3JYBA

Crystal structure of the rets periplasmic domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
138
structure length
138
Chain Sequence
b'QNWRLLRDESAQLRIADVLQRKEQFRPLAKRSFIFPASPQAVWLQVQLPAQKVPSWLWIFAPRVQYLDYYLVQDGQLVRDQHTGESRPFQERPLPSRSYLFSLPVDGKPMTLYVRMTSNHPLMAWFDQIDEAGLVGLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein
publication title Crystal structure and oligomeric state of the RetS signaling kinase sensory domain.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 30
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07696 7TMR-DISMED2 7TMR-DISM extracellular 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2380 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3jybA00
3JYBA 2XBZA
chains in the Genus database with same CATH superfamily
3RVUD 5KVDH 5K59F 4BQ9A 1E5BA 1S9KC 1RP8A 2XTSA 5BRZE 3WFBH 1CDGA 1HFUA 3JWDL 4OFIA 1TNNA 2AJ3A 3H85A 5CWSA 4W9DC 3ZHFA 4XXWA 3S36L 4IRJA 4M5SA 2ATAA 3DLQR 4PTUB 5GRUH 3CTTA 4LSUH 5H2BB 1QO3A 4BIKA 2R0KL 4X7EC 3MBWA 2GY5A 4F93B 5KAQF 3BGMB 4X80L 1AQ8A 5EUKA 4Y2DD 3TFKD 1D9KA 1HHGB 4WENB 2XSKA 3BIKB 1NINA 3F04A 1D6VH 2R83A 4KKCC 2DWSA 4JPQA 5IBTH 5ESQA 3TWCL 1M7XA 4RBPK 1D7DA 3CPLA 1TTCA 1JMZA 4WEBH 4AMKH 5EZLA 1ZLUH 3CX5K 4F27A 4NNPH 3ULSB 5JHAA 1IMHC 1QLRA 4HKBB 3H4FA 5SV4A 4U1LB 5ICZB 2G9KA 5T3XE 3N40P 1DQIA 3FQUB 4HMEA 1A4AA 1X3DA 4TUJA 2Y1YA 4FADA 4YLCA 4KJYB 4M5ZH 2UV3A 1JRHH 4HS3B 5GS3A 2XRAL 1JGEA 1ZLSL 1PG7X 3BMWA 2LAAA 4LO9A 3C5ZC 1NMCB 4LFHG 4XMTA 1R1CA 3VRIB 2B5IC 1P9MA 3ZE0B 1F4YH 4EXPX 1MCOL 2B3RA 1DQKA 1BEXA 32C2A 4NOBA 1YAIA 2J88L 4PJAE 4DW2H 1CO1A 4MLSA 2FT7A 5ABDE 2AXHA 4NQEB 4GI9A 3VXMB 5DD1H 5DHVA 4F2ME 1UZGA 2CXGA 5AYUL 2P26A 4N90E 5H8DA 3VH8A 4UM9B 1OM9A 1CLOH 1FLRH 1NWOA 2RTTA 2I5YH 2DS4A 2X4OB 1U3HD 2ZG2A 3MRJB 3UAJD 4HJIA 1MWAL 1Y18B 1HQ4B 3B8YA 1WEJL 3QW9A 5B1KA 1AJ7L 3MUHL 1GC1H 5K5YA 3S37L 1DN0A 4H1LA 3S2AA 2J8UB 2F7IA 5CN1A 4K3DL 5FGCE 4S1QL 5J56B 4TQEH 3LS4H 3HPLB 3KR3L 2B59A 2ZYHA 3AVEA 4DFHA 1AQDB 1ZCRA 4TM9A 2A77H 2VYRE 3HUJA 2QADC 2MCAA 2FL5B 2V9TA 5MEPA 2QHRL 3C5XA 1BJMA 3QEGL 3A22A 5BRZB 1BGXH 3K1DA 5IW6B 1KCWA 2WZ0A 3ZTNH 2QPUA 5L0QB 1UH3A 2ZCLL 5GJSL 4BK5C 4ANWA 1CI5A 1YSOA 4QHNA 1ZE3C 4GKZA 4BUQA 3ZX1A 4C59B 2V9UA 1EXUB 2ENSA 3BE1L 3G6JF 4XI5D 3OSVA 4ZAKA 3QC6X 1U8MB 4KO6A 3VXOB 4HSCX 2MEJB 3COOA 1ZA6A 4XAKD 3QFJE 5EO0A 4YHYC 2YK1L 3Q2VA 2X4PA 2HG5A 5GGUA 1JYXA 1CG9A 4CW1A 4IIQB 2YKLL 4GMTL 4CMMA 1EZLA 1WICA 5LGHH 5I5JA 2IH3A 2FSEB 3F62A 1SLVA 3OX8B 1J5HA 4HJJL 4FA6A 1N7ML 4L4TA 4J3UA 3V5DA 4AH2A 4EQ3A 5L2JB 3SGKA 1BZ7B 1EHAA 4K23L 5AOIA 4RETB 1F58H 3QHTC 3CWGA 3U7WH 4N2MA 3K71A 5AAWA 3HS0A 4GMSL 1W6LA 4GQQA 3KPPB 2NY1B 1YQVL 3HG3A 4WNJA 3KPSE 3Q6GL 2G3ZA 5KANI 3QWOA 3RI5K 1KBVA 1PTZA 1IVTA 4K3GA 1AO7A 1JGUL 1B4JH 3MJGX 4K8RL 4OF5A 4PQXA 1QHPA 3DOSA 3TIEB 4TUKL 2BOCB 4PJAB 5AZ2H 1K3IA 3H3PL 4HAKA 5AOZA 4G6MH 1OAKH 1E2VA 1ZXKA 4PY8J 1HVXA 4F2MB 1FYTE 3D06A 3QEQE 4IOSD 3N0AA 3W39A 4GSQA 3V4PA 4ZXBB 1CFSB 2VLLA 4M8QA 4X9IA 4DNLA 4GRWH 2F1AA 3CFJA 3QXAB 4JG1L 5DUBA 3V4PH 2WXQA 5CNHA 2LR4A 4MLIA 2J73A 2X42A 3P73A 4MJIE 4XPFL 5GS2H 2A2QT 4J1UB 2NNXA 4NNXB 4KXBA 1KSRA 1RZKH 2NNFA 4IU2B 1PPIA 5FGCB 5IR1B 5I1EL 3QUXA 1F90H 2LLNA 1L9QA 3BO8B 5C7XL 3FUFA 2YO3A 1B3IA 3TV3L 3VI4E 1CFTB 3F05A 5CINH 3BKYH 3OKDA 1QTYT 4MAYA 2KUTA 3B9KB 3MRRA 3BKML 3VU2A 3RIFF 2CDGB 1CT8A 3KWUA 3V0HA 1AR1B 3TVMB 1EMTL 4QWWC 1HZLA 4PJ9D 3BHBB 1KTBA 1ZEAL 4ZPTA 2ADFL 4JHVA 1E4JA 1XR9B 4UV4H 1ACZA 4QRRE 4WUUA 2E6QA 2AI0L 3NK4A 5I8EA 4EVNA 3LEVL 4IRZA 1IKFH 1YLBB 3QFJB 2CRYA 2GITB 4H2CA 4G5ZH 2ZNXA 3IMVA 2V3EA 4MJ2A 4X8XA 1QNZH 2BW5A 2CIKA 3LZOA 4OJFL 4CN1A 2J72A 4U3XA 1FRGL 3KWXA 3MSPA 3HRZA 3LXCA 2EEFA 5HGBB 5DQ9A 1J8KA 5FW7A 1TJIH 3N1PC 1ZGLM 2C4FT 2YD4A 4R8WH 4JEGB 3ROLA 2AVFA 5D55A 1BDYA 2ZWNA 2GFBB 1PKQE 5IQ7H 2JE8A 4OJEH 2CR3A 5C0DB 3QVAA 1XSIA 4NERA 4LPYA 3OB8A 3D85A 4NUGH 2OSLA 4WNQA 5T33H 3KPSB 2FNWA 4XVUC 4HEPG 1QBLH 5IVXE 1A7OL 3JWOC 1V3KA 1QTPA 3GBEA 4Z0BH 3DOIA 4XNMA 2Z65C 3Q3GA 1WAPA 4L1TA 1GZPB 1BG9A 2VLRE 2VN5A 3GRWL 5DMKA 3OC5A 1NDMB 2BP8A 2NW2A 1QI4A 1X5MA 2MQ0A 3KW7A 1FNAA 3FFOA 1JFHA 5C08E 1DJIA 2DQIH 1FYTB 4JFYA 5FUZH 4HAFA 3QEQB 4GAJH 5LQBL 3KLLA 3OAUL 2F7OA 3ZKXC 1KLFB 4KKBC 1AE6H 1OP9A 3UGUA 3BZFB 2JCCF 2XFXB 4UQ2B 3GBML 3B1UA 2NY3D 3O41A 1A7QL 3SKMB 3H54A 4RSVA 4XMKL 4MJIB 3S0PA 1EEQA 2E8YA 5HHOE 3K8LA 1HSBA 4FYRA 3ARQA 1U4EA 4E9WA 3WKPA 3WI9A 3L7EA 1MCDA 2HH0L 2NPLX 2UY7B 4N0UA 2P24A 2Z7WA 3PNWA 5KOMC 4YHKL 1C5DA 2EE0A 2F54E 3VI4B 3DETC 1S7WB 1QOKA 2BPBA 1CGSH 1XZ0B 3H9SD 4WI4A 2QKSA 3L5JA 3DX7B 3NTCH 4ZMYA 4HOMA 3FN9A 1MWAB 1X5GA 2UVFA 3BRDA 3G6AA 4RGND 4U6YA 1UURA 2NR6A 3IDMA 1O9VA 3BQUC 2YEVB 3OKKA 3BVWA 3MBED 2RHEA 3PHQB 2YD6A 3RUGA 1X4YA 2CGZA 2ZP0T 3ZRSA 4EI6B 4F7MB 3HZYA 3L3HB 1YVLA 4JFEE 3CHRA 3P9WB 4IJTA 1P7KB 3S36X 2H1PL 1WD8A 3BT2H 4LLMB 4KROC 4L9DA 5ANME 2R2CA 5FK9A 4LLYA 1IGFL 4KI5F 3V55A 2EDYA 5JNYB 4PWGA 3MREB 2J44A 2DBJA 1BP3B 3MV7E 4YHMH 4XP6L 2BW4A 3WIIH 3IVKB 2L3BA 2WB7A 4FQIL 1BFSA 2W9EL 4M7LT 3GSUB 1R5VA 5I0VA 2D7QA 1DBBH 3W0WA 4FD0A 