3JYBA

Crystal structure of the rets periplasmic domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
138
structure length
138
Chain Sequence
QNWRLLRDESAQLRIADVLQRKEQFRPLAKRSFIFPASPQAVWLQVQLPAQKVPSWLWIFAPRVQYLDYYLVQDGQLVRDQHTGESRPFQERPLPSRSYLFSLPVDGKPMTLYVRMTSNHPLMAWFDQIDEAGLVGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and oligomeric state of the RetS signaling kinase sensory domain.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords Sensor protein
total genus 30
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07696 7TMR-DISMED2 7TMR-DISM extracellular 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2380 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3jybA00
3JYBA 2XBZA
chains in the Genus database with same CATH superfamily
4YXHL 3FW6A 4R7VA 1JVLA 4P3DA 4KX9A 1C16A 2VLKD 1CURA 1T4KA 1ZTXE 2GSMB 4FQ2H 4JM2B 1LILA 1BQLH 2HX9A 4NYLB 2BW5A 1ZLVH 3TBBA 2ICEB 4KU1A 5D1ZC 3KWVA 5LQBH 2ZXBA 1P5UA 2XKNA 1K8IA 1L6PA 3STZB 3BLBA 5K59F 3HUJB 1ADQH 3QNZA 2PXYD 2KLSA 1BX2B 1I85C 1WAAF 5JORA 1IBGH 3MUZ1 3MBWB 4P48A 3WJLA 2GC4C 4K8RH 1PNDA 3SDDB 3U9WA 3V9CA 3ZHLA 2GT9B 4N0CC 5LDSA 2HT2D 5BJTB 2X44D 3ARGD 1J0JA 4CC4C 4ZD3L 1A6AB 4X6EB 4QXTB 3NFNB 4Y1SA 1CU4L 1A14H 4Z7QE 3MJ7B 2QV4A 3MRLA 2WGXA 2WO3B 2LAAA 3VWKA 3VWKC 4CNIA 4D3CH 2VERN 2H0EA 4WW1B 3HI6H 3LB6D 3RX5A 4M6OL 1N6UA 1CGTA 4FP8H 4JL2A 3RHWK 2Z35B 3VI3B 3CSYA 4Y9BA 5DWUH 1DLFL 4ES8A 4Z7WB 3PHOB 3DK2A 4TLSA 2WIIA 2CRIA 3T0ED 4B9IA 2GFBB 2MTAA 1LEKA 5E4EC 2ZAHA 3B7RL 3HG5A 3D7PA 1I85A 2HVKA 1OM3H 4PJ5A 3AROA 3EO1B 3J07A 4F8PA 1JBJA 1VFOA 1LVEA 3VXMB 3O4OC 4KNSA 3HC4H 1MNUH 3UTPE 3HA0A 4GBXD 5C0AE 4OUUB 3BQUA 5LGYA 3MLYL 3MI6A 3V0JA 1OGAB 3FTGA 4FQQB 4JRXD 4HU2A 4WW2B 3K7UA 3KWUA 4IGBA 3S98A 4A2GA 4OCWH 3QDAA 3RVWD 3CC5B 1AXIB 5IR1A 2Q3XA 3H9SD 4N25A 4QI3A 5FYLL 4HGWB 3P11L 2OQJA 3AM8C 2FJUB 4MMXC 4OGAC 1LNUB 5TH2B 3QIWA 4KFMA 4S2SA 3SDCA 4HOMA 1LK3L 4DN3L 2CNYA 4JQVA 5ESAA 5I82A 3GHEL 4WEBH 4OLVH 5D7JB 2XV2A 5KEZA 4UBDC 2BNUA 5EU4A 4MGXA 3HNVH 4XHJD 3K3QA 2I5YH 1IGMH 2YMXL 3GJFH 3MRGA 5C07E 2LV4A 2QZQA 3DTXA 4LDLB 4HT1L 5H37H 3E8UH 5KSBB 1MCPL 4QWWD 3R7RA 2H8PB 4P9MH 4UBDD 2NLJB 4WNQB 1VFBB 1Q0XL 1UM6H 4GSDH 1X4ZA 3PQYA 4HK0A 5MEND 1SDDA 4OF0A 2WTOA 1AAJA 3LZPA 3V7AG 1W72B 4AK1A 4FA6A 1I7TA 4JZOA 1QSEB 1UWXK 4JZOB 2ZUTA 2DQDL 5E8OA 3VRJA 5IF0B 1U8KB 4XPFL 3OKNA 1ZK9A 2F53B 3VI4B 3WN5B 3G9VA 1L9NA 2NNAB 4ZMTA 1RZQA 1S7SA 4NQED 25C8H 4U3SA 1HH9B 5DZOA 3WNKA 4P59L 3G5XA 4GI8A 4X98B 1AIFB 1D2PA 1UENA 1XCQA 4N2OA 1TMCB 3TO4B 3ZVVA 4TNEA 4DCQB 4DP9X 3O4LA 1SJHB 4GUQA 1N19A 2YRBA 3D5OF 4Y4HA 2YGNA 5HDWA 4AYID 1ETB1 5L0QC 2Z31D 1L0XA 1L0QA 5DK2B 2HXAA 3E6HA 1BF8A 5DZVA 5BMFH 3BGMA 1VKXB 2A73A 1DUZA 3L1OH 1ND0A 4PJAA 3VRJB 1UGKA 4QDGA 3HI1A 3V9EA 5A2JH 4YHLL 1OGTB 2ZP9A 3BUQA 3FKUS 3I2CH 3Q8AA 1J05B 4ZFFB 3FRPG 2VT0A 3P0YH 1ZLEA 2CRYA 4Y19D 5D70L 2F5AH 2PTTA 3D34A 4MCNA 2DW5A 4IGBB 2Q10A 4R2GD 3RDTC 4JZJB 1ZT7B 4W4OA 2V5MA 1MZZA 3QFJE 1TJHL 4OI7A 1KXTB 3IDIB 5CN3A 1KELH 2HJLB 4NC0B 5I73B 5BNXD 1BZ7B 4HAGA 1S5IL 2EIBA 3HE7A 3U1PA 3UP6A 3HLAB 2BSED 5HYQA 3CHOA 2WCGA 2YK1L 5CP3A 3UXFA 3CVBA 1C9SA 3ZO0A 1H8LA 4TUOB 4Q9QH 1KB5L 4YHZH 1UJ3B 4U2YA 4Z7WF 4L37A 1U8QB 4KKZA 4R3SA 4L37B 1MCWW 4NZJA 2RCSH 4WO4A 2C3WA 3VFTB 1KTDB 2IWFA 1E27B 4YE4L 4Y4FB 1E27A 4G8GD 1R3JB 3EGSA 4V1DB 5EOTB 3THMH 2WTPA 5HGBB 1BHGA 4XPHL 5KW9L 5IJKC 4X6CF 1MQKL 5AG9A 2D3VA 1K2DA 1JHKH 1ZJBA 1PKOA 2DBJA 1OPOA 4J39A 5I24A 3SE9L 1YCSA 1IL1B 5IKCA 1I1AB 2WQUA 1L7IH 3QVAA 1U0QA 2Y6SC 1YY8B 3BUIA 2Z8RA 4KGLA 1YDPB 4UM9A 1T5KA 2Z3FA 1UXWA 5J6HB 1FYTD 4BXVA 1CD8A 3VSUA 1PQZB 5EBMA 5T33H 2A6KA 3C09B 4IRZA 3F01A 1AMYA 3V6ZA 3QZBA 1CDGA 4J3VA 5I18H 5E2WL 4BH7B 1DFBH 3Q9QA 3UDWA 5JHDA 3W0WB 1TZ8A 3C60C 3ES6B 1EEZA 1SUJA 3VDAA 2HJFB 5DSCA 3CFQA 4OAWB 3STBA 1I8MA 4R5VA 2F08A 2DH3A 1FFPB 4PGDB 1KUMA 3FQ1A 4WJG3 1K4CA 4AV5A 3C60D 3SD2A 2B16A 4UF7C 1BOYA 2GB2A 1KXQE 3QQ9D 1KWKA 5IF0A 3O3DB 1BD2D 4G59C 4XOAA 3THML 1BDYA 1WT5C 3JWNH 1VHPA 5CSGA 1XCQB 3TO4A 3GB7B 5IFJA 4AH2A 2DIEA 3P54A 4BYHA 3ZKXC 1M1XA 4NP9A 3X2QB 1SQ2N 2JVUA 4NJAH 1BMZA 4ZW3A 5JW5B 1KIPA 3H85A 3RWEB 1H15A 5I8EB 5JW3L 3N1MC 1W6LA 2XI9A 2QTVA 1W16A 2FECL 1P4BH 4NCC2 3SBQA 4Q6IC 1OK8A 1ZLSL 3KNBA 3BP7A 3RGVB 1KCVL 1SXBA 5FB8A 4U6XA 3BZFB 2YK1H 3IDUA 3PUCA 4IBSA 4KV5F 1C8QA 1L6XA 4QRRB 4PLOB 2IALA 4YN3A 2J8HA 1JZ3A 1AANA 1ZS2A 2NY7L 4X9HA 1X9QA 3QI9A 3V6FA 3MC0A 5IB3A 1HCVA 2Q3AA 4PVLA 2MEJB 1RIHL 3OR7B 1A6UH 4NLAA 1LO3L 2TAAA 4H4NA 5EF1A 1BVOA 4N2IA 4OUOA 1HESA 1M56B 2FGWH 2VR3A 4OCXL 1YYMH 2D0HA 1AI1L 3EOTH 3VYOA 3MV7A 1L4IA 3JQOB 4YHPB 4LU5H 3UTSB 1JRHL 4WK0B 1J0HA 3ARSA 1NLBH 4NO5B 1HSAA 3BMWA 3CHXA 1F4AA 3FN0H 4PJ7E 5DZPA 3KBHE 3LDBC 3QJXA 5FWRA 2ZWSA 3HBPA 3R1GH 3QCTL 3TBVB 1KY6A 2VABA 4NHUA 4JY6A 4I4WA 4NHUB 3VO0A 2VLJD 5ILTH 4WHTA 2C9QA 3IDXL 3LQZA 4P2AA 1LGVA 1KACB 2CLRA 4OFVA 1RVFH 2P4AB 1MVUB 4AUYA 3DYOA 4E68A 2MQ0A 3VWJB 2PKDA 1K5NB 1U58B 1J10A 4JY5H 4U1JA 4FFVD 1OL0A 2W38A 1GTFA 3IKKA 5DO8A 3UTSA 1A47A 2FT7A 1YN6A 3OAUH 5H37A 4WO4C 1ODAA 1RZPA 2VIRA 3EJZC 