3JYBA

Crystal structure of the rets periplasmic domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
138
structure length
138
Chain Sequence
QNWRLLRDESAQLRIADVLQRKEQFRPLAKRSFIFPASPQAVWLQVQLPAQKVPSWLWIFAPRVQYLDYYLVQDGQLVRDQHTGESRPFQERPLPSRSYLFSLPVDGKPMTLYVRMTSNHPLMAWFDQIDEAGLVGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein
publication title Crystal structure and oligomeric state of the RetS signaling kinase sensory domain.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 30
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07696 7TMR-DISMED2 7TMR-DISM extracellular 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2380 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3jybA00
2XBZA 3JYBA
chains in the Genus database with same CATH superfamily
3ZKMD 1A8JH 2CJTA 3TV3L 4P48A 5EG6C 1T1WA 3UCQA 3V5HB 5I1IH 5KTEH 4O02A 4P3DA 3F64A 3REWA 2DMHA 4DSYA 5E99L 2ZP8A 2VDQB 3AM8C 4OZIE 5I1LA 4X5RA 1B9ZA 1DE4A 1UWEH 4WWKC 1WYJA 2VLRA 4GW4A 5GPRA 4P5KA 5CD3B 1RZJC 1F4AA 1EHLL 2HTLD 3IDMA 5I76B 5D8JL 1YVLA 1PG7W 2BH0A 1OARL 4G9DB 5AW7B 4EMZA 4FMFA 3HC2A 4C56D 1T03H 1RZJL 1T1WB 2VDKB 1P84K 4KPHL 4O02B 2GTWA 4F58L 1KZQA 5GIRB 2AEQH 4FEMA 5I1LB 3G5ZA 2R2EB 2ZOWA 3KHQA 2QVMA 3B2UD 5DJDB 5AWNH 1DE4B 3P0VH 1QO3B 1N2RB 1B9KA 2CRMA 1GYAA 5D5MF 3L3IB 1SEBA 1WCBB 3O2WH 3IDMB 3HG5A 4KXDA 3X14A 3CZSA 4HULB 3N43F 1E4XI 1ZHKB 1CF8H 2BJMH 2DQCL 1V7ML 4PGCA 4J6RL 2FT7A 4DKTA 3OR7A 1XGUA 3KLDA 4IU3B 1F56A 1WT5A 2ICEA 2VDQH 3EBAA 3UP6A 5C9JB 1P7QA 3PJSB 3UG3A 3QISA 4EDXA 3DIDA 4XP6L 2W91A 1PW3A 3MKKA 1E4HA 1NCCL 3MUGA 5IQ7L 4IBYA 1A2YB 1LM8V 3GDBA 4HD9A 2FD6H 3BT2H 3HS0A 4WI0B 5TQ2H 4PJ9C 2B1HH 2D31A 2YD3A 4WCYH 5DEZA 2CO1A 1F58H 1NZRA 5DLMH 4ZPTA 3QIWD 1EDYA 4P9HC 4OT1L 5DO2D 3RVVD 2YK1L 1F41A 2Q2EB 4IRJD 2DQTL 4PJDE 5C8JB 4X6EA 3VFOB 1XGRB 4JDTH 4JFDB 1EUTA 3OR6B 4B9YA 2Y6TE 3N40F 1P7QB 2BVQB 2K8QA 4LAQL 4EDXB 4BWWA 5CJ5A 4AEIL 4RGNE 4IBZA 4ZS7H 2FGWH 4YHNB 3OKEA 5FHAL 4AQAA 5IM7A 4FAAB 3D25A 4DO6A 1GR7A 1DLFL 4N2OA 1ZAGA 3U9PH 5HJDA 1IT9H 2R69H 2D31B 2JIXB 4H26A 2N7SA 4K8RH 3WFHB 4ZPTB 3WY4A 1X5XA 1Z9SA 2MJWA 2IAMA 3K6OA 3KLAA 4XN1A 5CLZA 2X7LA 4OAWA 1NFDF 2GW5A 4X6EB 5IVOA 1SXCA 4DFIA 1YEKL 2X89D 5D70L 5CJBA 4YXLH 4AE1A 5I75C 3F6IA 5JHDE 4UB0L 1NBZA 4GB9A 5DS8B 5E8OA 1EQWA 3OHXC 5A43C 4ZDHB 3OPZH 1P5UB 1T4WA 4HDIB 3ZN6A 1NBVL 3Q44A 3OKEB 3V9CA 4BQ8A 3FO9A 5I6LA 1IEBB 5BV7L 1EJ8A 1KJ2B 4ZUVB 2C26A 1QFWL 2AJVH 1WHPA 3BPOC 3CVHH 4NZUL 5E08L 3S34H 3P77B 2ZSWA 4P2QB 2UUDK 2ZOOA 2R2BA 2GIMA 1NGYB 3T6XA 1KTRL 1KXTA 3IN0A 5LBSH 1QLRB 2X7LB 4BA0A 3MRNB 3N1MC 3WTTA 1UT1A 2JLLA 4EI5C 5D2NE 2J88H 1MVFA 4LGPB 5E8OB 1D9KC 2P5EB 3F12A 1UWEL 3DOSB 1ITBB 3INUH 4LLMA 3QXDA 5I1AA 4Q4IA 4WJKB 2K0RA 5EZLA 4Z3TA 2IPUG 2A6KB 4JQIA 4KVPA 3SQBA 4F7PB 3O8XA 2ZSWB 3V6FA 4HT1H 3P2TA 2R2BB 3R0MA 1UD3A 2IWKA 4NHUB 5KSUA 4ZK8A 8FABA 1A4KB 1T03L 3POHA 1G7HB 4HALA 4WW1A 4AT6B 4I3GA 3TVMD 3RA7H 5I2IA 4I85A 5C7ZA 2Z31D 5HYJE 2VXQA 3RTQC 3W11C 1KPVA 4LLQA 1I7UA 4YSUA 1A7NH 1UJ3B 3ZE2F 1KJ2H 2F74B 4YSQA 2UYLB 5AWNL 1TLKA 4XWOC 3P0VL 1WFJA 3K0YA 4G42B 5I1AB 3B4NA 1M7XA 4A7VA 4HJ0D 4G43A 4YDZA 4DW2H 4XB7A 2H2SC 1HXMA 4QT5A 3O2WL 3QA3A 4Y4HB 2XXGA 4EVNA 1CF8L 2BJML 4U6VH 1GCFA 4HA1A 4W9KC 4JE0A 3VWJA 1CI5A 1ZPUA 2YARA 5DXWA 2Z7WA 1CFSA 4NBXB 1C7SA 4N68A 3CZLA 2VDQL 3QEUA 4P2OD 2GY5A 3POCA 1F4HA 4XPBH 4YBLB 2Q8AH 4PHZA 1NUNB 4DK3A 3CU7A 1IILE 2FD6L 4I77H 2B59B 4WJG3 1N5AA 1VZGA 3BT2L 1B6DA 2AZUA 3VVVA 1AQKH 5J57B 2C34A 4UQ3B 5EUOF 5K33A 5TQ2L 3UL4A 5JW4R 3FCTB 2VJ0A 3SKJH 1AKPA 1HXMB 2B1HL 2P24B 1G9MH 4WCYL 5DLML 2AV1A 1F58L 2VH5H 5FO8A 4QRAA 1CICA 1PD0A 1FJ1A 5ENWA 5GZND 3RKPA 3BESR 4JDTL 4BK5A 3AZUA 4XN5A 1KJVA 2C5DC 3UTSA 2XPYA 4QOKE 1B6UA 1EEUA 2WTOA 2BCKA 2B9AA 3RJQB 1ZT4B 4K8RC 1MW2A 5SWZA 2FGWL 4B7LA 4IBLT 1ORSA 2BSSA 4G8EB 4NQEB 2K3HA 2D9QB 2ZF9A 4GINA 5DS2A 1RJZB 3TM6A 3EOTH 1FFQA 1FFOB 1NCAH 2VN5A 3I2CH 5C07B 1IT9L 3IDIB 4K8RL 1R75A 3Q1SL 4LSSH 2AC0A 5L4IA 1CYWA 4QDGA 1S9VA 1T20B 2WWKO 2XIIA 2B5IB 4JO2H 1CFNB 4BQBA 4YXLL 5MHSE 4PREA 3WFEH 2BCKB 3D18A 1KNOB 3QZBA 4FJZA 3OPZL 4U1MB 5CHNA 5B1CA 5BVPH 1MY7A 2HVJA 3NCYS 3WUZA 4PGBB 3GM8A 2FH8A 3FQNA 3RVUD 2WKGA 3GJEB 1KGIA 4N22A 1RIHH 1KTDA 2UWEE 2WQUA 3FPYA 1AHMA 3UCRA 1TQBB 5CNHA 1R1CA 1HESA 3QFDA 3S34L 4Z76B 3VWKA 1SHXA 3GSQB 2L7JA 3BE1H 4PJ8A 4GUPB 4IJ3C 5LBSL 4LCVA 2UV3A 2AXGA 2VLKE 5B4MD 5HHOD 4K3HA 2GUYA 2B39A 1WWBX 1GZPA 1AD0B 2J88L 1MAMH 2VMCA 5B38A 3DO4A 1WITA 2J55A 2MNJB 2VZTA 4IIQB 1OD7A 1TUPA 3FQUA 3OGCB 2XQBH 3BAIA 3N44B 4UMGA 1PDKA 2OMWA 5CP3H 3VWKB 2ZG3A 4XPAH 1E8YA 1WBZA 2YAOA 4PJ8B 3MBEC 5TE4H 3WKMH 4K94H 1KIUB 4F7CB 3RA7L 2UXTA 2AXGB 3CDGA 4M61A 4RDQF 5IP4A 3NEOA 2VE6A 4G8GD 4UV4H 2V2WA 1D7CA 1A7NL 1KJ2L 1J1XH 1HH6A 4MQTB 3T65B 5JOEA 3O0LA 4WFED 3FTGB 3LVEA 1MH5A 5DUMH 3UZQA 4DW2L 4RDQG 2FBRA 1ZWIA 3MRJA 3NIGE 4PG2C 3P4OB 2WQ8A 1HZKA 3I6KB 5JXAH 1AD9A 5BW7A 3QORC 1ZGLM 4U6VL 4AGLA 2IADA 1GZHA 3PAZA 1BZDA 3VXMD 4OH2A 3SCMA 2Q2LA 2VE6B 4XPBL 1G9MC 2DLTA 5JHLA 2Q8AL 5KANI 5K9QG 1CXIA 2GABA 2FO4B 3WXVH 1I1AC 1IVLA 4I77L 