1AC6A

Crystal structure of a variable domain mutant of a t-cell receptor alpha chain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
110
Chain Sequence
b'DSVTQTEGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRASRDKEKGSSRGFEATYNKEATSFHLQKASVQESDSAVYYCALSGGNNKLTFGAGTKLTIKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-CELL RECEPTOR ALPHA
publication title Dual conformations of a T cell receptor V alpha homodimer: implications for variability in V alpha V beta domain association.
pubmed doi rcsb
molecule tags Receptor
total genus 25
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ac6A00
3IJHA 4OGAC 3HZMA 4WI4A 5ELIA 2HLFD 3ULVL 1T7ZA 4JRYE 3REVA 4ELMB 3FO0L 4WW2B 3EO1A 2OTUB 1DN2A 1LO0H 4MQSB 2X4QB 3DMMD 4MXWH 3RVWC 1N0LA 2UWEA 5T1DH 2VLJD 2H1PL 2WUCH 1ZEAH 4HQQH 1IGJA 5IVZB 4LVEA 2F53B 5IM7B 2FWOB 1K8DA 1BX2B 2Z8SA 4NO2A 5D93B 5A43C 1EBAA 1G7LA 3KYOA 3ZSTA 5I1CL 1NBQA 4KKAD 1P7QA 2L4OA 1GVIA 5D6DC 5H8DA 4EDWH 1CFNA 4PB0L 1LO2H 4Y4HD 4LCCA 4FQQA 5CILH 1A4JA 4L4TB 4X5XB 3QDJD 2R0KH 2JE8A 3QYCA 3T65A 5MHSD 4CJ1A 4R4NC 3U36B 3HG1E 5EOCL 4BZ1L 3D6GA 4LIQE 5E8EB 2PXYC 3F65A 3MCG1 2R4SL 4R7NB 4HKJA 5E2TL 2ICCA 2LU4A 1E27A 3WXVH 4EOWL 4L1HA 5J1TC 4HGKC 3PNWB 1EO5A 1CGTA 4JM4H 2OJZL 3DXAD 4TUJA 1ZGLP 1G6RB 3DROA 2JJTC 2VDQH 4U1SB 3MNZA 4L8SA 1NANH 3SGJA 3D3VA 5JZ7D 1PKQE 4G8EA 3HS0B 2X4PA 4X7SL 1KGCD 1AP2B 2AAVA 3EOYG 3TN0C 1C16B 3C6LD 4U7MA 3SGKC 5GIRB 4ORGB 1JTPA 1R3IH 2KQMA 5FGBA 5CEZE 2EDKA 4U1MA 2W1NA 1S9VB 1S3KH 3AREA 2A9NL 2X1OA 4HJ0D 4YEEA 1R5WB 2BJMH 5CEXA 1EAJA 1MJJB 4JQIH 4LCIL 1F4WL 3QR2A 3WFCH 4OUUA 5TDOB 4QGYA 2DIJA 3WS3A 3PJSA 4UU9A 3NFNB 1I7RB 3N9GH 3EYVA 4DK3A 2AEQH 3WUZA 4Y2DC 5DUBA 3KPLA 4RGOH 5T5NF 2X4RA 3EJYC 4ZPTA 3MOQA 2MQ0A 3W81A 3BZ4A 1X5IA 1YJDL 4UB0L 3ZE1F 2UUDK 5IB4A 4P4RA 5I9QB 1F90L 3BOVA 3PWLB 2GK0A 4JQXA 3MUJA 3S3JA 3KLSA 