 3MOAL 4B0MM 3V7AG 4Y1AA 5DQDL 1GS6X 4ZS6D 3PY9A 4A7GA 4EN2A 1OSZB 1N7ML 2NY6D 3L9EA 5DK0B 1G9NL 1S7SB 3UZEC 5C2BH 2GCYA 1QSFE 1FL6B 4JB9L 2WO3B 1J9TA 2AQSA 2RIKA 2V3DA 3FRPA 5TH2B 1NIAA 1HEZA 2CUAA 3CBJB 3MLRH 5F3FA 3FT1A 3H9SE 1M7DA 2Z7ZA 4O2EB 3CLWA 4YXLH 4S11A 3UTPE 2AERT 3VAEA 2Q8AL 1EA9C 4YJZL 1ZJBA 5LAPA 2FGZA 4JO2L 2CHZA 1F3RB 4QHLB 4M48L 3DX3A 2FO8A 5DI8A 1Z7JA 4R4BB 4C56B 3L4ZA 1VKXA 5AW2B 1MCEA 2BPBA 4LRNL 1B9ZA 4O02A 2ZT9C 4D0CB 3L1FA 2F7IA 2NY1D 3IJHA 3NFPB 1IQDB 4QLRA 5L8LB 3KH4A 4F37F 1AGCB 3R4RA 1JCVA 2BY2A 3D30A 4G6FB 1KY7A 1N26A 3U7WL 3VD1A 1ZPLA 3KPPA 4MLIA 4XP1H 2XPGB 5CAYB 1FG9C 3GMOA 4E9RA 4U0RC 3E8UH 1ZVNA 3KBPA 3HAEA 4AVIA 3CD4A 3Q9PA 3RWCB 1GC1C 3CVIL 3K2IA 4PPTA 2FD6H 2Z92A 3GKZA 4MS6A 3TCTA 2PWGA 3NZUA 4LHJB 3KCPA 2XV3A 1N2RB 5MI0B 2WKLA 4PD4K 5GS0D 4LL1A 2VYRE 3AC0A 2R1XA 3KJ6H 5I6KA 3BPCA 4Q58C 2ZKHL 1R3LA 4MMYA 3U1QA 4OLVL 1U41A 2NY5L 4XN7A 4M7JL 4G6MH 1AHWA 1I3GH 4TQEH 4UQAA 5CZXC 5GRVL 4OCNC 1AR1C 2NY7H 5HYQB 3GSXA 2C5DC 2W07B 3N40P 2R0ZH 2JLLA 4JPKH 2W94A 5HGBB 1A0QL 3BAXA 3CU1A 3OXSA 2FLMA 5IQ7H 4RWYL 3QK0A 1T1WA 2F5AL 1II4E 3NJMA 5D55A 4BQCA 3RVVD 5F7HA 1Q9WA 1PFCA 3STBA 2V5YA 4YFDB 4ZSOA 4S0HA 1OP9A 4R3SB 4PRDB 1KULA 1HWWA 1TQCB 2Z1KA 3MUGB 4FADA 3NIGB 4IGBB 3IFLH 4UTBL 3UPRA 3ZL4H 2AV1A 2AQ2A 4FABL 3EYVB 2QFPA 3HPJA 3N1GC 4YR6A 2DM3A 2O5YL 5I5RA 1T7WA 2OX5B 5FKAB 4PVNA 4Y4KA 5IMOB 2YPVL 3VFTA 2WVVB 4UYPA 4ZXBB 3WFBH 2CHNA 5CJXC 1INQA 3P73A 4JO3H 3L9YA 1RIUL 5L2JB 3I6GA 1ZLSH 3HS9A 3ISYA 4NFBA 4IBLT 1A6ZB 4YLCA 3IDNB 2KDYA 4J4PC 2R0WL 3EUUA 4NUPA 2E0PA 4OCWL 1JGVL 1EXHA 5I9QC 2XN0A 4XNUL 4ABUA 1T66D 1P4LB 2MOVA 5HHNB 4ALAL 4J5VA 4V2CB 1RZ7L 2EH7L 4PGEA 2KZ1B 2QQLL 1R19A 3S5ZA 4AQAA 1RV6X 3PNWB 