4NUMA

Crystal structure of mouse n-cadherin ec1-2 a78si92m
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
215
structure length
215
Chain Sequence
DWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIARFHLRSHAVDINGNQVENPMDIVINVIDMNDNRPEFLHQVWNGSVPEGSKPGTYVMTVTAIDADDPNALNGMLRYRILSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTYGLSNTATAVITVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Cadherin-2
publication title Structural and energetic determinants of adhesive binding specificity in type I cadherins.
pubmed doi rcsb
source organism Mus musculus
total genus 44
structure length 215
sequence length 215
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4numA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4numA02
1EDHA 5JYLA 4ZMNA 3K6DA 4ZMVA 2O72A 3Q2NA 1OP4A 2OMYB 2WCPA 3QRBA 4NUMA 2EE0A 2YQGA 1NCGA 4XXWC 4AQEA 2WBXA 2X2UA 1ZXKA 4NQQA 2WHVA 3LNHA 3LNIA 4AQEB 4QD2E 4ZI8A 5CZRA 3LNFA 2OMZB 1O6SB 4ZMXA 1L3WA 4OY9A 3Q2VA 2OMXB 3UBGA 4ZMLA 4AQ8C 3K5RA 1FF5A 1Q1PA 2A4EA 4AK1A 3LNEA 5KJ4A 4APXA 3FF8A 4ZTEA 4NUQA 5CO1A 4ZMZA 2YSTA 4XXWA 4APXB 3MVSA 4NUPA 2OMTB 3FF7A 1SUHA 4AXWA 3Q2LA 2QVFB 4ZMPA 1WUZA 4ZMYA 4ZMOA 3LNDA 4AXWB 3K5SA 3K6FA 1ZVNA 2V37A 3UBHA 3Q2WA 2OMWB 4AQ8A 3PPEA 5JYMA 4ZT1A 1NCHA 2WD0A 2A4CA 4AQAA 1NCIA 3UBFA 4ZMTA 1WYJA 2OMUB 2QVIA 3LNGA 1NCJA 4ZMQA 3K6IA 4AQAB 5DZVA 2OMVB 4ZMWA
chains in the Genus database with same CATH superfamily
4HKXB 1A47A 4OZGB 3IDYB 4LNRB 2AK4E 2IFFH 2X1XR 3U0TB 5LVEA 3WFHA 4NQUA 4MS6A 3LCYA 1VEPA 4KZ0A 2NXYD 1A6ZA 3WD5H 4JGUA 4CVZA 1SXSA 4ENED 2NR6A 3FT1A 5BZZA 1BJ8A 1CE1H 2XXMB 1DVFC 4G8GA 3LEVL 1AH1A 2WBXA 1QLRA 2XG4A 4G7VL 1FV1A 1NKRA 4P59L 3Q3GA 4U31A 1P53A 2WHVA 4XMXA 1Q9WA 3CFKA 4K07A 4NPYA 2AK4B 5D7EA 1AZRA 3A4EA 2JQZA 4JFQB 8CGTA 1TCMA 1L9QA 2X10A 2J57A 2Y5TB 4H40A 2GFBB 1SYSA 4MX7A 5DT1L 5KS9F 1M4KA 5KSUA 3ZDWA 1E6JL 3MLRL 4C55A 1KELL 2VR4A 4H88H 5DVMA 3EH2A 4UMSA 4K9EC 1EWHA 4MA3B 2APSA 2ZOLA 1F11B 3MDJA 1L0YA 2Y07H 4PRAB 4I7ZC 2FX9L 3ML8A 4K15A 2QMJA 3FTZA 5EB9A 5FGBA 4LBAA 3X12B 3T3PE 1F4YH 2O6PA 3MLYL 2XTJB 4ZFGL 1SBSL 3UTTA 4PGEA 1MQKL 5GRWA 4K73A 3QR2A 2Y7MA 3KG5A 4MVBC 3SDAC 1KBBA 3BP4A 4OCWH 2BSEA 2FWOA 3UO1H 2IADA 2DQDL 5HHQA 1MEXL 3RNQA 2JKXA 4L4VE 2XKNA 4KJQC 3MJ6A 1YC8A 3MBEA 3E7JA 2IPTH 1NLDH 3GTVA 1VHPA 4F37K 1CJYA 2X9ZA 3FT2A 4XO8A 3LV3B 1GS6X 4FQ1L 1W15A 2FEEL 4O00A 3AADB 2D2OA 4OLVL 2BFGA 2X9XA 1RLWA 4PVBA 2VT0A 4OZ4A 2AEIT 4ZFZB 1YG9A 8FABA 1ZHNA 5I0XA 2FNBA 5KVEH 2VR3A 5H37H 3S2AA 1KT2B 3L2MA 4J5VA 3U7AA 4AQ1C 4AJ0A 2EXYC 2IG2H 2F1AA 5E24E 3GLDA 4OLWH 1IIIA 1HQ4B 2CO7B 3HVDA 4PRPA 2J1YA 1BWWA 1Y6NR 1FIGL 5C0BA 2B20A 1SMOA 5EEVA 5TE6H 5FCSH 4I8DA 4X8GA 1I7UA 2ZG3A 4HEPG 3FT9A 3QIUC 3MRHA 4PJXF 4XB7A 4IIZA 3V52H 1R3JB 3TBSB 5IQOA 4YHNA 1KCSH 4ZO9A 3GHEL 2N7BA 4FRWA 1Y1DA 2E6PA 3IU3B 3PNWA 4JM4L 2PXYD 1NGXB 5HDBB 3WIHH 1BFOA 2I60H 4JJ5B 4FLQA 5TTRA 2QV4A 5DEGA 2QHRH 3WS6A 1Y18A 4EXKA 1A9EB 1YNTF 3VI4F 3UIYA 1BD2A 1DBKL 4LSQL 4OZIF 4J3VA 1QR4A 3EYVA 2AQRA 5KSBA 3CD4A 5DFVD 4YWGL 3PV6A 2XV2A 2HA1A 2VZVA 4JVUA 2ZKMX 3V4VL 2RMNA 1HKLL 4XN2A 1OAKL 5FAAA 2MIZA 1RU9H 2FR4B 2B3RA 4XPFL 2E9IA 3WFEH 4LQFL 4HZAA 1TU2A 2XYCA 4QI3A 3VXOB 5IHWA 2FH8A 3RUGB 1F6LL 1R33A 4H8UA 3MJ8A 1TEYA 2VJ8A 5EDXA 1JSYA 1GPOL 4S1SH 1JF5A 3NACH 2XWTA 5F9WB 3SO3C 4MXWH 1MWAA 3T65A 3CXHJ 1JPSL 2F7RA 4AW7A 5A16A 2CO6B 2YJQA 1RVFH 2H26A 1XGPB 2CD0A 4UOW1 5F8QC 3MUGA 1N5YH 5GS1C 2Q3XA 5IEHB 3DX3A 3DI2B 1UEMA 5GS2D 3C60A 4LP8A 4IKNA 2BNUA 2ZYRA 4YC2B 4YDNA 1RK0A 1OSPH 4QRRD 3SCMA 3T2NL 4JHWH 3GRGA 3MRFB 3RA7H 5ALBH 2HWZL 2Z93A 1MI5E 2VDPL 4PJDA 4Y4FA 5DRNB 2EDLA 3MVSA 4FI7A 1MLBA 4DPCX 1NGPL 1DSFL 3QQNA 1C08B 3O2WL 4P49A 4J3OD 1ZE3H 4NQTA 4XODA 1I7RB 2K6YA 1U21A 3VA6A 3GIZL 2EH7L 4IOSD 3RTQC 3WNIA 1E4XI 1PF3A 3MJ9A 1E4KC 5IGXL 4IRJB 5F7UA 1IC5H 3C9NB 1P4UA 2WN3A 3UAAA 2E56A 3PWVA 5C0CA 1AZCA 1GA2A 5I8OH 3MYZA 2EVGA 4Q9QL 5ACZB 1IV8A 1WPCA 2BINA 5I1EH 1J05A 4WCYL 3HMWH 5FLUA 1KTKE 4HWBA 3QNYB 2H2SD 2OP4H 4HCRL 1NCOA 3PFUA 1E8XA 4JREB 1Z3RA 4L8BB 3WHXA 3N1PC 4M7JL 1L7IL 1HINL 5K1NA 2B5IB 5JPMB 2FIRT 1BAGA 4QHLA 3GRWL 1I7TB 4WTZG 3LEXA 4QXWA 4AYSA 1JF6A 4CN6A 1I4FA 5I30H 1AFVL 4TSCL 1A25A 3NT0A 3V95A 3Q06A 3LX9A 3S36L 1OCCB 1Q0EA 4E9QA 4Q9CA 3VH8B 3WEMA 5AVSB 4DUVA 5EOQH 4HD9A 1H3UA 5CJ5A 2FX7H 3KL0A 4N2AA 5GRUH 4PJFA 3LS4L 3ECUA 3BVVA 2CXGA 4KNUA 2FNWA 4YDJA 3DX7A 3FB7B 3PWPA 3NRPA 4MMZC 5DRXB 3ARGA 4W9LC 5I1CL 1QQDB 1P4BH 3FO9A 4N9GB 3DO3A 4L1DA 1K85A 2P8MB 4BSVA 1HH6B 5E6ZA 5G2NA 4YNYA 4BZ1H 4Y7OC 1CIDA 4D0CA 4HCFA 3O2DL 4PJGA 2FL5A 3HZYA 3B2UC 4NNYA 1ZPLA 2DLHA 5B7EA 1F4XL 3K80A 5CD3B 4I4WB 3UYRH 1DQJB 2H0PA 2QV2A 2YD6A 5JDSB 1XEUA 1M2VA 3B9KA 3O3EA 1PG7H 1HHIB 2M8XA 3LHAA 3KLDA 3MACH 5GSRA 2AEPL 3CLWA 5FHBH 5DYFA 1B0RB 5F6IB 4UTAA 5CEYA 3CE1A 1JD7A 1TLKA 2EDQA 2R9HD 1LWHA 1F4WH 1CICC 3N85L 3GHBH 4XMKL 4URTB 1P9MA 1WBZB 2CJ3A 2A9NL 4JKPL 1NOAA 4JFPB 2UZYB 4MJ6A 1PIGA 1HIML 4LDLB 4FERA 2EDKA 3FH8A 2XBDA 4PRID 1G7HB 4MD4A 3CCHB 2DTML 4PV9A 2K8QA 5J11C 4J8RB 5HYEA 4YE4L 2JI1A 2PCXA 4AGNA 3Q2LA 3VFPA 1A7OH 