3JYBA

Crystal structure of the rets periplasmic domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
138
structure length
138
Chain Sequence
QNWRLLRDESAQLRIADVLQRKEQFRPLAKRSFIFPASPQAVWLQVQLPAQKVPSWLWIFAPRVQYLDYYLVQDGQLVRDQHTGESRPFQERPLPSRSYLFSLPVDGKPMTLYVRMTSNHPLMAWFDQIDEAGLVGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sensor protein
publication title Crystal structure and oligomeric state of the RetS signaling kinase sensory domain.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 30
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07696 7TMR-DISMED2 7TMR-DISM extracellular 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2380 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3jybA00
3JYBA 2XBZA
chains in the Genus database with same CATH superfamily
2WGNB 1FG9C 3CN2A 5DEFB 5IFJB 4M6NL 4EI5A 3EYOA 4NKOA 1VHPA 3SDAA 1V7MH 2Z31A 1CDUA 3BKCL 4BQCA 3BGMB 2XV2A 3EBIA 3IRZA 3N91A 4HJ1A 3UAEA 3TNMB 2F7IA 2XG5B 5DHMC 4RDQG 1HH9A 4NO5B 2A6DB 2NTFA 4FQCL 5EOQH 1EAQA 3SPVA 2I60L 2J8UA 3HJEA 1FL3B 1OAXH 2G4GA 4XC3H 5JDSB 5MENB 1OP4A 3MGOA 5DS8A 4QXTA 3KVQA 2AANA 2HN7A 4HGWB 5E0QA 2UX6A 4OFKA 3VWJB 3AXHA 4LDLB 4V2BA 3IDYB 5D7KD 1WD9A 5ICYB 2ZP8A 1ZDSA 3H9HA 4Q6IA 3TA3A 4FQXD 1A14L 3K4AA 4G8AC 4MS8D 1GYWA 4RLDA 4YFLF 3NA9L 5CCHE 1TEYA 2EDRA 4UT6L 3WN5B 3NZUA 1CGTA 4UU9B 2BS71 3PPEA 1NAML 2LV4A 3CH1B 2DYPB 3GEFA 4IEFB 4U6YB 2XZAH 4G42A 4XAWL 3EF7A 4F58L 4QNPF 3H56A 1TJHL 1WFJA 1JNNL 2IQ9L 4UIKL 1QW8A 1TTFA 3P9MB 4XZ4A 3ZKND 4NRZA 4A7SA 3ZDXB 4GG6E 5EU6D 4B96A 1JXFA 5AYQA 3RVVD 1I7ZB 1Y18B 4N8UA 4W9HC 3UERA 4JW3A 5F9WB 2PW1A 3EFDL 4KRMB 1FZKA 4BK4A 4QJ5B 2F1BA 3TH2T 4MAYC 4KZDH 4L1TA 1QA9B 1TO5A 3K8KA 3LKQA 2H0PA 2PO6A 3NZHL 2R7EB 4YHKL 3H8NA 5CIPB 2W0LA 2R56H 2DMCA 1OLZA 2IGLA 5I19L 2Q86A 4XO5A 2XWXA 4RAVB 4JEGB 4F27A 5I0VA 4HAGA 2HJKB 3MRNA 2NY4D 2GJPA 4JFOB 1HX0A 4KQ0A 1NAMB 1IEAB 5EZIH 3ZE1B 4RMSA 2AMGA 4LASH 1IGJA 3D39B 2P45B 3C8DA 4KH9A 5JR1H 1D9KC 3GBDA 1GPOH 3A6BL 2NW2B 1F11A 4J2QA 2MRYA 4PTUB 1ET8A 5FKPA 3VNYA 1KZQA 4ODSH 1PLBA 4LHUG 5HHPB 2D31A 3GIZL 2AEPH 5E9DA 3SDXE 6TAAA 5C0DB 4ZQKB 4LCIL 5BV7C 4Z3GA 2X4SA 5GPRA 1ACCA 1QP1A 1SHMA 3ATFA 3QEQA 4KY1H 3M17B 5ENWA 3S5LG 2FIKB 5JHDB 2MNUA 5D5MF 4Q2ZA 2P5ED 4NJ9L 4U1JA 3DX6B 4PJ9D 4FKEA 1T03H 2NDGA 5AUMB 5JXEC 4UILH 1PD1A 1UEMA 2Q76B 3E8UH 3DRQA 1FFOB 2AK4E 5JIKA 5T33H 4LKXA 2GC4C 3PP3K 1PYWB 4HS6B 2WC7A 4JFFE 4XAKE 4AQZA 3BMWA 3WS6A 1IC4H 1OPGH 4M02A 2QL1A 5FUCE 4HWEH 4AQ8C 1UUSA 5J6HB 1I9EA 3ECQA 4YHOL 4OW6A 3KCWA 3WS3B 2XY2A 5CP3H 4NHCH 2CK0H 4PJAA 1OT4A 4IHOB 4EI6B 4WUUA 3UX9B 3GTNA 5I74B 3FPYA 2D7TL 2P24A 2NNFA 3BH9A 3QFGA 2XRAH 3BAEH 2KC0A 3LS5H 3FOLB 1KTJA 3PXHA 3S88L 4K23L 5D2LF 3RAJH 4F8NA 1MCOH 4KVNL 5E6ZA 4AW7A 4C83A 3B4NA 4LCCB 2CLZB 4ZMNA 5BJTB 1CFQB 4GLRH 5AB9A 5I1JL 3JV0A 32C2B 5CR8A 1YCSA 4HPOL 1DVFC 2PYFA 1MFBH 2MKWA 5DSCA 5HYJA 2I9TB 1QOKA 4F5CA 5EULV 4FFWC 5E8OB 3V0HA 5KYUA 1MW0A 4PLJD 5H4YA 4KZEL 4FQ1L 1FFPB 1U3YA 4X4YA 5IMLB 1ZANH 5C0JB 1NLDH 5K9JH 4H88L 5CGBA 3HUJF 2NT1A 3ZHLA 4KUCF 5AG9A 2D9CA 5DHDA 4DKAA 1H5BB 1UKTA 3LYRA 3RL1A 3T77A 3CFEA 3DPBB 1YPZB 2QZ5A 1V3LA 3HE6D 5CZKA 2WGXA 3D0VB 4JGUA 3S3SA 3VFOB 4K3JL 2HFTA 3V0DA 2NY3C 1HEZB 1IBZA 2RH0A 1KF9B 2UXVA 2ZCKL 3FDWA 1T6WA 3ILQC 1DVZA 3AQDA 4FTVD 4UV4L 1I1YA 5SWQB 4BINA 2JJSC 1MJ8H 3SJVE 1A47A 5HGHB 2YRLA 1WP6A 4MAUH 5HDBB 1AGBB 4WJ5A 3NJKA 4MNHA 3GZPA 2A9CA 2A77H 5IQ9A 2VAAB 5E4EB 1UC6A 4FA7B 1RZJH 1I75A 2HWZL 4N0YH 3SOTA 4N25A 1COBA 3PWNA 4YOKA 3KWWB 4JM2F 2ICEB 1Q0XH 4U0RB 3EUUA 4OZIB 4CW1B 3H9YA 4M9OA 2YZ8A 3R7QA 5JQIB 2R29A 3BUDA 3MJWA 4JG1L 5I0WA 3BUBA 3C60D 2XJLA 1CFTA 4XPGH 3V0EA 3U0PB 1UKSA 1IBGL 3VJ6A 2VSMB 1W16A 3KBFA 4JO1L 1L7IH 4K71C 4FNLH 5ELIA 5I66B 1CLYH 4L5FH 4XVSL 1QFUH 3PHQB 4ONFL 3APDA 2OTUB 3RGVA 1QSEB 4FQJL 2AI0L 1LO0L 5AG8A 1BZ9A 2EIMB 1E28A 1KDIA 2VKXA 1R5IB 4HDIB 1J87A 1U8MB 3C5SA 4I18A 1DQJA 5EOCH 1LO4L 1CFVH 1U8PA 2GBUA 3FB8B 2AABH 3SPJA 3ETBF 3OKLB 4JFQB 3NJGA 3OAUH 5SWSB 1JZ7A 1FWXA 1ZCRA 1PY9A 5DVNA 2DH3A 1Q9LA 4ABUA 4B9KC 4K7FB 1JHLH 1KPUA 2JTDA 3M1BA 1IMHC 4E9SA 3EJZC 3RWCA 2JH2A 2DWEB 1NFDA 2VR3A 3DX2A 7CGTA 2DLEA 3AXLB 5KVGE 4N26A 3JTSA 2IOOA 3KPRE 3LIZA 1LWHA 4GW4B 1YA5A 4I87A 2XTSA 5HHNA 1BAGA 3L1EA 3FT3B 1G7QA 4BQ8A 3TYFA 1OB1B 3BC9A 1NOLA 1XF2B 4GQZA 3MKKA 1J0ZA 3QC5X 3FOMA 2MQGA 5FKAA 2BHYA 2RMNA 4GRWF 4PJCE 5JA8B 3CJJA 4F7PA 3TVMC 4CVXB 3GI9L 3TTSA 1L9OA 1NEZG 1PDKA 4PUBH 5J06A 4UM9D 4AJYV 4U6TA 1A7RL 1UZ8B 3RX9A 3JZYA 3W39B 2YWYA 1CJYA 1YNLH 1IQDA 1DBJH 1E6OL 1JRHL 2KUTA 2CZNA 2ZYHA 3OHXB 1QI3A 2VABA 1MXGA 1A9EB 1GS8A 3IU4L 2UZIL 2RD0A 4QKTA 2XG4B 2GB2A 2B5IC 4DKEL 1B3IA 1BYPA 3F12B 4J3OD 5DJ8A 2C34A 1Z5LB 2EIKB 4H8VA 5A2KH 4FG2A 4MAZA 1YDPA 1JUFA 2GJ6A 2IAMC 5D70L 1ZLSL 3K6SA 3WHXB 3K6FA 4UT7L 3MNWB 5AOLA 1FO0L 1CN4A 1CDBA 2NR6D 3IJHA 3LRKA 4JQXC 3T71A 2OV0A 1U8OB 1C5BL 1UT9A 2HX7A 4WV1B 3ZL4L 2X4OB 4NN7B 4M6OH 4LKCA 1QZ1A 2GK0A 1CGWA 2QLVB 2Q3ZA 2J6EL 2IJ0C 4YE4L 1Y7VA 5IROC 4YHNA 4CMMA 1H6UA 3QDGD 3SCMC 2PXYC 4RGMB 1SY6L 1CG9A 1EEQA 3X3GH 4R3SB 2CR3A 2H2PC 4YIQA 