4NUMA

Crystal structure of mouse n-cadherin ec1-2 a78si92m
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
215
structure length
215
Chain Sequence
b'DWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIARFHLRSHAVDINGNQVENPMDIVINVIDMNDNRPEFLHQVWNGSVPEGSKPGTYVMTVTAIDADDPNALNGMLRYRILSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTYGLSNTATAVITVTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cadherin-2
publication title Structural and energetic determinants of adhesive binding specificity in type I cadherins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 44
structure length 215
sequence length 215
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4numA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4numA02
3QRBA 3LNHA 2WD0A 4XXWA 4AQ8C 2A4EA 4APXB 4ZMLA 5JYLA 3FF8A 3MVSA 3UBGA 1ZVNA 4AXWB 4ZMZA 3LNFA 4ZTEA 5CO1A 2OMYB 4ZMQA 2OMUB 2WCPA 2YQGA 3PPEA 3LNIA 2OMWB 1L3WA 1NCHA 5CZRA 3LNEA 1NCGA 1WYJA 1NCJA 1ZXKA 1WUZA 2QVIA 1O6SB 4AK1A 3Q2LA 4ZMXA 1Q1PA 4ZMPA 5JYMA 1NCIA 2QVFB 4ZMWA 4XXWC 3Q2VA 3Q2NA 3FF7A 3K6FA 4NUMA 4ZMYA 3LNDA 4AQ8A 4NUPA 4OY9A 2OMTB 3K5SA 4NUQA 4AQEB 2V37A 1FF5A 3Q2WA 4AQEA 4ZMNA 4ZI8A 4ZMOA 4ZMVA 4ZT1A 4QD2E 2A4CA 1EDHA 2OMXB 4AQAA 2WBXA 2X2UA 3K5RA 4NQQA 5KJ4A 1SUHA 3LNGA 5DZVA 4APXA 3K6IA 2EE0A 1OP4A 4AXWA 2YSTA 3UBHA 4ZMTA 4AQAB 2OMZB 2O72A 2WHVA 2OMVB 3UBFA 3K6DA
chains in the Genus database with same CATH superfamily
4MWFB 3BP4B 5FYLD 7FABH 1XB8A 5EO1B 1XSJA 5B1AB 1U3YA 1B0RA 4F7EB 1AQMA 3CSTA 2YPLA 4UU9A 5FO7B 5E2UL 4L4VE 5CEZD 3PREA 4LCCB 1N3NA 3M86A 3NFNA 4G80A 1AKJA 2BOCB 3TP4A 3RGVB 3HB3D 4EMZA 4DUXA 4HCIA 5BV7C 4X7TB 1WCBA 2EH7H 1UZ8A 3EYSL 3QQ3B 4MTMA 5EDSA 1MKFA 3O4LB 2BVOB 3BP5B 1JRHI 1NLBL 3C5ZC 3MN8A 2CK0L 3WXWL 5KSVA 4AM0A 4NQSA 4WW2A 5DJ0B 1NAML 2ZF9A 1JN6A 1G7JA 1MCNA 2V4LA 2NY2D 1JVOA 1KBGH 4O51A 4CSSA 3MSPA 1IARB 2PCXA 4JREB 3X3FH 1ONQB 5LJYH 3KPQB 4TQEL 1EZSA 4Y19E 2NZIA 4ZBJA 5FYKH 3N40F 3ULAB 4UOJA 3LRLA 1G94A 1OPGL 2KLSA 2CHWA 2C1OA 1G9MC 2OSYA 4RMWA 1YJDH 3DTXB 2DQEH 2E5EA 4U4BA 3TA4D 4JHAL 1JWMB 4OR1A 2BNUA 3CZLA 3U25A 3FULA 4NM4L 1FN4A 3HHRB 4XAWL 5D9SA 3NIFF 3L4ZA 4IIQC 1FNEB 4LNRB 3IXTB 4PCTA 2CKBA 2OP4L 1OTUC 1BZDA 3FU8A 5BVPL 2GIMA 4RGNE 1TVDA 5FV1L 1ZE3C 3JWDC 5DU7A 1Z5LA 2MEJB 3HC2A 2WQ8A 5ANMA 4W9DC 5D93C 3EADA 3MR9A 2WQUA 5HVFB 3TIDB 1X5LA 5IHWA 4RAHA 3TA3C 2XQBH 4XMUA 4AZ8A 2DQFA 2FYYA 3RBSA 4HJGB 2BVYA 2XV0A 3KW8A 1FAIH 1BVLA 4O2CB 4U05A 4AK2A 4A7SA 3CLEH 5FFGA 4GLRH 1A65A 2PXYC 2QQKL 2UXFA 3NZ8A 1I7ZA 3SO3B 4BKLB 4M1DL 5DQDL 1IJNA 1U8IB 3IMWA 1CO1A 1UT1A 5HHPA 3GEFA 4P3CH 5AW1B 3WSQL 2ICWI 4ODWB 5ACMA 1QW9A 1UM6H 2X1WL 1IBZA 2BP8B 1W9XA 4HMDA 5I66B 4OZGB 2CIKB 1BQHG 2QVMA 4WU7B 2OMYA 3W9EA 1TFPA 5IESL 1N6QH 1JFHA 3D4CA 3VMOA 2HT4C 2P52A 3DHJA 3REVA 3ZOAA 4G8IB 4JZOB 4D0CB 1JBJA 3DX0A 1VHPA 4FFVC 2C8NA 1LE5A 2PPEA 3O2WL 4N0FA 1S5IL 2CBPA 3NJLA 4IRZL 1ZVNA 1ZT7B 2JKIS 3ETSA 1H9VA 2PP8A 1CU4L 2VQ1A 5AVSB 1CT8A 2UZYA 5G4MA 3UIYA 1LHZA 1VZIA 4Q9RH 2MQ0A 3L4CA 2AF2A 3NTCH 2XRAH 3EDFA 4FNLH 3T4AC 3AWFA 1F97A 4KK5D 5HGHA 2YMXL 3ARZA 1FL5B 2MKWA 1KLGA 1BAFL 1XH2A 5IHBA 2Z31C 1PAMA 3BVDB 1H6EA 3RVXD 1M7UA 1WFMA 4PJGE 3NFSL 3RJOA 1W6LA 1ACYL 3CVHB 1U8JA 3GTVA 3ZHKA 4DZ8B 1MW3A 1CC3A 1K8IB 2MOGA 3FKUS 3IDIB 3QZOA 3TPKA 1B0IA 4HMEA 1CDYA 2BP3A 4Y4FA 3K72B 3RX8A 5FO2A 1M57B 2IGFH 3TWYA 1OAQH 4KJPC 3ZZQA 5I30L 4V2BA 3C12A 1UA6L 3VGBA 1BFVL 3UACA 1C5CH 2WXKA 4Y8DC 2NYYC 2OXGA 3BAKA 4Z77A 2J6EH 4DKTA 2CR6A 4ATWA 5JPNA 2BM3A 3SCMD 3VFSA 4BFNA 4F9LC 4NJ9L 5HYSG 5I9QC 4OI8A 4G7QB 3ALPA 4WUKH 3IDGA 4PR5B 1L7TH 1U8NB 4F5CA 1OHQA 3QCUH 4KROB 3VWKA 2DWEA 3WAJA 4DZBA 1DVZA 4ESKA 2C4FU 4OD1L 1D6EA 4AX3A 1D5IH 4NPYB 3NIFB 1KULA 1HEHC 2DV6A 2Q2EB 5C3TA 3U2SA 3DDGA 3VJ6A 4OGAD 2QKIA 2C26A 1NMAL 2NNXA 4H25A 3TZVA 4ALAC 1BYOA 1CN4A 2B4CC 4B53A 3QORD 1DDHB 4P2OC 5C08E 1ZLWH 4LCWA 4QXUL 4K9JA 4X6DF 5BZWB 3IPFA 4XBEH 2HLAA 2VLRE 1OB1B 4PUBL 3C5ZD 4GAGL 4PGBA 1IV8A 1QO3B 5K93A 5IQ7L 1AZCA 2IBZY 4XN5A 3H2QA 5KS9F 4LAJH 2NCEA 3LRSA 4LCUA 2CGZA 1FH5L 4Z7WF 2ORBL 4XNYL 4XPBL 1ETJA 3ZKND 1HJCA 3FONB 4OCLC 2EC8A 2FHBA 5F9JB 1S46A 4NI6A 5EORH 4OCWH 3VSQA 1N0XL 4RESB 1UJ3A 3DI2B 3GMMA 4DP0X 4OTXH 1KC5L 4XH2A 2WZPA 4N87A 4FTVA 4L18A 2NT0A 5DLMH 2IV9A 1T7YA 1FZJB 4WQOA 5I1IL 1J9SA 2VN6A 3BD4A 1HHHA 3KVDD 5JHMA 1Z2KA 1EO5A 1CE1H 4Y5XB 4OD3H 5T8IA 3OLIA 4HD5A 3MUHL 4P4KB 1NDTA 1U3HC 5D7JB 3V5DA 4X9HA 1U8KB 5FCUL 1SYVA 1GZHC 3QJTB 4AXWB 3N1FC 4IBYA 1E4HA 4Y7MA 3IDXH 5CIPH 3D08A 3IPEA 4DPBX 2NW2A 3DIFB 1F00I 5D2NE 4UB0L 2WXGA 3DSNA 2DBLL 4F7TA 4DKAA 5FOBA 1BBDH 2JB5L 2A6DA 2YXMA 3O3DA 3I85A 5L8KB 4FXKC 1L9PA 2YAPA 1DQDL 4XCNB 2IBGA 2YPKB 2K1MA 2ZG3A 5D7IE 3EGXB 4PV9A 4MDIA 1INDL 4KTDH 5A16A 2VZUA 2GJJA 4Y4KB 3RWJB 3D9AL 5CSZA 3V6FB 1E5ZA 3FFDB 2JKTM 5DFVD 3UC0H 2DEWX 2EDJA 2P44B 1E5UI 1FL3B 4H2AA 4FLQA 4X4XB 5IJVA 3BH9B 2EH8H 2WP3O 2Z92A 3KR3L 2ZWSA 4NAMA 3QULA 1CI5A 3KMDA 3THMH 2W9EL 1CR9L 4PJIA 3OAYH 3CK0H 4MA8L 3FPYA 1BXXA 4WI0A 2QV4A 4P3DB 4P57B 4X7CC 4FFVD 3B56A 4J6RH 4XNZB 5C0AB 5IK3A 3D30A 5I1DB 5EBGA 5K9JH 