3GHBH 4MWFB 1MHEA 2DYRB 3HPLA 4AYEC 1IZJA 3D1MC 4DKTA 2NY6B 4HFWB 5KANG 4EI0A 4RA0C 5DJ6A 1CLCA 2VL5B 4PH8A 3T77B 1FYTE 1A3ZA 3WDHA 3IVKA 2VDML 1DQQB 3GC3A 4EO5A 4N68A 2XTLA 3GJEB 1SEQH 1T0NB 1UYWL 4Q14A 2FR4A 1PZ3A 4XNBA 4Y19A 1FC1A 3T0EE 3IJEB 2VJ0A 4ALAC 1QZ1A 2IFFH 2VLRE 1TQVA 4FMKA 3RWJA 4M8VA 4FCHA 1A7OH 4RMTA 4CA4A 4M56A 4H5SB 5DVOA 5JZ7D 2G9HB 2DH2A 3P4LA 2NQCA 3HZVB 3QAZB 4YK4C 5A6IA 1ECZA 5CLTA 4X6BA 1MFNA 4CMMB 5K9QG 3UJJH 3UBGA 5MEOA 3QFJD 2UXGA 4PJAE 2C9RA 1BM3H 4O2CA 2F5BH 3L9RA 2Y06H 1FC2D 4P4KD 4Z78A 5CLXA 2YSSA 4ODTL 1YUKB 3FQ4A 1QPPA 5D1QC 5H2BB 3BP5B 1NFDE 2GSIB 2R1WB 1K4CB 3KCWA 3V5DB 3S35X 3AB0B 5D1XE 1VGKA 4KTDL 4ONFL 1WIOA 2I26N 2BCKB 1JK8A 1ULVA 4I0PD 5T1MB 4Q58C 2EYTB 3MKKA 3VI4E 5I8KL 4KHXH 4NX0A 4PY8J 1M7IB 3PWLA 2RTTA 3DX7B 1X5GA 4ODXB 3RX8A 1ACZA 5IB5B 1A4JB 1E90A 4V33A 4JY4A 2ICWI 4O02B 4FA8A 2AEPH 2CJUL 2E6JA 3FOLB 3WSQL 1VRSA 3D3VE 4XMWA 2W81C 3DKHA 2ZXWB 2KKQA 2D7NA 4WTZA 5C0DA 4CSPA 4J3TA 4FRWA 4LEOB 2VZ1A 5GZND 5B8CC 4KNQA 2ADFL 4QOKB 4WI6A 2ED7A 2X87A 3FU5A 4N22A 4PJ8D 3S37H 4QLWA 1KG0B 2V2XA 1VGEH 4KUCD 2Q7YA 3WTVA 3UBXI 2VM4A 3ULUD 2FRGP 1BQUA 3V4UH 1NEZA 3B9AA 1LEIA 1QR1B 4ELMA 2OTUB 3O0RL 2DM3A 2X10A 2XKSA 4H26B 2VDNB 4XMVA 5T1MA 1G7QB 3QG6A 2Y7LA 5DURD 2YAFA 3AQYA 3VG0H 1ZXQA 3L3OA 3WL9A 5BUPA 2OXGA 5LUMA 1UB6B 3MTRA 1NC2D 1I1AC 3D39A 5H2BA 1OGPA 4JQVC 1P84K 4LESA 5GZNA 2X89A 4BCZA 4WQOA 1F1GA 1G6RA 1ZT4B 5I5IA 3K0YA 5CIPH 1D7FA 4L18A 1E6JH 3RB5A 1JRHH 1INEL 5CU9A 4QRSB 2XZCH 4MYPA 2P45B 3MOAL 4WUUA 4Y2OA 3JTSA 4JFEA 2EE9A 1IAOA 3QHZL 1EUUA 4MXQC 4XE0A 3TC9A 2ZXQA 5JTWA 3OMNB 4KMTH 2EADA 1RP8A 2W1NA 5T3XL 4MNQB 1KNOA 3RFZA 4EDXA 5G4OA 2X4RA 4A6YA 1MW2A 5JO5B 5CSZB 1A9EA 2BIQA 4OCSH 3LRSB 5FO9A 2XY2A 1FO0A 1A1MB 4JPSA 4MDIB 3CMGA 1P4IH 2ZJSH 4JRXE 4XPHH 4FXKA 4NZRH 3V2AR 4G80A 2H3NB 2JLPA 1BEYH 3EFDL 1NGWB 5DUML 3ZDXB 4AIOA 5D4QA 1U92A 2BS9A 3GSNH 4I1NB 2FBRA 4UQ3A 2VKXA 2WB1A 2Z7UA 3UZEA 2WCPA 4F1SA 4D8PA 8PAZA 1DQMH 3EF4A 1R3KA 1GY2A 3E3QE 2EXWC 2R0LL 2DYPA 4FOMA 4TNVF 4WFHD 3LKNB 4AI7A 3FU6A 4HIEB 1I3RA 4UILL 1S78D 4X7SL 3DURA 4H2CA 1OP5H 4G1MB 1IIIA 4EVNB 4X5WA 2ODIA 4NKDA 3NUKA 4DP0X 1JGEB 2BMKB 2FB4L 4CKVX 3SEPA 3BDYL 1ZSDB 1IC7H 3ZZLA 1JPEA 3QDHA 1E42A 3BPCB 4PV9A 5D8JH 4WSGA 4LF3B 5T1JA 1CO1A 4UT9L 4QHNA 5CEXA 3MRHB 1QUPA 1YG9A 1BGXL 1ES0A 5IHHA 1BFOB 3PIQA 5A2FA 1YEEH 4WUUE 3W9DB 1BFTA 1ZE3C 4JFHD 1JN6B 3AU0A 4KI1A 3QZMA 4QIRA 3DPDA 3CFUA 4J3OD 1ZVNA 2OYKA 2NY1D 5F96H 4M6ML 1RL1A 2OXHB 2CG9X 1TEFA 4YGAB 3HB3B 2IGLA 4PCTA 1QRNE 5HBBA 3K6IA 3GMQA 5FYKE 3X3FL 1DQDH 4Z95L 2VLME 1YEDA 3DX3A 5J3HD 1ZV2A 1A7NL 4F7TA 1RK0A 1VESA 2XTJD 4MQXC 3J7HA 4G8AC 4W9HC 4YZFF 2V7HA 1OALA 1KCVH 4YUEL 3ATAA 2YAOA 1XZ0B 2HYMA 3EYFA 5FA3B 5I26A 3QJSB 4NQCD 2WVUA 4NDMA 4G72B 2SEBA 5KUKA 4Y1AB 3F2LA 2PPCA 4PJHA 4HS3B 1UEMA 5D1ZD 4AH2B 4HWBA 3VM7A 3NCEB 4XPFH 2ZF9A 3VD3A 3NJLA 5TFSL 2OAAA 1BW8A 2BJMH 1XGRB 4J4PD 2ISDA 4Q9QL 1MRCL 2AJ3B 5D1QA 1U41A 2JXMA 2VAAA 2X3CA 2V33A 3UC0H 4NXSA 3W5MA 3K5RA 5AW6B 2BY2A 4XRCB 1SN2A 1XBDA 5B4MD 4KGJA 4G1EB 2SEBB 2AGJL 2CLVB 4N2EA 3L9BA 2BH0A 1SN5A 3NYKA 3P4MB 3OX8B 4P2QD 5F9WC 1TTUA 5K93A 1EGJH 3RI5K 3ZTNH 5BVJA 1OAYL 2YKLH 1G1YA 4PPTA 4LBEA 3MROA 3IGAA 1WFIA 3NCFB 4L9LB 1FJ1B 1UCBH 3RTLA 4GKSA 4QRPD 5D8JL 4KVPA 3UBXB 2I9TB 5F97E 4ODTH 1SN0A 2VUYA 1TVBB 1FDLL 1UM5L 2DBLH 1LO0L 3MREB 1BFOA 4L8DB 4LOVA 1D5ZB 1G7IB 5DJ6B 3J8F7 5LBSH 2X1XR 2J25A 3QA3B 1XGZA 1KIRA 1PD0A 4Z0XA 4IRJD 4RGOH 3PP4H 3RQ3A 3VH8G 3LVTA 1SNRA 3PNWA 3E2HC 2R23A 1RAMA 4YDIH 3WHE0 2HCZX 5E7BA 5A43C 3H2PA 3QZOA 3UPRB 1WGVA 4B41A 4GQPH 3SDDC 2DYPB 4MB5A 1UJ3A 3DECA 4NQXA 1ANUA 2X4OA 4DF9A 1CLOH 3GDCA 2EH7H 4G1MA 2VH5H 4EVNA 2OP4H 4YE0A 4C56A 4BKSC 4WWPA 1Z7JA 5IW1A 4JFFD 3RUGE 1PSKL 2R29A 1OF2A 3AXLB 4BCXA 4WFED 4NN5B 1PLGH 5IMOA 4AITA 2DJ4A 2EXTA 4CUCA 3T8MA 3ZHDA 4CDGC 4OD3H 1P6AB 4Z7QB 4WKZA 1CMOA 1AGDA 3NEOA 4R4BA 1K5WA 4W68A 2NZ1A 3D8MA 4HIXH 2QADB 1YSOA 4GOSA 3C8HA 3UGXA 1QI5A 5DMGD 5BMFL 1ZA3B 1YNLL 4LASH 4NRXB 4QHUB 3ZYZA 1U8PB 2VSDA 3W11C 1MELA 1TDQA 4PJDB 2FATL 4XWOD 3L1FA 1SPDA 3L5WA 3DLQR 2EDHA 2NY5C 2O6PA 3L3JA 4PGZA 1HEZB 1QSFA 5HSFA 2EKSA 3LS5H 2AJUH 4OIIL 3ATBA 3Q5OA 3W11D 5CCGE 1T1XB 4YSAA 1E5UI 3P4MA 3QRLA 3H9HB 1HL9A 1EEYB 3MLZH 3RVUD 2AK1H 1H15B 5I8EA 5I76B 1R5VB 3N5AA 2F53A 4ZUUA 1BQHA 1L7TH 1FAIL 3UEZA 3ZKNC 4JDVB 5IFJB 2Q8BH 4KK6D 3FO2B 3MCKB 3DUSB 4LCYB 1FNEB 4NHCL 3O3DA 3VFPB 4F15B 2P48B 3OJDA 5L6YL 1MJ7L 4DTGH 4FFWD 2YUWA 5LBSL 2BVEA 4GMTH 3UADA 3PL6C 2NY1B 1CE1H 1R24A 4AYMC 3RNQA 5B3JE 4RGMC 2Q86A 2EYRA 4TULH 1T4WA 5L8JB 1ZT1A 3LKSB 1Z2KA 2Y22A 4JHZA 3KPQB 5BW7C 5I0VA 3ABKB 4H13C 1C5BL 1AO7A 1OVZA 3GHBL 4JG9A 1AO7B 1I1YB 1TJIL 2XWCA 2PYEB 1TJGH 2D3NA 3ZUNC 5EBWB 4JKMA 1G9NH 4XNQA 3BQUD 2H3XC 5EN2A 1UOVA 1HZHH 1AGCB 1E5CA 4EIZC 2R2BA 3MREA 4Z3HA 1QLEL 4LPWA 2VISB 3DX1A 2F1EA 4X6FA 1HNFA 5FUZH 1KTLA 3S5YA 2IANB 4TUJB 3C6LC 1HWWA 1KZQA 3TBYA 4K7FB 3PXLA 1ZY9A 1E4JA 4AENB 5E6YA 2WBJA 3D52A 4FXGA 2EEFA 3D0LB 1MPAL 4MNGE 4DGYH 4DZBA 4R0LA 3DNKA 4XWGL 3IJHA 2YPLA 3QPXH 2YQ2A 3OZ9H 1OM9A 3DGDA 3ZY7A 1NCIA 