3JYBA

Crystal structure of the rets periplasmic domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
138
structure length
138
Chain Sequence
QNWRLLRDESAQLRIADVLQRKEQFRPLAKRSFIFPASPQAVWLQVQLPAQKVPSWLWIFAPRVQYLDYYLVQDGQLVRDQHTGESRPFQERPLPSRSYLFSLPVDGKPMTLYVRMTSNHPLMAWFDQIDEAGLVGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and oligomeric state of the RetS signaling kinase sensory domain.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords Sensor protein
total genus 30
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07696 7TMR-DISMED2 7TMR-DISM extracellular 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2380 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3jybA00
2XBZA 3JYBA
chains in the Genus database with same CATH superfamily
3IDIA 1AANA 1LDPL 1T1YB 2AJUH 2WXOA 5EU6E 4EUPA 2FGZA 5I82A 2YOAA 4K8RL 1FV1A 5C07A 1Q1PA 3JV4B 3L7FA 3LN4B 2HH0L 3BZ4B 4G3YL 5EWIL 3QDAA 3JXAA 5ADPL 4F9LC 2BM3A 1IBBA 1HQRB 1ID5I 4N2CA 1BYOA 4J3TA 3RVTC 2ADJB 1WZMA 1S5HB 2X0VA 1TU2B 1T0PB 3NABH 4W4OC 4JQIL 2IXQB 1KLFB 1VACA 2BY0A 2VL5A 1OT1A 3P30H 3MCLL 5C0FA 4XPFL 1IKFH 3UYPA 1OTSD 3ZKMD 1EMTL 3RFZB 1KB5B 3V7AG 3S34L 4MS6A 1B4JL 1PZBA 3RWCA 3EYOB 5I1LA 2EDHA 5DJAA 1KJ2H 1OAZL 2NQ3A 2XYCA 1FGVH 4K3EL 2PPCA 1E9PA 2D3JA 2PWGA 2ROXA 1FSKB 5TGBA 2W60B 4NCC2 3IDMA 4OV5A 5CZRA 4PJGB 4QGYA 1JAEA 1SM3H 5I5JA 5DSCA 2DIEA 5GZOD 3KBPA 3NOIA 4FEIA 4FS0A 4H25B 4NUJA 3O4LB 2WHVA 1KBGH 3D9AH 3HUJA 3TIEA 1L9OA 3JV6A 5DQDL 1N67A 3O3DA 4B9JA 1FFNA 5FA3A 1KLUB 4I87A 5T1JA 1T83C 1AQDB 3P2TA 2VXUL 3DX0A 2X9YA 1AE6L 3RIAK 3UFIA 4L23A 3VXRB 1JI1A 2A9BA 4IEFB 1ED3B 3L7FB 3QQNA 3X3FL 2XG5A 1PSKL 3KZ8A 2NQDA 1RPKA 1RURH 2L04A 1BF8A 1T89C 3OWEA 3CZSA 1AIFB 4GKNA 4LGSB 2BVEA 4OIIH 1CE1H 2CU9A 3GMPA 4KO7A 1WAPA 1XGPA 2XN9D 2WVVA 3E1F1 4L9LC 5DEFB 4OZIF 2GEEA 5EO1B 5BRZB 1WF5A 5TDPA 4FNSA 4CU8A 2ZSVB 2DWXA 4OQTL 5EG6C 4FXKB 3VGGA 3M1OA 4U7MA 3BVTA 1U3HC 1UADC 4JQXC 3SE4C 1RP9A 2LABA 2O5XH 3LZFL 4R7XA 4Y5YB 5GS1C 5GGQH 3T0BA 1JZ4A 4WSGA 5HHXL 1HIMH 3NJFA 5DURB 5D7JA 3VI4E 3ZDZE 4E36A 3EFOA 2F2HA 2JKJA 4PCKA 4LCYA 3APDA 3W9EA 4F8PA 5GGVY 3APCA 3IMUA 4YHKL 1K4CB 3CVIH 4ZOEA 3NJLA 5SWSB 3AG4B 3PF2A 3HE7B 4YSCA 1FNGB 2IDSA 1EEUA 2QV4A 2XN1A 3AGWA 3IJEB 4NT6A 4YWGH 1YNTF 4HSAC 1NSNL 3TBWA 4HEME 4Z7OB 4LEOA 4MS8D 5F0MB 1A3ZA 1FZMB 5PAZA 5EOCH 3KYKL 3X12A 4EIGB 2PR4L 1NAMB 2VB5A 3VNYA 2HLEB 1VAHA 4N2KA 3FCBA 4XN7A 4PJBF 4CBPA 2C3WA 1M6OB 4G6AD 1UXLA 3U0WH 3QAZB 2CLZA 3U30B 3VFPB 1N8OE 3J2PA 4P2YA 2IBZX 2QPFA 3FXIC 1IAIH 3QWNA 2NY6C 4HUXA 1OPGH 3DYOA 5C09B 3BWAA 2WBWB 2O5ZL 3RWFB 3SQBA 4Z5RA 3NRQA 1U8PA 3JTSA 5KVGE 2IV8A 3ZYOA 1ND0B 2I5YL 2X70B 2ZPKH 1FFQA 3G5YB 2YMOA 3ARWA 5J89A 5IUCA 1TPXC 2YJQA 4UINL 3MROB 3MA9L 2WCGA 3NJJA 3TVMA 3PE9A 1QLRA 4FLOA 4LFHG 3DO4A 5LGHH 1BQ5A 1JZDC 2C7UA 1BOYA 1JVOA 3BE1L 4XI5C 1ETZB 3KD4A 12E8L 2P5WE 1I3RA 5AKRA 1A6TB 2QADC 4H0GA 1GTFA 3GRWH 1P6WA 2CM6A 1LK2A 3VRLF 1JNHA 4HC1A 1P4BH 4G6JH 1KN4H 4S1QH 2HT3C 3QZPA 5CGYC 3F83A 2OMWB 3WNLA 3CZGA 1FH5L 2AEOA 2FJFA 1QKZH 3G9AB 2Z4TA 4GP5B 4XVTH 2ZUYA 1T2QL 2Z92B 3TM6A 3V95A 3ZDYE 1MW2A 1P5VB 4YNYB 3SOBH 3TN0C 2CRIA 1MHEB 3W11D 2ZCKH 4YSSA 1EO8H 2VXQA 3QIBA 4LHUB 1R5VB 2JKXA 3CHQA 4GO8A 3BH8B 1IGYB 1H15B 3GLEA 2WZPD 3E7JA 4OGAC 3I02B 4U1IB 1N3NB 3TT1H 1OTTD 3EYVB 3UYRH 2AITA 1LE5B 3FSZA 1OCZB 5C09A 3HG1D 1SM3L 2XIBA 3DOHA 5GGTH 3UTTD 2H9GA 4B9IA 4EN3A 2GJJA 4Z76B 3OLGA 4OUUA 2CLRA 4LLWA 5HHME 2BNUA 5CLZA 4L9LA 4Q6IB 1TNMA 2Z65C 1T4WA 4EPSA 1SLUA 1PDKA 1Q90A 4LEOB 3TEUA 4DKFH 3EH3B 3UTPE 1OK8A 3D3VB 4LRNH 3B2MA 4DEWA 3LQZA 1Y18B 3LS5L 3NCMA 3OR7B 2WQWA 1L7IL 3FT2B 4N4YB 1YLBB 3PJSB 1T5WB 5ACLA 2Y2TA 2HSIA 2KL6A 4KXDA 2DQHL 3OJVC 4PJAA 1E5UI 1RHFA 2HRGA 2QQKH 4TVPH 4DVBA 5HDQH 4UNVA 5FYLH 1NGQH 2KMWA 2V3DA 1WHOA 3N85H 3IWUA 4NI6A 5IHZB 3L13A 5FFOA 3FO0H 1T83A 3NDYE 5JO5B 4GG8B 5CR8A 4BQ8A 5JIQA 2UZXA 3ZYIA 4FNTA 3FQRA 5D5MB 3SGJC 5T33L 3DXAB 1FO0B 2ZUVA 1EAJA 4L3EA 4A6YA 2IAAC 1PX3A 1UD4A 5GGSY 1MRFL 2DJ4A 4LPYA 4XODA 3MRIA 3MACH 2KPNA 1KN2L 2OJZH 5AD0A 1P7KB 2F19L 4FFZA 2Q7YB 5KZCB 2WLLA 2ATAA 1LEIA 4NKIH 5AW0B 4ZX3A 3ULVD 2IGFH 4EOWH 4MWFA 1J8HA 3KYNB 3IETA 1I9RH 2RJMA 2Z8VC 2J8OA 2P8PA 4NO5B 5EU3B 3VFUA 4RRPA 3VRLE 1JXKA 3FTXA 1EDYA 1BEYH 3HLKA 1D9KB 3L4ZA 2XX0A 5DC4B 2G3NA 5F3HA 5MERA 3QI9D 3WN5B 2GBTA 1D5ZA 1NLDL 1OB0A 2DQCL 2GHZA 3VRIB 3KGRA 4JW3A 4B5ZA 1H5BC 1T66C 1T1WB 1WBZA 1DFBH 1CF8H 3HCVB 4K8RD 1JZ3A 2D7OA 4KO5A 1SJXA 4JGUA 4PRIB 2DQIL 3ZYZA 3TC9A 3BD4A 3PJSA 5C0GA 4XPGL 5FFGA 4RSVA 1HHJA 3VFVA 1CK0L 1KJVA 2MPAH 3FCTA 1NJ9B 1RIHH 3QNXA 2K7PA 4ELMA 1UM5H 1VCAA 3QORB 4AMXA 4ZUWB 3ROLB 2CPCA 3GK8L 1A1MB 3NPZB 1GZPA 4G8EB 3WXWH 1BV8A 5EORL 3DX8B 3RAJH 5LDSA 1UD5A 2H6OA 1HS6A 2AJUL 5EULV 3CSYA 3A6OA 3QIBD 4PRBB 4QXWA 3T8MA 3KPQB 3OZ9H 1KCKA 2PTTB 4AWJC 4LZKA 4P3DB 1KCUL 2W07A 2JB6B 2VM9A 1JHLH 4K7FB 5C0CA 2WQAA 4U3XA 3MRDB 3NBNA 3TNMA 1YN7A 3KYAA 2ESVD 5IHLB 5C0DA 3BEWA 1SY6L 1A66A 4OD3L 2OW7A 3OAUL 1LEIB 1LP9E 4R7LA 5JW4N 1I7UB 5ESAB 3KYNA 5ABZA 3QG7L 1L5GB 1H3PH 3AG3B 3ECQA 3JWDC 1CFBA 2GTZB 4IRJC 