2Q6WB 3D09A 1DLFL 3HG1E 2UWEA 1GIGL 3ZE0F 2VIRA 5LWYL 3M7FB 3LQAC 2V37A 1IAIM 3MLSL 5EZOL 3PNRB 1ZHKB 1UHVA 3VXSE 3QJHA 4ZPTB 1FE8L 3ZMRA 1JNNL 4MASA 1XMWA 1GS7A 2B39A 3VFTA 3VE0B 5C3TA 3ZE2B 2BXYA 4DETA 2H6PB 4ZMTA 2D7NA 5DU7A 1XT5A 2O5YL 3KDPB 4GMSH 4KGLA 2GTWA 4M61A 2ZYSA 2JMRA 4PJXE 4Z3JA 3T6WA 5JNYB 5AAPA 1IBGH 4DKEL 3GXPA 3IJEA 4JN2B 4DN3H 1FVDB 2WSDA 2D4DA 4ZS6C 1VADB 2KT6A 1DQDH 3KW7A 4ONFH 5C09B 1NL0L 4JG9A 3ULUL 2J5LB 1FO0H 3WDIA 3RIAK 2Q3ZA 3IDXL 4U1NA 3VI4E 1HAWA 1RUAH 1BVNT 3LH9A 3SKUD 4OZIE 3G6DL 1ND0A 1QFUL 1JI2A 2N1TE 3GT6A 3OMZA 1A6WH 4HGWA 4ZUVB 3C5ZB 3TBTB 4LCCB 1MF2L 2JQMA 2EYRB 1KZQA 3RDJA 2HN7A 3NJGA 3L95B 1EXUA 4HFWA 3ZL2A 4EF3A 2DAVA 2XV0A 4QOKB 1UVQA 1FZOA 1AC0A 1JZDC 2G75A 4MQ7B 1XF2A 2QJDA 3RZWA 1VJSA 3NEXA 2OMZA 5F7EL 1MFCH 2UUDH 3LQMA 1P6WA 1IVLA 3RPIA 1SM3H 4FQ2H 4IMLA 1JZ4A 5TDPA 1ET5A 5T5FH 4MAYD 4Y16A 2R0WH 1FP5A 1PSKL 1N2RA 2XN9D 5DR5H 5EOCJ 5I1HH 2J8UF 3ZZ1A 3HE7B 1U8PA 1NBZA 4L9LA 4WI2A 2ZSWA 3D0AA 2W0PA 1GY1A 1GL4B 1U8CA 2A6KA 4P9MH 3U25A 1KCVH 4MJ4A 2VLKE 2CLRB 4P4KD 3UABA 4JY6B 4HSCX 1OARH 4HH9A 2OK0H 4U1GC 2A0LD 2C3XA 4GSUA 5J1AA 4PJ8A 3EJYD 4HJGB 4WUKL 1I1CA 4I87A 3ZXAC 4AMXA 3DJZA 4WTXA 4ICXA 1V7NH 2A0LC 4WNQB 1ET8A 5I5IA 3ELQA 5I75C 2RFXA 3SZ6A 1T80A 4W9KC 3DMMC 4AENB 5CFHA 4IRSD 4LMQE 3C8HA 1BDYA 2AI0L 1QSFA 4PRNA 2GKIA 4Y2DA 2RGSA 5I16B 4NDMA 4JG1L 3HRZB 1PG7X 1KV3A 1MXGA 3NCYP 1KCRL 4MLIA 1D5XA 1U8JB 5FM8A 2YXVA 5F7LB 4RGNE 3UX9B 3X14B 2ZNWA 4F8TA 4HAKA 4N1CA 4IOIA 1AGCB 3UTSA 3DX9A 3IPFA 5DHEA 2K78A 3BP6A 2C9PA 2MCG1 3RWIA 1OPGH 3BPLC 5JQ6H 2YK1H 5DURB 1WEJH 2R7EA 4AQAA 1M42A 5GRVL 3PIQB 4HV8A 2CGRL 3RHWF 2HJLB 2QQNL 3P77B 4IHBA 2NUTB 3IFOA 1A1OA 3NABL 1RJLA 2BNQD 1KIRA 2WXIA 3L4UA 3KPSE 4FQLH 4JFSA 1YJDL 1ZLSH 2NYZA 5C0DA 2CLZB 4MJ5B 1KULA 1PZSA 4G9FA 3X3GL 2Z7YA 4QHUA 4GP5B 3AY4C 2XFXB 5H8DA 3FTXA 4XVOA 3FQ2A 4AV0A 1JWUA 5AVYB 4UDTB 5MENA 2OPCA 3MLVL 3GK8H 3KYOB 1OTUC 3WIIL 4B97A 4F8OA 1U2HA 1KB9K 2V9RA 3DROB 1QA9B 3QR0A 4JPVH 5I1IL 2I69A 1PU0A 2R4RH 3SE8H 2BVQA 1MCLA 5I15L 2ESVD 4MNQD 5H37G 1FPTL 4PHXA 5F3BA 3C5JA 2W65A 1MWAL 4UDUA 1P84J 2FIKB 3CNKA 3WY2A 3BQUA 5F7KC 1SXCA 3RDTD 4X80H 1XIWA 3UAFA 1WZKA 1E5YA 4M62H 4LSTH 1ZK9A 3RGBA 3UFIA 3SE9L 4FG6C 1HHHA 1TO4A 2VDQH 4JRXE 4TLSA 3RDTC 5JXEC 4X4XA 3N40P 4I18A 1KTDB 4RX4D 4KH9A 2NY3D 4UQ3B 2VXTH 2BHFA 3FMGL 5FGCE 1H3PH 2NQCA 4G8EA 4PW3A 2ZOWA 5I6XB 4ZAKC 3NEEA 5ESAB 4XCEB 2BSTB 1OE3A 3QO1B 1D9KD 3RZCB 2V9UA 1V27A 5D5MF 4H5SB 4RCAA 5FCUL 1U3ZA 3O3DA 3MA7A 1UASA 4OJYA 2VLJE 3HKZA 1D9KC 3TBYB 2HAZA 2N1KA 1C5DB 4RBPK 5B4MC 4O2EB 3GDBA 4JRXB 1WD9A 4G3YL 3P4OA 1SUJA 2P5WA 1X7QA 1I8AA 2UY6B 4FXGA 3VFWB 4QXVA 2CDGB 4R4BA 3QUKB 4HK0A 4ZBJA 2H0EA 4KUCD 1JTPA 5HPMB 3PHAA 4LLMB 1H3WM 2ERJB 5D2LA 1ZWIB 3VRLF 4X4YB 3S5LB 4G9DB 2AJYH 4NC0B 4Y8DC 3RL2B 4N2MA 3BPOB 4XVJL 3MLUL 2AQ1A 3KM2A 3GSOA 2P42B 3MRJB 1PAZA 2FQGA 3QISA 4GT7A 4PS4H 3EJQA 2ZOKA 1GKOA 1EAPB 3T6XA 3PGFH 2HJFA 1VFBA 3ZDXE 5L4FA 1OF2B 1P69B 4NPKA 4Y5XC 1FQ9C 4PJCB 3ROLB 1RI8A 4ALAC 4LT7A 2VN3A 1AI1H 2IOMA 4PW9A 5A7BA 1Q0YH 2WINA 2FJHA 3EFDH 3S88L 3ZU8A 4F27A 3TJHD 4GRLA 4PAZA 5E08L 2WTRA 4YX2H 2IGLA 4JNXA 4M8QB 4GAJH 4DOHB 3HOGA 1IC4L 5KVFH 3O0RL 1ZV5A 1QFWL 4NZTH 5HDWA 2G60H 2KH2B 1PLGH 2PP7A 1HSAB 2W38A 4HUUA 3HG2A 4NWTL 4Y4KA 5C97A 2YD1A 4N0FB 3EO1A 1K4CB 1EK3A 5ESQB 1YHPA 4OT1L 4EJ1C 3QUXA 3QORD 3DX4A 3L7FB 5KSAD 4A6YH 4CVXA 2X12A 1NCCH 1I1FA 3A6BL 4RESB 2PO6B 3HN5A 4G5ZH 5KSAC 4TUUA 4A04A 1M1SA 1NEZG 1NMBH 2NY7H 3CDGB 4Y7MA 4Y1SA 4HOMA 3SPJA 4K4KA 5KYNA 3PQYB 2DQGH 2HFGL 3ZRFC 4GO8A 2F53D 4IGBB 2WMPB 1RZ7H 3B3IA 4V33A 1CL7H 3KEHA 1KV7A 4ELMF 4LDCA 4PBXA 2F1EA 5ENWA 2Q7YB 4HP5A 1VZIA 4AUUA 4TRPH 4KK9D 2E7LA 1NMCC 2CDFA 2EEBA 2ZKXA 4JKMA 4P3CH 2J4WL 4YSRA 5JW4N 1CBVL 1UH3A 3U79A 4M5YL 4OJFL 2RR3A 4B9GA 2HFFA 3QJSB 5LKNA 1EEQA 3SPVA 2X6UA 3W1ZA 4K3EL 3V9FA 4MCZA 1MDAA 2FLMA 2OQJA 4CMHB 4YSPA 3THML 1TF4A 5KTEH 1PZUB 3RB7A 4AK1A 2AJ3B 3LH2H 2ARJB 4I3SL 3GB7A 5IFJB 1F3JB 5AYUL 4M4PA 4ZW5A 3MV7A 5I6PA 3M07A 3QHFH 3OVUB 2L7EA 2BS9A 1AGBB 3FQXA 3U0WL 3IBOA 1FRGL 4Y1AE 4LHQB 5LJYH 1G7QA 4MWFA 3NK4A 3QGVA 1DVFB 2J43A 4ZUUB 4KQ4L 2OKMA 4JDVB 3GSVA 5AB0A 3OMIB 4LL1A 1TQBB 4NP4H 4HK3J 2IBBA 4HW6A 3FAXA 1TJHH 1V8HA 3NOIA 3UP1A 1N18A 5DLLA 2BOBB 4R5TA 3MV01 3ZTNH 1NBYA 3AU1A 2VUYA 2ZXWB 3L9YA 3M8OL 1J1XH 5IUSA 3TF4A 2HUEA 2Y2TA 3REWB 1PFOA 2DQJH 3AXLB 2NW2A 5CMAA 4Y1AB 1BZDA 4IJ3B 5A2AA 2HLFC 2AZAA 3EGSB 5F7DA 1C12B 2DL9A 2WTOA 3D51A 3OKKA 1T0MA 3K4ZA 3U6RA 5L9DL 2CHWA 2EXWC 5B38A 4FFZH 3LZPA 4GW1B 5D93C 3TVMB 3GXUB 1WA2X 3D39D 4LIQE 2IFGA 3KWUA 3RY5A 3ARXA 3RVVC 4A67A 4BFIA 3DIFB 3SDAB 1YJDC 1J18A 3BEVA 1ETJA 3L1EA 3TFKD 1Q4NX 4PYHA 3T0WA 1MH5B 3VFOA 2VWEE 4X8JB 1IBYA 2GCYB 5C0EA 1X3DA 3TFKC 3VWJD 4LAJH 3BUYA 3G5XA 3MA9H 1HHKB 4UV7H 2EYTA 2DEWX 2XOTA 4XBGA 2CHNA 4Z77A 3L2NA 3KWWA 4XC3L 2BY2A 2N3JA 4OIBA 1KBGL 1V7MH 1X5FA 2A83B 1D6VL 4JDZA 4AKQA 43C9B 3O6LL 1LO0H 4UT6H 1AYRA 4W6XB 5L8KB 2OM5A 4Z7WA 3KZ8A 3JWOL 5D7JD 3MXWL 1YEEH 4L23A 2BSBA 1K5NA 4OSUH 1JCVA 3RY6C 1WGVA 3ZKMD 3V6FA 5IJDC 2WZPD 2AXFA 1IILE 2B1HL 