1AC6A

Crystal structure of a variable domain mutant of a t-cell receptor alpha chain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
110
Chain Sequence
DSVTQTEGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRASRDKEKGSSRGFEATYNKEATSFHLQKASVQESDSAVYYCALSGGNNKLTFGAGTKLTIKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor
molecule keywords T-CELL RECEPTOR ALPHA
publication title Dual conformations of a T cell receptor V alpha homodimer: implications for variability in V alpha V beta domain association.
pubmed doi rcsb
total genus 25
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ac6A00
1WAAF 1DQDH 3MNZA 1RV6X 1ZWIA 4X6CF 2EKSB 4K8RD 5DJZA 3TH3T 3V2AR 4PY8J 4RRPG 1ZWIB 2QR0A 1K9TA 3UEZA 3ZYOA 1FVEA 2BOBA 1QEWA 3ALWA 3GMNA 3RWHB 3QCUH 5D7LD 1T89A 4PJ7E 1QEWB 4MXWL 1MJJA 1QSEB 1QLFA 1FNLA 1T0MA 1UACL 3GMNB 3V0WL 4LCWE 3T0WA 3QDJA 4PJGE 4PRHA 1EV2E 1T0MB 1WWWX 1LO2L 4XBGB 4GAJH 2DDQL 5D7KD 3T3PE 1HYSD 5DZLA 3R0NA 4XVUC 1DN2A 3HE7C 4PRHB 4R2GC 1QOKA 1UZ8A 1GGTA 4YHYB 4JO3L 3NIFE 2MJWA 1BJ1J 3S97C 4M5YH 4MJ4A 5C0GB 4BK5A 4OIAA 3MRRB 1RU9L 1H3UA 3IS1X 4D3CH 2FSEA 3GSWA 2VDRL 4RFNC 4NJAH 4EI5C 2FHCA 2C5DC 5ECJE 2VLKA 3BPLB 2P1YA 3C6LB 1AO7A 3GSWB 1ES0A 3U4BL 1D3CA 3PDOA 1N5AA 1TJHL 1VHPA 3QNZA 2DLFH 5KJRL 1VFBB 5D1XA 1AO7B 1MCNA 2MWCA 1ES0B 3H0TB 3QP3A 2BMKA 2FEEL 1N5AB 3PDOB 5JQHC 4KK9C 35C8H 3H3PH 5D1XB 4J3OC 2P43B 1TNMA 3ULUH 1YJDL 3RDTD 4HXAH 2BMKB 1BBJA 4WDIA 2AABH 1UXWA 4A2LA 1S9XA 2Z92B 3T2QA 2OQJA 2IPUG 4YBLC 4BKLA 5IJVA 3P11L 1FNEA 4MNQE 1J11A 1BBJB 5TE4H 1FL5B 1S9XB 5HHOD 2HLFC 2OQJB 4BKLB 5IJVB 2F53D 4TNVK 3ZHKA 4DEPB 3STBA 1BGXL 3CJJA 4PYHA 3EJJX 3I9GL 4OD1L 2IBZX 3SPVA 1ITCA 5HYIA 4YUEL 1J1OL 3MLUL 5MHSE 5HPMA 4XPTH 2PF6A 2VQ1B 5DQDL 1OGTB 4XXCA 2R2EA 2C1PA 1DBMH 4X5XB 3S36H 1IL1A 1PY4A 5A43C 5CINL 2FATH 5HPMB 3FONA 5C09A 4XCNB 2R2EB 1B4JL 3G6JB 1UJ3B 3HUJF 1IL1B 2IPKB 2NY5H 1GHFH 3FONB 1D9KD 2VLLB 4JRXB 3BDBA 4R3SA 2R39A 1S7UA 2C4FU 4LDLB 3DX7A 4G5ZL 4N0UE 5C09B 4ZTOL 5CJOH 5EZLB 3FT3A 4LHUA 4NUJA 4RAVB 1Z9MA 5MERB 4PJ7A 4PJEF 2ZJSL 1BM3L 4X4ZA 3SGDI 3X12A 1S7UB 2R2HA 5TJWK 3DX7B 4YO0A 4R97C 4RWYL 4LCWA 5E5RB 1EPFA 1VPOL 3FT3B 3VRIB 5FV2A 4NUJB 2LTQB 2VLRB 3EYQC 2R4RH 4L4TD 2AGJL 1OD7A 2WINA 3HC0B 5E1HB 2B4CL 2R2HB 5FYLH 1T22A 4N0YL 1HHHB 4A2MA 4PV8B 4R4FH 1JI2A 5FUZH 1R3IH 4HEPG 1ZTXL 2UWEE 5IEKB 1T22B 1KUMA 1UENA 2B1HL 5D2NC 5HVGB 1WWBX 1MI5A 3SE9H 1JMXA 4LPXA 3P30H 5FYJL 2EECA 1NLBL 5IVOA 5HHMB 3NCCB 1VERA 2ZOLB 4X6DE 4PB9H 4LHUG 2VE6A 1OTUC 2D31A 3PIQA 4HIXH 4OFYD 4BH8A 4PTTA 5DFVD 4LP5A 2GSIA 1TZIB 5CLWA 4Y2OA 2W07A 4OCYL 4PJXB 5F6HI 2D31B 1A9BA 3CK0L 4BH8B 4U1GB 4JY6A 1FLRH 1MVUB 1RMFL 4OLWL 2W0FA 3K0WA 1MNUH 2W0PA 3ZYZA 4L1HA 1A9BB 4HFWB 4JY6B 4WW2A 3TIEA 2W0FB 4KDTC 3NZ8B 1KACB 4JG0H 4LPYA 3GSOA 3DV6A 4NBYB 4WW2B 4HUMB 3T77A 2NLJA 3AROA 2A83A 2X70A 3Q1SL 1FL6A 4L5FL 2HTKC 2YHGA 1DQDL 3GSOB 3DV6B 4F9PA 1EO7A 2APWA 4JM2C 1N5YH 2NLJB 4EQ2A 4HX1B 2JK5B 2X70B 1FL6B 2OJZH 1JWMA 2FB4H 3O3EA 4HZLA 5K9QI 1ZGLP 1PBYA 3QAZC 4F7CA 3EDKA 4XNZB 3DV4B 3QCUL 4MAUH 1JWMB 4HZLB 1G9MC 1WVZA 4WVRA 4OZGE 1T7XA 2CH8A 3VDCA 1YYML 1J1PL 3VU2A 5ADPL 2BSSA 2V7HA 3VXUA 4X4YA 4WWKC 3QCTH 4BFIB 2BVOA 3O4LE 5IMKA 2FYYA 4GAJL 4DUVA 4G6KH 2V7HB 2AK4E 4NZRH 5D6DC 2Z35A 2XZAH 2BVOB 1CXFA 1JYNA 1D6EA 2ERJC 5IMKB 2FYYB 2CRYA 4YHOH 3MLYL 3S7GA 2CKBH 4Y1AD 4N0UA 5BVPL 3IJYA 1RJYA 4G43A 1BAFH 3VFTA 4M5YL 1KB5H 4NRZA 3FO2A 3IJYB 4MAYD 4MJIE 4NJAL 5C6TH 5FYJE 4BFEA 1AGFB 4YFLI 4NRZB 3FO2B 4KMLB 4YDKH 5JXEA 3X13A 4Y19E 3BJ91 4H5SA 3TT1H 2DLFL 2UWEA 3SDYH 4I2XB 3SO5A 1YMMB 3X13B 4TNWF 4JFPA 4P3WA 3F5WB 5E8EA 1YEEL 4LU5H 3OBAA 5I2IB 2ATPB 1MFDL 4QT5B 1IEHA 1I75A 35C8L 1Y18B 3PWNA 1H15B 4RAUA 1NC4D 3ULUL 3VXPB 1EEYA 1I3RB 3HG1D 4HXAL 3VMPA 2AABL 5TF1H 3OKEA 3PWNB 4RAUB 4X7DC 4E5XA 4ISVB 2V2XA 4TYUA 5TE4L 1WZ1H 4M43H 4PJAE 1MREL 2HRLA 3DXAD 4E5XB 3GIZH 3QNYA 4JR9H 1HQ4A 2I25N 1YPZB 5KSBE 5T1KB 3WDIA 3QNYB 3D18A 4XPTL 4LHJB 1HQ4B 4NNXB 1V5JA 2OMBA 3AS0A 1G0DA 3KHQA 1DBML 2Q20A 3G9VA 4EDXB 1AD0A 4MA7H 2FX8H 3DVFA 3T0ED 4I77H 4OZFA 5IMMA 3EHBC 3JTTB 2NY5L 4YWGL 4JY5H 1GHFL 2QSQA 3FTGA 5K9JL 1OCWL 3PJSA 4RIRA 1QP1A 3RIAF 4PJFE 3MLXH 4LOUD 5CJOL 4U1IA 3FTGB 3PXJA 1N6VA 1N3NA 2A6IB 3PJSB 4MQXD 4RIRB 4OZHF 3H9HA 4LLVA 4Y2DC 2Z31A 2E6QA 15C8H 4LDEB 2NY0D 2RB8A 1N3NB 4LBEA 3ZTNH 1QA9B 3ZYJA 1JNNL 5FYLL 3H9HB 4MMZC 4JREB 2Z31B 4MD0B 5DHVH 1OP3H 3S35L 1KIUA 4R4FL 1EUUA 1R3IL 4OZFG 4LBEB 4GKNB 3OKOA 5LWYL 3WNPA 5IQ9A 3V79C 2CXGA 3P30L 1ULVA 1SEBB 1IGFH 4XCFH 1A3RH 4Y4KC 4PB9L 5DFTA 5IQ9B 4HIXL 2QSCH 2OL3A 1TNNA 3U9PH 2OK0H 4PJHB 4JGJA 4NQCA 4N5ED 3QIBA 4LRIA 5IB2A 4NQCB 2X4NA 3ULUE 2H9GA 1MNUL 3QIBB 1U93A 3THMH 4UQ2B 2DD8H 5IB2B 3EIFA 4UOJA 2R8SL 1T2QH 3V6FA 4LRNH 1U93B 4KZDH 2VQUA 4JG0L 1SJHA 4PRID 2W9EL 1PDKA 3K74B 5F7YC 3ZKQD 3BJLA 4NKMB 4OF7A 4XHJD 3RVWC 3ULVH 4ZSOE 2UUDK 1T1WB 2BNUA 1MWAH 3GSUB 4MDIB 1LEGB 1N5YL 2KL6A 3MUGB 4NQDA 3S3SA 2OJZL 3DVGA 3W0WA 4PJAA 1R5VB 2FB4L 4HF5H 4G7YH 4FQXC 3J7HA 4POYA 5F97E 4NO0B 4NQDB 4WGWB 4WHCA 1ORQA 4MAUL 4GW4A 1Q94B 