2YXVA 2GSGB 4KC3B 3VD2A 1HWHB 1OM3L 2BHFA 4KJWD 4LDCA 5K93A 2DKMA 4UTAA 2Z91B 5E4OA 4ZMAT 2VISA 3FB7B 3TJHD 1N64L 5JW4M 1TZGH 5LNGA 2YIHA 4WUKH 5BQDA 1QATA 3O11B 1WBYB 3DGGB 4PRNB 7FABL 4NM8L 3VGHA 2ADIB 4DP6X 1R3HA 1J1XH 2MMXA 2AXJA 2D03H 2ODHA 1GGCL 2V5RA 1IKNA 3EBGA 3MV01 4P23D 4XWOC 4F2FA 4KK5D 2NY0D 2DRUA 2Y7MA 1RIUL 4GSDH 3OG4B 4GXVL 4UWQB 1AR1D 3UYPA 4NC2B 1E8XA 1HSBB 2HG5B 4IIZA 3IGFA 5DQ9A 3UAJD 4J39A 2XSKA 2Z7WA 2F5AH 1RUPL 3ALPA 1FN4B 2OMTB 4EI5C 4YXKH 3SDAC 3T8XA 5EO0B 2Z31C 1KCUH 4JFTA 4L8CA 1EJ8A 1IT9L 4CADA 1U0QA 3CHOA 2HVJA 5AW5B 2HTLD 4XPHL 3J2PA 1XL4A 2G9HB 2QADB 3NJLA 1TR7A 1EO8H 2CO7B 4NZUL 2FIRT 1XSOA 3VFRA 4JZJA 2C9VA 5CXPA 3K2UH 3WIHH 2G3ZA 5AFAA 5E99L 1N6QL 3R4DA 2Q8BL 3FO0H 4BWUA 2DM3A 5I75C 5JW4Q 2EEXA 4QXUL 1VKXB 3HMXL 4Y2LA 2ZXDA 3WE6A 3RJOA 4ZX5A 5KVDL 3RY4A 2VC2H 3C12A 4J1UB 3KGUA 4YSEA 2WXMA 2E4TA 3O2VL 4WFGE 3ZE1E 1KMGA 2Y36H 4Q6IC 3D39E 1QR1A 3TA3C 4ENZA 1D5XA 3A4EA 2GAZB 4FXTA 3L6FA 4UTBL 1KULA 1IV8A 3FBKA 3IFNH 4HCRH 3NUKA 4ANVA 1R24A 4PI2A 4B9YA 3TH3T 1FE8L 1WWAX 1JGLH 1BBDH 1U3JA 3NCCB 5BW7A 3QUMA 3OC5A 2WLIB 4UINH 4D3CL 4BQ6A 3NJFA 5KYYB 3N1GC 5JXAL 5FM5M 2F54A 3GXNA 3DX8B 1J8HA 1TCRB 1T4KB 3V7AE 3LVTA 4GP4B 3GMPB 3H9SA 3IDJB 3VFUA 4XVTH 3VDCA 1DTUA 4F37K 3IBOA 1BD2B 1LK2B 1TQSA 4YBLB 3D4CA 3NSYA 2B9BA 1SDDA 1FPTH 2WK2A 4AM0A 1UD8A 3G04A 4Z7VA 5BXFB 4AUYA 1BFOA 1ZJAA 4FYRA 5E8DH 3K8MA 1S8DA 3ML9A 1P5UA 4HIEA 1B4JH 2NX5B 4MNQB 1OQXA 2JKXA 2D7OA 1SYVB 1P7KA 3I9GH 5EOTB 4E9WA 2AEOA 4LSPH 3IJYB 4PVNA 2GTQA 3IS0X 2AZUA 2DTMH 2PO6C 1J5HA 3N5AA 3T3MB 3VA6A 4RGND 2DS4A 4WCYL 1WFNA 4RAUA 3NDZE 2X7LA 3V52H 1NGZB 2GABA 2YAEA 2CUHA 3MTXA 1NLBL 2XKUA 4FFZA 1EFXA 5J13C 1DSFH 3S36H 1X5IA 1URLA 1L6PA 1THCA 2YSTA 5K39B 1ADWA 3X1FA 2UZXA 3N06B 5MEQA 4XNYL 2ODIA 4W70A 4LCWA 5IK3A 1CFSB 4BKTC 5E2TL 3QBTB 2PTUA 4L2YA 1AG0A 4XNDA 2IANB 3BT0A 4Y2DA 3PDOB 4FYSA 1QABA 2XTJD 3KW8A 3WJMB 4Y5VA 3RTQD 3BGAA 1BM3L 1FNHA 3BYTA 2XN9A 3NFPB 4M3HA 1BEYH 5HI4D 2Z8WC 2H26A 5FO8B 2LQRA 3GSRB 1Y6NR 2DLHA 2QV4A 2VQTA 2EDYA 4N2GA 4LBEA 2RA1A 1IKFH 4UT9A 1EX0A 3VXNA 2FHBA 2O5XH 3ALXA 4X98B 1T04B 2COQA 4LRNL 1FIEA 3PQYE 3WFBL 4CMHB 5BPPA 1RJZB 2NY5C 3KE0A 1OP5K 2QZQA 1N5AA 3EYFA 3PWLB 1UWGL 3JQOB 3EOAA 4ZMZA 4X5PA 4EBQL 4FKHA 2IO5A 3GSOA 3HJ0A 4ELMA 1RIVL 1CDCA 1F00I 1QFWL 4IRZL 3WFDL 3QDAA 5CO1A 1NKOA 2UXGA 4JAMB 1HHKB 3Q1EA 2DLFL 1JZ8A 3BP7B 2DQCH 2YPKA 3IMUA 4IU3A 4M5SA 3GSNH 4R4BA 5D71L 1PX3A 2OS7A 1RJLB 3D18A 4N2BA 3WS6C 4KXDA 2LU4A 1OSYA 1X5XA 2P8LB 2X2YA 3DROB 1JZIA 3EGSB 4KK6C 2IPKA 2XI9A 1A6UL 2YAQA 1GCYA 4N2HA 1HCVA 3VXUD 1T2QL 2N7BA 3L4VA 3QIWA 1P1VA 3ENEA 4OGYH 3NJIA 3DTUB 3TN0D 2QQNL 2BSTA 3WUZA 3C09B 4BQBA 3GMLB 4DN3H 1T20B 2B59A 4AYFB 4MWFB 3VVWA 1F4YL 1J7VR 4JPVL 3EOBB 4Z3EA 5E6RB 3G6AB 4YNYB 3QO1B 5E5RB 4FKKA 1RULH 4JY5H 1XGYH 5GS0H 3SIKA 5AAWA 2DQFB 4LLVA 1RMFL 4PCKA 1HHIA 2Y4SA 3QJFA 5AQ0A 1FGNH 1J8KA 5I1CH 4GBXB 3MZGB 2A6KB 3ZMEA 4J3XA 5HI5C 1XGTB 1HIML 1OE2A 4PGCB 4DP1X 3MHZA 3ZT6A 5D1QA 4ZDHA 5J12B 3HG3A 1IFHL 4GG6F 5IVZA 5FV2A 4JFHE 1V3KA 2BDNL 4XGZB 2V7NA 2J2ZA 1AOZA 2FHCA 3TP4A 5SWSE 2H6PB 4FXGB 1YNKH 4P2RE 2BIQA 2DWXA 1UA6L 4LPYA 5EPMA 4NKIH 1NGYA 4G7YH 2B9AA 2YJQA 1HL4A 4HWBL 3B56A 1Z2KA 1JZHA 5JIQA 4IOFC 5ILTL 2E46A 2YPLB 5B3NA 1A6TA 2CJTA 4L1DA 2FQFA 2WQUA 2YA2A 4K8RH 3II1A 1D6VL 3UDWA 1WZLA 4PCYA 4QTFA 5MI0C 3BQVA 3ZGHA 4MMZA 1UWXH 3GRWA 5EB9A 1IBYA 4PMFA 1WC7A 4G59C 4OBRA 3PGFH 5E6YA 2MH4A 3RPIB 2ZP9A 1GC1L 5F7HA 5F93C 3FAXA 1AO7B 3QRBA 2UXFA 3TYGH 5HYFA 1CGYA 4POZD 3FF7A 4FFVC 5B1KA 4Q0XL 1E3FA 2FB4H 1UXSA 3U25A 2WNGA 4G8FA 2ZUSA 3EFOA 3LAFA 2VQ1B 1H0DA 3PL6D 3ARBA 5AZEH 3SDXF 3JWNC 2AXFA 2BO0A 1FORH 4LHQB 1A3LL 1MJ7H 1ZHNB 3MFGB 4ZMLA 5F3HB 2E6JA 1F3JB 4DVRH 1ZVNA 2KYIA 2VDQH 3LXBA 3IM1A 5C0ND 2Y3NA 2CLVB 2FSEB 3UGUA 2VLLA 3OGCA 5BUPA 3SE3A 1MJJA 3GSQB 4NWTL 4X6BA 4YDNA 4DP7X 5L6YH 4XNXL 3RGVC 1M3IA 3TA4D 3W9DA 5LUMA 3O6LL 3AZUA 5CD5D 2KI6A 1MCQA 4NQUA 5IF0A 3KLHC 1NSNH 3WMSA 4I18C 4OJFL 3OKYA 2DQUH 4CSPA 3ZKSD 4JZOB 1X9QA 2WTRA 4IQHA 4X0KB 1XZ0A 2FJHB 3U30C 2QKIB 4ZFGH 5F7WC 2IBZX 3RA7L 3IN0A 5DFTA 1SJEB 2BNQA 4HWZA 1DJIA 3PWUA 1AKJD 3ZRCC 3UEQA 4Y4HA 3OXRB 2OL3H 2WBJA 4NIYE 3QJUB 3BAWA 5ISZD 3PU7A 4RBPH 1DVYA 1MVUA 3LOWA 3ELQA 3LH8A 4FZ8H 2PCFA 3SBPA 4X6DB 2BOLA 4B7LA 1JVKA 3VDBA 3NEXA 1S78C 2XWJA 3FTGA 2OMXB 4YE0A 4AMWA 3C75A 5IOPB 5AZUA 1QSVA 4B3VA 4FP8L 4KAQH 3MNVA 2VQ4A 3DXAE 1MHPL 4RNRA 1UFUA 1DUZB 1XCTA 2ZKHH 2ZZUT 3L1OH 3PJLA 5H37G 1OCRB 5GSRA 1PKQA 2QVTA 3UBXA 3MOBL 5LXVA 5J5EA 1JXKA 1N9PA 2H1XA 2K6WA 4JREC 4PJEF 3S34L 3SQOH 2HT4C 3D5OF 1FRGL 4HQQH 3PWPD 1KDJA 3C08L 3HPLB 4IMLB 4BELD 2AJUH 2DBLH 4HIPA 3NA4A 4HUKB 4N8VG 1QRNE 4Z7AA 4PBWD 5CBEB 2JE8A 3JT0A 4NZRH 2ERJB 4J3UA 3F58H 2JJVA 4MX7B 4P59L 4AH2A 1P6AB 4ANWA 2AC0A 1O7DE 3FU7B 1A1NA 1RFDH 2NNXA 3FH5A 2CDFA 5LNEA 1QSFA 3VXSD 1AGDB 2VJ8A 3OD3A 5SWZB 4E9YA 5IMMA 4J3BA 4HZ1A 2ICWA 3EDEA 4UUJA 1AYOA 1E6JL 1H15B 4X80H 5AVVB 1I4FA 1QNZH 2R2EB 1S9VA 3NT0A 3CMOH 3MRRA 1O5PA 2EE0A 2H32B 4O5LL 2EYRB 3O8XB 1G0DA 1QHOA 3MRKA 2R1YA 4P3DA 4YK4B 4JFEB 5KYNA 4I0PA 4F3FB 