1RK0B 3TIDA 4HETA 1CU4H 1ZT4A 1U58B 4S1QL 4HIXH 4XCCL 3I6LE 3KJ6L 2P28B 1M3JA 2A6DA 4J3OD 1MHPH 2AEWA 3KPPB 3C5ZA 4GG8A 4JFPB 2IDFA 3P0VL 1WBYA 4EI6B 3MV9E 4FQIL 4UM9A 3B1TA 3WO4C 2WZ0A 1JGEB 4IQHA 4H2CA 4YVNA 4XXWC 3BIKA 1AZZC 1L6XA 2B9BA 1WFMA 3MJ9L 3S5YA 3V5DA 1QO3B 4JZOB 5EZIH 2PPFA 2P1YA 4JFHD 3N06B 3MUUA 4NLHA 1UXWB 2HJLA 1TTRA 2K0RA 3H7BA 1VRSA 5E4EC 2IADB 4YAQB 3LNDA 2F58L 2YQGA 4KK9C 2O93L 1ZANL 3IETB 5I6KA 4QGTA 1ITBB 1M2OA 5TE6L 1X4YA 3REWA 4OCWL 5F8QC 3NIGB 4B3EA 4MA7L 3GMRB 2EYSA 2EDRA 4KUCF 4AXWB 1DP0A 4NS0A 4OCYL 5SWZE 4JR9H 5F71A 4J8RA 1URLA 2Y24A 4ZFFB 4W9LC 5EO9A 5B4MC 1LO0L 2HVJA 5JHBA 5D6DA 5CIPA 3GXIA 3GGWA 5IESL 4GO9A 2FQDA 1ZHBA 2R0ZL 4LSDA 1AP2B 1IIKA 1S46A 4FNQA 1BA9A 4K5PA 3MX0B 2AK4E 3DGGB 3M6DA 5FK9B 1OCCB 3RZWA 2WWMD 5HVFB 4AVKA 3WXVL 3MXVL 1DJZA 1WAAA 2JKRM 4JO1L 1A0QL 3SODB 1UASA 4GUPB 4WNQB 4RGOH 2KC0A 3VXQB 1MUJB 3S3SA 5AOMA 1OHZA 4AGOA 5TE4L 2G9HB 3BZFA 3GHEL 3CFCH 1G7LB 3KHQA 4PI0A 3WIIH 4QHUA 2E86A 4F27A 4UQ2B 3O6LH 3SDCC 1LNUA 2JCCA 1MWAL 1O9VA 1QTSA 2QR0A 2W81C 4N0UA 5SWSD 1KG0B 2NY7L 1KN2H 3GMMB 4Z3HA 4AQAB 3BN9D 1K2DA 2Y7NA 2ZX6A 4C58B 1IAOA 5EO0A 1L5GA 1YNTB 2YPLD 3WKML 3LKOB 1FNAA 4NBXB 1AHWC 1NL0L 2OI9C 1TLMA 4LCWA 3BGFC 2Z9TA 5BVJA 2CHXA 3ZTNL 3C5JB 1EA9C 3QZWB 2PWEA 3WTWA 4UQDA 3QDMB 4J6RH 2G4EA 1NCBL 1UFUA 3V79C 1MAKA 3S35X 5D7LB 1XIWD 4RNRA 3ISYA 4W81A 4U1LB 3T2PA 4YFLI 2PWHA 4H8WL 4NRZA 1S5HA 4LF3A 4LQ1A 1CXKA 1Y6NR 2VR4A 3E2HC 5F7UA 3BFWA 4HHGA 5D1XE 1S8DB 2VQ1A 2BP8A 2R2BA 1TTBA 4AV0A 2Y7MA 5KJRH 1V10A 3QE5A 4E9RA 3BCFA 2P5WB 1F6FB 4UIKL 4GUQA 2X2YA 4A2EA 4ZYKB 4EKJA 3GI9L 2PTVA 3GJFA 1YEEH 2FD6L 2E27L 1QW9A 3D6GA 4CVXA 1JBJA 4HPOL 1CWVA 2OXHA 2A6IB 2LU3A 2NY5H 2GITA 4OI8A 4OGYH 2AXHA 4AM0Q 2YWYA 4N2LA 4LLUA 4LARL 5I1HL 3H42H 3DX6A 3ZQWA 1DFXA 5D1QE 1HAWA 1WGVA 1VEMA 3IDMB 4OV5B 3B3IB 4YS4A 4QY8A 3MV8E 4ZSOE 4GXVH 3U2SB 2W65A 1UD8A 2QPUA 1UJ3C 5LG1A 4AKOA 1SHSA 4KVNH 4LL1A 3RTQA 4ZNEE 3GNMH 1UWEH 3L3KA 4O02H 1DQJA 4XP1L 3ABMB 3C75A 2YSSA 4XO5A 2A9ML 4N25A 4QTIL 3PHOB 3QNZB 4X6CE 4V2BA 1JYNA 3S5ZA 1EUUA 3WY2A 3L3IA 2ARJB 1E2WA 2VM3A 2RH0A 3HW7A 4FYSA 2H5UA 4LSSH 3K4AA 3L2NA 4PSPA 4GH7B 4NZ8A 2BRRL 2NNAA 2WAQA 2Q20A 1QRNA 1TCMA 5HHNA 3IK2A 2X87A 1S9VB 4URTB 3MJWA 5SWSE 2VERN 4KTGA 1UT9A 1KTRL 1CFVH 4IOIB 3RDTA 3FULA 5EO1A 5BRZA 3ZDZF 1AGDB 1H3VA 5GRVL 2VDNL 1M9WA 4FYRA 1J12A 4XXDB 1IGTA 1OANA 3GMMA 2YWZA 5EEWA 1OD9A 3RDTD 4LCIH 3WYRA 2ARWA 2FECI 1C5CL 1KENL 1UYWL 4D8PB 2IO5A 2IPKA 2HX8A 3TV8A 3EDFA 5B22A 3B2DC 4HHAA 2G5BA 4MD5A 5E23A 3RWJB 3SSGA 1AXTL 5DD5L 4PVLA 3SEPA 2JJVA 3OR6A 2AJVH 4NKMA 1Z7JA 4R4FH 4QOKD 2ISDA 1WFUA 1ASOA 1P9MA 5E4OA 1CPUA 1RUKH 1WEJH 3QJSB 3ZK0A 4NRXB 4Q97A 3FW6A 4PG2C 1CG9B 4JKPL 3ZL2A 3QUHA 1DJIA 2ZX9A 1A9BA 1NDGB 1OW0A 4QOKA 2AEPH 3SZKC 3BKJL 2UWEA 5FCUH 1R3KA 3VD7A 2JKNA 5J6GA 4EZJA 2O5YH 1GGYA 2F8VA 4Q6KA 1IV8A 4LPTA 4PJEA 4X83A 1NOAA 3QJHA 4J27A 4OZFG 4FRWA 1I1AD 2C3VB 3UO1L 2CIIB 4Z7UF 3U7WL 4QHNA 4X5PA 3ATAA 4U6XB 3FN0H 4D9QD 2VH5L 4UYQA 1UWYA 4FC3E 3VG9B 2JMRA 2BVTA 4Z7AA 2WXHA 3QIWA 5D4JA 2R2CA 2X4PA 2I07B 4QXGL 3N9GH 1PZ5B 4L29B 1IJNA 4RAUA 1MZYA 2LAGB 1USZA 4WFFE 4Y19D 3B2VH 7FABL 1HI6A 4Y2DC 1D2OA 5EUKA 4PRPD 3US9A 1LE9A 3EBIA 2DLTA 2HG5B 4BFRA 1P7QD 4FFYH 3EYVA 2WYIA 4M61B 5MI0B 2VXSL 3RB7A 1EXUB 4Y2NA 4HPHA 3CZJA 4U6HB 1AY1L 1G4RA 4YJZL 2B7DT 1JJUA 5AUMA 2EH8H 2VC2H 5HHNB 4X9GA 2FECL 2H2PD 2SEBB 3U82B 5E8NB 2AVFA 2LV4A 5F7HA 4L9LB 1LEGB 4JFZH 1TJIL 2PPAA 5F88B 3VXTA 2VWEE 2JI2A 1CL7H 2O6EA 4LBEB 4G7QB 2FGWL 4ES9A 5IB2A 5CZKA 3GRWA 3QS2A 3RB5A 1JYWA 2CO7A 4HALA 5JW3H 1X9QA 4Y2LA 4W93A 1NCCL 2E9IA 4JFDE 2WW8A 4M93B 3QJOA 1H15A 5FYKE 3UTSB 2G75B 3HG4A 1MF2H 4LPVA 4U2YA 5DQJA 3TXAA 5L6YL 3K46A 1F2XK 4APQA 3EDKA 2ZYRA 5GZOC 2OV0A 2R39A 5IW6A 2J5LC 3T6XA 1PVHA 2ZP8A 5E7FA 1B9ZA 4KVCH 1TZIB 4B27A 3HNVL 3U7YH 2WQ8A 2WLJA 4QF1A 4BKLA 5D7JB 3T77B 3KLDA 2NTFB 4NC2B 1SUHA 2X44D 1KYOJ 2P8MB 3U9UA 4AC4A 5H2BB 5KSBE 2F7RA 2V17L 3ZUCA 4CJ1A 1EZUA 1OSEA 4M3KB 3TVMB 4PW4A 1HHGB 2CRYA 2DM3A 4F2FA 3QJHB 1M56B 1PKOA 4K7PH 4O51B 3TO4B 2WXIA 3H6JA 2AGJL 4EUPH 5EMYA 2SEBA 4JCWA 1MAMH 1YN6B 2YC1A 2VLLA 2WKLA 2WVVB 4PJCF 4UIMA 5DEFA 4ZG1A 1S7SA 3W2DL 4L0YA 1L3WA 5BVPH 1DBBH 4L4TD 4F15B 2FWOB 2OI9B 5FM5M 1MHHA 1I9RL 1U3HD 5L7XH 4U1SB 4YFDB 1XX9C 4R90L 5EF2A 1MCFA 5CUSL 4YSOA 5BS0E 1F11A 2B3IA 4LIQE 2VRQA 1SVCP 3JWNE 3T6VA 1UG9A 3TBYB 2MMXA 3QAZC 4HU8A 3TZVA 4HWBA 4ODBD 4WFED 3HRPA 2XCMC 5CS7A 2XA8H 2H32H 2V5RA 4ZMNA 2VYRE 5CKGA 5GS1A 1ULVA 2IMMA 4FQXC 2JLLA 1RIUH 1VPOL 3IXTB 3MRRA 4U4IA 4QMEA 4WY7H 3ZRCC 2FR4B 5C0EA 3EO0B 2B2XL 4HS6B 4P5TC 1QSZA 5E5MA 2BIIA 1EFQA 4BFNA 2UZYA 2R2HA 3SGKA 4AQEB 4YXHL 5DFTA 5L8JB 1KLGA 4H25A 5DEGB 4XP9L 2VM4A 2ZUQC 3BEWB 4M9PA 3L6FB 3K7UA 3K74B 4AKQA 1AYOA 1UJ3A 1JWSA 5EU4B 3RY4A 4X8CA 3CE1A 2LE9A 5JA9A 1EGJL 4ZMLA 1NCWL 1AS6A 5B1KA 2ZWSA 1I8IA 5DHYB 3RL1B 3U4EA 1JPTL 4EO5A 1HILA 2FATL 1WP6A 4PGCB 4RFEB 2D0GA 4JX0A 5J1SC 4WGWB 3UERA 3MLUH 1S78D 4TV3A 5CXPA 3OJDB 4FYQA 4FQCL 1DBMH 1QUNA 4MJ6B 2DQ6A 2DMKA 1N9PA 1T66D 2EYTB 3RU8H 1CICB 1INQA 4RGNB 4OZFB 4WI4A 