2E8YA 2H1PH 3CFKB 4PUBH 4IDLA 3ZLQC 4P48A 3CXDL 1MRDH 3UTSA 2CRZA 2NXYB 3EJYD 1XIWC 1ZVHA 1ORQB 4X4ME 3E8UH 4GW4B 5CAYB 3QIWD 3R06A 3BKCH 3QCTL 3MBEA 2DQTH 3O2WH 5CSBA 1U92B 3S6CA 3UTSB 5BMFH 3ECBA 4DZBA 2Y6SC 5C3TA 2ZCKH 4G6KL 1F00I 4JJHA 4NZRL 4Y88A 5F96H 5I74B 1UB6B 2XZAL 3FAXA 5HGBA 1DP0A 1T1YA 3BPCA 3ECBB 1BQHB 1EAPA 4YHOL 4DZBB 1FZOB 2CKBL 5FYLE 5L88H 4D2NA 2NZIA 3BPCB 1BAFL 1KB5L 4U7SA 1HH6A 5DMJB 3QXTA 1JHLH 1YEIH 4EI6A 2P48B 4U6TA 4HS6A 4IRSA 2DI9A 5I66A 5C6TL 3RX7A 1INEL 4EUPB 4Y4HB 5LKNA 1HH6B 3WO3B 1B0RA 4YDKL 4EI6B 3C8DA 1AXSA 4HS6B 4IRSB 3OB8A 4D0CA 1BQHG 4PJBE 5KVGH 2NY3C 3TT1L 1I8IA 4MDJB 4V2CB 3NIGE 1K8DB 3UTQB 3SDYL 1B0RB 1AXSB 1EO8H 3D69B 1JZ3A 3SE4C 4LU5L 2V2TA 3BMWA 5IHUH 3HNSL 3ZL4H 3GDBA 1IILE 2FIRT 4PRNB 2WZPD 1KJ2H 3TBVA 3ZE2F 1HINH 4WENB 2V2TB 1ZT7B 1KLFA 3G5ZB 5TF1L 5DUBA 5GGUA 1TDQA 2XY1A 2FGWH 3QBTB 1YQVH 5MEPB 2NW2A 4JFDA 3QDAA 1PG7X 5F1IB 4M43L 5IVXA 3UTTE 3H6JA 3H9SA 3GIZL 4P23D 4P57A 5BQ7B 3K2MC 4JFDB 4KK8D 5IJKA 5IVXB 2CLRB 2SEBB 2ESVD 5L0QB 2XA8H 4P57B 4KKLC 3GGWB 2J3SA 5TE6L 1XGUA 1NLDH 1PYWA 3E0GA 1X44A 1WTGT 2FO4B 1FVDA 3MRPB 4F8TA 4MD4B 2A2QT 4MA7L 2FX8L 3LAFA 4KQ4L 3VFWA 1XGUB 5B4MD 1ADQH 1PYWB 5HI4C 3O11B 2DS4A 4JY5L 2MQCA 5KN5B 2GJ6B 3MLXL 5IBUG 2MKWA 2DLGA 1NH6A 2GJZB 3VXRD 1LO5A 1UM6H 2G5RA 5D2LA 5J1AB 1T0PB 3DYMA 15C8L 3TO2A 4RFOH 3ARFD 3SE3C 2BSTA 1G9NH 3ZTNL 5EOQH 1R5WA 5D2LB 1EDQA 3AC0A 3VWKC 5D4QA 4JCLA 3FMGH 1BVKA 4NQED 3KLSA 1F6LL 3HZVA 4UBDC 2CGRH 3G5XA 1R5WB 3U9UA 2VXQH 4GG6A 5JA9A 1BVKB 3O9WC 5INCB 1FYTD 3PGCA 4XTRC 5DHXB 3HZVB 4KUZH 3RQ3A 3CX5K 4XCFL 1A3RL 2VH5H 4YC2C 4WW1A 4MXQC 2QSCL 4X7FC 2FECI 3U9PL 2Q7NA 2OK0L 4R96A 2R23B 3NFNA 1HI6A 5SX5H 4WW1B 1HQRA 4MX7B 4B5EA 4M93C 3VXNA 1I8LA 5EC2A 4UDUB 5D93B 4R96B 1U0QA 4PJBA 2X40A 1ED3A 3NFNB 3D39B 1HQRB 2XN9E 2DD8L 5EC2B 3UJTH 4CVZA 4XVUD 3HE7D 3WS3A 4FRWA 5DK3A 1OLZA 4R2GD 3LHPH 1ED3B 2H2SC 4MXVE 4LRNL 2Y06H 5ETUA 1BHGA 4KZDL 2VKXA 4CVZB 1XEDA 4QGYA 2GQHA 3IDIA 3BESR 4I3GA 3I75A 4ODTH 3G9AB 5ETUB 3BO8A 3U7YH 3ULVL 4I9WE 4Q7DA 1HKFA 4EI5D 4IRJD 1MWAL 2P8PB 1OGAA 4GRWB 3BH9B 3BO8B 3L7EA 4NQXB 2XPGA 1IC7H 4HF5L 3BP6A 2E5EA 1J8HB 1OGAB 4G7YL 1GZQA 1YN6A 4Z7UA 3WLBB 4P4RA 3L7EB 1JRHH 2F5AH 1XR8B 3EAKA 1A7BA 3K46A 4KUCF 2G9HA 4PUBL 2XPGB 1FNSH 3BP6B 5E99L 4KK9D 1MRDL 3TVMC 4P4RB 1MFCL 3E8UL 3QULA 3LRHA 1KG0B 3BKCL 2KUTA 2DQTL 3O2WL 1YECH 1A6TA 1JUFA 1C08A 1PEWA 5BMFL 1MIMH 3QR2A 2EDLA 3MJ8A 2ZCKL 3QULB 1BIIB 5F96L 4LLWA 2JELH 1QFWM 2HLFD 4K3HA 5T1DH 3DIFA 1T2XA 4Y16D 3MJ8B 3OL2A 1RFDH 4XBEH 1AY1H 5I16A 2B5IB 3HI6L 1LP9A 4ZYKB 1QFWH 4WUUD 3DIFB 3IYLW 4O58H 5CBEB 3WFEH 2F54A 4Y0GA 3JV0A 1YEIL 1IZJA 1OP5H 3D2UB 3BOVA 4ZNEA 5I16B 1A4JA 1MFAH 4YHKH 1QFUH 2AQ2A 4J1UA 3MXWH 5F71A 1SJVA 3FRPA 2R1YA 3L3HA 3QG6B 4NOFA 3WIFB 5C9JA 3LKPA 3SJVE 4CADA 4IIQA 2BDNH 3WDHA 1AI1H 1C12A 2DTMH 1JPST 4J1UB 3LQZB 3UXFA 3GNMH 4PJ5D 2R1YB 3K4ZA 3LKPB 4CADB 3QWRD 1EO8L 4YDLC 1KJVA 4G9FD 1C12B 3U6RA 1ZHLB 3WKNA 1JFQH 3TNMA 4Z76B 5IHUL 3ZL4L 1NFKA 1MLCA 4FQHB 5INDA 1KJ2L 3DX8A 2BJMH 1HINL 3U6RB 4L8SB 3C5SA 2BNQA 3TNMB 5HI3C 1XF4A 1DANU 2I24N 5ENWA 5INDB 1S9YB 3MRDA 4MQ7B 3DX8B 4RMWA 2FGWL 4G6AC 4KROD 3C5SB 3FRPG 1YQVL 1XF4B 2ZUSA 4KJYA 4M5ZH 2GSGB 3ULVE 5ENWB 2EH7H 3H8NA 3MRDB 2X4QA 2X1XR 4GW1A 5F7KC 5C0BD 3OKLA 4U6YA 1X4ZA 4KJYB 5F3BB 5IG7A 1PSKL 1UKSA 3ZHDA 1N7MH 2ARJA 3RZCC 3U0TA 3VH8B 5DRNB 3QUMA 4U6YB 3QFJE 1OTUD 5IG7B 3AGVA 2Y23A 1NLDL 4L3EA 4K7PX 3LEVH 4YHPA 3U0TB 2QQNH 4H26A 3QUMB 1J88A 5JIPA 4DKEH 2CLVA 5DJAB 4N8PA 2EO1A 1VEMA 4YHPB 4TNVF 1CLYH 4OT1L 4H26B 3ZT7A 3ZKNC 2CLVB 3JV4B 3E1F1 1T5WA 4QRRA 3TFKC 5E08H 2R4SH 4KPHH 1UM6L 3H3BC 4YHZH 1Z9LA 5LGHH 1OW0C 3SOBL 5AUMA 2IAMA 1ZGLA 2P7TB 2BHZA 1J0KA 1Z9OA 3LH2H 2CXKA 1U6AH 2HTKD 3FMGL 5E8DH 5KG9A 2BRQA 5AUMB 2IAMB 1JJUA 2CGRL 2WWMC 3S3JA 2VXQL 3TO4B 4XRCA 3QIUC 1PLGH 2X1PA 4YE4H 5EFIB 4UNTA 2XFXA 1H0DB 4KUZL 1FFOA 4AT6B 2BNRA 4QHNB 2P5WB 2VH5L 2FJHA 4RGNB 5LGKA 5D5ME 2FLBT 1FFOB 2BNRB 5IHZA 4P2QB 4WWKD 1H5BA 2ZUQB 5DEFA 3BWUC 4HG4K 3Q6GH 2DQFA 2MFNA 4Q9RH 1KPUA 4O2EB 3SKOA 5JOPE 1DANT 4JG1H 1IM3A 5IHZB 4YEEA 1MRFH 4I18A 4BH7A 1NGZB 2XTJD 3PXHA 3O2DA 1KCRL 4YZFE 2CJUH 3T4YA 3DOSA 1TVDA 3SKOB 1KXTB 4I18B 1RIHH 1CFVH 3P3YA 2VLME 1HHIA 3U7YL 1KEGH 1MCCA 5FYKD 5BVJA 4CJ0A 2X4UA 4Q97A 1N2RB 2FLRT 1S7VB 3EYFA 3KJ4C 5BVJB 2X4UB 5HYEA 1RAMA 3FL7A 4F9LA 3EYFB 4JFFE 1JRHL 2F5AL 1CVSC 2ICES 5D7LB 3FQUA 1RIVH 3BPNB 1BOGA 5FKPA 4GKSA 1WCQA 5ID0A 4QF1A 4NUGH 2X4RA 1BJ1H 3UJJH 1DVFC 1F6AB 3RTQC 4MJ6B 1YUHB 5EIVA 1YECL 4TUOA 5AAMA 4QF1B 4KXZH 1NAMA 1LILA 1MIML 2ADIB 3G04A 3KYNA 4HDIA 1D7FA 2XZCH 5T1DL 2X41A 4Q6IB 2V5TA 5CGMA 4LLAA 3G04B 3GSNH 4TN9A 3C8KA 4XBEL 1AY1L 2HT2C 2HJLA 2A6KA 1QFWL 1NQBA 2CLZA 3DUUA 2P49B 4O58L 3OKDB 4IEFB 4DCQA 3WFEL 3PL6C 5BRZE 2YKLH 3C8KB 5EOCH 1DQLH 2HJLB 1MFAL 1JPGA 1OTTC 1QFUL 2CLZB 1RHHA 4YHKL 4OIIH 2F5BH 1T21A 3MXWL 4J4PC 4N8VB 1TQBB 5CJQH 3TT3H 5JIIA 5CLTA 1AI1L 1NJ9B 2DTML 3EOTH 1RZGA 4KH2A 1FGVH 4W4OC 3GNML 3EHBD 4R8WH 3DURB 5ERWB 4P49A 1A0QH 3IFPA 3RDTA 3DHJA 5DA0B 2IEPA 1JFQL 4M00A 