2D3NA 4IHBA 5IESH 4X6EA 1B6UA 3JV4B 1DJGA 2HFFB 1F86A 1YYML 2DAVA 1OVZA 2D0FA 5HDBF 4Z7OF 1BBJB 4GKZB 3LRHA 2JXMA 1KFGA 5T3XH 3DTXB 5HGGS 4CJ0A 3CLFH 3EF4A 2D7QA 5GS0L 3IDMB 1IGMH 3DARA 3B83A 4WFEE 2X12A 4MVBC 3RB5A 5GQBA 1J5HA 5BV7C 1AHMA 3MNZA 1IAIL 1LQSR 1SQ2N 4H8WH 4S1RL 4EZMA 5HHQB 3DRTB 4X9IA 5FGRA 4JCWA 2CNZA 1T2JA 4V1DD 3IGAB 1IILE 4L1HA 2B1AL 1RCYA 1E6OH 4ZFQA 5LBGA 4AJYV 1AGFA 5LXVA 3MJ9L 4OJYA 3VGEA 1E5UI 5IGXL 5JR1H 1LO4H 5CGMA 3H7BA 5KYWB 4FZEH 5I6MA 4R9HA 2Y7MA 1DE4A 3WIIL 1QHQA 3DI3B 3WE1A 3OKNB 4F80A 3RWGA 3D0VB 2OMWA 2FECL 2FB4L 1B3JA 4XAWH 2H8PB 4WWKA 2NOYA 2CM6A 3ILPA 2NTFB 4PJCB 2CDGB 3QQ3A 4U3SA 4RMVA 4KV5E 1MFNA 4W1TA 5D1QC 3ZDXB 2OP4H 3S3PA 3ZE1E 1ZPUA 3SDAA 4G9FD 1JJUA 3AMKA 5F97E 2OMYA 4DGYL 5F1KC 5JXAH 5L2KB 3OXRA 4IHOA 4OFDA 3T0ED 3LB6D 3SODB 2VM9A 5J89A 3L2MA 1MLBB 5CWSB 3MX0B 1PNDA 2EXYD 3MLTA 2OJEA 4PRIA 2IGTA 1YPZB 4OGZA 5T33H 3VACA 5E5MB 1BPLB 1HH9B 4K15A 2I9LA 1FWXA 3KPSE 4PV8A 1N12A 3CZSA 4OFKA 2MWCA 4Y9GA 2XPZA 4IU3A 4PB9H 4R2GC 5KSUA 2GVYA 2IOMA 1R17A 1EDQA 5ISZA 5KS9B 2UY7A 4ZK8A 5B7FA 1E5BA 1IV8A 4W6XB 3QJFA 4ISVA 3VRJA 1DBAH 4JO4H 4N90D 3EOAA 1LO3H 4NJ9L 4GQPH 1KB5H 5HVFB 4BZ1H 3BH4A 1WA1X 4GEJA 2ATKB 5IMKA 3P4LA 1EWHA 3I3DA 2EACA 3RWDA 3I02B 4G43B 4IEFB 1CICB 1FC2D 5D7JA 4FXTA 3UADA 3BGAA 3PHOA 4LNRA 5E23A 4ZUWA 4IRSA 3ILQD 3LRSA 3WENA 5IB2B 1ZK9A 1KYDA 1G7QB 1RP8A 2CBTA 4NQVA 2ZIDA 1T5XA 1AP2B 1U8KA 2KL6A 1IBGL 4JQXA 5B1BB 1ZE3H 3V6OA 5EZJA 1D7BA 1T1ZB 3KPMB 3VRLE 4DFIA 5CF3A 3U82B 2XV0A 1A25A 3EGXB 4RLDA 4UIKL 5T1LA 4BE6A 1YY9C 1RURL 4L1SA 3OPZL 4L3CB 3EO9L 1FORL 3HE7D 4QXUL 2Q6WB 4PJFF 3VSUA 5KSBA 5E8DL 4LHUG 1ADQA 3WTXA 1MWAL 2LT9A 3KWWB 3PL6B 5FYKE 4O2FA 3F2LA 5FPIA 2X1OA 4U6HA 