3FOMB 5D7JC 4FI8A 1Q1JH 1KSRA 3ARBD 4EN3D 2HX8A 3R8QA 2X2JA 2ZUVA 1SY6L 2CR3A 1YN7B 3DX6A 3C6EA 4OY9A 4J27A 5DQJA 4H2AA 4ZS7L 3S3CB 3QIUB 1JNLL 1VACA 1XVSA 5CLTA 3DUHA 2QQLL 4AQ1A 1INQA 1RZFH 5D5ME 1OL0A 2X3AA 1Z3GH 3F7LA 3SDYH 5EHFA 4ERSL 1GYCA 3BLBA 2JCCB 4PJ5D 5SWSB 5EPMA 2AJSL 1CE6A 5KJ4A 3BDYH 3MCYA 3WKPA 3MRDA 4YQXL 1F2XK 5K9QI 1U3HD 1MCDA 4OLUH 1K4DB 5E6IB 4BRVA 1OP3H 3CVCA 3O11A 5FX3A 1U3HC 3IDUA 4G43B 4H8WH 1B6DA 1CT8A 1E5UI 2J1ZA 4PWKA 4TNEA 1G9ML 1K3IA 3UYOD 1YNLH 5B1AB 4LLDA 4M7KL 3WFCL 4ZOAA 3OG4B 2P52A 3MNZB 2PXYA 5C0RH 5C08E 1KIQB 1OM9A 3G5YB 2VRKA 3B9DA 4NQED 4B27A 4BIKA 1UWXH 3NJJA 1CU4H 3UAJD 1NFKA 3H9ZA 4A2HA 1GZPB 4W93A 2MQCA 4LOVA 3UAJC 3GSWB 2IGFH 3ZIMA 1A0QH 1XCQA 4OI7A 5GS1B 4NGHL 4OZFB 4NQDB 3SBRA 1UEYA 3GBNH 1MCCA 5J56B 4GNKB 4NRYB 4QGYA 4G6JH 1FFPA 2FJFB 3BGMA 5HVHC 1KCWA 1E5AA 1U91B 3D2UD 5HHXH 3MRLA 5L2JA 1BZ7A 2H3NB 3RJOA 4CBPA 4HKBA 1QBLL 4JFFD 3FZUD 2DB8A 4ZMNA 2IPUK 1DL7H 1A6UL 5AW9B 4P8QA 1RAMA 3GMOA 3KH4A 4KKLD 5J8OA 1O9VA 5CHNA 3MNDA 4B41A 2EDWA 2YAQA 2YA1A 2VM3A 1NM4A 3HC0B 3U1SH 2VDMB 2YPVH 3QEQD 3G6JA 4YIQA 5E95B 3RTQB 3RWCB 5FYKL 1DEEA 3X13A 2BSDA 2WXPA 2XQYG 4RA0C 4ZYKA 2QSCH 3FCBA 3L4ZA 3S96B 4QRRA 1IBDA 4KO7A 3LRSB 2CG9X 2X2UA 4U05A 2AVGA 2BP5M 3NH7L 3SDCD 3NIGB 4F15C 1TQTA 5DVOA 2DY2A 2R69H 1RKRA 4FOMA 3HMXH 5T1MA 3H3PH 3CBJB 3H7BB 5FYLD 1S7SB 3JSSA 3SD5A 5TGBA 1LE5A 4UINL 1QEWB 5GRJL 3T8XA 5IBLC 5EC1B 1AP2B 2GAZA 3L4VA 3A5VA 3Q2VA 3WN6A 4IOSA 3GM8A 4HIPA 3UBGA 4JPKL 3NZ8B 2NYYD 2J6EL 5C7XH 1FNSH 2O4EA 2VW7A 3CVHB 2FYYA 3F5WB 5EUKB 1W91A 1IC7H 3DJTA 1FG2A 2NY5H 1TVDA 4XMTA 4LCWD 3CGTA 1HYRC 3FC8A 5CWSA 1MLCB 1F1GA 4XWGL 1PCSA 1A8ZA 3C6LD 2UXGA 4LLAA 1KYFA 4EDXA 2YWYA 2WLMA 1NCDL 4DGYL 5JW5A 5L88H 5SWQA 2NY2D 3LXAA 3T0VA 2E8ZA 2F54D 4MMZB 2XPYA 3WFBH 3TT3H 4RQQB 1I3VA 2PABA 1KTRL 4EI6A 1DUZB 2A1WH 2KBGA 2IV9A 3AFLA 5C0JA 2NNFA 3NGBC 4Y4HD 3NA9L 1E30A 3K2MC 3OHXC 4JE4B 1RZIB 2VO8A 4HJTA 2NYKA 3CBKB 3V7AE 3FHAA 5C3IA 2BRRL 2WZAA 3D08A 1H3GA 4XC1L 2EE2A 4AV4A 1YA5A 2GSGB 4KI5E 3KGSA 3BIKA 4IDJH 4PTUB 4S0SD 5GGRY 4ODXB 4I0PD 4Z3FA 1QBMH 1TQCC 4NN5C 1F97A 3CSPA 4NZFA 2BIOA 3EH5B 2GSIB 3FN0H 4D7BA 1WUNT 3ERXA 4PH8A 5AAMC 4HIEB 4XTRC 3UEZA 5IHZB 4H8PA 2I7OA 4XCFH 5DQ9A 3F83A 1CICB 3IS0X 1FVCA 1HWGB 2XPGA 3HNVL 2R1WB 2NQ3A 1KXTB 1RJYB 4HS3A 1EJ6A 3JYBA 4MCYA 2WUCH 4RNRB 5FFGA 3FQ1A 1DSYA 4EN2A 2EAEA 3FUJA 1DJGA 3HHRB 3RVTC 5BRPA 1KEGL 2P4AB 3P2DA 4XNQA 4B60A 3JT0A 4FDWA 1XGQB 3VXUD 3FTVA 1XX9C 3ZR5A 1OAYH 2DQTH 3ROOA 4NO3B 5J11B 1NC2B 1U0QA 1UM6L 2WQSA 2WC7A 1OK8A 3FPXA 3TA3C 4FHKA 4DP0X 3MRIA 1BGXL 2HJKA 2MFNA 2XX0A 2IQ9H 3BAJA 3K6SA 5ADPL 1QI3A 3FJTA 1EFXB 3PG2A 4HXBH 1TTBA 4ZJ9A 1F3DH 3T6QC 5E5LA 3SN6N 2ZUYA 3D4CA 5IM7B 3OD3A 3GXMA 4B9FA 4LVNC 3QAQA 1J8HE 1SN2A 3HA0A 3HS9A 3JWOC 3DXAD 4FXKC 1R24A 3OMNB 3CXDL 2PMZA 4PRIA 3ES6B 3AWFA 2XZQL 1NZRA 4FNPA 3RB5A 5JR1L 4U6XB 4EE2A 3QQ3B 3ARWA 1F58H 2GT9A 2CMRL 4YFLF 3I50H 4ZMXA 5IHUL 3OPUA 4H0HB 4BEIA 4UQ9A 5EU6D 3DV4B 5MEPB 2Y22A 1NDMA 2YQBA 3HHMA 5F0LB 3V4LA 5BZDA 4QXTB 1XH3B 3OG6B 4UBDD 2FGWL 3DGGB 3CFTA 4NBXB 1BQKA 1HCYA 1JNJA 4KDTC 2K4WA 2W9LA 5I74C 4QXUL 3BP7B 4JG5A 4PRHB 3MLTA 4TSBL 4AGQA 4MZ2A 1VFAB 1D2PA 4K3JL 5DDHB 3QG7L 1GY2A 4MNHA 3TFBA 1QWHA 1DBAH 3CDYA 5C0AE 3R7QA 4H13C 1J12A 1VA9A 4ZPVA 5C6PB 2R29H 2Y6TE 3T2PA 1IEBA 3CFMA 1S3RA 5HDQH 1O7DC 1SUHA 1LO5A 2X4UA 2X6BA 1TVBB 1G9MC 3HS8A 4A2LA 3US1A 3V4VB 5F3FA 1GOFA 2PWDA 2FT8A 2WO3B 2P8LA 3VSVA 2E7CA 5B1KA 4B9ZA 1CI5A 4NFBA 5F9OH 1A1MA 5GJTL 3HG3A 1QFHA 3RWDB 1TTGA 2FBJH 4QEGA 4X6CB 2YD4A 2J44A 1PCXA 1NGWB 4NRZA 3DVGA 3HZ3A 2H6OA 3WKQA 1NC4B 2IF7A 4JFTA 1CTNA 1CK0L 1HHJA 3MYJB 2Z35B 1IAKB 3U7YH 3OKLB 1IX2A 3S34L 3DO7B 1KPVA 3NUKA 1RUPH 4U1GB 4U6HB 3W37A 3KYMB 3VFVB 4BKLB 1Z9OA 3AQZA 4Q6YA 4G7YH 5CR8A 2R0KH 4HT1H 1GGCH 4FFYH 2GITB 2IAND 1I3GL 4WO4C 4MAYA 1PNCA 2VDPB 3EYFB 1JXGA 1Q72L 2ZP8A 5I75B 2WB1A 2XN9A 3DMMB 1WBYA 3NK3A 4YHZH 5F2FA 3H42L 4KMLB 2BY1A 3P1VA 4JRYB 4PUBH 4S2SA 1ZA3B 3TO2A 1UA3A 4OKDA 2P46B 2V33A 3I9PA 4TULL 4Y9GA 5J6GB 5GSVB 3V4PL 2RD0A 1DN0B 3AAZA 3T3MB 3L5JA 1QYGL 4P4KA 5FOJA 3QQ9C 1IGCL 5BRZB 1AR2A 3DETD 1OIOA 5D55A 2IWKA 5I1LB 1J88A 1FCCA 4FXLA 4WWKC 1X9LA 4XX1G 2IXQB 2R1YA 2WLHA 2CUAA 3DETC 1E27B 5FO9B 3OJMB 1DQTA 4ZI8A 5CZRA 3BPLB 3K2UL 4WWOA 1CGSH 1P2CB 5HDBF 4GG6A 2NW3A 4I2XB 5DS8A 5CIPA 4IRSA 4LRNL 3VFRB 4N6QA 3UJIL 1CLYL 4P06A 1AAJA 4O51B 3FQRB 3RYMA 1GGTA 2HFTA 5DVLA 3FOLB 1V5JA 3EKCA 5BW7C 1SOSA 4K7FA 3WTSA 2ENPA 4JO5A 5EEWA 3TURA 4NXSA 3R0MA 4BQ9A 4PCYA 6PAZA 2V3EA 2DWEA 5C07D 15C8L 1VFOA 5D71H 1TMCB 3RUGF 1ORSB 4P2QB 3VQ1C 1U92B 5BS0B 1EMTH 2K9UA 2NTFA 2WTPA 2EYSA 3F05A 3OKDA 4GAAA 5C0FA 4XP4H 2FEDD 3IJ8A 2ICWJ 1TZHA 1BQHG 1AG0A 1NMAH 2B2XL 2MHAA 3UG3A 2BNQA 4JFDB 4Q9BA 4X6DE 4GUCA 2FEDC 2H3KA 4PJDF 3NPSC 1UXWB 4TPRH 1OZUA 1PBYA 4WY7L 5I5RA 3GLEA 5C70A 3DV6B 4HS6A 4FQJH 5HI5C 2FWLB 1YEDA 1CI3M 3BKYL 4I89A 3S4SA 4DK3A 1H6EA 2DQIH 2ICWI 4X99B 5TH2A 1RHHA 2BP8B 3JTTA 5LNDA 3S8FB 2LGNA 4I1PA 3Q2WA 1J5CA 2V2XA 2TSAA 3ECBB 1UENA 4ZAKB 4MQTB 1S6NA 2ESVA 4N5EC 1M7IA 4JQXC 2ZX6A 5EO0A 4X6DB 