5DD3H 1U8MA 3WUWB 1IJ9A 3B9DA 3PHQA 2X42A 1L0YA 4M62H 5GS1C 1CIDA 2BJML 3MJ7B 4ONHB 5I9QB 2Q87A 2V9QA 4PRDB 3RDTB 2KDGA 3IDYB 3OR6A 4GMSL 1V05A 5HHOA 1U8MB 4Y2DD 1ZXQA 5F1SA 2F53A 5GSVB 3GMMA 3L9RA 3MODH 2H26B 3WFCH 1FDLH 4OKVA 5HHOB 4NN5C 4M5ZL 2F53B 1D5BA 2EH7L 1KIPA 3L9RB 3BN9C 1SEQL 5C0JB 1UKQA 2M2DA 3H7BA 4UINH 2VIRB 1K5NB 3VFRA 1N7ML 1KIPB 1J0ZA 4HWUA 5JW4M 1JGDA 5J13C 3I2CH 3RUGE 3IDGA 4Y4KD 4MJ5A 4YHLH 4C56A 3O45A 3C5JB 4XCYA 3SKJH 3VFRB 4WJ5A 3U1SH 4F8QA 1D9KA 2QQNL 3IDGB 4MJ5B 12E8H 3UMTA 5KVFH 1LEIB 2KZWA 2NPLX 4C56B 3O45B 4J12A 1JZ2A 5ESAA 3MFGB 1B4RA 1U8JA 4YGVA 1CLYL 3PHSA 1D9KB 2WQRA 1NANI 1I1RA 1OP3K 4S0SD 4PJ7F 1HWHB 4HAFA 5DJ8A 1U8JB 5KSUA 3UYRH 5E08L 1ADQA 2R4SL 4KPHL 5FGSA 1RIUH 1MRCL 1B6UA 5KSAC 4Y4FC 2D7OA 1WJ3A 4YHZL 1DUZB 3G6JE 1E4KA 4PJGF 1UFUA 5LGHL 3CCHB 4JRXE 5KSUB 3EOBA 1ZVYA 4L4TB 4R4ND 3T3PF 5F70A 3FO1A 1O0VA 3FT2B 4D94A 3ZSSA 4CUCA 1YEGL 3LH2L 1U6AL 3BI9X 3S36X 1NCBH 3MRHA 3S9DB 5E8DL 3PP4H 3EOBB 1UH2A 3FO1B 3NIFF 3QWQB 3X11B 1PLGL 4YE4L 4OFYA 2QTEA 4FQXD 1WT5A 2YA2A 5ESQB 4HWBH 2HT4D 4JQXA 1KPVA 1UWGH 5FUCC 5HGAB 3CLFL 1XIWD 4RMSA 1F2QA 1E4JA 1G84A 1CL7L 3MLWH 3Q6GL 3LRSA 1KPVB 5F89A 1A1NB 5EU7C 3VG0H 4Q9RL 3WL9B 5ACLA 4JG1L 2V9TA 1MRFL 1TPXB 3LRSB 2CJUL 5F89B 4HS3A 4PGBA 5HDBE 1LD9A 1JGEB 4HXBL 1RUAL 3EJZD 1RIHL 3ROLA 1ETZA 1CFVL 1KTLB 4HS3B 1TIUA 1HYRC 1PJ9A 1NGXA 1LD9B 1HSAB 1KEGL 1R0AL 1R5IA 3MGAA 3KNBB 4R26H 1GGYA 3ROLB 5GSRB 1ETZB 1XGYH 1NGXB 2BVYA 3H9YA 4L9LC 1J18A 4JO1H 3VGDA 2NY3D 3RI5K 4NRXA 4YBQC 5HHPA 2YD8A 1T6WA 3FO9B 1RIVL 2VSDA 2JF1A 2YMXH 3MMEB 4EQ3A 1Q1JH 5HHPB 2MMXA 1IGJB 3FHQA 3QUKB 5DJCB 3UJJL 5GGSY 4YHNB 2VKWA 3OXRA 3IGAB 2FWOB 2DQHH 2FDBP 3SDXA 1F2XK 4QRPD 4Y1AA 3OXRB 1H3VA 4P5MB 2YD4A 4TVPH 2AXFA 2XZCL 4ODUB 1JZ7A 3SDXB 4Y1AB 5EN2A 3GSNL 3MTRA 1QBMH 1XMWA 4MAYA 2AEIT 1NC2D 2J2ZA 1XGPA 2J5LB 4P9HH 5CUSH 2VWEC 5EN2B 2YKLL 3RHWK 5EOCL 2FH6A 3B9KA 4XNXH 1DQLL 4MAYB 4G8GD 4KKLD 1QLRA 4OIIL 2F5BL 3GEWB 3FCTA 1J86A 2WLYA 3PWLA 1M05A 3TT3L 1U3HA 1N64H 2FD6H 2F8OA 2UWEF 3EOTL 1A9EB 5GS0H 2IADB 2P8MA 1U8IB 2D7QA 3ES6A 3FCTB 3PWLB 1M05B 4R8WL 2DMBA 4K94H 3OF6A 4X6DF 1NC4A 1A0QL 4CVWA 2BC4B 3HG1A 3L5XH 5DD3L 4YXLH 4LLYB 4M62L 1OP9A 1REIA 3VA6A 3OQ3B 1NC4B 4LVNB 4PRAA 1EGJA 1RZKH 3AMLA 3HG1B 2ORBH 1YMME 5BZDA 3RU8H 4LGSB 4PRAB 3MODL 3FAWA 5HTSA 3WFCL 2IC2A 2ATKB 3CSYA 1RK0A 4YDJA 4PP2B 5K59F 1NAKH 5BZDB 1FVCB 3GBNL 3DXAB 4UBDD 5J1TC 1EAJA 1UT9A 2EDEA 4UINL 4CMHC 2P4AB 4U3HA 4XAKD 1RZIA 3VFSB 3HMXA 3I2CL 1CWVA 1YEJH 5CMAA 1U8LB 1J0JA 1J05A 2YR3A 3QO0A 4X6FB 3T0EA 3U0PA 3SKJL 4LSVH 4QKXB 5I8CA 7CGTA 3BWAB 5KVFL 1YPZE 3PQYD 1N26A 3O3DA 5CMAB 1J05B 3QO0B 3T0EB 1QRKA 3IDJB 4OUUA 2FHBA 1E0OB 5J12B 2EIDA 3RPKA 3TIDA 3IFOB 1CDBA 3FO0H 1H8OA 3O3DB 3E2HC 4JRYA 3F58L 4OUUB 4OZGF 2C3XA 4WI6A 5HYJA 1ONQA 1U8NA 3UYRL 3TIDB 3ABZA 1NMAH 2H2SD 1RIUL 1NFDE 1KBGH 5KOVC 5C1MB 4POZC 4NO2B 4ZG1A 3G5VA 2MCPH 1ONQB 1DLHA 2NY0B 1ZE3C 1HNGA 2D7TH 1NCBL 3WIHA 2QLVB 3G5VB 5KAQG 2UV3A 2GCYB 4TTDC 1DLHB 3HMWH 4HJJH 4QEGA 3IDMA 3ZZ1A 4Y5XC 4NGHH 2J4WL 4PPTA 5CD3B 3S37H 1FNGB 6FABL 3O6FD 2X9XA 4HWBL 4KQ3H 4F37K 4KAQL 4KZEH 5C9KA 4HBQA 4WV1B 4L3CA 5J9PA 1XFPA 4WI8A 5GRVL 3TVMD 2OXHA 3QISA 4OD2A 2X4OB 1I7TA 1FAIH 1G7LB 1KXVC 3MLWL 1F3RB 2RR3A 1KGCE 4M4PA 5J9PB 2JJSA 2OS7A 4L3CB 5E9DD 2DRUA 1DQTA 2E9BA 3BW9A 4HUWA 4LKCA 3VG0L 1WIOA 4J3WA 4OD2B 4KKAC 5L8KB 3OZ9H 3JUYA 3DVNB 4XPAH 2D7NA 4PRIA 3ARYA 1L0QA 4LKCB 3BW9B 5ICXB 3RVTC 2EH8H 1D5MB 4OCXH 5FGBA 2WNGA 5CEXB 1AJ7H 1P1ZA 4PRIB 3T1WA 2W65A 3V6OE 4R26L 4DWHA 3RX5A 4ZFZB 1XGYL 3VCLA 4U7KA 4PJAF 4FA8A 2P8LB 1MFBH 2W65B 1QYGL 3ARED 4IS6A 2AXJA 5DD1H 3EYSH 5SWZD 3HS0B 3VCLB 1RUQH 5MI0B 3JV5A 4I48A 5E4IA 2E27H 2YMXL 4CMMB 2X1OA 3AB0B 1Q1JL 3RBSA 5EUKB 3C8HA 4C59B 1S7XA 3QIWB 4OGAC 1X3DA 2IGFH 5HI3D 2DQHL 1X5YA 1S78C 2KPNA 4LF3A 4PJ8D 5A2LH 1CFNA 1S7XB 3TA3A 3OB0H 2OTWA 3SO3C 1EO5A 4TVPL 4G6AD 2JLLA 3C09C 1GSMA 1EA9C 1I3UA 4PJFF 5BZWA 1PD6A 4LF3B 4DGYL 3REVA 1IAIM 2OTWB 4LFHD 5GISH 5LCVH 5CSGA 1IEBB 4F9PC 4IDJH 2D3VA 4P9HL 3U82B 5CUSL 2PUQT 4XPGH 1F45A 3NN8A 4XPHH 3QDMD 2DLTA 2P44B 4RISH 4OCWH 1IAIH 4XNXL 1N8ZA 4YXHL 3RZCD 2PW2B 2NY2D 2CDFA 3DMMC 4ELMA 1I1YA 3MREA 1N64L 4MA3B 2FD6L 3VMNA 4X4XA 1N8ZB 1XCQB 1ZOXA 4OCSH 1GCFA 2ZPKH 1U41A 2CDFB 5GS0L 3GSRB 4OQTA 1I1YB 1BQSA 5JLZA 5TQ0L 1OY3B 1I7RA 5FXCH 3L5XL 1PZ5A 3ZKND 3LKNA 5DYOB 1AHWA 43C9B 1UWXH 4YXLL 1I7ZB 4FP8H 4P4KA 2CO6B 2ZKHH 5D1ZD 2X5PA 5JLZB 3CDCA 5BW7C 1PEZA 3TFKD 3UYOD 4QHMB 1NCTA 4XNYH 1RZKL 4JJ5A 5I1EH 2ORBL 5E7FA 5FOBA 1ZT4A 3LKNB 3AAZB 5IWLC 4QY8A 1AHWB 2HAZA 3RU8L 3ULUF 1A7QH 3W5NA 5FOBB 4RGMC 1ZT4B 3TNNB 4PJCB 1NAKL 3NCJH 1EHLH 5EG6C 3BZ4A 5CBAB 4HK3J 2NX5D 4P23B 2AJYL 3ARDC 4EEEA 2Z8SA 4IM8A 3QIUD 3VMOA 5CZKA 4KI1A 4N8CH 3HE6A 2ESVB 1ZEAH 3BP4A 3X3GH 4U1LA 1YEJL 3OX8B 3ISWA 3UZQA 3TBYB 3KXFE 3SGJA 4LSVL 2ZG2A 4LLQB 3UTZA 2DMKA 3OAZK 3BP4B 4S1QH 3LV3A 4HUUA 3PHOB 3CUPB 3MV8D 3IVKA 1QNZH 1A6AB 2JJWA 2EDQA 3VXQA 4DKDC 4UMGA 2WIIA 3FO0L 3LV3B 4HUUB 4J3XA 2K7QA 4ZPTA 1G6VK 1Z5LB 1NMAL 2WIIB 4JFHE 4TVPE 3VXRB 5C07D 1KBGL 