1OSZA 5CHNB 2WYTA 3FW6A 5DK0A 4YO0B 5J6GB 4YHYC 1EO8H 4D8OA 1KBVA 3IJEB 1AKJA 3W0WD 3WLBB 4XP4H 1IE4A 1D7DA 2X7LA 3BC9A 1TOXA 3QUZB 3FYEB 3QUYB 4L4TB 5LUMA 5C2UB 1NCCH 4Q7DA 1HS6A 1A4JB 3MRBB 5AG8A 4ERSH 4HKZB 4NQCE 4XPGL 5D96C 3VJ6A 4RGNC 3LDBB 1BZ9B 4NM8H 2IH3A 2HFTA 2IVFC 3K3QA 4QHLA 4WI8A 4XN9A 5F6HI 1M57B 4R4BA 4JKPH 1KBKA 2ADFL 3CPLA 2WQXA 3FFCE 1P6AB 5HGDB 1KJVA 1YSOA 2JJUA 3VGAC 4D0CA 1UKSA 5HHOD 3WKPA 5EOTB 2XWXA 3UGUA 3GJEA 3NFPA 3BQUA 3QG7L 5G2NA 5I1AA 4K7FB 4RMSA 5ENWB 2DV6A 4Y4FB 3RIFF 1IAII 5JPNA 5DWPA 2XPGA 5BO1H 5CCKH 5IHWA 1KTCA 5K69A 3MODL 3CFNA 3KGSA 2Q3AA 4P4RB 5AKSA 5I16B 4K7PH 1HNFA 5EU6A 5C0EB 1YYLH 4Y2OA 3P0VL 3AJ7A 3DYPA 4UB0L 1N2RA 2I27N 1YNKH 1ND0B 4MVBD 5FA4A 2QHRL 2VDRB 2ZOOA 2Z4TA 1X4XA 3EDDA 5KYYB 1QBLL 3HG0A 5J6HB 1ITBB 2F7PA 4LRIA 1YEFL 5I1EH 1SHMA 1MCOH 1AZBA 3B7RL 1ET5A 4FJ6A 2FT8A 3VDBA 4NZTL 4YZWA 2DWYA 4AV0A 5C0GB 4L4JA 3VD3A 5HGBA 5IKCB 2YGPA 4TNGA 3B9KA 1MDAA 4U1JA 3S7GA 2I07A 1U3JA 1NIFA 4R3SA 3S9DB 1QFOA 4PRDA 3DGDA 1JHTA 3GSQA 5E4AA 1D5IH 1A8ZA 2VDMH 3V6BR 3QUXC 4J3BA 3FH7A 2RTTA 3GXIA 1LEKB 4F1SA 3EYVA 4OQTH 1DVFB 5FO8B 2J3SA 3RKDC 5EOCH 3G6JE 4NHUB 2K45A 4GG8B 3H6AA 5D1QD 3EOYG 4TQPA 5FKAA 5C0CE 4AQ1A 4FP8H 2A9AA 5IMOA 2VDNL 4X7TA 3M7FB 5GS3A 4ZXBA 2DKMA 3CMOL 3RIKA 5K1JA 2BZCA 2CBMA 4YXHL 4JFTA 2PTVA 1U8JB 4BQBA 5L2JA 1XDTT 1MIML 5KSAC 4JY6A 1XGZA 1J8RA 3IDNA 3MYJA 1ZTXE 4GIOA 1TCMA 5DYOB 4DNLA 3LRLA 2AV7B 5AW4B 1ECYA 4YHZH 3US0A 3UTSE 1XF3B 1DL7L 2G3XA 4PCKA 4X9GA 2G5BA 3C5XA 4AZUA 2W92A 5HHNA 3ZUNC 1LDPL 4WEBL 1GOFA 1RFDH 5LXGL 3GKWH 3D05A 1JDCA 3VFVA 1QSEE 3B2VL 1DQKA 3FQWB 4XODA 4EIUA 1ZLWH 1QVOB 1IM3B 4WHYH 3ATAA 4NUGH 2HWZH 4XVUC 4AV5A 4AXWB 2R69A 2X2YA 4MAYD 1M6UA 1FPTL 4BK5A 