1OCOB 5ACMA 1PKQB 2VL5A 2WLZA 4MJ6A 2R23A 1C5BH 3P3YA 3R7RA 4AEHL 1Y7VA 2C5DC 3TH4T 4XCYB 4BV1A 2YMOA 1O7DC 1CJYA 4GW4A 3QZOA 4XNZB 5IVXB 1Y07A 3G5XA 4JRYA 2N1TE 4IRJC 4AQEB 1XGTA 2IANE 1FZJB 5I75C 2ICWB 3HOGA 2VLRB 1R5WB 5B4MD 3HMXA 4MXWH 4FP8H 5J06A 5E6IA 4BHUI 1D9KC 3HMXH 5DHDA 3QDGE 1P4IL 5C08B 4ODSH 1N70A 3KPOA 1PZDA 1RIUL 1RUQL 3RWEA 3L4WA 2CUMA 1SDAB 3KE0A 2EQDA 1H5BC 3T2OA 1FAIH 2IAMB 1FG2A 4NSKB 4NP9A 2NT1A 4Z1PA 3I75B 5HHOB 4FNUA 5ID1B 3PXJA 5T1DH 5F9OL 4I3RH 3M1OA 1X9LA 2CGRH 1PAMA 5E1AA 5CF3A 2WNKA 3VXSD 5F7EL 3MGTA 5GZNA 1UWEL 4A6YL 1NAKH 1QEWA 4AGNA 2VR9A 5FAAA 3PJNA 3S37X 5EB9A 3WE6A 4XPAL 4DKAA 2F54B 1D5BB 2K7PA 4BFKA 5I6LA 2VGLM 3SQBA 2ZUQC 4LSTL 2VC2H 3HBPA 5AW3B 1P9MC 4NAMA 1DDHB 1VGKB 2W0LA 2ZAIA 5AVZB 1JN6A 3BH8B 1J9SA 4NQDA 2YGQA 2DWEA 2YRPA 4JFEB 5FO7A 2R8SH 3FQYA 2ZP9A 5F7AA 5T3ZE 1NEPA 5ANMB 3F12A 3FQNB 1C08A 4PIBA 2ALWA 1QUNB 3DGGA 1OB1A 1AIFB 2Z9TA 3R0MA 3FZUC 1JJUA 1P4BH 1OAYH 3G5VA 1IFHL 1JERA 1X5KA 2BVOA 2JI2A 2MQ3A 3HHMA 3M88A 3MV7B 3OAZH 5CJOH 3VAEA 1A65A 1Z9OA 3A3YB 3D48R 4G1EB 2BS8A 1GYUA 3ZHKA 2P9RA 1P84J 4AYDC 3GZQA 4LDOB 1J9CT 5E99H 1R9FA 5F72S 1JDDA 1F8TL 5KBMA 1E8XA 3OR6B 4S0HA 5ESAA 1MHCA 4LVNC 2WB1A 4N5ED 5I9QC 2VZOA 4JBSA 2BIOA 2QV4A 1UB6A 1MPAH 1D3CA 4CKVX 4PJCA 2FT6A 4HS6B 4QKXB 3P9LB 5DZAA 3RU8L 4LL9A 1QSVA 3L1EA 3OZ9L 2ORBH 1I1FA 2BCKA 2PCFB 5D1XA 3LZQA 5I76A 2GC7C 1K72A 4NQTA 3EDEA 2CU9A 1KB5L 2IANB 4K15A 7FABL 3BJ91 1Z7JA 3L5WB 2F18A 2L7JA 3G5YA 3AG4B 4N26A 1WTLA 5CFHA 2XX0A 1T7YA 1YY9D 4L1LA 1IBHA 1TYRA 4LP4A 1M2VA 2WWMC 2X6BA 4XMUA 3QDGB 3OV6A 4MS8C 4Q58C 2COVD 2E75C 3VXRA 1RFDH 3FHQA 3SCMA 1ACXA 1I9RH 3MX0B 5I1LA 1TU2A 3IDXH 2H9GA 1A3RL 3WTSA 1RV6X 3BP7A 1R3JA 3SGKC 4EO5A 1VFAA 3K3QA 5E4IA 4RZKA 4LT7A 3LX9A 2LFGA 4ZUUB 4DN4H 5D7LA 4H20H 1GGIH 2UXVA 5AAWC 1B9ZA 5F1IA 4AT6A 3BSZA 1F2QA 4OF8A 4P3WA 3HS0C 3ZYZA 4YBQC 3IJYA 3MA7A 4NXSA 3ETTA 2WNWA 4X6FB 1BQHG 4HK0A 3CZNA 5F1SA 4HK3J 1FO0L 3QRGH 4PVNA 3CN0A 4RVBA 4KZ0A 2HJKB 3OKNB 4U1HB 4WWID 2P5ED 3GKWH 5F7DA 4NEHB 4TTDD 4IRSD 4JVPA 3P3TA 2GBUA 4ZYKA 1HHJA 3M07A 3PHOA 3Q9QA 2CR0A 1MFCH 1SXCA 3KPRA 4LB8A 2JV6A 3L9YA 3MUGA 3S88L 2GK0B 3SDYL 1OSZA 5B21A 3V5KB 4ABVA 3HZ3A 4Z7NE 2CE6A 1WC7A 2VZ3A 3B5HA 1M6OB 2FATL 5EPMB 4GXFA 1LK2B 3HBZA 3QCVH 4XCCL 4IHBA 4JM2D 2AXWA 2WZ6A 3MZGB 5F97E 4ZBJA 5KANG 3L3GB 1SJMA 5HYSB 2KBGA 1SXAA 2K4AA 5DMIH 3FU9A 1O6VA 2X2JA 4JFFA 5FA3B 4I1PA 2Z34A 1T04A 3JUYA 3QUXC 3HA0A 4TQ8A 4Y19E 4IKKA 3N43B 4OLYL 1RZFL 4HXBH 4DGVH 5BS0A 4HIHB 4Y5VB 3GMRA 3RIAF 3LNFA 3EYOB 1K4CA 2P8LA 4MAYC 2P52A 5IB2B 1AS6A 5I30L 2JKNA 5JOEA 4JS7A 1PVHA 3DUSB 3B3IA 2BOLA 1WZ1L 3AGVA 1N6QH 1NDGB 2OMVA 5CEZD 2NY7H 1LO4H 1Q1PA 1OOAA 4WHDA 2ADJB 1ZHKB 4J4PD 4P2RE 4GRMB 3SDCC 3PJLA 1XVSA 4HT1L 1VRSA 5E8EB 3PY9A 2XX1A 3WTWA 1LEGB 1X5JA 3DYMA 4M5YH 4LCYB 1T2QL 2CKBB 3OXSA 4LEOA 4QCIB 4JDEA 3ISYA 5EBMA 2PXYB 2O26U 1EAPB 4RQQB 1N9PA 2DIJA 1KUMA 2HX7A 2IOOA 4OGAC 4OBRA 3DBSA 3TBBA 3BZ4A 2BXZA 3D39D 3HRZC 4G8IB 4NO3A 4LSRL 1SHMA 4FQQB 5DRXA 3ZZLA 1NGXA 4YHYB 2A6IB 3LOWA 4GAGL 2KI6A 3FTZA 4YSCA 4ETQA 4L37B 5KVMC 3JTTB 4L1BA 3L4XA 2VKXA 1UWGH 3ULUF 4WHCA 2EDMA 2H45A 3EYFA 1QASA 4R26H 3NZ8B 5IQMA 1S7UB 3EJTA 3TJEH 3ZKQD 2VISB 1MN4A 1R3KB 4L5FL 4FLRA 4GO9A 5JQ6H 4NQCA 1MHPL 1R34A 4GKOA 4LARH 4JB9L 5MERB 3QDAA 1NLDH 2ICES 2NXZC 2QGCA 1CDHA 3ZGHA 3QIBD 5I16A 2ZNWA 5E23A 2DTMH 1UWYA 2FWUA 2ITFA 2OZNA 4WV1C 1TLKA 4GRLD 4A6YB 4ALAH 2IDQA 1ZD6A 2Y7QA 4H8WH 4Z7NB 1N3NB 1NAMB 1W0VA 4M6ML 4WEEA 2F6AA 4Z7UE 3QJVB 4LBEA 4N28A 1TO4A 1QRNE 4OM1L 1L5GB 4C8XA 3FQWB 5TGBB 5TD4A 5JPNA 3F58L 3QDJD 2E9JA 5IHWA 1XR8A 3WN6A 4P5SA 2CD0A 3C60B 5DUPL 5KVEH 1LE9A 5IQ9A 3CG8A 1TQBB 3LMJH 4PR5A 3W11D 4MAZA 2D31B 3AC0A 4Y19B 3CZSA 3ULVH 1UJ3A 4M6NH 2QLVB 4ORZC 4X6BB 1JGVH 3CN4A 3OM3B 3UPAA 4NQSA 2QDWA 3GSWB 4TSCH 3VSTA 2VE6B 5I71C 4G8AC 4NDMB 4FAAB 4FCHA 1RAMA 2DQCH 1FNGB 4FJ6A 1CD1A 5H94B 4ZMAT 1NIDA 4MAUH 5IG7B 1S46A 4E41D 1FAKT 4N22A 3U4EB 4QXGL 3PHAA 4P5TD 1BG1A 3R18A 4P2QD 4P2RB 1HH9A 2OXGB 3N1MC 1KYOJ 2NUTA 1NCAL 1FN4A 4AV4A 1DL7L 3B5GA 4F7CA 2FO4A 3ARGA 3BPCA 1K5NB 5EZIH 4PJAF 5KZCD 2O6PA 1U8PA 1G7PB 3VDBA 1IGTB 4B0MB 3U30C 1PYWB 1A14H 1NGZA 4FGMA 1N0LA 1LDSA 1XGYH 1JHLH 1KB5B 3VX0A 3O2DA 4XP1H 1YEHL 3V9EA 2PNDA 1KGCE 3KPMA 4HUVB 3C2AL 3RY4A 1RK1A 4EIGB 3VQ1C 1UM6H 4OF7A 3P4OB 4Y4FD 1A1OA 1UXLA 3PWJB 1B6DA 4FFZL 3L3IA 4G7SB 2J6EH 1MUJA 4FNLL 5E8OB 2IF7A 3PV7A 2DB8A 3HB3C 3VXUD 3L3DB 1IBGH 4M3JA 1KGIA 4Y7MA 1Z2KA 3AXLB 3FCTB 4JFUA 1A64A 1JK9B 1JK8B 3DWTA 3WFEH 3TA3A 5AL8A 3ARXA 1O7DE 5E6IC 4B50A 2WY3B 3CFCL 4ERSL 3Q8AA 4MZIA 3OR7B 5MI0B 3KH3A 3STLB 3WLWD 4FQHA 5EO9A 5IJCC 1QACA 4YDJA 4X6CF 1T6BX 4Z7UB 5B38A 2EICA 3GZPA 1QRNB 3CD4A 3IE9A 3MV11 3WS3A 2X4RA 5DS8A 1KY7A 4M6OL 2IG2H 5CGMA 5IEHB 1K2DA 2WLIB 2Z7ZA 3WKYA 1E27A 5DVNA 5A2JH 4FABL 2CO3A 1KC5L 1UASA 5GZNC 1J1PH 1G7IB 4JN2B 2IPTH 5DHYB 1Q9LA 3P11H 4DKFH 3TCLB 4L3EE 5A3IC 2ZKXA 1BOYA 3CVBA 5AUMA 5KBPA 4HSAC 2FQEA 3ARED 4OJAA 4Q9BA 4H0GA 2Z31D 2G2NA 2YBRA 4PJXA 5T8IA 5KS9A 4K71B 4XB7A 2WKLA 3KD4A 5ETUB 1UOKA 4NAQA 1HYRC 3HPJA 2P5WD 1NCCH 