4NUMA

Crystal structure of mouse n-cadherin ec1-2 a78si92m
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
215
structure length
215
Chain Sequence
DWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIARFHLRSHAVDINGNQVENPMDIVINVIDMNDNRPEFLHQVWNGSVPEGSKPGTYVMTVTAIDADDPNALNGMLRYRILSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTYGLSNTATAVITVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cadherin-2
publication title Structural and energetic determinants of adhesive binding specificity in type I cadherins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 44
structure length 215
sequence length 215
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4numA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4numA02
4AK1A 3FF8A 4OY9A 1ZXKA 3Q2NA 3K6DA 4ZMZA 1EDHA 4AQ8C 4AXWA 2O72A 4ZTEA 1WYJA 4NUQA 5JYLA 4XXWC 4ZMTA 3PPEA 1ZVNA 1L3WA 3LNIA 1OP4A 4ZMVA 2EE0A 4XXWA 4AQAB 2YQGA 2OMYB 1NCIA 4ZI8A 2WD0A 5JYMA 1SUHA 1FF5A 2OMZB 5DZVA 4ZMLA 2OMTB 5CZRA 4ZMWA 2WCPA 3UBHA 3UBFA 2X2UA 3Q2LA 2YSTA 3LNEA 3FF7A 2QVFB 4AQEB 1NCGA 3LNGA 4ZMQA 4QD2E 1NCHA 4AXWB 3K5SA 3LNHA 4ZMOA 2OMWB 2OMVB 2OMXB 4NQQA 1O6SB 4AQAA 4ZT1A 2WHVA 2OMUB 3LNDA 3K5RA 2A4EA 4APXB 4ZMXA 1NCJA 2V37A 4AQEA 1Q1PA 2A4CA 3K6IA 3UBGA 3LNFA 4NUPA 4ZMPA 5CO1A 2QVIA 4NUMA 4ZMYA 4ZMNA 2WBXA 1WUZA 3Q2VA 5KJ4A 3K6FA 3MVSA 3Q2WA 4AQ8A 4APXA 3QRBA
chains in the Genus database with same CATH superfamily
1FO0A 1PZDA 2H26A 2QHRH 2C9VA 4FQXC 1MCSA 2ARJB 4PJ8B 1JPFA 2VLRE 3EW3B 3SE8L 4PG2A 3UYRL 1BW8A 3QULA 2KDYA 2APVA 1EERB 2XTLA 4RISH 2X7LA 1AD9A 1OZTG 3V4UL 1NUGA 5H37H 1KLUA 2NY1C 1LO3L 1A0QL 1PZ2A 3O0LA 4WGKA 4HD5A 5IVXE 1CC3A 3RTQA 3Q44A 3TN0A 3QUYA 4XPBH 5KYXA 1CJYA 1IC4H 1P0SE 1PCXA 3CVDA 3H42H 3IGUA 1MI5B 2VR6A 3ESVF 1R5WB 1WEJH 4JCWA 4IGBB 4WUUD 2ADGB 3SKJL 4DFHA 1JZFA 5BQDA 1CICB 3U0WL 4R7VA 2VR4A 1EGJL 4MMZB 4OUOA 3SDCC 3NFNA 4B5ZA 5GZNC 5IFHL 4IK7A 1PNDA 4AGNA 5DHVA 1RKRA 5EEXA 1TYRA 2R7EA 5B3NA 2V3DA 4P4KB 1KWKA 3ULVH 1ZD6A 3UL4A 3ZHNA 4KVPA 4Z7NB 1P6AB 1OD7A 3BD4A 4IBZA 5J7CC 4G83A 1VZGA 4J3OD 3E6HB 3GHBL 3IDIA 5IMOA 5J13B 3JXAA 1HU8A 3H7LA 2WWKT 5B7MA 1KBBA 3O2WL 1A5FH 3BT0A 2WOYA 5HGAA 3LRSB 2AHIA 2PYEB 5F8RC 2NPLX 1F1DA 3ZDZB 4LSSL 1T1XA 3EO0A 4F91B 1SUJA 3X13B 4PCSA 3FL7A 1UJ3A 4JFSA 5BRZB 3G5ZA 4TUOB 5C2UB 1JJUA 3E2HB 4HUWA 4X7FC 3FT2A 2KLRA 2OBGA 4G80A 4QKTA 2NQCA 4LQ1A 4K7PY 1A1MB 1KJVA 4MCMA 3C09C 5EC2A 4YO0B 4AQEB 4XBEL 4B53A 2P8MA 2CNYA 3AXLB 1T2QL 1S9XA 4Y9FA 2WUCL 4QD2E 1T0PB 1NL0H 5DGQA 2CKBB 4P06A 5I24A 1UADC 3C6LA 1FI8C 3TCTA 3PGFH 4ERSH 5BJTB 4NM8L 1O6SB 4PHXA 5IMKB 3PQYE 5EU6B 4KDVA 3JSSA 1F56A 2H4EA 2NZ9D 3FQYA 1ACYH 1ZGLP 1NGYB 1SXNA 3AS1A 3WE6A 4K4KA 3GJEB 4M48L 2O5ZL 5GGRB 4GEIA 4ETQB 1P4UA 5E9DE 2D3VA 3D0AA 3IPBA 3CFMA 2WY3B 4NERA 4NFDA 3GXMA 1XF1A 3VH8G 1BFOA 5EU5B 4KKPA 2PCFB 3P30L 5GRZA 2NY5L 5IJKA 1AGBA 2EIZA 3V6ZB 1WUZA 2H32A 4YOKA 4S1SH 2EUVA 3JWNH 1IJ9A 5E24E 3CH1B 1T20A 1OSZB 4DZBB 3VU2A 4POZD 2IAMC 4OGZA 1PZSA 5H37G 1JHTB 2IMNA 2BNRD 3JTTA 3QNXA 1JZ7A 2DD8L 3L2MA 3MI6A 3ESMA 3QQ3B 1EXGA 3D48R 3B5GA 4N8VA 2LU5A 4AVIA 1L6ZA 3OKLB 3K6SA 2M2DA 4KDTA 3QO1B 4DSYA 3TA3B 2UVEA 1MFBH 4HJUA 2VERN 1B9KA 1C5BL 2WINB 2DLGA 1BIHA 2AEQL 4EDWL 1KXQE 3N42B 3OX8A 5T3ZE 4MNGE 1A6WH 1CB4A 3EJCA 3LN4B 2K6WA 3TT1L 4BA8A 5JOEA 4AK2A 4HLEA 1C08B 5ACLA 4OKVA 2O1AA 5BZXA 1T22B 3FU5A 3O4OC 1X5FA 4UZGA 4E5XG 1S7RA 4TMPA 5EOCL 5EEZA 4I0KA 4C57C 5C71A 3OR6A 5TF1L 5I1JH 5FGCE 2OV0A 3MLUL 4YDZA 1JDCA 3MKGA 2CIKA 4WW1A 4XBPB 2JF1A 4DTGL 3IGAB 4LBEB 1NUNB 1OCZB 1XGQB 3AG2B 5F6HJ 4GKSA 3S2CA 2FGWL 1NOFA 3ARRA 3SPHA 3VTTA 3O6MH 1MJJA 1AS6A 4K7PX 1N7ML 4EUPH 5TD4A 2C1PB 4XX5A 2EQDA 1A3QA 3F7VB 2KZBA 5CD3A 2ORBL 1FL3B 2GFBB 1JZ2A 4A38A 4Y4HC 3MA7B 4JRXA 1R9FA 2X44D 2PYFB 1X4XA 3H7BB 3GRWH 5F8QC 2XG4A 4GKLA 4M7KH 4UV7L 4XMUA 3H3KA 3C5JB 3X3FL 1MCWW 1UASA 2X2JA 5E2UH 1ECZA 5F9OH 4RMWA 4CMHB 3NIDB 4PI2A 4PJDF 1BWWA 2RIKA 2NDFA 1JWUA 1QTPA 3AAZB 4N6RA 4UM9D 3LPWA 3DRQB 1HXYB 5DVKA 1J05B 4HAGA 1TQCC 3MKKA 3S0PA 3PWPA 5F72S 3C08L 4DWHA 5CJQL 4OJFL 5ICYB 1ITCA 4Q2ZB 2MEJB 4WEBH 3GXNA 2NY4B 4P3CH 1M6OB 2A4CA 4OIIL 3MRRB 3OD3A 3ALWA 4FXKC 5DUMH 5T1MA 3L5IA 3B9KA 4EOWH 4L8BB 5CO1A 3OZ9L 3F04A 1N3NB 3KH4A 4OZHF 1H6FA 1EJ6A 4GQ9H 1BPLB 4RMVA 1GOFA 4FQ2H 1OK0A 4AGQA 3MLTB 5G55A 2GSGA 3GSUA 5C0BE 4Q74A 4W9KC 3BGFC 2R0ZH 3D4GA 1EXHA 1CG9B 3IWUA 4GUPB 3VXTB 4F1SA 1IGJA 1MQKL 4K7PH 2FE0A 3PL6D 2ZAGA 4S1QH 4K8RC 4XMKH 3V7MA 4AZ8A 3W37A 3ARDD 3VUAA 1X5MA 3C8KB 1F1AA 2P24B 2P26A 3QDMA 1CLYL 3MCLL 1S78D 1KPUB 1UURA 1O9WA 2QQNH 3DHUA 2DLFH 4XB3A 4CMMA 1P4IH 5H4YA 1HK6A 4MZ3A 4NUGL 1UWXK 4PRIB 3ME0B 3QZMA 5HI3C 1ROWA 1SFHA 2VLJD 2EE6A 1S7SB 5GGVY 5FYLL 4NRYB 3DNKA 3ZQXA 1NWOA 4MAYD 4HBCH 2QHLA 2VN5A 2D0GA 3B1TA 4PSRA 2H3NA 3O3AB 4UTBH 3ZGIA 1EZVX 2X4SA 2YD6A 3N43B 4DO4A 3KH3A 2YXVA 3ZW3A 4OFYA 1MCBA 4HIHB 1CFSA 4DZ8B 1H3GA 4NS0A 3QRLA 4PY8I 3PIQB 2YUVA 1TVHA 4M5TA 5FYJL 2NMSA 2X5PA 3MCKB 5IQOA 1NEPA 4RDBA 1H9VA 4ORGB 1GS6X 3N6YA 2CO6A 2DF3A 5LAXB 3FB6A 4AE0A 3VFGH 4Y5VB 3GMLB 3VWJC 5CZRA 2A99A 3OAYK 5CILH 