4JKMA 3W9EA 5IUSA 3PF2A 4MWFA 5F21B 4NQEA 4ZPTB 2FGZA 4R0LC 3ARFB 1SQ2N 3CVHA 2ID5A 3PNWA 4HCRH 1JZ6A 3BZEB 5LBSH 3TPUA 2GJ6E 3O4OB 1KCUH 3BHBA 3W9EB 2D7TL 4FFZH 4NQEB 4GG6F 4DJMA 3DX6B 3HMWL 4HJJL 3PNWB 4G6JH 2IH1A 4NGHL 1HE7A 4PV9B 1LQSR 5DK0A 3OR7A 2YPLD 1FYTB 2IFGA 3S37L 4LCUA 2G5BB 3MRFA 4EZMA 1CDYA 4KQ3L 4KZEL 3HB3C 1F4YH 4RMQA 3OR7B 4NFDA 2J8UE 4PRPD 1HILA 3VXMD 2FL5A 4LCUB 2CR6A 1DVFD 3QWOB 4PJBF 1A4KA 3P0VH 4KKBC 5IMLA 4PFEA 1FAIL 1CTOA 5EUOE 3OAUH 5DO2C 3NIGF 3HE7A 3O3UN 1WBYB 1LDPH 3HPJA 4ZUSA 4XVJH 3OZ9L 5IMLB 2WLZA 4XPAL 4O00A 2IJ0C 1JYWA 1T1XB 2EICA 3HE7B 4NNYA 1AGDA 4R2GB 2OZ4A 3HPJB 1UQSA 1MCHA 4BUHA 1YA5A 2EH8L 4OCXL 5TDOA 4WI9A 1OAUL 4F15C 3QPQC 2EXYC 4TOYH 3U0WH 2HT2D 4EI5A 1AJ7L 4NNYB 4KTDH 1X6NA 3D39E 4LVOC 4O2CA 5KANI 3PL6D 4P5TC 5TDOB 3UYPA 5IFJA 3F6LA 5KZCD 4RFNB 1K3ZA 2B4CC 4EI5B 4IRJB 3VFNB 1OTTD 4LKXB 4JANB 3RWFA 1MFBL 5BO1H 2HA1A 3UBXB 4Z7UF 5DD1L 3EYSL 4E0RB 5IFJB 2E7HA 1MH5A 2X1WL 1XR9A 1HIML 3E6FB 1RUQL 4KUCD 4NQSB 4AM0A 3N06B 4HUKB 1T04A 4IHOB 5I8OH 2E27L 1MH5B 2PYFA 3V4UH 2ARWA 4AM0B 4LSSH 4A6YB 2IANE 1F97A 1RHFA 2DQDH 1T04B 5BV7B 2GHWB 1MELA 4TPRH 2IGFL 1J8HE 4HBCH 5E95B 4QWWC 2IG2H 4YBLB 1Q9WA 4WI7A 1KTKE 4LSTH 3SDDA 3RJQB 3MLZH 5FGCB 4XP9H 5IROA 3C9NB 5FO7A 2CUIA 1TZGH 1F13A 4WUUA 1Q9WB 1S8DA 4Y16B 1LP9F 1CDIA 3CPLA 2B7DT 3BN9D 5E4EC 4WUUB 3PV6A 2W0LA 4XPGL 1QFOA 4RISL 1KSRA 1IAIL 4QTIH 3HNVH 3MLTB 1AGCB 1LO0H 3ZKXC 4GT7A 2O5XH 5I8EA 3B8YA 4PJ5A 5F93C 4PBWD 1ORSA 3RRQA 4U1NB 3QWRA 4OCSL 2OTUB 2ZPKL 3SDCC 1KCLA 4NZTH 5I8EB 4PJ5B 1ORSB 3V5KA 1P4BL 3MBEC 4G9FB 4ACPA 3P9WB 1QRNA 3VI3E 2ZKHL 4U7MA 3V5KB 4DQOH 4XNYL 5I1EL 5KSAD 1HN1A 4R97B 2ADFH 1JBJA 2BZDA 3WNKA 3L3JA 1P7QA 1A7QL 4XX1E 4KROB 1NGWA 5CFHA 1HKLH 3VXSA 1EHLL 5D2NA 1K4CB 1JVKA 2I9TA 4MXVF 1NGWB 4NFBA 5C0BB 3VXSB 4OBRA 5D2NB 1K6QH 1ZV5A 2I9TB 4N8CL 3PGDB 3S4SA 4YHML 1ZEAL 5GRZA 3X3GL 2P5ED 3NABH 4ZAKC 5F8QC 1U42A 1ZHKB 3G5YB 2CK2A 1TQCC 3P77A 3TBTA 4HD9A 1NCAH 3S4SB 4Z7NF 3L3IA 4JHAL 4M8VA 1QNZL 2YA0A 2D7MA 2CIIA 4OD3L 5DA4A 4MZ3A 5JOFA 3P77B 3TBTB 4FFYH 4HKBA 5FB8B 3AS3A 2UZIH 2QSVA 2VZ1A 1RZ7H 3EGSB 32C2A 4YNYA 4EJ1C 4PGCA 3V4VH 1SHMA 2YBRB 3OKNB 2X4PB 1GGIH 4HKBB 1W72H 3FOLA 3ULUC 4HGMA 2IANA 32C2B 3S4SG 5I6XC 5EBGA 5F7FA 3GSXA 4HCRL 4JM2A 5LBSL 2XV6B 3FOLB 4OM1H 1KCUL 4U6VH 4LPVA 4FFZL 1W0WB 2D9CA 3IXAA 3FB5A 2YSSA 4P3CH 3K8LA 3QO1B 4G6JL 4JPKH 3WNLA 5TDNA 2OTPA 4HC1A 4X7TB 1DE4A 2YSSB 3FB5B 4NWTH 4P46A 4YBQD 1JE6A 1F4YL 3IS0X 5TDNB 4WWKA 4YHIA 1U95A 3IXTA 3IT8D 2DBLL 5HI5D 1JRHI 5I1IH 1ITBB 1VDGA 5E7BA 3P0VL 4WWKB 3OAUL 2Y25A 4GFTB 3KPOB 4ZS7L 3IXTB 2WIMA 3KPMA 2P5WE 2NY5C 2Y9RT 4RGNE 3STLA 5AWNH 2XTJB 4GLRH 3RNQA 2ERJB 3KPMB 3WXVH 1CE6B 3KPSA 3CX5J 4TOYL 3U0WL 4CVXA 4WFGE 3RNQB 4KTDL 3CFBA 5D96C 5EA0H 4Z0XB 3A0OA 2Q76A 4QRSB 4X6CB 4CVXB 5SWQA 1CFSA 4D0BA 1QFWI 2B8OT 3DJ9A 1CQYA 3ULVF 3CFBB 3C5ZC 5BO1L 2Q76B 3DSNA 4XC1H 1DQJB 1KLUB 4D0BB 1IC5H 1MJUH 2VITA 2OSLB 3BUYA 2EYSB 2FHFA 4Z6AT 5I8OL 1F4AA 3QDJD 3GJFA 1CFTB 3O3AA 3V4UL 5F3HB 4LSSL 4U1MA 3EDEA 4M7ZC 3SE8L 3NVQA 1I85C 1FPTL 1QLEH 2DQDL 3CZJA 3WSQL 2AV7B 4TPRL 3GJFB 4APQC 1L6ZA 1N6UA 4GAFB 1U3ZA 1X5HA 2IG2L 5HHQB 5D7LE 1A5FH 5JORA 1DR9A 5C8JB 4JKPH 1S7RB 4LSTL 3KLAA 3MLZL 5F9AC 1DN0B 1T4KB 4XP9L 1I1AC 4D9LH 2IQ9H 5DJYA 3IDUA 1HSBA 2DAVA 3KLAB 5IKCA 1MAML 4XPFH 5DJYB 2VLKD 5C0AD 1S9WB 2IBGA 2QQLH 1YEKH 3RVVC 1D5IH 1X5GA 1CD1A 4QTIL 3HNVL 4M6OH 1LO0L 2O5XL 2CD0A 3DUHA 3JSSA 1EBPA 2RBLA 2V17H 3IB4A 1CD1B 1MHEA 2HYMA 4TULH 4NZTL 1UVQA 2Z93A 1KYOK 2I60H 1XF2A 1MHEB 1XF5A 3TPKA 2K9UA 5I30H 3JVGC 4ODVH 5D5MF 2XACC 4QTHA 4R7DA 5GZOC 4DQOL 2NY1C 2O61B 5B22A 2AQ3A 1FH5H 1XF5B 2XTLA 4H0HB 4POZD 4DK3A 4M7LH 4Y2DB 2ADFL 3VGHA 1QZ1A 4QTHB 4R7DB 4ALAH 1S5IL 1CDCA 2FX7H 3CFEB 2J7LA 1NFIB 4Q9BA 4ZXBC 1CGUA 1HKLL 4EXKA 2DBJA 2P24A 4GAYA 4FXLA 1IKFH 2XZQH 1WBXB 4Y4KA 1CDGA 5D7IE 1CIUA 1A6UH 2RJMA 2P24B 4XVSH 1K6QL 3NIDE 4GAYB 3MLVH 2JE8A 4IIQC 1D5XA 3ARGA 5B8CB 4Y4KB 3LSOA 3NABL 3HUJA 4I8DA 4BQCA 3QUZC 3FQTA 2VUYA 1OF2B 2R69H 4KJWC 1NCAL 3FJTA 3L1OL 4HMEA 1NDMB 4UIMB 1X5IA 5F9JA 2Y5TA 5HPOA 3MPCA 3HLAA 5C0FB 4LHUD 1UKTA 4Q58C 4FFYL 4AH2A 4L8CA 1X7QB 2UZIL 1F11B 3O8XC 1CL7I 5F9JB 2Y5TB 4LCWD 3HLAB 5E6IC 5GJTH 5H37H 4PJEB 4PG9A 1K8IB 1GGIL 3PWJA 3RWJA 4L8CB 5DHYA 3RVTD 1VESA 4N9GA 1H3XA 1FO0B 2ADJA 2BVTA 4OBSA 3BE1H 2AI0H 4PG9B 4F7PA 5ADOL 3PWJB 4I3SH 3V0AC 3TYFB 5DHYB 5HDOA 4JZOB 3O41A 4N9GB 4U6VL 2AV1A 1YQ2A 1MI5D 3P4OA 5JMRA 4P3CL 4FQXA 4K7FA 2QEJA 3HNTH 4JPKL 2UYLB 2AV1B 3GRWA 4L4TE 4NWTL 4M6MH 4FQXB 2A77H 2ZSVA 4K7FB 4WEMB 3RNKA 2C3WA 5DRWB 1S9VB 1XIWA 2EYTB 1TZHA 3ARPA 4MGXA 1JHTA 1TMCB 4M8QA 2OR9H 2WBWB 1M4KA 2EIBA 3V5DB 2ZSVB 3RNKB 2EO9A 4PD4J 3ZTJG 1XIWB 3EUUA 4OGAD 2AKRA 2HWZH 1S78D 4Y5VC 4JKLA 5DR5L 3W11C 5FFLA 5C3LD 2AKRB 3MRBA 2ZUUA 1E6JH 1NUDA 1W0VB 3FQXA 1CXIA 1KCVL 4NZJA 3WXVL 4JO2H 5C08E 4ZUTA 2IMMA 3D3VE 4ZOCA 5H35B 3MRBB 4I0CC 4UU9A 3IDXL 3CDGB 5AZ2H 4M1GH 4ETYA 4LNRB 4MNQD 2HFEA 3T04D 5EA0L 4OIBA 4ZUTB 4UTBL 1Q0YH 4UU9B 1NBYB 5T1LD 5JPNA 3MV7A 4HG4J 4OI8A 2HFEB 1Q9KA 3DMMD 2WV3A 2P45B 