4NN5C 4PGJA 4ONHA 2ITDB 4RSYA 3V9FA 1JK8B 3UYPA 1NCDL 1SFHA 1WP6A 1OF2A 3BAWA 3TC9A 4KNQA 2C9SA 4MQTB 5CNHA 3GSNA 3UYRL 5BV7L 5IW1A 4OI7A 5EZOH 5C70A 1I3UA 1TLMA 1Z32X 5E6ZA 1YUHA 2YWZA 2MPAH 4K94L 5BZDB 4Z3JA 1JZJA 1N8OE 5D1ZB 1G9MC 3Q1SH 4P23B 1D5ZA 2BOCB 5GZNC 3VSTA 3DRTA 1NMBL 3BWZA 3ECBA 4UINL 3GLAA 3MJ8B 4FL4C 1A1NB 2WXHA 2Y1AA 2BCMA 3IGAA 3EBAA 4PP1C 1X4ZA 4EVNA 3DO7A 1A3QA 3UBHA 2C1PA 4N4YB 1NFKA 3PQYE 5DD0L 4RMBA 4AUUA 4MJ2A 3A3YB 4HUKB 4UZUA 5FYJU 2MCPH 1NOFA 4UTCA 3QDJB 1ID5I 4EE2A 4GT0A 3UDWC 4AYFA 3D0VA 3KG5A 3W9DA 3NP3A 1OV8A 2Y4SA 1GGCL 4G8EA 4HKBA 3AFLA 2H8PA 1MFDH 4E5XB 3HZMB 5HHME 1N8ZB 1CD0A 1NQBA 3O3BA 4PJCA 3MKKA 3VH8G 4NNPL 3WO4C 1JGEB 2EO7A 4ZT1A 4PJ6A 4GMSH 3V6FB 4HJEA 4EXKA 4RGND 5DT1H 1KTDB 1ROWA 3LPPA 1D5MB 4I4WB 1AIZA 1K3ZA 3G5WA 4RGMC 4Z7VE 5B3JF 4KZCA 3FO1B 1S46A 5IIEA 4GY4A 5CWSA 3MX0A 1KCLA 2DY2A 3S8FB 4WSKA 1D9KC 3NZ8A 4LHQB 5MP6L 4GAAA 1YPZA 4Z3HA 5E5MA 2GJPA 3T2PA 3QEGH 1W8NA 4X42A 1IKNC 4U3XA 2MHAA 5CN3A 5T5FA 4HU8A 4ZNEE 5AFAA 1LP9E 1JZ8A 1LNUA 5JMOC 3TESA 3DK0A 3TS8A 2XWJB 1R5WA 4XP5H 2ZKYA 4X9FA 4YHLH 3RJDA 5IHLB 5KS9A 1J0YA 2WPGA 3D8MA 4M8QB 4GINA 3DA0A 3BUDA 2EKSB 4KI5E 5EDSA 4WHTA 3GMRB 3ULUH 2A5UA 2PABA 5DDHB 4XNYL 1MRCL 4W70A 3DV6A 5F1SA 3NJJA 3HR5A 3OB0H 1AMYA 4B9YA 1CICA 5TK2A 2EIJB 2AK1L 4UUJB 2HT2C 2QADC 1JYNA 5JHDE 3EYFB 5IB2A 1V27A 1G7QA 4JKMA 1P1ZB 3PP3H 2RGSA 4QWWC 4O9HH 4F9PC 3NDZE 4BV1A 1AP2A 3LKPA 5ACZB 1BLIA 3HMWL 2OMZB 1F4WL 1ZAGA 3KPMA 4YSSA 3QUXD 1WFNA 2VIRA 1ACZA 3VXUE 4GKSB 4M7LH 1F1DA 4LVNC 2HT3D 4OZHF 3LXAA 4GP5B 5B22A 2Q6WA 3VGDA 5HYJB 3Q8AA 3Q6GH 4H25A 4WI3A 3ZL2A 3LEVH 1WS7A 2BNRA 2FE0A 2X4RA 3PL6A 4QJ5B 3F7YB 1DQJB 4LCWD 4XNMB 3QDGA 5J6GA 1FGNH 4KUZL 4XMPL 1V3LA 