4PV8A 5DTFA 5T1LB 4QRTA 7TAAA 1MREH 4QCIA 5D7LE 4OGXL 4P23D 5F89B 3NSYA 4UDTB 5KW9H 3UGEA 5J13B 3SBQA 2P3YA 2UZXB 1PZCA 1MFDH 4M1GH 1OAXL 3B37A 2IWKA 3B2VL 3BPOB 2P24B 1WIOA 2RB8A 2F19H 4PY8J 2C7UB 4YIQB 4DKDC 3P4MB 2N3JA 5JMRA 1J7VR 2AJXL 5F96L 2EC9T 3L5JA 1M57B 2QADD 5LAXB 5IVZB 1YRKA 4E5XG 3MRKA 5EBMB 4LAQL 2J57A 5F9DC 2WOYA 5TQ2L 3D34A 3TX4A 1C9SA 1IC0A 5CZXC 1QZ1A 1NMBL 1IGFL 3RZCB 1TVHA 4Z7NB 3LRHA 5DVKA 4N22A 3HE6C 4EIBA 5AKSA 3Q2LA 5IJVB 3IU4L 5ICZB 3IDGA 5DJ2B 5BZDB 3NFSH 3BHBA 2CJUL 2XVBA 1VGKB 1AR1B 3PNWB 4F7KA 3B4NA 1JMXA 3O6MH 4NN5C 2K3HA 3RL1A 1CVSC 2FX8L 4E41D 2NR6A 3HBPA 4YX2H 1RUML 3LHPH 4C83A 5BZWB 2DIAA 4XNZC 4GI6A 3HMWL 1GPOL 5HJGA 1DVUA 2OP4L 1OGSA 1TOXA 3Q5OA 3U2JA 1F3JA 4L3CA 3TBCA 2FYYB 5FYJE 1S5IL 2W9EL 4F2MA 3FT4B 1JZ8A 4IOFD 5T3XH 2Y5EA 3QXAB 4IM8A 1A4AA 2YGVA 2CSPA 1RFDH 1M4KA 4WJKB 4D94A 3VYNA 1V7NH 1WG3A 2C3XA 3K8KA 4O4YL 1KCVH 4YHYB 2AC0A 3HLAB 3PGCB 5INDB 1E7VA 5HVWA 3QUXA 5D4QA 4KK9D 5CKAA 3NQIA 1YEJH 1WBXA 2X3AA 3BEVA 2OMUA 4M5TA 5ID1B 5IVXE 2O6FA 4CBZA 2E9WA 2JIXD 3WHXA 1F58L 5I0YA 1GIGL 1I3RB 2R7EA 4ZMPA 3KLHD 3MX0A 3NFNB 2XKNB 4UUJB 1AGEB 1LO3H 1TIUA 4L5FH 4KKLC 2ZXGA 2GSGB 3QHTC 4TTDC 3NAAH 1QLEH 3QZWA 3OSVA 1D5XB 4RGNE 4HLEA 1XGUB 1A1OB 1KY7A 1ZK9A 1Q0XH 3CVHB 3VGFA 4OM1H 3LRGA 3S4SA 3CFJA 5IVXA 3PABB 3W38A 2EADA 5TD4A 5C1MB 4FYTA 1E50A 3QXDB 4F20A 3NSCA 5GGVL 4AUUA 3HOGA 4HKBA 3ZE2E 2N0KA 3E9UA 4TLKA 1IRAY 2AI0L 4YE4H 3SDDD 1U8QA 2P45B 2ZSWB 1EHLH 4OCSL 4RGNC 4LBAA 2GUOA 1MH5A 3EGSB 2BOLA 4HT1L 5I6PA 2X9XA 4GLRH 4FXGB 1ZOXA 3V6FA 1XGTB 3QARA 3IRPX 3VI3E 4B7IA 1J5IA 2LTQC 4M03A 3KLAB 4NM8H 1L9MA 4UILH 2X2UA 5LQBL 4JO2H 4NZFA 3QIUA 1WD9A 4P2RA 4ISVB 3HCVA 3ZDXB 3IJ8A 2HLAB 3FRUB 1YEEL 4X7SH 5MENB 3P73A 1XGYH 5C97A 3AY4C 3WDJA 3OXRA 3I50H 1URZA 4W9ZA 1G9EA 3P4LA 3WDHA 3N40F 1I8LC 2Q3ZA 4JJHA 4KZ0A 4XBEL 1H3GA 1HQ4B 4UQCA 2A6DB 4J23A 1M1XA 4IBUA 5J12C 4FCHA 1GRWA 4FA7B 5C0BA 1TVBA 4NWTH 1UWGL 2CWRA 5AWNL 4ENEC 1EK3A 3LEVL 3EGDA 4FJ6A 4LAJH 1GOGA 2B16A 1NFAA 2GBUA 3EH5B 5AAWA 5IB5B 2WSKA 1EJOH 5L4FA 3QJQB 1ZCRA 3R0NA 5C0BD 3V52H 1TQCC 1Z3GL 3BSHA 3FQYA 4HCFA 1FNLA 1IVTA 1DQJB 1JE6A 3FOMB 2DTSA 3EO9L 3U9WA 1QX1A 4MNQE 4IU2A 4QRBA 3IFPA 4LSUH 1N5AB 2QR0B 4N0UB 1F3DJ 4PJHE 5EPMA 3TV3L 1MWAA 4AYFA 2W5PA 5T33H 1CXIA 5JZ7D 1ICTA 3B7SA 3GO1H 3DIFB 3O8XA 2W91A 3G6DH 3VU1A 2VZVA 5I8CB 2GJPA 4DZ8B 1HE8A 4ZAKD 3JV6B 1SRDA 4TNVK 5J4MA 4GO6B 2Z91A 2ZOKA 5E2TH 3CSPA 4GRMA 4PJXF 1AIZA 4YHYC 4M1DH 2OJEB 3KYMA 4ODXB 3NCEB 2NUPA 3C60C 1JN6B 3D85B 3FQNB 3AMLA 3VWKD 3G6JF 1QLFA 3S96A 1IC4L 1KT2A 1X6NA 4FL4B 1CB4A 2CO4A 3K4ZA 4RDBA 1KNOB 2HCZX 2H32B 4OIBA 4PR5B 2FD6H 3VAEA 1I9JH 4JKMA 1FIEA 5LGJA 4UOW1 3MRHA 1NEZG 1T6VN 4LCCB 3D25B 2XICA 3PJNA 3RILA 3D0VB 2X4SA 2B4CH 3AB0B 3GFUA 4Z7NE 1IM3D 3ZT6A 1BF5A 3T2NL 2JCCB 1IAIM 2BFVL 3QUYB 3DO7A 3HFFA 4NPYB 1X44A 4ZW6A 2CKBB 2HMIC 4Y5YA 4GSUA 3LV3A 4NAMA 1BZDA 1D6EB 3RDTC 2V7HA 4M6OH 1J0KA 1CD1A 4CADA 4IBLT 1NDTA 4EN3C 1IGCL 3RA7L 4FI8A 3L16A 2Q3AA 3N41B 3FU5A 3IS0X 1MNUH 1OGTB 1KC5H 2GCYB 1P1ZB 4ZMVA 1E8ZA 5AW5B 4JFTA 2Y07L 1X5KA 4ZW7A 2PCFB 1NCJA 3WGVB 4A2GA 4I4WA 1NBYA 3V5KA 2NNAB 3W39A 5F7DA 1N2RB 2PWFA 2XWEA 1ZTXE 4JZJC 4EI6A 1DL7L 4K55A 1S9WB 3EFFA 4BUQA 2X9WA 1TU2A 2AQ1A 2N01B 4AQ8A 1YY9D 4LQFH 3RX7A 3L5WA 1R5IB 2L8AA 2YAHA 2QPDB 3F7LA 1SBBA 2CHNA 1OT4A 1URIA 3MXVH 3AREA 5I5RA 4JFSA 1AI1L 1ADQL 4N8CH 3TBVA 4G7RB 3IPFA 2VJ0A 4PRPE 4Z7VA 3HZMB 3RWGB 3WIIL 1KGJA 5IOKA 4E2OA 5BVJB 3QRBA 4UOJA 3U2SA 1I1CA 2ZUXA 3UC2A 3T0EE 4AQ1B 5KS9F 3S35L 3BAXA 5TPWL 2Y69B 3KGUA 3QORC 3IRZA 3IMSA 4DO5A 2EYRA 3G5VA 4OF7A 5K39B 4G9FB 3QC6X 4BZ1L 1EVUA 5DLMH 1OAKL 3UZEC 2UV3A 2BY2A 3RWEB 3CVCA 3CFKA 4WTZG 3VCLA 4JL2A 5D2LA 2B20A 4Z7WA 3NTCH 3UGXA 2VLRB 2G3ZA 4KKPA 1MCLA 4OCWH 2XQYA 2X4RA 1AQDA 4HZAA 4U6VH 3HI5H 1AP2A 1JNHB 2VTFA 1JS4A 3JV5A 1BG9A 3AM8A 4JM2A 4UT6A 3WNMA 5CINL 3Q8CA 5FECB 4JR9L 4NRYA 2G2NA 2N7SA 3L1FA 4ZPTA 4AGMA 2KI6A 4WGVB 4PJEB 4DTGL 1QBML 3UBFA 4FDWA 3CQPA 4WHYH 3U0TB 1AG6A 1SQ2N 2FZ3B 3P11H 1GL4B 4I5BA 4I8DA 2BNRD 1R47A 4JPIB 2NY5C 4WRLA 4G70B 2Q3XA 4HFWA 4PJDF 1BFVH 4ANWA 2XFXB 3C6SB 1E9OA 2OQJB 2C4XA 2TRHA 5EOTB 2BNRB 1ACCA 4M43L 5ITBL 3MOQA 4F15C 1DANU 1QPXA 1C7SA 1E8WA 1E9QB 4GBXC 1OT2A 5EIIA 4OZGB 1U8KA 4JO1H 2CQVA 4AQAA 1YPZF 2XWJA 3FT1A 4JPWH 4KAQL 5D7SH 4RAUB 4WUUD 1ZSDB 4H8WC 4NQCB 1BQSA 2JQZA 5DWUH 4Z7WE 4PREB 1VADB 4I18B 3D0LB 1A2YB 5I26A 4F57L 2ZXCA 2VOTA 3MV9D 4HS6A 2VDOL 4DGYL 4RQQB 5F7KC 5IQ9A 2ZWYA 2QSCH 3R06A 2WXMA 1KLUA 1TPXB 2NW2A 5GSRA 4PJ9A 1KPUB 1BZQK 2O5ZH 3TEXA 4AENA 4HF5L 4BSJA 2LU7A 3EBAA 5F9AC 5T3ZE 1CFQA 4KMQA 5HGDA 4AX3A 1T0MB 4TXVB 5E99L 1EX0A 4Y5XC 1N18A 2P80A 5AKTA 3V0VB 3EDDA 2FHCA 4Y19B 3MRPA 4N0FA 3LZQA 3TP4A 1B9KA 2PTUA 3E3QC 1M7IA 1PZAA 2VQTA 4P5SA 5L2KA 4DIXA 4KX9A 2XVLA 1HXMB 2GKIA 2VN3A 4AYDC 1QSFD 1KN4L 4WEMB 4X98B 4ZW8A 1NAKH 2FIRT 2IAMA 3OM3B 3VFSA 3LAFA 4YDVA 5I74C 2IWEA 5KEZA 1RUAH 4UU9A 1R4XA 5CHNA 4FHJA 4IKNA 2KQNA 3V4PB 1BAGA 4KKCC 4XZUA 1RK1A 1I9IL 1FFPA 3E3QE 2ADIB 4OLZL 4O02A 5BV7L 3QCTL 4IRZL 5JORB 3D0LA 3ZQ9A 5CLTA 3OKLA 4N2BA 1G9MC 