2VDPB 2VZUA 2IXQB 4WTWA 4NO0A 1JPSH 2RFXA 1OPGL 4KKCC 3C9NB 2P1YA 2AVFA 1HT6A 3AB0B 1MPAH 3KL0A 2V17L 3PABB 4WCYL 4WNQA 1KLGA 4K3GA 4JM2D 3ILPA 2P5EE 3SYCA 1OF2B 1WIUA 1M1SA 1ZS8B 2A0LD 3R7QA 1AO7A 1OB1B 1PZCA 4XNAA 1K3IA 4YL4A 4C56B 1S5HA 4FHBD 1F3DJ 3MV9A 1F42A 4N26A 1ZGLM 2Y69B 4YSPA 4OI8A 4FCHA 3QFDA 5JHDB 4ZAKC 2XOTA 4EN3A 1MRFL 1NCWL 2LQRA 1M05B 2IAAC 3K8LA 5CU5A 1EAJA 5ISZB 2R0LH 3ARZA 2PXYD 1FBIL 4Z76B 1FLRL 2KH2B 1CO1A 5IVZA 1TKWA 1GR7A 1NDMA 4TVPL 3T3MB 1PG7W 3NSYA 4F3FB 2G9KA 4ZO7A 1O7DE 1N8ZB 5TK4A 3G6DL 3O4LD 3S2AA 3IU3A 5L2KA 3FQWB 1UEYA 2DQIH 4MS8D 3VQLA 2NUTB 3KS0H 4NI3A 2HKFH 4A2GA 2FJGB 1GHFH 1DDHA 1S7VB 2NXYD 5HDQH 5EZLB 1BQUA 3D05A 3KPPB 3AROA 4OI9A 2M26A 4Z7WA 4DAGH 35C8H 4PJFF 5IHZA 5DDHB 1KTDB 2ZUQB 5IBTL 5MEOB 4I4WA 1P1ZA 1R5VB 1F4HA 2A1WH 2VN6A 1UCBH 3KYKL 3HZMA 4JKMA 4ZD3H 3FF8A 4DKDC 4MJHA 3BOVA 3ARWA 3NPZB 4PSPA 1KCVL 1FFTB 1HWHB 3VXUB 3QAZC 4Z7UF 2XWTA 3W2DH 5HI4D 5FA3B 2GW5A 5JMRA 3WFDH 1HH9A 1XO8A 4AXWA 2G9HB 5CFAA 4XP6H 3WY2A 3PWJB 3CFDA 4CILA 1NBZB 1KNOB 4PJDE 5CLYA 1VGEL 2NQDA 3TBYA 4DK5A 1ZLWK 2DM4A 1JPST 2Z91B 3HAEH 1FNGB 4XN2A 1JYVA 3GDBA 2W65B 3UDWA 3TEZA 1KJ2A 4QY8A 5F70A 3OC5A 1H5BB 2DIJA 4ZMVA 4W9JC 3HI5L 2WYHA 3EYSH 1E8XA 1TVDA 4FJYA 3HE6D 3KW7A 3QO0B 1RMFH 4IK6A 3VXOA 5CS7A 4X5WB 5DJ8B 2UZXA 4PGJA 5D1ZD 5A2IH 4IM8A 1JK8B 5KVDE 1SDDB 3A4DA 2NTSP 3VD3A 5SWSD 2WPGA 4C55A 4OZHE 3D08A 1FN4B 1U9KA 5EZPA 1BECA 2ZXCA 4V1DB 3NT0A 3ZSTA 5DC2A 1R1CA 4FDWA 4HOWA 1VCAA 4MB1A 3S34L 1GGCH 3GF8A 1L9QA 3NDYE 1RURL 4U3SB 4G7SB 2JELL 4FMVA 3IN0A 3QXAA 3Q2LA 3V6OE 2YGOA 3N44B 4L3EE 1BQRA 4JZJB 4KXCA 3EUUA 1A4KB 1KB9J 1SM3H 4UT7H 5GGVH 4O2FB 5LUMA 2D3NA 5C6TL 3WMPA 1Z5YD 1JDDA 4OV5A 1P84K 3GS7A 5J12C 1NJ9A 1QX1A 2R2BB 5GRJH 4HJSA 5I75C 1DBBH 2EDKA 3MPCA 5FCUH 1G84A 2LU4A 1TO5A 1XCTA 4I89A 5F9JA 3QQNA 4NFCA 5IB5B 4JKPH 4MZ2A 3FQTB 3GMPA 4K94C 4RETB 5DJ2B 1IGJB 4WUKH 2RMNA 5AVSB 1NAKH 4LSQL 2H26B 5I1LB 5FV1L 5L8LB 1WAEA 4YDKH 1JPFB 3OPZH 3EH5B 1J0HA 1HL9A 4OZ4A 4TL4A 3KPSA 3HA0A 3CSTA 5SWZD 3RVUD 1SJHA 4KKAC 2X7LB 1AD9B 4N85A 4X0NA 1FCCA 4XVJL 3BQUD 3PJSA 1NBVL 2CDFA 2Y7MA 3OKOB 2XNAB 4OCLC 3OGOE 3TN0B 3QUYB 4EO5A 3APNA 5F1NA 2I25N 3HUJA 5KYXB 3TURA 4IOSA 4JQIA 3NZ8A 1HFUA 1LEGA 4BUGA 5I5MA 3RAJL 3RPIA 3HAEG 3A3YB 1UQSA 3U6XA 3RGVA 2EIDA 3M7OA 2M83A 3TZVA 3QCUH 3FN9A 4CVXA 4KGLA 3NJGA 5DHVB 4A6YH 2GK2A 2R7EB 5LXVA 2UZIH 8FABA 3V0HA 3ARVA 3GSNA 5JO5A 1DBAL 5DHEA 1OTUC 4Y9GA 2A7BA 5E70A 4XNMA 1C9SA 1EHXA 3GKZA 3IDIB 3RILA 3H3PL 3L6FB 4A04A 3D8MA 4NKIL 3EJRA 4PWIA 3RJOA 1HDMA 1RSYA 5HGAB 1FNSL 2Y5TA 2C9RA 1YN7A 1OW0C 2WIIA 2XQ0A 3EO0B 3KM1A 1UJ3B 5GGTL 1MFVA 3B9VA 1RZGA 3G5ZB 3KLKA 5C09A 2LV4A 3PS6A 4HUWB 5IQ9A 4XMTA 2UUDK 1S7UA 2YJQA 3NH7H 4PJ8C 3W3BA 1SDAB 3M17B 3SY0B 4XNXL 4DVRL 2Y06H 3S96A 5A43C 1HWGB 1KJVB 1NC4A 2QSVA 3CQFA 5HHXH 3UTPE 2IALA 4B9IA 3H4HA 1ORSB 1K5NB 1U3NA 5GGQL 4ALAC 4BZ2L 1SQMA 4ZS6D 3KPLA 4PJFE 2IWFA 1AJ7L 2YEZA 5C7ZA 5C9KA 4M62L 1QPXA 2A9MH 2OX5A 3IB4A 5DS1A 4D0DB 1DBJH 4H0LC 1HHGA 1PCSA 4BSVA 4IGBC 2XETA 4PCTA 3S36L 5EUOB 2OAAA 1QFWH 3N91A 3QR2A 3QZOA 4MBOA 5AW1B 4JY4A 4Z7UE 4KMTL 1XZWA 5DWUL 3WE6B 1XHHA 4MMZC 2Q3ZA 2FQDA 3MU3A 4G7VL 4DJMA 5AW7B 1RCYA 2F19H 5IMMA 1IZKA 5DMKA 5KAQG 4JHWH 4YSOA 3TV3H 1BFOB 1YY8A 4P4KC 2OMXB 3UADA 3AWGA 3H1ZA 4I3SL 1AGBB 1BVNP 2EIZB 2FH8A 2Z8WC 3MRBB 4M5ZH 3O9WD 1CBVL 5M95B 5J13C 4NZRH 5TF0A 1EEYA 5J6GB 4QOKB 4Z7VA 3BKCH 4X5QA 8CGTA 2VSMB 1UXMA 5B4MC 4N0FA 1D3CA 1W72A 4FFWD 3MBEA 4JCMA 2GCYA 3P4OA 3QNXB 4H8UA 3HMXA 4UV4L 3ECUA 4G8GE 1R3LA 2ZOKA 1QP1A 1VFBB 4A7GA 5TQ0H 2QSCH 1B4TA 3S37H 1YMMD 1ED3A 1EHNA 2OMWA 3A67L 3E2HC 5AVZB 1GJWA 3K6SB 1FZJB 5GZOD 2IG2L 5LBVA 1JBJA 2OZ4H 1XSKA 2X05A 4GI6A 2XHNA 5C08E 1M3JA 2Q3XA 4LCWA 1WO2A 4X6CF 4FI8A 2Q8AH 4L0YA 3OX8B 2PCYA 1Y6MR 4YDIH 4P2QA 5D6DC 3H85A 4BUQA 1A14L 2BY3A 1MCLA 2LLLA 4NBXB 1J18A 4J3XA 2PR4H 1ZTMA 2FATL 3HLAB 3KXFE 2W0FA 5KVEE 1S7RB 2K78A 2WKGA 2Z34A 4XCFH 5FKPA 3EFFA 3O2VL 5BRQA 4MB3A 1P53A 5ESAA 3OR6B 5E2WL 1D6EA 3GZQA 5IBUG 1MG3C 2HH0H 5GGSY 2I5YL 5D1XA 4WW1B 2CBTA 3SQBB 1I1CA 2A73A 2ZWLT 2ZD0A 1URIA 3DO3A 4ABWA 4GKSB 4OM1L 4PUBL 5AUMA 5E8NB 5DVMA 1EJFA 2VLKA 4Z77B 1J1XH 1G9HA 1MJJB 2JCCF 3CK0L 1J0JA 2NX5A 5EIIA 4OFVA 3D25B 2BVOB 4O2CA 4PJ5B 3BPOC 4NQDB 2DLEA 1SY6H 2ZSVA 4G6JL 2D7QA 4KVNL 3CVIL 4JFDD 4Z3GA 5EF2A 1XCXA 1AXIB 2XQBH 3TXAA 4WO4A 3O0RL 4GUCA 2CU9A 1JPEA 4N90E 4RRPM 3TA3C 2CDEB 3AACA 1QBLL 4ZZFA 1JWUB 4JPWH 2AK1L 4F58L 1MUJA 5E5UB 5IHBA 3CMOL 2YSSA 1IFRA 1PL3A 4NC0B 4XNZB 3RWDA 5HDBF 3QNYA 3IF1A 2NCEA 3PWPB 3BWUF 1VACA 1BZ7A 3NUKA 4P5KB 4RX4A 1LP9A 5JQHC 2CXKA 3F7KA 5T1MB 3B9KB 1HEZB 1GGBH 3WEOA 4LLUA 5BXFA 5D7KE 3LNHA 1A64A 1YYLH 1WT5A 2UZYA 2VRKA 4NKDB 4X7EC 3QDJA 4G3YH 3UMTA 3LB6D 1TTBA 1E90A 2H1LM 3GJFH 1MWAH 3GSUB 1NBQA 1EFXB 4TQEH 1J8KA 3I9IA 1EAOA 1SRDA 1BVKA 2RH0A 3DMMD 3F7LA 4KI5C 2V7NA 4WFHD 3T6WA 4ZMXA 1Z9LA 3H2PA 4IOFC 4DKFH 5SV3A 3B2UC 4EMZA 1S7XA 4MD5A 3ARGA 3WJMA 4U3CA 3QYMA 3KEHA 2DIEA 4ZMYA 5T1KB 4KNTA 4MAUL 3JT2A 4G9FB 2MPVA 2V2TA 4HQQL 1J1PL 1WBZB 3QRGL 4CMMB 5IM7A 1HXMA 1YC7A 4GBXC 5H8DA 4YX2L 