3RB7A 1IAKA 2Y5QA 2R15A 4C54A 1AQKL 2GPZA 4M9OA 1GZQB 1X5JA 3FSAA 4R8WH 1MH5B 4Z5RA 3SKJL 2YUZA 1WBYA 5CZXD 1ZWIB 5I71C 1G9ML 1SM3H 1TZHA 1UJ3C 3MNDA 2D7QA 2VH5L 3BVNA 3OX8B 4QRPA 1S4IA 4MJ5B 4X2UA 1ZE3H 4CDHA 2W81C 1FZKB 5EU7C 2QQKH 1BWMA 3P40A 2H6UA 3QS3A 3CXHK 3QZWA 1MNUH 4UTAH 1PCSA 2BY3A 3EO1A 4P4KA 3J07A 1IB5A 4KK9C 2MH4A 5GS1A 4QXWA 1DQQA 1AO7A 1N8OE 3EOTL 1M1XA 1NCAL 3I2CL 4Z5RB 4ZW5A 3ARFA 1M71A 2V7HA 4ZFFA 2VN7A 4MJIE 4UINH 3MRHB 1TZHB 4LSSL 4RSYA 3SYOA 2WTRB 4AIEA 4LCIH 4NN7C 4P3WA 4YHIA 4EPSA 2CIKB 1ECZA 1OK0A 1Q8MA 3MV9B 4QRPB 4JO2L 5J6HA 2ZKMX 1R47A 4TKWA 1OW0A 5E6ID 3CFUA 5IW1A 4Z9KB 2BNQE 2MQ3A 2WKOA 3AGWA 3WFEL 1ZLUK 1G4RA 3DV6A 5BVPL 1I85C 4ALAH 1BFSA 3JWNE 3OMZA 4OZHE 1HFUA 4ZUWA 5GS1B 1XAKA 1M9SA 1RIHL 2KYIA 4PWGA 4HLEA 4R26H 5L7XH 1YG9A 5GRJH 2HMIC 4XNAA 3IU3A 2GJ6A 3VM5A 3BE1L 5DVLA 2F58H 4JANA 4XX1E 4GFXA 3VI3F 4DJMA 1XTMA 1HL5A 1C1EL 1KBPA 3DMMA 1IE4A 4A6YA 1QOKA 1ETZA 1MAML 3B3BA 4HGMA 4J4PD 5F88A 3DV6B 3TEWA 4Y1SA 1F1DA 3HZVB 2NMSA 2Q3XA 4U7KA 4BKLA 1J5HA 3OLGA 4I5BA 4TULH 4CADA 3L3HA 4K94C 3KZ8A 5HYSG 2XQBL 2AQ3A 4ZQTA 2VLME 1JTOA 4E41A 4CU6A 3Q2VA 4XPAL 1LL1A 4WW2B 4WFGE 5FFLA 1RK7A 3RVTC 2VLRE 5DD6A 1AP2A 2BS9A 3HZYB 5CILH 5GRZA 4K94L 2OSWA 4PJGF 2BNUA 5IB2A 3HHRB 4A6YB 1A8ZA 2J5WA 1ETZB 4BSVA 4GPVA 4KKAC 1GGUA 1J1XL 1X6NA 3WLWC 1RZIB 2EO9A 2OTUB 3AWEA 4I5BB 5DUML 3TPUB 2O5NA 4Y16C 4E41B 4R84A 4OCMC 4I87A 3TTSA 2WW8A 3PWPB 1AP2B 2FWSA 2K7PA 4ELME 1KDJA 4PRPB 5T5FA 5J3HD 3QK0A 4NLAA 1BX2A 2WXFA 1Y1DA 2X88A 3T3PE 4N3UA 1HOCB 1AAJA 1O0VA 1HOEA 3FQTB 2JMRA 1WZLA 1ZE3C 1IAIH 5HP5A 1SNRA 1UURA 3JBG7 4R8WL 3TASA 3ULSA 3FSWA 1SM3L 1S2EA 1VFOA 5GRYA 5ESQA 4DQAA 4FNLH 4A2GA 3JTTA 3NIDB 1D5BB 5E7FA 2ED7A 5JDSB 1ACCA 4MVBC 2QQKL 1JHLH 5SX5H 3GMMA 3GGWA 3Q9QA 1NDMA 3U82B 4ZXBA 1MNUL 3BSZH 2QADD 3BEWA 4UTAL 3PQYD 3MRIA 2V2XA 3SY0A 2E9WA 2X2IA 4CVZA 3L5JA 2XI9A 4FP8H 3UEZA 5B3SB 3ETBF 3BGFB 3HPJB 3T71A 5ESQB 4ALAC 3RGVA 3WE6B 4PGEB 2XWZA 4IK7A 3FK3A 1FL3A 1QFWM 1MVUA 2WB1A 3GGWB 4WJ5A 2V2TA 1OEZW 2D3JA 1X7QA 2WMPB 3BEWB 3QT2A 1AXIB 1OP9A 5JO5B 5KN5A 1A4JA 3QDHA 4CVUA 3L1GA 2AEPH 3VXRD 4JFSA 4R26L 1UM5H 2BDNH 3X12A 3WIAA 5GRJL 1ZT1B 3B2PA 1CXFA 4KMLB 4FQ1H 4U6HB 4MA7H 1GS8A 2BSTA 3OM3B 4MNQE 4D9RE 2F58L 4EUPG 4GAJH 1IBBA 2ITDA 4UF7C 3STLA 2KS0A 5I8CA 2ADGA 2WLIB 1SJMA 2VUKA 4WJ5B 2XVLA 4HPYH 1F86A 2BHZA 5GGVY 4L3FA 2E59A 4J8QA 4GRWE 1SZNA 2CQVA 1K4CB 4TULL 4U2YA 3KPRA 3O3EA 2EACA 3T0EE 4BH8B 4X8CA 1GW6A 2PWFA 3X12B 5E4AA 5D7EA 1J8KA 1M6UA 3GPEA 1IGIH 2AK1H 3S5LB 5E9AA 3V2AR 4DP4X 2WXOA 5G4NA 3CZJA 3GIVA 2J72A 4XPGH 3DARA 3DIFA 2ADGB 1JZEA 4GFTB 2NNFA 2RH0A 3QDMB 4AUUA 2YD4A 1URIA 1PJ9A 5EOQH 1M6OA 1T7VA 4PLJC 1YUHA 5F89B 2EUXA 3TN0A 2CMRH 4JHAH 4GT0A 2VJXA 5GZOA 2J8UF 3FT0A 4M8VA 3O3EB 3WY3A 1FVDB 3TBSA 1XIWC 5GSRB 5E6ZA 1U93A 1HI6A 1WAPA 3ES6A 2VERN 3T3ME 5L4MA 4E9YA 3GJFA 4TUOB 4J23A 3KLQA 3DV4B 5HHNA 1ZDQA 1U8IB 3MNMA 3WXWH 1QMUA 1J5OH 1WH0A 2B3IA 2O5YH 2QDWA 5IW6A 4LB8A 3E3QE 3TFKD 3TEZA 4GKSB 3MGAA 5CGYC 2P7TA 1YUHB 3TN0B 4Q89A 1G7MB 4NOFA 1HXYA 4U4IA 4G2AA 3D6GA 4MB1A 1HZLA 3ZHKA 1S5HB 3E6HA 1JPFB 4FZ8H 3MV8A 1AMXA 5J4MA 4JDEB 3QQ3B 4AKPA 4FNLL 5AVSB 4TRPH 3B6SB 4KROD 4ZW8A 1N18A 4PRHA 1EFXD 1JHLL 2CLZB 5I1DB 1JZHA 3CLEH 3L9YA 2Y9RT 2ZUXA 4PYHA 1EZSA 2V37A 3KH3A 2C9AA 1DBBH 2OZ4A 5IVZA 1R5IA 4KOBA 4M6OH 3N1PC 4I0PD 2UXFA 3UTSE 4FP8L 3FN3A 2C3WA 1HXYB 4HXBH 4BINA 2Z8VC 3A21A 3MLRH 3QRLA 1PLCA 1JYVA 5SWZE 1OQXA 2WIIB 4LKCB 3HE7C 1U3HA 4Y19D 4NO2A 1BAFL 2VWEE 2YPKA 5KAQF 2P49B 3WSQH 3SYAA 2VZSA 3BW9A 3CX5J 5I6XB 1J0HA 1KG0B 5DVPA 1QWHA 3U0TB 1XWVA 2CR0A 2JB6B 1KGCE 2D0GA 4XPTH 3BFWA 3D06A 3HVNA 5B7EA 5KAQG 1JF6A 4AXWA 1C12B 2AEPL 4Y5VA 4FFWC 1CK0H 1T7XA 1UA3A 4LPUA 2COQA 5DRWA 4TLSA 4JVPA 4L48A 1UM5L 2BDNL 3MNWB 3LS5H 3BD3A 5GGVL 1P5VA 5I19H 4GJTB 1FSKB 1RUKH 4NO5A 4FQ1L 4MA7L 3TONA 3GSVA 2UY6B 5A2JH 3FAWA 2VRAA 4XCFH 1E27B 1IX2A 4GAJL 4MS6A 4XC1H 2YZ8A 2CKNA 5I8OH 5IT2H 3DVGB 3BGFC 3LRHA 4GYBA 1CWVA 4JFYB 4HPYL 5IKCB 1W0VA 3RY4A 1Q94A 2GK0B 3V5KA 3D0VA 1AG6A 4M7KH 3TL5A 5C0EA 4AXWB 4LHUG 1QI5A 3MRCB 4FFYA 4LXFA 3QUZA 4ATTA 3DPBA 3MRRB 3UZVB 2EH8H 2H3XC 1YYLH 4JVUA 5EDSA 1F02I 4NO5B 4EN3A 3IJEA 1QG3A 2AK1L 4PJHA 5I26A 3FO0H 1U9KA 4XCYA 3RFZB 1KEGH 5DJAA 3ZQXA 4GW5B 4DPBX 5I1CL 4N28A 1TSRA 2C7UB 2LU4A 3HAEG 4XPGL 1I53A 4DP9X 5EOQL 4PTUA 1Q94B 1T7WA 2WYTA 3V95A 1MCSA 4JHAL 5FO7A 1JD7A 4AGQA 3CBKB 4HC1H 4JZNA 1ZA6B 4L4VE 4UUJA 3SE9H 1M7DB 3OZ9H 3FQ2A 4X4XB 4KI5E 5F6IB 2ARJA 2HX7A 3EOAA 1YEIH 5K1NA 4WO4A 1D5IH 1SOQA 3EGSA 1CDHA 4L1BA 5I6MA 5T1LB 1MOEA 3GI8H 4XCYB 3WXWL 1J5OL 1VPOH 5EULV 5CN3A 5DK0A 1RZ8B 2VDPH 2O5YL 1EUUA 1EJFA 4MD0B 3TBVB 2AP2A 4PTUB 5AG8A 3OJMB 4LSRL 1I9EA 2XG5A 3WIFB 4PVBA 5D1QB 4UUJB 5HYIA 1QUNB 4K4KA 5MP6H 3LRKA 4FZ8L 3UTOA 1KPRB 4NQDD 3QIUC 2FH6A 5BS0B 4M5YH 4TRPL 4PH8A 4R0LA 2BFVH 4Z7WF 3IMSA 4OD2B 5E8PA 4K2UH 3UIYA 3MRMA 3P3YA 3CLEL 3CG8A 3CK0H 3EIFA 3AAZA 5FGCE 3UO1H 1MFNA 5F7KC 3AWFA 2VMJA 1DBBL 3PHSA 1UGKA 5JHBA 1X5ZA 4HSCX 3PREA 5F7BA 4OZ4B 1G7LA 2CDFB 4IRJC 4A2FA 4HXBL 5IJVA 3MLRL 1LO4H 3MGOB 5E2VH 1XB8A 4LSQH 