1OV8A 1CYGA 1PKQA 2VAAA 4YDVB 3CN3A 3WUWA 3RIFK 2OMBA 4J2XA 2FQDA 4TMPA 3D6GA 3H55A 2XHNA 4RFNC 3RDTA 2Z0UA 1DFXA 2BOCA 3MODH 5JXAH 4Q4IA 3VGAC 4ZMWA 2C1PB 1HH9A 4R4NC 5ANMA 4UUJB 2D9CA 2FD6H 4RX4A 5FXCH 5DYOA 4D8PA 3NBNA 4JO4L 5B7FA 3D85B 5FGSA 1SHSA 2ZCZA 4PP2B 4NJ9L 4QRTB 4NKIH 3IDNA 4U1KB 5I2IA 1S9VB 5DWUL 5FYJH 1D9KA 2C3GA 1MHHB 1DQQB 1ZVSB 1P5UC 3T4AA 4KQ3L 1GH7A 5DSCB 5DUBA 1JHKL 3NZSA 4NN7B 5GGQL 5FC9A 1ANUA 1WAPA 2B4CL 2C3VB 2OZNA 5EF2A 3HR5A 4PJFF 4ZXBC 1FLRL 1MFEH 5HGAB 1R47A 1S7WB 2CBTA 2FZ3A 3ULUE 1ZDQA 2Z9TA 3H4FA 4N2KA 4G8GE 1F1DA 3CFBB 3HVNA 1E65A 2DKUA 1GZHC 4PTTB 4KKAD 4ZNEA 5CCKH 1CL7I 4TVSa 5JHAA 1W0VB 2AQTA 4RMSA 4B95C 2W9DL 3QC5X 3K72B 4LKXB 3CMOH 5AB2A 4HEME 4NJAL 5D7KE 3IK2A 1AKJD 1C5CL 2ZX8A 3QRGH 4JDTL 1T2XA 4ODVL 3S37X 5K9KB 5KBKA 5MP6L 4PJGF 5IQ7H 2ADJB 3D7PA 4QYOB 3BVNA 1NUNB 5G4OA 1HWWA 2XJLA 2EVJA 2CSPA 3RTLA 1ORQA 3O4LD 4DQOL 4Y5XA 1M7XA 1D5ZB 1SJEB 3N41B 4F8QA 5D6DA 4OTXH 3I6KA 3JWNH 5DMYA 3TTSA 3VTMA 5A7EA 1S8DA 2PCPB 5JW4Q 3QNXB 1H3TA 3TN0D 2OR9H 2QZQA 3UCRA 1MSPA 3M6DA 4XXDB 1HEZA 4HS8H 4O02L 1U4FA 2MJWA 3NJHA 2ZPKH 1TZGL 5DFWH 5AOMA 2B8OT 4CILA 2G9HA 1Q94B 4P0DA 1ACYH 3EOBA 1MW0A 2W9EH 1MKFA 3C8KA 5I71C 3FCTA 5E8EB 5HHME 3X1FA 4O58L 4PCKA 1JPFA 1I9RH 1X6LA 4EDWH 2WBWB 1NMCB 2UWEF 3C12A 3PDOB 4NHCL 2DWDA 3WXVH 2WBKA 5KSAA 3I6LD 5KYWA 4KO5A 4NO0D 5D8JH 5I1JH 4KXCA 3EUUA 2NNAA 3GMNB 5KG9A 1NJ9A 1QATA 5E99H 4HG4J 4I3GA 4KK8D 3VSQA 3JTBA 2VITB 4BD4A 4FCAA 1INEL 1DJXA 2L0DA 2QKIA 2ZXQA 3EO9L 4PRDA 5HGBB 4PRPE 4CDGC 5EEYA 4W9GC 1OB0A 2F53A 1Q9KA 3L7EA 4KK8C 5C0BE 2GIXA 4PGDB 1MY7A 1G7IA 2EICA 4WFED 3UTPE 1OY3B 2CWRA 2JJVA 5A40E 1CFMA 3M17B 1S9KC 2HUHA 3WSQH 1M9SA 1IQDA 5TQ2H 2WQXA 1P5VA 1SDDB 5LXGH 4I5BB 2X89D 3EFOA 1BZ8A 3MV9B 1UZ6E 2Y1AA 1XCTA 5HYJB 1PZ5B 3WEBA 3PHSA 2VXQL 3KH3A 1F00I 4QO1A 4WI6A 3VGEA 2YMXH 1AHMA 2YHGA 1YN6A 3A24A 1BZQK 3AWEA 4P2YA 5KSBE 3ETSA 4ZQKA 4AQEA 4GW4A 4AYDC 1DFBH 1IM3D 1CFNB 5F44A 1QZNA 1T83A 3FB8B 2ROYA 1O6SA 3IJHB 1JWMB 4PR5A 3DVNB 2YMOA 1RZGB 2QADB 5FF6A 3L9RB 3RFZA 3BIBX 1IGJB 1W0YT 2MPAH 5CSZB 1VEMA 4QTFA 5MHSE 3PJSA 4PP1C 2QBWA 1WHPA 1BXXA 3S2CA 4GW5A 2H0JA 2VSKB 4FMKA 3KYNA 2ISDA 5DJDB 4XRCA 2TRYA 3WKNA 2ZZUT 5TF1L 4E42A 4ZG1A 1Q38A 4ODUB 2J21A 2AXJA 2R23A 2E7HA 3NZUA 4UWQB 2IJ0C 1GYVA 5BQ7B 3J27A 3FF8A 4ZTEA 1CLVA 3OC5A 1ID2A 3L1OL 2X4QB 2F5AL 4PG2C 1HI6B 3WFDL 2CGZA 1I8KB 3VYNA 2DIJA 4EMZA 2C4XA 1YRKA 1CFQB 1QUNA 2WYIA 4LLQB 5HXMA 1A3RL 1JK9A 1QZ1A 5AZUA 1IAIH 4KQ0A 5KUMA 1XGRA 4PJDE 2CRYA 1HJBC 3GF8A 2J56A 3VDCA 1QKZH 3F6JA 4U6TA 3D39A 5CSGA 3MJGX 5T3XH 4OFPA 4ZUWA 3APMA 3CXHK 3K6NA 4RSYA 4G82A 4IRZA 1TJIH 1LEIA 3IB4A 4KRLB 3F85A 1UFGA 3T0ED 1PEWA 2JWYA 3VWJA 4XMLL 3SDDD 2R0ZH 5GISL 5BNXD 2P8PB 1CDBA 5AVTB 4N90D 3U7WH 3ARFB 5D1ZD 3T0EC 4LVHC 3ASNB 1QLFB 5C0CE 5IG7A 4GBXC 3I6SA 1OEZW 2DYRB 2YGOA 4WJG3 5EZJA 1QRND 2C9AA 3RIKA 1VGEH 3QI9D 5DS2A 4HMCA 3RY6A 4TNFA 3S9DB 4DP9X 5D7JA 2CDEB 3OKEB 4FP8L 3NIFF 4UIKL 3IGAA 5AKTA 5AL8A 5CN3A 4JW3A 4NUGH 5TFSL 3II1A 1N0LB 2DQFB 1A14H 2OMVB 4Z7QE 3O6KL 2Z31C 5I8KL 3R06B 2VDKB 4L8DA 1E9OB 1WIUA 3ARBA 4EN3A 4KITB 5J06A 3MROB 2VR6A 3ETBJ 3UDWA 4BQCA 1WJ3A 2CE6A 3S6CA 4FYSA 1A7QH 1JPGA 2V17L 5D72H 2W07A 4K3GA 5IB2A 1UOVA 4FZ8H 5LG1A 3ISRA 3DUUA 3DPBA 4JZNA 4XNZC 4RVBA 4OV5B 4YXLL 1I9IL 4PJ5A 4DAGH 3BVDB 3FQ4A 4X7EC 2WPGA 4P23C 1R17A 1U3HA 3PHQB 1JRHL 4JY4B 4E9VA 2X7LA 3FBKA 5FHAL 4QTIL 3PWPE 1Q0XH 1KB3A 2DICA 4TV3A 2VDNL 4KXZI 2AEWA 4JPSA 2B16A 2XWBB 2EECA 4WZ9A 3ZHLA 4R96A 5CFAA 3GJFA 3MGAA 4AOFA 2EKSB 3STZB 1NINA 2DMCA 2E27H 4PJGE 5HI3C 1XTLA 2B0SH 1NBQA 3HC3H 1R1CA 1X5KA 4WW2C 3HEIB 5EF1A 1VKXA 4NQEA 4OF7A 2Q86B 4Y5VB 1K8DB 2HH0H 4GQPH 3ULVF 4U1LA 3TYGL 5LQBL 4BFRA 2YOAA 3UAJA 3WBDA 4HC1A 5HD8D 4UQBA 1S3KL 4F37F 1CWVA 3HI6H 3CDCA 1NIEA 3OZLA 2BDNL 2IAMB 1O7SA 2AABH 2JIXD 4YR6A 4ZMZA 3IXAB 3ZO0A 4EI5C 2OYMA 1RP9A 5IWLA 4XN8A 2C9SA 3V7MA 4MZ3A 1UZ8B 3BAXA 4M3HA 4KXBA 3BZ4B 2GEQA 1H0DB 1XF3B 5FK9A 1A7RH 3QZWB 5E8DH 1UT1A 3D2UA 4JDEB 2Y72A 1AXTH 2BW5A 2F74A 2GUOA 3M1BA 3MMEB 3OPZH 5JUEH 5JO5B 5BV7C 1XTMA 1I9JL 3OAYK 4I48B 4JFFA 4B5EA 1AO7D 4R97C 4TVPE 3WKMH 2ADFH 3ARTA 3P9WB 2ZJSH 4NM8H 3ZW3A 4E2OA 1PQZB 1M53A 3W11C 2DMGA 3QEQA 2CHXA 1JYXA 4FQIL 4NKDB 3MGTB 4ZOEA 2GJRA 4CDHA 5I73C 1VERA 4XNMB 4BXSV 4Q6IA 3N1GC 1MHCB 3MR9B 5IKCA 1TETH 4HUNB 4NKOA 4HZ1A 3VFUB 1FL3A 1U8HB 3SDCA 4HUKB 1HE8A 4PB0L 1EBPA 1OP5K 3NPZB 3B5GA 5K1JA 1MCWM 4G6AC 1JV5B 4FL4C 4BFKA 5EU5A 2Y23A 1JAEA 3IMUA 4N2OA 5K5YA 4L8CA 2MWCA 4GJTB 4L05A 2BC4B 5ABZA 3UG5A 4IKKA 4Z3TA 4FNRA 3L3OA 1T7WA 5DJ6B 4CJ0A 2IALA 2ZXCA 3I9GL 5K39B 1JFQL 3MBXL 4B9JA 3NGBB 1SYVA 3QFJD 1CGTA 3FB6A 3LAFA 4OIFA 3SKJL 3UZEA 3GXTA 5FFLA 3AU0A 3OHXB 32C2B 5DJYB 1HC1A 2VH5H 1YYLH 4LCWA 4QHNB 4KDVA 1WWBX 3MV8D 5DHVA 1JHLH 1YVLA 3C6LA 4S1DC 2YGPA 1J8SA 5SV4A 1TQCB 1JZHA 4G80A 4NN5B 2VLMD 4OM0H 1BW8A 3RI5F 5C2BH 3RWHB 1MREL 2F54A 4ZDHA 1F8TH 1LO3L 1T2QH 3N44F 4MSWA 5H4YA 5F1SA 1OSYA 3E80A 2DQUL 4KHTH 4BHUI 3G08B 3WE6B 9PCYA 2XRAH 4Y4HA 3EXLA 5CBEA 1NLBL 4MA1B 4N24A 5HYSA 2X70A 5IREA 2WNWA 2GHWB 5I0DA 1T03H 1TITA 3VH8G 