4EBQH 1YDPA 5AZEL 1DHKA 4CMHC 1VESA 3CZLA 2WO4A 3KJ6H 1G1CA 1GY1A 3APCA 3DIFA 3FTWA 4IJ3B 2JKTM 4XP4H 2HPOA 2BCMA 3V0DA 2OSLA 2ARJQ 4BJLA 5HYFA 4TSAL 1N18A 2X3BA 3MBWA 3T0EC 1AHMA 2XJKA 3PCYA 2BP0B 1MHPH 2X4SB 2ENPA 1CIDA 2NY4C 2ZCZA 1B4LA 3QWNA 4DK6A 4DGUA 3RX5A 3WOVA 1CFSB 2LTQB 4KX7A 1LLAA 1DE4A 3K0YA 2L7QA 1KB3A 2Y5QA 3HC3L 5ITFA 3U36A 2BNRB 3BSZL 4Z7QB 1V7NH 4OZIA 1FYTA 4HIXH 5E6ZA 1E9OB 5DFVD 1MSPA 1T89C 1QRNA 1WC7B 2CO6B 3FB6B 5C07D 1C7SA 4PJAA 2YQGA 3IDYB 5IQMA 3EFDH 1YQVH 1RVFL 2V5RA 5F0JB 2VLLA 3TVMD 3VXMD 3O45A 1KLGB 1N0LB 3B3IA 3JZYA 3ILPB 4GAAA 5C0CB 5FV2A 2FR4B 2XTSA 4GAGL 2CR0A 4PJCF 4QTIH 5KN5A 2GJ6A 3F8UB 2EDFA 4XC1L 5DR5L 5HTSA 3BRDA 4NNPH 4HWZA 4HJEA 3HN8A 4JDTL 3MV9B 1JXJA 1BV8A 1YNLH 1FFRA 2CPUA 4LSUL 2E8YA 4EN3B 1W0WA 1T4WA 2K3HA 4H25A 5T5FH 3VCLB 5B1AB 2EH8H 4KMQA 2E75C 5E5MA 5G4NA 3VGFA 2YPLE 4ZQKB 4QAWA 5CZVL 1CF8H 1WISA 1HAWA 3MNVA 4XX1E 1CXEA 1JS4A 4AYGA 2R69H 4WVRA 2LFGA 5LO7A 1AYRA 1QLFA 3HLKA 2EH7L 4KY1H 1OSPL 1FNEA 4JN1H 3SGJC 3SOBL 3IU3B 5TE4L 5L2KB 3FFDA 3FB8A 4GXUN 6CGTA 2HRLA 1C5CH 4GO6B 5LWYL 3DX9B 1X5ZA 4OIFA 5KSAA 5ABZA 5DJ6B 3HJ0A 5IHZB 3OJ2C 4K8RH 2JCCE 4I4WB 1P1ZB 2HT3C 4X6FA 5FM5M 5HHOD 3HZMB 1YECL 5IROD 3AB0C 2K7QA 4O9HL 3X14A 4B7LA 2XWTB 4HKZA 2EEFA 3MRQB 1OAUH 3L5XL 1WAAA 1JF6A 1LDPH 1PD0A 4RMBA 2XLLA 4YWGL 1PS3A 1JP5A 4HETA 3PU7A 2GT9A 3CLFL 3AQZA 1JZIA 4F37F 5DRZA 1PLCA 3L3DB 1SZNA 4LL1A 4LSTL 3TBWB 4YHZH 5A6LA 3TTYA 1CWVA 1KJ2B 4QY8B 2YD8A 3HI1A 3MMEA 5HDBE 3C75A 2G5BA 3JQOB 3BKYH 4FP8L 5C97A 5F7NC 1UH3A 1XGTA 2OMVA 3T65A 2YUZA 4YZFF 1NCAH 4ORZC 2QFPA 3MLSL 4ZUWB 1IO4C 2OL3A 3FQXA 3L5HA 2V7HA 4KNSA 4XVUC 3ESPA 4L4JA 2X88A 1NINA 1ULVA 3A47A 4G9DA 4HIIA 2BSRB 3V5DA 1QFWI 2TAAA 4ZK8A 1D5MB 1EUTA 2MCAA 1KXTA 1SLXA 4G8FA 5DFTA 3QI9D 1P4BL 4JY5H 4PPTA 1VKXA 2ZUQC 4N1HB 4I1RA 4LSPH 4UUJA 4Z3IA 2JB6A 5IOKA 1G7LA 3I6KB 3D9AL 1SDYA 4RAVA 3IS1X 2BNQA 3QXAB 4JAMA 1OGAD 1W6LA 5FECB 3BH8A 1CMOA 2Y7QA 4IBWA 2P9RA 1AMYA 3CVHA 3HZKB 1SJMA 2XWXA 2ROYA 3CHPA 3T2QA 1T66D 3WIIL 4WDIA 3M6DA 2AXGB 3WI9A 5KJRL 5HHME 1NUDA 3GSOA 1ZHKA 4BZ1A 3N1PC 4OV5B 1GCYA 4LHUA 1KYFA 1NMCC 1RJYA 1K8DA 2F7PA 3EADA 4HIEA 1YAZA 3RYMA 2YC1A 1EGJA 4TUJB 3ASNB 5CAYB 2TSAA 3ARFD 2P45B 1XEUA 2B4CL 2X1OA 4GIAA 4WHCA 2EYSA 1H5BC 2YD4A 4WI6A 4OGAD 1CS6A 1QNZH 4KKQA 3KLHD 1XGRA 3DPBA 1EEQA 1RERA 3GMPB 4K3DL 3TBCA 1INQA 1P7KA 3BXNA 1MREH 4Y7OC 5C0GB 3S88L 1Z7JA 4P2OA 4UQEA 4OZ4B 5F1OB 4R8WL 5M7QA 3LKQA 1CDHA 3MJGX 3SBQA 3INUH 3SKNA 3V7AE 1CGTA 4XOAA 1WWAX 2N01B 3HVNA 3QARA 3B2VH 3KYNA 5B1JA 32C2A 3HG1A 2FJSA 3D87B 3DECA 3SE3C 4Q9BA 3UJJH 4H8VA 5F1NB 2B16A 3LHAA 2YFOA 2GSIA 4KFZC 5IK3B 4IBVA 3NZ8B 3L4WA 3Q01A 5CLTA 2F1AA 1BF2A 1FJ1A 3WNLA 1LEGB 4AEIH 2B5IC 4HFUH 4DQAA 3GSXA 2BLFA 5ICXA 1UQSB 4PGCA 2XV2A 4RFNC 3RWEA 3TZVB 3B2XA 4ISVB 2AJUL 4JZJC 2A38A 3E0GA 2X4RA 1Y6NR 5IWLA 4PJIB 4UU9B 1FAIH 1BQKA 3ZKMD 3BDYH 2MPAL 5D93B 8FABB 1NIBA 3GSNB 1PD6A 1AKPA 4FQLL 1FFOB 4PJ9D 4Z0XA 4XNMB 2C8NA 4P5TC 3ZYJA 3AU0A 2R2HA 2F2HA 2YFNA 3CDYA 4NN7C 2XXMB 1HDMB 4LAQH 4P59L 3BN9C 3SCMD 5JXED 4ZFFB 3NAAH 3TT3H 1CFQA 4QRPE 1YN7B 3QDME 3DXAA 1ZLVH 1GKEA 2C9AA 3QNZB 3MSPA 4M03A 2UWEA 4NWTL 4LOVA 4OI7A 5IQ9B 2HLAA 4MWFB 4OD3L 1S7UB 2D7TH 4HPOH 1SHWA 3S96B 4YBQC 4PG2C 2V33A 5FYKD 3QIWA 4Y88A 2EE0A 2ZKXA 5AAMA 1PG7X 3QUXD 4XB8A 3OLDA 4DUVA 2WB7A 4WWKD 3JWOC 3RTQC 3TN0C 1RJZA 3QUYC 4F15B 2D7OA 1S2EA 2QZQA 2OX5B 5I6MA 4OQ1A 4BSVB 1RK7A 3LY6A 4AKPA 3TWCL 5FYKU 1A7RL 1U3YA 3RY6C 1B0GA 4X8JA 2EJ1A 2FBRA 5MHSD 4JG0L 1A7OL 1V27A 1WDAA 2WJ5A 1N0XL 4M7ZB 4X8GA 3VW3L 1VADA 3CVCA 3L4UA 4X2UA 2QDWA 4WNJA 3LEXA 1YY8B 3Q6GL 1R17A 1DLFL 3DIVA 4OM0H 4ZPVB 3LSOA 3T4YB 4M6ML 1EEYB 3HHSA 4Z7VB 4EIGB 3LQAC 4ZUVA 4N0FB 4U2YA 1W72B 4K94H 1JNNH 3MBEB 4L5FH 2GCYB 3P4OB 2CHDA 1P7QD 4HUUB 3HRZB 1RUML 5E4IA 1DJIA 1R3LB 2ZOKB 3KW8A 2N0MA 4JDVA 2W60B 3KWVA 4YZFE 3UABA 2AQ1A 1UJ3C 3LJ3A 5MENE 3RZWA 2AJ3B 2OMWB 1AO7E 5F7EL 1GAFH 3L5WB 1R3HA 1EDQA 4MNQA 1CDYA 2BDNL 4CKQA 2HVKA 4UQCA 2FUQA 3QWOA 3UH8A 3QUML 5AW5B 4LCWB 3OKMA 1VB9A 5ADPH 1ZANH 2WBJD 4R0LA 1ZTXH 1OGPA 4TNFA 2IH9A 3C6LC 4P2QB 3ATDA 2PP7A 1FLTX 3KPRE 2D9QB 3D2UD 2NXZC 5K9QG 3T4AA 1XD1A 5IEKB 5HDRA 3DARA 1AGFB 4PJ7F 1MZYA 4Y89A 5FKPB 1RZJC 1G1KA 1MXDA 3K1DA 3EFFB 4HH8A 1UM6L 5ESAB 1BQHG 2C26A 2BFVL 4X7TA 2J1KA 4QCIB 3IDGA 2C4FU 5D1XB 5I26A 4AK1A 4XP5H 3MJ7B 4EZLA 4Z3TA 1IFHL 3UTSE 3CAFA 3DDFA 5AUMB 1AFVL 2BVUA 4UQBA 2VLKB 4Z3JA 1TDQA 1T7VA 1XVSA 3K2UH 3HRPA 4G59C 1MIEL 5F96H 2Y6SC 4DPCX 2VDQH 3HEIB 4O2CB 5I8CA 3VFNB 3FT3A 3F12A 4TM9A 5D7LE 4HCRL 4NXSA 5D1QD 2HRPH 3MODL 2VC2L 4D3CL 1SMDA 4YLQT 4KDTC 1ZSDB 4R5TA 4K55A 3RWFA 2OULB 1VZIA 2X89A 5FO9A 5SX5K 5JIHA 4ALAH 4EIBA 5ADOH 3VD2A 3GSVA 2VXTH 2JJUA 5EEUA 4A63A 1MUJB 4JFXB 1AHWA 4X42A 4MXWH 3WENA 1SXSA 2O30A 3RWDB 4A7GF 3EBGA 3LAFA 4BQ8A 1RY7B 1AZBA 1NGWA 4OCSL 2WLLB 1RPKA 1VACB 2ADJA 4IBSA 1BZ7B 4OJEH 4FYRA 2ENJA 2WQ8A 1LP9B 1A3ZA 3MNWA 3U0PB 2WLHA 3QFGA 5HD8D 5LLIC 3ZIYA 3HI6L 2V2XB 1OLZA 2MNUA 2NNXA 4KXBA 1G6RA 5EA0H 4JRWA 5BXFB 4TUKL 2HZHA 4ZX4A 2UZYB 3PFUA 4R90H 3ZTDC 1KFAH 3VDCA 5CF3A 2BXZA 4NQVB 