2DYPA 3MRLA 3DO3A 5A16A 2JELL 5D2NE 5IB3B 5BOZG 5JIHA 1Z5LA 3W1ZA 2WKGA 2V9QA 2NUPA 4N8VB 3MOQA 1CQKA 1BFVL 2H32H 4HKZB 4A7GF 4G6KL 1PW3A 2R69L 1VGEL 2NX5E 4BGDA 1IM9B 3MLYH 4Z77A 2W65B 1RJCA 4ZUVB 1RI8A 1TKWB 1MCHA 1SY6A 2D7TL 3MFFB 1VA9A 3BQUB 4HWNA 4L8BB 5D9SB 1SY6H 5FO9A 3LKOA 5GZOA 1SRDA 4YBLC 3S3DB 3T4AC 1RZGA 5FYJU 4JFDD 4KROB 4KJPC 2H2SC 2ITCA 2VN4A 4IK7A 5DJDB 2H3XC 2WZPD 2FQFA 5E95B 2UXGA 1AQHA 2WYIA 1OPOA 4TNGA 3RI5F 2L0DA 4ESKA 3NJGA 1J12A 1JL8A 4F5CA 4PWIA 3GPSA 2IOMA 3ISWA 3VG9C 4H8PA 4DVBB 2C1OB 2ZYIA 1XGQB 1I8IB 4I0KA 1UACL 4X7SL 3TIDA 3LQAC 1CICD 4X50A 1CXHA 3L13A 1KXQA 4CVXB 2B7DT 4JGUA 4Q4IA 1BMGA 4XVTL 1QSEE 2FIKA 5CWSB 4RSYA 3SIKA 4HU8A 4JFPB 4IRJB 1I9IL 4N2GA 2VABB 3VWKD 2F58H 4KNTA 2PWHA 5I75B 4R3SA 3SCMC 1JZDC 3RX7A 3SBWA 3WTTA 1ZT4B 5DRWB 2VR4A 4LU5H 1A6PA 3RWIA 4HF5L 4PGCA 2DKUA 5IHUH 4GXUN 1D9KB 5FCUL 5GGVH 5I6MA 3I9GL 4UTAL 3T0XA 3ARRA 2J71A 1D5RA 1YEJL 4EDXA 3RHWF 4OFPA 2BNUB 3MNWA 4BINA 4PJGA 1H5BB 2O30A 4L4TE 1S7QB 3SDXA 1J1XL 4FNSA 1P6WA 1R0AL 4Z3JA 3SPIA 1RHHA 3MA9L 4L3EB 2AEPH 2VKWA 3ZTCC 4BD4A 3CSPA 1JV5B 4Y4KD 1O9WA 4DEPC 5JIMA 3IJ7A 4KDVA 2DEXX 4GI6A 4PVMA 2LU3A 4F2FA 3MJ7A 4PRNB 4Q7DA 5JW5B 4Z23A 2LAGB 5B7FA 3CFMA 4QEGA 2ZCKL 4HVBA 3CX5J 2N7SA 2ZUQB 2VDRL 2Y1VA 4LOVA 4ORGB 2NX5B 1AO7E 3BFWA 3FQTA 4EI5B 5DJYB 5FV1L 3KNBA 2I07A 1VACB 4TSAH 4RISH 1LLAA 5BUPA 4WIQA 3H42L 3EFFB 5CM1A 3FAWA 2WUCH 5DHVB 3VYOA 4Q0XH 3FU7A 2C1PA 4KI5D 1U0QA 3CHPA 5I15H 3I6SA 3J2PA 5EORH 2N7BA 3GB7B 1UB5A 4Y7OC 4YHZH 4LCWD 1GKEA 3TOPA 5IHLB 4OV5B 2FGWH 2UWEA 1AAJA 2F9BT 3A23A 4FLHA 5F3HB 4OIAA 4B9CA 1DBAL 4S10A 4L2LA 1HXYA 4DPRA 1I75A 3ARFC 2NXYD 4FDWA 1M7DB 3TA4D 1Z9LA 3CC5A 3MJ8A 4OD2A 1KLGB 4N85A 3X12A 3UAFA 3APDA 3FT2B 4WEUD 1JF1A 4WFED 1ZS2A 1UOLA 3WNJA 2VH5H 5BOJA 5E5RB 5L9DL 2IQAB 4LVNB 4PJBF 1CDJA 1WAAA 5DVKA 2Y22A 1WDAA 3IU4L 5I9QB 1OZTG 3TEWA 1HINH 3KMDA 2BRRH 2NY2C 4ENEC 1PG7H 3L7FB 3QIWC 4BFFA 2ZE0A 3OGCA 1J8HD 4DN3H 4XNAA 1QSEB 1XF4B 3NT0A 3ZUNC 4HUUA 4KVNH 5IVZA 1EQWA 4QHNB 4FA8A 3EUUA 2PPDA 4M7JL 3A6CH 4ODVH 1S5HB 3QQDB 4FTVD 3PP4L 1ZA6B 2IIJA 4E9YA 5CZXC 3RZCD 1XIWD 4YR6B 3MKKA 1KBPA 4MNGA 4K7PH 5MEOA 4FNTA 3MXVH 5CJXA 2GUOA 3ZE1E 2Z35B 2ATPA 3FO1A 3DVGA 5G5DA 1FNHA 4L4TB 4X98B 4DKEH 3DIDA 4OCNC 1G0XA 2V5MA 1GYWA 3OF6D 2IC2A 2X2YA 3CQPA 3CZFB 2CUHA 2OYLA 2K6YA 2XC8A 4HIIA 4MS6A 5IBLD 5HGHA 2HT4C 2ENJA 2A9MH 4JPWH 3WN5C 4D8PB 3QO1B 3O4OC 4WHYH 1FPTH 1F97A 2JKIS 2NZ9C 4ELKA 1DLHA 3KPTA 1IB5A 4HJ1A 1G7LB 3APMA 4M62H 4Y5XA 2XKNA 4KMTL 5HDQL 2BMKA 5I1JL 1RJZB 4ZFZA 1OAQH 4XO9A 4CN4A 5E6YA 3CZKA 3MRMA 4RAVB 4WJ5B 3RL1B 2Q7YB 4ES9A 1AO7B 2AP2A 1HSAA 1W72B 2BFGA 2P80A 2UUDH 4FG6C 4ZPVA 5TQ0H 3WIHH 3X3FL 4XC3L 2YAMA 1KJ3H 1NANI 3HJEA 2JLLA 3BAEL 3QFDA 1T22A 1OTTC 2A9NH 3UOAB 2OM5A 3UBHA 1NBCA 5JPNC 1OK8A 1RIVH 2DEYX 2EADA 5L6YH 3IYLW 3D2UB 2J2ZA 4XP5L 4M8QB 4MJ5A 5EF3A 4F8QA 4IBZA 3MFGB 2GVYA 4XB3A 5DUBB 3TBYA 3FO2A 5EF0A 1PEWA 3QUZD 5FB8B 1UJ3C 1AGDA 3B9EA 4AMWA 1ZK5A 1IC1A 4JJHA 4KK8C 4Z6AT 3MQIA 1DJWA 3KPQB 2QZ5A 4LGPB 5HHNB 2GCYA 1YEIL 3QUXB 3KXFD 2UYLB 5BO1L 4DZBA 4F8OA 1R3HB 1OW0C 4BSWB 3ZO9A 4XCFL 1USQA 4G6JL 1H9VA 4AW4A 5K69A 4OM0H 4R4ND 1OSPH 7PAZA 4B9KC 1G94A 4MAYB 1QBBA 3VFGH 3PPEA 4JM4H 5HI4D 1CT8B 5FR3A 5ANHA 3N40F 5LCVL 3ARGC 1NLBH 1U3NA 1I3GH 2FBOJ 3BDXA 3MRFB 4QRPD 4YXKL 3UDWA 4Y2DA 3X2QB 2CLVA 2I25N 2ODIA 2IWFA 2RD0A 3BGFC 4J3OH 2A1WH 3SDCB 4I13B 4PEEA 1DN2A 4UT9A 4HIEB 5I8EB 3SKJH 3FN0H 3QHFH 1ND0A 3WCYA 1UOVA 3RRQA 4I1NB 5H37A 1KZYA 3UBXI 2DM2A 2BERA 3E8UL 2X0WA 3CSTA 3OB0H 2WLYA 4PREA 3ZYIA 3GSNA 3ZE1B 3DI2B 1J5DA 1E4XH 3DECA 3IFOA 5H37H 2CIKB 3SPHA 1BBJB 2R4RL 1GYAA 5DJ2A 1CLZL 4HIXL 3HRZB 3P4MA 2AEQH 1S7VA 4KGJA 3VFUB 1OXYA 2R27A 1A25A 1C12A 3OG6B 1A6WL 3WHXB 4Q8BA 2YAOA 4D9RD 3BKJH 3HNTH 1IU1A 4Y8DC 5CD5D 3N43F 2E76C 2X89A 3CMOH 2Z4QA 3UPCA 2YFOA 3IJHA 1P53A 1JYVA 3TA3C 4WNQB 2X41A 3MRBA 4YXLL 3CDFA 4W9EC 3DO7B 2O5YL 5D1ZD 5JIPA 3ZMNA 5KVGH 2A6JB 2GSGA 2NXZB 3MNZA 2OK0L 1OK0A 1LWJA 1CXKA 1NFAA 1PJWA 2DQJH 2X1PA 4MMZC 4Q9QL 5DMKB 1KB9K 3UJJH 1FL5B 1NIFA 3U1QA 2X9YA 3LRSB 5T1KD 2B8OT 2BP8B 4LHQB 4WV1B 1RD6A 2DWXA 2QVFB 5FM8A 3E8VA 1WBYA 1U3HA 3M46A 3QEUA 1A7NH 1GY2A 1XMWA 1J9QA 1Z0MA 3BVVA 4JFYB 5E56A 3UAJA 3S8GB 1TZOA 3EHBC 3EFDL 3FXIC 1UVQA 1KCRH 1RZQA 2FX8H 1CBVH 3SDDB 1FFNB 2VDRB 5DZNA 2XUWA 2ZKYA 3O6MH 3Q1SL 5AFAA 3T8XB 5BZWA 1HSBB 3MUZ1 2Y6SD 1C7SA 1KG0A 2YXFA 3EFOA 4NAJA 4XGZB 1NGPL 1SMOA 2ED9A 5IEKA 5C0FA 2DICA 5BJTA 5TPWL 3ZT6A 3HHSA 3DRQB 4GW1A 4R7XA 5GGSA 1ZWIA 2P24B 4KKLC 3V6BR 3PNWB 1K8IB 3RDTB 1BFOB 2C7UA 4BRJA 2BSSB 5E2TH 1MVUB 2P7TB 2BVEA 2P5PA 5F96L 1Q0EA 1D2PA 1KDIA 3OHXA 4O00A 2XZCL 3QRFM 2EH8L 3EW3B 2HLAB 1IFGA 1WS7A 1CFNA 1EFQA 2B14A 3A67H 3G5ZA 3IDMB 3RJQB 4IHOA 4F24A 2APBA 3EH4B 4P2OB 4RGOL 4X5XA 2AEWA 5GZOC 3VM5A 5D6CA 2IH1A 5T5NF 1YN7A 2OJEB 5T5FH 1PJ9A 2CDEB 4X8JA 5DO2C 4AJ0A 2YMXL 4YHPA 3IWVA 4X0KB 5BW7A 5GRZA 4BFGA 3IDIA 1GJUA 4TVPD 2NY5C 3IXTB 3O6LH 2IGLA 3U30B 4LDEB 2VUOA 3ULUD 4MCZB 4H0IA 3BXNB 1R5VB 5KWYC 5E2WH 3BD5A 3DMMD 3RKDD 3TWYA 4BUGA 3HI5H 1EDYA 1PD1A 3L3KA 2VL5B 1IAOA 2IDFA 