1H3VA 3MZGB 4U6VL 1HCVA 5LLIC 4NYLB 2VZ1A 2HX7A 2D4FA 4ETQB 4DEWA 2HVJB 4I0PA 4LEXL 3BUTA 5AAMA 1YDPA 2ICEC 4GYBA 1LD9B 4HCGA 4EBQH 3TA3B 4N8CL 4NQSB 2F8IA 3TZVD 1EERB 2ZOUA 4RWYL 5CZKA 1KJMB 1AQHA 5L0QC 2X38A 1OCZB 2YKKA 2GBTA 4KRPD 3VFMB 4B50A 1XGTA 1HEHC 4WI9A 4Y19A 1HQRB 2HT4C 3P30H 4RGMC 3D3VD 5HGGS 4LVNB 5INDB 2E5EA 5GJSH 4L29B 4A1RA 5L2KD 1IKFL 2P80D 3TBVA 1J48A 1U95A 5E5MA 3VXUA 1QSFE 4DQAA 3NTCH 3K4AA 4K9EH 5F21B 1UB5B 5F9AC 1J0ZA 2HTKD 2KUTA 3ECVA 5FA3A 4RZCA 3SY0A 3Q1SL 4GSDL 4NSKA 3ZZLA 1U8LA 3QFDB 3U9PL 4MJIB 3VXTA 2KS0A 2XN1A 2YUWA 5EA0H 1RZ8A 3KAAA 1U8QB 5D1QE 3BZEA 1FZMB 4U1IB 1BF2A 4A2GA 4HAFA 4FXKA 4J2QA 1EO7A 4E9XA 3JWNG 3LZNA 4G6FB 3P4MB 5I74B 3NIFE 3VRJA 4OJEH 5DJXB 3FUIA 3WXWL 2G0KA 3DXAA 2P5EB 3ORJA 5DC0A 5DTFA 4FTVB 5GGTH 2A9ML 2LT9A 3HNTH 4Z3HA 1OGAB 1B2WL 3MRCA 1FYTD 3QUZD 1S7TB 4PV8B 1I7ZA 1I8IB 2EVFA 4OCRL 3SQOH 3VGBA 1J0KA 4IIQC 2CJUH 5KVDL 5EU6A 3HUJE 3EJTA 4WI7A 2BIIA 2F7PA 4FHJA 3SBWC 5D1QB 3ZHDA 4APQD 2CO1A 5L7XL 3QZLA 1IZKA 2Y2YA 4J4PD 3ZQWA 3VWKC 1QNZH 3EYQD 4APQC 5MERA 2JKIS 5JHDD 5AZEH 4RMUA 1WC7A 3UJJL 5IP4A 2ATKA 1AGEB 4YSCA 1U8KB 4G5AA 4TOYH 2QQQA 3IJSA 3FUMA 4NN6C 4R4FH 4Z7UA 4OFIA 2J71A 3IFNL 2QLYA 4MA7L 5F7NC 3NCCB 2NX5B 1FH5L 1RIHL 3HUJB 2PW2B 3FT3B 3PLYA 4AK2A 2VLRD 2IDFA 4JHVA 4Z7VE 2XG5B 3QYNA 3PGDB 3MFFA 3K2KA 2BSRB 5MEQA 3HR6A 3EIFA 2KZKA 2FBRA 2JI2A 3ULVE 3IBEA 4WO4B 4C4KT 2R2HB 3OGOE 2EXTA 3WTVA 4QR7A 1I1YB 4J3WA 1EX0A 3TONA 1W8NA 1KXVA 1TVHB 5FA4B 1KGCE 1QSEB 4BSJA 3D4ZA 2QR0A 4H26B 4AIZB 1KNOB 1DLHA 1ZT1B 3QEHA 1JPEA 1JL8A 4XCYA 1QVOA 3P3UA 3DECA 2WXMA 3DHUA 2YFNA 3O4OC 4UQIM 4Z7VB 2IBZX 4JVPA 4D0BA 4NKMB 1KGYE 4WWKB 4D94A 3AQYA 4YHML 1KTJA 1FFQA 3BP5A 2A6DB 4U1MB 4AYMC 1ZS8B 2IANA 2QSVA 2ZAHA 5EORL 3S3JA 3DJRA 4I3RL 3DSNA 3OR6B 4HZLA 5D2LE 4A7QA 5I8EB 1JNHB 4HJEA 5GGSA 1AHWC 4CSSA 1T1XA 2ILLA 3G6AA 4I1NB 1NICA 4NM4L 1ONQB 1XZ0B 2KLRA 4P46C 1LP9E 1Z7JA 2JKNA 2LLLA 1CIUA 2WWNA 4XPBH 4DFIA 4XPHL 3MLWL 3MLXL 4GQQA 4UTBH 1R3HB 1MCWW 4UT7L 2WIMA 1CXEA 3RIAF 3QQDB 3SQRA 3WE1A 2AXGB 3R1GH 4R7VA 5A43C 1ZTXE 2IH1A 5DZVA 2Y3AA 3CQQA 3TF7C 1KIUA 5BOZG 5IIEA 4N0CC 4XPTH 4XGZB 5E1IA 3IJYB 4EUPA 2AFNA 3O6FD 3S35L 1LP9B 4UTCA 1OXYA 3O8XC 2OMYB 4GKOA 3FU7B 2AXWA 2W80C 3E3QC 4FQXC 3FHEA 5IMOB 3O6FC 3IKCA 3KYAA 5GIRA 5E5RB 2X4NB 1H15B 3G5VA 2RA1A 3BJLA 1KBWA 2IH3A 1NCGA 3VW3H 5ETUA 2A77L 3NQIA 5C07A 4FQQA 3ZYIA 2ZCHL 3G6JF 2VXVH 2ZAGA 1NIFA 2HRPH 3H6JA 3L5WB 5IZ7A 5DUJA 2ITFA 3AG2B 2EIBA 3BCDA 4FXTA 3D0VB 4LAQH 1S7UA 1N5AB 4KJPC 2CBMA 1A6AA 3EGXA 4NNPH 1BIIB 2B1OA 3D25A 4OV6F 2R2BA 1I8MB 1EAJA 4JFZL 1Z9MA 1OTTD 4GAYA 3F7VB 2Q8AH 1MRDL 3L4CA 4BK5C 1YUKB 4RFNB 3GTNA 2EDBA 4TUJB 3CLFH 3CVHH 4OUUB 4YLBA 1OW0C 2DQEH 3VGAB 1B4RA 4J3OF 2OXGA 3K5RA 3T2OA 4AMKH 4YL4A 4MD5B 2RALA 1DUYA 3UJTL 1VFUA 2BSSA 2X4RB 3NIGF 2HRLA 4XT1C 1K8IA 1DBJH 2C34A 1X5ZA 4ZFFB 1NAKL 4YSQA 3OX8A 4PG9A 3L3DB 1P5UB 4X9FA 2XBTA 5T1KD 3MV7E 5AG8A 2C9QA 1ADQL 4AIEA 2ATAA 3ML9A 5TDOA 3LEVH 2F6AA 4IS6A 3MCKA 3O45A 4G42A 4G7VH 4LCVA 4UU9B 3TJPA 2JCWA 4ZXBB 4WKXA 2AV1B 4ZMPA 5FKAB 5CJXA 5DRWA 1XF4A 3I74A 4FQCL 4DUXA 4YAQB 1WAAA 3FONA 2EEXA 1PD1A 2Z91A 4FG2A 1OWWA 3UPRA 1KB5A 3L5XL 1FFNB 5CD5D 3LKSB 5DGRA 5DT1H 4CNIB 1FAIL 4QRPB 1I31A 2OI9B 1E6JH 4PJHA 5FO8B 3MLRH 3Q5TA 3N2JA 3QIBD 4CSPA 5FDWA 4HDIA 5FYLL 1M05A 3VX1A 3Q8FA 4ZX5A 5D4IA 3WNNA 5T1LA 1ZT7A 1AD0B 4HHWA 1Z1WA 1S9WA 4B0MM 4D0DA 4GH7B 1W72A 4ZFGH 1A1NA 1SBSH 3MKGA 4UIMB 1L0QA 1MQKH 3CFDB 1N19A 3Q6FB 5IVZA 1S7XA 1QMUA 2JXMA 3WJLA 5E8PA 2ADGA 1AD9A 4Z5RA 4L37B 1GW6A 2DQDH 4N0UB 1NBVL 1W6WA 3S5LG 4P2OC 1CLZL 4DERA 4RBPH 3VD7A 3ILPB 3KLHC 1JUFB 1AKJA 1YEKH 4F5CA 1CTOA 2SODB 3MOQA 4DIXA 5I24A 1GGIL 2I07B 2QVMA 4XO4A 2YAEA 4JM2B 4G7QB 4XP1L 4OLVH 1EAQA 2X1QA 3LQAH 3VXMB 3O4LA 4FKHA 4LPTA 3U30C 2BK8A 3OGCA 1ZHBA 3WIFA 3D0LB 1E4WL 3IDGB 1H5BA 3GIVB 3H9HB 2HG0A 1R3IL 1NCWH 1N59A 1U2CA 4ZFOL 1OD7A 1MRCL 3QA3B 3AW5A 3Q1EA 3JWDL 4AH2B 2X28A 4WW1B 5CZXC 2Z8RA 1BFSA 4Z7WE 1J7VR 4YBLB 3BOVA 3V10A 3VRIA 2PETA 1UGNA 3M45A 5K9OB 1FIGH 2Y24A 4MA8L 5DFTA 5F70A 1W8OA 5AW3B 2OYPA 3BKML 4G2AA 3QE5A 2VYRE 4AQ8C 4FJZA 3V4UL 1EDYA 5B3NA 3GHEH 3I3EA 4JM4H 1ZJBA 5FUCE 6FABH 5CGYC 1J87A 2EH8L 2X0UA 1JD9A 4HEPA 3RWEB 4TVUA 4HUXA 2JFCA 4LCYB 1DBKH 4OFQA 4LSQH 3J8F7 4GRMB 5LBSA 1L9MA 3DBXA 4ELKB 1EIBA 5BXFB 4NO0A 5TDNB 5AUMB 1S78C 5J6HA 1E3FA 4YWGH 4W1TA 1U8OA 1EJOL 5A2FA 1RL1A 4UILL 4OLEA 3UC0H 3OSVA 3V4PB 3QDJB 4EVNB 1OAKH 2YD0A 3LKQB 3CFQA 4M1GH 3L4TA 5CP3H 1LEGB 4LQFH 5EU4B 3VFGL 3W0WD 1WO2A 5I19H 3CHSA 4FNLL 3ESNA 5D4QA 3H2QA 3MGOB 2DH3A 4ZTOH 2XNAA 1GPOH 1NEPA 4KKZA 1T1WB 5D1XD 1LNUB 1JPSH 1SJXA 2R0LL 2X89A 5F89B 4B0MB 2XJKA 3LN5B 4FS0A 4LRIA 4M7ZC 4XBEL 4LMQI 3WJJC 2OL3A 4Q0XL 5CGTA 4NRXA 2A99A 5JOPD 3GSNL 3VM7A 4G7RB 5DUMH 5E2UH 3FB5A 4LGRB 3WIAA 1P6FA 2Q8BL 5DUPH 3VTTA 3WELA 5A3IC 1IM3A 4LPVA 3KWVA 4XCCL 1KBKA 5D7IA 1ED3A 3SZKC 2NXZC 5TPWH 2VDPH 2N0KA 3K8KA 3QWRD 4KBPA 4LCIL 4QWWC 5F9DC 1WGOA 1NGPH 4UB0L 12E8L 3TA4D 3HZMB 5EUOB 1FZKB 5CP7A 4V1DB 4NENA 1FNGB 1Q9LB 4MS8D 4YSSA 3W2DH 3VD4A 3GIZH 1A4CA 2EH7H 2JKWA 5EC2A 3ZUCA 