4IHOB 1OV8A 2H2PD 3CZKA 3NCXA 2R1WA 2DLFH 2UY7A 5I30H 2E6QA 1LD9A 4JGNA 1AIZA 2FQDA 3WSQL 1AO7E 2DDQH 4EKJA 4AEFA 4L0PB 4L3CA 4QRTB 3RGHA 1JN6B 2C3VA 4Z3GA 1SVBA 3GHPA 4XPTL 4KV5F 1QBLH 1UB5B 1CK0L 1E9PB 1G7LB 1XBRA 1NM9A 1ZKAA 3LS5L 1DJWA 1OGAA 3QXVA 4RX4A 5I19L 2J57A 3BC9A 4BH7B 1E5UI 4L1SA 4LPYA 1RUKL 2OMZA 1Q90A 2ZUUA 2UY7B 5IIEA 5AL0A 1LD9B 2N0KA 3GTNA 3L7EA 4XNXH 1ZLVH 2JQZA 3WY1A 4XCFL 3M7OA 3S35X 4XC1L 1Q1JH 3NSJA 4N90D 5IT2L 5IBLD 1TTFA 2XN9B 2GJ6E 2A9CA 3NCBB 5I8EB 4J3BA 3UX9B 5FUCE 2CU9A 5EO9A 4M7KL 4FI7A 1KGJA 1BF8A 2NY4B 4JG9A 2B8OT 1B4RA 5KWYC 2D3LA 4WTZA 3W39A 3TBYA 2EH8L 3WIIH 1YYLL 2WQVA 1WFMA 3KPLB 1I3GH 3IKKA 3QFJE 5IK3A 5GGSA 3QUKA 5E2TL 3FO0L 1JGEA 5F97E 2W0PA 3I3BA 5I1JH 1G9HA 4PJXA 1KEGL 4L2LA 4S0HA 1GC1H 4JQVC 5LAPA 4OZGE 3ZE1F 4YL9A 5J13B 4X6CA 2E7BA 2K9UA 4MBOA 5EU4A 3W0WB 3WFDL 1U8CA 4IRZH 5HDWA 4QHNA 5I0VA 2C9XA 4HC1L 4R4NC 2NTFB 2GJZA 2ERJC 2WLZA 2QQQA 3HR5B 3OKLA 3OXRA 3OZ9L 3QW9A 2PYEA 2XICA 3QGVA 1INQA 1ZA3A 4JM0A 5KSBA 1JVOA 2Y7QB 4G9FB 4LK4A 3C60A 4H5SB 1LNUB 1O9VA 1YEIL 2NY2D 5GGSB 1D5IL 4FFZH 4IW4C 4TOYH 3IGLA 1JGEB 2JI2A 4MYWB 2B08A 4X9FA 1PZSA 2D73A 4PQXA 4TUJA 4ZFOA 1QTPA 3LZOA 2AQTA 1VPOL 3ALPA 4KKCC 4MJHA 4H0HB 2VDPL 5EBMB 1D6EB 2E3VA 3MNZB 2NY7H 1HWWA 2H0FA 2YKKA 3RFZC 2EVHA 1XGPB 4LKXB 5H37G 4XCCH 4P2AA 2HRLA 4YDLB 3VRJB 2A73B 5MP6L 3GJFK 3DVNA 3OXRB 2PYEB 4P2OC 2IQAA 3C60B 2HLEB 3KBHE 2IPTH 4AKOA 3LS4H 4M5YL 2X1PA 1S7XA 3B9KB 4M4RA 2BFVL 4PJEF 4I13B 3FU8A 4A04A 3WEOA 1RZGB 1FH2A 4OCXH 1JDDA 3FFCE 3CK0L 5D5MA 3UO1L 5E1IA 1BM7A 1I31A 3FN0H 5A2AA 3TLRA 3D85A 5IV2A 3CHSA 3ZKNC 3ETTA 1RLWA 5B8CA 4RFEA 4EO5A 1BMZA 3NCMA 4LARH 5H4YA 4AJVA 1KOAA 3T8MA 1DQMH 1S7SA 2WZPA 2CPUA 4TXVB 5ISZB 5I30L 2DLFL 2IQAB 4WLCA 3L4XA 2HFEA 4QPEA 5C7XH 1SDDB 3T8XA 1MVYA 2BIPA 2DDQL 4O2CB 3RY5A 2IV8A 5D1QC 4ATWA 4H13C 1A6TA 2DQUH 3GSUA 4MFHA 3ET9F 3CLWA 3UYOD 2W07A 1OGPA 2XJKA 5D5MB 3CZFB 3TZVC 3D09A 5EFIA 3F83A 3ECBA 1U8JA 3OHMB 1QBLL 4M8UA 1FN4A 2CUHA 2YHGA 3N85L 3WNJA 1TEGA 3AQXA 2IOIA 3RTLA 3HG1D 4FG6D 4G7VH 1XF2A 4N6RB 2IEPA 1OHQA 2KL6A 2PW2A 3CDZA 3W37A 3RDTA 3ARED 5K69A 4FERA 2AVFA 4JHBA 4XNXL 4JPWH 4Z8FH 1AR1B 1JTTA 4WTWA 2APSA 1Q1JL 4K3DH 1F0LA 4XAWH 3GRBA 3LB6D 4LGRB 1RFDL 4AQ1B 4XXDA 5F9AC 4OB5H 4PRDA 1U8JB 3BO8B 2VN4A 1H0DA 3GXIA 4CRPA 2Y36H 4NKMA 4EJ1C 1GC1C 1QSFB 5KUKA 4ZFZB 4XE0A 3WIIL 3IXAA 1XEDA 3S2CA 1XF2B 2XKNA 1U36A 3W57A 3HJEA 1I3GL 1KIQB 2DB8A 3EFFA 3O3DA 2VCOA 3AS1A 3IWUA 5I1JL 3KPRE 2J12B 2N01B 3MTXA 3SJVE 3WS6C 2C1OB 3H3KA 4CSSA 3IMUA 3L1FA 2YFNA 3GSXA 3CFQA 1VB9A 3BPLB 3FW6A 3VQLA 4AM0Q 5I6KA 2Q20A 3K3QA 1KXVC 5E7BA 3GLZA 4IRZL 3OAZK 3P2DA 4NAQA 3WNPA 3FSOA 4NKMB 2PPAA 1KXQA 5JYMA 4UDUA 3S3PA 3NFSH 5DRXA 3MGTB 2X9ZA 1NFDB 2X6UA 1HYSD 2XKNB 1SLWA 2X4SB 4Q6IC 4TOYL 3F8UB 4U6TA 4FFZL 1CQKA 4L9LC 4GRLD 2P26A 4KH2A 1IAII 3KH4A 5IFHH 4R7VA 3BQUA 2RA1A 4LF3B 5DJ8A 1RULH 2BWIA 3G6DH 2NY7L 4U1KA 2OW7A 2MNUA 4PJ5A 1JI1A 2AK4E 3HI1B 1H8NA 2G3XA 4F20A 4XT1C 3UBXG 5KVDE 5DA0B 5C0BB 3CC5B 3KL0A 1XGTA 3MSPA 4RMUA 2DOCA 4XCCL 3D07A 5DHXB 4NKQB 1Z66A 1SXBA 2XBZA 1CLVA 5DRXB 1JPGA 3RBSA 4IDJL 4WFFD 1FVCA 3L6FA 4NOBA 4HIHB 5AW6B 2IPTL 1JXKA 4QWWD 2AEOA 4J1UA 3WBDA 5CWSB 1FNSH 4YGAB 2VYRE 5C0NC 4CW1B 3IJHB 3IU4H 3MV8E 3J8F7 4OCXL 3KPNA 3PWVA 4KNTA 3BQUB 2LV4A 2VDOH 4JFZH 1IQWH 3FN0L 3SKNA 7CGTA 2EYSA 1KMGA 3MRBB 4XOAA 1HHJA 1NC2D 4Z7UF 1ZLEA 2YRLA 4PRHE 5E5RB 1H9DA 2K6ZA 2VLJA 4LARL 3LXCA 4NZRL 3VSVA 1DQML 3PE9A 4RGND 1ORQA 3UTTE 1JPGB 4TTGA 3DGDA 5C6PB 5DWUH 4LVNB 4NFBA 4OFYA 1HEJC 5C7XL 3CMOH 3ZZSA 2K8MA 3QXTA 1VESA 2BVUA 3BZ4A 3KWVA 4P5TC 4YHKH 2DQUL 4NNYB 5T1MB 1INEH 1SJEB 5B39A 2Z7UA 3KPNB 4KUZH 2VKXA 3QR0A 3CN0A 3HCVA 3L2LA 3PAYA 4YHYC 1L0PA 1DANT 4AQEB 1T5WB 1MJJA 3LRMA 2WQAA 4X4YB 1RU9H 4PJAF 2EIZA 3CH1A 4K9EH 4G7VL 4WGWB 3KVQA 2BY1A 2G75A 3TH3T 2AQRA 1UASA 4LLDA 5F1OB 4Z8FL 4PJ9A 1ADQH 3EYSH 2O5XH 4JHUA 4K3DL 2DYSB 4XAWL 3FQXA 3LV3B 3PNWA 1NIBA 3HCVB 3SJVD 4Z3HA 4OB5L 5JDJA 5C1MB 2Y36L 3OV6A 1XFPA 5IEHA 3CH1B 5J6SA 3GBNH 4R2GD 1CD0A 1ZVSB 2DF3A 4KC3B 3HW7A 3ULVF 2ZG1A 1O7DC 4DCQA 2EP6A 1QBMH 1XF5B 2NXYC 5D7JD 3FO2A 1QNIA 2E6PA 4OF8A 4LLDB 3EJSA 1NA8A 3EYOB 4S11A 2YQ3A 4QY8B 5BVJA 2GEEA 4Q6KA 5LB1A 5GSVB 4PJHE 3ZT6A 2Q86A 2FNWA 2HJKB 2VSDA 3UZEA 1TCRA 4CSPA 3IT8D 3ABGA 4G72B 4NO0B 1HCFX 4B9IA 2NQCA 2KDGA 4S1DD 3H9SA 4GW1A 4B53A 4P23C 5HYJD 3OHXA 3QQDB 4NRYB 3LKRB 3NFSL 3PF2A 5CCKH 5EIIG 4G8FA 4AQ1C 1J18A 1DQJA 1CT8B 4IOFD 4F91B 1TZGH 5FA3A 3TWCH 1H8SA 5HGDB 1QR1A 3K2MC 4LOFA 3WAKA 3HOGA 1NGXA 1OGSA 4EAEA 5IFHL 3EG9A 4C47A 2C9UA 1F8TH 1VZIA 4G71B 3QEHA 4RMQA 3GS7A 1RULL 2NNRA 4OCLC 3G6DL 4XGZB 3SDAC 3WS3B 2I9TB 3KPSA 3BKJH 1DBML 4RAUA 2HYMA 4K5LA 3PJNA 4PJFE 3MQIA 3NDZE 3H9SB 4PN6A 3PYCA 1X4XA 1I82A 4OJFH 4L8BA 1V3LA 1EAPA 1S9XB 4L0YA 1L9NA 1WWWX 5TQ0H 3WJJA 2BP8B 3L3JB 1FNSL 2XQYA 3CZGA 1EH9A 1PPIA 2YMOA 4EIGB 2HLAA 1H8LA 4FNRA 1FC1A 1HC1A 2Z34A 3MV7A 3P9MB 3QEHB 3NESA 1NCUA 1JNNH 1LP9F 1IQWL 4HCFA 4JFZL 4Q9CA 2QDVA 2WO3B 1GS7A 1AANA 1T21B 1PVHA 1TTRA 2BS71 1ZLSH 5D7LA 3JTSA 4QOKD 4UT6H 1DVZA 3RTQA 3T0XA 2BW4A 2F5AH 