4OQ1A 2CKNA 2P5WA 2C9PA 1LWJA 2H3KA 1HU8A 3W5NA 4EN2A 5CCJA 1S9WB 1VJSA 1OV8A 3D18A 1YECH 3ASNB 5D7IF 3TA3B 4DP4X 1NCWH 4IOFC 4RGOL 1SZNA 5F21B 1D5MA 2XYBA 1SXZA 4S1SH 3WNMA 1AGBA 2XXCB 4BQ9A 1S7TB 5ISZA 3TONA 2FT6A 2R2CA 1IX2A 2I07A 3OVUB 5E9DE 1F4YL 1EFXA 4DK5A 2JTDA 2OW6A 2WQ8A 5HJDA 4BBWA 3QXUA 2FEDD 3FHEA 1HWHB 4NQVB 3PQYD 5DEZA 1E3XA 2XWTA 1YYLL 4Y4KD 3P2DA 3KYKH 1KLFB 4RWYL 4HFWA 4YX2L 4N2BA 5C0IA 2EO9A 1MFEL 1FHGA 1SOQA 1FZMB 4XB7A 4G9FE 9PCYA 2P28B 1WFUA 5AOIA 4B97A 4M8QB 1IC0A 2GEQA 1DBML 2XT1B 2R29H 3CPLA 5D1QE 1JZIA 2GBUA 1MFDL 3L5HA 4RIRA 4GSQA 3M88A 1D7DA 1IVLA 1NKRA 2HN7B 1FV1B 3AY2A 1DE4A 1NC2B 1NDMA 1R1CA 3FUKA 1JNLL 1GR7A 5B1JA 5C0AD 3WI9A 1O6SB 4AG4L 3M17B 4CN1A 4MMZC 2FWUA 1UACL 4WJKB 3FU8A 3X1FA 4J3OC 1I8UA 4YWGH 1T0MB 5TE4H 2Q20A 4RAVB 1QPKA 3OR6B 5D2LE 5EF0A 4LSRH 4JM2C 2LU5A 2VCOA 2WXHA 3BIKA 1DJYA 1SJXA 5JOPE 1CFSB 2MPAL 4H25B 3RL1B 4G7YL 2ZUQB 1EX0A 2WLIA 5EU6D 4DJMA 3FYEB 3HJ0A 2JJUA 3DXAE 4HVBA 3EJTA 3HC3H 5I66B 1MCNA 2FUTA 5CXPA 2NNAA 1Z3RA 3FFCD 3L5JA 2D2CC 3Q05A 1EVTC 3TCLA 1KBWA 1LDSA 5DMKA 3UTSD 4M5ZL 3V5HA 1FG2A 3TJHC 3TF4A 3O9WB 2C9UA 5E0FA 2V2WA 1ACYL 1T5XA 3L3OB 4A68A 2FYVA 2HWZH 3DETC 3K71B 1FFNB 4DEPC 3ZIMA 3EAKA 3FF7A 4OCSL 5AEAA 2A6DA 3TLRA 1UA6H 3B3IB 4XR8C 4FE9A 1UUNA 4IRSC 2VC2H 4U7SA 5DK0A 2ZJSL 3MSPA 2P43B 2ILLA 4BFKA 1NAMA 2BNQA 5T1KB 5KYUA 3DX9B 3CFIC 1NCWL 4LP8A 3ZTNL 4Z3EA 1FFOA 4IQHA 1GAFL 4P5RA 5DD0H 1JXJA 3TA3C 1OLZA 2YS4A 3RY5A 1TPXB 5IK3A 1FYTB 1QUNB 3FONB 2X4SB 4HWBH 5E99L 1LO2H 4MXVF 1J1XL 4KK9C 5TQ0L 5KSVB 5TE7H 5F44A 4RMUA 1YVLA 3QIUB 3PDDA 1BECA 3AQXA 4WW2C 1CLYH 4TOYL 4WI9A 1IJNA 2H7WA 1N7MH 2CHWA 5F1IB 4CU7A 4WUKL 4QRSA 4H2AA 2BRRH 1TNMA 5DC4B 2Y07L 3NSXA 1XF1A 2PXYA 5HHXL 4ZXBD 2G4EA 1B4TA 4MS8D 3PRZA 5DS1A 3QWRA 2O6EA 3BKYH 1EA9C 4IRJC 1HOEA 2VMCA 3HKFA 1OANA 4RFEA 4MMYA 4QRQB 5HDBB 3HMWL 1DZ0A 3SKJL 2PPFA 2R1XA 4X6BB 5IQ9A 3LS4L 4M7JL 1ASQA 2XG4A 3BH9B 3TH2T 4Y5YA 2OP4L 4YHOL 5AL0A 3ASWA 2KC0A 2Z35A 3VI3A 4PLKD 3OTTA 3DIDA 2ADIA 5CFAA 2N56A 2G60H 5I1HH 2PYED 1N70A 5FGSA 3KPNA 1R0AH 2H2PC 4OQTL 5AYUL 2GITB 3DJSA 1COBA 4LPVA 2ZOUA 4H0LC 1WGOA 2FWSA 4OCRH 2B08A 4QGYA 3W9DA 4O02H 4AEEA 2V0AA 3F58H 5D4IA 2R1YA 3VQ1C 1GZPB 1XD0A 3G6JA 2NXYB 1S8DA 3R0MA 5HI4C 4LVEA 1G9EA 1EMTH 4LF3A 3SBPA 5IUSA 3KDMB 4ZUSB 1CFTB 4TL4A 1PZ2A 2FIKB 3C2AH 2BMKA 2C4FT 4I85A 4FZEH 3MYJB 3KM2A 1FPTH 5JZ7C 4WTZG 2JJWA 3FCSA 1MJUL 4HBCH 3CQFA 4PJ6A 1CICB 1F6LL 3NRFA 3MLRL 3HEIB 1J8RA 3ORJA 3RKPA 4X7DC 3MRNA 3LXUX 1AS7A 4P4RB 1VGKB 5D6DC 5E2VL 3NFPB 4YWGL 4AQAA 1G9HA 2FX9L 5D7LA 1FZKB 1YZZA 3ZU8A 4R8WL 4GG6A 4POYA 3I2CL 3MV9A 2OJEA 4M1GL 1FNEA 2A9CA 4NNXB 3KR3L 3Q2WA 3V6OC 4KZEH 2P3YA 4G7VH 2JKXA 1XGYL 1BIIB 3C60A 5DFWH 3A4AA 5GGUA 3V4VL 5CIPB 4JRYB 1I1CA 1R3LA 1GCYA 2C26A 3A22A 4OTXL 3RI5F 3BD5A 2WLMA 4MA8L 3MBXH 4IHOA 4ZI8A 3AXHA 5SX5K 6CGTA 4QGTA 1JZ8A 4LLMA 3ZMNA 4JFSA 3B4NA 2A73B 3KVQA 3CBJB 3LSOA 4Q7DA 5IY5B 3A0OA 5FA4B 2O5ZL 4X7EC 7PAZA 2G0KA 4XNDA 3DJRA 1LL1A 3VFRA 1NCBL 2HKHH 1SXCA 4XP1H 4X2UA 4IMLB 5DD3L 4HMDA 4LCYA 2YWYA 1WFMA 5E8EB 4MLIA 3MNZA 3GMRB 3GO1H 1SOXA 1MLBA 3SBWA 3NAAL 4IKJA 4IJ3C 1QFOA 3QEQB 3CMOH 3FO1A 5J11C 1B6DA 3HBGA 3PHSA 3VXSD 3G5YB 2XTJE 4C83A 1SVCP 2OTUA 1CF8H 2EIKB 5EWIL 4RZCB 3AREB 3MRMB 2NRDA 1HXMB 4QTFA 3HUJE 5CCHE 4ZDHA 1UT1A 4F92B 3A4FA 5H35A 1B2WL 2B3RA 1XHHA 2LW3A 2W07B 1ICTA 1A4CA 2BP5M 1N59A 4P2OB 4HH8A 4LLMB 4FFYL 3FRPB 5GISH 2GJ6D 4OFDA 3VSVA 3W2DH 4NO3A 5HGHB 5BZZA 4DW2L 3JTBA 1BJ1H 4ORGB 3V95A 1ADQL 4KY1L 4CADA 5CZVL 1S7XA 1RZIA 2YD7A 1OGAA 3JT2A 3V6OE 1A02N 4C4BA 3ZKSD 3VI4F 1ZXKA 3RZCC 1P9MA 5IMLA 1X5YA 5IB4B 3D6GA 2ZICA 2O5NA 4DSYA 3DUUA 5IMMA 1QBML 4LLVB 3ZSSA 1DVYA 2UXTA 5BRZE 1NUDA 3FT4B 5E1HB 1SJVA 3SGJC 4A55A 3FMGL 4HCRA 1ZMYA 3DO3A 4P23C 2WAQA 4OGQC 4NI3A 3B9VA 5L4MA 4YNYB 3LZFL 5E2UL 3K72B 2HJKB 2KPWA 1NPUA 1W0VB 2AEWA 2IPUK 3WNIA 3ISRA 3B56A 3APMA 5J0BA 3REWA 1UD8A 2R4SH 1CWVA 1TZHB 2X2JA 4JVPA 4MSWA 3VXRB 2J5LC 3NK4A 1SFHA 2CHXA 2B1HL 3GXFA 3O6LH 3I84A 4G2AA 5GGVY 5EU6A 5GGSY 3U46A 2X3BA 4QTIH 2X0UA 3LIZL 3DO4A 3DX8A 4Y19E 2GEEA 1EXGA 5CN1A 5LXGH 1XXDC 2FH6A 2WWKT 3IEAA 3SY0A 4PJHF 4FG4A 4F2MB 5HYSA 4HKJA 4BZ2H 3PFQA 3S5LB 5TDPB 3HNTH 4YDZA 2H0FA 4PGCA 1I7RA 3C5ZD 2VAJA 2XETA 4ZW7A 3WTYA 1DBBL 3POCA 1FNAA 3NBNA 1BQLL 1FL3A 3G04A 4LRIA 1Z9OA 4ZAKC 5T3ZH 4F8LA 5I30L 2ZOLA 2BJML 3OMAB 5FYLD 5KW9H 2Z7WA 3GXTA 3BUDA 2WANA 1AS6A 3F62A 1MCIA 2QHRH 1IM3B 4G42A 4XPGL 4GUOA 5FF6B 4Y5XA 2ITCB 4Y5XC 3U36A 2AK4D 2QADD 1HKLL 5F89B 4B9CA 3WY2A 4LRNL 4X4ME 2CSPA 4HJ0C 4PTUA 3T65A 4QAMB 2RA1A 4Z7VE 1Z9PA 1R9FA 1ET7A 4YSCA 1JV5B 4PJIA 4IBYA 1TZAA 3MX0A 1N5YH 2V7HB 4B9FA 2Y36L 3ZOAA 1EZUA 4NO3B 3AQZA 1E5AA 3Q43A 4U2ZA 1JGUH 1BZ9B 2X6AA 5BO1L 1AQDB 2B1AL 4HIIB 4L3EE 3ARBA 2VERA 4N0CD 5E51A 3U4AA 3ARXA 1FIGH 1YNTA 1DN0A 1PZ5B 4KJWC 1CF8L 1G1OA 1RJLB 1WUNT 4S0HA 1RK1B 3OD3A 2AGJH 5K39A 1HZLA 3NJNA 5F0JB 1U95B 2IBZY 3KLQA 4Z7WE 4S0SD 5PAZA 2XTSA 3MV9E 1DUYB 3UEQA 2DMGA 4Y5VB 4V1DE 2XWDA 4WWNA 1B6UA 5AW4B 4HS8L 5C9KA 3LB6C 3O6FA 4LXFA 4I9WE 1DQVA 3AG3B 1NSNH 4X4YB 3LPPA 3MNWA 4OCRL 