5AG8A 3FN0H 1XWVA 5BZDA 2QTEA 4JO4L 4N28A 1OHZA 4JZOA 2P46B 4JPVL 5MERB 3IKKA 3F2LA 2V7NB 4FQCL 4WFGE 4OCYH 2Q5BA 4WAFA 4FA7B 3NP4A 3FC8A 3KPQA 5ACMA 3KWWA 5CJBA 2IADA 1NCHA 5ELIA 3WN5A 1S7XB 4M61A 3WO4B 3ARGB 3WJMB 1WZ1H 3MV8E 4NJAL 1IAKA 4KROD 1HSAA 5A7BA 4HZLA 2EC9U 2AW2A 5BVPL 1JRHL 4E9XA 1BEYH 1HXMB 3CG8A 3STZB 1YYMH 2P7TA 3BVVA 1VFUA 4U4IA 3GINA 2WP3O 5GS2D 1UYWL 2J8HA 2VC2B 5KS9A 4N2IA 4JFEE 2CKBH 4MJ6B 5B3JF 4U6YA 4UBDC 1LEIA 5ERWA 5LAPA 3TO2A 3FOMB 1Q1JL 3A6CH 4ACPA 2MTPA 4P46A 1U3JA 3FCTB 1QHQA 5E6YA 3G5XB 2OSLB 2CSPA 4LGRB 5CHNA 4YSRA 3DI2B 1CE1H 3HNTH 4XNZC 5KG9B 4B50A 5TQ2H 2VH5H 4NHUB 2RQ8A 3KPSE 1O0VA 3CX5J 2QMKA 2OTPA 4NZTH 2XKNB 3CXFA 4N1EA 3B9KC 3QRBA 5HDWA 1DE4B 4I87A 3ULSA 1IQWL 2MCPL 4UOQA 3EOAB 4GP8B 1L0QA 4PRHA 4AQOA 1FYTB 4MXQC 5DRXB 3B34A 1QRNB 2H2SC 3VI3A 2PPEA 3US0A 1CDCA 3ULUD 1S7QA 4DGYL 4QUOA 5EH1A 2H2PC 1KCLA 5DVOA 1FUNA 2I07A 4OZFA 2F7OA 3V0AC 2VLLB 3O45B 2W07A 1P9MA 2WWNA 1A9EA 3NCEB 2A9CA 4PBVC 2XXGA 5I5IA 4YC2C 3F3HA 1IE5A 2GAZB 5AZ2H 4OCRH 1JZ4A 5KN5B 1WP6A 1XMEB 4YSSA 5KSVB 3BE1L 4IJ3C 3BCDA 4KUZL 5GJTL 4JJ5A 1Q0XH 4H25B 1JGUL 2WKOF 4M1GL 4CL7A 3FT4B 5TPWL 1U8HA 5C09E 5AQ0A 2OJZH 5D6CB 3S7GA 4PJ7E 3U2JA 1X4ZA 4LMQE 2WVSA 5D71H 1GOHA 4Z0BH 1NFDA 4LFHD 1QLFB 3ROLA 1BLNA 3NA4A 1FNEB 4HUXA 1U8IA 3IU4L 4TTDC 4KJQD 4ADGA 3ML9A 4R3SB 2BXYA 4FQQB 2BWDA 4W4NA 4A2EA 5KSAB 4HMEA 4AW4A 5H2BA 1EH9A 3O2DA 4S11A 1QA9A 4X6FB 4XNYL 2XIIA 1TCMA 1ML0A 1WK0A 2YGPA 5DFWH 3K5SA 2Q7NA 3X14B 3BSHA 1USZA 4HKZB 5ALBH 4IRSD 1FSKB 1PPIA 3N9GH 4J1UB 4Q6IA 5K9QI 1X7QA 3OAWA 3LIZA 1YJDL 4M7JL 5G4MA 2Q86A 4QEGA 4EJ1C 4OCWH 4F93B 2BERA 4LPVA 2F58H 1IM9A 4YDVB 3VFWB 4M6OH 5D7IF 3MNDA 4KU1A 1BAGA 4EN3C 3S3PA 4G72B 4ZTOH 3HI1B 1Q8MA 2OZNA 3MMEB 3CDCA 1QFPA 2G5BB 4XN1A 4AYMC 3DSNB 1RZ7L 2EKSA 3CFCL 1NMAH 2CIIB 3ECBB 1XGTB 1CVSC 1LWRA 1OQOA 3BRGC 5F7WC 5KVGL 43C9B 4WKZB 4XCNB 3RFZA 4LCCB 2GABA 1NAMB 3FQXB 2IGLA 3ZHDA 2C4XA 3TP4A 5L6YH 1ZWIA 4ZXBD 3ISWA 1QSEA 1SOQA 2IQ9L 4YJZL 2DTMH 4L4VA 1HCFX 4G9DB 4HIIB 4OLYL 4JFZL 2G5RA 3V5DB 4I1NB 2EIMB 1HL4A 2FSEA 4AUUA 5CSZB 3FYIB 1KXTB 4YVNA 1CFVH 3DVNA 4G8FB 4HA1A 2IV8A 1I8IA 2X4NA 2EDRA 3CFBB 3D12B 4KAQL 4LLWA 4PI0A 4UUJB 1NKGA 5BO0D 1G7LB 1A47A 3OWEA 3MA9L 1USQA 4RAVB 2BNQB 1AR1B 4F7MA 5IB4A 3UG4A 2E9WA 4M1DH 4Y4FA 3BH8B 4M8RA 5CD5C 1GH7A 1HZHH 3I6LE 4QKXB 3IDXH 1B9ZA 2CCWA 4OR1A 2QV2A 3BFOA 4XN8A 2BIQA 3THMH 1MIMH 1LVEA 4MASA 4PV9B 3DI3B 4FFVC 3GSOB 1ZHKB 3WNPA 5B3JE 4OLXL 4R9HA 1A9VA 1GZQA 2RCSL 1RJYB 4JL2A 1K8DB 4J7RA 1H3PH 4HIEB 2XU9A 2YQ2A 2OP4L 1ZLSL 2JJTA 2VW7A 3NCXA 4P2RE 4TOYH 4F57L 3UDWC 1JFQL 1T0MA 2WWMD 2EYSB 3WHE1 4GB9A 2WVVB 4Q97A 2VDNL 1XGRB 2ZP8A 3DPBB 5I28A 2BVEA 4BHUA 1INQB 5DTFA 3BXNB 1UM4L 1U3HA 2AI0L 1GSMA 4LP8A 1CDJA 2M8XA 3GEWB 4P2OB 2Y4SA 4R84A 2H3KA 2GJRA 1LDSA 2FQFA 4NZDA 4UB0L 5D2NB 3DROA 1H15A 3MXWL 3C2AH 4X0KA 5C0IA 4ZO9A 2EC8A 1GYAA 2P49B 3KYNB 5AOMA 1TQTA 4HXBH 1HAUA 2V4LA 2VDPH 3FO0L 3DGGB 1AH1A 2DWSA 1KB5L 2MIZA 1ID2A 2BOBA 2GSIB 2W9EL 1EO7A 2W9DH 3PNWA 4H26A 3IJSB 1TZ8A 1KJMB 5LJYH 4BKLA 2ITEA 3GSXB 1IKFL 1PVHA 4PGCB 2W0KA 5FW6A 4FI7A 5E0QA 1UWGL 3WLWD 3D4ZA 2X4RB 3QDJE 3UEZA 1LO5A 2J4WH 3FUNA 5DYOB 3OAUL 1T6BX 1KBKA 4K9JA 5T33L 4JMNA 4PW4A 1JHKH 2E74C 4Z0XB 2DQCL 2R2HB 3MR9A 2X4UA 3L1OH 1UWXH 3KBEA 4YDNA 4YSTA 4OF5A 4ZUTB 4UOW0 3ZYZA 1DQLH 3MNZB 5ETUA 4IBYA 5DD3H 3DXAB 2UWEB 2NZ1A 4FQIH 4HHWA 3TFKD 4O02L 3H9SD 5TH2A 4FZ8L 4BQ9A 2HLAB 1UH4A 5GS0D 3AABA 3GPEA 3REWA 1R0AL 4NCC1 3L45A 1QLRA 2DEWX 3N55A 1N59B 5D7SH 4X8XA 5AW8B 1J8RA 4M3JA 4IKLA 4GT0A 4OZGA 4N0RA 3FTUA 1CXKA 2NY0D 5AVUB 5BUPA 4K3JH 1TTRA 2HJKA 2VISA 2PW2B 4K07A 5EWIL 1RJZB 2QELA 4ZTPH 4Z3HA 1DDTA 2YARA 1LM8V 2Y7SA 4X8JB 5JHLH 5CKAA 2YN5A 4FTVD 4MA7L 2E6QA 4R2GC 5L7XL 3TZVC 1VADB 3K8KA 2IC2A 3B7RL 3GS4A 4RGOL 1IT9H 3UGXA 2R83A 3S9DB 4ENED 1AD0B 5DJAB 5E4EB 4HWBL 4MA1B 3EDEA 1JYWA 4KOBA 1NIDA 3LEXB 5D93C 4XBGA 4Z8FL 3QUZD 5D7IE 4PP1D 5E8OA 3LSOB 4JFUA 1BBDH 1SUHA 3NZHH 7FABH 1MKFA 3HHSB 1RFDH 2W81C 4G1MA 2EDEA 4KI1A 5IIEA 3VFMA 1MCCA 5J6HA 5BUAA 4JDVB 1AIZA 3UXFA 4HJJH 1RHHB 3ASWA 2GJ6E 5GGUB 1R3HB 3PWNA 4NLAA 4RMTA 4FG0A 1PLBA 1QSVA 2DW5A 4O02B 3NZSA 2FJHA 2VIRA 2OTWA 1PKQA 2E56A 3S8GB 1CE6A 3AY2A 1IKNA 1OGAB 4R0LB 4DCQA 3BKML 3FRPA 2V5TA 3RZCD 4OFQA 4N25A 1GS8A 4F15C 2L7UA 3QG7H 4ZMOA 2E27L 4JFHE 3FFCD 3ULVD 2FNWA 3FRUA 4XCEB 4MHHG 4Y19D 2DV6A 4HUMB 3P11H 3NTCL 2D4FA 1L9OA 2JI2A 5C92A 1BJ1H 4X7TB 2YBGA 3IDGB 3WHXB 2NNRA 2XWBA 4FNUA 2CBQA 1I1RA 3QQ9D 1OAXL 1UXLA 2W91A 2ZF8A 3HG5A 4F92B 3WFBH 2GPZA 3MYZA 5FYKL 3E8VA 1WRFA 3CZSA 3RX8A 3FUDA 4Y4KD 3RX7A 1I9RH 5AKSA 1ODUA 1R19A 3P0GB 1NCUA 3MBEC 1FO0H 1ZLWH 4I2XA 1MRDL 4RWYH 4ELMA 1N6QH 4KK8C 3F12B 3NJFA 1GPOH 2IQAB 2KYIA 1CYXA 4NSKA 3UJIH 4GXVH 3SE4A 1HCZA 3PAZA 4WJ5A 1XGPA 5F1SA 2EUZA 1NGQL 2WTPA 5C2BL 1JAEA 2BSEA 3RWFB 2E9GA 3B8YA 3JWOH 3KJ4B 2B14A 4WKXA 3BO8B 2ZCLH 2HG0A 5GRVL 3VACA 5B38G 4ZTEA 1C12A 4Z23A 5JZ7D 1OIOA 2YRZA 1CYWA 2ZF9A 4NN6B 4Q56A 1U0QA 4N9OB 1DVZA 4HHAB 4K2UL 3T8MA 3PWVA 3H3BC 1NGWB 1TJHL 3LPGA 4L8SB 2ADJB 3GMMA 3BH9A 4N2CA 2DI8A 1NLDH 1IAIH 3MLWL 