2OTUA 3BWUC 3BVWA 1FORL 1BZOA 1PLCA 3MRQA 2WO2B 3O8XA 3OAZH 4J3VA 1RUML 4JFEE 3OB0K 4JFXA 4P23A 1ECYA 3H8NA 4D8OA 2LV4A 1BVKA 3F7KA 4H8WC 4TYUA 5ESAB 4K94C 1FFPA 5FK9A 1ZKAA 4LLUA 2CJTA 5HY9A 4HC1H 2BCKA 3RL1B 3P30L 2FX8H 5A2FA 4JVPA 3OQ3B 4X6DB 3C08H 4EVNA 1TMCB 3AVEA 4QRBA 2ZT9C 2JJTA 1NH6A 2WBXA 4K7PH 4OZIF 1M6OA 3ZT5A 3V4VB 3U4EA 5BXFB 5KS9B 3EH3B 2QVKA 4Z7WB 5BJTA 1NGZA 3X14A 5HHOB 1R0AH 5BV7B 3GDBA 3K6IA 1T80A 2WO3B 2P5WD 3WMPA 4KJPD 1XGPA 4G8EA 3LDBB 3HG1E 4Y5VC 1UACL 1MDTA 3O3BB 1T83A 4DP1X 4FA7B 4Z7OE 3OGOE 1ADWA 4IDJH 4L37B 3SKOA 3MPCA 1ZPUA 2ID5A 2NYYD 2K8QA 3BI9X 2F54E 1HE7A 2X9XA 3K6DA 4JCMA 5DD6A 4ZPVB 1I7RB 4X80H 1MQKH 4Z7UF 1TDQA 4KITB 4J3UA 4S11A 5FO8B 2VABA 2XWCA 1B4RA 1KGJA 2HT3D 4E5XG 4LSVH 3QHZL 5CN1A 5KBDA 4IYKA 3D18B 1X5KA 3BX7C 3OLDA 3AACA 3EYUH 1DLHA 4JKLA 4AIXA 1Y6KR 5INDA 3SPHA 4ZNEA 3IETA 1S4IA 1TNNA 4LEXL 2IWKA 3ASNB 5DGRA 5DJ6B 3ZMEA 5B3NA 5LQBH 1HQ4B 3JVGA 1OL0A 4IMKC 3BQUC 2EO7A 4P2OD 4PJXA 5E8PB 2V5YA 1XTMA 4ANUA 1MIEH 2AAVA 2R29H 1M1XB 3BFOA 4HUWB 2Q76A 5D4JA 1JG9A 1D7FA 1F58L 3EF4A 1FE8H 1Q9WA 3KLAB 4YHKH 4IIQB 1A9BB 4J3XA 3GT6A 4DUWA 4FHJA 4CJ1A 1ANUA 1OAXL 2Y69B 1Z3GL 1V05A 4BFBD 1EFXA 3DV4B 4K7FB 3HR5B 4AQOA 5JIPA 3C60A 2V3EA 4ZFZB 2DPKA 5B38G 1WGVA 2FDBP 2FWOA 4O2EB 5EUOE 4XNUH 4ZMPA 5LG6A 3FXIC 5D93B 1TCMA 1ESOA 3O2DA 2P5EE 4NQXB 3TESA 4HKBA 1T21A 1WWAX 1L5GB 3RL2B 1ZPLA 4YWGL 1MHCA 4ANVA 3VXRB 3WKNA 1A6WH 1PTZA 5I2IA 3LQMA 5I0WA 3IVKB 2QHRL 1L9TA 4KJYB 1V7NL 4K71C 4J23A 5HXMA 1YN6B 1SDYA 3GJFB 1U3HD 2IG2H 4GINA 3ARPA 3ZYIA 2XTJE 5E2TH 4HKXA 3NCYP 5IG7B 3V0FA 2ZCHL 1NKGA 5T5FH 1YHPA 4ONHA 1T5WA 1G7LB 4PRDB 2XUWA 3EH2A 4NZRL 1YPZE 3V5KA 1EWHA 3Q8EA 1X9LA 3APDA 2PR9A 1TEGA 1TOXA 4HUCA 1XF3B 5D6CA 5DMJB 1IC7H 3C8HA 3WFCL 4UM9B 3ECWA 4C57C 1MCHA 1QUNA 5GJTL 1S7SA 5CLZA 2EDKA 2NY1B 3I6LE 5ABZA 1ZVYA 2LOEA 2LVCA 4M6NL 4OZIB 5IJKC 5CILH 1PCXA 3FN3A 1BD2B 2DQGH 2DDQL 3FUKA 3HA0A 4WV1C 3T4AB 2MJWA 1FLRH 4OFPA 2QGDA 3ZRSA 3L3KA 2R2HA 3WG7B 5F88B 2YKLH 1SJHA 1KFGA 3GB7B 2K4WA 4YS4A 1CICA 5LBGA 4KUZL 2GB2A 3T0AA 3KXFE 3OQRA 2YZ1A 3MO1A 3W37A 1P6AB 4RQQA 3NN8B 2ZKMX 3TEYA 2FQEA 3PFQA 5T1MB 1ZV9A 1YYLL 4Z7UB 1OHZA 4XMTA 5JNYB 5E9DB 1OY3B 1E4KC 1CD0A 2WBWB 4XP6H 2WWMC 1JMXA 3PWUB 3HVDA 2BZDA 4DPRA 3DJSA 3PWPB 4LXFA 4PRBA 5IB2A 5J13C 4OLWL 3D2UA 1RSYA 1A0QH 1H8LA 1ES0A 3P4MA 4G7VL 3U9PL 2YQGA 4KK6D 2JCCA 2ATPA 1NWOA 2CLZB 1ZDSA 5I9QB 3T1FA 4PRID 2A77L 2NOYA 4IM8A 3RWCA 5GGRB 3DMMB 2FJFA 5C2BH 5FYJU 3PV7A 4K23L 4F27A 3BWUF 3NIGE 2BO0A 3GXFA 5DURB 1RL1A 3QFJD 4TKWA 3VI3A 1DJGA 7PCYA 5B3JE 2CXGA 3NA9H 3OF6D 3DX6B 4E41A 3NPSB 4ZMXA 3ETTA 1BGXH 5JUEL 3PUUA 4FQXC 3CXDH 4EPSA 3CFBA 3FFOA 4KMLB 5BQ7A 2A6JA 5FW8A 4IMLA 2BX5A 5I8EB 3SY0B 3QAZB 1LEKB 3QZMA 4D8PA 5AFAA 1M2OA 1GIGL 4ISVA 1BIHA 1DJSA 4L9LC 3FRPA 4KJQC 4I5BB 4IKIA 1W72H 2VCOA 4XX1G 2PP9A 2J73A 3CXFA 2B39A 3CU7A 4D7PA 2PNDA 3O11B 5D2LE 3RNQB 3L3IB 5JQIB 4IKKA 3VXUD 2A9DA 4PGCA 5ICZB 2XVGA 3ZJAA 2VLKE 4ZDHA 2IIJA 2F1BA 3K74B 4WUUA 5E1QA 1E42A 1PZUB 3WKQA 1HZLA 1MAML 2ZICA 1UKTA 4TOYH 2BIOA 4KKZA 4OF5A 4WGKA 3BQUD 1RUKH 5CFHA 3DYOA 1LK3L 5C3IA 5MEOA 3K3QA 5EULV 4J3OH 2GTWA 2ZD0A 2BJML 2X70A 3KBEA 1OGAE 4IBLT 4A6YB 5AEAA 2XN9A 3CVHL 1OP3H 1OSYA 2NY7H 4MQTB 2FEJA 3GRWH 2X1XR 2KHAA 3D4YA 4G72B 2DIBA 4PGDB 1ADQA 1VFUA 3UJJH 2ZSVA 3HKFA 4XCEB 3T9WA 1R3LB 1O75A 2DL9A 1KYUA 4AT6B 4Y0GA 1PLAA 2B16A 2IOOA 4K3EL 1PD6A 4JDVA 4Z3EA 5ESVB 1F11A 1GOHA 2GSGA 1FDLL 4X5LA 1PG7L 4MCYB 3K1DA 4FXKB 1QBLH 3U9WA 2EYSB 4ZD3L 3J8F7 1KXVA 2F15A 1NBZA 3O45B 2WD0A 2AQNA 1MAKA 3GMLA 1M1SA 4MYWB 1N2RA 5G55A 3QH3B 2XHNA 4I3GA 2R2EA 3KPOA 4HK3J 5KBMA 3H2PA 3CLWA 5HHQB 1UVQA 1Q9LA 4S1SL 3TO2B 3RY6C 1J5CA 4KTEH 5TE4H 3ZKMC 1E28B 3MCKB 1ZIBA 1T6BX 4G9FD 5F71A 3ULVF 1NCWH 3ZK0A 3CV5A 3BE1L 4ZW6A 4L3EE 2VSKB 3OPUA 1A3ZA 2ZX8A 5C3LD 1TR7A 2N7AA 5D70H 4HS3A 3TPUA 4L8CA 1A3LH 1JE6A 3P73B 5EZOL 4Y2OA 1HT6A 3BT0A 4OGXH 1F1AA 4X6CA 1N8ZA 4KXZH 2EIKB 4JPVH 2Z9TA 3GI9H 3WUWB 4JB9L 1WFUA 2EYTA 4MNGE 2Z93A 4J6IA 4ZYKB 5LGKA 4JM2D 2HTLC 2ZUXA 2IFFL 3GXTA 4DEPC 5CXPA 3MV8D 5KANI 4I1PA 3S4SB 1CFBA 3BUQA 2J1XA 3U36A 1F3DH 1YYMH 4ADGA 3F00A 1CLZH 1E0OB 5F3HA 1ZJAA 5JHLH 1CFNA 4Z3GA 2QGEA 2X4RB 4QDGA 4GP8B 4NNYB 5F0JB 3VXPA 3NCMA 5GS3A 4E0RA 2GAZA 4L4VA 4F3FB 1LM8V 1FNLA 1JIBA 1FHGA 5JIDA 1UT2A 1HHKB 4HDIB 4NC1C 4ZO8A 4ENED 3L5IA 4MAYA 1K72A 4EDWL 2WXOA 4W1TA 1K2DA 3MGOB 1WH0A 4N8VG 1YECL 3CHRA 1GTFA 1T22B 3FCTA 4WZ9A 4RGOH 3N3EA 3LEVH 1QRNE 1XGYH 4JQVA 4KQ4H 4G6JH 3OLEA 3IFOA 3VSTA 5DXWA 4Y19A 5I6XB 1N12A 4B95C 3DRQA 3F83A 4CMMB 4H5SA 3TV3L 3M07A 3FMGL 3ESPA 4QCIB 1MCFA 3S5LA 4H26B 1Y18B 1AY1H 4CADA 1NGYA 5GSVA 3TNMA 5FYKU 5I24A 4U6TA 4XB7A 1RHHB 5L7XH 3BKJH 4FQXD 4ZXBC 1MI5E 2DICA 3FN0L 6CGTA 4Q0XL 4DCQA 4PV8B 2PCYA 3VD9A 4W9FC 2IFGA 4P2RB 2HMID 3L4TA 1QBML 2YFNA 1F4XH 4IKNA 4UAOB 1MFAL 2ZAGA 3RNKA 1M7DA 5GZNA 1KCUL 2J8HA 3NZHL 4IU2B 3QJOA 3ZTNH 3MRNB 3GNML 1TZHB 5DTFA 5TQ0H 4FI8A 4FABH 3POHA 3SYQA 4OB5H 15C8L 1ZT4B 2GSIA 4YHOL 3US9A 2DM4A 3RX5A 3IS1X 4W4OC 4AUJA 5DI8A 1GZQA 1IGIH 1SLVA 4G6KL 2R1XA 3WHXA 3UP1A 1UH2A 1FC2D 4K71B 