2QPDB 2K78A 3WLBA 5AWNL 1NGQL 2FWOB 1G1CA 2LTQC 4Y5XB 4ZAKB 5AKVA 3OHXC 3QUZA 3B34A 4IS6B 3VYOA 4HF5H 4IRJC 3N43F 4Z76A 4LCUB 4PJDB 3FCTA 4HC1L 1FNHA 5D72L 3ULVH 1LYQA 4HKZA 4ZYKB 1MCDA 4XH2A 5DQJB 4ES9A 5HGDA 3ZYIA 1OPGL 3WKMH 4G70B 1TEGA 3MRLB 5EOTA 2JF1A 3TCXA 4NQEE 3PFUA 4LCIL 5FO9B 4K7FA 4XVUD 3ZGHA 1XSIA 3MRQB 3QNFA 4ZUTB 2W0FA 4TUOB 4JO1H 4EJ1C 5KW9H 1S7TB 4JZJB 2ODIA 4AJVA 2EZ0C 1NCNA 1YJDH 4WI6A 2LGNA 1FNEB 1TYJA 1MHHB 3GD1C 3RLSA 2NTSP 5F6IC 2NUTB 3SJVA 1YEJL 3A6BH 1YEIH 2J88L 4ELKB 5H35A 3VMOA 1EHLH 1QFHA 3HZ3A 2VH5H 4OJAA 4X5LA 5I6XC 2VDOH 4KK5D 4P4KC 3GJFH 3IETB 4W9LC 1SBBA 4P3WA 1E3FA 1WBYB 2F7QA 1INEL 1NMAH 3VXNB 3FTYA 1OP5K 1OE2A 3NJHA 4X8CA 2NXZD 1A6VH 5IKCA 2Z65C 4OI9A 5IQ9A 2B4CC 3G9AB 5AB0A 1UCBH 2CMRH 2R2CA 3SDCC 3WEBA 4PJ7F 2J5WA 4OZGB 5IBTH 4AEIL 5FA3A 3UTTB 4QNPE 4YHPA 2YD3A 5E1GA 1WT5C 5B21A 1MH5B 1J48A 1UOWA 4OCMC 1EANA 2K0RA 2H3NA 4PV9B 1PD0A 1DVFA 3C12A 4Q2ZB 3STZB 1N6QH 4M6OL 4IBUA 1NEUA 4O58H 1I1YB 3CVBA 5D7SH 1J1OL 5BUAA 2ERJC 1OE1A 2YD1A 4FMFA 1UM4H 1TZGH 2YAHA 2TRHA 4OW6A 4NRXB 5KWYC 2Y2YA 4E41A 1XCWA 1OGAE 2Q1EA 4HHGA 2EIDA 3QS3A 5LCVA 1A2YB 5FB8B 5IFAH 4RX4D 2PO6A 1KIPB 4WFGE 3E9UA 1DTUA 3BUTA 2A74B 2VR3A 2HH0L 3ENEA 4OF7A 1PQZA 1INDL 2AEWA 3T0XA 4C57C 4FQJH 1OAQH 3Q8EA 1XF3A 4BZ2L 4LKXB 4Q0XL 2VXSH 4X7SH 1HJBC 1ACXA 1DQQB 4JVWA 4HIEB 4X2UA 1T21B 4LMQE 2FWLB 3DXAE 2UXVA 3JZYA 3HMXA 2EECA 4AUJA 3VFPB 2VITB 4HGWB 4WF7A 2G75B 1QVOA 1IM3A 5IHUL 3D25B 4GRWB 5A40E 1VGKA 4PIRF 5E8OA 2HB0A 1JK8A 3CXDL 4FF9A 3T0AA 3EH3B 4DGVL 4ZJ9A 1AR2A 1T2XA 3B37A 2GBTA 1H3UA 1QRNB 4WCYH 4JFSA 3WFCH 2DWDA 1NBVL 1KEGH 5CGBA 5E9NA 2YSSA 4GYBA 5DZPA 4M9PA 2WLLA 3VI4B 1YECH 1WICA 1VFMA 3BE1L 4LSQH 5BZDA 1FLTX 1S2EA 3WFEH 