2CCWA 3BDXA 5DJZB 4JM2F 4ZMPA 3OAYK 3BH9A 2F54A 5E0FA 5DWUL 4F2MA 1TJGH 1EAPB 5AW5B 3QPKA 4OFPA 3ZL4H 1JZ3A 3CMOL 4DGYH 2EE6A 3C8KB 4X5QA 1TO5A 2WWKT 1UM4L 4K9EC 1INEL 3QG7H 3QJFA 3MV7B 3IJSB 3OKYA 3P0YH 1BJ8A 3CSTA 2CGRH 4YH6A 2A6DB 1GTFA 2D7PA 1LJMA 1RU9L 3BJLA 5D7LB 4K9EL 4MB5A 4RFOH 5T3XH 3TIDB 3CSFA 5EHFA 4H4NA 3BH9B 2ZZUT 1IM9D 4IU2A 1E0OB 4UZUA 3RFRA 4MNHB 4L0ZA 4LEOA 1ADQL 3EYSL 3LCYA 2O5XL 1OGAE 4HHGA 4AQOA 1DCLA 1L9RA 4F3FB 2XN0A 3LZLA 4NKOB 2M2DA 1ZVNA 1XSIA 3WO3B 1NFIB 1T0NA 2VLKD 3B7SA 1T4KA 2HN7A 3ENEA 4PY7A 1LLAA 4JFPB 5ID0B 2R69A 4Y4FC 4BSWB 3IGKA 2CRYA 3F62A 4QXVA 3FT2A 3A4AA 5C08A 3ZDYF 1QBML 2DQGH 3DPDA 3KWUA 4BGLA 4I18B 5FFGA 2F1EA 1T80A 1Q1PA 4IRSB 1NCNA 2CBQA 1G7IB 1TZ8A 3ZL1A 3QDJB 2CDEA 3X1EA 4FYSA 4XMPH 4F7EB 4DP0X 1ZXKA 5HHPA 1B0GB 4HK0B 2VDRH 1MCRA 4YBHA 4MXVE 1CLYH 5HGBB 3CVHA 3PY9A 1ZPLA 2HN7B 4PY7B 3ZE0E 2X4RB 1HH9A 3NCEB 5D72H 4HHWA 3IKCB 2WYZA 4X6CE 1KYUA 3QZOA 5CO1A 1YHPA 2G5BA 3W9DA 3FT2B 5CCKL 3BUYB 3FO1B 1E8XA 1ROCA 2DYPD 4QHKJ 4LCCC 1TZGL 5LBSA 1G1CA 2R56H 4U7SA 3TWCL 5FYJU 1ACZA 3HBPA 4HUMB 4AYMC 2F53D 4XODA 2DM3A 5KSBE 4WEUD 5EZOH 4HJGB 5LNEA 4M7JH 1KTCA 4H7VA 4QHLA 5DHYA 3V0FA 5KVEH 1RI8A 1U8KB 2YWYA 1CQYA 3BKJL 2HLFC 4MCYA 1BQHA 4AMKH 4FQPA 4DF9A 5ICXB 2PNDA 1VFAA 1IM3D 1ZD6A 3LIZH 1A1NA 1XDTT 4OJFL 4Z18A 1WD8A 3VI3B 1H5BB 3UAJC 2GBTA 3MJ9A 3MJ8A 5HYSB 2G9HA 4F8QA 4LLYB 3TFKC 5D1XA 4MCZA 1FYHB 1QKZH 3R7RA 1G5AA 3STZA 1JNNL 5E2WH 5F7UA 4MCYB 1MWOA 5BRZB 1BQHB 4FNUA 4UT6L 5E5MB 3QUHA 3GC3A 3HNVH 4JFFA 1N68A 3D8MA 3W9EA 5F1NB 4PJGB 1TJGL 2G9HB 2VTFA 3ZL4L 1PG7L 4DGYL 5D1XB 4MCZB 2JI3A 4JREB 1A4CA 4MJID 1ODAA 2Q3AA 3O6FB 2XTSA 2P52A 2D4DA 2PP9A 2QFRA 3QORA 4ZS6C 3X11B 4AZ8B 5A2BA 2YEVB 5IB1A 1I3VA 3LVTA 3P0YL 1DP0A 1X6LA 2LQRA 2CGRL 5KVFE 1CMOA 1YECL 4XP4H 5E70A 5JW4M 4HVBA 4TSCH 1IGJA 1FIEA 2BNQD 5KBMA 4XH2B 5T3XL 1FIGH 1X5YA 3Q8CA 4JG1H 4X99A 4RMBA 3VQ2C 1KCUH 2IANB 1I1AA 3F3HA 3L08A 3D30A 1CG9A 1H6UA 1BZ7B 2JV6A 3PLYA 1QTYT 4QTHA 3VXQA 4N2EA 6PCYA 2CBMA 4ES9A 2AABH 3DX6A 5IB1B 2ZCLH 3Q2WA 5DVKA 4MDIA 4L4TB 4PS3A 1AGBB 1YPZA 3H85A 2X4TB 3QHZH 3RKDC 4L8SB 1A47A 2EEDA 3NTCH 3UOAB 5IVXA 2YA2A 1VCBC 2C9QA 2DQGL 3QWOA 4PG9A 5AOMA 3QSKB 2WLLB 2GTQA 5DZLA 3S0PA 2VLMD 2VR6A 3SDDC 3VXQB 4KX8A 1CXHA 3FBQA 4M56A 4BUQA 4XMPL 3GSNB 4WFGD 4CSTA 2YPVA 4KRMB 5I1EH 3CHOA 3BUIA 2VLRD 2YPLA 3D3VD 2LLLA 4LPXA 1CLYL 2OMTA 2NR6C 1S7VA 1QZ1A 2QSCH 1P7KA 3DROA 1YPZB 5D72L 3CFBA 3D2TA 1XHHA 1C5CH 4WK0B 2CHXA 3KCWA 1T0OA 2WBJB 2MPVA 3H7BA 3KWXA 4LHQB 5FYLE 3DX8A 1T5XB 3QWOB 4PG9B 2GSMB 2QPEB 2R56L 4IGBC 1GMIA 1BG1A 4N20A 2J6EA 5C92A 5HGHA 5L0QB 2ZOKB 3BAJA 4LE8A 1I1FA 1WFOA 5EZOL 1J7VR 4M7JL 4EUPB 2VL5B 1DVFC 3HNTH 4LGSB 4N0UE 3G6JF 5KVEL 2BVPA 4R3SA 1U2YA 1BSIA 3P4LA 5E8DL 4AMKL 4C57C 1LWJA 1DO5A 4OF3A 5BRQA 1P7KB 3U9WA 3WHXA 1M4KA 1BA9A 3DURA 3V4UH 1E65A 3CFBB 3LIZL 3SKMB 1UZ6E 3O45B 4JAMB 3H7BB 3EJCA 5KYXA 1UM6H 5ICZA 3AB0B 3KDPB 5E6SB 3SY6A 1NICA 4HCGA 3ZTJG 4HOWA 4RLDA 1T66C 4JLRA 3U30B 4ANVA 5HGHB 2QVFB 4F27A 3EOBA 3BAKA 2ZF8A 4BZ1H 3MRKB 4NWTH 3UBFA 3WJLC 5E2WL 2BVPB 2ZD0A 4A7QA 3BPNC 4AEEA 4U1NB 2I69A 2V9QA 2WINA 4JFTA 4TQHA 1R3KA 3IRCA 4KRLB 5E6RB 5T3ZE 3ZO9A 4E9TA 3MRQB 4UQIM 5FW7A 3WHXB 2LAAA 2DM7A 3DURB 3HNVL 2RCSH 1U2CA 4X9GA 2EDEA 4CC1A 1IAOA 2X4NA 2GITA 1GAFH 1UQSA 4UT9H 1EXGA 2A6IB 3ARPA 3GBMH 1P9MC 3LKQB 4KXBA 4N8VA 4V2BA 2HX9A 4Y16A 3L95A 1MQKH 1MHHB 3BPCB 4HJIA 1CGTA 4EUPH 1OSZA 4BXSV 1MHCB 2G2RA 1E5BA 3DRTA 4LSTH 2J6WA 2J8UB 1IGMH 2HRHA 2W1NA 3BCDA 4Q6YA 1QA9A 3DLQR 4XP4L 2WINB 2VJ8A 4TSCL 4U3XA 2W9EH 1YN6A 5FECB 1OB1B 1E40A 3GBDA 3RIFK 1FIGL 3RJOA 1P6WA 1V3JA 4JG1L 4KTEH 3GZOA 1PBYA 1WFTA 1KCUL 3AG2B 3KDMB 3KXFA 1G6RB 4HXAL 4NIKB 2ODIA 3N2JA 2GITB 4N87A 4NZTH 4ISVA 2OW6A 2G0LA 1U8OB 3P4MA 1NKOA 4XMTA 1FFPA 1SN5A 3CHQA 1THAA 3HNSH 2D3NA 3JT2A 3KD4A 2FEDC 3M8OH 4MD4A 4G5ZH 4U4BA 4NXSA 5EB9A 4AYID 4RNRB 2UZXA 4UTAA 1D7BA 1KBVA 1N9PA 4MNQD 1OP5H 4AUYA 2AABL 3DHPA 3FSVA 4GAYB 2ZCLL 1MHEA 1IVTA 4MMXB 4LPCA 4YPGA 3F58H 4RDBA 1BLNB 5F9WC 3DSFH 1RSFA 1PLGH 1TU2A 1I8IA 1YN6B 3NTCL 5E5LA 4OV5A 3S5ZA 2F2HA 3KXFB 4JL2A 3DA0A 2AJSH 2Q7YB 2EE0A 2JXMB 3C6LB 3D2UA 3T0ED 3LKPB 2Y0SA 3ARUA 3QPXH 3L3DA 2YJLA 4H0LC 2EIDA 3HB3C 4KTDL 4WUKH 2FGZA 1JF1B 1Q4NX 1WFIA 5I1EL 4OTXH 5B1BB 4EF3A 3IMRA 5DTFB 1OLLA 1MAKA 4YPGB 3VI4F 2QSCL 3L3KA 1VLXA 2J20A 5HI4C 3S4SG 3WELA 3VFNA 4MNGA 5CJXC 4H2AA 4WEBL 1C5CL 1W9XA 1G6RH 4S2SA 3LDBB 1YAIA 5KBDA 2YQ2A 3KLSA 2PO6D 1JWSB 2I25N 3D39A 3ZO0A 1FV1A 1ND0A 4J8RB 1F4XH 4YDNA 4UZGA 2DAVA 3QO1A 3RUGF 2A74C 1N8ZA 1OD9A 5JW4N 2FSEA 5LLIC 2YO3A 3GINA 4L8SC 1UXWB 3GD1C 5CJQL 4A2DA 2Z7ZA 2BRQA 3QB7C 2H32B 3AY4C 3PDOA 1IZJA 3QUYB 3HNTL 3IS0X 4WZ9A 4UNTA 3ABKB 2CAKA 1HJCA 4A67A 2XUWA 4M1GH 4X4ZA 1ET8A 2NY2C 1OF2B 1RK1B 3O4LD 5LVEA 5MENE 4GS7C 3V4UL 3QXAB 3L2MA 4X0NA 3TJHC 2BRRH 4U1IA 3KPSE 4GNKB 1JK8B 2K4AA 3VWJD 2H26A 1EVUA 4AX3A 1J8HB 1UM6L 35C8H 1JVKA 1U8QA 4DK6A 1TJXA 1W0WB 4APXA 4AV5A 1OPGH 5TGBA 3OMAB 3ARVA 4TF4A 3VACA 3GSNL 4FQXD 3HZ3A 4C83B 1NBQA 3HRZB 2DWEB 5CEYA 4BZ1L 4NWTL 3DO7B 3D4CA 3QUXB 4NQXA 5AZ2H 