1CR9H 1CVRA 4UCFA 3RWHA 1SQ2N 5DMKA 5AEAA 5ICZA 1YY8B 1CUOA 3KNBA 5CF3A 1X9RA 5I17A 1NAKH 4ZW3A 2Y3AA 4I5BB 4RX4A 4QT5A 4N24A 3U1SH 4L4JA 4PRDB 4Z0BH 3QNFA 1ZT1A 5F89A 4JLRB 4JN2B 1INDL 4P9HH 4X6FB 4AI7A 2VLRA 3U36B 4AZ8B 1QO3A 1KYOJ 1UZ6E 2O5YL 3BPNC 1IKNC 4P4KA 1RP9A 4KROB 5AVZB 3HC4H 1RZ7H 4GQ9H 4PRHD 1L9SA 1PZ5A 3SGEI 1IQWH 4HJIA 4RA0C 2ZAHA 2JJWA 1MCNA 4DGVL 1AOHA 1KELL 1SZNA 2VW7A 5LBGA 3W11D 3ME0B 2NX5E 1ZLEA 2EDQA 1ADQA 3VO0A 3VRIB 1HKFA 1HN1A 4JG0H 2XQYG 4LLAA 2OJ1A 5D96B 1T6VN 3ESOA 5CJOH 5GZOD 5GGRA 5BS0D 3VX0A 4XO4A 4WFFE 3T3ME 5FO2A 4JN1L 4NPKA 1AFVL 4JZJC 1GYCA 3L13A 3UJJH 3AUVA 2VUYA 2C5DC 5EU4A 1EXUB 2ZUYA 3SKOA 2Z6FA 3LPGA 2O5ZH 4HUUB 3CG8A 1BP3B 1FNLA 4KJYB 1OAQH 1Q0EA 2WINA 5CUSL 4JUSA 1AI1H 2EINB 1DVTA 1KOAA 1WICA 4D8OA 3H2PA 2GSIB 2OSWA 1M2OA 3QORD 1C16A 3QFJD 1PG7X 2IANE 5L7XH 1I3UA 3QG7H 1PZBA 1PY4A 2G75B 3NRPA 4U3HA 3D05A 1LO2L 4GAYA 4JDZB 4JBSA 3ZE0B 5I16B 5KEZA 5I8EB 1ES0B 4X5WB 3A6CL 3HC0B 4G6FB 4AKQA 1YN6B 3PJSA 2HLFD 3WTVA 4QWWD 4A6YL 4DQOL 5BW7C 4X9IA 3P4NA 1NBVL 4KI5C 1EVTC 2XWDA 3WXWH 4FL4C 2OX5B 4XCEA 1OALA 2ZWLT 3VWKB 2DH2A 4Z8FH 3MV9A 4P2OB 1P5VB 2GIYA 1A1OA 3QDMB 1S3KL 1Q9KB 2FQEA 1HYSD 1AHWA 3MRJA 1MCJA 4BFOA 1L0QA 1OD9A 2K7PA 4JPWL 5DJCB 1XIWD 1VFBB 2P5PA 1T3FA 1I3VA 3RDTB 1A9BA 2ZWZA 1YRKA 2ZKWA 4G9DA 5DK2B 2X0WA 3NQIA 5DS2A 3S37X 1P5UC 4GI6A 3ZLQC 3ZY7A 4AV0A 1T21B 2E9JA 4LU5H 5E5UB 3MJ7B 5FLVA 5F1NB 3SO3C 4F7KA 2E75C 3ARUA 3S48A 3QPXH 4MMYB 2ED6A 4MJID 4N87A 2NY7L 3IDXL 3QUZB 5F0PB 5LLIC 2AEQL 5CWSB 2FEDC 3THML 1DBBH 5TF1H 4OZHF 3HI5L 3HKFA 5INCA 5EEWA 5HSFA 3B1UA 2P5WA 5EC1B 3NABL 5F1IA 4OV5B 4L9LB 2FR4A 1RUKL 1DANU 2VDMH 3HW7A 5BUAA 1NFKA 3VG0H 5FUOH 2XCMC 4TL5A 3WKQA 1N12A 4HUWA 4WW1A 5I73C 2NY1B 1BPLB 2BW4A 2R0LL 4P5SA 3RVTC 2VWEC 4A6YB 5SX5H 2UYLA 3LQZB 4NO0A 5BRZB 4Y2DC 2UY7A 3CXDH 5H37H 5J4MA 4N22A 1XB6A 3QWRD 1JFQH 4Y5VC 2VXQL 4UMGA 3QYMA 2AJYH 2IGFH 1NDMA 3FQ4A 1G1OA 2EDJA 1Q1JL 5H2BA 3LRLA 1WCQA 1ACYL 3G5VA 3HVNA 3I6LE 5I6LA 3NIFF 3LEYH 3L4ZA 5CP7A 1E4WH 1FNAA 1AGFB 1D7CA 2PTTA 2RCSH 3PWVA 4M8UA 1Z9PA 3GHBL 7PAZA 5CS7A 2VN4A 1FYTA 5LG1A 4G70B 3MC0A 2OPCA 3TCTA 2AVGA 1TSRA 1VFAB 2XZCL 2C3XA 4HKZB 3HG1D 4XXCA 3T8VA 2A38A 3VYPA 1SEQH 2CDGA 5C0IA 5KSBB 3HUJA 3O3DB 4ATTA 1YEDA 1R46A 2YXMA 3BWAB 4HETA 4N2CA 4X7SL 4YHIB 4KO7A 5EUKB 2ED7A 3FC8A 5TQ0H 2O26U 3BVNB 4YVNA 1RERA 3KPNA 3I2CL 4U6VH 1UM6L 1XF5A 1CLOL 4ZUWA 4OD3L 4Q9BA 1G9NH 1K4CB 3MRIA 3QIWC 4TUJB 2Q9OA 4U1HB 4PJDB 4DQAA 5HY9B 2CHZA 3EYUL 2CHDA 4XHJD 2B2XH 2VXTH 4N0UB 5TK4A 2AJ3A 4ECNA 3F6LA 3NAAL 4PWHA 2B4CH 5EG6C 4IYKA 2OZ4L 4NO2A 1X5GA 5B39A 2FQGA 1LDPL 3OKNB 4BEIA 4N2MA 3FQ1A 2ADJA 4NFBA 2WO3B 1A4BA 1SBBA 3E80A 2GITB 5D7SL 2Q8AL 3L1FA 5AAWC 1NCAL 2VR9A 4L4VE 4P57B 2C7UB 1XHHA 2CHXA 1R75A 2WXJA 3AW5A 3FT9A 1IAKB 1LE5A 5HHOA 3FL7A 1HL9A 3DV4B 4ICXA 4AEHH 1OAKH 1V7NH 4E9TA 5IB4B 3ZYOA 4JM2A 1FZMA 2FJUB 5C9KA 2ORBH 3NVQA 5HDOA 4RZCB 4X6EB 4XCNA 1MCCA 1HHHB 2EJ1A 2DEXX 5D1QC 3PG2A 5DGQA 2ZOKB 4UOW1 3IGLA 1T0MB 1FJ1A 3VH8A 2OLDA 2Q6WA 1UOLA 4PU2A 2APSA 5FA3A 2IV8A 5SX4I 4GKLA 3MRQB 5EBLB 2VYRE 4HX1B 1UXMA 3G9AB 3Q48A 5LBVA 1E30A 5CAYB 3IDGA 4WK4B 1ZGLB 3KPOA 4NKMA 1EEYA 4ZOCA 4PRID 3UDWC 3ZX1A 4NBYB 5HHXH 2BOCA 4MMZC 5D1XB 1W8NA 3M1OA 2XN1A 3RY6A 2AAAA 4WO0A 1H3XA 1QBLL 5DHEA 3F7VB 2K8MA 4WK0B 2F68X 5F7DB 1MHCB 4ENEC 3VD1A 1OT1A 3BW9B 4P9MH 3VSUA 1ORQA 1INQA 2XKNA 1J9CT 1FNSL 4PJBA 4PJFE 5AZ2H 3IKCA 1G7IB 3GSNA 1UXWA 2K6ZA 3TF7C 1P4IH 2YGOA 3LKRB 2NXZC 2BWDA 2ITDA 2NUPA 1SBSL 3ARBC 3JWOC 3UMTA 1BHGA 5FHAH 4HFWA 4URKA 4NNXB 4PGZA 4JR9L 5LJYH 1GJUA 2CIKA 2C1PB 3WEAA 2XV6B 3D52A 3Q1SL 2DQHH 4WENB 4YJZL 2F15A 3VFGH 1GW0A 4W9IC 3VI3E 2J43A 3RWGB 1FI8C 2R1WA 4WU5A 3SE3C 2ETWA 5SWZE 2X70A 3NP4A 3WLWD 4R5VA 4G3YH 4AGNA 4ZYKA 3S5LB 3GXMA 4X7EC 5F0MB 5GQBA 5KSAD 2H2SC 3VE0B 2JI2A 2ZICA 3SDYH 3QZPA 1OVZA 4WWID 4D2NA 3X12A 3RPKA 1WIUA 4PIRF 2EVGA 1BXXA 4OUUA 5L0QB 3WUWA 4E9RA 1HINL 2E86A 1EJOH 5DEGB 4L2LA 5F6HI 3BIBX 5LGHH 4DTGL 1WQVT 1A6VH 5CEXB 3BDXA 4IDJH 4JFEE 3RZCD 4GKZB 3Q8AA 1BQHB 4Y4HC 1I1AA 4YDKH 1NCBH 3NCBB 5CEZE 2WBJC 3UTSA 2G60L 1F3DJ 5D6DA 5ESQA 1ED3B 4R2GD 1GHFL 4W9EC 3ARFA 3WELA 4ZOAA 1EANA 3GFUA 5FYKD 1KTBA 2XBZA 4N0CD 4N28A 1DVSA 1W8OA 3CHQA 3MA7B 4LDEB 4PJ5D 4TULL 5E2WL 3HI1A 4LLDA 1E27A 2QPEB 2YSSB 2XT1B 4EZLA 4HS8H 5D9SB 5I1EH 1YNTF 3ML8A 2CAKA 1HZHH 4XVJH 1BAFL 3FQUB 3BPCB 3H3BC 3R1GL 5AVWB 4C56D 1YECH 3X3FH 1ZGLP 5KYWB 4HH8A 2HLAA 4MS6A 4JHUA 3V4VA 3FU5A 3CIAA 4WHTB 5BV7L 4JG5A 1HCFX 1T22B 2BOBA 3BZ4B 2UZPA 3CDCA 3L5WB 3MRCB 4O58L 3VXRA 1RZJC 4TOYL 4OUOA 2JIXA 1XF3A 1HH6B 2QSCL 5A3ID 2EDKA 2N3JA 4X99A 1IM9D 1KIUB 2DLIA 5IB5B 4HIIB 5DLML 1C5CH 1JNLL 1JF1A 2OMBA 3QXDB 4O2CB 1LO5A 2DL2A 1YEGH 2XYCA 3CD4A 4Z77B 3N40P 2ADGA 3BZEA 5FA4B 3MRFA 1FAIL 2V5YA 4S1SH 3TM6A 2LU7A 1HZLA 3ZYIA 3DO3A 2J71A 4PS3A 4WEBL 1JV2A 1U9KA 3FU3A 5ETUA 1L5GA 3TO2B 3U82B 1R3LA 2ZCLL 3D51A 4XMKL 1JTPA 5F8QC 3WTTA 3X1EA 4F7MB 3WEOA 1LQBC 4P2QA 4I0PC 3LH2H 2LGNA 3TX4A 1KFAH 3AROA 1P1ZA 1S5IH 4ZNEE 4NPJA 3ZE0E 2FECI 1BOGB 3ZHKA 3CDZA 3E7JA 4I0CC 2VLKD 2P8PB 2Z93A 1D9KB 1J1PL 