2XXGA 2ZP8A 4MCYA 4F9LA 4MJ6B 3NCWA 4PJCE 2AJSH 2Y07L 1A6TA 1KFAL 5DVLA 3G5XB 3F64A 1OAXH 2F1EA 4XN2A 3CK0L 4QHLA 1U21A 5DHEA 2F5AL 5BRZD 3MRQA 4IOSA 4G80A 3SBWC 1Z9MA 1AXSA 5I8OL 2NDGA 3N85H 2OL3A 3ZKNC 3V4VL 4FI7A 1KXVA 3OKMB 1TZHA 3MYZA 4JO2L 3VXRE 3TPKA 3IPFA 3W2DH 5K9JL 2OMUA 3K0YA 2B1AH 4G7QB 3T0AA 1X9RA 3NAAL 3NFPB 3NIFE 4HC1L 4LESA 3ZZQA 1QFWH 3GI9H 3E9TA 4MDIB 5I1IL 5EU4A 2ICEA 5I2IA 4PRBB 3GBNL 3QAQA 2EDTA 3RY5A 4OZFH 3CGTA 2E4FA 4AEIH 2JQMA 2VR6A 4JZOB 4XO4A 5BMFH 1CD9B 1QEWB 1NCWH 4AJWA 4YHLH 2EO1A 1LK3L 1DQDH 2AK4D 3WE6B 4AV5A 5I0YA 5E0QA 1HWHB 3ZN6A 4NO0D 1RULL 4KU1A 3D2TA 3DPBB 4FJYA 4NGHL 3SQBB 4EZKA 4NJAH 4OV6F 4PJ9A 2ZXAA 5DRNB 2RBLA 5SWSE 3ESUF 4RMBA 2QVKA 4JFZH 1G9ML 4KTEL 2NY1D 3MROA 1EH9A 3U1SL 4HJSA 5KOVC 3IDGA 2QQKL 3CVIL 1ZT1A 1JN6B 4M61B 3CU1A 2DDQH 1UZ8B 1W8NA 3KPRE 5FF6B 5BV7H 4ZMNA 1RHFA 1JPTH 4LPCA 5LB1A 2FEDC 5HHPA 1IE4A 4UDUB 2ZOOA 1HAUA 4KQ4H 1JFQL 3SO3C 5IFAH 1OSYA 1J9TA 3PWLA 2V17H 4YGVA 4YBLB 3BWUF 3T4AB 4Z7UF 1MF2L 4ZXBD 2OYKA 1R5IA 2XBZA 1NJ9A 2K3TA 1G1OA 3QQ4A 4M7KL 3GUTA 1FH5L 4WI0A 4HGKC 4YOKA 4LVOB 1N59A 3GIZH 5ESAB 5EV7A 5CGYC 3WKMH 2V8LA 1A5FL 2OMTB 5BS0E 2HVKB 5B39A 1HKFA 2PUQT 2M26A 3VU1A 4RIRA 2WQAA 1QZNA 1MFMA 1AY1H 2L7QA 5FHBL 4KX8A 3SDAC 4CUCA 1E3XA 1CGVA 1U8HA 4H13C 2VXQH 4PJCB 4ECNA 4DF9A 3VG9B 3IF1B 2WLKA 1GGUA 1Y0LB 3V5HB 2LT9A 3NG5A 4UV7H 1RJLA 5SX5K 5I26A 2XXCB 3ZYOA 3QWNA 2X2HA 2Q7AA 3IWUA 3PQYE 4H8VA 2XZAH 3G5YB 4OCMC 3DX9A 5D2LE 2FZ3A 4ZUTA 4CNIA 3BEVB 3QQ9C 3KJ4B 3WD5H 3UTQB 5ACZB 2GSIA 1OAZH 3HAEB 4KJWC 2X4QA 1B4TA 3VXRB 4IEFA 5CJXC 2AK1L 1DP0A 2CUAA 3SCMB 3NIFB 5FPIA 4NZDA 1Z3GH 1MLBA 3LQZB 5I1LB 1TU2B 4D9QD 5EWIH 3CCHA 2H9GB 3QFJD 4YDZA 4DEWA 1PU0A 4I3SL 4NYLA 2V9RA 3VW3H 1MIEL 1VFAB 1L6ZA 1IC5H 4Y89A 1IQWH 3VX1A 5CD3A 1N5AB 5FV2A 3NABH 3FRUA 4JLRB 4PJ5D 1WA1X 4A1RA 3U2JA 2HP4A 4AT6B 5E00A 2AKRA 4PJ8C 1JTPA 5KBLA 4KQ3H 1YNLL 3MBXL 4KRNA 1RZJL 4OD3L 4AL8C 3EUDA 5CEXA 4YSAA 1MFBL 4DEPB 2YPVA 3THMH 3QXDB 1DVZA 2MOGA 3MBEA 3RVTC 5SWSB 3MXWL 4D94A 4KX9A 3CC1A 3ULAB 5F7DB 2YPVH 3UJIH 2F8IA 4V1DD 1OCWH 3BQVA 3FRPA 1HHJB 4MJJA 4ZQKB 1J5OH 3PHOB 3KPRB 3OKLB 3WNIA 1UA7A 4AVIA 2IFFH 3MUGB 3RFZA 3OPZL 5TF0A 1QHOA 1H8OA 2QV2A 5C0IA 4JQIL 2APTA 2OR9L 1IAIH 4G7VL 4Q6IA 1DJSA 1X5AA 4WI2A 1TJMA 2WXJA 1B2WL 4JFHE 3QEQD 2F7RA 2X2IA 1M05B 3WFHA 2XA8L 2B9AA 4K9EH 3HG1D 5INCB 4QLRA 5DURD 1YEDB 5B38G 5TE4L 4M56A 4MJID 4TUOB 3RVUC 1HKLH 1ZSDA 1JTOA 3LS5L 1SPDA 4PP2B 4YSRA 1NSNH 2DM7A 1LDPH 5BS0B 3MLXL 3GMRB 4Y0GA 3ARFB 2JSFA 4GQ9H 2L7EA 1K4CB 1G9NL 4Z3EA 4PS7A 5D93B 3VGFA 2APSA 2YRZA 1IBDA 2B1HL 4OY9A 4XCNB 5IY5B 1BXAA 5HDWA 2VR5A 3CBKB 3KEHA 3QI9D 4Y2DC 1BIIB 3TFKC 3FSAA 1A6AA 2F5BL 2NY2B 1MQKL 3QIWB 5LBSA 4DGYH 1P5VB 1ETJA 4MCMA 3PQYB 5D2LB 1WWAX 7TAAA 3JSSA 3N1FC 3FCBA 3NSYA 3KCWA 5LBSH 3QXVA 1RJYB 2VAAA 1OP4A 3REWA 2AGJL 4BK4A 4PG9B 3VQMA 5D1QD 2L8AA 2AQ3A 5KYUB 4QRRD 5LLIC 4MNQA 3S8WA 2DWDA 4JY6B 3LTVA 1E8WA 2CDFB 1I1CA 1NUDA 2FT8A 5IJVA 1ROWA 4S1DD 3VXSA 5AVRB 5IB4B 1MCFA 3WLBA 6PAZA 4UIMB 1SN2A 3D69B 2CKNA 4NNYA 1EVTC 4G9FD 5C0RL 1UQSA 4FQCL 1MJ8L 1JI1A 4MD5A 4A2HA 2YUZA 2X1WL 3JV6B 1MRDL 1MW3A 2VDOL 4X42A 4XWGH 2W07B 4DUWA 1CMOA 1OM3H 1MFNA 1MJUH 5F7NC 4OF3A 6TAAA 1VCAA 2Z92A 3CFTA 3LNEA 4UZUA 4O51B 3A4DA 4PJDA 2W59A 3MOBL 3WN5B 2JH2A 3OSKA 3VCLA 1T0NA 1TXKA 2XPGB 35C8H 4XBMA 5I16B 1IKOP 1S78D 2AITA 1W6WA 1UTDA 3P9MA 3MLTB 2DYRB 1NGQL 4H44C 4C56A 4UUJB 5IMLA 4HCIA 1J11A 3ESPA 5HHMD 1TT6A 1WVZA 1QFWI 3SYAA 1PCSA 3UTSD 1U3HC 3J07A 3UAJC 1G6RA 2KKQA 1TNMA 2WLLA 2MSPA 3TF7C 3JWNC 4WRLA 5DK3A 5DDHA 4ABWA 4APQD 4PRAA 5DJZB 4F7KA 2B4CC 3VWJD 1UYWL 1R75A 3CXDH 4FZ8H 4KAQH 1NCBL 5TFSH 3ZMRA 3HNVL 3OKYA 5JYLA 3K7UA 3QNYA 1TUPA 1ADQL 2E9GA 2GY7B 3ZL1A 4K8RD 4XB8A 2H0FA 1RUKL 5HHOD 3PGFL 1UJ3B 4XWOD 3IAPA 2A9BA 1KTDB 3X1BA 3DXAA 4AE0A 1UD8A 4O02B 4N2DA 5EEWA 4LCUA 3SZKC 4F37K 4NQSB 4YDVB 1WPCA 5DD0H 2AJUL 2XQBL 2I9TB 1HEZB 3OHXC 4LQFL 5CZKA 4MD4A 1WAEA 4H0HB 5I1DA 1P7HL 4E0RB 4DCQA 3QZWA 4UYQA 4XI5C 3AT9A 3QZPA 2F54D 7CGTA 1DBJH 3W81A 2PTTA 1WFIA 1W9XA 1KV7A 2D2OA 4XVJH 3O6KH 2ZG3A 5IHZB 5LWYH 4DEUA 2FD6L 1FN4B 1ONQA 1JGLL 1QMUA 3JZ7A 4YDKH 2MPAH 1P1ZA 2X38A 3I9PA 3UZQA 4F7CB 5M7QA 1NBZA 5D6DC 2FO4B 3ARGB 3WIFA 1GZQA 4JFED 4MGXA 1X6LA 3GMPA 5SWQA 3PWNA 3BGFB 5M95B 3FAXA 3DIFA 2GKIA 3NN8A 2WYHA 2FLMA 1E3ZA 4HIJA 5FO2A 4UNIA 4QRFA 3R7QA 1KIRA 4LLWA 4HJEA 1XF5A 1G0DA 3MLVH 4N2KA 3VM7A 1CGWA 1P69B 2MNJB 2R0ZL 2DI9A 3L4TA 4BFRA 5JW4N 4KZDH 2FR4A 4JFVA 1KN4H 3EKCA 1RK1B 1A4JB 3WXWL 5LGYA 5DR5H 4F9LC 5IQOA 3K2MC 5EIIA 1P7QB 2C34A 4PJHA 1KIPA 2P5EA 4H26A 3V0JA 1A1OB 4OJDH 4IRSA 5D4HA 3UC2A 4Z7WE 3RPIB 1SXNA 3L3IB 1J9RA 4Y1AD 4EUPA 1JNJA 2XWXA 4QRUB 3DDGA 4RFOH 3KDPB 3LEYL 3QZLA 4AYEC 1NPUA 4A66A 1JPEA 3GSOB 3LKSA 4IMKA 4ZDHB 1KXQE 4OJYA 3TA3B 3LZLA 5TF1L 3VJ6B 4PJFA 2WVUA 3BT0A 1VSCA 1FV1A 3EOBB 3H56A 2N0KA 3MRNA 5F9WB 1UATA 4R0LB 4RMRA 3PIQA 4BE5A 3GMQB 1KLUA 5GRJH 3BIBX 4MMZB 5D4QA 4DPCX 2I60H 5CBAA 4DKDC 3LN4A 4XH2A 3ZIYA 4O5LH 4UIKL 4BELD 2YIHA 5F1NA 3QDGD 2ICEC 2X4RB 1D5MA 4ANVA 2J6WA 1ZTXE 1PZSA 2J1ZA 3AACA 3SGEH 