3C09C 4HCRL 3GBNL 1PDKA 2UUDK 3BPNB 2AS5M 2B1AH 4GUOA 2X0VA 2NQ3A 2OX5B 4TNWF 2FO4B 4I0CC 5ALCL 3V4VL 1UT9A 1VCAA 1JK9A 3DX3A 2RIKA 4HXAH 1FNSL 3U6RB 1ZT1B 4XNXH 2HRPH 5AVYB 5BV7L 4K73A 1U93B 2VMFA 3LIZA 3PIQB 1G7PA 1BCIA 2B77A 4F7CA 5D96C 4XNAA 5E1IA 5C0CD 3W57A 1UC6A 4GRLB 5ID0B 2X53A 4FA8A 3BAEH 3IFLH 2XOTA 3DVGB 1CXLA 3GF8A 3KYKL 3ERXA 4P4RA 4TUOB 3VCLB 3C9NA 1G5AA 1F90L 3MBEC 3D6GA 4WEMB 1SEBB 2G3MA 3IPBA 3Q48A 5AWNL 1JJUA 4A2LA 2VJ0A 1JP5A 3LXUX 3LQAL 3FQ4A 1Q1JH 2X41A 4WV1B 5EO0A 2GFBB 4AYDC 4PG9A 2NDFA 1T7VA 3QXVA 3WKML 4Z3FA 2F7OA 2D9CA 3C6SA 1DYZA 1IKNC 3GXNA 3D34A 3CUPB 1DVFD 4PJGA 5IWLC 1TCRB 3FFCB 4OJFH 1EVUA 1CFQA 2HVKA 5F1KC 5TFSH 2AEPH 4RX4D 5CUSL 1AO7D 2XWTA 3AFLA 2NY0C 4NQCD 4OGZA 3BH4A 5HHNB 3VFNB 3ZPDA 1T7ZA 4A2FA 1MPAL 3F2LA 2VJ8A 2ENSA 3LB6C 3QUMA 5G5DA 2ZOKA 3C87A 2FGWH 3ECBB 4I0PC 3HFML 4MD4B 3K71B 3LKQA 5E4EB 4ZSOE 4GMSH 3JWDL 3E9UA 3FUIA 4M5TA 5CJ5A 2AJSH 4Y1TA 1NIAA 3PAVA 5IROC 2RA1A 3IAPA 3GSWB 2GEEA 3KPPA 4BWWA 1AYOA 2NY5H 1CQYA 3MLZL 2LAGB 2G4EA 3SKMA 2FJSA 5CKGA 1T89C 4GAYB 3UZEC 4L3CB 3SJVB 3P4OA 4U49A 3IMBA 4XXWA 5B7MA 3SBWC 2JFCA 1WBZB 1LYQA 3AS0A 1DN0A 3LHAA 1KPRB 2AQSA 1IAKA 4WFHD 3RDJA 3ZDWA 4JEGB 3QUZB 4GSUA 1T20A 1PEWA 1YCSA 2K7QA 2W65A 1G9HA 3FAWA 2UX7A 4GS7B 4PW9A 5FC9A 5C08A 5BRPA 2D7TL 2GG1A 4TNGA 5LWYH 3VRJB 2VLRA 5HI5D 5JPMC 1VKXB 5F7HA 1TQCB 5IOPB 1JGDA 5C70A 1AQHA 4YFEA 5HHVL 1RMFH 3PPSA 5F7WC 5DRZA 1E43A 5C0FA 2IBBA 2ED7A 4Y9BA 5BVJA 4H0HB 5IQOA 3WELA 4X5XA 3KBPA 3CCHA 1AMYA 4ORGB 2YQBA 1MJ7L 4JE4B 4RAUB 1KGXA 3BJ91 1JPFA 3HAEA 4Y4HA 2DOCA 2HVJB 1CGSL 3QXDA 4GI8A 3SOTA 4AQ1B 3PXHA 3QEHB 4KC3B 3K8KA 3MC0A 1WG3A 2LAAA 2VXQA 1TZOA 3GKWL 1ZS8B 1VACA 1SHMA 3A4AA 5A2CA 4PJ5B 2YKKA 3SE3C 5C07D 3LV3B 2GUYA 4YQXL 2DQDH 1CDCA 3VFMB 3KCWA 5KVEH 2C7FA 4GIOA 3E6FA 4QXWA 4K3DL 3O4LE 1NMBH 3UBXB 3BGAA 4L8SC 4HK0B 2X88A 4JFZH 5CHNA 5FUOL 1EHKB 1WS7A 2XKSA 4L1TA 5ETUA 2BVPB 3MNVB 3STZA 5IT2L 3PP4H 4YDIL 3BHBA 5EF2A 3KJ6L 4OUOA 2ADFL 2QPDB 1H15B 1A7OL 5D2NA 1KBKA 2NY4D 2GUOA 1B2YA 2DTSA 1MCCA 3W0WB 4UT7H 4NO5A 1K6QH 2D8KA 2ZUVA 4FLSA 2HA1A 1TNMA 2XKUA 4LOUC 2YN5A 4LOEA 3E9TA 4CKVX 5GXBB 5D7IA 4JQIL 3KDMB 2WUCL 5CFAA 5T1DH 4DVBB 1KV7A 4D9RE 4ELKA 1NGWA 3MRMB 2P26A 2FO8A 5JR1L 1OD7A 3V6BR 1WEJL 4EN2A 1PY9A 2D3JA 2XZAL 4YSAA 5C09B 3QNFA 1KY6A 1PL3A 4B9GA 1CCZA 4FQQA 2WWNA 4LLVA 2PP7A 5FF6A 4NO0B 5DDHB 2IAMA 1P5UA 3BXNB 4EI5C 4FZ8H 1G7MB 4IS6B 2O72A 3IF1A 2WIIB 4MJ5B 3BT2H 2Q7NA 3UPCA 4FP8H 4E9LA 2LU4A 3PL6D 4M8VA 2H9GA 4LIQL 4AQ8C 3QO1B 1R3IH 4HCGA 1H5BC 4JFEA 4U7SA 4DEPB 4L4JA 5F7UA 3P11L 2NX5D 3OKMB 3BEWB 4FQIH 4NM8L 4XE0A 1A66A 3G5YB 1JF1A 5H94A 2YLHA 3M8OH 3B2VH 1RZJC 3TLRA 4MX7A 4PWIA 2VZSA 3IAQA 4G3YL 3QNXB 1A9VA 4WHDA 1LDSA 1G9EA 5H37G 1E40A 2APFA 2D31A 3JTSA 4LP8A 2AJVL 5A2LH 4RH4A 4OZGE 3BWAA 2W60A 4YE4H 5FUZL 5GQBA 2BC4A 1V3LA 3KM1A 5LO7A 3TJEH 4C56B 2AP2A 1NM4A 2KQNA 2QHLA 2ZG1A 2CIIB 4QKTA 3BPOB 4HW6A 1GS6X 4A6YL 1WUZA 1P69B 2Z7WA 4NKOA 1EV2E 5HDQL 4EZKA 3V2AR 4BUHA 3R8BB 3KL3A 3IBOA 4QRRB 3FJTA 2JI2A 5DZ9A 2MNWA 4C4KO 1K4DA 4I0PD 1M05B 4PG2A 1AJ7L 5D7KE 4CSZA 2F54A 5JHDE 2R4SH 3EOTL 4YGVB 5IROD 2ZX6A 1KCVL 4LLWA 3T2NH 3H9SB 4PMFA 5E99L 5HHMD 4JO1L 4N8CH 5AVQB 5J6GA 4PD4K 2CCWA 2VDMH 5I8CB 1HYRC 3VXMD 2N59A 3JVFC 3GHPA 2C9AA 2JJVA 4LLYB 4P9HC 3TGXA 5CZVL 4Q9BA 5IIEA 3HC3L 1QQDA 3BUIA 1U30A 1VFBB 3T2QA 3K7UA 4TSBH 1RIVH 1VEOA 2JKJA 3N1GC 5F7KC 5IV2B 3FZUD 1OZUA 3MLTB 4JDZB 4DTGL 2VXUH 4ZXBB 3RVTD 1QSFB 2VH5L 4HFWB 3FCGA 2GI0A 2VM9A 1AQKL 2Z8WC 3WJLC 1FCGA 1NCNA 2ZOLB 1I3RB 3DK2A 1X5IA 4C55A 1MOEA 2G60H 3BZEA 5IQ9A 1ZEAH 1ZRUA 2WNKA 5DGQA 5EUOA 2EE0A 3LZQA 3VQMA 1HILB 3ULUE 1XGUB 2IWGA 3AB0C 4HLZH 3RVWD 1HH9A 5AW0B 2IQAA 2P5EA 3O2DH 4JDEB 4ZOEA 3RRQA 3KGRA 2MH4A 3AREA 2C9PA 3ATFA 4PREA 3LHPL 3Q9QA 4JS7A 2YUVA 4L5FL 5AW7B 2Z8VC 1EHLL 5IEHA 2F7RA 2PR4H 1IT9H 1NL0H 1T6VN 3EFOA 4GQZA 4UQDA 2XXCB 4XBPB 3SGKA 2H7WA 5KSAB 2KYIA 1XH3B 5HVHC 4BSWB 43CAB 5KZCD 2J2ZA 5IF0B 2MCG1 1MSPA 2YMOA 4U6HB 1YPZA 2E7CA 3FB8A 1A7NH 1G7QB 1F5WA 3OB0H 1K9TA 4PCSA 4CW1A 1JNHB 1LWHA 1SMOA 2DD8L 2N4IA 3IJSB 3LNIA 5SX4I 1AZUA 1V3KA 5KVFL 5CMAA 3IDMA 4X7SH 3QI9B 4LOUD 1P7QA 3VWJC 1CD8A 3CFJB 1LD9A 5A2AA 1XAKA 2WLIB 3CMOH 4HH8A 4AIEA 1KYFA 4KKBC 1ZLVK 3TVMB 2QR0A 3EOBA 2XQYA 4WWPA 1VFMA 3BP6B 3FCSA 3JWOH 1F4YL 1XV8A 1IFHH 3ETBF 3F6IA 1IAMA 1I1YB 4E9XA 2ZXWB 3F7LA 4HIEA 3QARA 2IXQA 3VFTA 1EUTA 2VKWA 4ZTOH 2X2HA 3KXFA 1TTBA 1RZPA 3OKDB 2J6WA 2VMCA 4AJYV 4EI5D 1YNKL 3H55A 2VZ3A 1DCEA 5FKPB 1IVTA 4I3SH 35C8H 2NY0B 3RLSA 4H88H 4A7VA 3JTTB 1RZIB 2EUVA 4UNIA 1S3KL 4XMKL 2F19H 3WL9A 3WDJA 4LGSB 2UY6A 5GJSH 1TSRA 2W92A 3IDUA 3QJQB 4CU6A 4IJTA 4HISA 4OCRH 2ZJSL 1N18A 5GZOC 5EOCH 3FQXA 2CDFA 2Y6TE 1KGCD 3CD4A 3O81A 3VYNA 3LKPB 4XPTH 3ULVL 1UKQA 1OAKL 4JGMA 2QPUA 3RTLA 4N4YB 2H41A 4K9EL 3X1BA 1N7ML 4DH2A 1AS8A 3NZSA 3HG3A 3ZTDC 3ABZA 2VLMD 1N4XH 4YDJA 1PIFA 3GHBH 3P54A 1MFCL 3VTMA 1IO4C 1QYGL 1QFHA 1U91A 4HOMA 3SIKA 2DRUA 3I6SA 5CU9A 2P7TA 4PJ7F 4CUCA 3H0TB 4OV5B 1MHHB 4U7KA 1QLEH 4QTHB 4QEGA 4HIIA 2UY7B 1IGJB 3P3YA 4LARL 3UABA 3Q1EA 4EAEA 2R8SL 4U6YB 3EJPA 