4ODVL 2D7PA 1RZFH 1LEIB 5EO1A 2FO8A 3E6HB 4Y1AD 5ICXB 1MIMH 4OZFB 5EBMA 4HSCX 2ZOUA 3IXTA 4OQTA 5BV7B 3OZLA 3QDME 3AU1A 1QQDB 4H8UA 1QEXA 4YSAA 4P4KC 1K72A 1G6RL 4PJ8A 4G8EB 3BISA 3NCJL 4R8WL 5IFAL 3EYQD 6FABL 4ABVA 3TH4T 2C26A 1I7TA 3GSWA 3AG3B 1HCYA 3IFPB 3QIBB 4A2HA 4E36A 2IIJA 4I88A 2YQBA 3IDNA 4QOKA 1WITA 1R5WB 1U4EA 5EA0L 2H3NA 1UWXK 3MRHB 1UQSB 2Y1ZA 3MJGX 5GRWA 3SE9L 3E1ZA 3T1FB 4CL7A 4U3XA 1T7XA 5IT2L 4YGVA 3RL2B 1IC7H 3M8OH 3QJXA 1ID2A 3Q2WA 3CVIL 4S0SD 3HRPA 4OLZH 5C07A 3ISWA 2BIHA 4HSAC 3KR3L 3I6SA 3WKMH 1MFUA 4OM0L 4QPEA 5T3XL 3IDMA 5HVGB 1MWAH 3UBXI 5I1IH 4GFTB 4JRXD 3IXAB 4PB0H 1AIFB 4K9EH 5ESAB 4JE4B 4ZTOL 4Y89A 1U2YA 3VSQA 3T6QC 3NFNA 4BSJA 4Y5YA 4MAYD 1I9JH 2N56A 4F80A 1F13A 1R1CA 1NCGA 2F7PA 4JRYB 1QPKA 2FGWL 4Y4FD 3V0WH 2JK5B 2J8OA 3LZFL 2WYTA 4PM1A 5JOFB 5LQBL 1G6RB 4HKJB 4XE5B 4I48B 3FFCB 5C0FA 1AYRA 1H6FA 3ISRA 4NUJA 3MUY1 4JFYB 5I2IB 2YXWA 4LF3B 3AVEA 1NEZB 5E4IA 1TO4A 1XTMA 1QKZL 2IDQA 3OR6B 1EHLH 5DUJA 1AHWC 1A22B 3HZMA 1U92A 4LEBA 2G2PA 3T0ED 4LP4A 3T08A 4MYWB 3WFEL 4C4KO 1CF1A 1R3KA 1FZJB 3FXIC 4X6CA 1JHKH 5C6TL 3V0VB 1JZEA 1USZA 1GYVA 3MOQA 3PUCA 4NQDA 3KM2A 4QRPD 4RBPK 1MCPH 2V2XA 4X8CA 1UURA 2JKWA 1OF0A 2VM4A 3MOAL 5E6IA 1ZLWH 2YUXA 4K3HA 1KN2L 4H8HA 1NCNA 1TVHB 5F1SA 3GMQA 3O41A 4MASA 1BJ8A 1T66D 4MXVF 4YDVA 2V6HA 2CKBH 4ZMVA 4AGPA 3NGBC 3R8BB 5C08A 4W9JC 4M3JA 3BE1L 1EGJH 4MD0A 1CIDA 1KTDB 3QRGL 3NCYP 3MA9H 3BJLA 3SDDA 3MLVL 4YFLI 3FQNA 1OARH 4E2OA 1JCVA 2FNWA 1H6TA 4E41D 4O51A 2FYYA 2MQ0A 2HH0H 1FGVL 1KGCD 4K5OA 4KKPA 4L8SA 3FH7A 3KPLB 4D9LH 5IUSA 1U36A 2A0LD 2YEZA 3TU6A 5IEKA 5EIIA 1C5DB 1TQBB 4NIKB 1A7QH 1G7LB 2GTWB 2DQIL 4L4TD 4OVVA 1WHPA 2ZG3A 3DURB 4RFOL 1J05B 4U7KA 3MREA 4K71B 2HMIC 2Q2LA 5MEND 2DYRB 2XNAB 1LEKA 3MBWB 3WV0A 4F93B 3PY9A 4NUGL 3AWFA 3V4PL 5CCKL 1MJUL 1XCQB 3CSTA 2B0SL 1MUJB 1VEPA 3KYKH 5T1LB 4HKXA 4LCUA 3RNQB 4MRCA 4LLUA 5JO5A 1G7JB 2BFVL 4G6KL 4TUKH 1CXFA 2NZIA 2GBTA 3E8VA 4XVUD 4XXCC 1JFHA 4OCYL 3GXUB 4OSUL 3CN4A 4QHUA 4ANKA 2OJEB 2IH8A 1OAZL 2VJ0A 3T4AB 2VLME 3B9KD 3EYVB 3MV8B 2VCOA 2EXWC 5F96H 2WXPA 1JVLA 3DBXB 4WI5A 5T3ZH 4DO5A 4AVKA 4NQSB 5DD1L 5HHMB 3VXOB 4YR6B 2D2CC 1ANUA 5D1XE 2H8PB 3E6FB 2QLYA 4MXQC 4ODXB 4J3OH 4M8VA 4NS0A 1DBAH 2P80D 4BH7A 2JMRA 4M1GH 2ZCHL 3WE1A 4YSSA 2OR8A 3MJ9L 1UB5B 2NY3D 2DWTA 1DP0A 2A6JB 2BNRA 4XH2B 1H3TA 2CGRH 3UIYA 2V7HA 4OD2B 3EJYD 3LCYA 4LEOB 1K8DB 2QDVA 9CGTA 4PV8B 5I18H 3ZTNL 3V4PB 4PV1C 4NZDA 1XZWA 2ZKXA 5DFVD 1QPXA 5ESVB 1KIPA 1PW3A 3IK2A 2HT2C 1TTGA 3RKDD 4V1DA 4JM2C 5BQ7A 2OP4H 3TEYA 1DFBH 5AW1B 3C2AH 4GRLA 2XBDA 2DJMA 4HXBL 2QPDB 1JPGB 3CLFH 2C1OB 2L4OA 3OMAB 4U3SB 4HPHA 1MFCH 5C0AB 4FHBD 2CO6B 4WEEA 3GNMH 4RCAA 3K0YA 3QR2A 3S3CB 2JV6A 3R06B 4XT1C 1MAJA 3TV8A 3CTTA 3V5DB 3KMDA 1UT2A 3RVUC 5K5YA 3FMGH 2WLNA 1BGXH 3FSZA 4HP5A 1RQ5A 3DVIA 4GKNB 4FG6C 2EADA 1TJIL 3BLKA 3ETTA 3FF8A 4DFIA 3ULVL 4X8JB 2AJXH 4WWKD 4TQEH 4WJKB 3UPRB 2Y2WA 4MBOA 3SCMB 2PXYB 4Y9FA 1BLIA 5DA0B 5F7AA 1KT2A 1R9FA 1IGFL 3RY6C 4UQDA 5JHDD 1S7XA 2R0KL 5FB8A 3RU8H 4GKSA 1U58B 3B3IA 3ZKXB 3CU1A 3HMWH 4PRPB 2OL3B 1O75A 1D5IL 3DUSB 4OAWA 3D09A 2EH7L 4TL4A 4WF7A 5BZDB 5GRUH 2F19H 1U8CB 2H5UA 4J7RA 5CJBA 1CI3M 1EPFA 5AYUH 1TUPA 2VXVL 5I8CB 1EHNA 1YO4A 4Z18A 3WIFB 2N0KA 2E6QA 4G6JL 1KXTA 2HT3D 1KEGH 2P8MB 1KB9K 2XPGA 4X7TB 2PNDA 3DGDA 4YHML 2ED9A 4M7ZC 5EHFA 4EZJA 5CBAA 2YUWA 3APMA 5I5IA 2KLRA 2LABA 2X28A 2DL9A 4QY8A 3VXMB 3PGDB 1PJWA 4QRQB 2EO7A 3KHOA 4KQ3L 4XP9L 3SDAB 5LCVA 4PJEA 4FFYL 3BKMH 5L4JA 3GB7A 3L3IA 4ALAH 5GGTA 2DLGA 2ADFH 2B3IA 2NTFB 3G5XA 15C8L 3LS4H 4DPCX 3A3YB 3GMMB 3SPVB 1G43A 1TYEB 4LE8A 4E9VA 1B2YA 5SX5K 1PNCA 5I75B 1NCDL 2W92A 4QXTB 2HN7B 3RVWD 3G5WA 1BF8A 1FVCA 2WD0A 2WJ7A 3PV6A 5D2NB 2OXGA 3CVCA 1I1AC 4XN8A 5CJQH 4FNSA 1EDYA 1T83A 5D6DC 2WZ5A 3EKCA 2W8CA 3N0PB 4RZKA 1QI5A 3CNKA 1UTDA 3CCHA 4Q7DA 3ARFC 4B0MB 4XBGA 5EU3A 1E40A 2HFFA 1XV8A 3CHPA 4I3SH 4LOEA 4F92B 4U2ZA 2P28B 4F20A 1LP9B 4FQHA 2WOBA 4DWHA 2BHUA 4PG2A 3S9DB 4G1MB 5SV4A 3BGFC 1DDHA 5IROD 4K8RC 1SM3H 1RI8A 5I76B 4FNTA 1A6WH 1MHEA 3BDYL 1KN4L 3RFZB 5DTFB 3VW3L 1AZZC 5E08L 5KSUA 3P4OB 3KYOA 1G5AA 2Z9TA 4M7JH 4YZFF 2IDCA 4PWGA 2I9LB 2ZOWA 4K2UL 1RHHA 4NRZB 4NJAH 4ORGA 5CU5A 4NKDA 4NQEE 2EDTA 4KKCD 4ODUA 3K71B 3M7OA 4F1SA 2HUEA 4P4RA 3IE4A 1MCKA 2PW1B 4NRXB 5DZNA 1HK6A 5L8LB 2WIIA 1WAEA 4F57H 4GIOA 1W15A 2PPAA 1NJ9A 1MCDA 43C9B 5I6OA 3NCEB 3LKQB 5IJBC 3HFFA 4ISVA 1SJHA 4LSTL 3BI9X 5ADOL 5EUOF 1GIGL 5GIRB 1DLHB 2P26A 4J4PD 4IBZA 1ZJBA 3TEXA 1IX2A 3UCRA 1YEFH 3WY3A 5J13B 4FQXA 1OTTD 1QBML 3BP5A 1D5BA 3I6KA 3MNZB 3MRNB 1O6VA 2CLRB 2H47C 4Q8BA 3U7YL 2VL5B 2Z31D 1V3MA 2MEJB 4EO5A 2XETA 4RISH 4UOW0 1DZ0A 8FABA 1JK8A 3IDUA 1BVNT 5AAPA 3W37A 3DLQR 2CMRL 3OKEA 5KS9F 1QSED 1F11B 4PJFF 3SBQA 3ZN6A 4OLYL 3WXVL 1E43A 2ZT9C 4BCYA 25C8H 1ODAA 2EUWA 1GVIA 5DR5H 1W0VB 4ZFGL 4FEIA 1JGUL 1JPSH 1U2CA 3RYMA 2X4SB 5TJWK 5ITBH 4ZT1A 3HNSL 2CIIA 3BH8A 4J6RH 5ENWB 5KW9H 2BP0A 3FQTB 5EU6A 2F2HA 3QXTA 1KLGA 1BJ1H 2DM4A 3BD5A 3QUKA 4PJ8C 3TA3D 1N5YH 3MLSL 3VI3F 3O9WD 1KGIA 5AWNL 3O6KH 4M6MH 4KHTH 3Q06A 4G9FB 4L3AA 5D4JA 5CSZA 2XFXA 3RVXD 