3BYTA 3MNWB 5DHVH 3EDJA 4NT6B 1X7SA 4NENA 1I1AD 5D70H 4S10A 1GYVA 5DQJB 4ODTL 1YMHA 3EH4B 4ZUSA 3GBNL 5D1XC 4OGXH 5C9JA 3UAJD 2WUBH 3CUPA 1F6LL 5BZDB 2AK4A 5MI0B 2ADIB 1QYGL 3W5NA 3DSFL 1F41A 4JZOB 3LQAH 1OCWH 3S5LA 2J73A 5CGTA 1A6UH 2R1XA 3J2PA 3LZFL 4NBYB 1CLOL 3NA9L 3X1NA 3KPQB 4XN9A 3KWWB 4B9FA 4G6MH 3WN5B 3KL5A 3U4BH 5FC9A 3WLBA 4BE5A 1IAKB 1M53A 2WYTA 3CXHK 3L9RB 3BP6B 1AG0A 2ZUVA 4HZLB 3LHPL 5FM8A 3GYRA 4F20A 1IBZA 5HJ3A 5AVTB 2WK2A 1TXKA 3MRJA 4LNRB 3VTMA 3SPJA 4WI7A 3QXUA 2AZUA 2E6JA 2YAOA 1G9ML 1LEIB 4U6YB 3TO2B 4WJG3 4HKXB 1TYEB 2XN1A 4P46B 1GTNA 5EO1A 1KBGH 2KLSA 2ICWB 5DQ9B 1TZGH 5JIQA 1CGSH 4DEWA 1RZJH 3VD0A 1XF3A 3MOAL 4ZW8A 3NMEA 3GIVB 5DHYA 2F68X 3ARYA 4DETA 4GSDH 3QDGA 3QT2A 3US1A 2V37A 3K71B 7PAZA 5FW8A 2XN9D 1V8HA 3K4ZA 5C07B 3QORD 5B39G 5E08L 1S9KC 3M07A 2DYRB 5DMIL 4X4YB 3U6RB 2O5YL 1N5YL 2EZ0C 4KQ4H 1CFNA 2XZQL 1P7QB 1WT5C 3BGMB 2H32H 5DVLA 3RIKA 3ULSB 4EIZC 4HGKC 3CPLA 3F83A 2WZPA 2VKXA 4DN3H 2ZAHA 1QNIA 1XB8A 4JG1L 2AXFA 3VI3B 5E1GA 2L4OA 4XAWL 1SEQL 2ZUTA 1S7QB 1YEKL 1ZVSA 4DIXA 4R7LA 3ARDA 4MB4A 4OZFB 4RDQF 3ECQA 3N06B 1ET7A 4PU2A 2VDMB 3WO4C 1GIGL 3ARGC 3P4LA 5JW5A 4FJZA 2W07B 4W9EC 4AGLA 2EDJA 2ZX6A 4MMYA 1I9IL 3F7QA 3TNMB 1MY5A 3D3VA 1BZ8A 4PRNA 2CHZA 4R5XA 2VLJA 1A7QL 1AI1L 1JN6A 2XTJC 1NC2D 4WY7H 5EULV 3ZKNC 1UD4A 4GEJA 9CGTA 2UUDH 5CSBA 5L4MA 5DC4B 2Q2LA 1O5PA 3CLWA 4JJ5B 3SDXF 6FABH 4J5VA 4E5XA 1ASQA 4F8LA 1J11A 2R59A 4TYUA 4UQAA 1ZT7A 3PUCA 1NPJA 1H8SA 3NEXA 1U8HB 4NC1C 5DMGD 4JDEB 5DLLA 1RULL 4L4TB 2JKNA 3VMNA 1TQUA 4S2SA 1UWFA 4YQXL 1CD1A 4A66A 1NFDB 5FKAA 3WIHA 4NJ9H 3HR5A 1BLNB 5TDOA 4HUXB 2V2WB 1YUHA 4KPHH 3O8XD 1U8IB 1FCGA 3U25A 4XX1G 1BVLA 2ZWYA 4CGUB 1T7ZA 5FWQA 4X9HA 1ETZA 2F54D 4TSCL 1FV1A 1M9SA 4CSTA 1NMBH 4FFZL 1TOXA 4LEXL 2XRAL 5I1EH 4I77H 1QLEB 4YFEA 5H2BB 4IKIA 2N7AA 3FSAA 1QA9B 3FW6A 3MRKA 3LQZA 2YMXH 3CBKB 2MQ0A 3CIAA 1OAYH 2VL5A 5F9WB 1FGVL 2FCBA 3BAEH 2WCPA 3QHFL 1H3VA 4RGMB 5KEZA 4JFFD 3E1F1 3MX0A 1MJUL 4ZO6A 4RSYA 2DL9A 5J9PA 2ICEA 4N2FA 2Q86B 1BXUA 4GSUA 2NNAA 2YD9A 4Q0XL 3I02A 1IM9B 1MG2C 1UEMA 1GGIL 3CFKB 4GP4B 1DVQA 3FZUD 1KC5H 3RDTB 3ISYA 2FECI 4M6NL 1R3KB 3IE9A 1LWHA 1PZ5A 2C9QA 3LZOA 4QHLB 3WNJA 4K71C 1PLAA 4AV5A 2EKSB 4C8XA 4B96A 1KGJA 3O4LA 4MNQE 5JOPD 1RUPH 1GZHA 3O3BA 3BLBA 2B8OT 5DQDH 3MREA 2ZZUT 1T5XB 1YNKH 4N8VG 4GYBA 4A2FA 5I74B 1W16A 1QSEB 1T2XA 2IWEA 4UIKH 4L4VB 1Z66A 4BKTC 2HT4C 1HCYA 4ZNCD 3G5YB 1JGLL 2YPVL 2VZOA 4K9EH 4P23D 2FSEB 2YOCA 4MDRA 3VGAB 5KSAC 1ICTA 4HGMA 2X4NB 4LLWB 3GGWA 4YHML 1R6VA 3DHMA 3BISA 3CFJA 3Q06A 4K15A 3LV3A 4OJCA 4CC0A 4RQQA 5BOJA 4F7MB 4PR5B 3C6SA 1DJYA 2ITCA 1E4XH 2VUYA 2WZ0A 1FSKC 2DMCA 2EEBA 3GBEA 4B9KC 3BKJL 1GTFA 2CUAA 3LZQA 1JTTA 2YKLH 2YPKA 4NP9A 1LEKA 4XVSL 5A2CA 2Q1EA 1RHFA 4Z78A 4E42A 3KNBA 4YGVA 1D5RA 4NUQA 3G5WA 1CFTB 2J6EA 4PJBA 1DQML 3MRGB 4MCZA 1IIIA 3GMQB 3IJ8A 1KENH 4IRJD 2DI9A 1T0MB 3T3PB 2WQUA 3PGCA 4XZ4A 3ATBA 3QSKB 1TMQA 5EU4A 4NQSB 1XCQA 1BD2E 4RLDA 2XA8H 3F7YB 4UT9L 2RBLA 4AQAB 2Y6TE 4KRPD 3JWDC 1U3HB 1L6XA 4P57A 3SE9H 5I1GH 1KYAA 4UZSA 2BK8A 5CJXC 5I0DA 2VXQL 1I85C 5C0IB 3C87A 2OTUA 1H15B 3DROB 2OI9C 3P73A 4U33A 2J8UF 4KZDL 1NFKA 3QGVA 2NT0A 1FDLL 1VA9A 4JFYA 4DO6A 4NFBA 2CJSA 4V11A 4XP1L 1TLMA 1XIWA 5F7AA 2A77H 3PNWB 1TZOA 3EGSA 1JSYA 1Z3GL 2UZPA 5H35A 1SBSL 3WKNA 5ISZE 2WQWA 3T71A 1AR1C 3UIYA 5I30L 5FYLE 1ZS2A 2BIIA 2J1YA 4RZCB 4JR9H 5BQ7A 3A24A 1G7HA 1A3LH 5JIMA 3P3RA 1UXSB 1HHKA 2H8PA 2N4IA 5TDNA 2APFA 4LSRL 3ZQWA 3NGBB 4XWOD 1G0XA 3SDXE 3GMNA 4MD4A 5ITBL 1U8MA 3MR9B 3NZUA 2X4UB 1RZIB 1S3RA 2G60L 1YEJL 4JRYB 5ILTL 5FYJE 4YE4L 3VFPA 4KZEH 3P9LA 5L9DH 1AP2A 3W0WE 4ANKA 3N3EA 1CUOA 1LO2L 4P2OC 4QXTA 3TL5A 5KS9E 3QZWA 2BOLA 1MCQA 4J8RA 4L1HA 1JGVL 1Y0LA 3BQUA 5DJ0A 4YIQA 3WKML 2WBXA 5MEPB 4EZMA 2LW3A 4JLRB 4MLSA 4ONGL 4YSCA 4X4ZA 1GKOA 4DQOH 1HILA 4UT6L 5B1JC 4OZGB 4K7FA 1YQ2A 2HT2C 2KZKA 4IRSB 4U7SA 1IAII 2HJKB 4IEFB 4OFDA 4HOMA 5EOQH 2DB8A 5FFOA 2XVBA 4NQCE 2ZUXA 1IGFH 5E4AA 3VGBA 3FT0A 3WY4A 1YPZB 4IKJA 1BFVH 1ECYA 3G5VA 5ES4B 3QUMA 3NESA 4YNYA 5DD0H 1EDHA 3A23A 5GRUH 1OARL 4KHTL 4NQED 1MFCL 3WKYA 2YZ1A 1OP3K 5IWLC 3SD2A 4TVPE 3UPRA 4EI5D 1VSCA 3PYCA 4XBGB 4XXWC 3MRHA 3D4YA 3ARED 5E03A 1VGKA 2ZXQA 4V1DE 5E8OB 5FOBB 1KJ2H 1IIKA 1T7WA 4M8QA 4G8AC 1PD1A 2WXRA 3RVWD 1GXEA 3WTTA 3MV7E 2VZTA 4G6KL 4G7YH 5IIEB 1BOGB 3IDNA 5J6HB 1QTYT 4AG4L 4S1RL 1KGUA 3ARBA 1W0YT 1U8CA 1PY0A 4OSUL 2LAGB 3QZLA 4WJKB 2XUWA 5AFAA 2GBAA 4M00A 3TESA 4AYFB 2E59A 2FJHB 2VIRB 3V5KA 1EJOL 4D9LH 2AJVL 1NGPL 1PKQB 1MFEL 1FIGH 5J56B 1KIPB 1CE6B 5AAMC 5IF0A 4EPSA 3R06B 1I3RB 4QXUH 1RQ5A 4DCQB 4AI7A 4F2MA 4UMGA 3LXAA 4YPGA 3VDBA 2GITA 1BQLH 5F7KC 4PRAA 3FRUB 3V0WL 3PXLA 4FD0A 1Q72H 4KITB 4LIQH 1V5JA 4BUHA 3DTXA 4Q14A 3LS4H 1FZOB 1R34A 2R27A 1X5AA 4IW4C 5GS0L 4FJ6A 3NACL 2AC0A 1BAFL 4IBUA 3CV5A 4PB0H 2APXA 1QSFA 1UHVA 1HIML 4HCFA 4CVZA 3CTTA 4P4RA 1XCWA 3NJLA 4H13C 4IRZH 4LLVA 4IIQA 4ELMB 1E8WA 3BVXA 5C0AB 4ZMPA 4NSKB 2IH3A 2ARWA 1UH2A 4WJ5B 1XF2A 4AOFA 1XGPB 4J3OF 3SQRA 2CUHA 1VEOA 4WWNA 3VG0H 2J8UE 4WIQA 4YL9A 2NTFA 4KO9A 3TWYA 4I0CC 2Y25A 2WNXA 3ZHLA 2NY3D 