2QKIC 3BKJH 4F8TA 3ZL1A 5IBLD 3NJXA 5ESVB 2HLEB 3MA7B 5F9WB 2W91A 4GRMB 3P9MB 1JHLH 3CD4A 1KMGA 3RL1A 3P9MA 3BQUB 3II1A 5C0AA 4KX8A 3TBTA 2AXFB 2N0MA 2IBZX 4JKKA 4DPRA 2E9JA 5DVNA 4X5PA 5KJRL 4RNRA 3LQAH 2MIZA 4U1SB 2AJSL 3KGTA 5SV3A 1P7QD 2X0WA 2I5YL 2H0PA 4PJEA 5D7SH 2EDDA 3EYVB 1YEWA 4PYGA 4W81A 3T3ME 2JB5L 2WBKA 1Y7VA 3CN0A 2XN9D 3WAJA 1RUAH 5EIIB 5ICYA 3T8XB 3WXVH 2B9AA 2H6PA 2JNZA 1DVTA 1RU9L 3FU9A 3AAZB 3ETSA 1HT6A 2AERT 3CSYB 4PLJC 1NAML 1BIIA 1MIMH 1XH0A 2J1XA 2VLJE 2HAZA 4XN2A 1CVRA 3BLPX 3LQAL 2JQAA 4FXGC 4QR7A 5H94B 2AABL 1T21B 1FNLA 4OLZL 3VTTA 4QO1A 1H3TA 3OGCA 4U3XA 1JVOA 4PRHA 2WLKA 4LSSH 3NDYE 5AYQA 1AR1B 4M43L 1MJ8H 3P77A 1KJ2L 1QOKA 2ZP0T 3OAZK 2UWEA 4LEXH 5JPMA 3PE9A 1K72A 1N2RA 2FQFA 1NKOA 4GRLA 4UNVA 2EDTA 4K7PX 5IQOA 3O81A 1KGIA 5KBPA 4KH2A 3QNZB 3WFCH 1V3LA 5C09B 1HVXA 3R8BB 3CC5A 2UZXA 3JWNC 3C6SA 5GGVH 4X7TB 2OXGB 4FJ6A 5EEUA 4Z9KB 3OZ9L 3DSNB 1J9RA 4JN1L 1D5XA 4WI0A 1YN7B 5ALCH 1GS8A 4F7CB 5I6MA 4BM7A 1C1EL 2A6JA 5TQ2H 3QO1B 5F7AA 3US0A 4FP8L 2JH2A 1BD2B 4LLDA 3LEVH 3RAJH 3UBHA 1EERB 4P2RE 3SKMA 3QAZC 4YK4B 6FABL 5AZ2L 4YC2C 3EJRA 4FQ1H 1ED3A 4YIQB 4AY0A 3PL6D 5JLZA 3LPOA 2PMZA 3RWIA 1HZHL 2OK0H 2CALA 4FLRA 3DX0A 4MCYB 2O5XH 5KSAD 2ZX6A 1CFMA 1EPFA 1BF2A 1DVQA 1TQUA 3PDOB 3U1SH 3UABA 2ZCHH 5JMRA 2PPEA 4IOIA 3QGVA 3NJMA 4AZ8B 1LHZA 3KPQA 5T3ZD 4KKQA 3ZJAA 2AJUL 1NCOA 3CBKB 1T83C 5ITBL 1M05B 4CSSA 2AJVH 1CGWA 3BQUC 1CXIA 1MVFA 2N1KA 3KD4A 2PABA 5FKAA 4KQ3H 3QQ4B 4A2DA 3WN5A 2EH8H 2IDSA 3D2UB 1J5CA 2P9RA 1UACH 4NRZA 3BQVA 3LKPB 4B53A 3HC2A 1A5FH 1JYXA 4JLRB 1E4KC 4E9LA 1V54B 4UUJA 3F7KA 5IVOA 5I15H 4GRMA 1MDTA 1S7RA 1FBIL 1J5OL 4PV8B 2V3EA 4N2MA 4UV7L 5K9OB 5MEOB 4NQUA 3QH3A 3UAAA 1SM3L 1E8ZA 2CKBH 4LSUH 5D2LF 2FBJL 2Y1YA 1WH0A 3S36X 2WWKO 4FEIA 1FVCB 2NTSP 1DLFH 3AXIA 4IDJL 5ES4B 4YSEA 1WT5A 3U4EA 4FG2A 3LDBB 4IBTA 2X5PA 3KCPA 1K85A 4HKXA 4JCLA 2YGOA 1AQDA 4HIIA 4GW1A 1RKRA 4PRPB 2J55A 4C47A 4PW3A 5D1XA 1ERNA 1AGEA 5D2NB 1MRDH 5D2NC 4AW7A 1JPFA 1B4RA 5CEYA 5ESAB 4TVPD 1AOHA 4ZMZA 4LLQA 2VJ8A 2OQJB 5TH2A 3WIHA 2Y1VA 3MRKB 3V8OA 5G2NA 4M4RB 4X8XA 4MZ2A 4A7GA 3VH8A 2DICA 1R3LB 4KNTA 4N2DA 1ILSA 4XNZB 1MH5B 1NGXB 2QTEA 2XIDA 4GT7A 1A7QL 2ARJA 1SYSB 1CDBA 4ODHH 4GYBA 4U1KA 3I74A 5TPWL 3EADA 3BZ5A 1O7SA 2HT3D 1R5IB 2CPCA 2HKHL 3BVNA 1FZKA 1SJMA 2WP3O 5KYYA 4GINA 3A47A 1J9TA 3BWUF 1KT2A 1FLRL 2GTZB 4PM1A 1JWUA 1EJOH 5C3TA 3BUTA 2IFFL 3C6SB 1IM3A 2A6IB 3QDJE 4TVPL 4NQDB 4C55A 2N7AA 1OD7A 3IBOA 3Q5YA 4WDIB 3PGFL 2OL3L 4B9PA 3L4ZA 4HG4J 3PV7A 1QTYT 4OLUL 3NIDE 2AI0L 4GRWF 4ONGL 5CGBA 4YFEA 4UDTA 2E75C 3K2MC 4F37F 5LGHL 3EO9L 5FKPB 3QI9B 4FQLH 4Y1TA 4XNMB 5AFAA 5ALBL 4I2XA 4XCCL 3ZKQD 4R5TA 4QRRA 1ZGLP 4UANA 1ADQA 2GT9A 2DB8A 4LIQL 4AIZA 4LNRB 4CU6A 5DRXB 1RXLA 3ULUH 2C1OA 4YH6A 2R2HA 1RI8A 1ZWIB 4Y2DC 5JUEL 2ED6A 3T4AC 5J4MA 1TQCB 5L8KB 3PWUB 4M5SA 1K8IB 5B4MC 2D7MA 2WWMD 4MBOA 1CFNB 3D0VA 1A6AA 3BE1L 2APSA 4PWGA 3SGDI 3IMVA 2J8UE 3SJVE 1RZFL 3WFDH 5DJYA 1QWUA 3BVVA 4P9ML 1DYZA 4LL1A 4J3BA 3CDCA 4NUJA 3S36L 4IS6B 1KCSH 1LQSR 3GS4A 1YY8A 4PJEF 4D8OA 4WCYL 1PL3A 2LLGA 2FEEL 4QPEA 4JREC 1B0RA 3WXVL 1A7OL 4KKPA 5EU3A 2BSTA 2G4GA 2MNJB 4G8EA 2A4EA 4G9DA 2VDKH 1YPZA 4KO9A 4TNFA 4KQ0A 4BSWA 2KLTA 5KZCB 4FXGB 4WSKA 3BE1H 3KPPB 2X4QA 2HRGA 4NN7B 2AFNA 3A21A 2DZEA 3PHQA 3L81A 4IRSB 2YPKB 3V0GA 3X1BA 1CGUA 5IMLB 2HRLA 4P46C 3ARPA 1JHLL 1WBZA 4TXVB 2HWZL 2XWJA 1KEML 5EBMB 5EBWA 2JB6B 4MQ7B 3Q2CA 3JYCA 4I3RH 1Z3GH 3SIKA 4ABQA 1DUYA 2CRZA 2QJDA 4PGEB 3L1EA 5CSBA 2VZTA 2E47A 4HUXA 2HJLA 1CPUA 5JHBA 2NX5D 3JTTA 5CGYD 5DQJA 3AS0A 1QTSA 5F9OH 3C12A 4HALA 3T0WA 4NOBA 4JO4H 1KOAA 2MQGA 3KVPA 3ERXA 2LLLA 2E4TA 5DJAB 5DT1L 5T3XD 4EBQL 2DQGL 1Q38A 5BRPA 2CCWA 4H8PA 4PJIF 3TA4D 2RACA 3PWJB 3TT3L 4IBVA 1MY5A 3CLEH 3H4HA 3LKRB 4XPTL 4NFCA 4F3FA 1AD9A 2Q8AH 4H0GA 1UCBL 2GTWB 3G5ZA 3UO8B 1SFDA 1TZGL 4LDOB 4DKFL 5KG9A 1BAWA 5F6IC 2FL5A 4KXZI 5E2WH 1YA5A 2NX5A 3WO3B 1FAKT 5DDHA 5KAQF 2ITCA 1T7ZA 5GRYA 5HGAB 1LLAA 4QYOA 3SKOA 4QY8A 4UNIA 2K9FB 3D3VA 5F9AC 3H42H 1Q72H 2PN5A 4M02A 4OZFA 1LK3H 2CLZA 5DEJA 1UHVA 1RZGB 4HCGA 4R2GB 1IE4A 3M17A 5TDOA 3TWCH 2DDQL 5TDOB 3ESUF 1BMGA 3IFPA 5BCAA 3FDWA 3BO8A 4BKLB 1T5WA 5DQ9B 1CLOL 4ANKA 4K3JL 1IGCL 2NZ9C 4HSCX 1JSYA 3H3PH 4LT7A 2FBJH 3QZLA 1DN0B 2ZKHL 1IAOB 3VDCA 1E3ZA 4R4ND 1GMIA 4U6YA 3K74B 3K71A 4H8HA 1FA4A 3RUGF 2VN7A 5MEPB 5C0CD 1D5BA 3UZEC 3QIBC 5HHME 5DJ2A 3MX0B 1FZJB 4X4XB 3MRNB 3S35H 2FJFA 5DYOA 4GIAA 5DJ0A 3WJMA 3WG7B 3II2A 5AOZA 1H5BC 1C5DB 3LQMA 5IB2A 3WENA 4CN6A 3IPEA 2EO1A 3QIBD 2NDGA 5GRJL 1ZCRA 1IFHL 4KWUA 5BRQA 3G6DL 2R4RL 3JZ7A 4C56D 4BUQA 1A21A 5C2UB 2WSDA 1D5IH 3IJHB 3UJTL 1XIWD 2QPEB 4LOFA 3F64A 5T5FH 3HS0B 3E38A 4NM8H 1BYNA 1ZA6A 3F7VB 3BIBX 4B6ZA 5KJRH 4X6CA 4JREB 2MRYA 3S37X 1EZVX 1KG0A 3F3HA 5TDNB 4A63A 3O2VL 4EDWH 5BOZG 1JI2A 4YSRA 3TT3H 2JJTC 4GKOA 3N42F 5GS2H 4FHJA 4RFEB 2V5TA 4PJ7B 4FMFA 5GGRB 4L5FH 2H9GB 2OJZH 1KCRH 1NCJA 5IBUB 2ZF8A 2J3SA 4IKLA 3MGOB 5EUOA 1ZDSA 3R0NA 5FR3A 4YBLC 2OMYB 2DY2A 1BZEA 3FRPA 2W60A 2ZONA 4PMFA 3L5XL 3V7MA 2D3LA 4PJCE 3CZUB 3LKOB 1M2VA 5LGJA 5EO1B 5BZWB 4NNYA 1DL7L 