5AW7B 1AGEB 1KNOB 3S3JA 4IBLT 4A39A 4MMYB 4PV9A 4U3HA 2R29H 3QAZC 4DAGL 1INDL 3ZE1F 5J7CC 2H0PA 1KJ2A 5CJ8A 5GIRB 2HWZL 1UEMA 3KPNA 3UYOD 3T77A 1EHLH 3NK3A 3DX0A 1FORH 3AWEA 4YPGB 1MZZA 4PJ9C 5KS9B 3D12B 1UA6L 1CVSC 5EC2B 1SUJA 2APXA 3H8NA 2GAZA 2B77A 3S5LB 5A16B 5HJDA 3VFWA 4WHYG 3F7VA 2NUPB 3VFPA 1IAII 2Z7YA 5A6LA 3HE6D 2RA1A 2H2PD 2BVPB 3OAYK 3SYQA 5J1AA 3P02A 3D39A 5DC4B 1EAJA 3EO1B 1CR9H 2CJUL 5FO8B 1UUSA 1C5CH 3MLUH 2IEPA 4S2SA 3OQ3B 4OIFA 1A6VH 3GMMA 4BQ6A 2P8MA 1XSJA 4POZD 1QLFA 2VTFA 3WL9A 1IVLA 4QJ3B 5J12B 4KV5E 3V6FA 1AACA 1ADWA 2VDNB 4L3CB 1NOLA 2X10A 5FYJL 3VXNA 1BF2A 3MNVA 3QIBA 1BECA 4HZLB 5F7BA 2HT3D 4HIQA 1I8MA 4ZTOL 4RRPM 1EO8H 2A7BA 2KZBA 2X4UB 4N2OA 3TIDB 4JY4A 5DTFB 2FO8A 4L48A 3OLGA 1GKOA 1TMQA 3DYPA 1QBAA 4R7VA 2BDNL 4WZ9A 1WBXB 2NY3C 2YMTA 3Q5TA 2BNQE 2VDOB 4X4ME 1BJ8A 3I02B 4XTRD 3CFDA 2FVNA 3QPXL 4RFNC 2WXRA 4XXDA 3T8VA 3QDJA 2OMXA 25C8H 3CH1A 4R3SB 1EHKB 1RK0B 4JRXA 4UILL 4WY7H 3TC9A 2NZ1A 1GSMA 1WJ3A 1P6AB 5I1KH 3TH3T 1XMEB 5GRWA 1QR4A 3T65B 5HHVH 4J3OG 4NZJA 2PXYD 1DQQA 4E5XG 1P6FA 5ICYA 5CLXA 2OI9C 3N6YA 1V54B 1VKXB 1YYMH 1I31A 2XXFA 3U46A 4X9BA 2EVIA 5DD6B 1GS6X 2D4DA 5H37G 3RGHA 4RGNC 3RWCB 4L8DB 4OCWL 1QG3A 2V5SA 3L2LA 3MBEC 43CAA 1O5PA 4E41A 4GT0A 4GT7A 5CN2A 1B0GA 3L6FB 3VD0A 4P5TA 5BVJA 1G9EA 2O4EA 3WHE0 4P2QA 2XWZA 3A4EA 5IWLA 3TBVB 2VDPB 3MCG1 5FYKE 3G6JA 4HGWA 4QT5A 1OSEA 4I1RA 5AVQB 2VQ4A 1YPZE 2AJVL 1IL1B 1UKQA 1MJ7L 2WXMA 3T0DA 3B2MA 4LRNH 4ZFOL 1T1YA 1FBIL 1LO0H 3ZGIA 1T7WA 1ORQB 5C0CD 1E8ZA 3UO8B 1NC4B 1BD2E 3BZEA 2XV2A 3QNZB 2VZVA 4Q6IC 1MI5D 3Q01A 1UM4H 1I7ZA 3PDOA 1KCVL 2W91A 5CUSL 3EYSH 4XPGH 4BZ1A 4ZMXA 2AQTA 3WO4B 1CU4L 1A9BB 4OZHE 4F92B 5HVFB 1HH6B 3SO3B 4BZ1H 5J1TC 5LAXA 1U3YA 5LBGA 4LNVA 4JHWL 4Y4FA 2UZIL 1BX2B 2ZJSH 4XP4H 3C60D 1U58A 1HXYB 1J5IA 1SXSA 2VDKB 4G8EA 5IREA 4ES8A 4XBGB 4DVRL 5AW5B 4A7VA 3FUDA 3VXUA 4JAMB 4ANXA 2A74C 3X12B 4XPTL 4Y19D 4HIPA 3D8MA 3F5WA 4H8QA 3IN2A 5FHAL 2JB6A 5KVDL 5B4MC 5GQBA 5CEYB 3B9AA 3KL3A 3ARDD 4MRBA 1DSWA 1WHPA 3WFBL 3SDAB 3IBOA 5IFHH 4OFKA 2QPSA 3MO1A 1XQ4A 5F9DC 1S8DA 1EGJA 3BPNC 3ZZSA 5GRUL 4LSUL 4HUUB 1G7MA 5I74C 2BNQB 5CS7A 1I9JH 3HS8A 4XN7A 5JA8B 1KGWA 5K9OB 4J12A 2E3VA 1NUNB 2FDBP 1Z5YD 1D6VL 2R2EA 4JPIA 3TJHD 1OIOA 3WFCH 5J9PB 4HG4K 5J11C 5IBTL 3LB6D 2V4LA 1ZA3B 2AV7A 4LK4A 2F53D 3H3KA 4JRLA 3QJRB 4WEBL 5AB0A 4AMKL 3AREA 3DVGB 4JCWA 4NNPL 4Z7AA 1PDKA 1OP5H 1WCBB 2IQ9H 2PW1A 4KMQA 1B4LA 4GOSA 4R5TA 2P5WA 3GM8A 2AFNA 4HPYH 3VD7A 1P2CB 3S3BB 4M5ZL 1KCSL 1JRHL 3IFNH 4PJ8B 2BZ7A 2DKMA 5I18H 2YSSB 1HI6A 4E36A 1JGDB 5BRQA 4F20A 4U0RC 2DMGA 3WEXA 2XKNB 2XVKA 2AQ1A 3L5IA 2BMKB 4R2GD 1F4YL 4G9DB 4ZFZB 1TQTA 4R7NB 2GUYA 4DW2L 3P1VA 2WTRB 2K8QA 1YPZB 2IDCA 3VMOA 4AQAA 4HZ1A 5EF2A 1CD8A 2A9DA 5DD1L 3TURA 4K73A 2EC8A 1E28A 3C6LD 4JFDA 15C8L 1BD2B 3KGSA 3SGEI 4W9KC 1E6JH 1FLRL 3OKEB 2I5YL 4QHUB 4ODXA 4QRBA 2WZPA 1MFDH 3WY3A 1MFEL 4UOJA 2WSKA 1IGJA 3JWNE 4U7SA 4DGUA 5LN8A 5E2JA 2GTQA 1QRND 4MJ5B 4N5EC 1SM3H 4HEME 3P69A 4OZHB 2O61A 2ESVE 3T6WA 5C0AD 1U3JA 2CO2A 2Y7OA 1ODUA 3AS0A 3VD3A 3NIFF 1GC1L 3VD5A 1SVBA 4N2EA 1FUNA 3KBPA 4A38A 4U4IA 4IM8A 4TQEL 4XNUH 3EJUA 3LS4L 4P9HC 4LVHB 4C58B 3HE7B 1F6AB 2GCYB 3I9IA 3QUMH 2A77L 1QEXA 4OZFG 1SLUA 2VUKA 4ZFFA 4WCYH 2Y7MA 2JXMA 2H4EA 1D5ZA 1YY9C 1S7TB 3EZ8A 2EAEA 3ZTNL 2QT6A 2WLJA 4PUBH 1NBVH 4PBDA 3D9AH 3S5YA 2F19H 3VWKA 1PG7W 3ARSA 4BDVB 4ZUSA 3FOLA 3SYOA 3GRGA 2OS7A 1HXMB 1FNSH 2JCCA 5DD5H 2PWFA 2YLKA 2X0VA 1PGRB 1Y1DA 3HLKA 5JR1H 4HCRH 3GHBH 5KVDE 3DX1A 2GJ6A 1T0OA 1DEDA 1YY8A 3RWJB 4CBZA 5LGHL 5C8JA 4Q9RH 2Q10A 1M3JA 3JV5A 2XCMC 1NL0L 2VSKB 2DAVA 4LEBA 2HX8A 3ABKB 1JNNH 1XB8A 2WXIA 3WTXA 4Y4KA 4JFTA 5DS1A 5AVTB 4JZNB 5T1MA 1R33A 2D7NA 1F58L 1B3JA 3RWHA 3U7WL 1OGTB 4PLOB 1SF5A 2BOBB 5CU5A 2UZXB 4TTDC 5EBWA 5L8KB 4Y88A 4IRSC 5IROD 1UKSA 5KTEH 1FNEA 1PX8A 2NTFB 1MAKA 1KCUH 5C09A 4DP1X 1M7IA 3V7MA 3LPPA 3MYJA 3SE9H 4U7MA 4XRCB 1KPUA 2Z4QB 2QELA 4IMKC 4H40A 1B4JL 3LIZH 4QAMB 5TE7H 3V7AE 2NT0A 1DQTA 5AZ2L 4JM2C 4NN7C 3UZEC 5B39G 4HBQA 1U93A 2GSGB 2XG5A 3MNZB 4G6ML 3VFSA 4Z7OE 5J4MA 1OAKL 3BH4A 3ZE2B 4B9GA 4CAGA 1J86A 2BSRB 2ZOWA 1ITBB 2CLRA 4BH8A 1MG2C 1MHHB 1T0MA 1TCRB 4LCWA 1K6QL 1KJVA 1WBYB 1U3HB 2HZHA 4N2NA 1V10A 4NBYB 5D2LF 3QEUB 5H35A 4C57C 3OMZA 3W9DB 1LE5B 1TZIB 3V4PL 4HW6A 4WO0A 3VE0A 4ZMWA 2C9UA 1DVUA 1QLEB 4HPOH 1F45A 3A4FA 4I89A 2K45A 5DJXA 4BUHA 5HHQB 5I28A 2ESVB 2I7SA 4YSQA 1KB9J 1RZKL 4HHAA 4H88H 1Q9KA 2NNCA 1UD5A 1F90L 3Q48A 4CMHB 1ROCA 5IEKB 5BXFA 3E6FA 5C0FB 5BJTB 1F3JA 4J4PC 5CINL 3BKYL 5EA0H 1J0IA 1DEEB 2CIIA 5GRVL 2C7UB 1ZANH 4ZSOA 3BVDB 3AQZA 1IGMH 3PG2A 2CJ3A 4W9LC 2IH8A 3OHXB 1MSPA 2AMUA 2BVTA 3QIUD 4ODTH 5IIEB 1CFNB 1XB3A 1YECH 4Y8AA 3WJLA 1S7RB 4FTVA 1ZVSA 4X5XB 5IQLA 5E9NA 4HFWB 4CJ0A 1PZ5B 1XIWA 4NKDB 1IKFL 3RZCA 2B16A 2Q7NA 2ALAA 5D6CB 4EI5D 1YN7B 3BLPX 4X7CC 4UNVA 1GYVA 4G5ZL 1FGVH 3L8QA 3TEYA 2Q9OA 5B3SB 3P3SA 4QOKE 3UTTA 1QNZL 4E9LA 3KLKA 3OF6A 1TG8A 3P40A 4HV8B 5JDSA 1AS7A 3M8OH 1TJIL 1SXZA 5HYJA 2WP3T 4YC2C 3VYNA 4R8WL 3QISA 1QYGH 1BQKA 5K1VA 5DJCA 3QIBC 5EZPA 1XHHA 2OX5A 2VDLH 3L16A 3Q6FB 4IW4C 5IQ7L 