4UF7C 3TH2T 4U1IA 1N2RB 3P4MA 4AQ8A 1IMHC 2Q76A 1C12B 4U1JB 4R0LC 4X9YA 2YAFA 1AR2A 2YGQA 4JQIH 3T1WA 4FERA 4Y2DB 3VXSB 4DKAA 4HK3J 4E41A 2QHRL 1DLHA 1MAMH 2BP3A 2WNKA 1W8NA 2CH8A 3MRCB 3T4AC 5DSCB 2F53D 1KV7A 1PZBA 1CF1A 5CFHA 2HVBA 5EBLA 4JY6A 4WFEE 4NENB 4RISL 1IC0A 4YR6A 5F7MC 5G2NA 3G6AB 1YMHB 3GSNH 4NNYA 2D3LA 3TH3T 1PYWA 2ITFA 4FQXD 2PPFA 4URTB 4XPBL 1IC4L 2AK4B 3H42L 3NFPA 3HKFA 2CE6A 1M7UA 1WEJL 3H9SB 3S5LB 1OP9A 4NKOA 3GB7B 4GNKB 1TEYA 4WGVB 4BXSV 4LGSB 3KR3H 4NCDA 3IXAA 4UILH 4FNLL 1CN4A 2NY1D 4XGZA 5I6XB 3H6JA 3RWCB 4A7VA 5HSFA 4JFDA 3WLBB 2XPGA 3T2LA 1EIBA 4DKEH 5GJSH 3MJ9A 2XG5A 5E2JA 3W9DA 2YXMA 3ULVL 3RHWK 2PPAA 5HJ3B 4AZUA 2P43B 3MRJB 4Y8AA 1XAUA 2HJLB 5L4IA 1E0OB 3RA7H 3EJYD 2GUOA 1I1YB 1REIA 3KJ4C 5F3HA 1VCBC 2NLJA 4PJXA 1W8OA 5GZND 1A5FL 5AB1A 1X9UA 3WL9B 3U4KA 2B1AH 4EDXB 4NN6C 5DS2A 1AHWC 1NH6A 1YNTA 4QPEA 4QOKE 2Z93A 2Q6WA 1TFHA 3L7FB 1F97A 1WV7T 1DUYB 2G2RA 4KTEH 4L8SC 1T04A 5DHYB 4FABH 3QUZB 1RZ8A 4DGIL 1YG9A 5AB9A 2EICA 3VH8B 3UEQA 4F9PA 1VDGA 2R8SL 2EAEA 3V95A 4E68A 3P77A 3T5WA 3DO7B 1KMGA 4AV0A 1C1EL 4U1HB 2X6BA 1NL0L 1CFNB 3VFOA 3ZDYF 3CPLB 3DMMA 2X42A 3PGFL 4ERSL 1KTCA 4HS6A 3ZRSA 2OMUB 2BC4A 2AXFB 2WV3A 1W72H 1E4XI 3HMXH 5CMAA 1ACYL 3DOSB 5ALCH 5AB2A 3V9CA 3WN5C 4AYSA 3LN5A 4WWID 3UC2A 3UAAA 5JW5B 1UM5L 1TJIH 2Y7OA 4L3CA 4N24A 4DKTA 4QRRA 4DUXA 3RZCB 4NAJA 1CXLA 3HG2A 4UWQB 1ONQA 5SX4H 1W80A 1QG3A 3V6FB 4UI2A 1E8ZA 4S1SL 1JN6B 3EOBA 2JTYA 4X98B 4BK8A 5HPMB 3P69A 1XMWA 4Y19B 3KWXA 5DZ9A 1FL6A 3NSXA 1SLUA 3HFMH 3L3KA 4P46C 5I8KH 1TENA 4E5XB 2Z9TA 1T83A 1Q38A 1ZT7B 3Q8EA 3LN9A 3T2PA 1XR8A 3D1MC 1JNLL 2CRYA 5EBMA 3RU8H 4S2SB 5KZCD 2VR5A 4U3HA 5E8DH 5FKAB 1VERA 4CRPA 3TBBA 2IAMD 3HR5B 1PNCA 1MFBL 5F7YC 5CLZA 1TU2A 1I8LA 3MFFA 1YUHB 1DVTA 5BS0D 4NGHH 1BVLB 4WUUE 1A6WL 4F33B 3NIGF 3BWSA 2Y24A 4FQ1H 1LK3H 2MKLC 4TRPH 4CADA 5HYJA 3IRPX 4GS7B 4YVUA 5T1DL 2CQVA 2HLFC 3MRKB 3RWJB 3TVMA 3VXMA 4XMLH 4YUEH 3RG1C 2VL5B 4M43H 4ATWA 4NRZA 5A16A 5IESH 5T3XH 5I1JL 2X6CA 1HE7A 2DQUH 3MX0B 3ZKQD 5I1CH 1P9MC 1E42A 1ORQB 3CZNA 2VDRB 1OAZH 4ONOA 4HU2A 2ICEB 4HWEL 2DKUA 3U7WH 3MV8D 4X7CC 2NNAB 4FXGB 1T1WA 3O6ML 2PP9A 4W9ZA 3VDAA 3DUHA 3I02B 2NW3A 1YUKB 3WMSA 1U95A 5KUMA 2BCKA 2IANA 4XI5C 2PABA 1V3KA 3A6OA 4PV8B 4XO5A 3H56A 1G94A 1D5ZA 1SMAA 3FMGH 5BRPA 2ADYA 4EE2A 2YXFA 2ESVD 2ATPA 3GRWL 3HE7D 2QSTA 4WQOA 2BS8A 5ICZB 2RGSA 3D50A 4M7KL 3RVTC 2J3SA 5IB2A 5E2UL 5F9OL 2HWZH 3NFSL 3RPKA 1MFDH 2D2OA 3FUIA 5D4JA 5AEAA 3P0YL 4P9HC 1FAKT 2BJMH 3K4DA 2V5SA 4Y4HD 5D7JB 2BM3A 3CX2A 4M4RA 4XPFH 1D5XA 2JIXD 3FCSA 4BH7B 5HHOA 3GGWB 5JIDA 2ZXBA 1HI6A 4WEBL 2KHAA 4DVBA 4P3CL 3CFJB 3QQDA 4JUSA 2YWZA 3KLLA 4S0SD 5DUML 1JV5B 4RQQB 5F9WC 4ANUA 3UBXA 4EOWL 3RTLA 4XZUA 4PB9H 3C6SB 1T0NA 4RGMC 4WV1A 3VM7A 4JDZA 1MWOA 3V52H 3LCYA 1ZDQA 1HSBA 4GQ9L 4HS8H 4FQ2L 1R5IA 3EYUH 1LEKB 3GBLA 2YPKB 2FSDA 3ZMNA 2R0ZL 3MGOA 4Z78B 1WFNA 2BNRE 4YGVB 1GJIA 3FQ2A 1IQDA 4K7PL 4S1QL 5L88H 1YN6B 4XMKL 4MCZB 3ZTEA 2XPZA 3LDBB 1FQ9C 4PWHA 3DX3A 4JM2F 5SX5H 1A1NB 3V4PB 1E4WL 3PGCB 3C5ZA 4ZO8A 2EDMA 5DEFA 3UGUA 1TTUA 4ZMZA 1XCQB 2V9TA 1UOVA 4BELD 3D0VA 1EO8H 2OK0H 3T1FA 4A68A 2QQNL 3F65A 5EIIG 2DLFL 1P4IL 5CIPA 1E5YA 4P57B 3RFZC 4DNLA 3I9GH 4EVNA 4K8RD 4KO7A 2D0HA 2OTUB 5AZUA 4I9XA 5ID1A 3P73B 2YBRB 1EVUA 3PWUB 2IGFH 3B56A 4PJIF 4WW2A 5IZ7A 3ZDYE 4KQ0A 1D6VH 1E3ZA 3REVA 3V10A 2QADC 1CXFA 4ADJA 1I8MA 2BSTA 2YD3A 3SDYH 2ZCKH 1DJHA 5JPNA 2FX7H 1FIEA 1XIWB 1LNUA 1UENA 2YQBA 3AFLA 3GLEA 3MJ8A 4M3KB 2F8IA 4UTBL 1OV8A 1TZHB 3QIBA 5HI3D 4ZX6A 1A8ZA 3EGSB 3ARSA 5IOPA 2VW6A 2JB5H 3MOBH 2BHYA 4IS6A 1E4KA 2C7FA 3N0AA 5H35B 2BHUA 3IKCA 4C47A 3OQ3B 2AANA 1U8QA 1Y18B 2R23A 4Y4FC 2OR7A 2Z1KA 3RURA 4MA8H 5BQ7B 5DJXA 1G7HB 1KN2L 3VFGL 3MZTA 5FM4A 3EDFA 2H8PB 2CK0H 3ARFA 4RGNC 1JPSL 2EIKB 3GMNB 4MD4B 1U8MB 3BVNA 2JJTC 1J8HA 3IWVA 3FH7A 5HXMA 1V05A 5EZJA 4GRWH 3VFPB 5CBEA 2Z8VC 2FBOJ 2JVUA 2OMZA 3HG4A 4Q4IA 4RSVA 1YY9C 1F0LA 3P9LB 3VWJD 3E38A 1YEWA 2A3TA 2F5AH 5TK2A 3L48A 1U3HC 1DVUA 1U2YA 4MNHA 4AQ1B 5FHAH 4CVUA 3ATEA 3QZWB 2FRGP 2WMPA 4J8RB 3RIAK 5DJ0B 1F00I 1F3DH 2ICCA 3NIGE 1HILB 2G2PA 4JFFB 3DOHA 1S5IH 3MQIA 2BVYA 5A40E 3MC0A 5FHBH 4PRPB 3MRDB 3PDOA 4NP4H 4FXTA 3G5VB 5ESVA 4ZAKD 4YMPA 1DN0A 3BPLB 3BGAA 5BNXD 2DQIL 1FWXA 1QQDA 4XP9L 4YHKH 4WI3A 4X9BA 5F71A 1JZ5A 1GHFL 5HDQL 3UPRB 3O6KH 4DAGL 3U2IA 5B21A 1PX3A 35C8L 3D39D 3MRHB 4H20H 1VGKB 3K2KA 3PAYA 3LZLA 1BCIA 3NGBC 3UTTA 3VXRA 5IW1A 2A1WL 3NJHA 1UCBL 4ZD3L 3U7YH 2BY1A 1I7ZA 4N8CH 5FWRA 2VR7A 1S9WB 1KCSL 3MLYL 1JIBA 3W2DL 2ZYSA 4KJYB 3QFJA 2ZOOA 3IDNB 3JWDH 3V0IA 4P23B 4DUWA 4NQUA 2OL3H 3ARBB 2EO7A 2UY7A 4XP6L 3QJFA 2VLJE 3EAKA 4XNDA 4QO1A 2KI6A 1URLA 1L3WA 4L9LB 2OXHA 1VF5C 3QXWA 2VSKB 4NDMB 1HKLH 5LCVA 3V5KB 1MFAL 2WP3T 1X5KA 1I8UA 3ZY7A 4H4NA 2EEDA 4X6BA 1DL7H 1GZPB 4TV3A 3SE8H 3EYSL 4Y2NA 2V0AA 4F2MB 3WG7B 4CJ0A 2YA1A 4PRAB 3ZRFC 4OQTA 1A0QH 3CVHH 1QFWM 2OYLA 4J3BA 1Z9NA 2XWCA 2EXYD 4BZ1H 4MJIA 4G1EA 5J57B 1GGCL 2WSPA 3SEPA 3HZVB 4L1BA 3A21A 1QSFB 5CZKA 2X4OA 4CVZB 5CP7B 3V6BR 4LLVB 4S1DC 4LVEA 5SX4I 4Z7OB 4IIQB 4UT7L 1SM3L 4GW5A 5GGVL 3HW7A 3NJIA 2IH3B 