2MTAA 4PJ5E 4KPHH 4YHKH 4F58L 4P23A 1J11A 4MA7H 4PGBA 4U1LB 5SWZA 1X44A 2KPNA 2ICWJ 3HN5A 1CFQA 2HRPL 3UERA 3MJ8A 1FG2B 5AVYB 3OKEB 1A1NA 3QRBA 2AXGB 2BJMH 4DN4L 3QORC 2OSXA 2NSQA 1UKQA 4S1DD 2J1XA 1PU0A 2P49B 5HDQH 5HHVL 1Z5LA 2VZUA 1Q0XL 1DBJH 3SD5A 3QDJA 4HXBH 4V33A 2A83A 3L13A 4FKHA 1EAPB 1NWOA 1VAHA 3GTNA 3VA2C 4GPVA 5AZ2H 2WBJC 2Y7QB 5IEKB 1YHPA 1MUJA 1CFTB 1CI3M 3HZMA 1T6BX 1PX8A 2FO1A 1EBAA 4UAOC 1WD9A 2EDRA 4FDWA 4J8RA 3V0GA 3PWJB 3INUL 4RMRA 4XPBH 3C6LD 1DN2A 5DMYA 4HBCL 4OB5H 1L9SA 3V6FA 4MQXC 3P11L 2WZ5A 5FUZL 4BD4A 4E42B 2P28B 3RVWD 4JHWL 2X3CA 4DP5X 3G6DH 5D1XA 3FOMB 4LSSH 4I4WA 3CK0L 3L4WA 4B7IA 2YOAA 3FO1A 4N0CD 5D71L 4K0OA 3ULUF 3BESR 2EDBA 4ORGB 3GEWB 3SOTA 5EIIB 5T1KA 4C4UA 5HJ3A 2B1HL 1I7UB 1S7RA 1A6AB 3ETBJ 1IC1A 1BAGA 2X2UA 5GZOD 1K6QH 4UMSA 5JQ6L 2JE8A 2R2EB 4KROC 4R7NB 4RIRA 3CVHH 1I1CA 4Y2NA 2Y24A 4HG4J 1N59A 5JPMC 1KLGA 1TZ8A 1URLA 2ADYA 5G4MA 5IVXF 5J12B 5H37A 4A2DA 5ECGA 5ESQA 3O2WL 1AD0B 2NRDA 2ITCB 5C0NC 4JHUA 4V11A 4P4KD 5F9OH 2AFNA 1VFAB 1AI1L 1M71A 1IFHH 2HJFB 2VRAA 3TJHC 2VLRD 1HZLA 3UCRA 2E7MA 5DD1H 4UILL 3FCSB 1P7KB 3PE9A 5C0AB 4JGNA 4PRPE 1W0WA 5HGHB 4ODUA 1UT9A 3EGSB 3EYFA 4NWTH 3IGUA 5EO1A 3A0OA 2J6WA 5D7LE 4LDLB 3OAZK 1T89C 3QJZA 3HG1D 5C9JA 1B2WL 4JG1H 2W60A 3SDCD 3QAZC 5A2FA 3QEHB 2W65A 4WI0A 1GIGL 2OMZA 3TNNA 2EIKB 1KXVA 3IU4L 5DJXA 4GKSA 4JM2C 1WBZA 2WIIA 3IFOB 4UOW0 1R5VB 2VR4A 3SOBH 1NLDL 1TJMA 5FKPB 5LO7A 2AXWA 3ULVF 3U9WA 1Z3RA 1B4RA 5EV7A 2RHEA 3PJSA 3F7YA 3FDWA 1DFBL 1AFVL 2SEBB 1DLFH 1X5KA 1A6UL 5MEQA 4K4KA 3K6OA 3S8WA 1BBDL 1NFAA 3L3HA 3L6FB 4WKZB 3DUSB 1NCBL 2FWOA 5DXWA 2CG9X 4HWNA 4QDGA 3ARDC 4WNQA 2XDHA 4ZAKA 3SGKC 4QD2E 1OZTG 1BIIB 2XVLA 2I24N 2OYMA 4IS6A 1EO7A 1GCFA 