4D9QE 5DJ6B 4Q9CA 4XC1L 1DZBA 1ZHNA 4OF5A 1CI5A 5JPNB 5MHSD 4NO5A 2NY3B 3MBXH 3T65B 3W9DB 2AJZA 3B3IA 2HTLC 1ZHNB 2Z91A 3BGFC 5DJ0A 3VXUD 3RUGF 1H5BC 3IU3B 3SKNB 4NO5B 3EYVA 2R9HC 4HUVB 2E9JA 4FXGA 1PX3A 4OCLC 3QI9C 1QLEL 5DJ0B 5E6ZA 4QRPA 2EDBA 2W38A 3UZVB 2XQYG 4G7VH 1RZJH 5EWIH 4Z8FH 4M7JL 4QHKJ 1BQUA 3AY4C 4M03A 3JTSB 1J87A 1A5FL 2BCKA 2JB6A 3OV6A 4QRPB 4JKPL 3FZUC 1P4LB 5CKAA 2C3HA 4D9LL 4ZODA 1I3GH 4U6HA 2OR7A 3DBXA 3V4PH 2IQ9L 3NA9H 2JB6B 5K93A 5JDJA 4KK5C 5FF6A 2GTZA 5ISZE 5IHBA 1CICC 1IC4H 1NC2B 3FFCE 3G6JF 2B1AH 3DBXB 5AAWA 2QQLL 1YEKL 5FF6B 4X80L 1D5IL 4IMKC 2ZUXA 3ULVC 4KHTH 4M6OL 5F9DC 4K07A 4G8GB 4JY4B 4XWGH 1DJSA 1R3HB 3HKFA 4MVBC 2V17L 1W2KT 4OF8A 5GJSL 2EDDA 2X10A 4YFDB 3HR5A 2I60L 3MRCB 4X9FA 3TESA 4ODVL 1H3PL 4AMKH 1JF1A 4Y8DC 2EIZB 4M7LL 2A6JA 2NTSP 3DGGB 3VWKA 1INQB 1EXUA 1U8PA 4ALAL 5EBWB 4UIKH 2FX7L 4OFPA 3A67H 1OWWA 1WTLA 3QQ4A 3CH1A 1WISA 2VNCA 3AS2A 1EXUB 3O9WA 2VR4A 3FT4A 1IKFL 3FQWA 2XZQL 3HZYA 5HDBF 1CVRA 3LMJH 1U8HA 1BZ7A 4BQ6A 2R29L 3QQ4B 3CH1B 1A6UL 4XVSL 4X9IA 2PW1B 2YPVL 2APBA 3MLVL 2Q86A 2PO6C 1U8HB 5J6GB 3TZVA 1OPGH 2I07A 3MJ6A 3PQYA 2PTTB 3HB3D 4MA1C 4OF0A 4YC2B 2RIKA 3SEPA 2VZTA 1MFEH 2OI9C 2Q86B 2R69L 3VW3H 3PQYB 4M6AA 5DJDA 1AGBB 2A6DA 4KKBD 4M93B 1A2YA 2XICA 5DO2D 4HJ0C 2A9ML 4OZHA 5HVWA 1IARB 3V0VB 1JV5B 5DJDB 3RWEA 3PGFH 2A6DB 4Q74A 2EDTA 3ETBF 1L6XA 5J8OA 4BQBA 1KLGB 3VE0B 3G6DH 4OZHB 2IQAB 3LIZL 2A9NH 2OMNA 3CXHK 4Q0XL 1RD6A 5JPMB 3QPQD 2EXYD 4NQVA 1KNOA 1XCTA 2AK4D 3BE1L 2AI0L 4S1DD 4DUXA 4I3SL 1K85A 5BV7H 3TN0C 4NM8H 4P5TD 1W72A 1EBAA 4DW2H 1C16A 5DGRA 3NCMA 3ARZA 4UQ3A 4FQCH 1BD2E 2VO5A 4YR6A 1Q72H 1C5DB 5ISZA 3V5HA 4M6ML 4NQCD 2A77L 1C16B 3X3FH 3GHEH 1HXMB 3O6FB 3TVMA 5AG8A 1N4XH 5FYJD 5GRUH 3D25A 4X98A 4UQ3B 3TWCH 1ZLUK 3V5HB 1OTSD 5FK9B 3TVMB 3FN0H 3QXWA 4WNQA 5IB1A 2XRAH 1I9RH 4J8RA 2HWZL 5ICZA 5E9DB 3CNKA 1QTYT 4QWWD 4OLVH 3ZDYE 5IB1B 5GPRA 5I8KH 4J8RB 1E6JL 1V7NH 2BFVL 3F7YB 4GUPB 3TBSA 4JO2L 3UDWA 3ZSTA 5AZ2L 2VL5A 4M1GL 3KYKH 3VXOA 4J3SA 4D9RE 1AGEA 1GRWA 3TBSB 4PG2C 1Q0YL 1MCPH 5DJXA 3W0WD 2V9RA 3MACH 5SWZA 5C2BH 2VL5B 5GGTH 3RKDD 3VXOB 2VLJE 5FOJA 1TVBA 3AREB 4DKFH 5SWZB 2EDXA 3L7FA 3MBXL 1I8KA 4OZ4A 3SDCD 3DWTA 5LGJB 3UX9B 4O9HL 1VA9A 1BFOA 4YBHA 5CP3A 1P6FA 4JKKA 1TVBB 3EDJA 2NXZC 3MBED 4J3VA 1HEZA 1I8KB 4DAGL 3F6IA 1BF2A 2UY6A 3JV6B 1MCRA 2HH0H 4TUKH 3DSFH 3MJ9L 2XQBH 1RUPH 4Y89A 4G7VL 1E4WH 5EWIL 1HEZB 5E1AA 4FZ8H 2ED7A 4PJ8B 3GSQA 1WC7A 1T1ZB 3CFDB 2FR4A 4OGYH 5E1AB 1MSPA 2GI7A 1IE5A 3WIIL 1I3GL 5IW6A 3V4PL 3NA9L 1EFQA 3GSQB 3ILPA 1CT8A 1UM4H 1WC7B 3QDMA 1NFDF 2FR4B 2VZ3A 2EXWC 1IC4L 4RMVA 5MENE 5IW6B 2B1AL 5F7WC 4ODHH 3ILPB 1CT8B 3QDMB 1UCBH 2L7UA 2FJFA 4ELMF 4X6BA 3RZCB 2NY2B 3GMQA 5KVMC 3TV3H 5DEZA 2FJFB 1CG9B 3CU1A 4X6BB 1WEJH 5A16B 5CSZB 3GMQB 4LFHG 3HZKA 5HVHB 3GMLA 1BD2A 1FE8L 2QV2A 4M4RA 5IM7A 5F7UA 3QXDA 5CIPH 4OCNC 5D1ZB 1WGOA 2VYRE 3GMLB 1IGTA 1OW0A 5IK3A 4AMKL 1P7HL 2F15A 3GIVB 3MLRH 4JM4H 1RJLA 3BX7C 3ULUD 5IM7B 4WI2A 1CDJA 2DB8A 3C87A 4QXUH 5J6HB 1Q9LB 4OFDA 5IK3B 5KTEH 3H9SD 4XXDA 1E28A 1GGCL 3U36A 3A67L 5M94B 1YY9C 2NX5A 1FZKA 3PDDA 2HKFH 2VXUH 3GO1H 1BMGA 1AR2A 1UJ3C 4XXDB 3LMJL 3U36B 4JEGB 2NX5B 1M7IA 1FZKB 1DDHB 3ZDZF 3QIUB 4M61B 1U3HC 2NNAA 3IAQA 3MRIA 3SCMA 3TBWA 4U1JB 3KPNA 3VFGL 1OPGL 4PJCE 2QADC 1B0WA 2GFBA 2N7AA 3RX8A 4I0KA 5TDPB 4JQVC 1CGWA 3OHXA 1MFEL 3MRIB 3TBWB 1WFOA 2IALA 2LTQC 5HY9B 3KPLA 5DT1H 1CGVA 3MV8B 1NBZB 4KTEH 3OHXB 1DQQB 2ESVE 5DMIH 3HAEA 3Q5YA 2LAGB 2IALB 1OSPH 1Q9OB 1T03H 3LKOA 5TQ2H 3KPLB 3PGFL 1CTNA 2J6EH 2NCMA 3G6DL 4GXVH 2A9NL 4TQEH 1OAKH 4LLMA 4OCMC 5ITFA 1NUNB 4A6YL 1NDGA 3N85H 5GS3A 5BV7L 1CXEA 2D0HA 3PWVA 4UV7H 1NDGB 1FFNA 3C60C 3VXRE 4U1GC 2D4DA 4DW2L 2W92A 3KYOB 3KPQA 3AM8C 3HAEG 3KJ4B 5D8JH 1ZA6A 3BKJH 3QYCA 5DS8A 1TTUA 2PYEE 2YPLB 1S3KH 2WW8A 1FFNB 2WANA 3X3FL 3GHEL 1IAOA 4V1DE 2UVFA 1N4XL 4PB0H 3KPQB 4KY1L 5EULV 5GRUL 1DVFA 3RTQA 1ZA6B 5DS8B 3QXVA 4PRPB 1BQLH 2RCSH 4WTWA 3VXMB 4X7SH 4ZO6A 3FN0L 1IAOB 1MQKH 5DK2A 1DVFB 2XRAL 5E8PA 1I9RL 4JFZH 3EO0A 4APQD 4PS4H 1ZLVH 2GK2A 4ZPVB 5A1AA 3I50H 3DRTB 4OLVL 3U2SB 4OV5A 5DK2B 5FKAB 1I1CA 5E8PB 3T4AA 1DSFH 5I8KL 5E2VH 3ILQC 4TUJA 1V7NL 1BX2A 2WUCH 1I1AD 5F9WC 5F7DB 5IOPB 2WMPA 4OV5B 1I4FA 3T4AB 1QD0A 2Y4SA 1HHGB 4WHDA 3MCG1 5DDHA 3KYKL 3LB6C 1GH7A 43CAA 4J4PA 1I4FB 2LABA 2GY5A 1GIGH 3PL6B 4XVTH 1MCPL 5HJ3B 3RVVD 4KVCH 5C2BL 3UTTD 5GGTL 5KZCB 4HWEH 43CAB 2UUDH 2VERN 4W4OA 3T3ME 2DM3A 4DKFL 1IAII 3OG4B 1P6AB 3QFDB 3U48A 1PY9A 5CS7A 4URTB 3MRJB 3KPRE 1G6RH 4JRWA 4FHBD 1JN6A 1DBJH 5JNYB 5LXGH 4CN6A 5FECA 3C6SB 4QRUA 2GT9A 2JB5H 1OAXH 2HH0L 4AG4H 5GZOD 4TUKL 3DSFL 2NY1D 1MAJA 2XQBL 4JO3H 3BEVA 1JN6B 5GS1B 3PWPE 3M17A 5D6CB 4FZ8L 5FECB 2GT9B 3OPZH 5T3XH 4ORZC 1V8HA 1A8JH 3LKRB 1LE9A 1UB5A 3HI5H 4OGYL 1X4XA 2YUXA 3DETC 5MEOA 1EX0A 2F54D 1UM4L 5FM5M 5E56A 1LE9B 1UB5B 4FQQA 1DEDA 4IMLA 1ZANH 5B21A 1TJHH 4ODHL 5EBLA 5HGDA 5FGCE 5J13B 3STZA 4LCIH 3S34H 4PJDA 4X9HA 4AZ8A 1K3IA 4JGUA 3QUZD 5EU3A 2VZUA 4W6XB 1YJDH 4BQ9A 1WEJL 1IM9D 2HLAA 3P11H 5EU3B 1S7WB 3GBMH 3RIFK 2Z8VC 2ICWB 4P9MH 2BNQD 