2MCG1 1XF2B 3X12B 3QUHA 2VT0A 4OCMC 1A6AA 3UX9B 3JZ7A 1LILA 3ZPDA 2NTFB 3DYMA 4LSVL 5GRJL 2CHWA 4X4ME 5FCUL 4U1IB 1XH3A 1Z32X 2EP6A 3MROB 3B9EA 1C16B 2Q76B 2ZG1A 1IKNC 3QBTB 3QJHB 4HUKB 4I0PA 4MAZA 4JKPL 3HAEB 4I3GA 1HESA 5IVXA 4HEPG 1P5VA 1AC6A 3O4LE 4WUKL 1NAKL 1E3FA 2NZ9C 1DLHB 4M8UA 4V2BA 5J3HC 3KPNA 4M93B 4YDKL 3OPZL 4ZMNA 4FOMA 3ZO9A 5D7EA 2A5UA 2CO3A 4ODWA 4A2MA 4K5MA 2W0LA 4PJEF 2HUEA 1VFOA 2Z8SA 2B1OA 3M86A 5A6IA 5E7FA 4FA8A 3ABLB 3V0GA 2CLZA 1H9DA 3FTSA 5HYSA 1OAQH 2PO6A 2VXVL 3NFPB 4V33A 5DJDA 3RIAF 5JDSA 3I3EA 2FH6A 4NKOB 2DWEA 2EDDA 4A39A 5C0JB 4KQ3H 1AXSA 1U91B 4KKAD 3BAIA 3IXAB 2IDSA 3ZE1F 1P5UB 5D1QA 3QCUL 1VPOH 4PTTA 3DTUB 3KGSA 3UTOA 1PJ9A 2X1PA 2XPGB 4XXDB 5HHPB 2QPFA 2VZVA 3TIDB 3UGEA 4A6YL 4GUQA 5HD8C 5F6HI 2XG5B 3GSRA 2UZIL 3SE4C 3SJVD 3W9DB 1YO4A 2BVQA 4AW7A 3EO9L 3L1EA 1XZ0A 2BWQA 1OP4A 2CMRH 2DD8H 2VJ8A 2EVIA 5F3HB 2GUOB 5DWPA 5F7DA 4PREB 2NLJB 4PJXB 4YFDB 3L9EA 2BW5A 4LHUG 4IHOA 1YNTB 4IJTA 1E9PB 1FP5A 2KZ1B 4JFPA 4U1MA 2Q6WB 4OD1H 1I53A 5SWSE 2G2RB 4EI5B 5IW6B 2ZWKA 3NH7L 3TJPA 1BJMA 1WBYA 1RZ8B 4EDWH 5IFAH 3COOA 2QTVA 5DUBA 5HHXL 2P5WD 3TT1H 4GQQA 3FQNB 4YHNA 3CFTA 3P77B 3PF2A 3EFOB 5E9DA 2Q7YA 4GG6A 1G6VK 2DQJH 3D51A 4BFRA 3QH3A 5GSRA 1MH5B 2ZPKH 2A9ML 4PJ8D 3HNSH 1DBJL 3CFNA 2E4TA 3GO1H 2BC4B 1QFWL 1QEWB 2I9LB 3X3GH 5CMAB 4NO5A 2FIKA 3GSQB 5DT1H 4ZFZB 2QKSA 4YHYB 4DTGH 5I6XC 1R4XA 3ZKSD 2R1WA 4DGWC 3FO9A 1JK9A 3OKNA 1IRAY 2NT1A 4Y0GA 3SE6A 3VSTA 4L3CB 4JHWL 1AHKA 1MI5D 4FFZA 4QRRB 3TV3L 1N7MH 4IGBD 4FG6C 3GTVA 4A6YB 4M5ZL 1U8JA 4WO0A 4WWOA 2CGRH 3EOBB 2NNCA 2ORBH 4KTDH 1G7IB 4N2LA 4NZRL 1UOKA 4FF9A 4ZOAA 3KBPA 3BKCL 5DURB 4OD2A 1G9NC 1E6OL 3L3KB 5T5NG 5FDYA 1KXQA 3A6BH 4MNGA 2QSCL 3IJHB 4P4KD 5TQ0L 3S37L 5BZWB 4BFGA 2CLRA 5EBMB 5SWZE 4IDLA 1J9CT 4HLZH 5IBUB 3V0VA 3KGUA 5CEXB 2DM7A 5LBSA 5C0RH 1WA0X 1HNGA 5B4MD 4N8PA 2IVFC 3MV01 4MDIA 3UZQA 1TU2B 2PYED 4ONFH 2HX7A 4L2LA 2Q8AL 1MLCA 1SHXA 5BRZD 4QHKJ 4YDIL 1A7NH 3VXNB 4OIIH 5J1TC 3BP7A 3ZBMA 4HK0A 4U1KA 1ZT1B 4CADB 2PR4L 1K4CA 4NOBA 3AJ7A 4XCFL 2AQ2A 1EDYA 1Z1WA 3ARDC 2XZZA 1OF0A 2NY3B 4LLMB 3ZE0F 1DQQA 1EQWA 4WK0B 2SEBA 3HBZA 3L5JA 3NIFF 2ZT9C 2HH0L 4O58H 4W9FC 3EYVA 2EIJB 4WK4B 5AYQA 1LD9B 2VO8A 3W11C 1JMXA 4GW1B 3DX1A 1A4AA 2X4PA 5EU6D 4I13B 4WGWB 2WNWA 2NW3B 1V10A 1J1XL 4PHZA 1RJCA 2UY6B 1SGKA 5C0EB 1NCIA 1TVBA 2BCKB 2IANB 3ATAA 4J8QA 3UZVB 2ZYIA 1C5DA 3I2CH 3OV6A 4BFKA 1D5ZB 2FJUB 1ILSA 1SY6L 3FQUB 5TE6H 3V4VA 3DOIA 5KYUA 4KVCL 1N64H 5JHAA 2XQBL 2Q3AA 4OFKA 1UD8A 2ZSWA 2IOOA 5IB2B 1G6RH 4MB5A 5JOFA 4PJEE 5DJCB 2O6CA 1RZFL 5DZOA 4JPWL 5T1LB 1KGCD 5DEGB 4KMLB 3UMNA 4GQPH 3RE0A 4M4RB 5FA4A 1X6NA 3FAXA 1D5XB 4UT9A 4E9SA 1T3FB 3N04A 4H1LA 1MCNA 1J48A 1BAWA 4MZRA 3TA3D 3NBNA 5C0BA 1XAKA 4U1LB 4X4XB 2BSSB 1U93A 2CZNA 4DVBB 3ZE1E 3QEHA 3QQDB 2P8LA 4YPJA 5DD6A 3TBTA 3WSQL 4X9GA 3UBXB 4XZUB 2O5NA 1GGBL 1T0NB 4WV1B 4EI6A 1YYLL 4JDZB 4DP1X 4G3YL 4PRDB 2ICEC 3CDFA 4HLZG 2W0PA 1OPGH 1R5IB 1MWAL 2GEEA 4FXGC 1A6VH 1YHPA 2V17H 3MGOB 4I18A 2H0FA 4Y1AB 2AJXH 5IQ7H 4UNVA 4BSWB 4H5SB 1IQDB 2GIXA 1G7MA 4DKFL 1YMME 2DQHH 5JNYA 4UNUA 1F86A 1UVQA 3NJMA 2AV1A 4W68A 1T7YA 3L08A 3C5ZB 4HW6A 5DEFB 3CHXA 2YAHA 1K85A 4JG9A 1B0IA 2XACC 3ES6B 4AMKH 1J5CA 4H0HB 4LPXA 4KI5D 4JKLA 1GZHC 4EBQL 3KJ6L 4KK9C 4EVNB 1TEGA 1DQIA 4IOFD 3B2UD 4PP2A 5A2AA 4XP4L 1FLRH 2WBKA 4KJPC 1A22B 2K8QA 1MW0A 2PTVA 4WW2B 1JYXA 2F7QA 5D7JC 3WN6A 3REVB 4TLTA 1W8EA 4B95C 5GRWA 2GBTA 1I8MB 1N19A 4Z9KB 4OCXH 3LEVH 5E6IB 3FBKA 5I6NA 4OZFH 4I8DA 2I26N 4R6UA 3LKOA 3QIBB 4JO8A 1MHPL 4Q52A 2OKMA 1GYWA 2VDMH 2K70A 2LOEA 1B4RA 2PPDA 4L18A 4IS6B 1J0KA 5I5JA 2R23B 4UT6A 3DVFA 1JZJA 5FAAA 4DPAX 5IVNA 2X41A 2P5EA 1V7NL 3RVXC 4HIXL 2W95A 1ET5A 3KYKH 3T0ED 2RB8A 3LKSB 2CO7A 3CCHA 4ZDHB 1MFMA 2NY4D 4J3SA 4HFWB 1H19A 2WCSA 4J6RH 4LOUC 4DPRA 1PZUB 3OR7A 3RGBA 3EFDL 1MWAB 4KX8A 2IAMB 4JHVA 1YQVL 3LDBC 3QB7C 5SWQA 5AOKA 1S9YA 2J72A 4OB5H 4R97C 4PAZA 5TE7H 3SDAA 3LEYH 4C4KT 5CBEB 1TFPA 3BZ4A 1MCIA 1N6UA 2OMZB 2RJMA 5EC1A 3CQPA 4JHZA 3HIZA 1A6ZA 4QTIL 1M71B 4NNPL 3Q9QA 4QYOA 1LE5B 1MLBA 3V5HB 1OP5H 2WLNA 4OAWA 1YNLL 1RAMA 4NZUH 3UO8B 3VFRA 4E9VA 1D2PA 1IC7H 2C9PA 2YAPA 5T5FL 1VENA 3EKCA 2HMIC 1E2ZA 1QLEH 3R4DA 5GRVK 5CEYB 3O2DH 4UANA 4UCFA 1CF8L 4MDJB 4PRBA 5IKCA 4TF4A 2Z0BA 1XIWC 4PRID 3VGEA 5CLWA 5EDSA 2R69L 2G30A 1IGMH 2WLZA 5J4MA 3PDOB 3ZE0E 5FUCE 4KY1L 2G75A 5ESVB 3NIFE 5J0BA 3L4ZA 3LIZH 4Y5XA 4OTXH 3RIFK 3MO1A 4M02A 3DVIA 1C5CL 5C1MB 1QQDB 2JV6A 3UZEA 1AZNA 4WFHE 3WJLA 1JI2A 5I1DA 4WI2A 1VEMA 1F6FB 4IBLT 2WGXA 4K8RL 3RL1A 4DOHB 1SPDA 1CVRA 3UTTB 1J87A 1K9TA 4OLVL 3SYPA 4F7EA 1I7ZB 2H6PA 3A22A 3Q2VA 5C6TH 4UOJA 4P5RA 1FZKB 4ZFGH 1OAUL 1OE1A 1KPVB 4XTRC 4X5XA 1LDPL 3GM8A 4OZFG 2UY7B 2B1HH 3QJFB 4B6ZA 2AQPA 3QW9A 1RUAH 2Y3AA 1NGZA 4AQ1C 2OXHB 3MRIA 3D33A 3N1MC 4AJ0A 1DO5A 3BQUC 3AS3A 5E56A 4YHZL 3L95A 4OZHA 3J07A 3OHXA 1IEAA 3SO3C 1FNAA 2E7LA 1GGUA 2DQEH 4P5SA 2PUQT 3RWIB 1FG2A 1B6DA 3NJVA 5JW4N 4C56D 1NCAL 2P3YA 1NICA 1BBJA 1TMCB 5EG6C 1NBVH 3CD4A 5K1JA 5JHDD 2BINA 1GJUA 3BPLC 1LJMA 2DKSA 3V6OA 3IDMB 3HZYB 3T77A 2A6KA 5C07E 4L3EA 2C3GA 3AQDA 4MJIB 