2J6WA 2VR5A 3U36B 3K5RA 3L5XL 4TRPH 1UM4L 2DWDB 5F8RC 5SWSA 4NO0D 3WFZA 2YRZA 3A67L 1NCUA 4HBCL 2EQDA 4NT6B 1XF4A 2K6YA 2X1PA 3DARA 3MOAL 4M48H 1J18A 2EKSB 3GBNH 5D7IE 5FYKL 4AGQA 4FFWC 4M5SA 4Y2DB 1K4DB 2XI9A 4WKZB 1TUPA 1FFNB 2CJSA 3F12A 5FA3B 5ALBH 4A67A 3K0YA 4QCIB 3BP7B 2DLHA 4OF0A 2I85A 1KJVB 2DH3A 4PVBA 5D1ZD 4HLJA 4ZW5A 3X14B 3VGDA 2IH1B 3HBQA 2HRPH 3AFLA 4LOEA 1RQ5A 4TVPE 3QDGE 5HDWA 2VDKB 4OZ4A 2AS5M 1JV5B 1RKRA 3UAJC 1BQRA 4ZSOA 5FLVA 5TDNA 2FYYA 1I7RA 1LEKB 3EHBB 3FTGA 4WI8A 5TGBB 3HC4L 5FV2A 2NY3D 1N3NA 2NR6C 4GMSH 3WHE0 4TOYH 1NINA 3SBWA 4YSQA 1J1XL 5IM7B 2Q2EB 3DK2A 1GYVA 1C5BH 2F5BL 2NNFA 3LKQA 4RRPG 3VXSA 4RLDA 2FAUA 4X4XB 4WI0B 4JDVB 3TEYA 1E3FA 5CU5A 2Z31C 1KENH 3D09A 4ZTEA 2R2HB 3GUFA 3VSTA 2CO6A 3CBRA 3GIZH 2VZUA 1N70A 3QUXB 3WOVA 2XWTB 3FUHA 3FO1B 3VXRA 4Q9CA 5GZNC 3K6NA 4K73A 4XPTH 3TIDB 4LVHC 2ETWA 1M71B 4JY6B 2OMWA 1PGRB 4E41E 5CCJA 1SJVA 2ATPA 2IEPA 3BW9B 1YYLL 3DV6A 3PWUB 4G6FB 4NBYB 2C4FT 5T1DL 2CBQA 3HRZC 4UM8B 3SQOL 1BZ9A 4NFBA 3QEHB 4I3SL 5C0AE 1AMYA 1ZMYA 4N85A 3TV3H 5J1TC 4KZCA 3HMXL 2P5ED 4H40A 4XP6L 4AE0A 2V8LA 3LPFA 4LCUA 4BUHA 1FNGA 1TZGL 4HOWA 2IAMB 2NTSP 1C12B 3HG1B 3BGAA 4O2EB 2IWFA 5CZVH 4X4YB 2BY3A 4N0YH 3QYNA 1JWMA 4NKDA 2R2EA 4X6FA 1EUTA 1D7DA 3R0MA 1ADQA 4GRWH 1NTDA 3DYMA 1QLEL 4U1IA 1KYFA 2V5MA 4JKPH 2DEWX 1G7HA 3BO8A 4OLUH 4YK4C 5F96H 4KFZC 3IN2A 2ZXEB 5IB1B 4L9DA 1TFHA 2ICEA 1HHGA 3LRLA 1DUYA 3GLZA 4KHXH 4RZKA 3T0XA 3F00A 4P4RA 4X6BB 3DX9B 5E1HB 4IOFC 1WFJA 1RZIA 4N87A 5HHXH 1H6EA 4PJGE 5I17A 4W4OA 3BKML 1KELL 3P9LA 3QEQE 1CFSA 5J56B 3LXBA 4QXGH 5DVPA 1FHNA 4AKPA 1BREA 2VR6A 1W8EA 5CEXA 3QNFA 3ILDA 1KDIA 2XTLA 2Y25A 5EBLB 3RZCA 1CZ8L 5BJTA 1KCUH 1N68A 1UFGA 3VGAB 2XZQH 1BOGA 2OR8A 4F2ME 1EJ6A 4YXLH 3QEGL 4FMFA 4PJAB 4HLZG 1AO7E 5IBTL 2XQBH 2EUZA 3WEOA 4JDEA 1Q9OA 5BRPA 1THCA 1OTSC 2FNWA 1A6TA 3RDJA 3ZKMC 1ETA1 4ANVA 4U1KA 3DGGA 4Y1AD 5FK9A 1BJ8A 1DVZA 5IY5B 5HGGS 1T2JA 2YGOA 2YPVH 1NA8A 5HDLA 3WFEL 1JSYA 1RLWA 3HKFA 2GUOB 3ILPB 4UQEA 2PR4H 3UTSA 4QTFA 3VSUA 4WF7A 1QFOA 5GS3A 2WWKT 3B9KB 4XNMA 1EWHA 4R83A 3ZTDC 3VE0A 1PX8A 5EDSA 1FLRL 5LGYA 1UT1A 3CX5K 2K8MA 2MOGA 2R0KL 1GZQB 4NN7C 3II3A 5CF3A 2YN3A 4HPYL 5B39G 2HLFC 1SXZA 4WWPA 5D2NE 3AS0A 4S11A 4ZMZA 1E8YA 2H6UA 1HINH 1I1AB 4FQHB 3LX9A 3HS0B 1I8IB 4ODHH 1J8HE 2ZIDA 4EQ2A 5KSVB 1MWAB 4KHTL 3FZUC 1GGUA 4KRMB 3ULUH 5CP3H 3D2TA 3BZEA 4L5FL 1VFAB 2WYZA 1RZKH 2JB5H 4C47A 2R7EB 2EO7A 1U42A 1I85A 2JLPA 4RBPK 2VC2B 3KPTA 3CFDB 4FNLL 4IDJL 4F9LA 3TJEH 3GZOA 4MQXC 1R46A 1SPDA 2RCSL 2F9BT 2R0ZH 5IB5A 4FABL 2EO9A 3D3VA 2Q86B 4JZNB 2H3KA 3H9SD 4KFMA 4PJ8C 1BMGA 4WCYH 3VM7A 3KM2A 1CN4A 4NC1C 4WNSA 4PS3A 1G7PA 3MLUL 4WTWA 2QELA 1JGUH 2NYYC 2TSBA 1F3JB 2V4LA 2YA1A 5IB1A 5JQHC 1MDAA 5LGJB 1FBIL 1HHHB 1H9VA 1IGIH 4J3UA 1S7TB 2X4SB 4P3WA 5B1BB 2DW5A 2ITDA 4G71B 4YXKL 2MSPA 3T1FB 4R4BA 4E0RA 1FNHA 2BSRB 1YN7B 2DBLL 5B39B 3LZLA 5GJSH 3RTQB 3TT1L 3NJIA 4MNQA 2QSQA 4NI3A 3UZVA 2DLFL 3WNJA 5I8OL 2ZOKB 4JFQA 3LS5H 3F62A 3K2KA 2FJHA 2QGDA 4CSTA 3SY0B 5CILH 4FJZA 1MWAH 2EJ1A 5LXVA 4HSCX 3TPUA 4WY7L 4I88A 2AF2A 4M43H 2ZX5A 1SN2A 5E8DL 3GMOA 3KHOA 1JDCA 3SJVE 4GG6B 3UCQA 4BFOA 4N2DA 2E0PA 4Y9EA 4FTDA 4PP1C 3ILPA 5F72S 3UOAB 2C26A 4B9GA 4HIEB 4QHMB 1HNFA 3FB6B 5DRXB 4M6OL 4ZTOL 2I60H 1DUZA 4HX1B 4MSWA 4HCRA 4BH8A 5JPMA 1BVLA 4FCAA 1IGCH 4LPXA 1AGDA 4LOFA 3RA7H 1BAWA 2C9RA 2AHIA 1GYWA 2ZX7A 3SDDB 2GK2A 2HN7A 2EDXA 3EKCA 2B1AH 5TK2A 1UC6A 3MBXH 3VFWA 3O2VL 1JTOA 4I0PD 3MLRH 1QPPA 4U3CA 2HTLD 1ET7A 1OAYH 3ARFD 2M83A 1CGTA 5T1MB 5AD0B 1KEML 1KG0A 5IEKB 4J3VA 4CN1A 4E42B 4JQIH 3FMGL 4K3DH 1AQ8A 1RV6X 1EJFA 3JTTB 3KLLA 5I18L 4NXKA 4HKZA 2CDFB 5B39A 5IG7B 2OZ4A 4N2OA 2FWSA 3A23A 1J11A 1CDUA 2CGYA 2EIBA 2HAZA 1K5WA 4PJ7A 1OAZH 4TSBH 3MRDA 1RPUA 2BHFA 1OIOA 2D7TH 2H4EA 5DLLA 4D9QE 3OXRB 2F53A 1A9BB 1GHFL 3VQ1C 2QSVA 1BCIA 3WEXB 3MYJB 1S7VA 3FT3B 2RD0A 1JIBA 4NNXB 4U3SB 3KYMB 2NT0A 4ODXA 2FT7A 1G7PB 5FYLD 3FB8A 1TZOA 1LMIA 4YGVB 5E03A 3NCYP 4QHLA 5LO7A 4DPCX 5CBAA 1N5YL 1FL5A 2YRPA 4N8PA 4OFDA 4QHMA 5HDBB 1CK0H 1SY6A 3FCSB 3FL7A 3HAEH 1NCTA 3HZMA 4DHLA 3GHPA 3KS0H 2DM7A 1YMMD 1JZGA 3TA4D 3AAZA 1J5DA 2DM2A 2V37A 1YEHL 3LNIA 5F0PB 2APSA 4TULL 4CUCA 3TBSB 3QCVH 1KCRL 3W0WA 5MEPA 4KDTA 4OLWL 2K7QA 3FSVA 3MC0A 4LIQL 2A2QT 1QBLL 4DUWA 2ADYA 5ALBL 1KIUA 2W9DL 5IEKA 3SKOA 3VI4B 2DQDH 4S2SA 1XXDC 2I69A 5DJZB 1AXTH 3O6FD 4KHTH 1NFDA 4IRSB 4TS6A 4HEPG 4ADJA 2B1HL 4CDGC 5E9DD 5IQNA 4L3AA 5J0BA 3FHEA 5F9OH 2CE6A 3LZFH 3IGUA 4PJ9D 1OB1B 3IJSB 4UTBH 4UUJA 3FB6A 5DRXA 1GR7A 2AK4D 5IB3A 3NSJA 5B3JE 3QP3A 3STLA 4NQDE 4XNDA 2F54A 1V3JA 3ZUNC 5F3FA 4L2YA 3I50L 1XF3A 1SZNA 3X11A 4PWEA 4PTTB 2P5WA 3J8F7 1ZHLB 1F4WH 1E6OH 5JQ6H 1CGUA 1ONQA 4HVBA 4P3CH 2BXYA 3NZUA 3FF8A 4MJIE 1HHIB 1Q94A 5EIIG 5BO0D 3ERXA 5AVUB 4JANB 2RR3A 2Y1ZA 4H5SA 3F84A 3UO1H 3UDWC 4MGXA 3ULVC 1OV8A 3DX6B 3VQLA 2WTOA 3JV0A 1ZLVH 2W8CA 1SVZA 1VCBC 5KBKA 3NJNA 4PJFF 4PIBA 5F2FA 5C09E 3DX2A 1JWUB 4FXGA 3A6BL 4N0CD 4K15A 1AGCA 3LH9A 2CUAA 1KBGL 2VCOA 3BDYL 4U3HA 1O7DC 4PJ7B 1DANT 2RHEA 2CUHA 4HJGA 4Q2ZB 4WDIA 3QDJB 2OJEA 5DZAA 1DCLA 4R9HA 1WWAX 