4LCUA 2CGZA 3L1EA 2LAGB 3LIZL 4ZX5A 1QI5A 1AIFA 2CRYA 3QI9B 3IXAB 1HXKA 4P9HL 4ZYKA 2GJZB 4DP8X 5DQJA 2DPKA 4M62H 4XRCA 3CXHK 1F6LL 2B5IC 5JNYA 1UENA 5BXFA 2AXJA 2VDKL 2ZXBA 3Q44A 4JFEB 5DQDH 4L3ED 5MEPB 1LMIA 4JZJA 5IQMA 1X3DA 4RNRA 1N7MH 3C8KB 4ABQA 1GY2A 1MHHA 5GRJL 1G9NH 3ZQWA 3G5XB 4OLUL 4JB9H 4LLUA 5HYIA 2MJWA 2VZSA 4JGJA 3TBBA 1H5BA 4ELKA 4AIZB 2ITFA 3D07A 1KACB 3WS6C 2BSBA 2H0EA 1FVEB 1FAIL 2Q8AH 2DEWX 2YWYA 1I31A 3IETA 3NH7H 4JO2H 4J3XA 3QVAA 5BVJA 1JZDC 4M48H 4X6CF 2BWDA 3BUYA 2B4CL 3H53A 1LVEA 3OR6A 3QORD 4OJEH 3VXNA 3LZQA 3C5SB 1VFBA 3G5ZB 2ARJQ 1PEWA 1EAQA 4MA3B 2NNXA 5IUSA 3W2DH 2IBZY 2TAAA 3BZFA 3EHBC 4Z7WF 1NBYB 4PJBE 2C9RA 2ZXWB 3ARGC 3MLSL 3VXME 3D0AA 2WBJD 1E9OB 3RDTB 1MH5A 1U30A 1BMZA 3T2NL 3KPNB 2DEXX 2PMZA 1J8HE 1G87A 1FL5A 1EEYB 3D33A 4MHHI 2WZ6A 3PXLA 3STZA 1I8LC 1MFAL 1AO7E 3DHJA 3LNGA 3CVIH 4DVBA 2QEJA 3MV8B 1MJUL 4PJ9D 3V5KB 1XF4A 2R51A 1QSFD 2B59A 4FQXB 4NRXA 4JM0A 4ZMOA 1A9BB 4KJQC 1WQVT 2ZKHH 3AY4A 3IJSA 4RAUB 4OLVH 2IANB 3H9SD 3TO4B 3ROOB 1PJWA 4M7JH 3UTPD 5I75C 2ZOKB 2A74A 1ZSDB 1MFUA 3BP7B 5E9DE 4K5OA 1FFOB 2J72A 5DJYA 1UG9A 1JAEA 1QQDA 2F5AH 2Z3FA 1DQQA 3QQ4B 1Y6MR 7PCYA 3SN6N 2HLFC 5DC9B 3FB5A 3VM7A 2GIMA 4YSUA 3IMSA 3FTUA 4UTAA 4XTRC 1U8HB 1L0YA 4GXUM 5C8JA 3TF4A 1G43A 4IRZH 4M5YL 1MZZA 2ZWKA 1OT1A 1RZ8A 5SWSE 2DOCA 2YGNA 1ZWIB 2O5YH 4YLQT 2EVJA 4AW4A 4HWEL 1I8KB 1S7QB 2CE6A 4PW3A 2AJZB 5E8EA 2YPVH 3P9LB 3TBTA 2AQ1A 4QF1B 3OKOB 1U2HA 3RPIB 4PS4L 2IQ9H 3RL1B 2YPLA 3CVCA 1RZQA 1CDHA 3V7AE 1RIUH 4HIHA 4NYLB 5A6MA 4QCIA 1DO6A 2H4EA 3HEIB 4GLRI 3SE8L 5DUBB 1DYZA 4I2XE 2Q2LA 2E9JA 1R34A 2R0WH 4U1LA 4OCWH 1JGVH 2ZCKL 2UZIH 2H9GB 5F0JB 1KB5B 4HAKA 3D06A 1FG2A 3OKEA 1SYVB 2DWEA 2Z91A 4JFPA 4XNUH 3ZE0B 