4I87A 2UWEF 2VDQH 1MVYA 4PTTA 3JYBA 2HLFC 3FTGB 1GC1L 3GSOA 3BAXA 3LVEA 1IC4L 4WFFE 3L3GA 1S78C 1DE4A 2OMZA 2M8XA 1D3CA 5D2LA 4X6BB 1I4FA 4C4KT 2D4DA 1OTSC 1J8RA 3BH8B 1JYXA 2RBLA 2VLKA 3PU7A 2F8IA 3PGCA 4TLKA 1X44A 1NCBL 2EVHA 5D71H 2X4UA 1YEGL 4OZFH 3VFGL 5KS9E 2OKMA 2ENPA 3Q5OA 2CM6A 4ZMQA 2BW4A 4Z7WE 5HHOE 1BIIA 3R18A 1PLGH 2EEXA 2QFPA 1KCWA 1DN2A 2X1PA 3CG8A 3QXWA 4OM0L 3DC0A 4ZRGA 1KZYA 1ASPA 1HSBA 2DQJH 4PW4A 5EU5B 4DEUA 4U3HA 5FCSH 1OGAA 4UOQA 3BLPX 3VXTA 4GQRA 3ZSSA 5GPRA 1Z7JA 3ABKB 1J8HB 1HCVA 4XNMB 1ADQH 4IRZA 5EU3B 4X5PA 4EUPH 3US1A 3JUYA 2X6CA 3WIFA 3QG6B 4P5MA 2WMPA 4WVRA 1R24A 5KYWB 4CNIB 4PSPA 5JYMA 5KBNC 5AVTB 3BC9A 3LJ3A 5SWSB 4KGLA 3QEUA 5C71A 4FQPA 4OLYL 4GFXA 1GPOL 5EU4A 5ANHA 1KCLA 4WNJA 4J3OC 3DYMA 5T5NF 2VTFA 3WO3B 2P9RA 1P4IH 3GMRA 5E4AA 4I13B 3MA9L 2YBRB 1G6VK 2VISB 5IBLC 5GRYA 3IFNL 4FE9A 3L1GA 2SODB 4PGEA 1DEEB 1DR9A 1FZKA 2BWQA 5L88L 5CIPB 3VFPB 1B0WA 3QPQC 3L3HB 2TSBA 4H8VA 5J6HB 1X6LA 2X5PA 3OLGA 1I1FA 3PDGA 5D1QD 2G0KA 4L3EA 3WY4A 3ARGB 1RZ8B 1YEEL 2DLFL 3RDTD 3W11C 5K1NA 1JGIA 1Z66A 4WEBH 4R6UA 4U1SB 3TEUA 5FYJL 4KVCH 1ZK9A 2I60H 2XY2A 1T2XA 4U1JA 4EN3A 4EKJA 5KYYB 3F7RA 1YUKB 5H2BA 2R59A 2MRYA 3IRZA 1NC4D 1G4MA 3WKPA 1Q0YH 1I8IA 2AK4D 5DZAA 3E0GA 4XN2A 4J39A 3S35L 3VWJD 4MNGA 4TM9A 4N25A 3CTTA 3QYNA 2FJHA 2EKSB 2HSIA 5L2JA 5F1IB 3EGDB 5FM5M 3IDJA 4KKBD 1TZGL 2VZVA 3VXRE 1OGTA 2ZPKL 2QVTA 4KROD 4XB8A 4TSCL 4KKCC 3HW7A 4NOBA 5LDUA 1KTRL 4S0TD 2G9KA 3QDGE 4PJ7B 1XVSA 1D5MA 2Y5QA 1YSOA 2LT9A 1BLNA 1A1NB 2Y06H 2FJUB 1HVXA 1NSNH 3GZKA 2H6UA 5I15H 1GGBL 2EINB 2KS0A 2JIXA 2UWEB 3HIZA 1KB9J 4I77H 3ES6B 4F80A 1U8LA 2YFOA 5EBWB 2BVTA 2Q10A 2Y7QA 4FFYH 1AGFA 4GW1B 2ZUTA 1K4CB 1SXSA 4PB9H 4DSYA 3AS3A 4HBCH 2VZTA 1W91A 1BREA 3MVSA 1Q9KB 5AB1A 3N1PC 1E4WL 1A6ZA 3PWLB 4AITA 1D5XB 4BH7B 3W2DH 5BRZE 5K39B 1NGXA 2YSSA 3MLUH 4F57H 1K8DB 4JGNA 2DMKA 1S7RA 1IAIL 1NFDF 3FNKA 4D9LL 3T0DA 4JY4A 4OZIE 2VW7A 4G6MH 4QXGH 5GZOD 4ILDA 2OMWB 1QRNA 3SPJA 1W8NA 2VXVH 2HTKC 1C5DB 1Q4NX 4RMUA 2P4AB 1JHKH 4Y16C 1C5BH 1YMHB 2B3IA 2C4FT 1WBXB 4K3GA 3KYMA 4QRPB 2AXWA 5B22A 2H5UA 4W9HC 4QY8A 2Q3AA 5DS8A 5TE7L 5AAMA 5KTEH 1A4CA 4KGJA 4LSDA 4BK5C 3WTUA 1KTLB 3CBRA 4OKVA 3FB5B 4P4KD 4XMLH 1AGBB 5JQ6L 4KPHH 1FV1B 1JD7A 1IEAB 1KJMA 2W91A 4WDIB 5E9DE 4XWGH 1R5IB 4ZFFB 1MI5A 1INEH 1URZA 3PXJA 2WNWA 3QGVA 4TUJB 1VEMA 2GBTA 1NCIA 4RA0C 5T33H 3RKDC 4E9SA 2HLFD 3PWPE 1RZKH 5CJ8A 4YHYB 2W0FB 1GOFA 1XZWA 2NSQA 1LO4L 4WW1A 3K0WA 4NT6A 1D6VH 3O41B 4CN6A 1BZQK 1MF2H 1XMWA 1I53A 1RERA 2NNAA 3BW9B 5BQDA 3ABGA 5IMKB 5ENWA 3AB0B 5DJCA 4BFIA 5DYOA 3JV4B 1YC7A 3TTYA 3II1A 3TBYA 3NSYA 2V3DA 4MD5A 3QDMB 4NNXA 5FHAL 3SDAA 1ML0A 5INCB 5DRWB 4FXLA 4JPWL 4NCDA 3DX7A 5HDBF 2XY1A 5GGSB 3TBWB 4Y5YA 1SN5A 4UT6A 3WN5B 1U6AH 3KPRA 1RQ5A 3NSCA 4YDKL 2QDVA 1UTDA 5DRNA 4LIQE 1KIUA 5DS2A 1MREH 1BOGB 5C0NC 1AD9B 1S8DB 2ZSWA 4CN1A 1OP4A 1Z9SB 5C0AD 3HZMB 5IJCC 3LN9A 4UV4L 4UV7H 3ZL1A 2XWEA 3BGFC 2P3YA 5F70A 3D39D 2K6WA 2QSTA 3HPLA 3K8MA 4LHUB 3N04A 2CG9X 5I75C 3QXAB 2VDNH 1QZNA 4F20A 1MFVA 5JIMA 4U3CA 2P24A 3AGWA 4EQ3A 4HLEA 4Z5RA 3HN8A 1HWGB 1NGQH 1XD0A 3RWGB 3GLEA 5JXEA 7FABL 1ZANH 2NT1A 3GI8H 3MNWA 3ZL4H 3IS0X 3ZMRA 3EW3B 3B3IA 5IB4A 4X9GA 4V1DB 1KDIA 1T04A 4PRHE 5DHYA 4TTDC 1K3ZA 3KWWA 3FO0H 1LK2A 3NPZB 4KNTA 3MMEB 3QAQA 3CWGA 3QPQD 4ZTEA 4M5ZH 3V0WH 2BCMA 1B3IA 1SFHA 2EH7L 1ILSA 2ZP0T 1M42A 5C7ZA 1PG7X 4L29B 4J3OF 4Y1SA 5H35B 4YSCA 5KYUA 4EQ2A 1NFDB 1Q94B 3UXFA 5KVGH 4IOIB 4GKSB 5JW4N 5LLIC 3H42H 3D4ZA 1KBGL 1QSZA 1HDMB 2CDEB 1RZGA 2W5PA 1YO4A 3LN4B 4MSWB 3Q06A 5ITFB 2IAAC 5KYXA 3V0EA 1N70A 2BP0B 2ODHA 3EO0B 5FYKL 1GTNA 1A6VH 2PMZA 4ZSOA 1N64L 4JHUA 1O6SA 1UWGL 2D03H 3D33A 4IOSA 1ORQB 2UVEA 2XA3A 5HJ3B 1YJDL 2DQEL 3AITA 3NP3A 1HI6A 4X6FA 5GRVK 5LDSA 1CD1B 3CBJB 5DQJA 3RIAF 1Z3RA 1MCOH 2WBJB 1FH2A 1E4JA 4ODXB 1IJ9A 4JLRB 2ENJA 5ABDE 4JZJB 1OT4A 4P2QB 4QF1A 5EEWA 3F01A 1FGVH 2OMTA 3UYRH 4DERA 1HCFX 3OGCB 1AZZC 4UMGA 1D9KA 1IGMH 1KT2B 4Z7IA 2R0LH 5F7EH 2AKRA 2HX7A 3SD5A 3H9HB 3OAUH 2BNQD 5FPIA 3TO4C 2CE6A 4FJYA 2HTKD 3MUGB 2XQBL 4IW4C 4OLEA 3EG9B 4PQXA 1HSAB 5D6DC 3V9FA 5HDBB 3B7TA 1FAIL 3QHFH 4MWFA 3BP4A 3HAEH 4RA3A 5EO1A 2F1AA 3CLEL 2OSLB 4J8RA 1GSKA 4F7EA 1IIKA 2UUDH 3AXIA 1NIEA 4HKJB 3KG5A 1I1AC 5EZIH 2YAFA 5FO7A 3WDIA 3LPGA 4LCCA 3MA7A 1TJGH 2X3BA 4P3CL 3NRPA 1IKFH 3RGVA 1UM6L 2NY6C 1R34A 4RFNC 1PYWB 4X7TA 3GLDA 5EIIG 3QIUC 3TASA 4WWKB 3BISA 3O4LA 2BVOA 1N6QL 4NP9A 3BP5A 4YBLB 4PJAE 3HE6C 3AQXA 1H3PH 3MUZ1 3N06B 5KVFE 2OA9A 4L2LA 4GIAA 2VUKA 4LEEA 2XN1A 3SE4C 4Q6IB 1QSEB 3UP6A 2X4TB 5LG1A 3VFRB 5ACZB 3GIZH 1JDDA 3MRPA 1ONQA 3LPPA 1AGDA 2XJKA 4D9QE 1SDAB 1MCIA 4JMNA 1AQDB 4OF8A 5DUPH 2NY1D 3WTSA 3HNVH 4Q9RL 1E27B 1HL4A 3NTCL 4FNLL 1JWUB 4A2GA 1BD2D 2P8MB 5JZ7D 1V5JA 2AXFB 4LF3A 4GT7A 3AADB 5LGHH 4B50A 4NERA 1H3VA 1RKRA 2F2HA 1NGPH 1JWMA 3QZWB 1NCGA 2FECL 5E8OB 2N0MA 4JG0H 3QUKB 2ESVB 3QUYD 2MMXA 4G7SB 2IGFL 3AG4B 4PPTA 1OAQL 3VRLF 5DWUH 4HUXB 1IC5H 4AGPA 1FNEA 4LNRA 4KZEH 3IXTA 1DL7H 1CLYL 1H8OA 3J7HA 5E9DD 5C0ND 5AAWC 1CMOA 2Y23A 1DQQA 4ZS6C 2C3HA 1AANA 5FA4B 3KLKA 3LH8A 2J6EL 3MLWH 