1TQWA 2BNRD 1WP6A 4M1DH 2GYSA 2IMMA 5FYLL 1WBZA 4GRLC 1TOXA 4NUGL 3S34H 3V52H 1UM5H 2CO6A 1T7VA 1QBLL 4N6RA 4P06A 4Z0BL 1MCQA 4ODBD 4MA1B 3HS9A 3H3BC 1E42A 2X4TA 5GGTH 4U33A 1N4XH 4Z7OB 4QHLB 4GFXA 9CGTA 1NWPA 2DQIL 1QSED 1J10A 5FUZL 3MCKA 1A8JH 4GAJL 4Q2ZB 2OL3B 2VLJA 2Y06H 3WJMA 1PZAA 1NOFA 3LNHA 3R8BB 3W11C 3W9EB 4OLEA 1OKEA 3CQFA 2OMUB 1P0SE 1BLIA 2K0RA 3FW6A 4XPBL 2MH4A 3KYOA 3VGEA 1B0WA 1MVFA 2CHZA 4OF6A 3KXFA 3UCQA 1WA2X 4NENB 3UGXA 4S1SH 3T08A 2BS9A 3ETSA 4DPAX 3GQFA 4PY7A 5D7HA 5I5RA 2CRMA 5EU5B 3QAZB 4YDIH 4P5TC 3H9SE 4W9GC 3CVHA 4H2AA 1CGSL 4GRWE 5IWLC 1CYWA 5GRVK 1Q1JH 3NTCL 4Q74A 2DMHA 4I0PA 5DMYA 1P5UA 1E4WH 4OCXH 4CADA 1AD0B 4MA3A 3WJJA 4QRPA 3MTXA 3S35X 4N3UA 4R96B 4TS6A 5I6XC 3TBWA 2HPTA 4KO5A 3QR0A 5EU6D 1ID5I 5HGAA 1ZT1B 4U6XA 4XCEB 4YL9A 4FFYL 3BT2L 5GS1C 3PDGA 5CP7A 3VSUA 1BOGA 2R59A 5KW9H 3WG7B 1C8PA 3N42B 3G9VA 3GMNA 3DSNA 5HHPB 1YMHB 4AYFA 1LHZA 3HN5A 4QOKB 5CMAA 4YHML 4D7BA 2WMPA 4B60A 2XJLA 3PWLB 3FJTA 4HKXA 4W9FC 1HL8A 3WIIL 4Y4FC 3FSVA 3D2UD 3SKNB 1CLYH 2JTDA 3OLIA 2VXTH 3FTWA 1Y1UA 3VFRB 1MRCH 5E8PB 1DBBL 3IK2A 5A43C 4YHNB 3UEZA 3K4DA 1N59B 3D34A 1I8UA 4MB5A 2GJZA 3REVA 1SJHB 1C5BL 3F7LA 3WENA 3IE4A 2YC1A 3H1ZA 1LMKA 4RIRB 2E9IA 3NIGE 1V3LA 5D1ZA 2Z1KA 3WLWC 2QKIA 1ML0A 1W0YT 1MCIA 4M8RA 5F21B 2ZUTA 5T1KA 2YJLA 5E24E 4HJTA 1OV8A 4ONFH 1RJLB 4MXWL 4FP8L 3NP3A 3STZB 3MOAH 2GBAA 2VN6A 2VNCA 4PTUA 1L9OA 3WGVB 3HMXL 1PZBA 1IZKA 5H2BA 1UD2A 3AM8A 3DX9B 4ODSL 3TM6A 3BGMA 2FZ3B 4ZUTB 5FYLE 5PAZA 1U41A 2GSIB 4PGBA 1HHGA 3BIKA 4P07A 1FAIL 3S97C 1DJYA 3FUIA 4U6VL 1ZMYA 3AREC 4F37F 2Z31C 5T1DL 1YUHA 3CCHB 4M93C 2WAQA 4NYLB 3LRMA 2CGRL 2Q2EB 4L8SB 3HNSH 2MCG1 3ULSA 1OCCB 5LHDA 1NAKL 2VERA 4XNXH 4HKBA 4JRWA 4U1LA 2OI9B 1YC8A 2CJSA 2FB4H 3H9SB 1PF3A 2AEIT 3EO0B 4GRWB 4W6XB 4JGJA 4AM0Q 4KJYA 1YHPA 4GBXD 1DBKH 3INUH 3R8QA 2JNZA 4HS3A 5CEXB 3NRQA 2A6DB 4NQVA 4WI9A 2J4WH 4Z7WF 3CFQA 4NZFA 1NGYB 5CFAA 5EIIG 3KM2A 2R8SL 1JZJA 3AS3A 1BFTA 3BDBA 4NQEA 4ZS6D 5ILTH 2RQEA 4NP4H 3DYOA 4U1GB 3VXMA 3L4VA 1CXFA 3MRGB 1DUZB 3WELA 1P4BL 1OAYL 4UM9A 5C0IB 2Y1ZA 5FOJA 1INQB 2HYMA 1S9WB 2IMNA 5IQNA 5JQHC 4Q6IB 5FM5M 2BVYA 2X4OA 4AMXA 3MRJA 1Y18A 1HQ4A 1RH8A 4Y9CA 5E99L 3ULUH 1SN5A 3DMMA 3R1GH 2BWIA 2CK2A 2MNWA 1MFUA 3SDDD 5KSAD 2ARJQ 5DVOA 1CICC 1SNRA 1E40A 3K6DA 3SE3A 4UQDA 1MPAL 1W8OA 1TSRA 2WO2B 1EDQA 1DANU 1FCGA 1MHEB 3CU7A 3NIGB 2DQHH 2A74B 2XNAB 2FL5A 1BA9A 3VWKC 3RDTD 5E8NB 5BRZA 5D70L 1MCBA 4DQOH 4AEEA 4FERA 2QQNH 3O11B 4M00A 2Y1AA 1WD9A 2XV0A 5BRPA 3U79A 5KYYB 4WGVB 4HDIB 2AW2A 2W38A 5JHLA 1BZOA 4NT6A 3K8KA 4NO2B 4Y9GA 1VFUA 1QR1A 4P2OD 1RFDL 3ILEA 5I74B 5JHLH 1I9RL 3HFMH 4JDVA 4UB0H 2VAAB 3GI8H 4QNPE 5KAQG 3REWB 1IBBA 3HC0B 2G9HA 3IDXL 5J8OA 3L45A 3UBFA 1XBRA 4XVOA 1O0VA 2Q86A 2FSEA 4M3KB 4Y4KC 2WWNA 3OX8A 3PWUB 3M86A 4DN4L 4JZJA 2YPLD 4PD4K 4MZ2A 5L2JA 4H20L 1A4KB 1CK0H 1GGIL 5E94A 1FFOB 1BZ7A 4NNYB 4J39A 5A2KH 1BF5A 5FUCE 1L6PA 2AK4A 5HDBB 1UQSB 4BGLA 3HCVB 4NN6B 4DFIA 5CGBA 4J8RA 2EE2A 3SPVB 2DTSA 4JJ5A 2IBGA 4KXCA 3AQXA 3QRGL 4CSTA 5GS0H 3KPPA 1A66A 2P5EE 5HY9B 2ZG1A 3N3EA 5T3XH 3ABMB 3GKWL 5C9JB 4KV5F 4YGAB 3SGJA 4FHKA 1L3WA 4KXZI 3D25B 1KYUA 1MFCL 5E4EC 1PL3A 4KI5C 4U0RB 3TIEA 2BOCA 4MWFA 2PCPB 4PJAA 3P9MB 3NZSA 3QJFA 1SVCP 3K72B 4EN3B 3UX9B 4O2EB 1IBYA 4CSSA 2Q76B 2YPKB 2FBJH 4F2MA 3F2LA 3QCVL 1G6RB 5F9AC 2RJMA 3BRGC 1N26A 1TDQA 2VO8A 5B7EA 4ZXBA 1CFSA 4R90H 3OAZK 1IC4H 4UOZA 3U4AA 2NXYC 2B2XH 3FFCE 3QXAA 3VB9A 2JKWA 2QZQA 5DMIL 3FUNA 2EDKA 4XBEH 1HDMB 2EYSB 2RQ8A 3ARZA 5DZJA 1MREH 3ECQA 4NNXA 3W82A 1U95B 5IMOB 2P28B 1YJDH 4ZT1A 4AGQA 5E2UH 4IU2A 1IKNA 3U36B 4GG6E 4ZS7H 5BCAA 5IR1A 2WUBH 2YGPA 5F6IC 3BO8A 5K59E 2QTVA 1YEEH 5AOKA 4G7RB 4LLDB 3NP4A 4I48B 3MRKB 4MNHB 4OGZA 5CEZE 4POYA 4YBHA 5I1DB 1N6QL 2LLGA 2VB5A 3QZWB 2NY7L 1LO4L 3SY0B 2UY6B 2Y25A 3TVMA 3BAYA 2IV8A 4X6CA 3WJLC 2VZUA 2Y7LA 4Q56A 4E2OA 5EEXA 3RZCC 1XIWC 3BHBA 5I1AA 3L9RA 1XR9A 4M5YL 2J25A 3BVXA 4AYSA 4F7TB 1L7TH 4FG4A 3VSQA 2MCPH 5F9JA 2GT9B 1YPZF 4ZX5A 3OJVC 4KTDH 5L4FA 3QFJA 4TRPH 5J6HB 3D39E 2GITA 1CFMA 3I6GB 5FGSA 1DLFH 3IFLH 3NUKA 4KITB 1T03H 3PWNB 5B1JA 2G5BB 4B3VA 3DIFB 5IBLC 3BW9B 1UGNA 4H7VA 5CP3H 1QX1A 3EJRA 3MUUA 4HIJB 3VYPA 5EO1B 1FL6B 1UWGL 4ZNEE 1KIRB 1L0QA 5FDYA 1SVZA 1NFIB 1CDIA 4A2EA 4R26L 2AJXH 2TSAA 2W0KA 4OZHF 1KBBA 3H0TB 3CFUA 3D7PA 3TJEL 4NQXA 2GFBA 3VO0A 1ILSA 3JUZA 4LSSH 4IYKA 3O8XB 5FM4A 5JQ6L 2P5EB 4LARL 3P2BA 4WWNA 4A7GA 4CC0A 2YAHA 1NLDL 4IRSB 4V1DA 3TGXA 4UQIM 1IJ9A 3B2VH 1G4MA 1A9EB 3KPSA 3OZLA 2DTML 3G5WA 4KUCF 2GTWB 2XZQH 4ZOBA 3UFIA 3ZDZF 4ALAL 3RNKA 3TBTB 1T1XA 3RWFA 1GZPA 5IVNA 1JCKA 4K5LA 4PW4A 2W81C 4BFNA 4A67A 4H8WL 1NDMA 1TITA 3LZPA 3U6RB 1NA8A 4N8UA 4TNVK 2E7LA 3PIQB 2WC7A 4JM2B 4OGYH 5DQJB 3QUZC 3QEQA 5GISH 3OMIB 4RMSA 1KLFA 1YG9A 2J1KA 3BZFA 3LN4B 1AKPA 4OKVB 5IB5B 4KPHH 3FFCB 4YXHH 5KVEL 4MJIA 1D5MB 5TDPA 2QFPA 3LMJL 3EBAA 3L9BA 3PAYA 1TQCC 1T89A 1XGRB 4NRXB 3T3ME 1V8HA 3GDBA 3ULVL 4R4NC 2ZICA 3FHAA 4GG6B 2ZSVA 4K7PY 1PX4A 2UY7A 3MRPB 1UXMA 1JGVL 2ZZUT 3BH9B 2AV1A 4QY8A 3MVSA 5D8JH 1JZ8A 2GEEA 3PL6D 5HI4C 1SBSH 3K5SA 1N18A 1P5UC 