4PJEB 3O4LD 5FGCB 5FCUL 1J1PL 1KLUA 3MUGB 4ORZC 4EN3B 2FIRT 1A7NL 1PZ5A 4O51B 1RUML 4RWHA 4F37K 4JFEA 3EAKA 1IZJA 3T0DA 3NCEB 1BD2D 1HN1A 3MR9A 1QEWB 1BREA 4S0TD 3BKJH 4AY0A 1CGWA 4WWID 1P4LA 4QY8A 5EC2B 1I1AD 1M05B 3BH9B 3LB6C 5DYOA 4HKBB 3HR5A 3OR6A 3VFUA 5D2NE 5C08B 5HI5C 4K07A 3B83A 2Y5TB 3O11A 3KXFD 1PVHA 4PBWD 1I85A 2VTFA 2NY3C 1OAYL 5ITFA 1CI5A 3F7PC 3PABA 3MRGB 3BGMA 4X8XA 2YD4A 5DD5H 2HJLA 4P46C 1OF2B 4YBQD 1E0OB 3SO3C 5C7XH 1OGAD 3SPVB 5E8PA 5EO0A 3OG4B 4P2RA 3SEPA 1NC2D 1GZQB 5FGRA 1NCTA 3DOSA 4P3DA 1NANI 3UTSE 2F58H 4X6CE 1A02N 1RU9L 3BWAA 4FZ8L 4LDEB 3CDGA 2CJUH 4RNRA 1BIIB 5CINL 5F1IB 1CFVL 4QRQA 4S1SH 1XGUA 1YEIL 1F45A 3ARBD 4WVRA 1A1NA 2WWMD 4M1CD 2EDNA 3BKCL 4G7VL 3FJTA 4U7SA 1BECA 4YXLL 4OLYL 5D1XA 2PETA 2G5BA 4MA8H 2Z31D 1D6VL 4O5LL 4OQTL 1ZS8A 3P0GB 4E41A 2EDBA 4P5KA 4POZD 4BKLB 1YEJL 2GT9A 1T83C 5DRZA 2DQDH 4YHPA 4GBXB 4YGAB 2AXGA 3JVGA 5B4MC 3UZQA 1Y18B 1DUZA 1FFPA 3V4UL 2ILLA 4NQEB 4ZNEE 4Z7WF 5SWSD 4M9OA 5I8CA 5E2JA 4KPHL 2EDFA 2IAMC 1A2YB 3FOLB 4MXVF 4K3GA 4ZAKA 1MY7A 1DL7H 1KACB 4MJ6B 3V6ZA 1MREL 3QWQB 3TT3H 1NGPL 3C5JB 1YECL 4XH2B 5C0GB 1AQDB 2E6JA 5IP4A 1FAIH 1MAMH 5GHWH 2ZSWB 2P48B 1ZXQA 4LLDA 2W38A 3ZT5A 4IIQC 3MODH 1RIHL 4OFYD 4FFVD 1KB9K 5EU6D 3KPSD 1UT9A 4WY7L 2OR9H 4FP8H 1W0VA 3RA7L 3VDCA 1HINH 3U0PA 4Y5YB 2C26A 3Q2CA 1AQKL 3ELAT 5KS9F 2AXFA 5HGAB 3HE6C 4C56A 3MYJB 1A9BB 3P0VL 4OZHB 4OZFB 5I16A 4P3WA 3RVXC 1JZ6A 1DQLL 1Q72L 3S36L 1O0VA 1ZK9A 2Y06H 4FABH 1QYGH 4MMZC 1HILA 1C5CL 3RY6C 3FFCB 4DZBB 4ODHL 1UM5L 4PJ7B 4EZMA 4KKLC 3WIFA 1M7XA 1B2WH 1W0WA 1MWAH 2HH0L 2QQLH 4U3XA 2X09A 5KVMC 3D25B 1F42A 2I60H 2F53D 4R4BA 5JHDB 5J3HD 3ZMRA 1MWAA 5FXCH 3WLBB 4ODVL 5GGTH 3KYAA 4XNZC 1Q0YL 3IFPB 5FDWA 3KPQA 4IRJD 1B0RA 4MQ7B 2D31B 1H3PL 4K9EH 2AK4E 2E7CA 4L4TD 4KVCH 4JFDA 2IWGA 1CF8L 2EYTB 4R6UA 3O41A 4KMTH 3BEVB 4MNQE 3NZHL 3D39B 4MZ3A 5D71L 