2ERJC 2LTQB 4TUUA 4HZ1A 2MQGA 5DRXB 4JPQA 3S8GB 4WUKL 5TDOA 1X5ZA 4B7LA 1L7TL 3TIDA 3QCUL 2QELA 1UD3A 3BD3A 4F7MB 3VQLA 4NZTH 2B1HH 4YHZH 4FRWA 1D5IL 3OR7A 1P1ZB 2QADB 3IU4H 5DJ8B 4TTDD 1OF2B 3WIIH 3ISRA 2LU5A 3K80A 5TF1H 3L3DA 2RH0A 5CJOH 4ECNA 5EOQH 5DURD 5GIRB 4U1IB 1U8IA 2VO8A 1EVTC 4KDWA 1E2VA 4ODWA 4W6WB 4ANXA 3UPRB 4A2EA 5B4MC 4UIKH 5I66A 4OZGA 2CIKA 3L1FA 4N5EC 2OYKA 3MXVH 2KPNA 5BPPA 1X7QB 4FKHA 3DECA 4K2UH 2HX9A 2X9WA 1I8LC 3HVNA 3IJ8A 4G8IA 4XC1H 4C54A 3QSKB 3AS1A 5EF1A 1J87A 1W8EA 3DTDA 3SB3A 4MMZB 5IMLA 1BAWA 3DOHA 4OCWL 1Z9OA 3E3QC 2EEDA 1L4IA 1ZT7A 2NQDA 1ORSB 1KBBA 2AW2A 1CIDA 4OTXL 1FO0H 5JHDA 4K3JH 2YAEA 2E7MA 4Y16B 1AMXA 1HNFA 1THCA 2UXGA 5DLML 5FKAB 4ZMTA 1IM9B 3TBSB 1CFVH 4A55A 1KN2H 1FL5A 4UU9B 5C86A 3BIKB 3NDZE 1MCLA 1CE1L 2ROXA 1N3NB 4K55A 3NFNB 4OD3L 4JKNA 1JGLH 1MXDA 3CVHA 1DJYA 4WWNA 1EK3A 3S3PA 3FFCE 1K8IA 4XP5H 3IDIA 5A3IC 5T1LA 1OANA 3CIAA 2ITCB 3K72A 1N59A 4UNTA 1MZZA 3IDXL 4RVBA 3UO1H 3WJMA 5DQ9A 4NQSB 4WI6A 4PAZA 1JN6B 1G7JB 2LHAA 2ZYRA 2X28A 3WTWA 2IWFA 2Z8SA 1ULVA 5C0IB 5D8JH 3N55A 1BBDL 1UG9A 4X8JB 3GXMA 4PWEA 4PLJC 1T1ZB 2YLKA 1H6FA 4TNVK 4XXDB 5GSRA 4PR5A 4XO9A 4KK8C 1NKRA 4BWTA 3SGEH 2FX7L 3EOYG 1T1YB 1PZ3A 3DVFA 1JPST 3FPXA 3SJVE 1KGIA 4YK4B 5J1AB 4PRNA 3HBPA 2DTMH 4HJ0D 4NPYA 4R96B 1I1AD 3AAZB 4U1GC 3UC0L 3CZUB 4JE0A 2UZIL 4KHTL 4ENZA 2Q9OA 1MFBH 4JN2A 1FSKC 4LSSH 4MKTA 1Y07A 5K33A 3KVQA 2NY6D 3PJLA 3NH7H 1GYWA 1UQSB 4GAAA 3QIUD 5B39G 4HHGA 2MIZA 5E5RB 1IRAY 1J0IA 5D9SB 4LEBA 4UDUB 1PG7W 5BZWA 5AYUH 3THML 1FG2B 5K5YA 3HE6D 1OB1A 4M56A 2EUWA 3CK0L 4OVUA 4PVMA 1QO3A 5JOFB 3K81A 4J6RL 4PLKC 4AGOA 3M45A 4ODHH 3T6WA 4Z7QE 5LGJB 3UYPB 1Z5LB 4H4NA 1JWSB 4PP1D 3FONA 2DYPB 3ARDA 1HIMH 5I75B 2A74C 4ZUWB 1OK8A 1IGYA 5E8DH 4PBDA 4HC1L 2NY3C 2FX8L 3SPVA 1BVLB 4DO5A 3C08L 3JWNH 3KL0A 4FNRA 3CLFH 4XBGB 1FAKT 3GSXB 1FZJA 1ZHLB 4K7PL 5ACLA 3NZ8B 1WK0A 1I7ZB 4YSSA 3KD4A 3B2DC 5B1BB 25C8H 2WXIA 5EU6B 4Y5XA 1QA9B 2V17H 1ID2A 1R0AL 4A7TA 1BPLB 2F53E 4KFZC 5IEKB 3OWRA 2D3LA 1U8KA 3IRPX 1IM3A 3C6LC 2BMKB 4YXLH 3O9WB 1RU9H 2A7BA 3F7QA 4AXWA 2B1OA 3SE9H 3QJSB 3NSXA 3NMEA 4YPGB 3NIDF 3DIFA 1ILUA 4IDJL 1ACXA 4PY8I 5JORA 3IB4A 2ZKWA 5T3XD 1JV5B 4IKLA 3IAGC 4ZW5A 1HH6B 4X80L 3KE0A 1MQKL 4MCMA 3W0WE 5E5UB 2K8MA 4FL4C 4H8QA 3DROB 4XCNA 1M9WA 4LSVL 2AEIT 4KKLC 1YMMD 2YPKA 3JWOC 4DP7X 3EYUL 3EGXA 4AJWA 1BQRA 1J0ZA 5HGHB 4XC3H 4HVBA 1P2CB 2WKGA 5SX5K 5IB5B 4Y4KA 1CDBA 3V6FA 4FQ1H 5LQBL 4QRFA 2OYLA 4IJ3C 1PZSA 2NTFB 1SJEB 2EYRB 3ARBD 3CVIH 5F7NC 4X4XA 2C34A 5C09E 5JIIA 1MIEL 2R29L 3BH9A 4R26L 3D3VE 3QO0A 4Q4IA 5CJBA 1WZLA 2YRPA 4N5ED 1FE8L 3BYYA 2ARJA 4YHKL 2F61A 3NP4A 3STLB 4P2RD 2DJMA 1RURH 1UADC 4Q2ZA 4K5MA 2PN5A 4X83A 4MA1B 1JPEA 4NX0A 4P3DA 3MYJB 4P57A 3UTOA 3VH8G 5I1DA 3RWDB 1SXCA 2OXGB 4Z77B 4YO0B 5JPNB 3FOMB 1WJ3A 3QQ9C 4XNUL 3VFSB 4L8DB 2WNGA 3IDGB 1WHOA 3LKNA 1X5HA 4A7QA 1FNFA 1HXMA 5ADPH 1LILA 4FC3E 3ULVD 3RL1A 3U4BH 1A6WL 1ACCA 5CJQH 1DBBH 3MRDB 4G9DB 4F8TA 1E50A 2CCVA 3BZFB 2VITB 3VJ6B 3U2SB 3TZVB 1L6XA 3HOGA 3K46A 1GGCH 4J3BA 1ODAA 2IG2L 4U0QB 4EOWH 3V4VA 5BXFA 4C56E 4YMPA 5KS9A 5E2TL 5A3ID 4Z7WA 1DQKA 4RFNB 1XF1A 5HHOA 3UERA 1B2WH 1SHWA 2WQXA 2YK1H 2ATKB 4U6VH 3UTSB 4APQC 1ZWIA 4ZMVA 3O6FC 4QRRE 1AOHA 4LO9A 5AZEL 1IC7L 3LRSB 1EDHA 4NN6C 4L37A 2Z1PA 5TQ2H 4PWKA 4LLMB 4WIQA 5IBUB 3RUGF 4ZPVA 1I7RA 2MOQA 4R2GB 5FO8A 2DKMA 5CILL 3FB7B 3H9SE 4ORZC 2DQGL 4TXVB 4FTVB 4ABVA 1OGPA 2Y7LA 4LEOB 3DSFH 4ZNCD 3ZDXE 1FLRL 4Y2DC 1J18A 2GY5A 2YMXH 3QZLA 2YKLL 1BAFH 4CC4C 1ZSDB 3NIDB 5GS0H 4GRMA 1HQ4A 3SOBH 2BPBA 3HS8A 3NCCB 5E8PA 3G7TA 3V5DB 3HC4H 4HUKB 4QHUB 4QR7A 3FQ1A 3ELQA 5K59F 2WSKA 1OQOA 4WSGA 5CZXC 4CMHB 3L7FB 3WMSA 3KLAA 4Q89A 4XP6L 4IIQA 1A9BA 4NRXA 4PLKD 4PJXF 1E65A 4RLDA 3DSNB 5I18H 3VMNA 3DV4A 4K7FA 1A0QL 3G6DH 1CYWA 3FTZA 4Y7OC 3ML9A 3GMNB 5FOBB 4ZFZA 1LO0L 2WXPA 3O3DB 4NQEB 2Q87A 4O2EA 5DLLA 2YA1A 2VQ4A 3KH3A 3FH8A 3ARWA 3KPSB 5DEGA 1XTLA 2JCWA 2NY3D 1OQXA 5C2BL 3TA3A 3F05A 4LL4A 1L5GA 3RL2A 5A16B 4IU3B 4X7EC 3VXRA 5IHHA 2ZOTA 5CSZB 3STBA 1E6OH 2C3VA 2J5LC 1QPPA 3QDGA 4A67A 4KJYA 3WY2A 4WJKB 5J4MA 2PXYA 3NA9L 1A4JB 1YN6A 3GJFA 4H1LG 1UXLA 5I73C 4ELMF 5IR1A 2OI9B 3C6LD 4MASA 4PY8J 1BGXL 4C4UA 1NEUA 2AJ3A 3CXDL 1PZBA 5JHBA 3QUZD 1KTBA 3FUEA 1T0OA 4LDCA 2H32A 4PUBH 4PRDA 4GAGH 3WEMA 3N40P 1EAPA 5FYJD 2XWXA 3DI3B 1J5OH 1Z9NA 2EECA 3TN0D 3LXCA 1XF3A 1MY5A 1W72L 2DM7A 2OTUB 4F8PA 3WYRA 1FH5H 3APCA 4UM9A 3MRQB 4IRSD 3LNDA 4ZUUB 5BRZA 3PXLA 4G7RB 1BWMA 2YD7A 1UCTA 1WFJA 2WXFA 1CI3M 4KJWD 4OZIA 2X4QB 4ZFOA 4JKPH 4LCYA 5J1TC 5AL0A 2DI7A 4A7GF 2EDOA 4TOYL 3T4AA 4EVNB 3KPNA 4BHUI 1TENA 5F88A 1RUKL 3WY3A 2C3GA 2Z31A 4GUCA 5I1IH 4ODBD 3GB7A 2UXVA 4PJ5D 2BZ7A 3ARFB 4MD0B 1NGZB 3P0YH 4GO6B 3X14B 2P5PA 4RMVA 2IWEA 2NY7L 3GRWL 3L8QA 3NN8A 3A23A 2WAHA 4QHLB 3RUGB 4AJ0A 3UTPD 5T1MA 2NCMA 2CNZA 3UJJL 2FBJH 3SDDD 2M83A 4OD2A 4WHYH 5DVKA 1MCWW 5MENB 5E2WH 3PWUA 5B7FA 3QJVB 1DO6A 3PWPA 3QQ9D 3AWGA 1XF5B 2VABB 3CSPA 2KBGA 4BV1A 1BMZA 3NA4A 4F9LA 5K9QG 1QBLL 5IM7B 2CPCA 2VDMB 3BKMH 3BPLB 4JQIA 5ISZD 1QHPA 5GGRA 2WWKO 1UA7A 3DMMA 4IBUA 1HU8A 4MMXC 5L4MA 4LPWA 