3UG4A 4XCYA 1PGRB 4GAGL 3I6GB 5T3XE 2OSXA 4LKXB 2CRMA 3KJ6L 5J6SA 1MF2H 3N1MC 2AEWA 2QQKL 5ERWB 2YO3A 4LQFL 4Q89A 4ZMXA 4Y19D 3V4UH 4XMPL 4IDLA 2O61B 5C0BB 3BFOA 1IAIM 1IU1A 1S3RA 5A1AA 2VITA 4OCRH 4AEIH 3FUNA 5ECJE 4XXDA 4PGJA 1SN2A 2ZX5A 1JIBA 3CU7A 3GQFA 4G1EB 4WUUB 1C08A 2P24B 3BH9B 1G1CA 4X0NA 4RMVA 1TEGA 4Y16B 1IGTA 4LP5A 2IADA 4Y5YC 3QZLA 2AQNA 4APXA 1IE5A 1OAUH 2DAVA 2NMSA 3FKUS 4QAWA 3T04D 2PO6D 3DJRA 3Q6FB 4XOAA 4N0FB 3MXWL 3EO1A 5DJYA 3AT8A 4JPKL 1QLEL 1MPAL 2WQWA 3NSJA 1L0YA 1OSPL 4JRWA 5DDHB 3Q0HA 5DSCB 5HYJB 5JW3L 2OAAA 4H0GA 4MQSB 3KPSB 5AVRB 5PCYA 5CZVL 2OTWB 5CLWA 4NN5B 3FTZA 4HALA 1BBJB 4B5ZA 1TJGH 2P5EA 3AB0C 1VPOL 3P4MB 3U4BH 4NP4L 4PJ9A 4X4YB 3R8QA 5CEYB 1XF4A 3MJ8B 2X4UA 1I7RA 2XACC 4IBUA 2PR4L 4JHWH 4OZGA 4N9GA 4N8VB 1UCTA 3CFEB 1MW2A 4POUB 1UWEL 3LQAH 1KYDA 1A6ZB 2K70A 4GIAA 3QEGL 1YC7A 5FYLH 4J23A 3C6LD 4MB1A 1ONQA 4B9IA 4B60A 1KV7A 1UCBH 2VXSH 3MLRH 5E6IC 4AYID 3MV8E 4ZFFA 3H3PL 1LMIA 5HHME 3VD0A 5I9QC 2WLHA 3WSQL 3WIIH 1VFMA 3FQRA 4AYEC 1YEKL 1G87A 1A7OL 5AW2B 3ILDA 4ZK8A 2NW3B 5B38A 1ZV2A 1EEZA 3CQFA 4WJ5B 2ZWKA 2JWYA 3EH5B 1P4BH 3FB6A 4XCCH 5IQ9B 2JJUA 3CXHK 3UADA 2B3RA 1QLEB 3SDDC 1CDJA 1LMKA 4WZ9A 3ZE0F 1F4AA 5CILH 2NDFA 3QFDB 5K9KA 1Q0YH 3MCG1 4M8RA 3RPBA 1RUAH 5E95B 3R0MA 5DUPL 5J1SC 2IGTA 4QCIA 4XMLH 3B9DA 2EO1A 5CN2A 1MLBB 3WENA 1ZD6A 4L8SC 4ZUUA 5C0CA 5FO9B 1MREL 3QUHA 1P53A 1SN0A 5H4ZA 2COVD 5F2FA 3SZ6A 2YMXH 3SB3A 3AS1A 2CCVA 2R4SL 4OIAA 1SLWA 4MQXC 5AKSA 4L8BA 1NGQH 1NC4A 1X5MA 3RGVB 2GJJA 5GHWH 1YEJH 2A9BA 2IPTL 1YUHA 3HE6A 4HCIA 3UTZB 3V6ZB 1IZKA 3ARQA 1ZRUA 3L3DB 5IJVB 1NWOA 3IPFA 1U8PB 1FHNA 4FTVA 2EZ0D 2B15A 1S46A 2OMZA 3NZ8A 2EE6A 3W1ZA 3UZVA 4U31A 3B7YA 4YDIL 3ASWA 5E1AA 5BVJA 2DJSA 1KPUB 2BVPB 3U4AA 3K4ZA 5HI5D 3RWCB 1FVEB 1AQKL 2VR7A 2E9WA 3AMLA 1IJ9A 1K8IB 1NFDB 1J5IA 2WXQA 3QCUH 4EXKA 4UB0L 3JTSB 4R4FL 1WAAE 2VDKH 5KTEL 3PXJA 1I3RB 1NFIA 2CBMA 1BD2D 1H9VA 5HHNB 4PRPE 4OIFA 3B2VL 4MD4A 4N5EC 1FIGL 5DJ2B 2BMKA 2R15A 1X5HA 3CX5K 4F91B 3IJEA 3FOMB 4PBVC 1CD1A 2YQGA 5FKAB 2EVIA 1BVZA 3BWUF 3C60A 1U33A 1S7QB 1SMOA 2K9FB 4CJ0A 3GO1H 1XSKA 3QHTC 1TETH 3KS0H 4MNQD 2W0PA 1SHXA 2CKBA 2EE3A 4Y9GA 3ALWA 3DIVA 1IQDB 1F4XL 1RZGA 1ZA6A 2VABB 5ITFA 3RWJA 2WSDA 4HT1L 4YLBA 1VA9A 4OI9A 3RHWF 3MLYH 1SJXA 5CJ5A 5F6HJ 3QNXA 1A7PH 1NCWH 4I9XA 4WAFA 1IO4C 4GRLC 5DJ8B 2EE2A 2AQPA 4MCNA 3U2SB 4KKLD 7PCYA 2R23A 2WWMC 3ESVF 3ULVE 2EVHA 1YDPB 1F58H 2GJ6B 1ID5I 4GUOA 3K6SB 1CI5A 4M8QB 4R26L 4QRAA 3IMVA 3IJHB 3HS8A 1YY9D 1G9MH 4KUZH 1EFQA 1YAZA 4YN3A 1GAFH 1HFUA 2GK0B 4GMSL 1AQMA 2CRIA 4MCYB 2MHAA 4BKLA 3PXLA 4CMMB 4NLAA 2DTSA 2QQQA 2CNYA 3GPEA 4W1TA 1CG9B 1CK0H 2YUVA 4I8DA 4QRRB 2FT7A 1URIA 5AB2A 3ABZA 5KUMA 3QPQC 5KJRH 5IMKA 1YYCA 2PWDA 3SO5A 3TS8A 1H8SA 1S9XA 3NACL 4LVNB 4BGLA 2WKGA 4UM9A 1LP9E 3WJJA 1CE6A 5GGSY 3MODH 1INEL 1F2QA 4OGAC 3CN3A 4M7LT 5EORH 4F8LA 2QMKA 3X14A 3ZBMA 1U6AH 3TT3H 1TQCB 3EO0A 2AF2A 1GSMA 1CXIA 5HVHB 3CFDA 2FD6L 3CV5A 4WIQA 3QUML 1ZLWK 4L23A 4D0DA 3ZRSA 1G9NC 5K9OA 1NGPH 1Q94A 1S78D 1Z9NA 3MBXL 4I2XA 1VLXA 2DJUA 5DQ9B 1AQ8A 5FCSH 2WP3T 5AVYB 3WMQA 2EKSB 4UQ9A 4H26A 2NR6A 2NY6D 3ZU8A 3U48A 2VW6A 4Y2OA 3MFFA 2WTOA 4CADB 2HVJB 1A64A 4Z7NB 4ACTA 2ENJA 4O4YH 3ESNA 4N8CH 1I8IB 4RGOH 2Q10A 1SXBA 2BSSA 1SEBA 3D2UD 3QDGA 4BFFA 1DL7H 3QUXD 4PLKD 5E56A 3EXJA 3MLXL 4BA0A 5K59F 5HD8D 1IM3D 1Z9LA 3O3EA 1W72L 3WE6B 4KV5E 2F58L 2LLLA 4UV7H 2YD9A 4AWJC 5H35A 3K4DA 1T83C 4AGLA 1CZ8H 4PR5A 2XZZA 1QR1B 4FFZL 1EQWA 2EEBA 2N1TE 4Z3FA 1I8UA 5KVEH 3FNKA 3L6FB 2NQDA 1MIEL 1H3PL 2O6CA 3L2NA 3N40F 4OV6F 4DEWA 3LDBC 5LAPA 1R24B 1DCEA 1Y0LB 3CX2A 1JWMB 4N1CA 1QWHA 4P23A 5E9DE 2JB5H 3BUQA 1FUNA 2AERT 2VDNH 3QUMB 4JFVA 1AXTL 5LBSL 5T1DL 3IVKA 3EZ8A 4PG2C 5HDQH 2J44A 3QEQE 2YGVA 4O02L 3UAJA 3H9SB 3O4OC 1XGPB 5IB3A 2V2TA 1J5DA 3PUUA 3DTXA 2YPLD 1SDDB 5DC4B 1ZKAA 2MOGA 3N41B 2XBTA 4UT9L 4AM0B 1DQMH 2FDBP 1BFOB 4GEIA 4KQ4L 4LFHD 3WD5L 5FDWA 2L0DA 4PWFA 3DMMA 1KCRH 4AQOA 3MUGB 3UO8B 5IB1A 4POYA 1U2HA 1AO7D 1P7KB 4WSKA 3ULUD 2FCBA 3SO3B 3HPJB 4UM8B 1NTDA 1FFRA 1W72B 1U8NA 1DVUA 4JUTA 4HHAA 4QTHA 4PTTA 3OZ9L 4RAUB 2F74A 2X89A 2VZ1A 4PJAE 3FCSA 4WUUE 4JFXA 1EFXB 4K94H 4OLWH 3BSZA 4FQXC 3SY0A 4JO4H 4LVHB 4KTDH 4DGWC 4R7NA 3QXAA 4FMKA 1HXYA 5MEQB 5I73B 4LCWB 3H53A 5IK3B 3GXFA 2ICWJ 1MHHA 2KT6A 3CPLA 3K2KA 2PPEA 4Y2DB 3LN9A 1LWJA 2ARJA 4ZD3L 5HYJE 1FL5B 4O02B 1NIAA 1TLKA 2Q0ZX 4UQ2A 4RRPG 1RL1A 4N2IA 4WWNA 4Y5VB 1N0LB 2UX7A 2D8KA 2H26B 2CNZA 2CJUH 1JZJA 4GT7A 2P3YA 5FX3A 1YEIH 4LBEB 1JERA 1GGIH 2Z35B 4X9GA 3VRJA 1ZPUA 3ZKNC 2IXQA 4QF1A 3BO8A 1MFDL 2BNUB 2A83A 2R2BB 5A2BA 3RVVC 3WI9A 2DMHA 1N5AB 3EYFB 2XA8L 3EOAB 2YBGA 3GSOB 2H1PL 3D69A 1F41A 1J5OL 2FH6A 1JCKA 3UBFA 3BX7C 3VB8A 1TTUA 3GUTA 5IMOA 1O6SA 5DD0L 3SODB 2F54D 3HR5A 5JR1L 1CVSC 3D3VB 4OM1L 2YPKB 4IU3B 4QHLB 5GGRY 5JW5A 1MCRA 1OGAA 1A2YB 4WHCA 4YX2H 2NY4C 5L9DL 1M71A 4YXHH 2IPKB 4E68A 2BPBA 3AXIA 2PPCA 3QA3B 3DUUB 3QIWB 4AKOA 5JNYB 2RBLA 1J9QA 2HLEB 2HJFB 1CGUA 5F0JB 1B0RA 3RTQA 4R5TA 3GRWL 3UZQA 4ZPTA 2B59B 4KGJA 5D6CA 1VADB 1PSKL 2FH8A 3VQMA 3MQIA 3OAYH 2E7HA 2YN5A 43CAA 4ODWB 5JHAA 3JWNE 