2APTA 4HZLB 1OAXL 4OF5A 3T8VA 1SBSH 2A7BA 3IFNH 3Q8EA 2E7MA 1LP9B 3WS3A 1G43A 4M43H 3B2UC 1J8HB 2IVFC 2UX6A 3DX6B 2EDWA 4MJIE 4PS7A 2C7UA 2ZPKH 2R9HC 1Z32X 3P3SA 1W91A 3F5WB 4AGNA 2AQQA 3IS1X 3EO1A 3GMNB 4LARL 1BLIA 3CLWA 1USZA 4MMYB 1KY7A 2VLRA 4QRQA 4XB3A 3KPTA 5DEFA 2FCBA 2VSCA 5H37G 3Q1EA 5F88B 1NANI 4MXWL 2Y5TA 1BLNA 4FQIL 3N9GH 1T66D 1JZJA 1TCRB 2XG5B 3MJ9H 1XEDA 4FXLA 1QFPA 3WE1A 2QKIB 3QJOA 4KKRA 3NCJH 5C0CE 5BS0E 1U8HB 2VRKA 3KS0J 4Y2LA 5CFHA 1YJDH 3QQ9C 3L2MA 4P3DB 1AG0A 4K8RL 1C5CL 4XC3L 2DEYX 1FG2B 2J57A 4IMKA 4W9JC 1E2VA 1DCEA 2J1WA 5FLVA 1NCUA 4Y8DC 4YEFA 3QRFM 3UZVB 4P23B 4QRPE 5ID1A 2HTLC 4F9LC 5ICXA 3HC0A 3W0WE 1A3RH 2DKMA 2NMSA 4GSUA 4FFZL 1ZLUK 1HFUA 4TRPL 3FQWB 3OL2A 3IDYB 5ANMB 4PRNB 4CU8A 3G7TA 3LKSA 4RMSA 3FYIB 2A77L 2AP2A 4ZMWA 1CGXA 1UD2A 3OMIB 3CGTA 5I73C 3U6XA 3MUUA 3HZYB 5CGTA 1X9LA 2ADFH 2CWRA 3Q06A 4HDIB 2YD6A 1Z5HA 4MXVE 3T0VA 3RVTD 1KCRL 1R46A 2JCCB 5J1TC 4HUVB 1FRGL 3S5ZA 1AS8A 2JTYA 2M2DA 1CDIA 3FN0L 3NSJA 1FL6A 2B0SL 1CFQB 3STLB 5C7XH 2EVHA 3FC8A 5C0GA 1LO5A 2ICWB 2YFOA 2ZXGA 3QK0A 5ISZE 2A4CA 4OZHB 1MW1A 4HJ0D 2KT6A 1LWRA 2B39A 3O0LA 2YPVL 4XCFL 3WO4B 1DVFA 3CZLA 1CU4H 4BGLA 4E41B 4L3CA 5LAPA 4KROC 3PDGA 5EDSA 1W8OA 5CLZA 1TENA 3QQ4A 2J12B 4G9FA 4L9LA 4N0YL 4WI8A 1FZMA 3CHPA 2R7EA 1AR2A 3A4DA 4KROD 5J89A 3ZIYA 2DQFA 3NCYP 5KYNA 3QUXB 3VGBA 2HN7A 4TSCH 3DVNB 3KS0H 1SXAA 25C8L 5IREA 5A2BA 3HZMA 5JIDA 2MWCA 3KWXA 2YR3A 4Q4IA 4BFJA 3WUZA 4HJUA 1MEXL 3SD5A 1S7RB 1KIUA 4NZTH 1WG3A 2V9RA 4WGVB 1UYWH 1YEGH 3MBEC 5I1CH 1GGIL 4BK8A 4UTAH 4LEXL 4Q4EA 1UOLA 3T9WA 2ZG2A 4AQEA 4KI5D 3GSNL 3OSKA 3P69A 3K6SB 5KUMA 3L3GB 1QKZH 4GBXC 4L48A 1TCMA 5IJKA 5DTFB 1F3JA 5IMKB 1URIA 2D7TL 3CXDH 1UT9A 3B2XA 4UM8B 4KXDA 1OW0A 4PJ8B 1W6WA 3AGVA 1IU1A 4HC1A 2QPDB 3WIFA 3GI9L 4TL5A 3WY4A 3KLSA 4Z77A 1MHPL 3ALWA 2EDEA 2WXMA 2VXVL 1HHJB 4U1NB 2MOGA 1CTOA 3MGTA 4OGAD 4U1NA 3FBKA 1JFQL 2AANA 4KDTA 3KXFB 4OSUL 4QRPB 1ZVHA 1KXVA 2NTFA 1U3HD 3GSXB 3IETB 3KPLB 1UXSA 2JMRA 5I6PA 4ZMAT 3DGCR 5E5MB 1E40A 1ZPUA 1KC5H 5INCA 1E6OH 4PBWD 3WNNA 3OLIA 2WSKA 1MCQA 4G6MH 5CBAA 3OKMB 3BHBB 5L4IA 4IRJB 4ADGA 2UZIL 4N20A 2X4UA 5D70H 3ARBC 3GI8H 1RHFA 1NWPA 1JV2A 4AQEB 4LVOB 1T7XA 3O9WC 4K3JH 2J20A 2ORBH 4JCWA 1RULL 4PJGB 2VRAA 2DL2A 4FNTA 5JXAL 3DPBA 4BKTC 1AHMA 5GZNC 2F8XC 3G5WA 4XRCA 3MYZA 2A9NH 4O2CB 1MOEA 5EPMB 5MERB 1NCDH 5GIRA 1RERA 2F7RA 2CO7A 4RSYA 5EOCH 1I9JL 3CXHK 5C9JB 4RGMB 4BSVB 4KY1H 3LCYA 5CZVH 4OKVB 3D69B 2JCCF 3GKWH 3F8UB 1BXXA 1PG7H 1WWCA 4JFYB 3V0FA 5J5EA 3DJTA 4PG2A 3PPEA 3VUAA 1WEJH 1ZV5A 2ZSWB 3WELA 4L3CB 3CVHH 2YRZA 3L3KA 1BP3B 1MAJA 4MQTB 4G6AD 1TQBB 1EEUA 2EYSA 4P4KB 4QF1A 1BG1A 4S0TD 3QUYC 1IBYA 1Q1PA 3ARUA 1JG9A 5E7FA 1BSIA 1MJJA 4OZIE 4CAGA 5KYUB 5TDNA 2YQBA 5J1SC 1JGIA 3IDNA 2WUBL 3K2UL 1S7VA 3QIUD 4LAJH 3SO3C 1RJLA 1MCOL 1UZ8A 3OJ2C 1FNFA 4ONOA 1NEZG 4JFEB 4MA7H 4ETQB 2CRMA 1UWYA 1K6QL 5C0FB 5C6WH 2K0RA 1BFSA 4NQTA 2F54D 3HPJB 4HPHA 3NZ8A 2DV6A 2GYSA 4E42A 1FL6B 1KIRB 2CDEB 5HDBF 2VLRD 2D73A 3X1NA 5BUAA 1YYLH 2GIXA 3COOA 1TKWB 4N90D 2VC2L 4LGRB 2IV8A 3T4YB 2PF6A 2DQJL 4KO6A 1FE8L 5D96B 3CZGA 3TFBA 2AQ1A 4MA3B 5DD1H 3WMPA 4R4FL 3T3MB 4PI0A 3OJMB 5GHWH 1PZ5A 5DZNA 4NC1C 1CFSA 1VERA 2DD8H 3MRGB 3OAZH 4NKOB 3TXAA 1GY1A 1TR7A 3FU3A 3DOHA 3GSXA 3H9SE 3IETA 3KPLA 4OZ4B 5C0EB 1AACA 4G70B 5DHVB 3GK8H 3UTZA 3L1GA 2QKIA 3TX4A 3U83A 4FULA 4NQEA 2J44A 1OQXA 4B3EA 1EWHA 5CHNB 5E1AB 3VXSE 3L16A 4U3HA 1OGAD 1NDMB 1LNUA 1QAWA 3S7GA 2PCFA 2EZ0C 3LH8A 4U6VH 4HSAC 4UAOC 2CJ3A 3FUHA 4PW9A 2CO1A 4M6OH 2ZKYA 3VXTA 2P8PB 1M7IA 3PWLB 1MVYA 1TJHH 3NCXA 1OIOA 4OCXH 3GMPB 4P23A 3V5KB 3VFMB 4AYDC 3PL6A 5GRVL 2FB4H 1WEJL 3CX2A 4YDVA 1CBJA 4F24A 4XCFH 4YHIA 4M5YL 3CE1A 1EFXB 1FF5A 2JELH 3MCKA 4M4PA 3JWOC 4NUGL 3DI3B 1GA2A 3BEWA 4KK5C 5DSCB 4ZX4A 4XO8A 4MZIA 5LCVL 4HS3A 1BQHB 3DPBB 1KXHA 4JBSA 3TO4D 3QQDB 1WIUA 4F9PC 3MMEB 2UZYB 3ECQA 1KCLA 3OKOB 4IOSD 4N86A 4PFEA 3SZ6A 3TNNA 1G5GA 2VGLM 3SDXA 2OYLA 1BXUA 3VFMA 4E2OA 4NWTL 1DJHA 1AKPA 1NCDL 2N0KA 3C6LA 2PR9A 2Z65C 2GK0A 2IPKA 8FABB 2HMIC 3C75A 1J87A 1B0GA 4A39A 4QJ4B 4DO5A 2VQ1B 2R2BB 1HN1A 1DVFB 4F8OA 4IIQA 5E00B 5IVXE 3EYOA 5HGBA 1ODUA 1XZ0A 4FNUA 4IRSD 3HBZA 4YXKH 5I23A 2ZOKA 1WFJA 3PPSA 2R0ZL 4ENEC 1H8SA 4MJ5B 1R47A 1UH3A 4QHMA 1ESOA 1JUFA 5KS9E 3A6BH 1PG7W 4P2OC 4XN7A 2F2HA 4X4XA 1IGFH 3F05A 4NKMA 4RAUA 5FYJU 1O7VA 2FH8A 4WAFA 2HKFH 3TH4T 4DO6A 3NCMA 1CTMA 1HS6A 4Q0XL 3P9LA 4U49A 4HEPA 2XZAH 3ME0A 3CK0H 2G60L 1A6WH 2F58L 3FRUB 1HSAB 4E9SA 2MKLC 2LFGA 3G08B 3H7LA 4QEGA 2IH8A 1IKNA 1CGYA 2OA9A 5CZRA 5J06A 1RHHB 1U6AL 2QGEA 3FQTB 3MRFA 4QJ5B 2IO5A 5FLUA 5AZ2H 2IWKA 1F1DA 2DJSA 5T1LD 4L1LA 3VB8A 1KNOB 3K91A 3H7BA 4K5OA 3FFCE 4X5WB 3QPQC 5ACMA 2DQCL 1Q9KA 3TN0C 3L95B 5KVFL 1B9KA 2RGSA 3F6JA 4MJHA 1PX4A 4MJJA 3VD1A 3T3MF 3G6JE 3BWUC 2LTQC 1MI5B 3DGGB 3ZXAC 3I6KB 2J4WH 4ZBJA 1MI5A 3QI9C 4CVXA 2E74C 1F90H 4ZMXA 4FLQA 1PZCA 4P99A 5C08A 2DMBA 4OY9A 4XZUA 2D31B 4KJPD 3HAEB 4PJCB 3KNBB 1A25A 1C12A 1AGDB 2EICA 4WJ5A 1TU2B 3GSNB 5J57B 3L6FA 4W9KC 5IM7B 2QQQA 1WZLA 2YN3A 4L4VB 1BLNB 5IMOB 1I9EA 4P2QB 1CFVH 1AXSB 1F58H 2IAMB 