2FSDA 4HJ1A 2H1LM 3OKEB 5KBKA 4KTEL 5TE4L 5D7EA 2FSEB 2OS7A 9PCYA 3C5JA 4PJXB 1NCWL 1FZMB 1FSKB 4Z23A 3KGUA 3DX6A 2DJ4A 2O6DA 5J11C 5CBEA 3FCUB 2JKXA 5D70L 1TFHA 3U9UA 2J88H 4POYA 2H3NA 1Q9WB 4B96A 1A3LL 1ITBB 1FIEA 1L0XA 2ITDA 4APQD 1Q9OB 5I8EA 5DJZA 3SY0A 3RZCD 4UT6H 2H0EA 2ZYIA 5AW8B 3RJDA 3RILA 3DX8B 4BK8A 2XXMB 4JPVL 3GI9L 1S7TB 5DEJA 4NKMB 4UYPA 2FWOB 3MXWH 5CCJA 2WZAA 3B8SA 3AG3B 2IH1B 3RNQA 4GH7B 2Y72A 2EDDA 3CQPA 4G83A 3VG0H 5ICZA 3L5WA 3HN3A 4ELMB 3MX0B 1YYML 3FQWB 1CLZL 4Y2DD 3EKCA 2H3XC 3NJNA 2IH9A 1A8JH 4OF3A 2X6VA 1BZ9A 4XPFL 1CF8H 4X4ME 4KI5F 4PRHA 3ILQC 1DTUA 4QWWC 4EF3A 3NK4A 5E6SB 4M29A 3HNTH 2W94A 1R46A 5CZXD 1GZHA 2WLKA 5D7LB 1EJ8A 3C2AH 4Z6AT 1AI1L 3MV9B 1L9QA 1J8HE 2V37A 4PGDA 4K8RH 3FQUB 1I9RH 4M43H 1F1DA 1R3LA 3F7VA 3SQRA 2AJYH 4IKJA 3MCLH 4RGOL 3LEVL 1XGYL 4KQ4L 5ESVA 2R39A 2VR3A 4G6JL 2WLJA 4MCYA 2GJRA 2COQA 5SWSE 4FXKA 3QP3A 3RZWA 1G7HB 2QT6A 3VYOA 4MGXA 2I69A 2FIKB 1ZA6B 4KZDH 4N0RA 3QH3A 1X5XA 2FBOJ 3FU6A 3PFUA 4LKCB 1P6WA 1SXNA 1KXTB 3QHTC 1TZIB 1AXTH 1SJHB 4K5PA 3VMPA 1AY1L 4WLCA 5K9QI 4HIPA 5BO1H 2ZNWA 2LW3A 3PP3H 4EO5A 5L7XL 1SOQA 3BKJL 4R7DA 5E95B 1E5BA 4RQQB 3ASOB 3ZYZA 2BIIA 5LHDA 1V54B 3OHXC 5SV3A 4NDMB 3P69A 4AV4A 1F4XL 1UWEH 4YFDB 3TFKC 1QSFD 1KFAL 1SM3H 5JO5B 2ICEB 5LXGH 3UTZB 12E8H 1EO8H 1Z3GH 3SE8H 1GGIH 3D2UB 2QMKA 2V2WB 1UASA 5AW5B 3ZTNL 3WUWA 5D7HA 3EJSA 3VRIB 3QJRB 5F7FA 4P46B 4FABL 4N0UE 5FYKD 4OB5L 4YDLB 4ZYKA 5HJDA 3EYOB 4ODSH 3T1FB 4XXCC 1MWAA 2FJFB 2CD0A 3S4SA 4PJ7E 1I82A 2EC9U 4FFZH 3W1ZA 3ZYJA 1IGIL 1QLFA 4M7JH 1OZTG 2X9YA 1L9NA 3B4NA 4XHJC 2X4RA 3WTVA 2FQDA 2UWEE 4NNYA 5JDJA 2B1AL 4E41B 2FNWA 4F3FA 1ZCRA 3T04D 5AOKA 2MQCA 3EZ8A 2ZCHH 4HXAL 4S1RH 4XZ4A 3UFIA 3QIWB 5BQ7B 3S37X 1K5WA 2BXYA 2A6JB 1AXSB 1HHKA 2HRPL 1W16A 1EGJA 4HDIA 4J4PC 4XNXL 2L7UA 4ISVB 5KSAD 4OZ4A 4NCC2 3RVVD 5ID1B 3FRPB 1KXQE 4PJAA 3O6FB 4HJTA 3UGEA 2PWHA 2COVD 3MGOA 4MZIA 5CGBA 1QFPA 5F89B 4MRBA 3BAEL 3IFLL 3VXOB 3TEZA 2DIAA 5EC1B 4O5LL 1N26A 4YBQC 3UTQB 2YGNA 3MGAA 4M6NH 4CVZB 4A37A 4MJ2A 5E08H 1I3UA 4WUUB 3VE0B 4AYMC 4YSPA 1CDIA 1Q1JL 1PJ9A 3P0GB 4OZFB 4QRPE 4CMMA 2BSED 4NUGH 4HJJH 2MWCA 2D73A 4XAKE 2ZXEB 4QCIA 1WA0X 3POCA 2WXLA 1J0HA 1GAFH 4H26A 5CNHA 2CGYA 1Y18A 3FBQA 2VWEE 2WWKT 3P1VA 1F3JB 4RGMC 3PAUA 3AQDA 2XDHA 5FAAA 3O3EB 1MDAA 4OJFL 4QYOB 5JOPD 1CZ8H 1QWNA 4GBXC 4OFYD 3UCQA 5BW7C 5TFSL 4PV8A 2AEPL 5L2KD 1C7TA 3K5RA 3LMJH 4EUPB 1VDGA 2E6JA 2WTRB 2AERT 3A6BH 1MFNA 1N0LB 2FGWL 2I07A 4IU2A 4JDVB 4NQDB 3RWHB 4G7VH 1CE6B 1XSIA 3MRNA 3OXSB 1DQIA 3U9PH 4GMSL 4NQTA 3QCTH 4WTXA 2AJSL 1KSRA 3PDOB 3ARVA 3TYFB 1ZT4A 5IOKA 4ELDA 1A14H 1COBA 2NY5L 4PH8A 2YEZB 1ZOXA 3DV6B 2R2EB 3G5XA 3KPOB 4NBYB 4N1CA 1Q9LB 2C1PB 4WFGE 2P46B 3ILQD 4ZMLA 5IMOA 5HHXH 3E6HB 3QDAA 4UDTB 4W9KC 5F96H 2HRHA 5FA3B 3DVNB 1F02I 3LNFA 4HK3N 3H2WA 5SWZD 3L45A 1HS6A 2FO4A 2BOLA 4PGJA 3FU0A 3LS4H 4H8PA 4MZ3A 5LWYL 3INOA 3U6RA 1NCAH 1B0GB 1P5VA 1EDYA 2FECI 2NW3B 1S9YB 1RMFL 2WJ7A 5DC2A 4KZCA 4P5TD 4XZUB 3S3CB 3HE7C 2IVFC 1X9RA 4GRLA 5ID0A 1WZ1H 1MCSA 2QGCA 4J3WA 4LVNB 4X9YA 5I5MA 1ACZA 2AHIA 4S0HA 3DVGA 2J8UF 4ODTH 3VCLA 3HKZA 4TUOA 3D12B 2HLEB 2YIHA 1MN4A 1SEBA 3QR1A 2YAOA 4GI9A 4V1DE 4OJEH 4DAGH 1FZOB 5DVMA 3VFWB 2BNRD 4WV1A 4JFFB 4BDVB 2JELH 2GFBA 5D4QA 3U7YL 3LEXA 1OE2A 3F7YB 4M4RB 1KLFB 5KVEL 4L4VB 4E0RB 1PIGA 3CUPA 1BYNA 5CLWA 5HYJD 1NMBL 4JFZL 1NFDE 1NUGA 3CIQA 1NC2B 5D1ZC 1TLMA 5CEZH 5F7AA 2DYRB 3PP4L 1GOGA 4MAYB 4CA4A 1J88A 2BDNH 5HHNA 3GMQB 1E4KA 3VFNA 1P53A 1K2DB 5E0FA 3JV6A 4O00A 1PVHA 4N2AA 1RFDH 1TUPA 4K3EH 3S7GA 4GKZB 3OKKB 1WWWX 2BSSA 4U7MA 4UT7L 3SBRA 3WFEH 1K6QL 1P84J 5DHDA 1OO2A 3G9AB 4S2SA 4F37K 5C0GB 3O3UN 3DRQB 1CDJA 2ENYA 3GSWA 5LAPA 5T1DL 5MHSE 1ASOA 4MMXB 4GAYA 2CRYA 8FABA 4L3CA 3SJVA 1RJZA 1NM9A 3ULUH 4CADB 5GSVB 1WHPA 1A8ZA 3FS9A 5D1XC 4B3VA 5CKAA 3TNMB 5J3HD 4QHPA 2OCFD 5A1AA 4ZW3A 1LVEA 4OLVH 3BE1H 1UENA 2HB0A 2YA0A 4ZX3A 4P2QE 2FGZA 1WUNT 1U3ZA 4FZ8L 3RNKB 3MHZA 1M7DB 2AQPA 5IOPA 4LGPB 2F5AH 5M95B 1G9NH 4FP8L 5T1KB 4W93A 9CGTA 4Y2LA 5EEZA 2OTWA 4RGNB 4AKPA 2R0ZH 5F9WB 2CO6A 5DTFB 1R3IL 2NNRA 4YBQD 4F58H 4Y1AB 3T0EC 4RAUA 4BFKA 5FECB 1ICTA 2ODIA 4GPVA 2IFFH 3VFVA 3GGWB 4FQIL 5HDBE 1AHKA 2HVJA 4AQ1A 3U46B 3TH2T 1J1PL 2W0PA 4F7PB 5DI8B 2CJSA 3M8OL 1GZQB 3B2VL 2NUTA 5AG8A 2R1XB 5LBSH 1ZS8A 3CZFB 1SVCP 4KTYA 2IGTA 1TLKA 5HJGA 4A2HA 4MNQE 1HJBC 1ASQA 1PDKB 2FYVA 5F21B 2JLLA 3LD8C 2I26N 3VFMA 5I23A 4YE4L 2H2SD 1TQBC 2E7DA 3AY2A 3RFZC 2A5UA 3TJEL 4GBXD 4U1KB 3BZDA 3UBXA 5DT1H 1JK9B 2F53A 3QJFA 4HK0A 3L2MA 4HPYH 2ZXAA 5CGYD 3GRBA 4N28A 2BVPA 2J8UB 3MNVA 4HT1H 5CS7A 5DJ2B 1A6AB 4N2EA 4G5AA 1QSEE 1F4HA 3G6JE 5HD8C 2VDNB 3UZVA 1CBJA 1U8HA 1H15A 3VG9C 3GPSA 5SWQB 1I1RA 1P0SE 1ETB1 4P4RB 3LS5L 2R4SL 4DPCX 4MXVF 1OOWA 4G2AA 3W0WA 3V0JA 3TYGH 1WAEA 3T2LA 4M8UA 3T2NL 1Q38A 3PQYD 2H6PB 4MCZA 4N8CL 1NDGA 2VDML 3KDMA 4M7ZB 1AGEA 2BIPA 2OSXA 3TV3H 4PG9B 3FMGH 4HKZB 4WI7A 5I0VA 4XWOC 1P7HL 1N9PA 4P06A 5AENA 3C6SB 3MRMA 5FFOA 3RY6A 3ILPA 2Y4SA 5IW1B 4TSBL 4BFRA 2Y36H 1DZ0A 4GEJA 2ESVE 4PS7A 4PRPB 2VXUL 2XWBB 3PHOB 5C09A 4J1UB 5BOJA 2R15A 2PYED 2HVKB 3D3VA 1SMAA 