1AD0A 1K6QL 2YOAA 2QQLH 1FLRH 5BO1H 2E3VA 5T1MA 4TNVK 4LLVB 4HLZG 1HHIB 2BVTA 3DDGA 2NXYB 3HE7B 3QJFB 4AG4L 4PJ9C 2A9MH 4KRPB 1JWSA 2F0CA 5E2UL 4IJTA 4UBDC 2WLYA 3V2AR 3RVTD 3LEVH 3JWOL 5C71A 3NIGB 1HI6B 3VCLA 1GGUA 3WTUA 4LLYA 3CFMA 4ZDHB 1A0QH 4ZXBB 4LVEA 1XTLA 3F5WB 4AY0A 2FECL 5IVZB 1JMZA 5B1BB 2V7NB 2YAFA 2J2ZB 2XN9D 4P5MA 5H8DA 4P5RA 3ZDYB 3JTTB 1P6FA 4Y1TA 3J27A 4UMSA 4QHKJ 2BRQA 5EPMB 3TBBA 4I9WE 1NFDE 4CGUB 3VXUA 2IFFH 3LMJL 3TN0A 4JQVA 2QFPA 3VFWA 5MHSD 4ABQA 3B8YA 4BXVA 4Z7UB 4MMZB 1EZUA 5C09B 3BSGA 1YAIA 2B1AL 3CFJA 4GIPD 2WVVB 1FZOA 5JUEL 5FGCB 2HKFH 5L2KD 1PL3A 2X2HA 1M7IA 3FHEA 3AQZA 5GRXG 3BHBB 5GGSB 5A2LH 3W38A 4WI4A 1EERB 5C6PB 1HQ4A 5I8OH 5FGSA 5FHBH 4AMKH 4HC1A 1E2VA 1MRFL 4G8FB 2YEVB 5KG9A 1E9QA 4N1HB 2GTZB 3H2QA 5LGYA 1H0DB 4F15B 2C7FA 4WWOA 2FHFA 5ADPL 1T80A 3J07A 4H1LA 4G7VH 5LGKA 3L3HB 2AZAA 2BP3A 4K9EC 3QI9B 4JHZA 3TBYB 2IDUA 1MJ8L 2BSED 1UACH 1MJJB 4X6BB 1A4JA 4HPYL 4YQXL 3PREA 3W9DB 3HE6C 2VN5A 3GKWH 4A2LA 1KCSL 2GJ6E 3U4EB 5C70A 2HAZA 4KNUA 3CC5A 3ATBA 1JS4A 2N01B 5DYFA 3DX3A 1CE1H 4HFUH 2VDOH 3DVGA 3CQQA 1TF4A 3VFVA 3DX9A 2BNQB 4FLOA 3LEXA 2GI7A 1IGCL 3PWUB 3UJIH 3GM0A 2KQNA 4PJXA 5IHLB 4LSQH 3QDJD 5IB2A 1JYXA 1K4DB 4PY7A 4WI0A 4QRRE 1J1OL 4OT1L 5D1QD 1HS6A 2WBWB 2IOMA 3CZLA 3VWKD 3SYCA 1DQDH 1MVUB 4BA8A 4AYMC 2PCFB 4MHHI 3UTTB 3JT2A 2IVFC 2XWJB 3CVBA 3DBSA 3IYLW 4JY6A 2WQXA 2NQCA 2G2RA 4AV4A 1XR9A 3ABGA 3PL6A 1QX1A 3OKMB 4MHHG 5ACZA 2FBJH 1ETB1 3C60C 3CBRA 3KYNA 3UBXB 2LOEA 1PKQB 2ZF8A 3NSCA 1YMMA 4CC4A 2YGNA 2O93L 4MQ7B 5IVXA 1MRDH 4AMXA 1EEUA 1ZSHA 3ZOAA 3QYNA 1O7SA 1E42A 1KCVH 1KIRA 2PKDA 1NDTA 3AQXA 4QHNA 5I1DA 1G9EA 4JCMA 2ZAIA 1XD0A 2A1WH 3QZMA 1JHLL 5DEZA 4OLVL 1PZ3A 3MBEA 4OQ1A 4TN9A 1KENH 5GISH 4AH2B 2MJWA 3UC0H 1RZKH 1Q72L 2CDFB 3WKYA 1QSFB 5C0RL 1RZIB 2AK1L 3MMEA 4AYBA 2X1QA 2HPTA 4BZ1A 1CICB 1ZHBB 4BK5A 3AWEA 1D5MA 2ZXCA 5IMMB 1R19A 3G6JA 2NY1D 1AKJA 4UUJB 1CPUA 3QB7C 4X4ZA 5E2VL 2F1EA 3ATAA 5EWIH 3DOIA 1ADQL 5LWYL 1WO2A 2YMOA 4U1GB 5BRZD 1S9VB 4UIMA 3VQ2C 5ISZA 4PJGF 1WLHA 1K85A 4NO3A 3MRRB 1PNDA 4N2NA 2MCMA 1MG2C 3QG6B 4AJWA 3MRKB 4P3DB 4YBQC 4I0PB 1NCCL 1V5JA 2F08A 3LRSA 3O81A 3SKJL 2H2SD 3K3QA 3RWHB 3HC3H 4F2MA 4KXCA 5DMKB 3H54A 1C1EL 3OJ2C 1TNNA 4X9BA 3RGBA 1ZT7A 3INUL 4UDTB 5ICZB 4TSCH 3W0WD 3D7PA 4XE0A 1I8MA 5I6XB 3WJJC 4QT5B 3GMRB 4RWYL 2WW8A 3PWPA 4KI5E 3DNKA 1GR7A 1J8HE 3VNZA 1ZT1B 4M5YH 5F89B 3A67H 4ZMPA 1X4YA 3H9SE 5CN1A 1D3CA 4Y4HD 3MLTA 4IBSA 5MP6H 1SXCA 1WFTA 5FUZL 1QO3B 3QJRB 1PAZA 1XH2A 3Q05A 4J3OC 3VXSA 4TVUA 3ETBJ 4Z7VE 4EF3A 1PZ5B 3Q5YA 2XN0A 1CBVH 4EDXA 3DJSA 1U91B 3KGRA 1RZ8B 3V7AG 3FUEA 3JV5A 1JZGA 4FERA 4QYOB 4LIQL 4XOEA 3O3UN 2PCYA 3SE8L 2NR6C 3MU3A 2KLSA 2Y5TA 3U6XS 2IALA 4MRBA 5GGRB 3ZQXA 3N04A 1R34A 1EBPA 2DD8L 1A6AA 4NC0B 3VGEA 1JSYA 4YC2C 12E8L 4XPAH 2MCPH 4F8OA 3BD4A 1F90H 2AMUA 2WWNA 4R9HA 5HGAB 2PYEB 1Z9OA 3CFBA 3ZXAC 3FN3A 4CU7A 2WCPA 4M62L 1HXMA 1S6NA 4LCWE 2JTYA 2VWEE 1OIOA 1WAAF 3JZ7A 4KJWC 1C16B 2QMJA 5AYTA 3MLUL 2NNRA 3TJHC 1KJ2L 1MQKL 2WZPD 5KVGH 4MNGA 5D7EA 2BCKA 3FO9A 3WY4A 3WCYA 3GHEL 2Q7NA 3VXPA 5EUOA 2WNXA 1B2WL 4GAYB 3LKOA 1P0SE 4JKMA 1DYZA 1SPDA 4XX1E 3CZGA 1L4IA 4S10A 2MWCA 3PS6A 3OB8A 4P23C 4OFIA 2VT0A 3P4NB 1ZWIA 4PRHA 1AR1C 4XP6H 3N44F 2DQDH 4NRYA 4XCEB 3UAJC 4BYHA 1Z5HA 3TV3L 2VDLH 3WKNA 3B2UD 4WKXA 3LNGA 5J11C 4WK2B 4UQEA 2YK1H 3CFQA 3L7FA 4ELME 5KS9A 1AG6A 2C3VA 1E5BA 2FLMA 4RIRA 5G5DA 2YAPA 4HD9A 3I9AA 1II4E 2HTLC 1W8EA 3ABLB 1CU4H 2GVYA 4ZO9A 3DMMC 5BS0A 1XH3B 4ZBJA 3QNZA 1YVLA 3G5YA 5SV3A 4Y4KD 4D9RD 1YN7A 4MA3A 3D3VE 3ZIMA 4DEUA 1KIQA 2J8UF 3U46A 4B9PA 2P49B 1KGWA 2VLRD 2RFXA 1P9MA 3EFFA 1BSIA 5D5MB 4P4KD 5LAXB 5IKCB 4NN6C 4AIOA 3QZNA 3LNEA 3QORA 3AACA 3QFJA 1KJ2B 3C8KB 5EN3A 1T1YB 4AM0Q 1NPJA 1QYGL 2EDMA 2R69H 5F1IB 2FR4B 4QHMA 3VDAA 3TEWA 1MEXL 3OM3B 3ZDWA 2YZ1A 3APNA 2Z4QB 4X8GA 5FW7A 2D9QB 4DO4A 5C0EB 4LHUD 3WN6A 1RCYA 3P2BA 4WW1B 2OI9C 1FPTL 1A5FL 3LHPL 4ALAC 4OJYA 2X1PA 4KH2A 4K7PY 3PABA 2UYLB 4JS7A 2D7QA 4G6MH 2UY7B 2A7BA 1BZ7B 3QJHB 4FQ2L 2UV3A 4M48L 2IG2L 3VFTA 4NZTL 3WJLA 3A4FA 4MDRA 4XNQB 2J5LB 3TPUB 2SEBA 1NDMB 5IWLA 4FULA 2VMCA 3EADA 4L3FA 5DUML 4S0HA 2VKWA 2EACA 2YC1A 4A67A 3O3BB 3BUPA 3UYRL 4XNMA 3GGWB 2YQ3A 2EUXA 1NA8A 1QFOA 5D2LB 1XIWA 3DO7B 3NIGE 5G2NA 1NUFA 2ZG1A 3BKCH 3VFMA 4DZBA 1K9TA 4WNQA 1PZ2A 1IGML 4RMBA 2NY2B 2L7UA 3FQWA 4MJ6A 4ZSOA 1LGVA 1ZS8A 4FQCH 4KKBD 2VAJA 3ZDYE 3CSYA 1BM7A 4UZUA 1AGEB 4B9CA 2I60H 1BZQK 1JNHA 4JJ5A 2ITCA 4MJIA 1IC5L 3MJ6A 3TJPA 4RGNC 5IQNA 3EH4B 4CN6A 3HIZA 1GTNA 2CDGB 3DA0A 4N2FA 4Y7MA 5C0IB 1FDLL 3MLWL 3CFTA 3HUJB 2QSVA 3PFQA 3FB5A 1YEDB 3QE5A 4HWNA 5B8CB 2XWRA 3REWA 3K1DA 1BEYL 2NNAB 3TCLA 3KPNB 5CIPH 3L54A 2BSDA 4GQRA 5TDOA 3OWEA 1WBXB 4OCNC 1XF5B 2F8IA 5LGJA 1A14H 1C12A 3AREB 3NA9H 4WFHE 3MRIB 4UT6H 1FP5A 2R0ZL 3FONA 2ZSVB 3QWRA 2XTJC 3RTQC 1J8RA 4HIXL 1UD4A 4AITA 4N2KA 5HI4C 1NAMH 4XN4A 1REIA 2LT9A 3E1F1 3WO4B 1N67A 1MXDA 3P40A 4XAWH 4F58H 1ND0A 4DCQA 4QMEA 4YSOA 3T4YA 1TJHH 1AZBA 4HUXB 2Y7SA 2QVFB 2IQ9H 4XP1H 5INDB 5KWYC 4UIKH 2CWRA 3ZTJG 4WTQA 2OZNA 3GSNL 1R3JA 5HJ3B 4UQIM 4IRSD 1LE5B 4LSRL 3T3PE 