1IKNC 4GRWB 4LCUB 2VLRB 4GW4A 1KIQA 1WBYA 1QFUH 1RIVL 3T0EB 1NCAH 3MJ9A 3WFEH 3U7YH 1AOZA 4GG6B 1BAGA 3PQYB 1I7ZB 1IKFH 4WFGE 1P9MC 3MLPA 2W5PA 5AZEH 1RSYA 2NUTA 4OGXL 4GAYB 4TSAL 5IOPA 1ID5I 2RQEA 3R18A 5E03A 3EH1A 1KBPA 2VN5A 4PJHB 4TSBL 3FQWA 2JK5B 5KSUA 4W9DC 4HJIA 1Z3GL 4ODXA 4Z18A 4CVUA 5L7XH 2DQ6A 3MXVH 3MRIB 4ODBD 1T89A 3GEWB 4ALAL 2EYTA 3SE9H 5FGBC 2O61B 4R4NC 3RGBA 2B4CH 1S8DB 4PJDE 4UQAA 4BZ1H 3HN8A 4U1IA 1JZ6A 5BXFB 1K4DA 3VFOA 3JYBA 2ZXDA 4BFEA 2W65A 3QEUB 3ML9A 1W15A 2NZ9D 2CAKA 5JOPD 3B2DC 1CZ8H 4HD9A 3DSNA 4N1EA 3T6ZA 2YARA 4ELKA 3WDJA 2HB0A 2E9BA 5IHWA 4F33B 4YVNA 3U9PL 3PP4L 4P2QE 3AVEA 3S3DB 3K2UH 3B9DA 4TTDD 2QVIA 1JFHA 1DJGA 1H6EA 5ABDE 5HYJB 3CXFA 3MV01 1Y6NR 1A22B 1M42A 1OGSA 1F11B 4UM9D 1P4LA 3HI6L 1Q1JL 2JJTA 2X89D 5F3HA 2D2OA 3WGVB 1QLEB 1XR8B 2IG2L 1OSZB 2XSKA 3QP3A 5I6OA 3IGKA 3QO0A 1YNKH 3IVKB 3ARDB 3P0VL 2CDFB 1TVHA 5KSBF 1KXTA 3IDIA 3N9GL 1I3RB 3WFHB 1MNNA 4AEHH 4ZRGA 5C86A 2QKSA 2R4RH 3HLKA 4HULB 5A3ID 4BSWB 5LGHH 2J6WA 4PY8I 2FX7L 4XAWL 3EJJX 5DFTA 3QWOA 4F9PA 1GSMA 5M7QA 4QXTA 1DVUA 3LEXA 5IFHH 4X8JA 4JE4B 3PAUA 4Y9EA 5EIIA 2NNXA 1J5IA 3S2CA 4PJAF 1NGWA 2P1YA 1ETZA 2BRQA 1SLWA 5GGRA 4NUJB 4OVVA 4BQ8A 1HYSD 2WNKA 4NN6C 1FO0B 5DHVA 5IBTH 4BFIA 2GAZA 2R9HD 4N6RA 2W8CA 2XWXA 3WNJA 1MWAH 1F6AA 5DJDA 3WN5C 5FECB 4TQEH 3CWGA 5INDA 2JF1A 3M1CA 5SWZA 2H1PH 5H4YA 3LNDA 4QRFA 4FQCH 3KPOB 4JZNA 2FO4B 4PJEE 2EDBA 5IW6A 4KVNL 4KTEH 5DF0A 3BEVB 3RP1A 2V9UA 4JVUA 1IC4L 4IRZL 1G7PA 1LD9A 5FM5O 5L0QB 1JGUL 5BO1H 4GSDL 2YBRA 2ICCA 3Q2NA 4F80A 2B2XH 3T0BA 1MCPH 3LXAA 4OIFA 1N3NB 4R96A 5JIKA 1JDCA 5AKRA 1YJDL 3G5VB 15C8H 3BSGA 3QUXD 2X1QA 4MJIA 4JM4L 2OCJA 3DYMA 2QR0B 5EU7C 1T66C 2AJZB 1UGNA 2UY6A 4Y4FD 3SE8L 2NY1C 1NCHA 5BV7B 1DLHB 1HQRA 3FN3A 3EHBD 5ERWB 4CGUB 1H9DA 4ELMB 1VEPA 3RIFF 4X7FC 5KTEL 1R3KB 5GJSL 3OR6A 3GO1L 4YHPA 2GAZB 3GRWL 2X2YA 3P3UA 3KM1A 5JHLH 1KTJA 1IC1A 2HFGH 2EACA 4OM0H 1M7DB 5ITFA 5ID1B 1F1AA 4OV5B 2H1PL 3EGXA 3L13A 3NQKA 4POUB 4X5QA 4ZW6A 3N44B 1HC1A 1YJDC 1TQBC 1XF3A 3FOLA 3LRHA 5IB3B 3ZKXB 5F3FA 4PCSA 4O02L 1OP3K 4PD4J 5JO5A 4UT9A 2WNWA 4TSCL 4X4KA 3PGCB 5K5YA 1K6QH 3K8MA 5LXGL 5ACZA 4AVKA 4L4TE 3OB0K 3ZE1B 4XXDB 1A8ZA 4WUUB 4Y2OB 1MAMH 5B1KA 3LKPA 3RVVD 2BP8A 3BP6A 1YUHB 1RH8A 3MUGB 1T2QH 1G7MB 2XV3A 1EEQA 1HQ4B 5JQ6H 1FG9C 3D87B 2ZYRA 1TYJA 3JWNG 4IBQA 3GPEA 4O9HH 2VDNL 1A66A 3PP3H 3B43A 1OAJA 3IGUA 3ZYOA 2I9LB 2W9EL 3S3CB 5E2VH 3O6FB 2PW2B 4Z3IA 2B14A 4M5TA 5AAMA 2QV2A 2QVMA 3CLFL 4LMQI 1N4XL 4LVOC 3BAKA 2EIDA 3CFEA 4F2MA 1IMHC 2GJZA 1ZWIA 2OSLB 3CVIL 4R90H 4LB8A 5E5UB 3POHA 4ABWA 2BS71 3RWHB 4D0DA 3ARGC 3RWIB 1UT2A 1RK1A 2OTPA 2X2UA 1IM9B 1Q1JH 4O9HL 4F57L 3OWEA 4XXWC 2NYYC 4P07A 3MJ7A 1HX0A 2PO6B 4FQHA 4I2XB 1A4AA 4PP1C 4TLTA 1LE9B 4HPOL 3IF1A 1S7QA 1N10A 5FHBH 4L4VE 1DJSA 1MW0A 3MZGB 2I07B 1G9MC 2WMPB 4KTYA 3WYRA 2R56H 1CICD 3FS9A 1G5AA 4HW6A 1WVZA 1KEGH 5HYJA 2ENQA 4FG6D 3VD9A 3DV6B 4PJBA 1R19A 5D2LB 1W0VA 1R3HA 4JANA 4LZKA 4PJ9B 2J5LB 3OB0H 4JFXA 3QPQD 4OQTH 2BHUA 1U8OA 2JKSA 1CICC 4WNJA 1KN4H 4DZBB 3DJZA 4KQ4H 2VN3A 3ARED 2VXSL 4LSSL 4ZTOL 2DAVA 2BO0A 2FWOA 2NCMA 2DQEL 4AZUA 5BQDA 1JF1B 3EFFB 4BK5A 1GZQA 5D93C 2V8MA 5I1IL 3M6DA 3WV0A 1G9ML 2VXQL 2Q76B 4IBZA 3BFWA 4X6CE 1T20A 4KJPC 5ANME 4BZ2L 4JJOA 1IBFA 1N8ZB 3UX9B 2ZYIA 4PJ5B 3T2NL 5IIEB 1O6TA 4NQCE 1WSST 4H88H 1DHKA 4ZAKB 4JJHA 3CZNA 1CT8A 3IDMB 1RPKA 1U91B 2UWEB 1FBIH 3NCCB 2EIJB 4RDBA 4CMMA 2H41A 1QLRA 1E4WL 3TYFA 1BFVL 1QYGL 5TDPA 3F7YB 1JS4A 2GJ6E 3WKQA 1A5FL 3HMXA 1GYWA 2Y1AA 4K71B 1GYVA 5B7FA 2ADJA 5DJZA 4PJEB 2R15A 2IGTA 2E7BA 4NO2A 5BS0B 4BDVA 1T0NA 4BRJA 3NEXA 4OCWL 4XC1L 1QFHA 2ZUSA 4ELMF 4PRHB 2VLKB 1NBZA 4RGNE 5EULV 1KLUB 5D72L 3U1SL 3LNIA 3ZR5A 2BW4A 3LD8B 2JKLA 3QQNA 4FLOA 2MHAA 5EV7A 2NUPB 1E9PA 1LO3H 3M07A 4L5FE 2IQ9L 3AWEA 3GDBA 3N44F 4KY2A 4U3SB 4DN4H 5CD3A 4PB0L 1VFBA 4NN5C 3QSKB 2XVGA 3KPMA 2ZXAA 4N26A 1GHFH 2XN0A 4L29A 5G55A 2WV3A 5DZAA 1EHLL 4OLWL 1OP9A 1CE1L 2NY6C 3EYVA 3QJRB 3TYGH 3MKGA 1ACYH 3WKPA 1SDDB 1P5VA 2ZUUA 1RJCA 2E7CA 4M1GH 3IBEA 4G7RB 4W9LC 2LR4A 1G0YR 2VW4A 1KBGH 5E9DA 5MHSD 3U9UB 3MNWB 4PB0H 2E7DA 3GSRB 4H1LG 3V4VA 1NBQA 2IC2A 1UASA 3LOWA 4W70A 3JWOL 4MDJB 4O2FB 4R6UA 5AQ0A 4Z7AA 1RJZB 2C9SA 3BMVA 3GXDA 4PTTA 4OV5A 3U0TA 2X53A 3IDJB 4Z7VF 4ZX5A 2BZDA 2JJSC 4Y16B 1QI4A 4QXVA 1D9KB 4LK4A 5LN4A 2Y06L 9CGTA 1JV5A 4PJIB 4YHKH 3EG9B 5L9DH 3C2SA 2BY0A 1IVTA 1EK3A 2WXQA 5KN5B 1AY1L 2FK9A 2ZX7A 4JM0A 4ZYKB 3AFLA 1S9XA 2Q76A 2R0ZH 4UZGA 1GGUA 4PR5B 3A23A 1EQWA 3QR1A 3S6CA 3MU3A 4PRBB 4KZCA 4X5RA 4HWBL 2FNWA 5E99H 1U95A 3VGFA 3WCYA 5KZCD 1EZLA 4BWTA 1JHTA 5F8QC 2L04A 3IXAA 2WBJD 3KW8A 4PRAB 1JXGA 4R7LA 3ZMRA 1PZAA 1SEBA 1VACA 3I75B 5ALBH 5C3IA 1TF4A 3VFTA 4LVNB 4RESB 5DVLA 4B9ZA 1Z9SA 2Y7QA 3H3KA 5AW7B 2H6UA 4XCYB 5K9OA 2EILB 3IWUA 1U8QA 4AWJC 4KTEL 1ZHBA 2V8LA 3NJJA 1VGEL 4JG0H 4HCIA 4OUUA 4OCYL 1ETJA 1KB5B 1S78C 1AJ7H 2WWOA 2OZ4L 1B4LA 1NLDH 1WQVT 2X6VA 4GG6F 4FQHB 4KDVA 1LE9A 1J5OH 3PL6B 3C5ZB 2VRQA 4KKNA 3ARGA 3OKKA 4XMTA 2WW8A 3GSWA 3RUGB 4BFFA 2OL3H 2QHLA 2E8YA 2ADIB 3BPLB 3NCWA 2CQVA 2WIIB 2QFRA 2Y9RT 4GSXA 4F7PB 