4Q0XH 4ZT1A 2ETWA 3LRHA 2WK2A 4NO0A 2I7SA 1UZGA 2XWTB 2A4CA 2CRMA 3VI4F 5I71B 3BRDA 1X6NA 1AS6A 1AZVA 1T4WA 2WIIA 5G5DB 1JXDA 4QOKD 3QJUB 3NZHH 2G60L 5IHZB 5GRUH 1EEZB 1L9SA 1ZEAL 3LKQB 3QO1A 4NPJA 2EUXA 2EADA 3U0TB 1QW8A 3RYMA 2N01B 1F1GA 4R84A 4UQBA 2A9CA 2H47C 1GYCA 3KPPB 3LKRA 2IADB 4NUJB 4B3EA 3BEWA 3O2DL 5DF0A 2DM3A 3IEAA 3G5YA 3CFQA 2AV7A 1L7IH 3I50H 3MJ8B 1ET5A 4MKMA 1FPTL 2ZWLT 4OIBA 1ZVSB 3U1SL 1XSKA 3QNXA 3ATBA 1IAKB 3QDMD 4KAQH 2PR4L 1IT9L 1NL0L 4L1SA 4XPAH 1Q8MA 2PLTA 4HHAA 3O6MH 5D1ZD 4C56A 2W65B 4U4IA 5C08B 4DGIL 5E7BA 2BRRH 3EDKA 3ZXAC 1HYSC 2VLRB 3EYQC 4Z3TA 3KWVA 1CG9B 3IKCB 4MZRA 2JH2A 1XT5A 1JGDB 5B1JC 4HG4K 1A7NL 1IBDA 5DRZB 1ODUA 5D1ZI 4QRRA 3F7PC 1L3WA 3VUAA 1REIA 2YUZA 3CCHB 1M05A 4CILA 3VXSB 3MKKA 4YSEA 3QYMA 3V55A 3AMKA 4BD4A 3HAEB 3IGAB 2D9QB 4YGVA 3QXDB 3T8MA 3CMOL 3RPKA 4CVWA 4RMQA 5AWNH 3H9SA 1C16B 4WEUD 4BFFA 2EQDA 4S1DC 2F68X 4OGQC 3WIHA 5I8CA 3JWOL 4JHVA 5AW2B 5D1XD 4LLYA 4YSOA 1IFHL 2GY7B 2ZUQC 1VFBA 4RGMB 3E6FB 1G9MH 4ZTOL 1H8NA 3SDCC 3WNPA 3QIBC 4PJ8D 3MLTA 4JDZA 4Z9KB 4LDEB 4ZXBA 4HFWA 4JFDE 4WO4D 3BHBB 1WICA 5F97E 35C8L 3INUH 4H88L 4UM8B 4NN5C 3BSZH 2F19L 2VERN 4ZQKB 2PO6C 4FZEH 1YEIL 4OJYA 5GJSL 3ZE0F 1BQLH 2NLJB 3WCYA 4OCRL 4PY7A 5EOCL 3LCYA 1AC6A 1ZE3H 4IGBC 1BBJA 1HILA 3GXPA 4X99A 5SX5H 4D3CH 1YVLA 4EXKA 4HUUA 4YC2C 2Y25A 1JNLH 4XPTL 2XPGB 4JDEA 1CVSC 1HHIA 2EDYA 2OR8A 4W4OA 4HWEH 4ELKB 1UD8A 5EUOF 3GHBL 3MV7D 3VI4B 2VDPH 4XBPA 2D7MA 4Z0XB 2Q7YB 3VAEA 2JKNA 4KRLB 4LQFH 4AM0Q 4BRVA 1QLEL 2WBJD 3DJRA 4MQ7B 4W70A 5CJXA 43CAA 4N2KA 2AZAA 4PJEE 5L6YH 1HTYA 4NN7C 2VDQL 1LL1A 4MJ6B 4U6HA 1N68A 3LH2H 4KMQA 2H32H 2H0PA 3BMVA 3L1OH 4WW2C 4K7PX 1JNHA 2XA8H 3IJSA 1BPVA 1FCCA 4R5TA 4UWQB 4I2XB 3IDNB 1UXMA 5EV7A 4FF9A 3ZRCC 3QI9A 3L9YA 3CFJA 1TITA 4OI7A 3MBEA 2NZ9D 2WLIA 2PUQT 2C9QA 4MXWH 4YZFF 3MFFB 4TVPE 5D71L 3TVMA 2FL5B 3NCXA 4XWOD 2BIQA 4KH2A 3DO7B 3FDWA 5EU6E 3BP6A 3IJHB 2AGJH 4XI5D 2YAQA 4FMVA 1PLGL 2DH3A 2AXJA 2HFTA 3L1EA 2FIRT 4X5RA 2B5IC 3CH1A 4R4FH 1IKNA 2DQJL 4HAFA 4O58H 3ZTJH 4LLQB 4OW6A 3KEDA 1JL8A 1E4XI 3MDJA 5FUOH 1RCYA 1QVOA 4JPKH 4WWKD 4NKOB 4PP2B 1B88A 2PTTB 4ZAKC 1GHFH 2UX6A 5DC9B 1ADQL 4N9GA 3JTTA 1RZIA 1K4DB 3V4PH 1TQUA 2JJWA 3RP1A 1U9KA 2R7EB 1FO0B 4UF7C 3P3RA 4ATTA 2HKAA 4JZNB 3EJZC 1YA5A 1QFWI 2E8YA 4LVOB 3RQ3A 3T8XB 2XPZA 1JMZA 3EBGA 5DJXB 1DVXA 3EFFB 1ZV2A 3NESA 3DA0A 2YGQA 1FFOA 1T0MB 2JQZA 4N0CC 1P4IL 1BM7A 4AEEA 3SQOH 2F1EA 2GPZA 1T89A 3UZEA 3TBCA 2IGLA 2L7QA 4JCWA 3SBWA 3X13B 2ADGA 3QWNA 4Z78B 4ETQB 2XZCH 1CLVA 3TFBA 3S4SG 1EMTH 3PF2A 5G4NA 4NO3A 3ZE0B 5I1AA 1A7BA 3Q2WA 3EYQD 4ALAH 1XQ4A 3N6YA 1MHHA 4OV5A 1HYSD 2B4CH 4QTHA 2W0LA 1QOKA 4WEBL 1IGJA 4LPUA 2J6EA 5B3JF 2P80D 3Q01A 2I60L 4B9KC 2RR3A 4HSQA 3FTGA 2BRQA 1W0YT 1Q0YL 4LIQH 5EUOB 3T0EB 1G1OA 4JQXC 2PWEA 4X6BA 1OB0A 2CR3A 3D0VB 1PKOA 4ZPTA 1HQRB 2YMTA 1JPGA 3AREB 4Z1PA 1OKEA 1AVAA 2Y06L 1CIUA 4L4TB 4HJUA 3RTQC 1NSNL 1TTGA 5I15L 1A5FH 3APFA 3SE3A 3E1ZA 2Y07H 4I77L 1ZY9A 2R69A 4X4MA 3LD8B 3EFOB 2AJVH 3QIBD 4FFYL 1JHTA 4PB9L 2VIRB 5EU5A 1SVBA 4HBCL 4L8SA 3UTSE 4OF6A 4WGWB 2GJ6B 2J2ZB 4GAJH 4NC2B 3D0AA 1J8HA 3W2DL 4XNMA 3MLUL 4E9QA 4F57L 2BFVH 3AWEA 3RX7A 5EU3A 3QZPA 5BUPA 1OGSA 3VG9B 3IDMB 3QG6A 1L6ZA 4G6ML 4QXGL 4DP8X 1XIWC 3WHE1 1FNHA 1P7QB 4KXZI 3WTTA 2VXVL 4IGBD 4FTVE 3TX4A 5KYWA 1JHKL 1LD9B 1C5BL 4CNIA 4M3JA 3EJQA 1KCVH 5SWSA 1AZRA 1BYPA 4KVNH 2RGSA 4DKFH 5KVEE 4E42A 3VWKC 3EOBB 4BWUA 2EVIA 1KIQA 1MNUH 3NIDE 3OM3B 3TL5A 4PHXA 4ZFGH 1LEGB 1E67A 1Z9PA 2EDNA 2VISA 2YPLD 3MLRH 4GXVH 1M4KA 5KTEL 1PGRB 3HCVA 1DEEA 2MCPH 1AKJD 2QKIC 2IXQB 3FU3A 1KYOK 2Z65C 4XMLL 5CIPA 1ZLUK 3VFPA 3S48A 3L3HA 4KPHL 4P59L 3ZQWA 4PJHF 3N9GH 4XWGL 5J6HA 5TGBB 1INEL 1JDAA 2BFGA 3N91A 1DBJH 3ARGA 3QWRA 1XAUA 1RZ8A 5T33L 3EJUA 1WO2A 4CVUA 2X4NB 1RZKL 2WXQA 3HI1B 2BP5M 3L5HA 4J7RA 2R0KL 1VADB 2VSMB 4NQEE 3WL9B 3VD5A 4B9PA 5KYYA 3MREB 3HS0C 4HJSA 3KPSE 4AQ8A 1D6VL 2CUIA 4DN4H 1DQLH 1MF2L 5DK2A 1H5BA 4QRAA 2EKSA 4KRPC 4N0UA 1FFQA 2B08A 2V2XB 3EGDA 5F1IA 4KX8A 1MWAH 1HINH 4H8WH 4AI7A 1Z0NA 4PJ7A 4FX5A 4K94H 1XX9C 3NEXA 3EDJA 3AQZA 3U0WH 4Q9CA 4L8BB 3P9WB 2AQRA 2UWEA 5CCKH 2A9BA 3ES6A 2VR8A 3FU7B 5EBWA 1K4CA 4U0RC 2PW2B 3E1F1 1MQ8A 3OTTA 4PYGA 5F1NA 4HIIB 2L7EA 1MREL 4H40A 5DVNA 1AHWC 4PTTB 1J48A 2X7LA 1XBDA 1EGJH 2APWA 1D5XA 4BH7A 2GBUA 4DP2X 1KXQA 4UV7L 5E03A 5K39A 1USZA 1K8DA 3EJZD 3E3QE 4EE2A 2VDNL 3FSAA 3FT1A 1DE4B 1UD4A 2OMZB 5ICYB 5DMGD 4DP9X 4ABQA 2YXWA 5E6IC 1C5DA 2B3RA 1NGQL 3GSVB 4HEME 1YMHA 1FRGH 1ZANL 4DW2H 2WPGA 4KKNA 3FTWA 5F8RC 4TQHA 1WBXA 1OWRM 1LO5B 4QRPA 1PD1A 4DK3A 5DJYB 3FO0L 3BRFA 1NOLA 4N22A 3TJHC 5GS1B 2ZX5A 1YNTF 1J5DA 4M5ZL 3V0WL 2WY3B 4IBQA 1HSBB 1KTLA 3SKNB 2O93L 3RUGE 1DLFH 2VRKA 4YUEH 3FB5A 3SDCB 5KAQG 1AGBA 1XF2B 2A3TA 1WBYB 3KLDA 4L1HA 5HGAB 3ATAA 1FV1A 2KDGA 2NPLX 5FDYA 1JZ2A 1D7CA 3GMPB 1W0VB 1R5IA 4HFUH 4ZFFA 5KVGL 5MENE 3H42L 2IANB 4TUJA 1GXEA 4UAHA 2XX1A 4M1CC 1QBAA 1S9WB 2F9BT 1J1OL 1GH7A 4XE5B 1NLDH 3WIFB 2PO6B 2W0FA 4P5MB 2C3XA 2WMPB 2H0JA 4WAFA 1YY9D 1JGEA 2ZYSA 3O8XC 3O41A 1A6VL 4OCSH 4P0DA 5IMKA 4JRYB 1TTAA 4JRXD 2D03L 3JV4A 3OMZA 