5ETUA 3JSSA 4FG0A 5FCUL 3E2HC 3VFPA 1IMHC 5FGRA 3M86A 3UP1A 4HIXH 1F6LL 2HVKA 1CICD 3ME0B 4AYSA 2RCSL 3DVFA 3FH7A 4J3VA 2AJUH 5FK9A 4U1IB 5FCSH 4UIMB 4XVUD 5ERWB 3ULUF 1GAFL 3VUAA 4NQQA 3UTSD 4OGQC 1U8QB 3GBML 4K7FA 1KCWA 4N5UA 4PB9H 4APXB 1F00I 2ZE0A 1DSFH 1MQKL 5IQ9A 3EGDA 4F2ME 1D2OA 4LSTL 4XZ4A 4YJZL 1IGML 4N2DA 5E94B 3UROR 2X05A 5DRZA 5MEQA 2QVTA 2LAGB 3MYJA 4AQ8C 1CXKA 1QASA 1HYRC 2W9EL 3RVXD 4KDTA 3ZKSD 1KGCD 1LHZA 4NFCA 3VXSA 2HJFA 1QYGL 5FK9B 3DHMA 3VFUB 15C8H 1AYRA 5CBAA 3U6RB 3C5XA 4NZTL 3K2UH 1PTZA 3JWOH 2H0PA 3HNSL 1U6AH 1WP6A 3M8OL 3HLAA 3BSZA 4G5ZL 2X9WA 5LBGA 3UJTH 3EGDB 3VDCA 3HAEH 4EZMA 4QI3A 2B2XL 1HNFA 1TCMA 3PL6D 2BNRB 1XB6A 3CPLB 3F58L 1SJXA 1U41A 4XHJC 1GW0A 3DSFL 5B22A 3H56A 1PLGL 1R5WA 1TPXC 2IDQA 1EZLA 2ZYSA 3DI2B 4QGYA 4P8QA 5KOMC 2ZX8A 4Z7WB 3GB7A 2AJSL 1BBJB 3FCSA 3QAZC 4B3EA 4XBEH 4ETQB 4HS3B 1XH2A 3QPXL 2WSPA 3W38A 4LVOB 5C08E 4WUKL 2Z1PA 5DFWH 5K9OA 1QRNA 3VXOA 4OTXL 4M5ZH 4X6BB 3KPMB 4AYFB 3RWGB 3B5HA 4MMYA 4Q0XH 3L9EA 2G3ZA 4NJAH 2NY1D 4ENED 3LQAH 2NY6D 1G6RL 4P99A 2R7EA 3S3SA 2HWZH 3GB7B 1MW3A 1F4XL 1ZLDA 1G0YR 1SDYA 1MCOH 2DQIH 5DI8A 5K9KA 3MR9B 1F97A 2H1XA 2MOGA 4L4VD 4K5NA 3BDBA 5IEKA 4KI5D 4N5ED 1QRNB 4UQDA 2X5PA 3NQKA 1HYSC 4M1CC 2XLLA 5H2BB 4M1GL 4AVIA 3GMPA 4X8JB 4MMYB 1H3GA 4UM9B 1J5DA 3GPSA 1R5VA 4IKIA 4LLWB 4IBWA 5DC2A 1XGYH 4P46C 4R6UA 3ZL2A 4DUVA 4KHXH 5FB8B 2BRRL 4RISH 2R7EB 1HSAB 1DEDA 4WNSA 35C8L 2X38A 3H2QA 3M1CA 4HYTB 4Y7MA 4YFEA 3TBTA 4W9GC 1UATA 1OPGL 3F2LA 5CKAA 3KWWA 5LAXA 2IBGA 2ITFA 1S7QB 3VA2C 1AZCA 1UKTA 5BJTA 5AZ2L 1TTCA 4MLSA 4Z78A 1P84J 1BOGA 2KBGA 5JMOC 4JRXD 3U0WH 3V6ZA 2ZPKH 4ZMTA 2FX8H 4UQEA 1KFAH 1L7IH 1GYVA 4WKZA 5BNXD 2AJUL 3QUYC 4BZYA 1J0JA 2X4OA 5DGQA 1XCQA 3ZE1B 1M3IA 4C56A 3EDKA 3ECQA 5LNDA 2ENJA 4PB9L 3L7FB 1DSFL 1ES0A 5LGKA 3KWWB 3BRFA 3K74B 3NFNA 5KYYB 1NC4D 2HG5A 5D1ZD 1KWGA 4CKQA 1E6JH 4XCEA 1AO7D 3F05A 3ARFD 1UVQB 3JWOC 4IM8A 1D6VH 4XMKH 2A99A 2X10A 4QRRA 1YLBB 1NCOA 2PYFA 4U2ZA 2Y3NA 4EN2A 2X4OB 3K2UL 4C56B 3H3BC 4X98A 3LEXA 1U6AL 4QHKI 3X1FA 4APQC 4EBQH 1QEXA 1ZSHA 3GSOA 2VDLB 1KENH 3DTXA 1KYOK 3NFNB 3UJTL 5FR3A 4DN3H 4YXHH 5FKPB 3WEMA 5EBLB 4ZUSB 2OYPA 1CIDA 4GOSA 4OF5A 4CJ0A 4OCRH 2AW2A 3ZKQD 4PIRF 1L4IA 2GJ6D 2YOCA 2UVEA 3GEFA 4V33A 2IVFC 4PJEB 3BKCH 5EU7E 3QIWA 4IRJA 4XBEL 3DMMD 1J10A 2KHAA 3LEXB 3D0LA 2X4QA 3LN5B 5AAPA 1KIRB 1CCZA 5CLWA 3LQAC 3QFJD 1ZK5A 4YHPA 1NWPA 4JY4A 4HGWA 4DT2A 1K8IB 1E28A 1W6LA 4M5ZL 2WC7A 1L0QA 1LO5A 2EUVA 5HDBF 1NOFA 1U30A 3DYMA 3F85A 4Q0XL 4NAMA 1QUPA 4NJAL 1DJXA 5AUMB 3LQAL 5KSAB 5H37H 3SEPA 3TYGH 3G5XB 1R9FA 3EYFA 2HWZL 4NDMB 1SYVB 2C9SA 3F5WA 4OZIF 1MCOL 2DQIL 3C5ZC 3E0GA 5DYOA 4Z7IA 1VEPA 2C7FA 2VDLH 2X89A 1KB3A 3D0LB 3BIKA 3E6FA 4CC4C 1QPXA 2JK5B 3PXHA 4LL4A 4DEWA 1LO5B 4BELD 32C2B 3GMQA 3K4DA 3FB7A 4PJCE 1XZ0A 1V3KA 1XGYL 3JV4A 4XVJH 4KHXL 4MAUH 5CS7A 5FS5A 1ZS8B 5EU5B 3ARGC 1E5ZA 1OAZH 1ET5A 3LYRA 4FQQB 5IUCA 3OC8A 2Y7OA 3BJ91 1UKQA 3X13B 2KT6A 2R29L 3FJTA 3WO4B 1NCDH 3QJQB 5CBEA 5EC2B 3RHWF 4BD4A 1PKQA 1S8DB 4B9KC 3OSVA 1AZRA 4CN4A 4JQVA 3U0WL 5I16A 2ZPKL 2XX1A 1KB9J 2FX8L 3A67H 3FFCD 1KFAL 3FB7B 3MJ7B 4LVEA 4TPRH 1L7IL 3IAQA 3MLWH 3JVFC 5E5UB 3CFCH 3PHOA 3CVDA 1LMKA 3QPQD 3C2AL 4NSKB 2AFNA 4HAFA 4DK5A 1WAAA 2F6AA 3TVMA 4Z7NE 2L7QA 4RQQA 3HLKA 1KJMA 5AVUB 4PWIA 4M9PA 2EDRA 2Z31A 3T1FB 4ONHA 2H47C 2R1XA 1FHGA 3L45A 1E6JL 4QXTB 3CFKB 3QJHB 4IHBA 4F15C 2YLKA 3VAEA 1D6VL 4F2FA 3OWRA 4LCYB 1YZZA 2X09A 3GLDA 4TVUA 4XMKL 5I74B 3UBXB 3H0TA 2WWNA 1CDCA 4MLIA 1RJLA 3BP7A 3Q8BA 3IPBA 4MAZA 5KJRH 3MRGB 1M9WA 2JKJA 4NT6A 5F1IB 3VFWA 1LE9A 5AVTB 4QRQB 1GGYA 3LN4B 3BWSA 3P2BA 4EBQL 3TVMB 3CHRA 4RQQB 1XEUA 4P2OA 2Z31B 3SGJC 1KENL 4ONHB 3O6LH 4XO8A 4YXHL 5SWQA 4DN3L 2V5RA 4ZI8A 4Y2DC 5ID1A 1VA9A 4JL1A 4MQ7A 1Y18A 3NZUA 2CBPA 2PPFA 2H6PA 1EZVX 4MKTA 4OCRL 2CHWA 4QIRA 4A66A 1GY1A 3SBQA 2DQJL 1F6FB 2YD9A 1RJLB 4E2OA 3BKCL 5KJ4A 2Y1YA 1VCAA 1FO0H 5GZNA 5SX5K 1I4FB 3VFWB 4DVBB 1MLCB 3KGTA 5HVWA 3UG4A 2IPKA 4OUUA 4NUMA 4PJ7F 5I9QC 4Z7UB 2HFGH 4PJAA 3QC6X 5SWQB 4GSRA 1F4WH 2O93L 2H4EA 1KLUA 2JKXA 3CVIH 4M8QB 5FPIA 1I9RL 2H6PB 4Z7OE 2WPGA 1WISA 2VIRB 4N8CH 4UM8B 4UNVA 5E1AA 1P2CA 3GQFA 3TZVA 1MG2C 2E7HA 3TYGL 1LE5B 1LXMA 2WD0A 5CU9A 3GXPA 1CFQA 4YGVA 2CCVA 4KNUA 4NPYB 4Y1AD 1G1OA 1Z6JT 3G5WA 4MNGE 2VDLL 2IPKB 1ZIBA 4NC0B 4OQTH 4YE0A 4PJAB 2EDOA 3LAFA 1WC7A 1OB0A 3HI6H 5GZOD 2AJXH 2JKNA 2YEZA 1FUNA 1KLUB 2WXGA 4DAGH 5A40E 2X28A 3FFOA 2H8PA 4HGKC 4FA8A 1S7UB 2CO7B 5CMAA 1UG9A 3L9BA 4XP1L 3U4KA 3BOVA 4XVJL 3OKMB 3P9LA 4MAUL 4LEEA 2AK4D 3BP4B 2GBUA 3I85A 3ARDB 3MDJA 4LLVA 4YGVB 3S97C 2E7LA 5EF2A 4S1QL 4MJ6A 5GJTH 4P9MH 2ARJQ 4F5CA 4BM7A 4N2NA 4YC2C 1DHKA 5KSAC 4NUJB 4YE4H 1NCDL 4P5RA 4FF9A 4E9LA 1Y6MR 1HXKA 4IRZA 3V6OC 3SGDH 1A7RH 1T1XA 1WC7B 4FX5A 4NUPA 3WS6A 4KVCL 2A9NH 3DNKA 2GTZB 1QI3A 4GKNA 1WF5A 3A67L 4TPRL 2OBGA 1G0XA 3MLWL 5EZPA 3CFCL 4K5OA 5KZCD 4FFZA 5JW5A 1IC5H 4PRHD 3UTQB 5TFSH 4JY5H 3D12B 5EIIB 1IAMA 3K2IA 4MGXA 5HHOB 3UTTD 1S5IH 3Q2NA 1YN7B 4G8GA 3O9WC 4Q6IA 4PGDA 4JGUA 2E47A 1N64H 1YCSA 6PAZA 4NPKA 1E4KA 2BSBA 2XFXB 2XC8A 2XWDA 3HE6C 3IMWA 5DF0A 