5IGXH 2JKTM 5I66A 1G7LA 2Z4QB 4PJIA 5JIKA 3EYOB 4NC1E 2WOYA 4Q9QH 3G6JE 1KGXA 3ENEA 5FUOH 2FRGP 1OAZH 2BZCA 2CIKA 4WCYH 4LVHB 4BH8A 1IL1A 3NZHL 4PB9L 3LNIA 4QRRE 4PY7B 1BREA 3L45A 4GBXB 4Y9EA 5KYUB 1G1CA 4HCRH 3VXRD 2H32B 4NQXA 5E6SB 3CFEB 3TIDB 4JKLA 4MYPA 3NYKA 3KHQA 1OAUL 5HHOD 5LAXB 4UI2A 6TAAA 4GG6F 4M8RA 3HHSA 1A6TA 3GBDA 2BWQA 1R5VB 2Z31B 3QHTC 4OR1A 5JIPA 3T0EA 1AFVH 3T3MF 3FCUB 4TSCH 3VVVA 3SDDA 3S36H 4CC4C 3UTZB 2IEPA 1ADWA 5FOBA 1EAOA 5D1ZA 5DJ2A 3SGKC 5FM4A 4WTZA 1EHAA 3L48A 2DJUA 4GXVL 1EPFA 1CD8A 4IK6A 2BRQA 5AVWB 3BKCH 4L3FA 4PJBB 4EEEA 1QRNA 4XNZB 5IOPB 5EEXA 5DRZB 5GGRA 1X5AA 5HHNB 1MRFL 1U8MA 1F3RB 3NJKA 2WLKA 4AZ8A 3BE1H 5DJCA 2Q76A 4PGBA 4P23B 4X5RA 2J72A 4KNSA 1EHLL 5BZWA 3N3EA 1KPUA 5IF0B 3MKKA 4PWGA 1MCOL 1N6QL 2J88H 3AITA 3V0WL 3O2DH 1PLBA 4GS7C 4OZHA 4NZJA 3WLWC 3MPCA 2ZOOA 4NEHB 3BPNC 2FUTA 1AR1D 3DPDA 3NSDA 2CGYA 2J73A 3VSTA 1YEJH 2BIQA 2LR4A 1F6AA 2XWDA 5KSVB 4XMPH 3ZRCC 7CGTA 5TK4A 2AEPH 4ZSOA 2H8PA 3H1ZA 3QDAA 3BZFA 3MJ7A 3GMMA 3VFSB 5FLVA 2VISB 3IMTA 3FO0L 3N85H 2O5ZH 3FO2B 1VPOL 1NAMA 2RIKA 2V5RA 4XMKH 3JTSA 4X0NA 3AWGA 4JKPH 5EBLA 2WCSA 2RJMA 2X9WA 4EI5B 4PD4J 1HIMH 3D4YA 4XMWA 3ZT6A 3ZKNC 4GUPA 1RURH 2P44B 4WW2A 3LH8A 3W9DB 1TTRA 2J2ZB 2YQ3A 4M1DH 3Q2NA 1UH4A 1BLNB 4YE4H 2ZD0A 4O02B 3QJOA 3SBQA 2ZG2A 1DLFH 5BV7B 2IPKA 4P2RD 4L3ED 5F96H 4NI3A 4R97B 4FA8A 5LWYH 4GFTB 5E70A 3UPAA 2I9TA 5EZOH 4W4OC 1PS3A 4A66A 1E6OL 3NJVA 2XACC 2NY4D 5D7LD 4FFWC 4ODWB 4OZFG 4G8IA 4OQTA 3TO4C 4G6KL 4AYBA 5I73B 3DK2A 4ZO6A 3QPQC 4Y9FA 5HGDB 2AKRA 1XGUA 2V7NA 4L1LA 5ACLA 1XD0A 5JORA 2IDUA 4QAMB 4UAOC 5C3LD 4YO0B 1T20B 1HXKA 1UM4L 4HJJH 1AO7A 4FL4B 5IR1A 3CQPA 2PCFA 1A7BA 4DCQB 4KZDL 2XN2A 3BN9C 4AM0A 3SJVB 4MMYA 3D1MC 1X5XA 4ETYA 3OAZK 3OR7A 4XOCA 2LAGB 3IDXH 4A37A 3HG4A 4IBUA 3JV4A 1EUTA 3RAJL 3N55A 4OD2A 3LYRA 4HYTB 2CR0A 3ULSB 1ESOA 3FQNB 5EIIB 1WFMA 4WK2B 1MF2H 3PL6C 4JZOA 5AVRB 3KM1A 3VSUA 4GQ9L 2Y0SA 5HJ3A 4YGAB 1WBXA 1TJMA 5DWPA 1KEML 2WLIA 4BH7B 2BVTA 2GVYA 1LQBC 4K5PA 4B3EA 4A7UA 4UV4L 3N0PB 1XMEB 4IBYA 1ZVHA 2WXNA 5C0GB 3CU7A 3ZHFA 3LKRA 3FTUA 1MNUL 4DWHA 1HVXA 1Z9PA 2JV6A 3SIKA 4RIRB 4QT5A 1BBJA 3WTTA 4OI8A 4XCNA 1I1AD 2IMNA 3QFJA 2PYEB 4L48A 1LEKA 1L9OA 1NCHA 3QXDA 5EOTB 2JQAA 1SFHA 4RA3A 5B3JE 2ED6A 2HRGA 2IO5A 2DLFH 2P7TB 4PMEA 2FDBP 1XGYL 3MV8A 1NCJA 4F33A 1M3JA 1QSZA 2ICEB 3U48A 3EYUL 5KS9A 3EOTL 3MO1A 4WUKH 5J9PB 1AOZA 3I02B 4HF5L 1FCGA 3DUSA 3EF4A 4LP5A 4O5LL 4F7TB 5F1NB 3EDKA 5TQ0L 1MHPH 2DW5A 5D9SB 1AZVA 1OAXL 3L3HA 4PLKD 4PN6A 1AQDB 1QI4A 3VCLA 1P7QD 4YDZA 2A74B 2CA4A 2WCPA 3B37A 4R7NA 4OGZA 2EDDA 4F92B 1WZMA 2FQFA 3VACA 2BNRB 3OTTA 4JG1H 3DTXA 1KCRH 5KVGL 4JR9L 1AXIB 5AW6B 2X0WA 1COBA 2Y1YA 3QXUA 5CLZA 3MRKA 4CBZA 3HS0A 2LVCA 4UMGA 1T04A 4OQ1A 1FSKC 3TZVA 3OLEA 4ODSL 3OKMA 2HG5A 4D8OA 1U8NB 1TPXC 4KK5D 3V5DB 1XL4A 2CGRH 2YBRA 3NABH 3QH3A 1CF8L 1NH6A 1OAJA 1AS7A 3D3VA 3KXFB 4LO9A 4ZW8A 5IY5B 1BBDH 4GG6E 1YJDH 3GUFA 4M1CD 3ARED 5L2KA 1BZEA 3T1FB 2P80A 1J9QA 4Z76A 4R7DB 3WG7B 3WLBB 4EOWL 3X3GH 1FNLA 1KCKA 3ZT5A 3CFCH 5H2BB 5FYJU 4E41D 1FFOB 1IC0A 4ANXA 5AOZA 5I26A 2N4IA 1NWPA 2RACA 4ES8A 1EHNA 2KI6A 1T5XA 1FGNL 4C56D 3DOSB 5I15H 5DHYB 3KPLA 5D70L 3UBXI 3VFNA 1P1VA 1FPTH 5IQNA 2XQBL 1CD0A 1R5IA 2VQTA 3QIWB 3VWKB 1NGYB 3IMVA 3NRFA 2UYLB 4LGPB 3SGJA 3O41A 4KFZC 5I17B 1BQ5A 3UERA 1YC7A 1ZGLP 1KJ3L 1U6AL 2ITCB 2XKUA 1RMFL 1NUGA 5BVPL 4HSQA 5E8NB 3APDA 4URKA 2BNQE 4IIQA 4KV5F 5DO2D 1FYTA 1GW0A 3QUZA 5H37A 2VMFA 3QCUH 3SBWA 1UURA 4I77L 5IHLB 4LHUD 3KCPB 4M6OL 2GB2A 4U0RB 4P5RA 5E4AA 1A4KA 5E94A 5I0ZA 3MNWB 3RNKB 3VTAA 4C58B 4APQA 5EN3A 3VA2C 4A2FA 1T22B 1YECL 4J4PA 4NBZB 4ANWA 1UADC 5AZ2H 5FCUH 2Z7ZA 1UD6A 5ALCL 1IJ9A 5JHDA 5AW2B 3CH8A 5DJ0A 1QTPA 5F6HJ 2H1XA 2ESVE 1T6VN 4PSRA 3PWNA 4MNQE 2VDKH 4OF0A 1EFQA 1VZHA 3GNML 4ZX6A 3MCLL 3JVGC 4IU2A 4P9HL 3WIHA 4BCYA 3LZQA 2J12B 1MXDA 1OANA 4GSRA 4IU3A 2VLRA 1EH9A 3APFA 3EFFB 3JT2A 5F6HI 5ANME 4IBTA 4Y9BA 2WJ5A 2XQ0A 2OV0A 1JGVH 1MJ8L 3IXTA 1T1ZB 5IV2A 2F58L 4XVJH 2WWMC 2W0FB 1D6EA 3MLUH 3DDFA 3WJMA 1BMZA 5LUMA 1S5HA 4MNQB 4X6FB 1AHWB 4F24A 3V6BR 5B1JA 3QUYD 3UPCA 2KC0A 3L4WA 4KRNA 4QCIB 4P46B 2DWSA 4MB5A 1T5WA 5SX4I 3T77B 1C8QA 4PJ9C 3MUY1 4XVTL 2JI3A 5IQ9B 4DW2H 1G5AA 1X6NA 3NFNB 1T5KA 3FRUB 4L3CB 2Y1ZA 1T0NB 1JS4A 3X1BA 2O61A 2X4OA 4ZNEE 5IB3A 2W94A 3QJRB 4X9BA 2V7HA 5E08H 4C4BA 2WXOA 5FPIA 2VQ1B 1T21B 3CFJB 1IC4H 3GJEA 1XR9A 1HOCA 4RLDA 1FJ1A 3SPIA 1U9KA 2WXJA 3OKOA 4TNWF 2DLGA 5ICXB 3GI8L 1KJ2L 3HLAB 4LSRL 4DKFL 4F9LC 4ISVA 3V2AR 3O8XB 4NWTH 4KVCL 3QDHA 5J3HC 4AITA 4FQXB 3MRQA 3FO1B 4OT1H 2O1AA 3TIEB 5HHPB 1TG8A 4M7LL 1RZJL 4F8PA 3CX2A 3Q01A 3WTWA 3A6CL 1PVHA 2DF3A 1MJJA 2Z64C 1RD6A 5EH1A 1FL6B 1JVOA 2AANA 4X5XB 1AC6A 2HFGH 4YS4A 1IAOA 4KTDL 3MAWA 1FFRA 5E9NA 5GRYA 1R4XA 3O6FA 3VX0A 1URZA 3CDZA 4JZJA 4YSOA 3CFUA 1NEZA 4GKLA 3WEAA 1NAML 2J4WH 1CBVH 5KN5B 3U4BL 1JZJA 2W60B 4OJFH 2YPLD 3CH1A 1HZHL 3KPPB 3OLIA 3MREB 4UNUA 4BELD 4FQHA 3V6OA 3THMH 3ZDZB 1SVBA 4F7CB 2MCPL 4I3SH 3F7PC 1P4LA 3HPJA 4W9JC 2R39A 2VQ4A 3BXNB 1RUQL 1BVNP 3QJZA 5JW4M 1HDMB 1MFDL 1YEGL 2WXGA 3BPCB 4YBQD 3TBWB 4AUYA 