2O72A 4KXZI 3ELAT 2A6KA 5E0FA 3US0A 4OJFL 5I1AA 5EO9B 5J3HC 4EQ3A 3DECA 4CN4A 1IBZA 3LXAA 1KFGA 3ZGHA 5DJ0B 3E38A 5IBUG 4AIXA 1A7PL 4BCXA 3WMPA 1E6JH 2HFTA 4BSVA 3OX8B 3WO4B 4QHLB 3WLBA 2VC2L 1U95B 3V0VA 4XNUH 1AKJB 3BT2L 5HJDA 3T1WA 1ESOA 4PCSA 1NC4A 4YSEA 2YPLB 4OF8A 1SOXA 2J8UA 1AS7A 3DPDA 3V7MA 5A2AA 4KJQC 4FLHA 2EVGA 2ZKHL 2LFEA 5AZEL 3MRJB 4WO4A 3RFZC 4KNTA 4YHPA 4CAGA 4LLMB 4XWGL 4CKVX 3Q05A 1AO7B 1LNUB 4QYAA 2O61B 4F7TA 4HWBL 3WTSA 1I9JL 4JRYD 3MRQA 5HI5D 3CTTA 4BHUI 3X13B 4ATWA 5L8KB 3FYIB 2WTRB 3MJ7A 4KJPD 5DRWA 2BSTA 3MLXL 3ZKSD 1PZDA 5KVGL 3JWOC 1XH2A 5KANI 3L3DA 2NY7H 2WVSA 1Z9LA 1OCRB 3C87A 3QQ4A 3GMQB 1BVKB 4IRJA 4OCXL 3RWHA 4HDIA 1E4XI 4G9FD 2V0AA 1X5XA 1JUFB 3W56A 4Z3IA 5BOJA 4AL8C 3MTXA 5CGTA 3MJGX 2DQEL 4W9EC 4HJGB 2I9LA 4OLEA 4Q2ZA 3EUUA 3B6SB 4Z7OF 5DA0B 3LQAC 5HYSA 5F7DB 2D7TL 3DVFA 1OVZA 3P3UA 2FQFA 1JI2A 4W9KC 1EFXB 2XN9E 3P77B 4IU3A 5C08A 5EU4A 3X2QB 3MGTB 1SXAA 2EE2A 4L1LA 5D96C 3ZJAA 5KG9A 1NBCA 5FLUA 4XWOC 1HHIA 1KB5H 1KBWA 2YKLH 2VUOA 1HQRA 3X14A 1NC2B 4MYWB 2P49B 2EXYD 4GRWB 2Y5QA 3P69A 4XXCC 1M71A 2DY2A 5EU6D 2GG1A 3KYKH 3BAEH 4IBZA 5FO2A 1E90A 1CICA 4AV5A 2G5UA 2E3VA 1YPZE 3KGSA 1MCKA 3MCKA 4N28A 3UG5A 3IJHA 1NEZB 3FTWA 4ZO9A 3IMTA 5D1ZC 2COVD 3SB3A 3T4AC 3O6KL 1E9PB 1VJSA 4RMBA 3CXDH 1FVDB 2KS0A 2VDLH 2P24A 2YD7A 5C70A 5I6XB 4ZUUB 4JN2A 2EIDA 3TO2B 4XN8A 2FBOJ 3CQFA 5DUML 4HUMB 3UTTA 3ULUC 1FI8C 4DERA 3SDXF 2BS8A 2ZPKL 1YQVH 1NPJA 3CDCA 1VERA 3JVFC 1Q9WB 4Y1SA 3NEEA 4Y7MA 5CAYB 3H9SA 4LK4A 2ERJB 2WWMC 1AKJA 1DJHA 4ZFGL 3LPOA 3PP4L 4X4ZA 4BE6A 1HFUA 4P49A 1U3YA 4DETA 3BE1H 3TO4A 4QXVA 1HTYA 1WWCA 2FZ3A 3QHFL 4GAJL 4XPBL 4B95C 1F41A 5BUAA 3UG3A 2QFPA 4FP8H 3CN1A 1RHHB 2XXCB 2OSLA 3V5KB 3W39B 4BRJA 5DD3L 1FAIL 2VUKA 1G4MA 1F4WL 4XVOA 2WNXA 4YHLH 5GJSL 1G1CA 3QUKA 4G6FD 3L1EA 4GBXD 1AZBA 3CXHK 5I8OH 4AMKL 1FN4A 4ODUA 4YHZL 3FU7A 3GHBL 2CNZA 3UJJH 5DZLA 1RUQH 1ZSDA 25C8H 4PV9B 3V4PH 4CRPA 3GZQA 1NCWH 4ZS6D 2QKSA 2VDMB 1ZGLA 3BJLA 3MHZA 4U1NA 2BSSB 3VI4F 3ZSSA 2YD3A 2XZQL 1YJDC 3PDOB 3GXMA 4PUBL 4MX7A 2NQCA 2IPUG 4LDLB 4L8SB 3FO2B 4ZSOB 4D3CH 2KLRA 2NW2B 5GSRB 4KY1L 5LLIC 3VD9A 1YUHB 1DFBL 3CFIC 4Z0XA 4YDLC 5CNHA 2GAZB 2OMYB 1SHMA 2DDQH 3WUZA 3H1ZA 2CLRB 3MPCA 4PYGA 1FLTX 1TVDA 4MMZB 5LN4A 4LHUG 1HSBA 4N1HB 3HZVB 3UJTH 4TUOA 4JDVA 2AQTA 2ZUSA 2XV0A 3H9SB 1SDDB 1E0OB 2PR9A 2VR7A 3D4GA 5I28A 4Y19A 1J1PL 5SX5H 1CIDA 1FGVL 4K3EH 5AUMB 1OWWA 2WXNA 3VFRB 1FG9C 1FZMA 4OLYH 4GEJA 1EBAA 1MLCA 1Y1UA 1VHPA 4KXZH 1PCSA 5BW7C 3WNKA 4AZ8A 4IK6A 3S37H 3WTVA 2XXGA 3CWGA 1HZHH 1Z1WA 3CSTA 4JG1L 1H0DB 4NUQA 5GGTA 3U0TA 3BH4A 3N85L 1E28B 4XOEA 1OF0A 3F65A 2O4EA 3AWEA 5DHMC 4HH9A 4NN7B 2R1YA 3OKKA 2PW2A 1OAQL 3D33A 3MACL 3SHSA 2BHUA 1MHPL 1R3LB 3WAJA 2YQ3A 4YDJB 3BRGC 2BSDA 2WP3O 2HRLA 4EOWL 1R5WA 3EGSA 4FTVB 3MFFB 4B0MB 4FNPA 4HS3A 4JDZA 1PSKH 2X1QA 5ADOH 4QJ4B 3BO8B 4PRPA 1BXXA 4FADA 1VADA 4I18A 3GDCA 3ELQA 2AEIT 1QLRB 3LS4H 3SPCA 4WI0A 4BXSV 2NCEA 1WD8A 3CDGA 4FFWD 4F8NA 1VA9A 4UQAA 5DEJA 2WZ5A 4H8QA 3MBEA 3ULUF 3X1FA 2P42B 4TNWK 4BH7B 5BOZG 4NNYB 3FT0A 4GOSA 2X05A 3WIHH 1LO2L 1NQBA 4GW1B 2MPAL 3ZMNA 3QEGH 4RAHA 1B0GB 2A6JB 2WBJC 2XWCA 4GQPH 4LBEA 4PJDB 4Q6YA 1AD0A 2ZZUT 4F7EB 3ZY7A 4A2FA 1BXAA 5FR3A 3RLSA 4U31A 4A2DA 1BFOB 1LQSR 1B3IA 4E9SA 4BIKA 1AGBA 5E6ZA 5E2VL 4M7KH 1FH5H 4FLSA 3UAJD 2FB4H 3QISA 3FTVA 1ZXKA 1T2QH 2BVOA 3I6SA 1IFHH 2EDTA 2PXYA 4HKXA 1J8SA 1LQBC 3G6JB 3IFOA 3MRPB 4G80A 3ZR5A 4AEHL 2WNGA 3FBKA 5J13C 1I75A 3MUJA 1IGYA 3O0LA 1A5FH 4OU3A 1JZ7A 2HUHA 5FYJL 1X5IA 2E9JA 2PW2B 3ETBJ 2VLKA 4F7MA 2Z31D 1NCHA 4IBSA 2XWDA 3P4MA 5AW4B 1TTAA 5ANHA 8FABA 1KEGH 1IAMA 4DGVL 5IVZA 5KS9E 3QQDA 1IUZA 2OSXA 4TQ8A 3BVNA 3GSQB 1ASQA 1YQVL 2APBA 2DN7A 2NY0C 4NYLA 2JJUA 2EDMA 3HNVH 4M6NL 3U7YL 3VI3F 5H37H 1W6WA 3QFDA 4WW2C 5JLZB 2UY6A 1KXVA 5CSBA 1A0QH 4GG6A 1OP3H 4X8XA 4XHQA 4FLQA 3OC5A 4DOHE 2JB5L 4U1MB 5H35B 3TZVD 4E9TA 1DE4A 1I8LA 5HPMA 5BMFL 3RX8A 1S9KC 5IWLA 2OZ4H 2BINA 3ARED 3NCYS 5L7XL 1D5BB 5DRZA 2M8XA 4ZUTB 4KJWC 3GXFA 3DXAD 3O3EB 1S7QB 2GC4C 3ATDA 3CFDA 3VXMB 1KT2B 1WCQA 5JO5A 2WCPA 3RRQA 3N2JA 2PO6C 3QIBB 2N1KA 4J3OF 4LHUA 1D6VL 4M1CD 3U4EB 3UYOD 4M4RB 1QO3A 1OTTC 1MRDH 3EXJA 2P9RA 3GF8A 3TYGL 5I2IB 2CK0H 2OX5B 3IDNA 3HN5A 4KROC 3N41F 3VXSE 4Y5XA 4PB9H 4DF9A 1RZKC 4MA3B 4XE5B 1R17A 4X5WB 3OKDB 4L1DA 2EC9U 3MLSL 4XBMA 2I27N 2LGNA 5G4OA 2YXVA 1UM4H 3GBDA 3V0EA 1A7QH 5E5MB 3MUGA 5FGSA 3WG7B 3EHBD 5DK2B 2R4RL 3ILQC 3MOAH 4DPAX 3ZDXF 1MVUA 3BYYA 2BNUB 1JZEA 2VMCA 3SKNB 2EDNA 2X9ZA 3QQ9D 3KDPB 4RFOH 5L9DH 3PWNA 3QQ3A 4QWWC 1CXEA 2CGRH 1SYSB 1PS3A 3TWCH 3CIAA 3EJJX 4QRPE 5DZ9A 5EV7A 2D03H 1AGFA 3QJVB 4JRLA 3CFTA 4G6ML 4IRSA 2EVJA 3VXPB 2P8PB 5EU3A 2ESVA 5DHYA 2V2WB 5A2KH 1RJLA 4NQTA 3IDYB 4N2GA 3LIZL 1XL4A 1D9KA 4UNIA 3BZ5A 5F1NA 2OR9H 1LD9A 4FHKA 5D7JC 5FUCC 1LHZA 2YK1L 5F7EH 4ZFZB 2DQIH 1D5BA 5DRZB 3L5HA 4G5ZH 4AT6A 1KV7A 2DMGA 3WLWC 3BP4B 32C2B 3AWGA 4LCUB 1BQLH 5GGSB 2XQBL 4TNEA 1QNZL 3DROB 2ED9A 1FF5A 3L3HA 1CLZL 5ESQA 1JPFB 3LY6A 2BW4A 2XPYA 4PWKA 3WUWG 3OHXA 4NIKB 4JN1H 1IC7L 2B9AA 3M88A 4YBQD 5FEBA 2DWEA 2FSEB 1KGXA 5L88H 3WFEH 