2XIIA 2XXGA 3CDYA 5HHOB 2G9KA 4KJPD 3F62A 2IOIA 2ICCA 4FQQA 4JM2B 2XFGB 1EAPB 1L3WA 2XWZA 1DJSA 3EFDH 4XCNB 5HGDA 3HG1A 3CZFA 4NO0D 4X5RA 5FYJL 2E27L 4ANUA 3E0GA 1R17A 4KJQD 2WWKO 3I84A 1FJ1B 2BXZA 3VH8B 3NZHH 2EXSA 2W9DL 3GTTA 1KYFA 4UTCA 2BNQE 2EYSB 4YHKH 3O45B 1LDSA 1PZAA 3PHOB 1SUJA 3B7RL 5FA3B 4IJ3C 4N6RA 5I19H 4J27A 3QWQB 3TN0C 4JQVC 3KPOB 4NKMB 4PJAF 5AOZA 1K3IA 3SDCB 3DVFA 3FUKA 2VZ3A 3DYOA 5IW3A 3MRDA 4DP2X 4I1PA 2V8MA 4OGZA 2OSLA 3A6BH 5E8EB 1WFOA 5AW3B 4AZUA 2VERN 3BEVB 2Y23A 5TE4L 1KNOA 3GIZH 2B20A 1PKQE 3ZR6A 2GC7C 3MNMA 1XGUB 5B3SB 1H3VA 3IKCB 1A9VA 2CPCA 4LCIH 1FG2B 2VDKB 1MFNA 2VH5L 4NERA 5E6SB 1T7WA 1EXGA 4M7LL 2NUPB 4KGLA 2KHAA 4G7YL 3QWOA 1MH5A 2HJLA 4NJ9H 2EUZA 4M7ZB 4FXKA 2YFOA 5E5MB 4XN5A 1QSFE 1KBKA 3SD2A 1BQUA 1TLMA 2EC8A 2R1WB 3KDMA 4GRWB 4WU5B 3WAJA 3LZOA 3BT2L 2X70B 4OR1A 2YR3A 1AD9B 3LKNA 3V4VL 3L3JA 1PZSA 4PP1D 1LD9A 3VXQA 3QZWG 4RWHA 1AZVA 3DK2A 2AV7A 1JD7A 1A8JH 4YHOH 4GS7C 3CZJA 4OUUB 5B1CA 1D5ZA 4PRIA 4HIJA 4A7UA 2Z7ZA 3ZE2E 4ZNCD 4JRYD 2BP8B 1J12A 4JHVA 2HT2D 1GMIA 2D7TH 4O00A 5I1LB 3FFCD 2EECA 5ESQB 2IWGA 4MZ2A 4GAJL 4QLRA 4OIIL 4TNWK 3S88H 3GJFB 3LD8C 4K23H 1KGJA 2FJGA 2YFNA 1RIHL 4KVNH 5CKGA 5I1JH 4GP8B 4KKNA 2IBZY 1NBZB 4R0LA 1VZGA 3P30L 3T6ZA 4HPOH 3M45A 5EF2A 4PREA 3RB7A 1IKOP 2X6UA 3D9AL 3OG6B 3UTPD 1CFNA 3ES6A 3PL6C 4I4WB 3GZKA 3HI1B 4N68A 1I7UA 4K7PL 1WGVA 4KZEH 4FQ1H 2BM3A 4CC4C 1M7XA 4OJEH 3BGFB 4BFIA 1MI5D 2JCCA 3PE9A 3O4LB 4H88H 4L3EB 4TRPL 2AKRB 1ITCA 3PIQA 3ZMRA 3IMBA 4XC1L 1DVXA 3V4VB 2CDEB 4OQTL 3FCTA 4QXVA 5KSAA 1AP2A 2BOBB 2BY3A 4ZAKB 3VXRB 3MBEC 4G8IB 4CC0A 2O6DA 2ZXQA 1QUNA 3CAFA 1CGSL 1XF3B 3CQPA 4WTZA 3VYOA 4K3JH 3WG7B 4KXZI 4QNPE 1QLFA 4X99B 5EMYA 4GKOA 4BK5C 2ZCKH 2ZCZA 1PEWA 1UZGA 1H3UA 4JO5A 4G80A 4LAQL 2ADGB 4QRTA 4UV4H 5T5FA 3BZEB 4YHZL 3RZCA 3EHBB 1HCZA 4G8GB 3S35X 5ALBL 3VTAA 1WUZA 5I71C 2L04A 2VMJA 1JV2B 3BD3A 2PYEE 3OAYK 3IMRA 4QRBA 1R3LB 3DK0A 4HQQL 3TBVA 2HWZH 2AJUL 1DUYB 4R90L 1TEFA 2V5SA 1IBFA 4PJ5A 4EZKA 1B9ZA 3ZDZB 3G5ZA 5GS0D 2WLKA 3ZYZA 2ROXA 1VACA 3CDZB 3GRBA 4YHLL 2W07A 2Z93B 2CH8A 2ZX7A 3PP4L 2IQAB 2O5NA 4JG1H 1CGVA 3AQYA 5ABAA 4C56A 3QW9A 4IK6A 1IBGH 4TVPL 4JO1H 3ZTJH 3TBWA 3MV9E 4LIQE 4CBPA 3CVHA 3NBNA 2IH9A 4XVSH 4GSRA 3QH3A 1E9PA 4ONFH 4OFYD 3MV11 2AI0H 1LO0H 1NANH 2VDNB 3ARFD 3L2MA 4Y5XA 3B9AA 1IM9A 3WAKA 4HOZA 5AVXB 1R47A 2CKNA 2Y7QB 3GSWB 1T4WA 2IMMA 2F53D 1LO4H 3P3SA 4W9GC 1KYUA 2YKLL 3IDNB 4QOKB 5TF0A 3REVA 3RIAK 4A1RA 4D9QE 1BF5A 2Q3AA 5M94B 4UOQA 2VR5A 3DX4A 2XWTA 1HNFA 3A4DA 1NUNB 5C97A 1FHGA 3VGAC 5MERB 4K8RD 3FAWA 2APFA 4K5MA 4YGVB 3UFIA 3D85B 4ZS6D 1DCLA 4MMXB 1T0OA 3L1GA 5C07B 1KTLA 4HU2A 5EBWA 3GLDA 1PZDA 2VNCA 3IDMB 2WXRA 1F8TL 1DANT 1HJCA 3LPWA 2Y7OA 3K6OA 2D7NA 3NFNB 4U6XA 2K4WA 4IGBD 4Y5YB 2ZXEB 4F37F 3GI9H 4XOCA 5F9JB 2PF6A 5FWRA 5AL0A 4P5KB 3WLBB 1A7RH 1HOCA 2A9NL 3BVWA 5J1AA 4ETQA 1JRHH 1E6OH 4PGDA 1PLGL 4Y0GA 4F9PA 1CWVA 3GJEA 5C0AD 5C0FB 1DEEA 3V5HA 4HV8B 4NUJB 4R7DB 2Z64C 3IU4H 2AW2A 1GKEA 1XD1A 2BZCA 4ZUVB 5FW6A 4YHYC 4P2QD 2AQRA 4DKEH 3OBAA 3HEIB 4F33A 3W11C 3N42F 4PJIA 2D0GA 2XXFA 3RBGA 1FYTE 4HMDA 3ARXA 2V3FA 5EFIB 3RWEA 4XO9A 5IREA 5D70H 1ZLSH 5DFAA 1TFPA 5DHYA 4GW5A 4UT7H 1KJ3L 2BXYA 3U7AA 1G84A 4G43A 4LLQB 1HHJA 2V17L 2QDWA 3SD5A 4U1KA 1IBDA 3FHAA 3VG9B 3KZ8A 2NT0A 4NQDB 4R7VA 3BZFA 4HK3J 4QRSA 1C5BH 2HFGL 3HUJE 4W93A 3ZL4H 4B9ZA 4ZX6A 5E6IB 4R97B 2HVKA 4HD5A 5GGVL 1G94A 1P9MC 2ZUXA 5GZND 3E38A 4EIUA 1PLAA 2J6EH 4YE4H 4PBXA 3O41B 4JRXA 1XCXA 3W2DL 2V9TA 2KL6A 1SY6H 2YOCA 3HLAA 4IIQA 2CUIA 1BX2A 3QORC 3HOGA 2J1YA 3QO0A 3ETSA 1JPTL 4JQIL 4ZUTB 3SGJA 1JDDA 2HFEB 3MRMA 1OM3H 2H7WA 4JDTL 3IDIA 3C8HA 3KVPA 3JVFC 4UYPA 4JM4L 4Y4FA 3HG2A 1SHSA 2A74A 1BCIA 1N64H 2FVNA 2VQUA 4JZNB 1ZLDA 4GO8A 4UZSA 4G11A 2ESVB 3VXMD 2HLFC 3QQDA 3GBMH 4QWWC 4K9JA 4ZTEA 5T1KB 1V05A 3QCTL 3GSXB 7FABH 2ISDA 4NM8H 4O51B 1DN0A 1ERNA 2FYYB 3OXSB 4YDLC 4X7CC 5HYSG 4Z23A 1GGCH 4CJ1A 3MR9B 1Q90A 3WJLC 1RIUH 2CSPA 2W81C 2R1XB 4GXVH 4NPYA 5EIIB 3ORJA 4NQCD 5IWLC 4EN3B 1S9WA 5HHOE 1VGKA 1HYSC 1Q1PA 3T0EA 1GZPA 3VAEA 1RUPH 3OKDA 1WEJL 4FHJA 3DVNA 1XIWC 4Q6YA 3MTRA 4Z7VF 1U8HB 4TUOB 4NWUL 3UTQB 3F84A 1IT9H 4QRPA 4HKXB 4LCUB 4XPHH 4LLUB 5TE7L 4YWGL 2DWYA 1CCZA 5DWPA 4CNIB 4JGJA 1BMWA 4NZUH 5F71A 4ZUSA 4CSZA 1U95A 1PY0A 5E99H 5I6KA 1N6QH 4DKFL 2X4NA 3L3GA 1IL1A 2V4LA 3BLBA 3N85L 4WFEE 2Q8BH 4H5SA 3B3BA 4QHUB 4QXUH 4BFNA 3HMXH 1RSYA 4OF6A 5KVDH 2Y0SA 3MACL 4K5LA 2J3SA 4GG6B 1N7ML 2BVOA 3O2VH 3C5XA 4PGEA 4JNXA 1PQZA 1NL0L 4GRMA 1E2ZA 1MFAL 1BVKA 1OTUC 4UTBH 5CMAA 4AQ1B 5IFJA 4KPHL 4E41A 3GZQA 1KBVA 3C5ZB 3OAZH 1CGXA 1I9RL 5TDPA 5CLTA 1HL8A 5IHZA 3BGMA 5J7CC 3ZGIA 4MSWB 4ELKB 2OW7A 3UCQA 3TNMA 4EJ1C 2FBRA 4GB9A 1MSPA 4PJHF 1GW6A 1CTNA 3BKJL 2BNRB 4NO5A 5CCJA 4D3CH 4RFNC 2IPUG 5JXAH 2AXGB 3I9PA 3BH4A 2BH0A 4L4TA 1UHVA 2FJSA 2V7HB 1AHMA 2VZOA 1JGDA 3TGXA 5MENA 1KJVA 2TRHA 4J28A 1ZXKA 1U4FA 2ALWA 1VZIA 3S8GB 4FLRA 3WYRA 4HGWA 3Q9PA 2K78A 4DUWA 2UVFA 3WEXA 2N0MA 5DUBA 1FCCA 3FT2B 4GNKB 3QCVL 5DCCA 5DVLA 1OPOA 4V1DB 2BSRB 3OGOE 4ELMF 5BQ7B 5LN4A 2RIKA 1OE3A 3OKKB 4GRLB 5KVFL 1G9NL 5IM7B 