5F96L 4NP9A 2E75C 3BUBA 3WO4C 1BIIB 5AVWB 4F7KA 2FJSA 5EN3A 5KG9A 4HUWB 3MRFB 1J5IA 3MZTA 2VLLA 4HQQH 2R8SH 2ZX9A 3N41F 4WHDA 2AKRA 2R9HD 1K9TA 1KTJA 2BMKB 5HVHB 3VXSE 2YGPA 2APXA 2Y23A 3VXMA 1UCTA 5E9NA 2XTJC 3O6LL 5AOLA 2EEBA 2OX5A 3FOLB 3U36B 4CVXA 1AOHA 3UMNA 4PWFA 3ULVH 5IHHA 5KS9A 5MEPB 1CFVH 3HG4A 5HDQH 3CX5K 1FNEB 1Q72L 2M1KA 3CXHJ 4BCZA 4G6JH 2YFOA 1DCEA 3D50A 2FIKB 4J28A 3PABA 4S10A 3RY6C 4FXKC 4JDVA 4K73A 4QYAA 4YDMA 3F7LA 2UZYA 4NNXB 1GGCH 3KYOA 1FO0L 4N0CC 1HCYA 1XXFC 2X2HA 1AKJA 3JYBA 2AKRB 4HF5H 3VD5A 1W72B 3HFML 3WFZA 2Y2YA 4MDRA 43CAA 3TURA 2Z92A 1RLBA 2ODHA 3B43A 3VXMB 4FHKA 1LILA 1D7FA 4I3RH 1F4WL 3VE0B 3QUZD 5CEZD 4UDTB 4JM2B 5HYQB 5JLZB 3UPRA 1ASQA 2WOBA 4LT7A 4JCWA 3IGAB 1VFUA 5FYKU 4UBDD 4N8CL 3B2VH 3OKKA 3PABB 4OFKA 5E4OA 4ADJA 2BIQA 4N2HA 2EH7H 1JHTB 3VRIA 4XCNA 3CQQA 2A83A 1KYAA 1JZ2A 4GRMB 3F7KA 4ADIA 1I1RA 3BKYL 3EGXA 3V9FA 3B56A 4AUJA 1C9SA 4OQTL 3QZPA 1MI5D 3L5IA 3QZNA 1YEWA 2AJXL 1I3RA 4P2RB 1A64A 1ZS2A 1Q0EA 2BOCA 2XHNA 3U1SH 4DAGL 4IJTA 2FZ3A 4G1MA 1UB6A 1UZ8A 4HIIB 4OU3A 3RZWA 1ED3A 4RIRB 3HUJA 3L5WB 5BMFH 2ZXWB 4HCIA 1Z9OA 2GSIB 3I9IA 4L05A 1W72H 4IKJA 3BP5A 2IOMA 3AACA 3F7YA 1TNNA 3DETD 4P9ML 4PBXA 5GJTL 3X3FH 4L8DB 5I15H 5C0AE 3EGXB 3WNMA 4YIQA 5E6IB 3WNNA 4DVRL 1C8QA 1DBKH 1MZYA 3ZHLA 5IUSA 2XBDA 3CDFA 4J4PA 3H9HA 3NIGF 1A7RL 3VGAC 4C4UA 1EMTH 1JZDC 1VSCA 2QGEA 3ETSA 3LN9A 1P4LA 2HP4A 5F7AA 3ZDYB 2A9NL 2IDCA 2FZ3B 5FM5O 1S9YA 1ZHBB 3HUJB 1RHHA 2VMDA 3F7VA 2CDGB 4QLWA 3H53A 3OJ2C 3WY2A 1IC5L 1FNGA 1LO2H 2DIAA 1B3IA 5TFSL 1WIUA 4P23A 4W9FC 1I8KA 3MBXH 3X3GH 4N2LA 5K39A 1S5IL 2FCBA 5F7LB 1MUJA 1BG9A 3ARDC 1N64L 4WHTA 2A5UA 3UC0H 5C0FA 3BLPX 4HEPA 1DN0B 2HT2C 1QW9A 3SDAA 2IV9A 5HI5D 3SN6N 1S9YB 3FF8A 3UC2A 3EF4A 2CNZA 1YQ2A 1J0YA 5L6YH 2XPGB 4HQQL 3ULVC 1QSEE 4KITB 4H8WL 4YAQA 3ILQC 1I8KB 4ZMLA 3LH8A 1MWAA 4OJAA 2Z8RA 4MS8D 4QRRE 2W5PA 4ZO8A 5L2KD 2Y25A 4W4OA 3VCLA 2GFBB 3HVDA 3ULVL 2QFPA 2X2YA 5HDQL 1OGAD 5DQDL 1IIIA 4BFIB 3QXWA 4G6JL 1T6WA 1A7QL 3VGDA 4Z7QE 1NPNA 5F44A 3WKNA 2HSIA 3B5TA 4PP2A 5F0JB 2AZAA 1UXLA 3GXDA 1J9TA 5F7HA 5C86A 2GJJA 3VD3A 4HF5L 4Y2OA 1MWAB 3MFFA 1W15A 4DP8X 3NCYP 5AB2A 4KGLA 4XMLH 3VCLB 2LLGA 4HH9A 3APFA 2MSPA 4I3RL 3BZEA 3HKZA 1TYEB 2P45B 5DEJA 5HVHC 3NT0A 2FJFA 1CYGA 2VO5A 1BMGA 3IDYB 2CUIA 3JWNG 4I0KA 5DMGD 5C3IA 1CBJA 2EH7L 3BGAA 3MCLH 1R17A 2H7WA 4OGYH 3T77B 1U8PA 1FAIH 2BY0A 2HUHA 4JZJC 4Y2OB 3MFFB 2WUCH 5CZVL 3LJ3A 4XX1G 4OLVH 2W94A 2RD0A 2FQFA 1HCVA 4HH9B 4A7TA 3PQYB 4AL8H 1BD2E 3OC5A 1IBFA 2Z4QA 3U1SL 2HA1A 3WL9A 3EJZC 4N2CA 3Q9PA 2FJFB 4HX1B 4LBEA 1AHKA 4U1SA 3V9EA 3UYPB 4QO1B 5BMFL 4POZD 4PSRA 4ZFQA 4NB7A 4Z0XB 1ZLVK 1NDTA 5J1AA 5TF1H 4JM2C 3DRQA 2IWFA 3TGXA 3KBPA 1W72L 3QEQA 4XMWA 3PG2A 3X3FL 4D2NA 5I15L 3K6DA 5D7HA 1B4LA 4MA8H 1MDAA 1OCZB 1DBKL 2C4FT 4GMSH 5DZJA 3OD3A 3FRUB 2GSGA 2DY2A 2NCEA 2NDGA 3HR6A 4XI5D 4U05A 1FC2D 1EMTL 2FTAA 2Z4QB 1XSJA 3S36H 3QE5A 4OD1L 4GXUM 5LDUA 3VXRB 2NPLX 1ZHNB 2OJEA 3MCKA 1DYZA 3HPLA 4TNWK 1PKQE 2OSXA 3DUHA 2EDMA 4ELMF 4FQXC 1HNGA 5J1AB 1JGLH 1LO2L 2XYBA 2BZCA 1MREH 2XTLA 4HFWA 1SEQH 3ATBA 3QQNA 1JYXA 3T3PF 4A1RA 4QRUB 4WU7A 5BZWA 1OE2A 2BOBA 4LCCA 3EBGA 4M7ZB 4X80H 5DDHB 1NFKA 1CLCA 1YEEH 4B95C 1WAAE 3UC0L 2NY0C 4MSWB 4X7DC 2WZPD 5F9JB 2GQHA 5IJKC 2DQFA 3GMOA 2OJEB 4FQCL 4H8UA 3ZW3A 4JZOA 4BQ6A 3GRWH 1UD2A 5L6YL 4NC1C 4QRBA 1MCNA 3EH1A 3RWDA 1YNTA 4IS6B 4B50A 1BGXH 4FI8A 4OBRA 2EZ0C 3V55A 1S7RB 2F61A 3G6JB 2AQSA 4F92B 3UH8A 4G6FB 4WU7B 1UKSA 1CE6A 1XH1A 3VXNA 1MFVA 1HL4A 4BRJA 4OLYH 4DGUA 3E38A 3SPGA 3W3BA 3NJXA 4P5MB 3P3TA 4PP1D 1SXSA 2EECA 5BUPA 2BSDA 1DZBA 3RURA 4BUGA 3VD0A 2FO1A 3TPKA 4I8DA 3GS0A 3RBGA 4JZOB 1FRGH 3QZLA 2E74C 1XR8B 5DQ9B 3UG5A 1P1ZA 3PL6C 4R96A 1EFXA 2OMVB 2JJSC 4L1HA 4WDIA 4XMLL 1TYJA 5D6DC 4XZUA 1CE6B 3V7AE 3P1VA 3MBWA 2I07A 2DQHH 1BHGA 4LRIC 4I0PA 4OSUH 1WJ3A 5EBGA 4TNFA 2Y72A 2YIHA 2MNWA 4AGNA 4HFUH 1RUQH 1YMHA 3EDJA 4GO8A 3T09A 3WE1A 1OM9A 3KS0J 3MCLL 4AL8C 1K8DB 4MZ2A 1A9BA 2F7PA 2X70A 4KROB 4OGYL 4RZCB 3CFEB 1FAIL 4ZQKB 2EAEA 4GRWF 4R96B 4ODXA 3L17A 2WUCL 2R4RH 5FYLD 3AT8A 4OLVL 1E9QB 3DSNB 4GBXD 3PP3H 3W5MA 2R2HA 1I1YB 1LMIA 4KXZH 3L16A 1A1MB 3MA9H 2NNAB 5E8EB 5J11C 1YMHB 3O11A 4GQPH 5TF1L 4Y19B 2ZWZA 2CCLA 1PY9A 4GKZA 2EDTA 1ESOA 1EA9C 4J27A 4MA8L 4K3JH 4XO3A 2BVOA 1SQMA 3BDYH 2D4FA 1AIFB 4F5CE 1OF0A 3SDDA 3S36L 1OT2A 4EXPX 2ZXBA 3U2IA 1ZGLP 1J1PL 4WWKD 3VXUD 3FB5A 1O6SA 1W91A 1U3ZA 4FXGB 5CP7A 5C97A 4FFTA 1S7WB 3S4SB 4K3GA 2K70A 1MREL 2DWDB 4OLZH 1SEQL 2XWBB 4LOEA 2XG4A 1JTPA 5T3ZD 2PW1B 2XVBA 4MWFB 1NLDH 4KH9A 2JCWA 2ADYA 3VFRB 5C09A 2QV2A 3KVDD 2VGLM 2QT6A 2A6JB 3ZDXE 3VI4B 3TWYA 1P7BA 5EOTA 4X80L 1HT6A 4JHVA 4IEFA 1YEEL 4NKDA 4JMXA 4YO0B 3VMPA 3X17A 1M7UA 1G6VK 3DOHA 4ZAKB 3IN2A 4O00A 2LR4A 3N55A 4H8VA 3VYPA 1DVFA 3WN5C 1A6AA 1MF2H 2DLHA 3RUGB 3S6CA 2H3NA 2ICWB 1ZK9A 2PCYA 2Z93A 4I4WA 4U6YA 3GRWL 4JFEE 4ZT1A 2EDJA 5FC9A 2P3YA 5D1ZC 3AXLB 1T04A 2XWEA 4G80B 2DEYX 1BGXL 2OMXA 2GB2A 1A22B 3CDYA 1CDGA 2V3FA 1XCTB 5EEYA 1N70A 3TNMA 3K81A 5E4EC 4L3EA 1BFTA 5B1KA 3MV01 4GSDH 4NKDB 4OLYL 5TDNB 5JIIA 2BP0A 2ED8A 4LNRB 