1KCLA 2XSKA 1GZPB 2V5YA 3DDGA 1J0YA 4YSTA 3WS6A 2HWZH 4NYLB 1PLCA 4IGBB 4Y4HB 5AEAA 2GSMB 4X80L 5INCB 1A4CA 2R0LL 3ARDB 3LH8A 4DN4H 5EF3A 3Q5YA 5CJOL 4Z7NF 1EQWA 1TZGH 2J6EL 2VMEA 1JHLL 3H3KA 5KJ4A 4DOHB 3LS4L 4LLVB 2R0KH 2XTJE 3FRUA 4PVNA 1YCSA 5CD5C 5A16B 4Y16C 4P2OC 4QXUH 1FL6A 1TYRA 3VRIA 1D5IH 2H41A 1QUPA 3HC3H 2WXGA 3NH7L 3TL5A 1E3ZA 2A73A 3ZX1A 3V4VH 5K1NA 3ZE2B 2G3MA 3X11B 1JL8A 5J1AA 1MY7A 5JHLH 1VEOA 3O6FC 2HT4D 2P5EA 4YC2B 3IE4A 1KCSH 1UGNA 1BJ1J 2PCPA 3CN0A 3N40P 2HJFA 1QOKA 3CHRA 3KNBA 2E27H 2XVKA 4MYPA 3WHXB 1RUKL 2QTVA 4M7LT 3H8NA 4XOBA 1UVQA 1W72H 4JPKH 1T21B 5I0DA 4NZRL 4L1TA 3SY6A 1WK0A 3TESA 2RCSH 4KO9A 2YPLE 4MA1B 3I6KB 4S10A 4A2HA 2DWYA 1GGBH 3GI8H 3ETBF 1G5AA 3MXWL 4OKVA 2J1ZA 3KW7A 4WO4B 4WU5A 2W07B 3VG9C 4Q9QH 5FWQA 1IZKA 1B4JH 1D9KC 2AV7B 4DCQB 4PRNA 4OLWH 3OLEA 3TO4D 4GIPD 1XZ0B 1AOZA 4GXUM 4CU7A 3TBSA 2OMTB 5HHQB 2WVTA 1PZSA 3T0DA 1W80A 2P8LB 5L4IA 3WD5H 3HG2A 1I8KA 4JAMB 4DKAA 4HIHA 4XN4A 4LMQE 1UWEL 4I0CC 3T8XB 4XXWA 2R4SL 2H45A 3FH8A 3OX8A 3VGHA 3K81A 3P2DA 5EZOL 1D5MA 3SBPA 5CIPB 1ZV9A 2X4QA 1FYHB 2CG9X 4ZO6A 3VB9A 4AXWA 4LHJB 4ZNCD 5A2FA 4M8UA 3FHQA 5DK0A 5MP6H 3NFPB 3BH9B 1BM3L 1IFRA 2IC2A 4FI6A 4D7PA 1OAKH 2IF7A 4X7FC 1F45A 4NIYE 3WEBA 1JHTA 2EC8A 4ECNA 3B1UA 4IBWA 1FLRH 5JDSB 4I4WB 3HPLB 1ZHBB 2NSXA 2AXFB 2ZICA 2WLMA 3GEWB 2AQRA 4NUPA 1CXLA 4X8JB 3RNKA 4TMPA 3AUWB 3NZHL 1LGVA 3G5ZA 5DZOA 4UZUA 2G3XA 3KBFA 1KB5A 2BIQA 2XTJD 5AAMA 3RUGE 1RY7B 5BUGA 4YHML 3FCUB 1DYZA 4JFDD 4V1DE 5KBPA 3AAZB 3L3DB 2FO8A 4MB4A 4LEBA 2BS9A 4HBQA 1XGTA 3UTPD 1WICA 3DVGA 1SYVA 3IJHB 5KN5A 2WIIB 3UPCA 3LV3B 4A04A 3ESMA 4JFZL 3AQYA 5C6TL 1ZVYA 2ITFA 3ESUF 5FKAB 1JZ5A 1W16A 5E4AA 1CL7L 1INDH 1U8HB 2OMTA 3F7YB 4HUKB 5TDOB 3ZE2F 2FWUA 5HHQA 5IJKA 4AG4H 4MCZB 3O3DB 4ZPVB 4ZODA 1KBBA 3HNTH 1IM9A 2MHAB 3ASOB 1CTOA 5CBEA 4YEEA 5KVEL 1CGWA 3VXUA 4HUUB 2DYPA 1IJ9A 4K3JH 1OB1A 4X9IA 1U4FA 4J6RL 3BSZA 3DX1A 1WFTA 5LUMA 4G8GE 1RXLA 3GJEB 2EDQA 3M07A 2YK1H 4Y1AB 4L37B 1BGXL 1F42A 5FWRA 1S7WA 1Y1DA 3M46A 3OHMB 1B3JA 1BF2A 3HFMH 4ZPTB 3BAJA 4QEGA 5LN8A 4PRDB 4JMXA 3SKMB 3C6LD 3VJ6B 5FYLE 3DMMC 2J72A 4ABQA 1SXCA 2MCMA 4P4KD 4NWTL 5F21B 1JN6A 3D85A 2BWQA 2IH1A 4MCMA 4PS4H 4X6CB 5EFIB 1OGAA 3SD5A 5HVHC 2NX5A 2EIEA 4F7PA 2IAMC 1TCRB 3QPQD 2XG4A 4LLMA 4JHWL 4A37A 1WO2A 3PUCA 5CILL 1X9RA 1KWKA 3D2UB 5DJXB 4DUVA 5GGRY 3VQMA 3OQ3B 1JPST 4HXBH 2ED8A 4ODWA 4UNUA 4AYFB 4F37F 4M61A 3I74A 5E2VH 3HMXA 1R75A 5FW7A 1UH3A 4TTDD 4NJAL 5JHDD 5K59F 5AZ2L 4B6ZA 2DLIA 3K6FA 3TA3B 3Q1EA 5KOVC 1TZAA 4QHKJ 1BIIB 1OTUD 2R9HD 2VDPB 1T03H 5A2CA 4CADB 1C8PA 4JRFA 3GSVA 3G6DL 5ICUA 2RTTA 2FX9L 4JPVL 4PGEB 4XO3A 4Z7IA 3ZZSA 3ASNB 2IH9A 2XWBA 2DMCA 2EDWA 1GC1L 4Z7VF 4F3FA 2UXVA 2CHZA 4DKEL 4AEIH 4FQXB 4NRYB 1DCEA 1A7RH 3CV5A 2V2XB 1T5XA 4E41B 1XBRA 4AQ1C 5EEVA 4M48L 1Z5HA 1F1GA 3F6IA 1SN5A 1F1AA 3Q44A 3MGOB 5I1EH 3QUZC 3RYMA 3D25A 2I32A 3L9RB 1HVXA 4MD4A 1W2KT 2VSDA 3WKYA 3VH8B 2DI7A 4OLVL 3RBGA 1HDMA 4YHPB 2JKIS 5FA4A 2WKOA 5MEOB 3WMQA 4G7YL 3SZ6A 5GJTH 3QW9A 4PBVC 3IF1B 4KH2A 1UD2A 1T7WA 4M7JL 1OOWA 2GPZA 4XMKH 4KRPB 3IT8D 5CN2A 1YEKH 1Q0EA 2NY3B 2ZYHA 1EGJA 3QT2A 5I15L 1VIWA 1FP5A 2F53D 1ZIBA 1X5HA 4OKDA 4HGMA 1PLGH 4DP4X 1Z2KA 3RY6A 1CGSH 4DGUA 5CEZH 3IAQA 4FXKC 3MREB 4ERSH 4XHJD 1HYSD 2EO1A 1F8TH 4OF3A 3COOA 2FUQA 3U4AA 4KKBD 1ECYA 1WAAE 1XCWA 2BIMA 4PRIE 1L7IH 1SDAB 3ALWA 1WDAA 4FI7A 2PNDA 2WXQA 4RH4A 3GXNA 4J3WA 3BSGA 2EH7L 3C9NB 3QULA 4O02L 3VM5A 1ACYL 5EC1A 2NY4C 2E4FA 2FWOA 2C34A 1CR9H 5FDWB 1ZEAH 5TF1H 3VX0A 2OSLB 1RI8A 2JJSC 1ZY9A 3BT2H 3RJOA 1EXGA 4KUZL 1B0RA 4TUJB 3BP6B 5BRZD 3NJMA 4GW4B 4X99A 3WUWA 3VH8G 3PGDA 3O6ML 4F24A 3BESR 1QFHA 3MCKB 4MJHA 4U33A 1ZTXL 3DHMA 3VI3A 15C8L 4WFGD 2M2DA 3QIWB 4X50A 3C5SA 3LNHA 2ITCA 1EJ8A 2E7MA 5CJXC 2VR9A 4OFQA 4LGPB 4U1GC 2F8IA 1G7JA 4X5XB 4IMKA 5EUKB 2Y6SC 3L6FA 3RVVD 3UADA 3AQDA 4EI5D 1ZHNB 5DYOB 1G87A 4JY4A 5DK3A 5EEXA 1WSST 4KPHH 1I1AC 2VDQH 4DFIA 3NIFF 2F7OA 4FQJL 4KKRA 3RUGB 1FVEA 1U8IB 5KVDE 4AH2B 3VX1A 2WLIB 2XUWA 2MFNA 4YHIA 2YAPA 5KUMA 4AQOA 1U8MA 2ADFL 1MREL 3VH8A 5E95B 1BFVL 1W72B 5T5NG 5KTEH 1RFDL 1HH9B 1BZ8A 1CYWA 1C8QA 1X5YA 1DQDH 3K8LA 4HGKC 3ZLQC 5FFLA 1KCVL 3MBEC 1FORL 3CXFA 1VF5C 2F1EA 3I6LD 2AK4A 5FM5O 4B97A 1ZA6B 2VITA 5E9DE 1JPSH 2J5LB 4A39A 5C0FB 3RKPA 5FCUL 3MRQB 3QO1B 1PMYA 4LPCA 3KJ4B 3LH2H 4MX7B 4UZGA 3K2UL 1SEQL 4JQIA 1MJ7L 5IR1B 5KSBA 3CN2A 1NLBL 3QQ4B 4Y4KA 3Q5TA 3ETSA 4AYID 5A6MA 3IU4H 1CE6A 1TSHA 5I66B 1JERA 1Z5YD 1K6QL 1GGBL 4TTGA 3ZPDA 1UCBL 3HUJB 1U6AL 1RK1B 4N2FA 2NY0D 3QJFB 4Q6IA 4Z18A 4FQ2H 3PQYA 1EHLL 4R0LC 1NJ9A 4ELMB 3ZO9A 2EE0A 1AHMA 1NC2A 5C6WH 1UATA 3TZVC 3F05A 3HHMA 3CU7A 4M7ZC 1S7SB 2K45A 3FAXA 4KK6C 2DKMA 3L4UA 4YQXH 4X4YA 2J7LA 1A5FL 3C2SA 2NDGA 4QHPA 4B3VA 5JXEC 3BQUA 1PIFA 5DXWA 1R5VA 1Q9LA 3KLSA 3LPPA 3L3OC 1XEUA 4M8QA 3EYFB 4OCNC 5E08L 5T5FL 3UBXI 4ANXA 1UJTA 2AJSH 3H9SE 4OUUB 4YL4A 2EDYA 5GS1B 4PRPB 1J05A 2Y1AA 1OARL 4NO3A 2BVQB 3ULVE 2FR4A 5F3BB 2A99A 2Y4SA 2MQ0A 2MTAA 3O0RH 2DEYX 3HB3D 1NBVH 1P69B 4WWID 5F6IC 1TKWB 1KGIA 1JXGA 4J3XA 3CXDL 2Z7UA 4MMYA 3BZEB 2JSFA 1GIGH 3KPRD 4O5LH 