4Y4FA 2J8UF 2HLAB 3QJFB 3GKZA 1WQVT 5E6ID 1TTGA 3TA3C 4YPGA 4BSVA 3MLRL 5GGRY 5C92A 3L95A 5KSAB 4Z95H 5EUOF 4ZS6C 5FCUH 4K3DL 3RWDA 4QXUL 5KTEL 1YDPA 2XN9D 3TLRA 1TVHB 4MNGA 3WJJC 5ACZB 2CQVA 2VXUL 1CLCA 2ICEB 4BA8A 4QYOA 5DSCB 1R3LA 2YZ1A 1H3WM 2ZUTA 2P5EA 4Z0BL 5EU5A 4Q9QH 4OI9A 4L3ED 4S11A 1RJZA 4I9WD 4QYOB 1R3LB 3SBWC 2P5EB 3QA3A 5EU5B 4HIJA 4AYFA 2AQ1A 3HPLB 5CHNB 3LS5H 2R0WH 1SJEB 3QA3B 5DT1L 1SYSA 4MCZB 3AXLA 3G6AA 4KTEL 1OARH 5DMIL 4QRRD 1OSPL 2Q3AA 4L9DA 1T03L 2AGJH 5TQ2L 2X6MA 4JDZA 3W11D 1SYSB 2BSED 3G6AB 2J6EL 3VFVA 4XH2A 4JZJC 4N0YH 2DQEH 2Y7QB 2O5YH 1IZKA 4GXVL 4FXKB 5E8OA 4TQEL 1OAKL 4L8BB 4XH2B 4UDTA 3I3BA 3N85L 3PWPA 3CX2A 2VOTA 1NLBH 2R0LH 2ZCHH 4L9LA 1QHPA 2LVCA 2YD9A 4OZIE 3HE6C 3V7AG 1EIBA 1A1OA 2WBJA 3D85D 5D8JL 3BKJL 2OJEB 1NANH 1NBQA 2JJTC 4H1LA 3V6OC 1S3KL 5JA8B 4ZOEA 2DM4A 1RMFH 2HTLD 4PB0L 1A1OB 4OLWH 3ARSA 3ARUA 2JCCA 2RCSL 2R9HD 4DGVL 1OB1B 3QI9D 4P2RE 1FCGA 2XKSA 3SY0A 2HKHH 4JFZL 5KVEH 3R4DA 3EFFA 3EO1B 2QQQA 1Q38A 1R6VA 1FJ1B 3X14B 2EE3A 3HRZB 3SY0B 1DSFL 1JF5A 3Q1SH 4L5FH 3FZUD 5E2VL 2NTFB 3VI3F 2WUCL 3LEYH 4H1LG 3JUZA 4KK5D 1XGRA 1QSFA 2BVEA 3MNZB 1CICD 3P9LA 5DJZB 4NZUH 1GIGL 4XVTL 2XTJE 2HG5A 4KVCL 4WHTA 3ULVD 1S7QA 2H8PA 4E41E 2QR0B 3BZFA 3QEHA 4HWEL 1FVEB 2BOBB 3QHTC 1YYMH 1J1PH 5J1SC 5B38A 2HG5B 4MVBD 4XC3H 5ADPH 1JWUA 2H8PB 4PJ9C 5DURD 3QEHB 2VDPH 1XGTA 1MJJB 1QLFB 4UUJA 2DWEA 4X6CE 3LDBC 1G6RL 3VGEA 2PETA 1JWUB 1DBJL 4MCYA 3QDJB 5LXGL 1MUJA 1G7IA 2JB5L 2DWEB 1OAXL 4KJQC 4AG4L 3HA0A 3WS6C 3TGXA 3MLYH 3MX0A 3CH8A 5BVPH 4PR5A 1VEOA 3WFDH 3R8BB 3OPZL 5T3XL 1UZ8B 4PR5B 3HI5L 3MNVA 1EVUA 2W9DH 5JHDE 5B38G 1UEMA 1ZHBA 5FAAA 1S5HA 5C0AA 3K4AA 4FFWC 2EDYA 3QXAA 1QSZA 3ROOA 2FSEB 1MCIA 5MEQA 2VDMH 1ZANL 2XI9A 5DD5H 2YPKA 1URLA 2HJFA 1ZHBB 3MV9E 4O02H 5C0AB 2VLKB 3QXAB 3MUHL 2PO6D 2Z4QA 5EZOH 5MEQB 3BN3B 3UJIL 2ZWLT 4FS0A 1FO0L 4HIEA 1YEEH 4LCIL 3KYMA 3S34L 2BHUA 3QNZB 1MFDH 5EOCJ 1DUYA 2HVKA 2Z4QB 4OM0L 3LN9A 3N9GL 4JQIL 3LQMA 5L7XH 1DUYB 3PG2A 4PJIA 1MOEA 2HVKB 3BAEH 2XG4A 3GBML 2G2RA 4HJ0D 1VGKA 5E5MA 4M1CC 5DTFA 1QFPA 4P9ML 4BZYA 4WDIB 1UXWB 1QO3A 2R0KH 4ZUWA 3E2HB 4ZFOA 5ANME 1MREH 1FNEB 3SDDC 3EDFA 5IMOA 2P47B 5JO5A 4Z95L 5IROC 5JZ7C 5FCUL 2Q7YA 4XB7A 2C7UA 2OBGA 3BRDA 5CIPA 4K71C 1KELH 4DN4H 4U49A 4G6FD 4M9OA 4Y5XA 3SPVB 2Q7YB 1IGYA 2VN4A 3GMOA 3TP4A 5DF0A 1HOCA 1T5XA 4OLXH 4Y5XB 5FHAL 4C56D 5HGHA 4Q9QL 1IGYB 1JTTA 2C1PB 3GMOB 4P9HC 4JPIA 1HOCB 4YWGH 4Z7WE 5K9JH 3DUSA 1TLKA 1OCWH 3T09A 1HDMA 4JPIB 3LS5L 2R0WL 2VXTH 4R3SB 4Z7VE 1UJTA 2DQIL 4JFFD 1CZ8H 4K3EH 5GS0C 4PP1C 1G1YA 1OARL 3QEGH 4LHUB 3U4EA 4PJ7B 4MS8C 1DQMH 4K94C 4PJGA 3X12B 1JNNH 4YO0B 5T3XE 2H3NA 4LCWB 4JVUA 2DQEL 2O5YL 3S35H 3U4EB 3T0AA 3Q5OA 2WINB 4PJGB 4MQTB 1YNLH 3LN5A 1RZKC 4GLRI 5LWYH 2HMIC 2ARJQ 2J6EA 3IDNA 8FABA 3UO1L 5JUEL 3Q3GA 2DQUH 2R0LL 2ZCHL 3WEXA 4YAQA 3MRLA 3VGFA 3QDGE 1MI5B 1ZMYA 4I0PC 3RL2A 1JL8A 2NR6C 5JHDA 3RAJL 4F3FA 3WN5C 4HK0A 2VE6B 3PIQB 5BRZD 3P4NA 4PTTB 2GSIB 4ELKA 4F3FB 5GZNC 3MV9A 1ZVSA 4HK0B 2NXZD 1EHNA 3O3BA 5IIEA 4UB0H 2R8SH 1JHKL 2HKHL 3R8QA 1ZVSB 4OJFL 5KVEL 3NFSH 3H9ZA 4BSWA 5IIEB 2XKUA 4YIQA 2A73A 2W9EH 2E9IA 3TIEB 2GAZA 4PGDA 3SO3B 3QH3A 3C09B 4YIQB 1X5AA 3LEYL 1HWGB 4MNQA 1EH9A 4MB3A 3T77B 5ALBH 4JB9H 2F19H 2GAZB 2A83B 4PGDB 4ETQA 5T1LA 5IW1A 4HFUL 2I9LA 2EXWD 3Q2CA 4MNQB 4JFEE 3DMMA 4HW6A 4NZUL 4QXTA 4ETQB 3P4MA 5T1LB 4ERSH 3O3EB 2UVEA 4F7CB 3FRUA 4UT9H 3DMMB 4P46C 3CXDH 3A6CH 4TTGA 5A2IH 4XC3L 3P4MB 5D7IF 2VDPL 3NIDF 3B2UC 2LU4A 2BSSB 5BW7A 1G7QA 3VXUB 4X4YB 2H2PC 2QKIA 3WO4C 2VR9A 1WFUA 5IWLA 3CLEL 4Z7WA 2AXGA 5ALCL 1NCCH 2Z35B 1FFPA 2BERA 4HIIA 1VFAA 3WFDL 5FYKU 1D6EB 4U0RC 5FIEA 1P2CA 4H20L 1U58A 2MNUA 4N0UB 2D7PA 1IAKA 1VFAB 1AQDA 2W9DL 4RGMB 2FZ3A 4S10A 1RJYB 4G43B 3ARDA 3FB8A 3VFTB 1INEH 2YZ8A 4HQQH 3WLWC 1U58B 1IAKB 3B9KD 2VDML 2VDQH 3QQNA 4JPVL 2FZ3B 5DD5L 5C71A 4MQSB 4JZNA 4O02L 1U3HD 3NTCH 5EZOL 1EJ6A 4L8SC 4H5SB 2QADD 1F3JA 4K2UH 5SV3A 4JZNB 3HNSH 3IJHA 5E2UH 4X6DA 2UWEB 2APVA 5JOEA 2Q8BH 3OF6D 4JFPB 5FUOH 4MLSA 5E8EB 1M6OA 4X6DB 5L7XL 4OI7A 3BAEL 5DVKA 4MHHI 1C8PA 1EEYB 4G8GE 2GITA 4LQ1A 1AKJA 4TSAL 2R0KL 3OKEB 4FG6C 2GIYA 4R0LA 5FO9A 2GITB 2V2XB 3MA9H 4ODXA 1A6PA 1UYWL 3V8OA 1QBAA 2DJ4A 4QRQA 4NHUA 3BKMH 3HZMA 5F72S 4HKZA 3UP1A 1KELL 5FA3A 4DN4L 4R0LB 5C7XH 5FO9B 3U30B 5K9OA 3INUH 4NHUB 2A38A 5J0BA 3HZMB 5TE6H 3C60D 5FA3B 4EIZC 1UH4A 1KYOJ 5K9OB 4OLXL 1YNTA 2GJJA 3D18B 1T20A 4KQ4H 1IBGH 3RVUC 4Z18A 2NYYD 5J3HD 1YNTB 1AD0B 4JFEA 4LHQB 4X83A 2AJ3A 2N7BA 2W9LA 4OZFB 3FFDA 5IMMB 2D03H 1U9KA 4NRYA 1U8OA 2VXTL 2E7MA 4OZGA 4X99A 3DECA 2AJ3B 4L4VE 4JRYD 4K3EL 1CZ8L 4JN2A 5HYJD 3QEGL 4U1IB 3GJFK 1H3GA 4NRYB 1U8OB 5C86A 1BBDH 1DQML 4OZGB 4X99B 1OHQA 3BUTA 3O4LA 2A1WL 2ILLA 3TO4C 3A6BL 4LLVB 3ILQD 1ZLWK 2AK4A 3S5LA 4PLJC 3V8CA 1N0XL 4F33A 2VDOH 5EU6E 5J11C 1YNLL 4P5TA 2XKNA 2VAAA 4F15B 4JDVA 4RGNC 2X4SA 2AK4B 4GW5A 4XT1C 3S5LB 4ZMAT 1W8OA 3LB6D 5ID1A 4F33B 2Q8AH 2DQUL 2MKLC 3OKOB 4P5TB 2XKNB 2H32H 2VMFA 2X4SB 4GW5B 5DZNA 3MGOA 4MJIA 3ARGC 1ZLVK 3HHRB 4G80A 4FMFA 1BWWA 2OL3B 4X8JA 1P5VA 3F8UB 