2D03L 3SOTA 3W0WE 3PWJA 3G6AB 1J0IA 2BXZA 1NFAA 2XWJB 1BAGA 1JMZA 4NQDA 2Z93B 5KS9E 4MZRA 3D0AA 1FRGL 2CO6A 2FR4A 4W9JC 4LCWE 2OI9B 1DQLH 1T04B 4G9FE 3QIBC 2OMXB 4GXUN 4LFHD 3ELAT 5HPMA 3TNMB 4H40A 3RWJB 3SDXE 2ED9A 1B90A 2WBKA 2DQHL 5I5IA 4AC2A 4UOJA 5ACZA 5I0WA 3KPPB 1F6AB 4D94A 1RMFH 2BP0B 4XNZB 2PTUA 3MROB 4OSUL 5C0IB 3PWJB 2A0LC 4XNQB 1I8LC 1AZNA 1SOXA 3BHBA 5GGRA 2YZ1A 4HFUL 1RUQL 4I9WD 4JJOA 3UAFA 1OTTC 4NQDB 1I7RA 4QR7A 4PJBA 2FR4B 4ODUB 4BFBD 2P8LA 3GK8H 4B6ZA 3W5NA 4XPHH 3A4FA 3KJ4C 1KXHA 1KYDA 1ZJAA 2GI0A 2NZ9C 2V4LA 4JG5A 2R4RL 5HPMB 5J5EA 4X8GA 5EOCJ 1NGZA 1CBVH 4OW6A 4CN1A 4FEIA 43C9B 2YAEA 2HKFH 3UYRH 3OG6B 4X6FA 3BD4A 2GYSA 3MA9L 2IPUK 5CGMA 3WFCH 4PR5A 4QRFA 3TCLB 3ZTEA 1XZWA 4MRBA 1GIGH 4Y88A 1NEZA 4JRYB 5FUZH 3SGDI 3PGDB 5B38G 5MEND 4MXQC 2HJLA 2VXVH 3RLSA 3QNXA 4CMHC 4U1LA 3FONA 1ZIAA 4PRIE 4YSCA 2WM0A 4K3JL 2CIIA 3BSHA 3U7WH 2W65A 3VXPA 1BQLH 1NGZB 1OSEA 1XO8A 4EI5D 3BDYL 1A9EB 4KI5F 3WAJA 1D9KD 3ULUH 4PRNA 1O7DE 1XX9C 1LEIA 4X6FB 2VABA 4UANA 4BKSC 2H41A 4NNPH 2HRPH 2Z8SA 3QQ4B 3VB9A 4B0MB 1EAJA 5BUAA 2PR4H 3KCPA 4UQ2A 5E9DB 2CE6A 4OLZL 3WLBA 5SV3A 1NLDL 5I1HH 4JDZB 3D05A 3WDIA 1SGKA 4H8PA 3PGCA 4NC2B 4F7TA 3FUMA 3RTQD 3W11D 3VFTA 2V6HA 3RWCA 4PRNB 1T0MA 3AY4A 4QXUH 4L2YA 5DEGB 2ESVB 5DZVA 2H2SD 1QSFE 4U0RB 1A3RH 4XXCC 1MRCH 2I9LB 2P8PA 3BQVA 4UQ2B 3ZDZF 4ZPVA 1R46A 1FPTH 4YFLF 4FXGC 2P9RA 5JPNC 2A2QT 5AVVB 4QTFA 1D5MB 2NRDA 3QJVB 3GXMA 4GSDL 4ZUUA 5AKVA 2ZJSH 2NW2A 2GI7A 5IFAL 1FLRH 5IHZA 3FCBA 5JIDA 4FJYA 1FYTB 2ZWSA 3QZWG 4UT9A 3TO4B 4NZJA 4JKWA 1GVIA 3EUDA 3SPHA 1DQLL 2FVNA 2P8PB 2OXGA 3HFFA 3CWGA 4FRWA 4L29A 3O6MH 3RWEA 3UTZA 2NUPA 3IDNA 2WKOF 2P80D 1SBSH 3B5GA 3SO3C 1R3LA 1RP9A 4K8RD 1RMFL 2JJVA 2X6AA 4CN6A 2NW2B 5FIEA 5IHZB 5C08D 3ZMNA 3NSDA 4R4BB 3V52H 3VGEA 3WNKA 1GTNA 5C2UB 1I7TA 2WO4A 3QNYB 2Q1EA 1SJHA 3GMNA 4PMFA 5C0BE 3KLHC 4XVSH 4GEJA 2YA1A 3R06A 5MEOB 1DN2A 1JGDB 2VR5A 3GK8L 1XV8A 4GIAA 4XPHL 3OJDA 4EKXA 3MMEA 3Q6FB 2D7TH 3I74A 1CBVL 3RWEB 2ZKHL 4UQBA 2HCZX 2OI9C 3IMVA 4IKKA 2HKFL 3NGBB 3UYRL 4ZX4A 2X40A 4HKBA 3H42H 4JFDD 3HG1A 3WFCL 4FCHA 1I7TB 4AENB 1GIGL 2IG2H 1TVHB 5EIVA 4CILA 3CSBA 4UWQB 5FUZL 3AREA 4XNZC 5IGXH 1MAJA 3FAXA 4M93B 2VXVL 1R0AH 2ZWYA 1GMEA 5DUJA 4XP9H 3RZCC 3ULUC 3OJDB 1IEAA 2O6EA 3U7WL 2APTA 3A0OA 1KEMH 4D0BA 1BQLL 5E2UH 3ZE2E 3PHAA 2JIXD 3F01A 3QEQE 4S0TD 2QMKA 1S9WB 2BIOA 4LOUC 5GS2H 4WNQA 3ULUL 4J3OH 4NNPL 3VD9A 2HRPL 2X9XA 4YEEA 1QTSA 3QI9B 1W0YT 4F33B 3JUZA 5IREA 2CM5A 2PR4L 2PCPA 2MTAA 2FJGA 4LDLB 3DX4A 3K72A 1OAQH 2VW4A 4WK2B 5AD0B 2YJQA 1KDIA 1TJMA 5EEVA 5I1HL 1S7TA 4UOW1 3MBED 2ZNWA 3T2LA 2LVCA 1CDBA 3H2PA 2TRHA 4ZMWA 1AHWC 3QH3B 1AG0A 3MN8A 4WNJA 2KZKA 5HDBB 1KF9B 3RYMA 4PWHA 4WWOA 4P2QD 3A47A 4JW3A 2IBZY 2IJ0C 2RALA 2PWGA 5EUOE 3GRGA 3MREB 4WNQB 2YOAA 1OGTA 3RX9A 3MNVA 2LVEA 4QXUL 3TIEB 4OZIB 2X6BA 3FTSA 1KT2B 4Y4KB 1A3RL 2PCPB 1MRCL 4UOZA 2P5ED 4GRLA 4ECNA 3QORD 1PLBA 4P46A 2XN1A 4XN9A 4Y8AA 5FDWA 5I6NA 1FPTL 3ASOB 2J25A 4XXWC 4HUVB 3KR3L 4DO5A 1SY6A 3L54A 4GMTH 3MJ6A 2UX7A 1MFCH 3MCG1 3QJXA 2QR0B 2ZJSL 1I1AD 1MCCA 4Q2ZB 3I9PA 4I3SH 1NLBH 2EABA 2EDXA 3MNVB 3RG1C 1YMMA 4TN9A 5BUGA 1EO5A 1V8HA 3HC0A 1MIMH 1Q9OB 4GRLB 3RU8H 5FDWB 2Q0ZX 3IFOA 2Y1AA 2OP4H 2VAAA 3O6ML 2J4WH 4PJDA 1SBSL 1PLAA 3EXLA 1NC2A 3I02B 4JFXB 3Q01A 4KK9D 5H4ZA 4I1PA 4GKOA 4M5SA 3V52L 2JKIS 5BO0D 3M88A 4OQ1A 4IYKA 3PWLA 4XVSL 5DK3A 4U6XB 4ANUA 2QZQA 5T3XE 2OTWB 1LDSA 4TSAH 4XP5H 5BQDA 3GHBH 4BFNA 2GCYA 1PSKL 3UGUA 5I66A 1PQZA 2C3HA 3ZTNH 4CDGC 2D7TL 4M3JA 3IJ9A 5IW3A 3TO4C 2G2NA 4N2GA 2XXFA 1RKRA 2DI9A 3O41A 1URLA 3V5DA 1X7SA 1LO3H 1K3ZA 1KC5H 4DEPB 4KTYA 5JA9A 3H42L 2WP3T 4PVNA 4HPOH 5DMIH 3FT4A 4RGNB 4ZYKB 5C3LD 3E8UL 2IG2L 1H3UA 3AT0A 2CKBA 3IDJB 2HMID 1IKNC 2OCCB 3FUNA 3PWLB 1Z5LA 2CK0H 5IGXL 4OM1L 1JAEA 1FF5A 5LGYA 4AY0A 4JFHE 1KLGB 1KCLA 3VXTB 2L8AA 1OE1A 1RUAH 3BFQG 1QVOA 4J3OC 4Z77B 3BYYA 1KEML 2J5LC 4CA4A 4V11A 5C07D 4ZBJA 5E2UL 3N91A 1X4YA 4WVRA 3SJVA 1NSNH 2DQDH 2V0AA 3GMLA 3O41B 1D5XB 2CHNA 3CU1A 2BC4B 2FJHA 4E42B 4QNPF 3V0VA 1SHSA 1UA6H 4M02A 1WZMA 5FGBA 3H55A 3Q3GA 5JHDB 3G04A 4X9YA 4WU5A 3FT4B 1GOGA 4PI0A 3PNRB 1ACXA 2AJ3A 2CKBB 3FUHA 5D7JA 4E9SA 4AM0A 5AENA 3KG5A 3MXWH 1OAQL 1YEGH 3RVTD 3QRBA 5HPOA 4FC3E 1QVOB 4QCIA 2YGOA 1RPUA 1OKEA 3VJ6B 1L0YA 3C5ZA 5AAWC 4KX7A 3BIBX 5DJXB 4M93C 1LEKA 1AGCA 4HMCA 1F3RB 4LSDA 4KKAD 5C09E 1IGYA 2H5UA 3WLWD 5D2NB 4R2GB 3G04B 4F37K 4HWNA 1ZTXL 5EZJB 3C12A 3WKQA 2ITCA 3RNKA 2WLJA 4N0YH 5ADPH 3I6GB 1QACA 5EUKA 2OXHB 1U91A 4BQ9A 3ZHNA 3KGUA 4ONOA 3QI9C 4LP4A 2IWEA 3NZSA 3ARGA 3KPOA 4P07A 2WVVA 4F1ZA 3MLSL 4GMTL 3Q5OA 3V0IA 2RMNA 2C8NA 2QMJA 4QTIH 1MFCL 1VACA 2MTPA 3AY2A 2QLYA 4QGTA 1GKEA 5HYJB 4L3EE 5DGRA 3IF1A 2E7MA 1NLBL 3C6SB 1JXDA 3DBXB 5CFAA 3MO1A 5MERA 3EO0A 3DI3B 1MCIA 1MIML 4BEIA 3LD8C 3RU8L 3ZQWA 4MJ2A 1EV2E 1U91B 3N9GH 3RL2B 1IBZA 2F9BT 3A6BH 3PFQA 3T6ZA 4XNMA 1MCKA 1YSOA 5ANHA 2OP4L 4YLQT 4MVBD 2GC7C 4Y4KC 3TYFB 2WVVB 3MTRA 4YDJA 2VQTA 1DO6A 3TC9A 1NEUA 4NAJA 3KYMA 5A7EA 1II4E 4QOKA 2X0WA 1SF3A 3C5JA 1LK2A 3TT1H 1GJUA 3BCFA 5C70A 3DYOA 3LEVH 2ZOUA 2VZ1A 5IG7B 