4AT6B 1HU8A 1CO1A 1O7DE 2R27A 4H88L 1R24B 2MIZA 2VLRE 4F5CE 3STZA 3QEUA 3SO5A 4G1MA 4E5XA 3LKPB 1EHKB 1NGPL 4C54A 4ANUA 1E65A 1TMQA 4QXUL 3VXMA 2L7EA 3BUDA 1FZKA 2PXYB 3ARRA 1IX2A 3ARPA 2EEFA 3HNTL 1RJCA 2ZUTA 3FFDB 4LEXL 4P5TD 3WFCH 5EZLB 4MJ6A 4TF4A 3VE0B 1LWHA 2DQMA 3H55A 4B53A 3LIUA 4U0QB 5D7IB 2CLZB 5D2LE 1I9EA 5EEYA 4QXTB 2VNCA 4AYEC 3VW3H 3E2HB 4QRSB 2B39A 4HZ1A 4GEIA 1J87A 3U83A 3UTZA 3MBEB 4JY5L 1R34A 1WVZA 4JO4H 3MRKB 5EBMA 3HR5B 1MSPA 3Q8FA 2QQLL 2R2EB 2GTWB 4DK5A 3QA3B 1DQLH 1S7UA 3U1QA 5AALA 4FG2A 1OQXA 1U8JA 3MCLH 1WE5A 5MENA 1NL0H 3HJ0A 2J8HA 2HFFA 4J1UB 3PWNB 1UCTA 1T1ZA 1YAIA 3DJZA 3MXWH 1KJMA 3SCMC 1KJ2L 4XMPH 1ILSA 1DLHA 3C09B 1UWGH 2P46B 4GPVA 1I1YB 2NDFA 4RDQG 5AWNH 2TRYA 1K72A 4P05A 1CFSB 3SJVA 4P2OD 2DS4A 4UZSA 1T21A 5LWYL 4JO3L 4ZMWA 3JUZA 1NGQL 4GUPA 4ZUWA 3ROLA 5HYEA 4KQ0A 4Y2OB 3FPYA 4OZFA 3UJTL 2OTPA 1NBZA 5EZJB 2DQUL 3DJ9A 3NT0A 3ARGD 1AHKA 3N43F 2YSTA 5FO9B 4OB5H 1ZIAA 2GSIA 1OM9A 5EZOH 3LEVH 1I1FA 5EBGA 1LDPH 2ZYIA 4YSDA 4GRWE 5A3IC 4JE4B 1INEH 4MJJA 2G2RA 4H20H 3T6WA 1AZCA 1KBKA 4FJYA 5IUSA 2DLGA 2YXWA 2XPGA 1L9RA 2PYEB 1DJYA 1MCWM 5GIRB 1VZGA 4GXVL 2UWEE 4GFXA 4NOFA 1BQHG 5DVOA 3HA0A 1NIFA 3T0EB 1X5LA 4XCNB 4HOZA 4K7FA 1KCRH 2X4QB 4XB7A 4ZUSB 1NMCB 1BPLB 2JVUA 1GW6A 1X6LA 4LASH 3O3AA 5FKAA 4R7VA 5ICZA 4QRRA 3LOWA 3GMRA 3EOTL 5I9QB 3FQ4A 4JG0H 1BQKA 2B59A 4PEEA 4Z95L 4JGNA 5HGHB 1JP5A 4TVUA 2YFOA 1WAAF 2ZUQB 3QIUD 3LKPA 4WU7A 1DLHB 1HWHB 3FU6A 2XN9A 4EZLA 5F7WC 4AUJA 3BUQA 2NX5E 2HKFL 2LR4A 3CQQA 3H3BC 4KROD 4H8UA 2YMXL 4N68A 1T0NB 4BD4A 3D52A 3ULVF 4LLQA 3V5DB 2HT2D 2PN5A 5E00B 4LCCA 2YUXA 2NR6D 4HWEL 1EEQA 2WYTA 5DD0L 2OMVB 3ZL1A 3MUHL 3HI5L 4D2NA 1FC2D 1BBDH 2Z0UA 3L9EA 3Q7JA 4AYMC 1N12A 3B9AA 1CURA 3LIZA 4OBRA 3T6QC 3MRMA 3OAZH 5HPOA 4LDEB 2ZX8A 3OG6B 4RMUA 4GINA 2G2RB 1IT9H 3OB0H 4KWUA 4QNPE 3ES6B 1AGFB 2PF6A 3P3SA 3TBBA 2BFVH 3D3VD 2OMUB 5E6RB 1MCEA 1RMFL 2CH8A 1A3LL 1R6VA 2NNRA 1E5AA 1BG1A 3L17A 5F1NB 5A16A 3VDBA 3QFDB 1NOFA 1I1YA 1XH0A 1JNNH 4GRLB 1LWRA 2FB4L 3R8BB 2VISA 1YHPA 3LVEA 4JKNA 1L0YA 2D3VA 4UOW0 4ZFQA 4ODVL 1RULH 1VGEH 2EDDA 1MN4A 4F33B 2J73A 3F7QA 1WEJL 4YLCA 4N8VB 1TETL 3VFGL 4EBQL 2EIZA 1DEEB 3DRTA 3RGVA 4QT5A 3CH1B 2BJMH 3DETC 3IAPA 4YSRA 3KEDA 1MCPL 3V5HA 4Q89A 3VSQA 4DP0X 2DTMH 1TCRA 1QTYT 3NJKA 2ZSWA 1FYTD 1RVFH 1NCIA 3AREB 4XPFH 3FOLB 4MD0A 3T0EA 1K5NA 4MRCA 3Q2WA 1J9RA 4YHNA 5CD5D 3IRCA 3K8MA 3KE0A 5DZVA 1DN2A 1ROCA 4NHUA 5TE6H 1LP9F 1PFOA 4G83A 3QS3A 3BJ91 4JHVA 3CX5J 5C0CB 2YQBA 1K8IA 4XP5L 1FRGH 2X6BA 1NCOA 1ZLSL 3KPRA 2V5TA 5KVDL 2DYRB 3TNMB 2HT4C 5D55A 4HOXA 1SYSA 2BWDA 5HD8D 1NAKL 1N0XH 4OGXH 5FIEA 4DN3H 2R29H 3H56A 3HS8A 3ATFA 3T04D 2BXZA 2Z91B 1HL5A 2H0JA 1UVQB 2X6UA 4IBYA 4BKTC 5BO1H 1H3UA 2X12A 4M1GL 4E41A 5GJTL 2ENPA 4NQCD 1XIWB 4NO2A 5GZNA 2WB7A 3UIYA 4ELMF 1GJUA 4S1DD 3IXAA 3QUYC 4KI1A 4L1SA 4QLRA 2BH0A 4O2CA 1V7MH 4U1JA 3S37X 3WNIA 3V4VA 5KSAC 3VXQA 1XF3B 5B21A 3OB8A 1SVBA 3D08A 3MRNA 4QHNB 4CSPA 2BP0B 2R9HC 4MJ2A 4LF3B 2ZKYA 1S9YA 1J9CT 1E4KA 3D07A 5CGBA 3BGMA 4RGOL 3N44B 2XU9A 3CC5A 5FPIA 4LNRB 4NCDA 1G9HA 2BW5A 3MYJA 4ZFOL 5EU6B 3DROA 3L3HB 5JHAA 1XGYL 4AJWA 3BIKB 5GHWH 2YBRA 4IMLA 3FU7B 1EHXA 3B5TA 5L0QB 2Q76B 4I0PB 1RK7A 4FQPA 1QSEB 3FB7B 1A6AA 5JW3L 5J9PA 3GYRA 2OL3L 4JM4H 5ITFA 2HG5A 1IQDB 3VGBA 4QAMB 3I9GH 5C9KA 1WJ3A 2O5NA 5AVTB 3OMNB 3MO1B 2NYKA 3FQTB 3PQYD 2CMRL 1WA0X 3F6JA 1LP9A 4NSKA 2OTWB 3AWFA 3O6KH 3WKMH 4OCLC 1SEBA 2OMYA 1HE7A 4MAYC 5HP5A 3PJLA 5C0IB 5E8NA 3BPCA 3GSOA 3LSOB 1F00I 1YMMA 1SLVA 4PJFA 4QLWA 3TGXA 2A1WH 1BXVA 3HC4H 1GGIH 2EECA 1OEZW 1N6VA 2A74B 1AQMA 4PMFA 4Q9BA 5CJOH 5EN2A 3JWDL 3EYQD 4W70A 4OUOA 1NSNH 5F6HI 2OA9A 4LEEA 5T5FH 2CLVA 2F8OA 5KJRL 4PWJA 1RUPL 3N1GC 4R5XA 5GGTL 2YD8A 1G6RA 5J6GB 1N10A 3CUPB 1DBBL 2AGJH 4P5MB 2QKIC 2V3EA 5HSFA 4S1RL 4BFEA 1OLLA 4X42A 3QFJB 2BIPA 4AY0A 1GVIA 4MD4B 3FJTA 3LB6C 1NZRA 1FZJA 5HYIA 4NUMA 3FNKA 5A43C 3NDZE 3S5LG 3CDZB 3MTRA 1ML0A 2JKLA 5D8JH 3PHOA 3PL6C 3B9DA 2WIMA 4NUJB 1EANA 1IM3B 5HDQL 2P7TA 2B77A 4PJHB 4G8FB 2CXGA 1DBJL 4K9EL 3UJIH 1Z6JT 2RA1A 3GI8L 2VLKD 3ZO0A 5LGHL 3GJEA 1KJ3L 2HKAA 4A2LA 1NDGA 2OYMA 2BZDA 4AH2A 5D2LB 4BZ1H 3BLBA 1R3KB 2EILB 1Q9KB 3QK0A 4WI7A 5IREA 4PJ8A 1J8RA 1XF4B 1IVLA 3QUMA 4F8TA 2ZE0A 2DBJA 3IJYA 4GAYB 4MKMA 1OK0A 5F7FA 1HWGB 4LNRA 3QHZH 2OS7A 3LRSB 5T1KD 4BFBD 4BKSC 4DJMA 4I0PC 1BVNP 4OLXH 4DK6A 3BKYH 3EYSH 2R2BB 1Q94B 3FYEB 3ORJA 5F1KC 3ULAB 1F56A 4R96A 1G0DA 1I7ZB 1IBGL 4XVJH 4P5MA 4GQZA 2NXYD 4RGMB 4JFOB 4YXLL 4X6DE 5D70L 1YC7A 5EUOB 3QFJA 3UDWA 3V6ZA 3H9YA 2IG2H 3MLVH 2VRAA 3KPLA 1KUMA 1IAII 4X99B 3QCUL 4BQCA 3DBSA 4ORGB 2F5BH 2OTWA 2O6DA 5MP6L 4N90E 5C7XH 1WIPA 3DOIA 3LZPA 4PCYA 4KQ4L 4HC1L 4Z5RB 3MLZH 2D31A 5K9JH 4L3FA 4JZJA 3ARBA 3BXNA 2AJZA 4EZKA 4FXTA 4ICXA 4G8FA 3TF7C 3L8QA 2WLYA 1HXYB 2VUYA 3ARGA 3MCYA 4I77L 5EIQA 3RGVD 4C4BA 2MHAA 3ZIYA 2BDNH 3FO9A 4EZMA 5IMMA 3CDFA 4IRJB 5IROD 4OT1H 2Q9OA 4YVUA 5JPNC 2WANA 4U1HA 2GEQA 2VZ3A 1QI5A 3RURA 3UEQA 2F5AL 2FIKB 4DO6A 5IFAL 5G4NA 3QRGL 1WISA 1KPUA 4QTHA 2D8KA 4ACPA 2VAAA 3QI9B 4EDXA 1KY6A 1ZVHA 3GXPA 4C56D 5IQ7L 3SPVB 4YX2L 3SQOH 