4A2LA 3VI3E 1G84A 1S7WA 2IBBA 5JMRA 2DQCL 3QJSB 3QI9A 3ALPA 1E4HA 4MAUL 3IXAB 3DX7A 4LKXB 1MWAA 1TJGH 4P2QE 1VDGA 3VFNB 2J21A 4A2FA 2O6DA 2BO0A 4ODUA 3GMLB 2JFCA 1SJEB 3PHQA 4JDTH 5SWSD 4EI6A 3K1KC 3EGSB 4F7MA 3S48A 3SE4A 5D1QA 3ARBB 2YGNA 1P7KA 4QRRA 3GPEA 5DLLA 3E38A 4LLMA 5EZIL 5EBGA 4FFTA 4X6EB 2C3HA 1DSFH 4F7PA 5D71H 5B3JF 3K4ZA 5J1AB 3D39B 4PJEE 5G4NA 2X12A 5AD0B 5ADOH 5KJRL 3DV4B 5HDLA 3U9UA 1A14L 1QAWA 5JNYA 2C9RA 1TVDA 3MREA 4X9GA 3RJDA 4G9FA 1XGYL 5K39B 1JHLL 2XIBA 3FB8A 3GO1H 3BLKA 4XP1L 3RFRA 2EABA 3IVKA 3IPEA 4TPRH 3WUZA 5CD5C 1KEGH 4LCCA 2P8MB 1UM6L 2WXOA 4I5BB 4ZO8A 1QLFB 3DARA 2Y4SA 4MSWB 3EDKA 4PRDB 3WL9B 4YC2B 2J6EL 3H7BB 1M9WA 4MMXA 5D1ZC 1DVYA 4PI2A 2QKIC 1IBGL 4ODHH 1JYNA 4OB5L 4Y1TA 1I8MB 5CCHE 4TN9A 3TFBA 4MX7B 3WFEL 1ACYH 3NCFB 4GRLB 1NCOA 3UTSA 4JY4B 1H0DA 1N7MH 4AQEA 5AW1B 3L4UA 1QFUH 4LIQH 4JCMA 4Z5RB 1FZJA 1F13A 2R56H 2W1NA 3HN8A 2ICWA 1R5WA 4HP5A 1UGKA 1AGFB 4LSPH 5D7EA 4B9IA 3AG2B 3VG0L 5HHXH 2QVIA 5CJQL 3VWJA 3ECWA 3U4KA 5C08A 3CFDB 1IGIH 2YXVA 2K6WA 2PN5A 1KCBA 3QDJB 4LFHD 2Y6SC 2ZUSA 4PWKA 4RMUA 1E2WA 2GHWB 2IG2L 3V4UH 2N01B 3CFBA 3OL2A 1ZHNB 3DV6B 4NSKA 3NJIA 3Q6GH 5HHOA 3I75A 1J1PL 4HAGA 2IPTL 3EJZD 1I1YB 1V7NH 2MMXA 3IT8D 4LOEA 4L8CA 2QGEA 1GRWA 3P11L 4DKFL 3T3MB 3ROOB 1TFPA 1VB9A 1BQ5A 3GM0A 4JE0A 1KB3A 2CCLA 4PJBA 5KSUB 2XYBA 5DVPA 5HTSA 2EC9U 5EDSA 1B88A 4XOAA 2EKJA 4XNDA 2DBLH 1JHTB 1G7QB 3G7TA 5HI3D 2F54A 3VI3B 1NCCL 5HVWA 3RBGA 4N0CD 1CZ8H 2ZT9C 3ETBJ 5ABZA 4P2QB 5DI8B 2WO4A 1DDHA 2ZOLB 1KCKA 4JG1H 1VGKA 5BZXA 3MLYL 4JVWA 3G6JB 3ULVE 1QQDA 3BH8A 3Q8CA 5IV2B 4LSQH 3D4GA 3K6FA 2HFTA 2YBGA 1LD9A 4JFEA 2WTPA 2NOYA 5KZCB 4PRPD 4EAEA 1SY6L 5I6XB 2DLHA 5ANMA 4QJ5B 3FQNA 3NFSH 1NIAA 2OMNA 1QUNA 4KK9D 5H4YA 5GS1B 2ZX8A 5DEFB 3BZEB 1SJXA 4PJEB 4Z7OF 4K3JH 1RU9H 3ULUC 1WZKA 1H3VA 1KENL 4IIZA 2BP3A 3TT1L 3JT0A 1I3RB 3PDOB 4KRLB 2FJHB 5CCKH 3DMMC 4ANKA 3RKDC 4G1EA 2BSTB 2IO5A 5FLUA 5FGRA 2A0LD 5CSBA 5F2FA 3PDDA 4KOCA 1DZBA 4JFHD 1EMTH 4LRIA 1HCZA 3P4NA 3OR6A 3SE3C 4B6ZA 3ATDA 2HRPH 4AKOA 2IGTA 3O9WD 1XSKA 4HCGA 3CN2A 3SBQA 4BA8A 2HLFD 5CJBA 5I0ZA 4CGUB 2VIRA 1UXWB 4HS6A 1JPST 2GIMA 3P9LA 5TTRA 1RLBA 4KFMA 2FEEI 3TYFA 3CXFA 4FCAA 3OC8A 2X53A 2PCFA 5B22A 3QG6B 2IANA 5GGSY 4GINA 3L5WA 4OIBA 1P1VA 2LQRA 4FLQA 2F58L 4FRWA 3APFA 1G7MB 2XTJD 4X4YB 4YSSA 3QDGA 3BAIA 4LU5L 4Q52A 1ZRUA 4QPEA 1KEMH 3QDHA 2DL2A 4L29B 5IHUL 3MX0A 5GGVL 4XNYH 5AAMC 4HQQH 1VFMA 4JZJC 4Q89A 2XG4B 1LXMA 3N42F 4OFYD 2EVFA 2Y5QA 1A7OH 3HZVB 3S4SB 4ACTA 2CCWA 2AEPL 3AREB 2Z31B 2ZWSA 4Q6KA 4M93B 2PW1B 3FSOA 3M45A 3EYQD 2JIXD 2G3XA 4YIQB 4P4KB 3UTZA 2F74B 2NY1C 5D96C 4TL5A 4X6FA 1BAFH 3LKQB 3BP4B 3FQ4A 3KYMB 2X28A 2MTAA 3RGVD 3TT3H 3SGJC 1N68A 4FN0A 1P7QD 2HJKA 1VZIA 3OKNA 4U1HA 2YQ3A 3C6EA 3UERA 1DQJB 2EIMB 4HH8A 2YD3A 4HYTB 5A40E 2I85A 1AGBB 2G30A 4FMVA 3QWRD 4TSAL 3TX4A 1CN4A 4RISL 5C07D 4AQAB 2GK0A 4KI5E 3V5KA 4QXTA 4KZEH 2WUCL 4ZXBC 5E51A 5IJDC 4Q0XL 5I15L 4GIPD 4FNRA 1M6OA 4R4BA 1LK2A 2X0UA 5EORL 3GXNA 4PRHD 5T3ZH 5GXBB 4LCWE 4YHZL 3QJUB 1MCWW 1YJDC 4NJ9H 4AVKA 4DP7X 5SWZE 2FGWL 3RYMA 3L3GA 2DOCA 5HYSA 4GG8B 1IX2A 4CU6A 1IKNC 1Y6KR 4MQ7B 5FA3A 3V0FA 2V7NB 4C4BA 3GXTA 2ED6A 1H3GA 4LAQH 1VHPA 3BCFA 4WUKH 3T3PE 5DS2A 4ZG1A 5C7ZA 4WFEE 5E6ZA 3MDJA 4GSXA 1WWCA 4HIHA 4Y5VA 1FL3A 4P57A 3DBXB 4K94C 3EYOA 2Z3FA 5IB2A 1A47A 2HA1A 1CICB 2JJUA 1HX0A 1J1OH 4C4UA 1HINL 1J8HE 1SFDA 2BRRL 1PG7L 3DUSA 2ZF8A 4QYOA 2EDXA 1NDGA 3DHPA 4DN3L 4GRWF 3EOAA 4U0QB 4KVNL 4ZOAA 4FFVD 4GRMA 3NCJH 5AL0A 2OR7A 2I9LB 4ONHA 3A6CL 4ODVL 2D03H 1LEGA 4BK5A 4NM8H 4V33A 4LCYA 1XBDA 1HHHB 1JP5A 1UWFA 4QCIA 2OKMA 4W70A 5B1JC 2PXYA 2R0WH 4ZFGH 3K6SA 4RQQA 4UANA 3JWDC 1ZE3H 4HUMB 2WWOA 1PQZB 2CKBH 4K7PL 1NOAA 4OLZH 5FOBA 1YY8B 3MXVL 4G8IA 1N0XH 4LSVH 2A6IA 1JAEA 5KYWB 4DKEL 1T1ZA 5EOCH 3H9HA 4L37A 3BVNA 5AKRA 1E90A 4Z95H 5IK3B 5JHDE 1ET5A 2BIMA 3QULA 5T1MB 3F65A 1HL4A 3RWHB 3LCYA 2WWKT 3RX9A 3I74A 2A9ML 4JPWL 5EBWB 1X5HA 1FPTL 2VISA 2K8MA 1R3KA 1X7QB 3FB6A 4M62L 4IU3A 4MTMA 2WKOF 1URLA 1V27A 5MERA 1OAQL 3QA3B 3IGKA 2YEQA 4GPVA 1F1AA 5F70A 1Q0YH 1KPUB 3M1CA 1AP2B 1GMIA 3WIHL 3GF8A 2ZCHL 2CHNA 1KJ3L 3DX2A 3NIGF 2VDMB 4YE0A 5F9OH 3V2AR 4A6YA 1MI5A 3I3BA 1A21A 3MUY1 4BZYA 3VQLA 3HI1A 1U93B 5FGBC 3OKOB 3VFSB 5E4EB 2BSED 1UG9A 4NKOB 5B1AB 1N3NA 1XFPA 1RIVL 4M7LH 4QRAA 3CUPA 1Q9OB 2CLRB 3IAGC 3IKKA 2YD7A 5L6YL 1ZJBA 4YN3A 1L5GA 4LCWB 1NAMH 3M7OA 3O4LE 3FQWA 4S1RH 5TGBA 5CBEB 1GZHA 2IJ0C 2J5LC 5H35B 3Q44A 5SWZB 1EEZB 1T89C 2NCEA 3H55A 4G2AA 3C60A 1Q0XH 4KUZH 2DLTA 3I6KB 3IS0X 2NY0D 2B1OA 2YD1A 5C0JA 3T3PB 5LO7A 2D31A 1Z0NA 4Y19A 1X5XA 3HBQA 3KXFE 3SQRA 3A24A 1CFBA 1Q9KB 5I0WA 4X6BA 2P47B 1KYOK 3UJTL 2PF6A 3MJ9A 2JKLA 3QI9C 4Z8FL 3GSWA 2ISDA 1KPRA 1WWBX 2HFGH 4M8UA 2VE6A 4LLUB 4OM0L 4YUEH 4LOFA 1BCIA 5A7EA 1OSPL 4HWZB 1YQ2A 1J8HB 2DW5A 3MJ9H 1FNGA 4GB9A 3VFGL 4JM4L 1V7MH 3IRCA 3U4EA 3B4NA 4QRPE 2EH7H 1NLBL 2ZWLT 1I3GL 4HA1A 4PGDB 2FGZA 5D1QC 3SE4C 3UBXB 1U6AH 4AQOA 2OULB 2EDEA 2A1WL 2BC4A 2WSPA 4S1DC 1ZVSB 5F89A 2OTWB 4TSBH 3NSXA 3RZCB 1J0HA 3SKJL 3LH2H 2ZIDA 3FN0L 3IDNB 2FIRT 3QHFL 1FJ1B 4MASA 2CSPA 