2EUWA 1N6VA 1HYRC 1JNHA 1VPOL 3L3IB 3U6RB 2MCG1 4MB3A 4P57B 2VXQA 3LXCA 4WW1A 1UM5H 2DBLL 4I0KA 4WV1B 5D71H 3QUXC 1AC6A 3FTYA 3US9A 4UM9B 4PRIE 1MW3A 4UTBL 4YDLC 4S1DD 3B9KD 2IDTA 4Y4FC 5FKPA 1HEJC 4B5EA 5T1KD 1XSIA 3JWOH 1I4FA 2UY7A 4OT1H 3N3EA 4ZMLA 1TSRA 1G87A 2JI1A 5CO1A 4OLYH 2BHYA 3ABZA 4UNUA 2O5XL 5GS0H 2P8PA 4X7TA 5GRZA 3RPIB 3BESR 3S8GB 4HG4K 2Y7MA 4Y1AA 4UT6A 3CFTA 3MRRB 5EC1A 2DLGA 1ZEAL 1KENH 1NLDL 1XSOA 2OZ4H 4GIPD 1U8KA 5I1HL 5C0NC 3WEAA 2OI9B 4OJDH 1F3DH 1FLTX 1N2RB 4FF9A 4GRLB 5FDYA 2XWRA 1JZDC 2O6DA 2Y7SA 4IKKA 1A64A 1JGLL 2YXMA 2FX8H 4PG2C 1E7UA 3F65A 2HLAB 2OMVB 1NGZA 3ZRSA 4F8QA 4HK3J 4N9GA 5F3BA 3WUWA 4F33A 2DIBA 2NY0D 3TASA 2E3VA 3U82B 3FB7B 4HJJL 1QZNA 4JFPB 1QEWA 3EBAA 1GIGL 1MEXH 5JIQA 1JD7A 2RAMA 2EEBA 1NFDA 4BKLA 2GJZB 1IKOP 2KDYA 4H8WL 4HEPG 5EORL 5I1EH 3KMDA 3O41A 3DDFA 3F7RA 4XTRC 3ILQC 1WTLA 3U0TB 1K4DB 2YPLE 2F8OA 4L4JA 1WPCA 4W9ZA 4ZYKA 4F93B 3LYRA 1I1RA 4QTHB 1MPAH 3ARFD 4H7VA 4PJAB 4Y2DD 1VZGA 4ZJ9A 3NZHL 3VGDA 3X1GA 5CEZE 4FQJL 1AP2A 1B9ZA 3L48A 4HT1H 2XFXB 3FT3A 4PP2B 1Z9MA 4NERA 3LRSA 1HQ4A 1RLWA 4WEEA 5FO9B 2BOLA 4KV5E 5EO9B 3CSBA 1DBKL 3HCVB 2KZKA 2XHNA 1OCZB 2OMBA 4FX5A 4EPSA 4X5XA 5JUEH 4BSVA 2D0GA 4Y5XB 1MHPH 3OKDA 4GH7B 5HDQH 1IAIM 3U9UA 1CG9A 1YPZE 2QQLH 3RY4A 1KPVB 5LBSA 3PP3K 5I1GL 3VXOB 4UQ3B 5AL8A 5I1KH 2N1TE 2D3JA 2Q6WB 4PV8A 4XNZC 3VXNA 1JD9A 4OF3A 5AW5B 5G4MA 3RWCB 1FUNA 4G3YH 3M1OA 3QZWA 5EFIB 3TBSB 2P5ED 1FV1A 2F54A 3V0VA 3PHOA 2ITFA 3QI9D 4LSPH 1WICA 2TSAA 3CCHB 5EZJB 5HVWA 5IJDC 1NFDB 4ERSL 5CSZA 2HVJA 2O5YH 4ZPTA 4IHBA 4DP5X 3L7FB 5IFAL 3MRLB 4XN1A 2GTQA 2XWTB 2Z8SA 1TYRA 3TZVB 3IWVA 3H7BB 2HZHA 3UTQB 2AEQL 5KANI 5GSRA 1P7QA 3BGFC 1JZ5A 1YY9C 3PJNA 3EYUL 1RHHA 1HKFA 2MFNA 5CGYC 4G7QB 1OEZW 3WHXA 2BXYA 3D18B 2Y72A 3TA3A 2VLJB 5CWSA 2XU9A 3KLKA 1CL7H 1JI1A 2IWGA 4UMSA 4OBRA 3BSZH 5C0BD 3VFNA 3VXQA 2QQLL 4YJZL 1ADWA 3WNOA 4ZUVA 3JUYA 3KH3A 4JFWA 4AKQA 1E8XA 2DEXX 2CGRL 4G6KH 4PWIA 15C8L 3FCSB 4M7LH 4EN3A 1OAQL 3NA4A 1UA7A 1KJMB 5E9DD 2R4SL 4MJ5A 1IGJA 1QFUL 4NZFA 4XH2A 3V4LA 2A0LD 3NZHH 4K9EC 4PREB 5FM4A 3W81A 4IS6A 1NIBA 4Z78B 1EHLH 1NDTA 1TTBA 3Q6FA 4AQAB 3L3HA 1HHKA 2X70A 1O6SA 4KDTC 5FUCE 4JKPH 3ZZ1A 4F58H 3KYMA 2L8AA 3ZLQC 4YX2H 4QKTA 3HOGA 3AWGA 4N8CL 4DQOH 4NJAL 1NKGA 3TFKC 3RY6C 1JHKL 1B2YA 3UTQA 4K5PA 4MD4B 3WKMH 3MRDA 3KL3A 4XXWA 3HG4A 1MNUL 4ONHA 4QLRA 4G9FB 3VMOA 3MJ8B 4ZDHB 3CDZB 4KKBC 2MKWA 2CUHA 3EXJA 2V37A 4JO1L 2YAEA 5DLLA 3NTCL 4G8GE 2P24B 4LSPL 4WU5B 3CFBA 2I9LA 4E9TA 1P6WA 1J1PL 3P73A 4XOCA 2NW2A 4J6IA 3RWHA 1NPJA 1QI3A 2F9BT 4XC3H 3JSSA 1Q9LB 4J28A 3MRCA 2FNBA 2HSIA 3C5XA 4M7LL 5EIIG 4ZFOA 1ZTMA 3GSOB 2JELL 4RMBA 3O4OB 4RVBA 3UG5A 4ANXA 1KSRA 1DANT 4R26H 1JHTB 2ZXCA 4FNLH 4L4VD 4X0KB 2YAMA 1N0LB 3TCXA 4GMSL 2VXQH 3W0WD 5BO0D 4UDUA 3ARVA 4U6HA 4I4WB 1WCQA 1BBDH 3Q2LA 4NOFA 5BZDA 5CJOH 1CR9L 2AXHA 1Q9KB 4LAQH 4LPXA 1CLVA 4IU2B 1U3HA 4MKTA 2A4ZA 3LN4A 5I74B 1IAIH 3MJWA 1ZLSH 4ZFGL 5LG6A 3X11A 4JGNA 2YJLA 2Q87A 2B5IC 1MIEH 1GJWA 5EU5B 3ZDYB 3F58L 4ODSH 5DVKA 4NUQA 2Q8BL 4KKLC 5F6IB 2R56L 2UZPA 2WVSA 1TYEB 3WO4C 1EJFA 4NNXA 2V7NA 3CUPA 4WY7H 4EQ2A 1FFOB 4QXUL 3TPUA 2QR0A 3BZ4B 1WUZA 2Y6SD 3GXUB 3APNA 3MRBB 5D72H 3CQQA 4JFOA 4F2ME 1U8HA 4I1RA 3NFPA 1IAMA 5JXEA 1GOGA 4M03A 1WCBB 2FX8L 1PPIA 3DIFA 1M3IA 5I0XA 3W9EA 1W72L 2IGFL 1NCNA 1KN2H 3QPKA 4X0KA 5FV1L 4GW4B 4D9LL 2R39A 3BIKB 4BA0A 1SVZA 4QUOA 2R69L 3B2UD 1SM3H 5B8CB 2NQDA 4JGUA 1FN4A 2AHIA 4RAVA 1QBLH 3SE3A 1T5XB 5CD3B 2FQEA 4KK8C 1QNZH 3HC0B 4LSVH 2KZBA 4WI2A 5CS7A 4YHLH 2HKAA 3KR3H 4URTB 2XUWA 2AQTA 1T1XA 2PWHA 4NO0A 3GPSA 3QS2A 3VE0B 4MA7L 5FFOA 3HMXH 1DZBA 2Y4SA 4CVXB 1A6VH 1OARH 1ZS8B 1NMBL 2J1KA 1T1YB 1WS8A 4HJGB 3BEVA 3LSOB 2J88H 2PYEE 2RJMA 4TPRL 4YQXL 2HUHA 1FGNL 4I77H 3RVXD 2VDOL 4L4TB 3ZE1E 4D2NA 4YVUA 2NY2B 3IMRA 5EZIH 1A3LL 2ADGA 3N6YA 4MD5A 3HI5L 1H8OA 3VYPA 4NN7C 4KK5D 3RWFB 1H0DA 1OWWA 4OZIF 4PJGF 4N2GA 1I9IH 2UWEF 3B2VH 1GGTA 2WXGA 3E2HB 4R7DA 3S5LA 4AJ0A 4BH7A 4YSQA 1NCBH 3V6ZB 3MLVL 4JRYA 5D7IB 3MFFA 2BVPA 5AAMC 3HS0C 3RL2B 2VZVA 3EBGA 4YPGB 4KRNA 4LKCB 1DQKA 2VAAB 3TWCL 2OMTB 1X44A 3WTSA 5FV2A 4K3GA 4FTVD 4NC2B 1X4YA 1VA9A 4Z76B 3QNYA 3L4TA 3DXAA 3UTPD 3FFDA 2MCAA 1WDAA 4HMCA 1TVDA 1D2OA 4OZFG 3B9EA 2EP6A 1QLEH 3KJ6L 2AK4A 3GRBA 3KG5A 1ZHNB 1F86A 2KL6A 3QDGD 4HXAH 3WTWA 5HVHB 3UTTA 2A9MH 4MTMA 5HVHC 3KWWA 3K1DA 4R8WH 1UFUA 4BFGA 4HD5A 3UIYA 5EIQA 2XTJB 3TV8A 3TEUA 4A2LA 5HHPA 3I3BA 1A3LH 2MCPL 4TUOA 1K3ZA 2Q1EA 1WC7A 3BT0A 4CJ1A 4A7TA 3C5JA 3L9YA 1IGYB 2MPAH 4UQBA 1IGYA 2DQHL 1JIBA 3VCLB 4XVUD 5CLYA 1EMTL 3TVMC 4ISVA 1AY1H 2WYTA 1GZHA 2GSGB 4QRBA 4R83A 3CH1B 3H55A 1XF2A 2C3XA 5D1ZB 3Q7JA 2E9WA 4LFHD 1RZFH 4WEMB 3UTSE 3WFDL 5DD6A 3KPRA 3SPIA 3SCMD 2A74A 4N3UA 4BQ6A 2ZWLT 3GD1C 3QFGA 2ZYHA 5DJCB 1LEGA 2WM0A 3H3PL 1E9OA 1RUPL 2P5EA 3AS3A 3CVHL 3HI1B 2VE6B 1UD4A 1XB3A 1HSBB 2YGPA 2YD2A 2X4TA 2VXTH 12E8L 1NL0H 4JQXA 4NT6B 5FO8B 3KLHD 5I1IH 1MJ8L 4JKPL 2VLMD 4LSTH 4JQIA 4BWUA 3ECWA 2OMZA 1KYOJ 4YHML 5B3JF 2HFEB 5F6HI 2DS4A 2AQRA 4CGTA 4QXUH 1KIUB 4HK3N 4RFOH 2CBMA 1G1KA 3L3GA 3T0DA 4A7VA 5HHNB 4PBXA 2WXFA 3BVUA 4WUUD 