1SJEB 5I30L 1FN4B 3VXME 1BEXA 4GAAA 4LASL 4RMWA 4AGLA 4APQB 4Z3JA 1DVQA 4AM0B 3ABLB 5I23A 2ZJSL 1E5CA 5FV1L 4L48A 5EBWA 1JZ2A 3PV6B 4YIQA 2X70A 2LLLA 1JHKL 4JFOA 5FDYA 5ELIA 3DGCR 3EYOA 3MODL 3NIGF 5I1LB 2VITB 4DP1X 3IAGC 1SDYA 2A77L 4G72B 3P3YA 3D2UA 4H7VA 4I9WD 3BWAB 4PWFA 1MJ8L 1WUNT 5CP7B 3GNML 3FKUS 4CGUB 2YLHA 4XC3L 3MU3A 3RWHB 1CLCA 1F97A 1QSVA 1W0WA 3MLXH 3R06B 2E76C 2BOCB 5IT2L 4X4KA 3CLEH 3HZVA 4NKMB 1KB3A 3HJEA 4XCFH 4EDWH 5L8LB 5C3TA 3AXIA 3VXTB 5KYYB 4MZ3A 3BHBB 5EC1B 1JGDA 5HHVH 3QDGB 4NQUA 4GKSB 3RVUC 4NJ9H 3GKWH 3GUTB 1M2VB 1JGUL 4PH8A 4E5XB 4Y2DA 4WWKA 3C8DA 3VFRA 1QSEE 2Z7ZA 2ZAGA 3ML9A 2WLIA 4OCRL 3K72B 1NCAH 3GBNL 1JWSB 2FVNA 4ODTL 1O6TA 3SDAC 3TS8A 2XG5B 4UTAH 7FABH 3BMWA 1RIHL 5B38B 1JF5A 4LSRL 1MCQA 4L8DB 3DVIA 4JFEE 3FONA 3MRBA 4ZK8A 2ESVE 4ZS7L 3U6XS 4LVOB 1CF1A 3KPLB 4GT0A 4PLOB 2WLKA 1TJHL 2VZ1A 2FLRT 1HCYA 2CIKA 2YRLA 5F93C 2L7UA 3TH3T 3C5SB 1G9ML 1SJEA 3D30A 3WS3A 1TZHB 4QRPA 4YE0A 4QRSA 2FX7H 5AVQB 5I1CL 1R3LA 4CDHA 5ADPH 1UTDA 2F18A 3VFNA 3RHWK 1PG7L 5ACZB 3BKCH 3GIVA 1OSZB 3IF1A 4LESA 2WBJB 2CUIA 2L0DA 4Z7UE 1G0XA 2AQQA 3LKQB 1GC1H 1HKLL 1ZTXH 2PABA 1NAML 5IMMB 4Q0XH 2FEEI 1SOSA 1KMGA 2TSAA 5HVHB 4YH6A 4MCYB 3TCLB 6TAAA 5IM7A 2QPEB 3ZT5A 3GSRA 2VLME 4PLJC 3VGAC 4OZHF 1JFQH 3G6AA 1INEL 5F9WB 4JFFD 2H8PB 4I0KA 1U3JA 2X53A 3G7TA 4P9HL 5IIEB 4XR8C 4ZDHA 1KYUA 4GP4B 1HSBB 3QJFA 2HZHA 4OGQC 3WFBH 2IQ9L 5G2NA 3MBED 3TT3H 1K3IA 5CN3A 1BZEA 4GW5A 4AZUA 2HJFB 5BZDA 1SF5A 3FTYA 1NGPH 4RAVA 2AV1B 3L95A 3NQKA 25C8L 1XF2B 1OE1A 4D8OA 5HDRA 5B1JC 2QQNH 3RZCD 2BPBA 4ERSL 3QEUB 2H1XA 2AABL 4HCIA 4PJEE 3VG0H 4DNLA 4PUBH 1F6LL 4JS7A 1JDAA 4J7RA 4U0RB 2F15A 3EDEA 1SNRA 3QQXA 2CIKB 3V9CA 4ZMQA 2JK5A 3IFLH 4MNGA 3FQUA 4BFIA 2YUZA 4FFTA 3DOSA 2VERA 4G9DA 3GMLB 2XZCH 1OF2A 5DC0A 8FABB 3BWUC 3LMJL 1CR9L 1XAUA 1A1NA 1V7ML 1CDBA 1WZ1L 3JUYA 1ZLEA 4F2MB 4G5ZL 2W95A 4OLUL 3MLZL 3IDJB 5K9KB 4KY2A 1UT2A 4XAWL 2FWLB 4BE5A 4PJIB 3ZBMA 5DHDA 1S7RA 1RZQA 5JOPE 4JFQB 4PB0H 3I3BA 4XNXH 1Q72L 3RI5F 3SGDH 4M6ML 1N6UA 2GW5A 3FFOA 1JNJA 5L88L 1RZIB 3NIGE 4P06A 4IRSC 5GGQL 3GEFA 1I7UA 3U79A 3NA9H 3PNWA 4JKLA 3GSRB 2QADB 4L3EE 2N7BA 1DQQA 1FFOA 4HWZB 5HHOE 5IV2A 3QR1A 1L0QA 5DFVC 1YEHH 1YDPA 4YHIB 1ZWIB 2OSWA 1KCWA 2YAOA 4HJIA 5GS0L 5KYUB 3LTVA 2NY0B 3P2BA 1C12A 1YEFH 3HG1A 3GSXA 4MXQD 3STZB 2F7IA 3QZBA 3HPLA 1GGTA 4BH8B 5D7LD 1DEEA 1CYXA 1MVFA 5F9OL 3SDCB 3QIUC 1SHXA 5ID0A 3FUJA 3HG3A 1WZKA 1L7TL 2HN7B 2VJ8A 3LKRB 3QC5X 4C4UA 4U1KB 1AKJD 4FULA 3EJQA 4R2GB 2B1OA 4JFVA 3FSAA 5EA0H 3O6LL 3AU1B 3TURA 3MVSA 1A6UH 2O5YL 2V9RA 2X89A 3NACH 2HT2C 3F58H 3VWJA 2XN0A 2JH2A 4KTDH 3ZVVA 4IGBA 4GKZB 4Y4HA 1UXSB 2YAQA 2J12B 2H2PC 1JTPA 3EIFA 1NWPA 1WC7B 1MH5B 3EJZD 5I9QC 4JB9L 2DWTA 4ETQB 5GRYA 2R56H 4HYTB 4OF6A 3OXSA 4GBXA 2APFA 2H8PA 2YD1A 1U21A 3DX3A 4YC2C 2VN5A 2X1WL 4KGLA 1Q38A 1RVFL 5IW1A 3NN8B 1IAIL 3KPRB 1C1EH 3F85A 3NRPA 1KGCD 1I1AA 4XH2A 3N9GL 4JHUA 1IE5A 3G04B 4RBPH 1TG8A 3K2UH 5KSVA 5ACMA 4FTVE 3ZE1B 1QI3A 4BZ2H 1CYGA 2AFNA 2OYLA 1KIRA 3AG1B 2BRQA 4ELKA 5CR1A 4WFGE 2FJGA 5C0NC 1PYWA 1UOKA 4U1MA 5H35A 3V55A 3RL2B 1KC5L 1RAMA 1XEDA 2J56A 1NBZB 5EZJA 3MJ9H 3VA2C 5D5ME 1AJ7L 1K5NB 3UZQA 3ULUE 3BT0A 5FYJH 3ZE0B 3RVWC 4FKHA 2BFGA 2A9CA 2FSEA 4PV8B 4W6WB 5DTFB 5T1LA 3BI9X 1BLNB 2VLJB 1N6QH 3OGOE 3IDJA 1JXJA 3DTXB 4NNPL 3N6YA 4PJGF 1CBVH 2FH6A 3GS7A 1I8AA 1YECL 1OL0A 4KI5E 5HYJB 4M6NH 5D96B 1PG7X 1HCVA 2DAVA 4YUEH 2OX5A 3IDNB 3SOBL 2GI0A 1QFWL 4ISVA 3P9MA 4WENB 4KZDH 3UZVB 1CDJA 4LLVA 4WJG3 1SOKA 5K9QI 4Y5XB 3O45B 3ALXA 4OI7A 4DGVH 2A9MH 1MEXL 4QIRA 5KVMC 3CZNA 4ONHA 2LVCA 4MDIB 3HZYB 3ARUA 1U36A 4ABWA 5KAQF 1IAKA 4XRCB 2GJRA 5D1QB 3S7GA 2X4UA 1JZHA 4PG9B 3VTMA 1J8KA 1P4IL 2IQAA 4KNUA 4PJIF 4JUTA 3C60B 3IBOA 4KI5C 5D1ZI 2VXTH 4X7TA 1YMMB 1EO8L 3ARGC 5GQBA 3WFBL 3LRMA 5B7EA 3IPEA 2XA3A 3HC0A 2XWBB 3LNEA 5C0BB 5SV4A 1QQDA 3NCBB 4OGZA 3FCGA 1GCYA 1DSFH 1S9WA 4F93B 2CBPA 3ARZA 1BD2E 3TYGH 1WGOA 3E6HA 3FHAA 1C5BL 1SMAA 5E8PB 2CDGA 4JRXA 3IMVA 3PIQB 4Q4IA 1NBVL 5GRWA 2Z8RA 2FJGB 1R1CA 3NGBB 3EO1A 2Y6TE 3KWWB 5FM4A 1NDMB 1R0AH 3QUYD 5GIRA 3V7AE 3OJ2C 2CKBL 3OKOA 7CGTA 1GS8A 5J9PB 2Y7QA 3VRJB 3WIAA 1S7TA 3PL6B 4WHDA 1DUZB 2X41A 4HGWB 1KXQE 4OCSH 2F53E 4TM9A 4J4PA 5DHVH 4BQ6A 2D7PA 4L3CB 5CFAA 4JRYA 2OXHB 1TJIH 2WVUA 1UOWA 2PTTA 3QIUB 1XZ0A 3OV6A 4RA0C 3P11L 3SDYH 2WXLA 3KWXA 3H4HA 1JK9B 2OTUA 3DTXA 5HGAB 1XGZA 1PY9A 3FOMA 3D18B 3IB4A 3LKNA 4OZHB 4IRJD 4PJFB 5K69A 4P4KB 2FJHB 2DJMA 1KB9J 1X5GA 4S1RH 4JFHE 1FUNA 4PJHA 3HLAA 4UB0H 3TPUB 4RNRB 1HXKA 4LL4A 3R1GL 2Y06H 1GYUA 2C9PA 1DDHA 5BO1L 2CDFA 4PLKC 4JCLA 3QDMA 2DM4A 2JCWA 4JFWA 2X7LA 2WJ7A 4OF5A 5E2UH 1MRCH 3L3IB 4XBEH 1U2CA 1LD9B 4Z6AT 1FQ9C 2JCCE 3GXTA 4GAGL 5B1AB 1JYVA 2E7DA 3EH1A 5LCVL 2OMVA 3VXMD 1IC5L 4XC3H 3S96B 5BS0B 5B3JF 3RKDD 2EACA 3S48A 5FO9A 2IXQA 4EDWL 4OGYL 4TPRL 1UB5A 2AKRB 4CVXB 3BRDA 2Y5TA 4PJEF 4UQ3B 1U2YA 4NN6B 3C8HA 3HN8A 4XN5A 5F9JB 5E1QA 4E42A 1FAIH 4YHLL 1SYVB 3ARDA 3UPRB 5I1GL 4TLSA 5DRWB 4MQ7B 2A4ZA 4CN6A 3WS6C 3ZDWA 2JIXB 3OKMB 4PS7A 3RVXD 1TITA 1FAKT 3LNFA 2PWDA 2HRHA 3DO7B 4YHZH 4POUB 4GSRA 1IILE