1G7PA 4Y4HB 4JHUA 1PYWA 1J8RA 4PAZA 1JF5A 2BRQA 2BVQB 4XMVA 1KB5A 2AEQL 1Z9PA 4LCCC 5JHDB 4MBOA 3ML8A 4NZRL 1KB5H 1IIKA 4D9RE 3CZUB 1T4KB 1XAUA 3D6GA 2ZUXA 1E5UI 4MMXC 4OQTH 5LGKA 3BKJL 2PCXA 3HNTL 1LQSR 3I6LE 1S78C 3P4OA 2MRYA 2FH8A 2EXWD 3PWJA 3T0BA 3VD2A 3CMOL 2AAAA 3OG4B 5E8OA 2C7FA 2HG0A 4GQPH 1NCTA 3PV6B 3L3DA 2CO6B 3AXLA 3FCTA 5SX4I 2NNRA 3V0VA 5JMOC 3W37A 1JK8A 5JO5B 1WFJA 2UUDK 4KXAA 3FTYA 5KVGL 5LDSA 2XACC 4APQC 2DQJL 3C6LA 3U0PA 2V0AA 1C16B 2DWYA 3UJJL 1ZY9A 3VWJC 5JIQA 3K2IA 1OPGH 4OLXL 2QPEB 3S3CB 3NQKA 4H0LC 4H5SB 1KTLB 1Q38A 3E0GA 4L4VD 3JWOH 1KN2H 4Z7UA 3AXHA 1A7NL 1JE6A 4KHXL 1FO0A 1QRNA 2BNQD 1CDYA 3OMAB 1GPOL 3L48A 3GS7A 4UBDD 3O4LB 4K8RC 3DC0A 3WJMB 5C0AA 1KCRL 3CFKB 3DJTA 1CBVL 2FX8L 1RIHH 4UM8B 3QUZB 4XWOC 5IEHA 1ZSHA 3EH5B 2WLIA 3AROA 1Z66A 3O6ML 2XWEA 3IRPX 4G7YH 3F84A 3KYOB 1G7IA 4JN2A 3VVVA 3RE0A 4IBVA 1THCA 4AYID 5DHYA 3TCLA 2AANA 3KXFB 4WFFE 1QZ1A 1D5XB 1HU8A 1KBGH 1IC7H 5D7IE 4XE5B 5IGXH 5C3IA 5E2TL 4Z78A 2FATH 3CVHB 1ZIAA 2G75A 1XDTT 4YZFE 5IB3A 2J3SA 4CADB 4MA3B 1J18A 4W1TA 2PO6D 4QRPB 3A67L 2OTUB 2WXGA 4HKZA 4J28A 4ENZA 1IM9A 2W65A 3EH1A 4ZUVA 5ITFB 1TKWA 3ALWA 5DLMH 1QP1A 1L0YA 3MFFA 4PU2A 5T5FL 1WA0X 4L8BA 4B3EA 5D9SA 2DLFH 2D0FA 5EZOH 5DEJA 1SMAA 4XX5A 4AYFB 5IZ7A 1CTMA 3OB0K 4PHZA 3UC0L 5AG9A 4JM2F 2UVEA 2AABL 5HI5D 1VZGA 5DJDA 4PLNC 3O6LL 3FT0A 3CLEH 2IPKA 2OQJB 2CHDA 4PGEB 5ENWB 3I2CH 3G08B 2XBDA 3RWDA 2XHNA 2NMSA 5E2WL 1EFXB 4NFCA 4F1SA 1OGPA 3HI5L 3BP5B 3KVPA 1D2OA 4ELME 5LG6A 1ILUA 3LXBA 2C1OA 3GXDA 3REVB 3WFZA 4AQ8A 4GG6F 1SDYA 4PJIE 4RZCA 1XGQA 2OXHA 4M9PA 4QI3A 2AJSL 5J3HD 4F9PC 4JNXA 3HE7D 5D1ZB 4CILA 1NH6A 2D0GA 2QKIB 4KUCD 4MXQD 1OAXL 4HMDA 4R6UA 3VFMA 5D7SH 4CVXA 3S35H 4YAQA 3CBJB 4UU9B 5T1KB 1AVAA 4LCVA 4OGXH 1E6OH 3FQXB 4NXKA 5C2UB 4JFPA 3N85L 2FK9A 4BBWA 5IJKA 2VABA 3MRHB 3CBRA 4U3SB 5DK0A 3EG9A 4PTTB 5I1HH 4MDJB 2CUIA 2MOVA 1ZT4A 2ZX6A 3GJFB 1AQMA 5DRWA 3T2NL 3W2DL 1IAKA 2B1AL 3DK0A 5FYJD 4UNUA 4PGBB 3ATAA 1QFWL 3GI9L 1MHPH 1OZUA 4NLAA 4JB9H 4PJ6A 4MZ3A 4N1HB 5F88B 2BNUA 1F6FB 2ZOUA 3T1WA 1YUHB 1H5BA 1S7QA 4G1MB 4WWPA 3U83A 4AEIL 3HC3H 4L3EA 5ID0B 2VRAA 3CDZB 2YHGA 2L04A 3B7UX 3NACH 5CLZA 5BMFL 2AK4E 1OTUD 2V33A 1NCWL 3DROA 4FZEH 5D7IB 1JV5A 1QSFE 2Y24A 4F7EB 3JT2A 5AKVA 4PLKD 1I8LC 1OF0A 3QHZL 4U49A 2EZ0D 4PRNA 5JW5A 4NJAL 1OGSA 3HE6C 3W5MA 2VUYA 1YEFH 1KXHA 5D2NA 3ZQWA 4JFZL 4NQVB 2H2PC 3KYKH 2P48B 4TNWK 5CR1A 4U6HB 3RDJA 4ORGA 1NM9A 2NX5A 3BKCL 2DDQL 4EI5A 5DJYA 3D05A 5BV7L 3QCTL 1VACA 1JPTL 1E67A 4XE0A 5BUAA 3L3JA 2C26A 3WV0A 3EFFA 4WGWB 4ZTPH 4JO5A 4KQ4L 1IE5A 5KBDA 2H0EA 3CZJA 5IFAL 1BZ8A 4N1CA 4POZC 2GBVA 2V17L 3GB7A 4W6WB 2EACA 3NCYS 3NEOA 5DHVH 1RP9A 4K7PX 1BBDH 3RTQB 1UA3A 4OV5A 3DJRA 6PCYA 4KRPB 1RUAH 3ARUA 2G2PA 3BN9D 5F3HA 2HT3C 3PAUA 2BNRA 1ZLVH 3DMMB 4Y5VC 3GIZL 4ZTEA 1F6LL 2ESVD 1M7DA 5BUGA 3APCA 1KLGA 4ELMB 3FT2A 1DVSA 3T3MF 3WOVA 1AY1L 1NCUA 4IBSA 2ZSWB 4U1NB 4QXWA 3KLAB 4H1LH 2IQAA 2VXQL 4PJIB 4TNVF 4AG4H 2DJUA 3RPBA 3F6LA 3TTYA 1CYXA 3L7FA 4XTRC 4UV7L 2BXYA 3VI3F 3DHJA 1QSEA 1XF4A 4X6CE 1X7SA 1YEHH 5GSVA 2XZAL 2ZOKA 3E3QC 3UAAA 5D5ME 1FI8C 3WD5L 3JTSA 1LP9E 2PXYC 3DUUB 3O3UN 1OAZL 4FFZA 1N8ZB 1S5HA 4NT6B 3TV8A 4NBXB 5I8KL 5L8LB 3QQDA 2PWGA 4LOUD 3FT1A 3KVDD 2OW7A 2ZXEB 1QR1B 5DWPA 2D8KA 4D9QE 4JDVB 5AW9B 4MHHG 1F4WH 1Z3GL 1G7HB 5BQ7B 4YR6A 1ZVNA 2G9HB 5EWIL 1ZT7B 3S98A 3VW3L 3EO9L 4PJ5E 2NY4B 2Z35A 2PPAA 4OCYH 2Q86B 1IQWL 4PJEF 1PZCA 3NABL 4JZJB 1AC6A 4X98A 5E94B 3CZFA 1TVBA 5BZZA 5KSBE 2AK4B 1U8CA 3P0YH 4KQ3L 3T4YB 4K4KA 4BJLA 1NC2B 1QSFB 4NO0B 4J8RB 4D8PA 3QO1A 1A2YB 4JJ5B 5DRZB 3THML 4YLQT 1G7LA 5IHHA 4UQCA 5D96B 5DFWH 1WIPA 4PD4J 1LQBC 4V1DE 5GPRA 5BZDA 4A04A 1MXGA 1RJZA 2YPVL 3UJIL 3R4RA 2X4NB 4FQ1H 4OH2A 1OCWL 1J5OL 3RL1A 4RAVA 4WJ5A 2Q7YA 4OQ1A 1PNCA 1W72A 1KGXA 5DFVD 1MCJA 3SN6N 4C54A 4MWFB 4K5NA 2DD8H 3KAAA 2X70B 3QJFB 4L2YA 2IFFL 1W72H 2DQGH 4NO5B 4ABQA 4FXGC 3ZBMA 1GZHC 4IOIA 3GLAA 2GABA 1IAIL 3DTDA 2YUVA 1LJMA 1JVKA 3D2UA 2HRHA 3C60C 3HG1E 3CZGA 1CFQB 1TQBC 2MQGA 4K9EL 3AAZB 4NC1E 5B8CA 2R69A 3K6NA 5F6HI 4M7ZB 3BDYH 2Y3NA 3BUYB 3EDFA 5FB8A 5DSCB 4WO4D 1BFVH 2VZSA 2FX7H 1OD7A 3D09A 4Y9EA 1HKLL 5I1GH 5DEGB 4XOEA 4G42B 1IEBB 2DQEH 3KPQA 3ARDC 4LHUB 1LDPL 5DC0A 5HHNA 5DU7A 5EIVA 5DYFA 2UYLA 1RK7A 1R3HA 4GQ9L 4BSWA 5J6GA 2F15A 4G8GE 2YN3A 3AMLA 2ZUWA 2RR3A 1KULA 2AZUA 4GS7B 4X8GA 5FCSH 5HBBA 5F0MB 3RB5A 5IW1B 1MWOA 3VRJB 3LN5B 3FK3A 1AXIB 2CRIA 3CE1A 4DGYL 4X6CB 1NCJA 1HXKA 3N44B 3TJHC 3MRFA 5D5MB 4YFLI 3D4CA 2CBPA 4RRPA 1LP9B 3IDYB 3LB6C 3L9RB 5D1QE 3SDCA 1AGCB 3ABZA 3ULVF 2RIKA 3NZHH 3LVEA 5JIIA 4XOCA 1WG3A 4HIEA 2WPGA 5F9JB 4J3WA 2ZONA 1Z6JT 2JJSC 1SLWA 4J8QA 3MV9D 3BUPA 5G4MA 4IRZH 1MCPL 3WUWB 1TEFA 3D18B 4XZUB 1AXTH 1O75A 4G9FE 1FP5A 3GTVA 4PJ5B 4B9PA 1BBJA 1T21B 4QOKD 1G5GA 2Q0ZX 4OD1H 4RWHA 3OJDA 3VFUA 2Q3XA 2HKHH 5KSBB 1KV3A 3LNGA 1GY1A 4PMEA 3ZQ9A 4R2GC 3WHXA 5FM5O 2JJVA 4U1JB 1AMYA 1OM3L 4F58H 1MJUL 1G1KA 4NQXB 2WIMA 1TVHB 1OLLA 2GJRA 2XY2A 4UTAA 4IQHA 3U9PH 4ZAKD 4CKQA 5C6PB 3IMTA 4V1DB 5F3FA 1WIOA 35C8L 5MEND 3L08A 2WK2A 3FTSA 4PW3A 5C86A 3C6LC 3AXIA 3VTAA 3WNMA