1S6NA 1VERA 4PJHB 3GMRB 5L8LB 1HOEA 2JQAA 3F58H 1N7MH 5JW3H 2BY2A 4FG4A 1KDJA 2O5ZH 2JJTC 2VOTA 5DRWA 5INCA 5C0EB 1RH8A 3CNKA 5I1EH 1MCOL 1H9DA 4MJIB 5DD5H 5GGSA 3TBWA 3JV0A 4HWZB 4TRPL 3WN5A 4Y4FD 4L3EB 4FULA 3NFPA 1OD9A 4N2HA 1FGVL 3UYRL 1E9OB 3OVUB 1BOGA 2FNBA 3IRCA 3TV8A 2OYPA 1S8DA 1IGML 1T83C 1ZTXH 2WINB 1Z9SA 2R0LL 5F7EL 1PSKH 4I1NB 4CDHA 3OAUL 4LHUA 2AXGB 3OV6A 5CP3H 4PHZA 3IU3A 3QXAA 1I8UA 4Y9EA 4K3HA 4CU7A 4ELME 4KXCA 3IDJB 2OZ4H 3QUXC 4BZYA 3ZTCC 5JW5B 3VWKD 3NYKA 3QHFL 3QDJB 4JFHD 4HOWA 4GG8B 4GG6E 1U3NA 1IC1A 4V1DA 4MAUH 3MI6A 5EZIL 2VM3A 2QSQA 3FTSA 2UYLB 1U8PB 1TJGL 1YEGH 2P48B 4FEMA 4LMQE 1G7IB 4E9RA 1IKFL 3PGFH 4N90E 3W3BA 1AS7A 4PRAA 5D7LE 2NSXA 2Y7QB 3MV9E 4JG1H 4LCWD 1KB3A 4L29A 3N44F 4Z95H 1CFMA 1NFDA 4IRJC 4ZAKB 4XPHH 1E3ZA 1OT2A 1F13A 2QGBA 3VGAB 2R2BB 2YSSB 1HDMA 4N1HB 2CDEA 4H7VA 2YARA 3GIZL 2HUEA 3U6XA 4HIXL 4MSWA 3WS6C 2BVQB 5CBAA 5ITFA 4L1BA 4MBOA 1F4AA 4R2GD 1OAYH 3EO0A 2CXKA 4POZC 2J55A 2P43B 1YNTB 2XV3A 4LCIH 2X6UA 5BZDB 1FYTB 4M6OL 2WZPD 4FTVD 5EZJB 2YEVB 1T03H 1ORQA 3R19A 5LGHL 3ZZSA 4IQHA 4QY8B 4BE6A 1NEZG 4C8XA 5DS8B 3U0PB 3H4HA 1NGPL 4KNSA 3D5OF 4JHBA 5LCVL 1CD1A 3DX9B 4OKVB 3HB3C 1BVZA 1JVLA 4JG0L 3L95B 3L6FB 1E9QB 2FB4H 4E68A 1KJMB 5I1HH 4ODXA 1MI5B 1IC5L 4JLRA 1PW3A 4H0LC 4LSPH 1DL7L 1F2QA 1H6UA 2DLFH 3VVWA 1XMEB 4P2QA 5AZUA 4I9WE 1R19A 3M1CA 2NY2C 4RWYH 3D85B 4M93C 1KT2A 1MLCB 1BDYA 1XCQB 1R3JA 3C8DA 3OAWA 4WCYH 1NAKH 1E7UA 3ASWA 3WFZA 4NT6B 3S35H 2FTAA 1CGUA 2NNAB 2YD6A 5GGQH 2ZCLH 3EG9A 5ENWB 1CDGA 4ICXA 4NZTL 2B1HL 5DJCB 3ROOB 4YHZL 1W15A 4TMPA 1D5BB 2EIEA 3IU4L 1UGKA 5AL8A 4R4BB 4JM0A 2OSLA 3ECQA 4PJDF 5TF1L 3TJHD 5CJOL 3UTTE 4HKJA 5EOQL 4JJOA 3E80A 4WFEE 3SDXF 3SDAB 3UL4A 1SF5A 4AQEA 1Y1UA 1CF1A 2HG0A 4MNQA 1BZEA 2J21A 3FTUA 1ZLSL 3MTXA 1CICC 1KMGA 4UIKL 3ROLB 1H3XA 1KTKE 3KPRB 4A66A 5DRNB 4N8VB 3GD1C 3ORJA 2PW1B 4K2UL 3RE0A 5C6WH 4XC1L 4QNPE 3L08A 2ZSWB 1NIBA 3X3GH 3V5HB 3GK8H 3DJZA 3DXAE 1QSEA 2B59B 3DBSA 4K07A 2BZCA 3G6JA 5ACZA 3VFRA 2FQFA 4KI5E 2ZWKA 3O8XD 3RI5K 5T1JA 2BY3A 3JT0A 3PDDA 4P23D 1XIWB 2P49B 2NYKA 4WUUE 1FO0L 1U4FA 4TLTA 4D2NA 4Z5RB 4K3JL 1TQWA 4BFJA 5I6NA 3DGGB 4MYPA 2LR4A 2ZUUA 2CM5A 3QQ4B 1JWUA 3VQ1C 1CFVL 3NDYE 3WTYA 2ADYA 5IB4B 1KN2L 3KGSA 2P8MA 4YFLF 4XVOA 1BEXA 3PRZA 3N44B 1E2WA 4G8GB 4ES8A 3OG4B 3FBKA 4PB0H 1LK2B 3TBBA 1JGLL 1NOAA 2VDKH 2IV8A 5DR5H 4YPJA 1FVCB 3GRWA 3VGGA 3CC1A 4XP5L 1MFUA 5AOMA 5IKCB 1LO2H 5E8OA 2WLYA 5JQ6H 3QUKA 2ESVA 3UO1L 1U0QA 1J86A 1SBSH 1ZGLA 1QABA 4HUXA 3ZKXB 1IEBB 3RGHA 1S7UB 3KWUA 4NQDE 4PVLA 2B9AA 4B0MB 4RFOH 4OAWB 1AQ8A 3WGVB 5FA4A 1CUOA 4HZLB 2V2TA 2O6PA 4CGTA 5KYXB 1G0XA 5DRXA 2J72A 4I8DA 5DC4B 4GT0A 3QUXD 4QRTB 2Z0BA 1N5YH 4ZSOB 4F7MA 4TQIA 4KRPB 5KJ7E 1O6SB 5B21A 3L9EA 3W5NA 4PJ9B 2DTML 1P1ZA 5DJ8A 1TQVA 4KK5C 5PAZA 1OF2A 5I1LB 4HEPA 1MFBL 3WTXA 5B1CA 4LSSL 4P99A 1OF0A 1B4LA 3NH7L 4U1IA 4XNQB 5GGVY 4AVKA 5DMKA 3ZR6A 1SY6H 1PZDA 5HVWA 5JLZA 2ZX9A 2KZKA 3UPRA 3R06B 1YLBB 2Z6FA 4FXGB 5AYUL 3IJ7A 4YR6B 3QZNA 2K9UA 3GWJA 1CTNA 3FTXA 1FGNH 4QF1B 2EIJB 4X4KA 4JDTH 2OMTB 1MFMA 1CXHA 4ODHL 3UEQA 1VENA 1NANI 2V3FA 2OJZH 5EMYA 4QKXB 4YXHH 5I0YA 2N1TE 1EFXD 3OG6B 4BZ1H 5DWPA 5DS1A 3C60D 1TU2A 4PJDB 2BSRB 4ZI8A 3SCMC 1GGTA 5E8DL 3SDXB 1X7SA 1ORSA 3L5XH 4M48H 3UEZA 2VE6A 4LHQB 3TBTB 1K3IA 4JW3A 4Y16A 4JFFE 3CLFL 1KXVC 5FKAA 1IM9A 3QJZA 4J8RB 3TBSA 1ERNA 4UBDD 4W9GC 4JPIB 2F08A 3NSFA 5FIEA 3BIKA 1X5MA 25C8L 1BA9A 3MA7B 1F0LA 2V17L 4OGAC 3WIHH 4B27A 4BRJA 3QORC 4FYSA 2E9JA 4BK5A 4EZJA 4YXLL 1RU9L 5A7EA 5M94B 4JFWA 3SE9L 2ITCA 2VQUA 4R8WH 1I9EA 3F8UB 4U3SB 3NRFA 3O4OC 4JFDA 5B7EA 4RZCA 5C0IA 5EZPA 3OBAA 3MRPB 2MFNA 3ZKNC 5ITBH 4X8JA 4OFKA 1AGDB 4XP9H 1T1ZA 3H4FA 4XXDA 4C59B 5C0BB 2GBVA 1ZGLM 3UYOD 1T1YA 1N64H 4XC3L 4F2FA 5J1AA 1UWGH 1LMIA 4M7LH 4LF3B 4L23A 4C58B 4FQ1L 4R96A 3AAZA 1LLAA 1GYUA 1U2HA 4G43A 2OFQA 3CVIL 4IBSA 4RIRB 2IMNA 1BP3B 3DVIA 1CICD 1KTDB 3ULUF 1UQSA 2DZEA 1BLIA 2VUYA 1VF5C 2FHCA 3EFDH 5L4IA 3UGUA 1MVUB 4MFHA 4R0LB 4UDUA 2K45A 1JUFB 1FG2A 1E8YA 3F62A 3KHQA 4WJ5B 1RURL 1U8CA 2KDYA 4O2FB 5KW9H 5JOFA 3DUHA 1DQQB 4PJEA 3HEIB 1O0VA 2LVEA 3OKOB 4CSPA 5LGJA 3HHMA 3UYPA 1JWSA 3CFTA 4Y1AE 4F1SA 2OJEB 4OF7A 5AVWB 3D2UD 2DYPA 5TDOB 1EJOH 1RZQA 1GCYA 3PWJB 4YDMA 4LAQL 3CHSA 2XX0A 2CO2A 4KXAA 4ZUWA 1ZK5A 2IALA 3ARTA 5ADPL 3FUFA 3HLAB 4QT5A 2X4SB 2G30A 3A4EA 2VDRH 5IUSA 5TTRA 3U4BL 3OR7B 1F6AB 2GHZA 3MJWA 4JGUA 4NP4H 5CJQL 1DBBL 2NXZD 3N0AA 4XBGA 4PN6A 3GSXA 1XGTA 1ZHLA 3L3DB 1GGCL 4WI2A 5DFVC 4EOWL 1G4RA 1T0NA 5EU6A 1KJVB 1QA9A 3NCYS 2V9QA 5IEKA 1B2WL 4E41D 2V9TA 2GJZB 2YK1L 3U7AA 2BMKA 2E47A 3O9WA 2J8UE 4XVJH 3WFDH 4U6VL 2OL3H 1XGRA 2KZBA 5I6LA 4YPGA 3REWB 5TDPB 5FLVA 4RRPM 4IRJB 2OXHA 3QWOB 3DETC 3HC0B 4D0BB 3BAJA 3B9KB 3QQDB 5TQ2L 1UXWB 1WS8A 2CGRH 1JV5A 1J5HA 3RWFB 2BW5A 4PJFF 3CVBA 1HH6A 5GZNC 5IMLB 4ZX4A 2VXSH 3A47A 2X9ZA 3CJJA 4GJTB 5DZVA 2HZHA 3DROA 5TE6H 3CZSA 5JHDB 1ET7A 4W6XB 2C9XA 4UINH 1E5AA 2EC9T 3DSFL 3FSWA 3FH5A 4MXQD 1ZXQA 4WUUD 2EDRA 1J0YA 1P2CA 2HJFB 3S6CA 5IB5A 3A6OA 4AW7A 1BQSA 3LAFA 5GS0L 3SOBL 4OSUH 2NTFA 1NFKA 1SJEA 2EYRA 3HC4L 3QRBA 4PRPE