1MELA 1G7QB 2G30A 3EHBC 4KXZI 4XRCA 1X4ZA 4TSAL 4XP5L 3RPIA 2HB0A 4H88H 3GHBL 4ZJ9A 2X4UB 4E5XA 1VGEH 4F8OA 4XNMB 2H6OA 2BLFA 3T4AB 3ZTNL 4B27A 4QHPA 5HXMA 3NAAH 4PJBE 3JVGC 3APDA 2ZSVB 3BWAA 4JHZA 2KZWA 4OKVA 1MRFH 1OAYH 3S3CB 1LO3L 4HLJA 1A5FH 4GSQA 4ZODA 2EDDA 4QOKB 5BRZE 3TA3B 3N41B 4HPOL 4Y2DA 5DMIL 3K6SB 1VADA 2NYKA 4PIBA 1IM9A 5TJWK 3EH5B 2B3RA 2CK0L 3HMXH 4PJHF 3BEVB 2UWEA 2OK0L 1OCOB 1OP5K 1YUKB 4UNIA 2K3TA 3WEXB 2OLDA 5FGSA 4MX7B 2RFXA 1CUOA 3RDJA 4IOIA 1HDMB 3BWAB 1NSNL 2DQDL 3O2DA 4JFOA 4QHUA 2VLKA 4OR1A 2F68X 2NY3B 1UA6L 2ZNXA 1A6ZB 2EINB 3LXBA 5T5NF 3B8YA 3S8GB 1VADB 5HY9A 3N50A 1IM9B 3UBHA 3MXWL 4DEPC 5I73C 1E3XA 1YEGL 2YN3A 4UQ9A 1PF3A 4TV3A 3U4AA 2JF1A 1N3NA 5T5NG 1A6UH 2ATPB 5DJ0B 3AXHA 3WNLA 3P3RA 2GG1A 5DHDA 1BDYA 2Y24A 4U3CA 3GMRB 4PLJD 3ESNA 1RUML 3ZDWA 1KSRA 2ADIA 3HZKA 3KJ6H 2FLBT 2G4GA 3BRGC 1F3DJ 2DYPA 1XIWD 2B7DT 4N0YL 3PHQA 5ABDE 4OCWH 3EFOA 5ADPL 3VH8A 1OE3A 2F18A 2F53A 3BISA 2X6VA 1Q0YH 4MAYC 2PUQT 1DEEA 1RK0B 2Y7SA 2CBTA 3QQ9C 3NZ8B 4JFVA 4F8NA 4QTIL 4UAOB 2CHZA 1AGEA 2DLIA 1DL7H 3AU1A 5CGYD 2E46A 1IM3A 1E5CA 3OPUA 3V6OA 1Y1UA 5KEZA 3AS2A 4AIZB 4BWTA 4OGAC 1YEDA 3Q48A 2QHRH 5FYJH 2FIRT 5EN2A 2Q6WA 1SUHA 2AXHA 2BIIA 3N9GL 4XP6H 3NIGB 3A6BL 4FMVA 4AIOA 1OLZA 2H9GA 2JELH 1VKXB 4GP8B 2ENYA 3BUPA 5M94B 4F7MB 4TLUA 2CJUL 4XNUH 3O9WA 3PWPD 3TU6A 5I5RA 3TT1L 4R97C 2EKSA 4LVHB 4Y8DC 1TQCC 5JNYA 3T0DA 4YHZH 4PRPD 4TS6A 2DQTH 1IFGA 1JJUA 3VFSB 1WBXB 2GAZB 2IGLA 3NJVA 3US1A 3LEVL 5JORB 1L7TH 3HE7D 1T7YA 1J0KA 1MFAH 3ZLQC 2IIJA 3DWTA 3GEWB 2VR7A 1JYWA 2FL5A 4H88L 4MJIA 1VGEL 2VZUA 1KB5A 4YUEH 3RWIA 3H8NA 3W82A 1O5PA 2H9GB 5ICUA 4X7SH 5HD8C 5JTWA 3LEYH 3UBGA 1OAYL 2O61A 5D9SA 1A5FL 3G5YA 3WJMB 4H25B 1C5DB 4M1DL 2BHUA 4HS6B 3F00A 4FFWD 1DUZA 4YXKH 5CXPA 2W9DH 3ZT7A 3HN5A 4FXTA 4FI6A 5D70H 4OZHA 1CLZL 1DLHA 3EBIA 5BZDA 4F93B 5JOFB 3HG1E 3MRPB 4FXKA 4MXVF 3RY6A 4PJXF 3ROOB 4FHBD 2ORBH 1HHIB 2QV4A 3BZFA 1TKWA 4FTVE 4MJIB 4PS4H 4Q56A 3SDCC 3V4VB 3TO2B 2Y4SA 3DC0A 3ZE0F 2CGZA 4WTZG 3GBLA 5DC0A 5K93A 4X6CF 3RI5F 4JO8A 4MMZA 4NZUH 4J39A 5C0AD 3BRDA 1M2VB 1QLEH 2BNQB 3GHEH 4HKZA 4YR6A 3MA7A 3J7HA 4KVNH 5IB5B 1FFRA 1F11A 2YBGA 1JGUH 2VITA 3FU7B 1I9JH 3NSXA 5KSBF 1HZHH 5DHEA 2VR9A 2MCG1 2YGQA 1L6XA 3MXVH 4OQTA 1FDLL 1TJHH 2VQ4A 2MHAB 1TKWB 1A6UL 2Y2TA 3BZFB 1NMCB 1FG2A 4QF1B 3HA0A 3D3VA 5BQ7B 1AFVH 3J27A 3NJHA 1OT4A 4YK4B 1HSBA 3WIHA 4B9FA 1A0QH 2OMUA 4MMZB 4DOHE 4FLQA 1ZT7B 5LGJA 3TEXA 4HIEA 4PRBB 1U8LA 3HKFA 3U9UA 2N59A 3KJ6L 4XAKD 3QNZA 1KTBA 5D4JA 4X50A 5FV2A 3KM1A 5HYFA 3OMNB 4TSBL 5CZKA 1USZA 4P3DB 2OR7A 1XMEB 3REWB 2G5RA 2ZUQB 4OCWL 5I5JA 1Y0LA 1INDL 2NY3C 3V4VH 5KUMA 3EYQC 1Q0YL 2BFGA 5DJYA 3NA4A 2WWMC 1FL6A 4FL4C 4EQ2A 1T5KA 3X1BA 4B0MM 1FG2B 3M45A 1QSED 4PAZA 4MKMA 2VLRB 4GW4B 4P5KB 1T6VN 4BWUA 4G8IA 1DL7L 2OMUB 1BVLA 4QRRD 4ELMA 1H15A 3RNQA 4N1HB 3EDDA 4HIEB 2EYRA 3ARBC 5D6CA 1U8LB 5IR1A 5JPMA 3RWFA 4X6DA 4KDVA 3JWNH 4OJYA 2QHRL 3DX2A 1AACA 4M43L 3QDMD 1OO2A 2WAHA 5FYJL 4ENZA 5B1JC 2GTWB 3QIUD 5GRWA 4C4BA 3TJEH 1Y0LB 1PY0A 3NN8A 4PW9A 3G5ZB 1YMME 3ZZQA 4WFFE 4U1GC 2JELL 2COVD 1S9KC 2N0MA 2BY2A 4FADA 1SEBB 3QFGA 3MFGB 4XNUL 4ELMB 3X14B 2CH8A 2GUOA 2W0FA 3S88L 4OLXL 3RWFB 5CFHA 1X5AA 4YHZL 5IROC 3B3IA 2VDKH 3T3PB 2DLEA 4O02H 4PGCB 3VG0L 3GWJA 4MTMA 3OR7B 4G6KH 1XGUB 1U95A 3QDAA 1L7TL 2ICEB 1MFAL 2FWLB 1USQA 4NPJA 1Y07A 1NANH 4Y5XC 3MUGB 4YUEL 1XAUA 1OAJA 5KANG 4HOZA 4V1DE 4X7SL 3HS0B 3LEYL 3OL2A 1A9VA 3Q1SH 1EEZA 2GUOB 5L88H 4ZMYA 2PXYC 4YXKL 2W9DL 1BD2D 4JO4H 1JPSL 2XT1B 5BV7C 4PS7A 3NJKA 5CCJA 2NT1A 1M2OA 4OZFA 4O51A 4UOW0 1BJ1H 1B0WA 1XMWA 1XH3A 3L4WA 3L3OA 4PS4L 2ORBL 4KAQH 1IO4C 3NA9H 4MNQA 5J12C 5IM7B 4AQAB 4XMUA 5GS3A 3D25B 2O6DA 2QSTA 1Z3GH 5J89A 5INCA 3OWEA 3UAAA 3LTVA 3C5SA 2CXGA 1JV2A 4B9CA 4H26B 4FLSA 2VT0A 1QLEL 3GHEL 5CR8A 3THMH 4YSRA 3V0GA 1Z9SB 4YX2H 5JUEH 2ATKA 2IAMB 3K8MA 3KLAB 4KVNL 5DS1A 4OAWB 1OTSD 4N9OB 5GQBA 1JGUL 1I9JL 1KBBA 2BHFA 2JQAA 3BUTA 4PBWD 3MUHL 1HZHL 4HJEA 5ADOH 3LHAA 4OLUH 3G7TA 1KGWA 3T0EA 1NBZB 2NX5E 3MXVL 1KV7A 4GAAA 4ODHH 3TT3H 2X9YA 5K1JA 1TJHL 4WEEA 3L4TA 4HS8H 1HHGA 1SOSA 4LSPH 4XB8A 3FO9B 1EHKB 2DJSA 4MNQB 3T0BA 1AFVL 3SBWA 4GO6B 2IH1A 1UD6A 2QVKA 4JZJA 4OVUA 1A0QL 2BK8A 3D4YA 3FUDA 2I85A 2QPSA 1IV8A 4WI9A 2GIXA 2BNRE 2A4CA 4U1JA 3P9WB 1WTGT 2PO6A 3S96A 1KXTB 2WXPA 2ATKB 4R4ND 5INDA 1XT5A 1X5IA 4GRWB 5GS0H 2YGNA 1MNNA 3P4NA 1KB9K 3T0EB 3V4VL 3IDUA 1F2XK 3CNKA 3F12B 4I48A 4TM9A 4KKCD 3JWNC 3MRLA 4GQ9H 3H9ZA 3QXDB 4LLMB 1C16A 5EZLB 5B3JE 3RL1A 2TAAA 1J05A 3DX9A 3BP6A 3O4LA 3SQBB 3NIFE 3MLZH 3O8XB 3V6FB 3LKSA 4LASL 8FABB 5KSUB 4HLZH 5GGUA 1B0RA 3K4ZA 4WW1B 5I2IB 5INDB 1M3JA 1YEHH 4ZW7A 3TJEL 4F9LC 4ZMOA 2QTEA 4HKJA 1KPVB 1OAKH 2H0EA 2NLJA 1I7UB 4KO9A 4LLQB 3SGEH 4FQXA 1MW1A 2WNXA 3QBTB 2NYZA 4I48B 4AC4A 2HT4C 4K71B 4CNIA 4G43B 1C16B 2DMCA 4QT5B 3QA3B 1BAWA 5T1LD 1J05B 3ZKND 3DX9B 5LG1A 1JD9A 5SWSA 4EVNB 3LQMA 4YL4A 3ZVVA 3QDGA 2JJTA 2VDKL 4P5SA 4O02L 3VWJB 5B39G 3PUCA 1UH3A 3QS2A 1B0RB 4G6KL 5IJKA 5F7FA 1CFSB 5TDOA 3QEUB 1TEFA 3ZJAA 4Z1PA 4X5XA 5D1QD 3CIAA 4NCDA 3CAFA 1N5AB 3K1DA 5IBUG 5JQIB 2AXWA