3B5TA 43CAA 1N3NB 1CG9A 5IJVB 2WLLA 1OW0A 3I75A 3KPOA 4OCXL 1XL6A 3VI3E 3E1F1 2F53E 3U36B 1M57B 5I1KL 1QP1A 2VE6A 4JFUA 2FEEI 2VJXA 1AZZC 1ILUA 4EZMA 3IRCA 4NLAA 4OQTL 4Z9KB 4LF3B 4LSVH 3FFCD 2EVIA 3QORB 3MNMA 1HXYB 3QR1A 3X11A 1MN4A 3DRQA 4FYQA 2NR6D 4UQCA 4A63A 2DBLL 2ENSA 3IKKA 3M8OH 3O3BA 3EJJX 4HIIB 4KKBD 5AKVA 4BZ1A 4GKNB 3U2SB 1N0XL 1WSST 3BVXA 4IBSA 4R3SB 5D2NC 1QW8A 4JFXA 5T1KA 3ZDYF 1QR1B 1FBIL 5L4JA 3VI3B 3F6IA 4OM1L 2Z8WC 1A9BB 1CD1A 5KVDE 2IBGA 4OBSA 1C7TA 1GMEA 1H6TA 5E00A 4HPOH 5FKPB 3PXJA 3L3JB 3BEWB 1BYOA 1KCUL 5JLZB 1SJHB 4QY8A 5J12C 5CILH 2X9YA 3L3IA 1NIBA 4K9JA 4X7TA 4PBWD 4P2OB 3APCA 1SVZA 4O2CB 3FT4B 3QIBA 2IOOA 1NFDA 1I3RB 2E6JA 2PWFA 3P4NA 5GQBA 3UTTD 2RQEA 3U30B 1KBGH 3O2VL 1KDJA 2BIPA 3HBPA 4H7VA 1Z9LA 2VABB 1PY4A 1YQVH 5CJQL 4Q2ZB 2ZWNA 3O6LH 3F65A 4MMXA 3MBED 3JWOH 1JFHA 3UACA 3K0WA 3X3FH 1A4JB 3BYYA 3KPNA 4GRWB 1E3XA 4M6NH 2EADA 5F88A 2I9LA 1XSKA 2QKSA 2B59A 2B1HH 3GSRB 3L4YA 5ILTH 2XTJD 1CR9L 4GUQA 2ICES 4M56A 3GSXA 3D39E 1MHEA 2P24B 1SY6H 3RIFF 2G2RB 1B88A 1G6RL 5I5JA 1A3LH 1IFHL 1YAZA 3QXVA 3LPWA 2XWJB 3SGEI 5AWNH 2HTLC 1U93B 4LEOA 5I28A 4R2GC 4OGYH 5GGUA 4K7PX 4KO6A 5DK3A 2CIIB 2OMUB 3F2LA 5AW1B 3CPLB 3OZ9H 1EXGA 3VO0A 4KJWD 4E0RB 2AJSH 3W9EB 2KDYA 1FI8C 1S7QB 3CSYB 5H35B 1XR8A 5E7BA 4G1MB 1IFRA 4YQXH 3WD5L 4ZUTA 5F1IB 1QWNA 2DS4A 2IPUG 1E8YA 1CE1L 5FO7B 4BDVB 5AW0B 3P3TA 1FO0A 1F02I 4N1EA 5GPRA 3UGEA 1ZRUA 2J8UA 3HG5A 1G9MH 4KGJA 1XXDC 1A5FH 4RAUA 1MW2A 4N2BA 5ITBH 4ZZFA 3LKNA 3OAWA 3HC2A 1XV8A 5DMJB 4P5MA 2D0GA 1XB8A 2BW4A 5IK3A 5SWZB 2CXKA 5F0PB 1NCAL 1MNNA 2Y07L 4JMNA 3JV5A 4MGXA 2VDLL 4PJ5E 1M7DB 2OTUB 3FCSA 3LRLA 4KKQA 3CC5B 3JV0A 4L1SA 4M7ZB 4BKSC 4YHOL 4DNLA 1NGQH 5T5FA 1L5GA 2LHAA 4Q56A 3DX8B 1HILB 1BOGA 4PIBA 2HPTA 2E7DA 4OCWL 3W0WA 4HISA 4GIOA 2WP3T 2V5YA 4Z7UF 2Z92B 1ZK5A 3AG3B 1T4KB 3LKOB 3AQDA 2NXZB 4KKPA 1WP6A 3W38A 1RY7B 4Z7OB 4AX3A 1QBLH 1NLDL 5ID0B 1S7RA 4RMWA 4DZ8A 2IBZY 4FAAB 4HULB 3MXVL 5D1XA 4W9IC 1A6UH 3LEYH 4NQEE 1QPXA 5JHLL 1EEYA 4NO2B 5IFAH 4PJEA 5HHVL 4HD5A 3EZ8A 5KVEL 4U6YA 5BUGA 5FYKH 1RZKC 1DCEA 4Y5YA 2EACA 1WS8A 1RERA 2EC9T 3FRPB 3STLA 2ENQA 4OLWL 3NH7H 3V0VB 4AYID 1G7PB 4XPGH 5D96C 4U1SA 3QWRA 4U2YA 5C9JB 1T7XA 2XQYA 4G8AC 5FS5A 4K3HA 3UZVA 3NFPA 2IAAC 1B3IA 4JFFE 5GRJH 3V52L 3EJZC 3X17A 1IGML 2CRIA 3BO8B 4GO6B 2A9BA 1ECYA 2EQDA 2WD0A 1R0AL 4L0YA 2J6EH 1WWWX 2QHRL 3CHRA 3T8VA 3QEQE 3N43B 4IM8A 4S10A 3L16A 2ZNXA 3BVUA 4MQXD 4IRJD 3E1ZA 1S9YB 2BERA 1G9NL 2IQAB 1CGXA 5ESVB 1MFBH 3KVDD 4JFOB 4ORGB 3VXRA 3LIUA 5ITFB 4DGYH 3KLQA 3KLAA 4I0KA 4WKZA 5J6SA 3MNVB 1RU9L 3MOBL 3BH8A 3WFEL 5FYLE 5HHOA 1JV2A 1OP4A 5FEBA 4AT6B 1UATA 2D9QB 1OF0A 2A6IA 4ZFQA 4CC4A 2IDQA 1U2YA 2OTWB 3NA9H 5T5NF 4NZ8A 3UP6A 4S1SL 1RULH 5EWIL 1M6OA 2MNWA 2VLLA 1U58A 2H0FA 4Y8AA 2YJLA 1T1YA 1MPAL 2VR8A 3V8OA 1CDYA 4GS7B 2UXFA 1N7ML 1FAKT 1HSBB 1RVFL 1ZXKA 4XOAA 4ZQTA 1CMOA 1YO4A 2C7UA 3BPNB 2XZCL 5I8CB 2QTEA 1N5YL 4P05A 1L6PA 1RUML 4LKCB 4BE6A 1PGRB 2BHUA 4LCWE 3WEXB 1JN6B 4FFVC 2WSKA 3S97C 4CW1B 3BWSA 1Z6JT 4GI9A 4LLYB 4FQPA 1O75A 1ES0B 2HVKA 3NCJL 1H9VA 3RA7L 3WTYA 1X5IA 3DRTB 4NNXB 4WHCA 3BUIA 2F54E 1GJUA 5FYJD 2HFEB 2SEBB 1IEAA 4ZMLA 2NCEA 2XETA 5I76B 3F7YB 3KGUA 4W6WB 1KLUB 3BSZL 4HJIA 3UZQA 1KEGH 4OLZL 1IQWL 5E6RB 1G1YA 1T0OA 3EDEA 4XMUA 2C4FU 1ITCA 2P48B 3ZTEA 4P57B 4RAVB 2HVBA 1L9PA 1O7VA 4HHAB 3PJLA 3FYEB 1T3FA 1UM6H 5DK2A 2FO4B 4N3TA 4KXAA 1IC5L 1FVEB 3QNZB 3MN8A 3NIDF 1BGXH 2ADIB 1YPZA 3LRMA 4WEEA 3WNJA 3MZTA 5ADPH 4QYAA 3FQUB 3CUPB 2OMTB 3AXHA 1OZTG 4LFHG 5I1EL 3FN9A 4M4RA 3RVUC 3HMWL 2EO1A 3B7TA 1UTDA 5FUZH 3RWFA 2MOGA 3B6SA 3VJ6A 2Y6SD 1JI1A 3JZYA 2GY5A 3LQZB 1RIUH 2ITDB 3TO4B 3GEWB 4R0LA 4ZFOB 2ICWA 3QPXH 3Q05A 3CXDH 4LQ1A 1OM3H 5INCA 2N0MA 1OKEA 2XZQH 3HI1A 4PJ7B 2WAHA 4AKPA 3QJVB 1ZA6A 5E2VH 3SDXA 5IHUH 2QL1A 3T4YB 4UAOB 5I30L 2HLAA 3VXUE 1SNRA 4W4OA 4KKCD 4L3EA 4P2RA 3G9AB 1WZAA 3FTGB 2K70A 1ACCA 3TNMA 1E2VA 4PJHF 4E5XB 2Y5EA 4K5MA 3I2CH 3WDHA 4G1EB 3A4AA 5EOQL 1J1PL 3P54A 5D7LA 4QXUH 3C8DA 3F12A 5GRUL 3ARRA 3VXQA 1SXAA 2COQA 3AC0A 5FGRA 4ELMA 2GJ6B 1Z0NA 3GM0A 3N91A 1GCYA 4KJYB 1M71B 1G7JA 1KYOJ 3T0XA 3QZWG 1UGKA 3QG7H 1P4BL 4OF8A 4LOUC 1TZIB 3DXAE 4A7GA 1J1OH 3PL6B 3GGWB 1UCBH 4LSUL 3BX7C 3C6SA 4MD0A 2PWHA 4KK6C 1Z5LA 3P4LA 2Y7LA 5IW1B 4UZSA 2WXRA 5LBGA 4A6YA 2PTVA 2D31A 5ADOL 1JK8B 4OD3H 5EU6E 2FH6A 3UYRL 4G8FB 1PG7L 4M02A 4IOFD 5E8OB 4S0TD 1QEXA 3OAYH 4UT9H 4OGXL 4BFEA 4LK4A 2LU3A 5C09D 4XMVA 1GC1C 2JELH 4LZKA 1F4WL 3U9UA 2CNYA 3AS1A 1IE5A 1CK0H 2IH8A 1L9RA 4GINA 1DQLH 1JF1A 2ATPB 3EJSA 2R2EA 3GSNB 4NIYE 2R27A 2F8VA 2AJZA 3C5ZD 3LPPA 3HCVB 1OE1A 5DVPA 3S98A 3B5HA 2BVPB 1G7MB 3D9AH 3INUH 4M03A 1V3LA 4X6BA 4D9LH 2E4FA 4QOKD 1T4WA 3C5ZC 2HRHA 1I3GH 5CEXA 1SVCP 1OP5H 2I26N 1A7OL 1X5MA 2A6JA 4Z0XA 1I1AA 5HYQB 3WOVA 4ABQA 4FZEH 2AK1H 4ZK8A 4GKSA 3V4PH 4C57C 4LSPL 2E9JA 3EH1A 3LB6C 3PWLA 3LHPL 3QJXA 2WQUA 1IGCH 4IKIA 5DC2A 2CRZA 3HE7D 3RX5A 4P4RA 4X42A 2PPFA 4NO5B 1EHKB 3E8UH 2DD8L 5F7MC 4F2MB 2FJGB 2HKHH 4OU3A 3HAEB 1FSKB 3LNDA 4Z7AA 3KEDA 1OCWH 4FI6A 4N9OB 1ZS2A 2H9GB 1ZGLM 1P7QA 4ZX3A 1WITA 4HJ0D 1IBZA 4LRNH 