1W0WB 3QAZB 1T5XB 1S7TB 3MNDA 1KBGL 2ZP0T 3DOHA 3SDXB 2Q2EB 4P5TB 4A37A 3NK3A 4EXPX 3B9KA 4UU9A 1SLUA 4JFSA 2FWOA 4WCYH 4DH2A 5LCVL 3ILPA 4X9HA 1JZ2A 4IOSD 2DYPA 1HDMA 1NLBH 4U6YA 3VRLE 5GGTL 1LNUA 2R0WL 2XXMB 3NZSA 4I85A 1FCGA 4LGRB 5LB1A 2P80A 3KW7A 4DK6A 3UTSE 4X50A 4NOFA 5CSBA 1WV7T 4XNYH 4Q9QL 3SQBB 3NN8A 4XHJC 3P9MA 5E2TH 2AJSL 3GYRA 2AK4B 2VXUL 3OMNB 3V0AC 2W80C 1I7ZA 1Y18A 4L1SA 4E9LA 5FB8B 1BM3H 1U93A 1Z6JT 3B3IB 4LPTA 4JFFB 1OP3H 1S7VA 4TYUA 4H20L 4WDIA 1E90A 5DRZB 4G9FD 4OAWB 1FFTB 2YQ2A 4N3TA 4TV3A 2ZX6A 1DEDA 3EGDB 2F18A 3O4LE 3DI2B 1I1CA 3TZVB 2R7EA 3CFCL 3V0FA 3FYIB 3FUJA 3ARWA 4RQQB 3WFBH 5B3JE 1UWGH 2XPGB 3B34A 2ED8A 4EBQH 3MCLL 1PG7L 2C4XA 2HJKA 3VXRE 5CBAB 4KKAD 1I8KA 1RIVH 2EDEA 1IVLA 1QFWH 1XQ4A 4FXKC 4IRZH 1X9UA 2M2DA 5C0BD 3WFDH 4QY8B 3ZMNA 2E47A 2IEPA 1OP9A 3BWUC 1NAMA 2EEAA 1IEAA 5JOPD 1KPVA 4PJEB 2DLFH 3D39A 3GB7B 4XN1A 2KBGA 4G83A 2NW2A 3G5XB 5D71H 1J9RA 5BO0D 4JANA 4Y16D 5KJ4A 1ROWA 5HHPA 1WTGT 4WWKA 1TFHA 4QAMB 5C0DA 3QJZA 4ZQKA 1A6UH 3IU3B 3VD3A 1UB6B 1MCSA 1XCWA 4F7TA 3BXNA 4KK9D 1AANA 3PNWA 1T2QH 4WKZA 3M17A 2J4WL 2QQNH 1T1XB 3KPSD 8CGTA 2FIKA 5JHDA 4JDVA 3FO2B 3ZDZE 1E5YA 3DX6A 3S37L 2WWMD 3EH3B 2DQHL 4LB8A 5ID0A 2HSIA 2ZIDA 5DFWH 1F4YH 4R0LC 3CCHB 4JPVH 1OWWA 3HZYB 5EU3B 1RUQL 2C8NA 2HFFB 5DC0A 4UNVA 3LDBB 5F7UA 1FFOA 3FUHA 5DMJB 5FCUL 3UPCA 3HKZA 1NGWB 4KFMA 1RMFH 2Q7YA 3SJVB 1NPUA 4FQHB 3KPQB 3V9EA 5BVPL 4HS6A 4XPTL 3AMKA 1F0LA 1U8KA 3NP3A 2E9BA 5CLYA 3O4OB 2V37A 3CZNA 1MHEB 1HIMH 1MCBA 3P0YL 2V33A 4L37B 2Z8RA 2EKJA 3R4RA 3T3PF 2X9ZA 1QG3A 1IFHH 2WIMA 3TNNB 4XHQA 1JK9B 3WLWC 3P3TA 3DX0A 3RURA 4EI6A 5KSAC 2BDNH 2GIXA 4QOKE 2AFNA 4ORGB 4ODUB 2NNCA 3FOLA 3P69A 4ILDA 1FF5A 3D1MC 3F05A 3N1QC 1RKRA 1UA6H 2WYHA 2CLZA 2WIIB 2KMWA 3GLEA 32C2A 4HWBH 4TQPA 2AQQA 4R84A 1F6AA 1JYWA 5ILTH 2I9TA 1NJ9B 2EVJA 5C07E 3RZCC 1D6VH 1DQKA 3OAWA 4NSKB 4TLTA 1TVBB 4R2GC 1FFPA 2XPYA 4M00A 3MRBA 1XMWA 5IMLA 4J2XA 4Y8AA 4JM0A 1GC1H 1JHTB 3BP5B 1D5BB 2JQMA 5F8RC 5CGYC 1XB3A 4NNYB 3NDYE 4J6IA 4Q0XH 4AGQA 3QJQB 3ZO0A 3A6OA 4TVPE 5KBNC 4RVBA 4NZ8A 4H7VA 2I24N 1JZFA 1YPZA 1EZVY 2WO4A 3PAZA 5JHLA 1Z3GL 3D0VA 3VFOA 3LQMA 1QFHA 1HEZA 1NCTA 4XBEL 1A3LH 5CSGA 4MQTB 2A5UA 2C9SA 3EF4A 2WYZA 2FO4A 3LXCA 3KPRB 3K2IA 5SWQA 2Y5QA 3HAEA 4ZPVA 2BP0B 4NWTH 2BJML 2DIAA 5EU6B 5FUCC 4LVOB 2RQEA 4XNXH 3QUKB 1R4XA 4OKDA 3O6LH 3LNFA 1TKWA 4FC3E 5A3IC 1Z7JA 2VAAA 2D3VA 1KUMA 4PIBA 4Y5XC 4XN2A 5IW6B 4D7PA 4X6CE 4OJFH 2WXHA 3IJSA 4W81A 2XFXB 3BUIA 4NQDE 3DX7B 4AGOA 5HYQB 3MO1B 4XCYB 3RA7H 1JBJA 2BS9A 4DK5A 1T1ZA 2ICEA 4OZIA 4CW1A 1E0OB 5DO2D 4J4PA 2DI7A 5KN5A 1KBPA 1F45A 2FYVA 1XVSA 5F21B 1U8JA 3NSXA 1KBBA 3ZE2F 2NY4B 4TSAL 3SEPA 1U42A 5C08E 3U0PA 5KYXA 2ZYRA 3S4SG 2VITB 3VQLA 1UOWA 3WGVB 4R7LA 4DP0X 1LILA 1LLAA 2H32H 2WUBL 5EU7C 3L4TA 4CGTA 5I66A 2EYTB 2RTTA 1RZKC 5DWUL 4Z7IA 4FE9A 2OTUA 3D0LA 5DHVB 3FT0A 1GS6X 4AQEB 1QSEA 2ESVE 2VRAA 4FP8H 3SKUD 4PRBB 1MHPH 1G0XA 2IADB 4APXB 1R5IA 4HDIA 4TNFA 3MOBH 4FG0A 1XEUA 3FB8A 2Y7LA 1UJTA 5DJYB 3S34H 4BXSV 3EO1B 3OKLA 1WWCA 3FYEB 4OZHB 3VSVA 1FRGH 1ORSB 2ZOTA 1VJSA 3QIUD 3C08H 5JW4R 4TLSA 3MXVL 4WSGA 1OAJA 1HHGB 4HEPA 2DV6A 4J8RB 4K7FA 5JQ6L 4F9PC 4APQD 1A21A 3GI8L 3QS3A 1TSHA 2DWEA 2P5EB 3O9WA 3EYQC 4P59H 5BZXA 4QHPA 2X4QB 3AXLA 2SODB 2XOTA 2YLKA 5GJSL 3NESA 1I7RB 2FUQA 2CA4A 4OTXL 3TFKD 3ECBB 3FT3A 4ZX4A 4N9GB 4PB0L 4FNRA 1KWKA 2AQ2A 3NFSH 2EIZB 3DJTA 1E6JH 3FW6A 3IEAA 4Y19A 3RIKA 5F9DC 3S3PA 5DYOA 2JKSA 2KPNA 2CRYA 4FG4A 1HE8A 5JLZB 3NIFB 1E5ZA 4JO8A 3KDPB 4O5LH 3W39A 2JELL 4O2FA 2EDLA 3FQRB 3FRUA 2DI8A 1A9EA 4IIQC 1ET5A 1RJYA 4U1LA 5B38B 1EEZB 4XMVA 4ZW6A 1GSKA 3L8QA 3SGJC 1F4WL 3FB6B 2M8XA 3KAAA 4WO4D 4Y4FC 2BNRE 1Z5LA 4M1CD 1TJMA 2A74C 1DR9A 5K9KB 4NT6B 1NUDA 4NQXB 3QQ3A 1OHZA 3LN4B 2VSDA 3CE1A 3MNWA 1INDH 4QCIB 1B0GB 2GCYB 3LZLA 4YL9A 2O5YH 4ZUUB 4XPFL 3UMNA 1U8OA 3BP6B 1P7HL 1HSAB 2X4OA 3IRPX 5BUGA 3L95A 3OKOB 3T0EC 4DGVH 3D33A 2Z7YA 1KELH 3BPLB 4V1DE 4X4XB 5DJZB 2FNBA 4HOXA 2Z0UA 4L8BB 1NQBA 1KB5A 2YMTA 4WHYG 4R3SA 5C6WH 3H7LA 1IAMA 3HE6B 1YUHB 1AQDA 2EE9A 3C6LA 3WFCL 2GSGA 3LJ3A 3ZSSA 4XR8C 3VTMA 1DQQB 2Z91A 5J89A 4JN1H 2WB1A 1AFVH 4ZZKA 3FB7A 3D06A 2H4EA 4BSWB 2ZJSL 4FTVB 2MNWA 1T66C 2AJVL 4KKQA 1PCXA 3SGDH 2A6IA 2OULB 3HB3D 3O11A 1I1RA 3DGGA 5DZAA 3UZVB 5E1AB 2X05A 5BVJB 3KG5A 3QC6X 5E8PA 3QULA 4UBDD 2FX9L 5CUSH 5IQLA 3ULSA 4HGKC 1J0HA 1UATA 3B5TA 4BRVA 2XYBA 2Y2YA 3O2WL 1L0XA 4X4KA 1HSBA 2HG5A 2YPVA 3QSKB 3ZHFA 2AS5M 3BVDB 1BQHG 1LO2H 3UEZA 2OMTA 5EO0A 2A4ZA 4TQIA 4PD4K 3A6CH 2BMKB 4NZFA 5DC9B 4A6YH 4DQOH 2A0LC 4FJ6A 1CD1B 2JKNA 1NBVH 3BIAX 3C60B 4MBRA 1P7QD 4L3CB 4FADA 4OY9A 4X9FA 3MLZL 1SY6A 2OKMA 2M1KA 1S3KH 5KVFE 3QS2A 4UAOB 5JPNB 3TO4D 1VKXA 1CLVA 4D0CA 3RWJB 4FI8A 2R4RL 1RAMA 3IDYC 1YYLL 4FRWA 2FSDA 4J1UA 4P48A 3SYPA 2Y1VA 5CINL 4PJEE 1M05A 5F7EL 4HA1A 4Q6KA 5AOKA 1C7SA 1M1SA 4XVUC 4NGHL 4JO3L 1WYJA 1OZUA 3ROOB 3EOYG 5C0CD 2ENSA 3MYJB 4LBAA 5CD3B 2NY7H 3B9KC 3T1WA 3Q44A 3IDXH 2GG1A 2AEQH 3CFNA 2WLIA 5KYYA 2N59A 3THMH 3PQYB 3HCVA 2HTKD 3HI5H 5IY5B 1R5VA 3ZHDA 1TCRA 3UOAB 5C2UB 2WVSA 35C8L 1RUKH 3GMPA 2OYPA 5KVMC