1IT9L 1ACCA 1ZA3A 3CFJB 4KTGA 2R2EB 4H0HB 4P4KC 1BQHG 1PKQE 2D7QA 2DWSA 2R2EA 4RETB 4AYFB 4EKXA 4WKZB 4G6JH 3QUZB 3HC3L 3KXFE 1HE7A 2OSWA 4WF7A 3MCYA 4XBPA 4B7IA 3CPLB 4YFLF 1KELL 4BDVB 3D3VB 4WRLA 5EEXA 2E9GA 3ZE1F 1GKEA 1HHHA 4EN3D 3OHXC 4ENZA 2CUAA 1UVQA 4H44C 4OZHA 2DQGH 3MLWH 2ZYSA 2YEZB 2PO6D 1JFQH 3ULAB 3GNMH 1FN4B 3SSGA 3PABB 4NRXA 4QHUA 1G94A 2B77A 4GEIA 3ARBD 4E9QA 5FHAH 5I6KA 1D9KD 1SMOA 3ULUC 3MRRA 5C1MB 1ZSDA 3NPSB 3NTCH 3SE3C 5I0YA 2NY4C 3QUKA 3NPSC 4JO1H 5HHNA 1RUQH 4DGIH 1M3JA 3WL9B 5I19L 3F85A 5KBDA 2GSGA 1NCTA 4V2BA 3D0AA 3JVFC 4JPVH 4ACTA 3FB6A 3U36B 3FT2B 2L0DA 3X3GH 5A7EA 3LH9A 1QHOA 2H26B 5I1GH 3N55A 2CCLA 4KKBD 3ARFA 1LEIB 2APXA 1QR1A 1SQMA 3FTUA 3UBXA 3HG1B 1IB5A 1PEWA 2NTFB 5BUGA 5GZOD 4LPTA 2WZAA 4QRTA 1ACXA 2Z31C 3B9KB 3QB7C 2WZPA 3TO2A 1D3CA 3ISWA 4FYSA 1S9VB 4YDJA 3VYNA 4CSZA 4TTDC 1E50A 3W56A 1D5IL 4YBHA 2QQNL 3RJQB 4N1HB 3VM5A 4XI5C 1GGCH 2C9XA 5T5FA 1RURL 2YJQA 2QSVA 3IF1B 4FEMA 5DD6B 4BZ1A 2R2HB 2QDVA 4EIBA 2AABH 4Q6IB 3WEMA 1WISA 1FQ9C 1XF2B 3QUYD 3P30H 5CCKH 1AGFB 1KCSL 3X14B 4IU2A 2WBJC 3VWKB 5EHFA 4RISH 5JW4R 1U8NA 2G5RA 2IH9A 2JXMB 4PUBH 2QT6A 4DFIA 4J2XA 4NSKA 4D7BA 5A3IC 5C3LD 4HWNA 1F8TL 1HWGB 2ZWKA 2XG4B 3BH9A 4EIGB 4FTVB 1AGBB 5CUSL 4FGMA 4DP8X 3IGAB 1PFOA 2AEIT 2WZ5A 5CBEA 2ODHA 5CJ8A 3D08A 4MCZB 3MBXL 4XBGB 2OCFD 2CGZA 4GFXA 4RRPA 3CN4A 3VA2C 5CJ5A 1KFAH 5DHDA 3U30B 3MBEB 5C07A 1WFOA 5DEFB 2F18A 1KENL 12E8H 2VDPB 4P23D 3TTYA 3GMNA 3K6OA 4HH9A 3L5WB 2J1ZA 3JWNE 5ECGA 2VM3A 4PS4H 1UM4L 4YDIL 3VXUE 1J8HA 1MF2H 3PAYA 3TU6A 5C6TL 4PJCF 4PGJA 5JXAH 2CXGA 4X9FA 3UJIL 1MWAB 3KWTA 3X14A 3GZQA 5SWSD 4FNQA 4K5MA 1IQWH 3EBIA 1CFBA 3IM1A 4R97B 1IEHA 3MA9H 1XGTA 1Y0LA 4WU7A 4B60A 4ODHL 1I8LA 1KJ3H 1JK9B 2ZD0A 2AJVL 2YA2A 4NENA 4NAQA 1ES0B 3VACA 3HVNA 1JP5A 2ICEA 1NICA 2ADGB 3CU1A 4MD5B 4BRVA 5GGTL 1AR1D 1SLXA 3ILPA 3NGBB 3Q6FB 5SX5H 2Z0BA 2OXHA 2QQKL 4MB4A 1X7SA 3MNVB 1OHZA 3FOMB 4GP8B 4F2EA 4OSUH 5KBMA 4ICWA 2W0FA 2XJKA 2YSSB 1AR1C 3GMQB 3VFGH 5L2KE 4AEIL 4HAFA 3FB6B 4I48B 2ENSA 4D0BB 5DU7A 3PABA 1J5HA 4KRLB 1B3JA 1PEZA 2G3MA 3LEVL 4ZUUB 4ZXBB 5FO2A 3TZVD 5CD5D 4P5KA 1DEEA 4AT6B 1X9RA 4MMXB 3BZEB 2VR9A 5DZLA 4JCMA 4Y8AA 1LDPL 2VZ3A 2F7IA 5F7NC 3SDYH 3KYNA 4UUJB 4IMLA 2D0FA 4L8DA 5J13B 1QSFB 5D5ME 4DO4A 4E42B 3QQ3B 3UZQA 4JJ5B 1KEGL 1O9WA 4JJ5A 1IQDA 2HPTA 3VXME 2XPGB 1AD0A 5ICZA 3F12B 1Y6MR 5C8JB 4UIKL 2CH8A 3FB8B 4AQOA 2O1AA 1N6QH 3JWDL 4XBEH 3ZTEA 3LEXB 2KYIA 1F4HA 4N85A 5B1CA 3ROLA 2IWEA 3GYRA 1XCXA 1BVLA 3STLA 5EU5A 3R4RA 3WS6A 4JM4H 2VITA 3TA3D 3ZDYF 4MNQA 3CG8A 3V0VB 3QCTH 1PKQA 2XV6B 4AJWA 4JQIH 3SE8H 2Z64C 4GXUN 4HJTA 4N0YH 1RFDH 1IT9H 1MFBH 2ZUVA 4TNWK 4FXTA 5D6CA 3TBWA 3QIWD 5SWZE 3SDCD 3O6LL 3ET9F 4NAMA 3B6SB 5DJ8A 3CBRA 5IQMA 1OXYA 3HCVA 1TJIH 4NIYE 2EKJA 3FU0A 1DSFH 3BVDB 3FUNA 3NESA 3ZO9A 2EIMB 4D9LH 3QEHB 4GKNB 5DEGB 4ZQTA 1AP2B 4RFNB 2BOBA 4F7EB 3OQ3B 3ZKMC 4XCNB 4YDNA 3P11H 4C57C 3TT1H 1LO4H 3UPRA 1KJ3L 2ERJC 4LSTL 5CGMA 1OLLA 4JGJA 7FABL 1BOGA 2P5WB 5E2UH 3SYCA 3PDOA 1PGRB 3Q8FA 4K3EL 1KPRB 1E4XL 4P49A 2BFVH 1HH6B 3HN5A 3QEGL 3NIFE 3OLEA 43C9B 4XP6L 7PCYA 5IT2H 3SDDD 4D9RE 4P46D 1BWMA 1NFAA 1QVOB 1R33A 1JZFA 2BNQD 2YBGA 3BKML 3KYOA 3L4WA 1MIEL 4GRLD 4NGHH 2ATAA 5I17B 2V5RA 1IBHA 2A74B 3VX0A 2OMXB 5I17A 5FWQA 3C08L 4L5FL 3OQRA 3UYPA 2GITA 2I24N 1FJ1A 3CFCH 3RX9A 1UTDA 1E5YA 4K3DH 5IEHA 3OG6B 4BZ2A 5BS0D 1HCZA 4UOW0 5L88H 2XWJB 2VW6A 5KVGL 3MV8A 4NPJA 3TNNB 2P8LB 5C09A 4XAWH 4E5XB 2HG0A 4OZIB 2ZWNA 4A2EA 5JW5A 1VF5C 2ITEA 3LIUA 4G7SB 1F3JB 4K94C 4DP2X 5FEBA 1ET8A 2JIXB 4A1RA 3D05A 2BCKA 4P5MB 2MSPA 3LN5A 4AUJA 4QCIB 5B3NA 3QHZH 1TTGA 1JPTL 3WIFB 1EGJL 2UYLB 5EC1B 3DX7A 1DDTA 1FFPA 3KEDA 4EI5B 2F8IA 2CGYA 4L8CA 2V3DA 5DJYB 1PSKH 2XQYG 1SLVA 3AY4C 3MV7D 1ZLDA 1IGTB 4WEUD 3T1FA 3QIBB 2ZAGA 4PJ9C 3RHWF 3BP5A 4G8GB 4PGBB 3M1BB 4BE6A 4BK4A 4A2HA 4FQCL 3RJOA 1ONQB 1ZRUA 2X7LB 3AG4B 4NQCB 4WV1A 3S8WA 1ND0B 2UX7A 2F7PA 4PWJA 3V0IA 2BIOA 4EI6B 4QRTB 3BJ91 3QULA 1KPVA 3ROLB 4B0MB 2HA1A 1DQIA 1QLFA 4BH8B 2BVYA 2XV0A 4PJDA 5HYIA 4M1DH 1OOAA 4CMHC 3P9WB 2YEQA 3QDGA 4LOEA 1YMME 3ILEA 1UADC 4MHHI 4GT0A 3CVHA 2DLFL 2OMUA 2ID5A 4W9GC 5KG9B 1OTUC 4RLDA 1S7UB 1P7HL 1J8HE 1X6LA 3CCHA 5EZJA 1CS6A 3GSUB 5IP4A 1KDJA 4AJYV 2XWBA 4U1JB 2O72A 1U2CA 1ASPA 1RU9H 4M93C 3M8OH 1XL6A 5AVQB 5TF1L 4R3SB 3SE4A 4ZO8A 4DKFH 4ILDA 3HPLB 2NR6C 1E7VA 2CDGB 3P9LB 1KCUL 4GAJH 4MNGB 3SZKC 4G83A 1BEXA 4KO7A 3SDAA 3AT9A 1SEBB 3I75A 1AH1A 4P5TA 4NKMB 2DQTL 3MA9L 3NSDA 3BIAX 1RUKH 4K4KA 5FGCE 2ZUQC 4JZNB 2R27A 4NNPL 5F7MC 3TNMA 4WHTB 3IDNB 1J86A 1XH3B 3U2SB 1ZV9A 4Z7OB 4ZOBA 3LX9A 5LDUA 1A2YA 8CGTA 4YXLL 3LNHA 4YDMA 3QFDB 4M1DL 3QT2A 2HG5B 3CDFA 3FTWA 4MMZB 4NWUL 5HDBE 1I82A 1UM4H 3AQDA 2YMTA 2JJSA 1OD9A 1F18A 3D85A 4P5TD 3I85A 2G2RB 3S88L 3H0TA 4G5ZH 4P2RA 1D7CA 4M8QA 3UGUA 1I8KA 3LN4B 1QG3A 5IB1A 1FFTB 4G43B 2FX7H 4LBEB 4KKLD 1LYQA 5K33A 2HFEA 4PSRA 1R5WA 3VRLE 4MNQD 1T22A 1BVKA 3V5DA 4C58B 4PJXE 3HBQA 3SDYL 4J1UA 4P5TC 1NAKL 1E5ZA 3MJGX 5CEYB 3Q8BA 3IJYB 3VXMA 3HNTL 5F1SA 4NT6A 5FO8A 3CN2A 4ZMYA 1FP5A 4P5MA 3QUMH 1E9PB 3ATDA 4PBVC 4TVUA 4YHYC