3FUEA 4G1EB 2R1YA 2OXGB 4PVLA 3LOWA 5KVGE 1Z0NA 4JY5L 3BGFB 1F11B 2XZCL 2KS0A 3BEWB 4LSPL 2C7UB 4ZQTA 3VXME 2P80A 4XVUD 3M1CA 2WKLA 4P3DB 4BGLA 1AYOA 3WCYA 3Q5YA 1FPTH 2QPUA 2L3BA 2QGBA 3PPSA 3CHRA 4GW5B 3CZEA 1JMZA 4QIRA 2VJ0A 3DX2A 3BPCA 3ARBC 4PJHB 1MOEA 2B2XH 1E6JL 2X3CA 1ASOA 2J44A 3OXSA 5IFJA 1Y1DA 3X1EA 1FNSH 1A1OA 2VLRB 5FGBA 1CK0H 3TEYA 3VXUD 4BFOA 1YEIH 1XH3B 5F0PB 1RPUA 3HN3A 1IBBA 1Q0EA 4FHJA 4HJGA 2EDBA 4I0PB 1G5GA 1QNZL 4XNXH 2OCFD 1RIVL 5IVXB 1P5VB 3GXDA 1H3WM 3SQOH 4NKQB 1A8JH 1MREL 4N4YB 3BN3B 2HFFA 4NQQA 3R7RA 3BFQG 1KIQB 2AGJH 3AT0A 1K72A 2APWA 4FFYA 4AE1A 1L9RA 2MNWA 5FEBA 2AQQA 3M7FB 3B2VL 2MFNA 3IEAA 4NO2A 1ZHLA 3UJJL 4HZAA 2CLZB 2FHFA 3MRMA 5HYSB 4QXWA 2PO6B 1Q4NX 5HHOE 1EAPA 1ZT4A 3EDKA 5JDSB 4AEIL 2XV6B 2DWEB 3NSJA 4HFUL 1Z9OA 5DK2B 2JI3A 1MVFA 1QZNA 2QGEA 5KJ4A 3FPYA 3V0JA 4V1DD 3TA4D 2I60H 4JNXA 2C1OA 4PTTB 2FWSA 4IIQC 1CBVH 1FAIL 3BDYL 3FB7B 3EBHA 1ES0A 5I2IA 1CGUA 1O7SA 1XZ0B 1I7RB 4UV4H 3UJTH 3RIFF 5HVGB 2H0PA 2RAMA 4LAQL 5F7DB 4FULA 3AT8A 4L29B 4AQ8C 4XB7A 4H0IA 4IHOB 3AM8A 4PJFA 4ZOCA 3IDJA 1QVOA 3U9WA 2NRDA 4MCNA 3N50A 1HQ4A 2D7TL 4HPOL 2QLYA 3PQYB 1M42A 1D5IH 2YD1A 3AUVA 3S8WA 3IS0X 4L3AA 1UGKA 5DUBB 2IBZY 4Z7UA 3BN9D 5DD1L 3ZYOA 1SVBA 2JKLA 1EWHA 5E95B 5E9DB 2QVMA 4H8WC 1WIPA 4GG8A 3BT2H 4MZIA 4GRLA 4P9ML 5AAWA 2O6DA 1DZBA 4P5MA 4G7RB 5GSRB 1T2JA 3FO2A 3ZE2B 4MQSB 1FE8H 1L0YA 1OGAE 2DWYA 3CU1A 4YBQD 5F1IA 1X6LA 2BOCA 2AITA 4JPSA 1R3JA 4NO5B 4AITA 4G5AA 1N10A 3K1KC 5C0DA 2MHAB 4LGPB 2R1WB 1EO5A 3FO9B 4ZRGA 3GUFA 3OKNB 3RTQD 2FNBA 4G8GA 3QUYD 5HJGA 3TN0D 1HJBC 4EQ2A 2ICWI 1UA7A 4PY7A 3BPNC 4OM0L 3PHOB 3Q8AA 3VFUA 2X40A 1INEH 1TQWA 4PG9A 5C08A 1A02N 2D7PA 4K94L 4L5FL 1JNNL 4OD2B 1P1VA 1WCQA 3TOPA 5I0VA 4MNGB 2D03H 1QBLH 2CLRB 2EDTA 1BQHB 3P9MA 1LQBC 1GAFL 2WM0A 3QJSB 4GP5B 4GW4B 1D7BA 1KIUA 3LNDA 5J06A 3AT9A 2VUKA 5B1BB 3K72A 3NQKA 3RB7A 5ADPL 1ZANL 4PD4K 5FGCB 4HAKA 1BZQK 3W81A 1ZTXL 3ABGA 2CLVA 3DMMC 3MOQA 3BP7B 3N40P 2CM5A 4TUUA 4NB7A 1OP3H 2IDFA 1U41A 3U48A 4AVJA 1WS8A 4BXVA 1RUKH 5A3IC 3U30B 1KEMH 1CU4H 2VO5A 3BHBB 2WTOA 4YHYC 1NIEA 3T6ZA 1ACZA 4PYGA 1QBMH 1DQQB 4G82A 4ODVH 3B3BA 3C6LD 4RNRA 2DL2A 2AQNA 4GG6F 1I1FB 2NXZD 1MNNA 2MH4A 1R3IH 4B41A 4XCCH 5HHQB 2C5DC 4FHKA 3ABMB 5J12B 3K2UL 3F6JA 1OD9A 5I75B 2FYVA 2GI7A 5F96L 1IEHA 4GXUM 1S46A 3D7PA 1QI3A 2H5UA 1KT2B 3FXIC 2VDQL 2WGNB 2EEXA 1T80A 3QRGH 2Y36H 4JPKH 1RLWA 3EOTH 2DQGL 2JXMA 1TCRB 1ZVNA 3UC0H 3KZ8A 2CHNA 4Z3EA 1T83C 2FX8H 4HUVA 1Z9PA 2YKKA 1DEEA 1YJDC 1ZMYA 4UYQA 4PIRF 2YOAA 5ID0A 2HRPL 5FYKE 2WXNA 3UPAA 5JW3L 1CD9B 3O8XA 9PCYA 4ALAL 3AUWB 2Y6SD 4WWPA 1F6AA 2XICA 5B22A 5ADOL 2VXTL 1I8LC 3KHQA 2F54A 3SKOA 5DFVC 1JL8A 3UYOD 3WFEL 1FZMB 4MXWL 2HTLC 3OTTA 4HWNA 5FA4B 4OT1H 5EO0B 3BWAB 4H1LB 1E5BA 3IDUA 5FO7B 2KKQA 5MHSE 3WU1A 5IMLA 2YGVA 4YEEA 3HC3H 2Y9RT 1EZLA 2XZAL 1XF5B 2WSKA 4K3EH 4WI9A 3FRPG 3KGRA 2W88A 3W39A 5EA0L 5AOIA 4N0UB 1U58B 4F8QA 1BG9A 4EI6B 3UFIA 4R90L 3LX9A 1KFAL 4M8VA 3RPBA 3SZ6A 4AL8C 4HDIA 4W9GC 4HJ0C 3FN0L 3K4AA 2VQTA 2ATAA 5TTRA 3STBA 1JCKA 4PWFA 3PGDA 1KCRH 1G9NH 1RU9L 3ET9F 1JDAA 4OCYL 1MCOH 3IAPA 4LNVA 5CINH 1I7TA 2HRGA 4GAGH 1IBFA 2EE3A 5ECGA 2VN7A 1UVQB 4UQ2A 2AV1B 4JQXA 3CZFB 5DR5H 1U2HA 2VDQB 4ZT1A 4HVBA 4JE0A 5B39A 2DN7A 1WSST 3T0AA 1BEYL 4LSUH 3NRQA 2BIPA 2I7SA 1YYML 1BYNA 3CSFA 1BIIB 3MXVH 5TFSH 2CKBL 3D4CA 4RFOH 4PP2B 4Y9BA 4PJ5D 3ORJA 2DMHA 3A6CL 4NQDD 3I6GA 4PQXA 3F05A 4JRXD 4N2HA 2OSWA 2JLPA 1RPQA 2IPTL 2V9RA 1HINL 4CU6A 1IEBA 2OMTA 3QP3A 4AKOA 1CE1L 3HNTL 2EH7H 1VRSA 1Q9OA 4UTAA 5TQ2L 2VH5L 3PP4L 2VDKB 1XTMA 4CW1B 4UBDD 1B90A 4NZTL 3GLDA 5FOJA 1GSKA 2F1BA 4BWTA 3T6XA 2BW4A 2WXMA 1IV8A 3B7TA 4WV1C 3IRCA 4YDJA 2OR9H 1OVZA 1EK3A 2P5EB 4CAGA 3FHAA 3E1ZA 2F61A 3PWPD 4X7DC 2F7IA 3OF6A 1NFAA 4CJ1A 2ZXGA 1IUZA 4BHUI 4XH2B 4GKOA 3OR7B 4IRJA 4FYSA 4X6CA 3B9KD 5AVVB 5DC9B 2VM9A 4N3TA 5D1QE 3KE0A 2J7LA 5SWQB 2FEDC 1FVEA 1S9YB 3X1GA 5EBGA 3MDJA 3C5ZC 3S5LG 3SDAB 2EUWA 5DEJA 1AKJB 3BZ4B 4MXQD 4OF3A 4AGPA 2YPLA 2XYCA 1PFOA 1PIGA 3K80A 1EFXD 2K8MA 3WIHH 2FO4B 5AZ2L 1YPZF 3BIKA 3P0VH 4OCRL 5GS3A 1Y07A 3L54A 1EBAA 2H2PD 4QYOB 5HYEA 1MLBB 2XFXB 1U8LA 3MRNB 3IETA 4E9YA 3VFVA 1I7UA 1PEWA 2EYRA 2ZG3A 1HEHC 1KXVC 3NEEA 4J3VA 1Q0XL 3VFRB 4WW2C 5C3LD 4JVWA 5T1KD 4ENZA 2A83A 4G9FD 3CFUA 3DLQR 3AG4B 3L3IA 4XO4A 2ZUUA 2OJZL 3GMOA 4PRBB 5E6IC 1MCKA 4NUJB 3WFHB 5JPNC 5D71L 1KF9B 3QIBC 4Z0BL 3BUPA 2JCCA 4JFQB 4CU8A 3T6VA 2PWFA 2FGZA 3B37A 5AL8A 3QA3B 4FQHA 2VDRH 4Y5XB 3VGHA 4GG6E 3UBFA 2O93L 4H2AA 4P05A 4F8OA 5I1DB 4HXAH 1WBXA 2EO9A 1J10A 4OFYD 4PJDB 5DJZA 3KD4A 5F88A 3FBQA 3C5SA 1NUFA 4OGAC 2H6PB 4OLEA 3BZEB 1QFUH 4TTDD 2BRRH 4IMLB 3BPOB 4HKJA 5ALBL 1JV2A 1P4LA 5TGBA 3NSDA 3NCBB 2G3XA 4H7VA 3N9GL 4LKXA 1W0VA 4X5XB 3H0TA 2ETWA 2OLDA 2WVUA 1XBRA 1NGZB 3LNFA 1F02I 1QW9A 1CT8A 1KLFA 1AIFA 2B4CH 4NUPA 2F58L 4OCWL 3S4SG 1LK2A 3K0WA 4XR8C 6TAAA 3MRIB 4M6OL 3OB0H 3WEBA 1G9EA 1U8NA 1DZ0A 4IOIA 3UO1H 2BHZA 4K3DH 3L95B 4OZHB 5MP6H 3OHXB 1IEAB 3G3LA 4ZTOL 5C0CD 1NQBA 3R19A 2Y2YA 4I48A 1GYCA 1FG2B 1NMAL 1EVTC 2J1ZA 5J1AA 4APQA 1YRKA 3OZLA 4UQ3A 3MV9D 1BBJB 3BP4A 5HHNA