4Y19A 3MGOB 3OG6B 3S5LG 4CJ1A 3KPPA 1FQ9C 4G80B 1TCMA 5DGQA 4W6WB 1LO3H 2X4NB 2K3TA 4UB0L 5I1DA 5DMGD 2H9GB 1YN7A 3NFSL 4XMKH 3DPBA 3OGCA 3V6FB 1I7UA 1J12A 4G6MH 4LAQH 1GZPA 1SJHB 3V52H 1PX4A 4ZD3H 1QSVA 4JHWH 1I7UB 3DETD 2Y07H 2F19L 4JB9L 5ALBL 4QOKE 5BCAA 1GZPB 4RGOL 5E4EB 4PTUA 1CD9B 2BNUB 3FN9A 5F1OB 1NUFA 4PY7A 4X5WA 1JZ4A 3DVGB 3W0WB 5KSBA 4KRMB 4ERSL 4PJAB 5DUMH 4PTUB 1KTRL 4UT9L 3W2DL 2DYPD 3I6LE 2CDEA 5E99H 3SDCA 3ZKXB 1F4HA 3A6CL 5B39A 4YX2H 1CGSH 1LMKA 1MFCH 5IP4A 3VDAA 1HYSC 1EFXA 3SDCB 5JW5A 5FGRA 3ZHLA 3ZKMD 3R06B 3MBEB 3ZT5A 5JW5B 1NCCL 4ONFH 3TA3D 5L6YL 4PJFA 3HC4H 5HGBB 2VJXA 1T1YB 3HI6H 4ZS6D 3VWJC 4P2OA 1EAPB 4RFEA 5GS2H 1TQBC 2W0KA 4PJFB 4I13B 4OAWA 5B39G 3L6FA 2J1KA 3AU1A 2D9QB 1X5XA 4RFEB 4ZO7A 4HQQL 2YXFA 3QUXC 1SY6H 2Z9TA 2VDQL 2IPTH 5I66B 3AU1B 4F80A 4NC1E 4ZAKA 2BK8A 5EU6A 2IMNA 5D7JA 3BIKA 3MRNA 3NTCL 5DQJA 4D0CB 3VRLE 1O7VA 4K2UL 1I8IB 4NT6A 5E2UL 2Q8BL 1TQCB 3BIKB 3KLHC 5DQJB 4YQXL 3DI2B 5FUOL 4ONOA 2R0ZH 4KRPC 4P4KD 5I18H 3BD4A 1MHHA 3GSVA 5E6YA 3CSGA 1FN4A 3TBVB 5LAXA 5IT2H 1JZ5A 3T0DA 1MCOH 1LK2A 5DUBB 5GGUB 4FTVE 3GSVB 3UBXI 5I75C 1FN4B 3L3GA 3MA9L 1MHCA 2NW2B 5E00A 3BKML 5I6XB 5HSFA 2WQ8A 1PSKH 5C7XL 3H9SB 3L3GB 5EO9A 5IBUB 2BP3A 3INUL 3ZE2E 4U2ZA 2GK0A 3IFLH 4OLYL 4YFLF 2NY7H 3KPTA 4ZSOA 3MUZ1 3VD9A 4XP5H 3HE6D 4Z78A 4BSJA 4LARH 5T5FH 4WTXA 2FJGA 3VD4A 2GK0B 1T66C 1IBGL 3MO1A 5LVEA 3F12A 4ZSOB 5JIKA 5E2JA 4OT1H 1TJIH 1FVDB 2FJGB 1VFUA 3RL1A 2DQJH 5H2BA 3VFWB 3MO1B 1ZT1A 2D03L 4WEBH 2EYRA 3RL1B 5H2BB 2XNAA 5EH1A 1ZT1B 4X4MA 3SOBH 1Y6KR 5T3ZD 1BBDL 1AD9A 3I6GA 5EZIH 1LO5B 5KW9L 2W60A 2D0GA 1XH3A 3TO2B 2IBBA 4D8PA 3Q5TA 1KCSL 2BSTB 2ENSA 2VDOL 3I6GB 3MV8E 4P3DA 2W60B 3RJDA 1WSST 2XG5A 4D8PB 3DNKA 5D96B 1CR9H 3C5ZA 4P3DB 5T1MA 2Q8AL 3G5XB 2NMSA 3U9UB 4GG6B 1I9IH 5E5UB 3IF1A 3RGVC 3PGCB 4HV8A 5C07E 5F7NC 3T8XA 5T1MB 3TZVC 5SWSE 3H42H 3IKCA 4PJ9D 5EZJA 1SJXA 1KT2A 4HV8B 5BS0E 3T8XB 3B9EA 1I85A 1U8KA 1HI6B 3MCKA 3FB7A 1EHXA 3D0LA 3CXHJ 3SKUD 3VXNB 5L2KE 5EZJB 1VACA 4APQA 1KT2B 1KCRH 1LO3L 4PJBB 4M7ZB 5D7SH 4KJQD 1U8KB 2WSKA 3I85A 2YPLE 4APQB 1ODAA 3WS3B 4XMKL 5HD8C 1I1AA 3F7VA 3BIAX 2E7LA 5T5NF 1FIGH 4G6ML 3G08A 4LAQL 4PRPE 1PG7H 1PZUB 3V52L 4X6EA 5AYUL 4ZD3L 5E70A 1I1AB 3F7VB 4G8IA 3IDIB 4JHWL 2RFXA 1FAKT 2FBOJ 4IOIA 1F8TL 2Y07L 1XZ0A 3I75B 4FFWD 1FV1A 1F4WH 3HTLX 3UTTA 1NCDH 3IJSA 4G8IB 4HKXA 2RFXB 4IOIB 2E8ZA 3ESVF 1XZ0B 1U36A 4HMDA 1FV1B 1MLBA 3ARVA 1C1EH 3VD5A 4KVNH 5DUML 3UTTB 4ZTPL 1GZQB 1YN6B 4Z7UB 4LVHC 4YX2L 1CGSL 1MLBB 2BVQA 2G9HB 1PKQE 1LDSA 1FHGA 3MFFA 3JVGA 2C9AA 3C2AH 2BVQB 3MLSH 4PJCF 5DVOA 3SGKC 4RA0C 4M1CD 3KXFD 2IH3A 1OAZH 3QEQE 1A6TB 4U2YA 1JUFB 4LPUA 1C08B 4HIHA 3I02A 4ONFL 4KMTL 1QQDA 2NY1B 4RMTA 4LLWB 3HC4L 3SDDD 2IH3B 1A7PH 4BZ2H 5JQ6H 3FKUS 4ZXBA 4LEXH 4HIHB 3GMPA 2VRAA 3I02B 1ZA3A 3UDWC 2CKBA 3V6BR 4Z7OF 5IB4A 4IBLT 1LP9B 4JFHD 3M45A 3GI9H 2FEDC 3GMPB 2R56L 2F54B 1SY6L 1KB5A 5A40E 1DL7L 2CKBB 4FNLH 3LZFH 1A4JB 2IPTL 5C0CE 1G7HA 3GJEA 4N1EA 1U8QA 5I19H 4MLIA 3QUZA 3L3HB 2VDNH 4PJDF 5C9JB 1I1FA 1KB5B 4IIQB 5F9OH 4LVNC 1G7HB 1IM9A 4NYLA 3GJEB 3S8WA 3HC3H 3QUZB 4KK6C 4BJLA 4F58H 1I1FB 5KVDL 4KV5E 1KJVB 2BOCA 2CSPA 4QHUA 4DZ8A 1IM9B 2R0ZL 1QRND 3O8XA 4GMSH 4M02A 1EJOL 5I18L 5SWSA 5GS0D 4PP1D 5E6IA 1MLCB 3QG7H 3RY6C 5KS9E 3EYQD 2KBGA 1FP5A 5IT2L 4MS8D 4DZ8B 2BNQB 1MCOL 3K3QA 2Y5EA 3BSZH 1BZQK 5E6IB 1P7QD 2XN9A 5LG1A 4UAOC 3K4DA 1SEQH 1MY7A 1NGQL 3VXSD 1ACZA 2V2WA 4W6YB 1E4XH 3D5OF 2OP4L 5FDYA 2XN9B 2X4QB 4GW1B 1D5ZA 2C1OA 3OKLB 3IFLL 2NY7L 4I0PD 8CGTA 4Z5RA 2ARJB 4XP5L 2NR6D 4LARL 4I1NB 3MNWA 5T5FL 3JWNC 2COQA 4GXUM 1FNHA 3PDGA 1R24A 5B3JE 4L3EB 4Z5RB 4CW1A 3LPFA 5FEBA 4HJGA 1TJIL 5GZND 1EZVY 3LEXA 4F7MA 2DQJL 4LNVA 1KTDA 1R24B 2CIKA 1S7SA 1XGQA 2AJUH 4CW1B 3T3MF 4OV6F 4WEBL 4Y5VA 1MRCH 4FQ2H 2W59A 1KTDB 1S7SB 1XGQB 3OAZH 1T5WB 4QRRB 3KR3H 3PABA 4PD4K 4Y5VB 1A6WH 5EZIL 1UC6A 4JPWH 5HHVH 1YEGH 2IAND 4KU1A 4ZUVA 4XNMA 5KSVA 3AVEA 3PABB 2DQCH 1ZGLB 3BH8A 2DI8A 1D6VH 3F7RA 4JM2D 4ZFFA 3N1GC 1S7TA 3SGEH 4XNMB 5KG9B 2YN5A 1CR9L 4ZFFB 4XP1L 1C5CH 5DHVA 3UTPE 3D85A 4XRCB 6CGTA 1I9IL 4KDWA 5E0QA 5AEAA 1F4XL 3EFDH 5I76A 2XFXB 3DRQA 4P46D 3SCMC 3BISA 3CLFH 5DHVB 3D85B 3H42L 1G7MA 2FJHB 1IRAY 1CL7H 3SJVA 4CDGC 4UNVA 1F90L 1YEFH 3B2UD 2JCCF 3QI9A 3BGFB 1G7MB 2DTSA 1CLOL 1H5BB 2H2PD 5DEFB 2CDGA 2DQFB 5D7SL 4H8WH 3AY4A 1KPUB 3QI9B 1QR1A 3TJEH 1KJMA 4GG8A 1IM3B 4BH7B 4HXBH 1RUAH 3T4YB 1QR1B 3KPSD 1KJMB 1R0AH 1FIGL 1PG7L 2X4TA 1NKRA 1CICA 3WLWD 1HHIB 5E24E 3BPOC 1F4WL 2EZ0C 2X4TB 4IMKA 1NCDL 5GXBB 5IFHH 1CICB 1KXQE 2V7NA 5FM5O 1QBBA 1MWAA 4H0GA 1C1EL 1XF1A 5E2TH 4KVNL 3OJMB 3NCFB 2UY7A 1INDH 1AQKH 1LWRA 4X9GA 3V7MA 2A74A 3QFJA 4LEOA 3FQUB 1TCRA 1BOGB 5FKPB 4GKSB 4P5KA 5DURB 5ID0B 2EDJA 2X4RB 1E27A 3C2AL 1A14H 1KENH 2A74B 3MLSL 4GKZA 1TCRB 1NUGA 4P5KB 1OAZL 1QSEE 4TUOB 1B90A 1NCWH 4FG6D 1NAMB 4KMQA 4PGZA 1GOGA 5EU4A 3FB6A 3KYNB 4HDIB 1FFQA 1A7PL 4BZ2L 5JQ6L 4ZDHA 2BSRA 3S98A 4LEXL 1EEZA 4MZ2A 2B2XH 5F8RC 2DQGH 5EU4B 3MYJA 4KI5E 4B0MM 4PRHE 5KOMC 4ZDHB 2A6KB 2BSRB 3DUUB 1C7SA 1EEZB 3GI9L 4DCQB 2QHRL 2IBZY 