2IANE 2NSQA 4DN3L 3SE4A 1R5WA 1CLYH 1XSJA 5I6OA 4X7FC 3GKWL 5C0IB 1Y1UA 4ONFL 4WU5A 1FO0L 1IGTB 4LLVA 2G30A 4P07A 4X7SL 1RUAL 4RRPG 3QW9A 2AAAA 4J1UB 3ABGA 1LK2A 1CQKA 4FFZA 3VNYA 5LB1A 1MCHA 1XWVA 3W39B 3CVIL 1LXMA 5EN2A 2QPFA 3P9MB 4U3CA 5T3XD 2X44D 3MX0A 4FJYA 2GJZB 4XOEA 3HZKB 4DP6X 1WICA 5IMKA 2WOBA 5D7IF 2NLJA 5H94B 1KJVA 2JLLA 1AGFB 4Q7DA 1V3KA 3VGGA 5EF0A 5IJCC 3W81A 3AREA 4LESA 2IWGA 4F7MB 1I8UA 4MTMA 5IB5A 5DURD 3UTQA 5IUCA 3WTXA 4FQ2L 5EZIL 1HXMB 4ZRGA 1ETZB 3T5WA 5T5FL 3FQWA 3BKYH 1BQHA 4AJYV 2R0WL 4UT6A 4XXWC 4MNGE 1W0WA 3ILQD 4E41A 1RJZA 2OCCB 1QHOA 2ZQKA 1BVOA 4DO6A 1PIFA 4EKXA 2H32H 2WVSA 3BQUD 3QCTL 5EOCH 3D69A 1UWYA 2O6FA 5LN4A 4C56A 2GBUA 5C07E 1KCVL 4L5FL 1KXQA 2NUPB 2ZUWA 1BX2B 4UYQA 5K59F 4RGNC 3WNKA 5EEZA 1F41A 3OWRA 3UG4A 4M93C 3KGRA 3KDMA 2DM7A 4K8RL 3UIZA 1NGZA 3RGVC 2DJ4A 2OW7A 4WENB 4MNGB 5C0ND 1QFWI 3GMLA 4Y89A 5I1AA 1NUDA 4N6RB 1IGYB 3RURA 4FG4A 4PJAA 3FTSA 4RWHA 5C0NC 1C16B 2QDVA 5ICZA 2BP0A 2CKBL 5CBAA 1JZ7A 3MRGB 4U1JA 1C1EH 3D33A 3S48A 4APXB 2DBJA 4K55A 4Y2OA 3WHE0 4KVPA 5E1HB 1E42A 4M5SA 4P3WA 1JYVA 4JFEB 4XH2B 3RZCD 5JQ6L 1OPGL 3HI5H 1FLRH 1ZGLB 2YK1L 5BRQA 2AS5M 3RVWD 3GFUA 2GSMB 1MJ7H 1U8IA 1UWGL 4QJ3B 3RZCC 2VN6A 4PJ9B 1ZVNA 1BCIA 1DE4B 3G04B 1UXSB 4H1LB 2WAQA 4FQLL 4JRXD 5B1CA 4JK0D 1ZLSL 1EGJL 4UQDA 3CZSA 3WN5C 1WAAE 1S7VA 5ES4B 2AEOA 4JDTH 5MP6H 4ODVH 5EZPA 2RBLA 3PWJB 4XNUL 5DMIL 2K6WA 1W16A 4PJHE 2HT2D 2ZWLT 1QPKA 3GK8L 3QUYA 4HIJA 3HPLB 3V5HB 1DO5A 4OVUA 3VYOA 1VEOA 3IDMA 4V2BA 3BDXA 2J55A 4XN9A 3SE8L 1Z0MA 3UYPB 4GRLD 3CLEL 4IHOB 4TUOA 1W9XA 4F7EA 4TTDD 2ZG1A 4GIAA 5CUSL 1FNEB 5LAPA 2VAJA 1DJZA 1JXKA 4HJ1A 5GRZA 2AJUL 5LGJB 2E9WA 4M62L 3FDWA 1TZGH 1A4BA 1QI5A 4LSTL 4WI0A 5BV7H 2ALWA 2VDQL 5HGHA 2Y7QB 4W9DC 1VRSA 3MRNB 3V0EA 3E6HA 1N4XH 5CF3A 1R3KA 2JB6A 4UQ2A 5GRXG 4WW2F 4EIGB 4F5CE 1Q9OA 2K1MA 1YY8A 1Y0LA 3BLKA 3OLGA 2ZAIA 2OTPA 3GMQB 4O58H 1SQMA 4F80A 1DQKA 4IEFA 3WGUB 3O4LE 2XBZA 2R69A 1INDL 5IB1B 4NHUB 4ANUA 2XTLA 3HMXA 5HSFA 3KLLA 3F58L 4PREA 5G4NA 4JPIA 1N8ZB 4D9RD 1RPKA 1GAFL 1PDKA 5CN2A 3PAYA 5IVXA 5KANI 1BEYH 3ASOB 3EO9H 1UB6B 3NSJA 4F3FB 1MCRA 5ECGA 2D7TL 3BWZA 2DH2A 1J86A 3VD1A 2OFQA 1YUHA 4YLCA 5DZJA 5E9DB 4NWUH 3TYFA 1SJVA 2PO6C 3PQYD 5HYIA 2HCZX 5DLMH 3EO0B 3QG6A 4IGBD 2YPLA 3GUTA 2HMID 1FZJB 4XP5L 4U3SB 1QFPA 1ZY9A 4MXQC 4PS4L 4X5QA 3TN0B 2BHZA 3PGFL 4HUWA 4YOKA 2VXQH 4PGCB 3TXAA 3I6LE 4AEIL 4F91B 3RWGB 3MRMB 2VMJA 1N10A 5IT2H 1WDAA 4HUVA 2G5BA 1Q0YL 2L7UA 3TH4T 5FDYA 3IPEA 5D2NB 1A21A 2UV3A 1UQSA 4M48H 3EFDL 3NESA 4QHMB 5CU9A 3EG9A 5B7MA 4WDIA 4YX2L 4N20A 4WFEE 4AVJA 4HWZB 3H0TA 1ETA1 4CVUA 3VXNB 4DF9A 4NZTL 3FFCA 1EV2E 1DVFD 2BFVL 2BWDA 3L81A 3OXSA 5J12B 3UBFA 3ZPDA 4JHAH 4CA4A 4HKXA 3CN2A 4OZGA 4KFMA 3K6IA 4AL8C 4LNRA 4MJJA 1USZA 1TTFA 3IDIB 3QDMB 4HJUA 1TQBC 3C08L 3U0TA 4XNXL 2APWA 3JUZA 2AQPA 2J1KA 3QT2A 1UKSA 3IAPA 3IDJB 2FSEB 3ARYA 2JKLA 3O3AB 1WH0A 4LXFA 4G5ZL 4X8CA 2H41A 1UXLA 1H8SA 1FLTX 2NY7L 3CC1A 4JQVC 1A3RH 4JY5H 4C4KO 4P5TB 1SHWA 3SYQA 1MFMA 1IGFH 1T7YA 1V05A 2BP3A 3HNSH 3UADA 2JKSA 4KX8A 2R8SH 3ATAA 2W95A 4IJ3C 2DZEA 3VB9A 5KBNC 2E46A 4P3CL 1A8JH 4CSZA 4NX0A 2AK4A 3N50A 4XMLH 5GISH 2X3CA 1WIOA 4MVBD 3KJ4C 4JFQA 3KL3A 3SDAD 3W5NA 3IEAA 2NY1C 4PJIE 2Y5TA 1MVUB 2GFBA 3D18B 4DP5X 4KXDA 3D4GA 3TVMC 5KTEL 1NA8A 4BA0A 4B9PA 4A39A 1FG9C 1TCRB 4KJQD 3Q8AA 3LH2L 4POZD 4R2GB 5K59E 5DFAA 3AACA 4MA3A 3BLPX 3COOA 1MCFA 1F11A 4L8SB 4PRAA 3ZTJH 2D7OA 4BHUA 3INOA 4POZC 4R6UA 1HZLA 3L3KB 3QHFL 4KROC 4FP8H 4UIKH 5JOFB 3SKOB 3X12A 2LW3A 1A22B 3O6KH 5I8KH 4ZZKA 3B1TA 4K8RC 5C8JB 2EDNA 3T3PB 2DOCA 2EXYD 4JX0A 4M3KB 3BRGC 4W9HC 3WL9B 2CK0H 1TJHL 5E4OA 3CZFB 4RFOL 1EEUA 4PCSA 1QLEL 4QRUB 3HBGA 3LV3A 1ZEAH 3OKNB 2VWEC 4JANB 3BKJL 4L4VB 2R29A 1MJUH 3JUYA 3SKMB 4X9IA 1J1XL 5AD0B 3QIUD 1NCBL 2WWKT 3AS3A 4ZFZA 1PJ9A 1QRNE 4DTGH 1XAKA 3U82B 5EDSA 1TTUA 1KT2A 1EO8H 3CVBA 4QTIH 5FHAH 5KAQG 5SWSD 3FTWA 3MLZH 3MUHL 1LO2H 1EZLA 3EGDB 1MG2C 4KWUA 5E6ID 4X98B 2YLHA 1OGTB 4HLEA 1HQ4A 2CO7A 2OCFD 2W0LA 3CU1A 3KJ6H 2EIMB 1F90H 5E6IC 1V10A 4KNTA 4OZHE 3NCBB 2VSDA 3HFFA 4AEHL 2VKXA 4XB3A 5IJKC 4W9EC 4HMEA 4WFFD 3QZNA 1ZLWK 3TYGH 1QASA 4MQSB 1R3JA 2E76C 2QELA 4WTQA 3TBSA 4YHLL 5LQBH 2P26A 3QI9B 2V5SA 3IU3A 2BM3A 2X3BA 3BJ91 3H2PA 1NGXA 3IFPB 4ZSOE 2CUHA 4E9RA 4MFHA 2BDNH 4JJ5A 1KJ2B 3BISA 3NAAL 4FFYA 1BV8A 1HHGB 1NSNH 2BY3A 1A9EA 4CU6A 4OIIL 1LO0L 2BVYA 4OKVB 3WUZA 1JDAA 3EOAB 4NP9A 1JIBA 1YEEL 3DHJA 3FH5A 5TJWK 4ENZA 4OSUL 4L4TE 5CEZL 1TQVA 4F9PC 3EOYG 4YHIB 1A6VL 1B4TA 2L3BA 4KTEH 3PUUA 4ZO8A 5GS0C 1SF5A 4NQDD 3U46B 5C6TL 1PAMA 5D96B 1FC1A 1I9JH 3QDGE 1B9ZA 3ZYZA 2FR4A 2JJWA 1SHMA 3VXOA 3RUGA 3ZQ9A 2FATH 3IU4H 3HB3C 5FFOA 1RZFL 2WVVB 4JO1L 4E9WA 3QJFB 3P11H 3LNHA 2B77A 1Z3GL 4IBVA 4JL1A 2GYSA 2CO6A 5FWRA 3BWUC 4L4TB 1XGPA 3MU3A 4PD4K 1ZSDB 4RH4A 2YAOA 1L3WA 3RTQD 5IEHA 1NKOA 2BVUA 1VESA 4X5PA 4Z8FL 3QDGB 1XEDA 4MJ2A 4H8WL 5BVJB 2Y3NA 2OULB 5C6WH 4M43L 3EH4B 3MRFA 4FHBD 1YNLL 4KAQL 2YAFA 3LZFH 2Q9OA 4H20H 3LXBA 1UD2A 5DRNA 3HE6C 3I9GH 1JFQH 3B2VH 1MI5B 2IDSA 4P3DB 1C08A 2JIXB 1XH2A 4K71C 3SKJH 3FQTB 1I7RA 3ZLQC 2YEZB