4LL9A 1D5RA 3MJGX 4XZUB 4E5XG 2OI9C 2XC8A 2WNGA 4MB5A 3VDCA 2P8MB 4B9GA 1RZ7H 2EH7H 2QVKA 2UXFA 2WXKA 3V0HA 3UZEA 1HHIA 3NRPA 1IL1B 2GJ6E 2IDTA 3MR9A 2X4TB 4L8BB 1EAPA 4N0FB 1A4CA 2Y7QA 3COOA 4Y2DC 2HFEB 1YYMH 4PG9B 1ZVSB 1IARB 4OUUB 3TA3B 2WWKO 1QEXA 2WUBL 4MA1C 5IVNA 2YMOA 3GINA 3RJQB 4LP4A 1K72A 5GS0H 1WIUA 3NA4A 2HXAA 5C3LD 3IS0X 3L3OC 3ZHNA 3VG9C 4Z1PA 1MHEA 2X6AA 1FO0A 1IAIH 3DETD 3WJLC 1DQLL 1A6PA 3LS4L 4S1RH 1ASPA 4CADB 3LXCA 1FGVL 1H6TA 3V0AC 1OL0A 1WZAA 5HVWA 4HUNB 1D2OA 2B1AH 4DPBX 3O6KH 2YUWA 2NQDA 2A9ML 1I7UA 3MJ9H 1T0MB 3VB9A 1A6AA 3CU7A 5IGXH 4OZHB 4PJFA 2GB2A 3J2PA 2ADJB 3KD4A 5IHBA 2R2EA 5E6RB 1QI4A 4WW2C 2YD6A 1ERNA 4TNFA 4M5ZL 2FB4H 4K73A 4Y9EA 3WNPA 1NUGA 4FN0A 2E6QA 2FRGP 3CHSA 5J11C 2AVGA 2Q87A 3X1BA 1AD0A 1E28B 2ITCA 4HCFA 4DUXA 3CJJA 2KLTA 5ERWA 1VFAA 4HT1L 2HJFA 5ETUB 3M45A 1ED3B 5D93B 1JI1A 4PWFA 1A64A 2P48B 4RMWA 3WS3B 3PWUB 5DVOA 5C0AA 3SE9L 1T1XB 4PAZA 2DQDL 2QGEA 4XNAA 5L7XL 4Q6KA 1N9PA 3WGUB 5HGHA 4WFED 3UO1H 5F44A 4KXDA 4PRHB 2EVFA 5F0PB 2VW7A 1KPUB 5ANMB 3ARGD 4UQ3B 5AVRB 2BSDA 4MJIE 4XMUA 3K5SA 3O41B 5GJSL 3TBVB 5L8KB 1JYXA 4HKXB 4AEEA 2V9RA 3ZKSD 4CC0A 1DQIA 1ZHLB 5FF6A 1TO4A 1OHZA 1BVZA 3AAZA 4AYBA 3L5WB 1ZY9A 5CJXA 1EFXA 1T0NB 2XLLA 5FKPA 2YD0A 4F33B 4FNQA 1U3HA 1WPCA 2SEBA 1RK1B 3DUUB 1MCWW 2B9AA 1F11A 2MSPA 1TENA 4S0TD 5INDB 5I66B 3QWNA 4J4PA 4OVVA 3DUSA 1BZ7B 4UNUA 3QXDB 4ES8A 2VN6A 3K4DA 4PGDA 1IKFL 2VDMB 3CZLA 1A3LL 3V5DB 1MW2A 4M7LT 4G8GE 1BIIA 2CHDA 2YQBA 2ZWZA 2A9DA 4FFYL 2G2NA 1P53A 2F54A 3O8XC 5BRZE 2ZNXA 5BZXA 5AOJA 3QI9A 3IXAA 2K1MA 2NY2C 2WWNA 3VYNA 3KEHA 2GJZA 1UKTA 2VWEE 1CIUA 3DOSB 1JUFA 4QPEA 3P30L 1NC4D 3H9YA 1AOZA 1IBGH 4UIMB 2QQQA 4B95C 4PJ7B 2ZSVB 2R2HB 5CD3B 2BVTA 5I8KL