3AFLA 2YRLA 1Z3GH 2DF3A 2YN3A 3MYJB 2PO6A 1BLNA 4FNLL 3LZFL 2XY2A 1JPGB 2PKDA 3EYUH 1RHHB 1SBBA 1T21B 5I19L 1UCTA 4YXKH 1MCEA 2VDNL 4FN0A 5CEZH 1DBAH 2PO6B 5F9OL 1RZGB 4MA1B 4OZIF 1RZFH 3HC3L 4F58L 2OI9B 2DWDA 4G8FA 3IFPB 4PJIF 5D5MA 5J06A 1T7WA 3PHQB 1AO7E 5KANG 1WWCA 3QG7L 2DWDB 4KKCC 1SYVA 1MCQA 1KJ2A 3OR6B 2DKSA 3MC0A 3BSZL 3B5HA 3LS4L 2PXYC 3GBNH 3GMMB 4PLJD 1RJCA 4OKVB 3TN0A 4DFHA 1RZJC 1E4XL 3VFPA 2ITDA 1KIRA 5AYQA 1D5BB 3CAFA 2YK1H 5DC0A 2JKXA 2G75A 4G6FB 3VFPB 2XZZA 2ITDB 3H7BB 5JW4R 4K9EH 4FQLH 5IV2A 1JGDB 2Y36H 3ARGD 4L1DA 4RRPA 4UILH 3J8F7 4XCYB 4FOMA 2EC9T 1UXSA 4U1HA 5F44A 4B53A 1F6FB 5JTWA 5IV2B 4YGAB 4K3JH 1NSNH 4WJ5B 4ORGA 1WWAX 4NM4H 3GB7A 1T83C 3B6SA 1UXSB 4JFFA 5ESAB 3F58H 2AJUL 2R1XA 4YGVB 3WJLC 4FQ2L 3O4OC 3GB7B 3B6SB 4JFFB 3NGBC 2R1XB 4GS7C 2N56A 1IFHL 2FBJH 3MCLH 5DJ8B 3KR3L 2MPAH 4RZCA 1U91A 1A6WL 3RVWD 5C09E 1RUMH 4JPWL 5HHVL 3RWHA 1XAUA 4JHBA 1FCCA 3MV11 4ZOAA 2DQCL 4RZCB 1U91B 1D6VL 1QSEA 4PG2A 2J4WH 3MRHB 4JVPA 2VLRE 3L3KA 1L7TL 6FABH 1C5CL 4Y5YC 4XBGA 4KAQH 4UNUA 5I71C 5BRZA 3NAAL 4JAMA 3LD8C 3L3KB 3EFDL 2X44D 1XT5A 4WUKL 4EN3C 5BRZB 3PWUA 4JAMB 4EUPH 5HHME 3BKYH 3AS1A 1YEFL 4C83A 4Y8AA 5C0GA 2Y6SD 3MRRA 1MI5E 3S35X 2NXZB 5C0IA 1FYHB 3PWUB 4H8WL 3VG9C 1BEYH 4C83B 5F6IC 4PJXE 3TJEL 4CU8A 4NIKB 3K1KC 3C6LA 1Z6JT 4AQOA 5C0IB 1WITA 4IRJC 3VWJD 4PGBB 4HEME 1VFBA 2DJSA 3U46A 3H0TA 3N0PB 4LL9A 4IJ3C 3OJVC 1ZSDA 1QYGH 3QUXD 1R5IB 3U46B 1NMCB 3MV7D 5IFHL 1EERB 5IB5A 2Z92A 2AAVA 1ZSDB 3MZGB 4QCIA 2WBJC 2GTWA 4XHQA 2O93L 5BV7C 5E2TL 1GL4B 3GUTA 1HCVA 4K7PL 5IB5B 4NRXB 1INDL 1FL5A 1AQKL 3RUGA 1QFHA 3MRKA 4QCIB 2GTWB 3KLHD 2YOCA 4NFCA 3TCLA 3VGBA 5HVFB 1MCDA 5JR1H 2BVUA 4KRPD 3MOQA 3RUGB 3MRKB 2EEDA 4Y16C 1I9JH 1A14L 1KENL 4Z7WF 3TCLB 4U4BA 1T7VA 3NFPA 4HMCA 4J3TA 4M6NH 1UH3A 1NCWL 2A0LC 1A1MA 2VQ1A 1OGTA 4HPYH 4DGYH 1KJ3H 2J8HA 4LSUL 4OCRH 4X5XA 4KHXH 4OSUH 2AXFB 4JFYA 3NFPB 4Z7VF 4BK4A 4C55A 1A1MB 2YRZA 2B2XL 4XCNA 3VXUE 2DQGL 3FQRA 3G6JA 1UJ3A 1KOAA 2IPKA 4JFYB 4JRXA 4YXHH 2VLLA 1XGPB 4YDIH 1R3JA 1Z3GL 3FQRB 4AK1A 1DTUA 5EZLA 3B9KB 2MHAA 4RAVA 5MERA 1M7DA 2PNDA 3EYUL 4KWUA 1QLRB 1J5OH 3ZE0E 1T66D 1R3JB 2AEPH 2X7LA 4JQVA 4YXKL 1ZAGA 4ENEC 5HI4D 1DBBH 5CEZL 1U3HB 3VRIA 1DBAL 2MHAB 5TQ0H 2VLRA 1M7DB 4YH6A 1EUTA 2QADB 3HC0A 2P8MB 3ES6B 2X7LB 1RZFL 4NN6B 4PBVC 4TSCH 1ZK9A 3CFIC 1HHHA 3OKYA 1DBKL 2DMCA 4I4WA 4PV8A 4KROC 5IEKA 4I2XE 3MRMA 1H8SA 4I4WB 4ESKA 7FABH 1MIEH 2ZOLA 2OL3L 1EEQA 3VWKD 3MRMB 2AJSL 4M3KB 3CSPA 3CSYB 1TZIA 1RK0B 4YDJB 3VJ6A 2AJYH 4PJXA 3MLPA 3O9WD 2C4XA 4K3GA 3C60A 4XTRD 4Z9KB 3T0VA 2ED8A 2YK1L 2XXMB 5TF0A 4U05A 1MVUA 3VJ6B 3JZ7A 3AM8A 5C08D 4MXQD 3D3VD 4K9EL 3RGVD 1UG9A 2P42B 4FQLL 3C60B 4HFWA 1EMTH 1RZIB 4H25A 4N0CC 2Y36L 3TZVD 4LCYA 4WFHD 3U83A 4UILL 3TH2T 3NZ8A 3U0PB 5K59E 3GBLA 5I8CB 4H25B 1X6LA 4GRWH 4K3JL 1NSNL 4LCYB 4NM4L 4UT6H 4D9QD 2ZUVA 3GM8A 1WV7T 3S88H 4KDVA 3ELAT 3WDJA 2EDOA 4HX1A 2JK5A 4JRYB 5HYJB 2FBJL 3MCLL 5HD8D 1U8NB 2MPAL 4J2XA 1RUML 3DV4A 3MA7A 2Z8WC 4WFEE 2VDLH 2Q3ZA 4WI4A 5C0DA 5F9WB 1P53A 2WAHA 2O5ZH 4WIQA 3MA7B 1TENA 3HFMH 1WFNA 5C0DB 3RA7H 4BFIA 2IPUK 2ZUYA 2DLHA 4CGTA 4JN1H 2C4FT 1NBVH 3IDMB 4U3CA 4RDQG 5ISZD 5CEZE 3FFCD 3H2WA 4LCCC 5E03A 2B20A 2QJDA 2YXMA 2XTJC 4UOW0 3BKYL 4QHKI 4L4JA 5EORH 4OFVA 4LVEA 1I7TB 3MQIA 2NY4C 4PJHE 1KN2H 1BEYL 3WHXA 4HUWB 2XWTA 5DFWH 1AGFA 1KC5H 4GSDH 4W81A 4D3CL 1OAUH 1G9EA 4NQCE 1J7VR 3WHXB 2XWTB 1PG7W 5TGBA 1KCKA 4I2XA 1KPRA 1YMMA 5F7LB 2X89D 3OMZA 3F5WA 1P1ZB 2FEDD 5I2IA 2ATPA 4QT5A 5TGBB 1Y18A 1YEHH 1KPRB 1H15A 5BJTA 3VXPA 1I3RA 5KSBF 2DYPA 1HIMH 1BVLA 2RGSA 3H3PL 3B43A 4IS6B 5BJTB 4W68A 3KVQA 3DHMA 4ISVA 2DYPB 1BVLB 2FO1A 4KK6D 3VA2C 4I48B 3V95A 2DM2A 5JR1L 1I8MA 4NQDE 1YPZA 2QBWA 1PQZA 3W0WE 4XCCH 5T1KA 1I9JL 5F7HA 4MA8H 3QUMH 2CPCA 4N5UA 1I8MB 4M6NL 4NNXA 4HPYL 4GAGH 1PQZB 1CFNB 1KJ3L 3TA3B 4OCRL 4KHXL 4OSUL 3UTSE 1TJGH 4EDXA 5BZWB 5T33H 3TEUA 3WJJA 4RBPH 1RSFA 3REVB 1NFDA 2ICCA 4U0QB 1B6DA 3S36L 3JTTA 1KB9K 2L0DA 1VKXA 2FATL 3GSNA 2YD2A 4YDIL 1ZGLM 1MHPH 1OD9A 1NFDB 1SBSH 3NN8B 1VKXB 3GSNB 3SBWA 1J5OL 2A6IA 3KYAA 4ELMB 2AEPL 3MREB 3BD3A 1DBBL 4ODWA 1P4BH 4X4XB 3VGAB 2DLEA 1QA9A 2CMRH 4TSCL 2LFGA 3RBGA 4MD0A 2FCBA 4ODWB 1BD2D 2D4FA 5DZOA 2R4RL 1I7RB 1PZ5B 4GKNA 4KFZC 2HFFA 4NP4H 5J89A 4P4KB 2GKIA 5FO8A 3RY4A 4JZJA 5CGYC 5EBMA 2UZYB 4NN7C 1PFCA 4JJ5B 5FUZL 1SEBA 1WIPA 1CDHA 7FABL 1MIEL 2DL9A 5I1HH 4QXWA 2HFFB 4QY8B 5SX4H 5FO8B 3T08A 2HN7A 4JZJB 3SE9L 5EBMB 4PJHA 4MB4A 5B8CC 1Z0NA 3QRGH 2WWMD 4HHAA 5I15H 3BP7A 5AZEH 2HN7B 2EIEA 1OL0A 3OKKA 3BZ4B 1IMHC 4YHMH 2YWZA 4HHAB 3BP7B 3O2DH 1T7YA 4UQ2A 2JJTA 3V6OA 3VRJA 5IF0A 1CS6A 3OKKB 1EMTL 3MV01 3SCMD 3HE6B 1FLRL 5IBTH 2VB5A 5FDWA 5CEYA 4JFDE 4JHAH 4D9RD 4U1LB 5IVXE 3EOYG 3VRJB 1C5BH 3ARBC 3H9SE 4K8RH 4LDOB 5IF0B 4OD3H 3O0RH 3UTZB 5HDQH 5FDWB 3C2SA 5CEYB 3DROA 4NKMA 4UT6L 2VLJD 5IHLB 3IVKB 3L5WA 4EVNA 3S88L 2FIKA 1VGEH 3VXQB 1T1WA 5C70A 1X5KA 3GSUA 1LHZA 4MDIA 3DROB 1LEGA 4R4NC 3MUGA 5M95B 1YJDC 3L5WB 4EVNB 2H45A 3NZHH 3ORJA 1R5VA 2FIKB 3ZE1E 4XI5C 5HYSA 1J9CT 1Z0MA 4NO0A 1Q94A 2AK1H 3CFKA 4MWFB