2UVEA 2EE6A 1XIWC 3LIZL 4GAGH 5GS3A 1NCDH 4RAVA 5JNYA 2VQTA 5LQBH 2SEBB 3U1SL 3IFOB 4HS3B 5D7LB 3OKLA 2IADB 4O2FB 3AU1B 1QLRA 4NWUH 2EDTA 3V52L 1M7DB 2VDML 3IF1A 5C0AE 1JBJA 3TNMB 3OWEA 1S7VA 5I6XB 1U3JA 5I8OL 3D0VA 3DUSA 1CTOA 5EPMA 1RFDH 2NXYD 1VGKA 3MOAL 3SOBL 1ACYL 1NJ9B 3OGOE 3VXRB 3AB0B 3MCLL 5I1AB 3WO3B 4CNIA 1QFUH 5JW3H 3NBNA 4FMFA 3P73B 1J12A 3CGTA 5D5MB 1LDPL 3MJ8A 2XWBB 3PV6A 4P5MA 4LAQH 2NYYD 3BVNA 1Y0LA 3OMZA 5DFVC 4XCFL 3LKNA 3H2WA 3S3SA 3GSXB 3S35L 5MENA 3ZDXE 1Q8MA 1MIEH 1AFVH 4Y4FC 2Z9TA 3GSWB 3JWDC 4Z76A 3VE0A 5D7JA 1BGXL 1IZKA 3BZEA 3QI9A 1UKQA 2W0KA 3WIIL 4K94C 4PJDE 4ZPVA 3U0TB 1YY9D 2E8ZA 2GSIB 3MCKA 3IFNL 4HIIB 4QRUA 3HUJE 4OCNC 3QQ3A 4KUCD 5ICYA 4ZD3H 3BEWB 4LLUA 3CU7A 4X6DA 4NJ9L 1S5IH 5IJVA 5C2UB 1MPAL 4QXUL 3CXDH 1OTSD 3AM8A 5F6HI 4L4JA 3HN3A 4KI5D 3FO9A 1EO8L 5A2KH 3WV0A 3RKPA 4X80H 4PJHF 3KPRB 2H32H 3GMQA 4XWOD 1FZMB 3RWGA 1LP9F 3WJJC 4XTRC 5C08D 1EGJH 3LEVL 3BGFB 2H32A 3KLHD 4K55A 1HHHA 4ZOBA 4G43B 5CD5D 2NNAA 1B0WA 3GRWA 1EGJA 1MFCL 1I7ZA 2CRMA 3W5MA 4OF0A 4NQUA 4JHAH 4HF5H 4RMUA 1WTGT 1BQSA 3IJSB 3ZKQD 5FECB 3BN9C 3MRRA 3BI9X 5I71C 2XZCH 1M71A 1CT8B 3C6SA 4MJ2A 2JB5L 8CGTA 4M6AA 5MERB 3SY0B 1D5MB 4F9PA 4L8CB 4P46B 2J3SA 5F1NB 3IU3A 2YPLA 4JFFD 3DX7A 4OQ1A 1GCFA 1IQDB 2NW2A 4QYOA 3JTTB 4LPWA 2GFBA 1OAKL 2P44B 2GTZA 4PJ9A 4KKBC 5EC1A 4Z77A 5M95B 4OLVH 3VXUB 1ETZA 3CSPA 3HKFA 3EO0B 3QXTA 5INDB 1WBYA 4ZFFB 3MYZA 1WCBA 1MRDL 2JKXA 2HLAB 4MXWL 2FHFA 5MEPB 3QG6A 4P4KA 2NY4B 3MRJB 2I9TB 1MNUL 2X4TA 3RWDA 1EEUA 5FA3A 1G0YR 4GBXD 5GRWA 4NN6B 3BE1H 3NABL 1KULA 5JIIA 4HEPG 1FYTA 3I6GA 4UT7H 4NQED 3KYNA 4XVJL 2DDQH 4PLOB 1MJUH 4O58H 5ADPL 3UCRA 1DJSA 5EZIH 1EV2E 4HJJH 3DPBA 4B41A 2EE2A 1UB5B 2AGJH 4FZEL 2DWEA 1A9EB 5DRNA 5T1LA 1PYWB 3QIBD 1RJZA 3X3GH 1NBVL 3V5KB 3B9KD 4PRBB 1JPFA 4TULL 4MX7A 2Z35B 1QSZA 2J88H 2VE6B 1WBZB 1A7RH 1Y6KR 4L4VA 3RTQC 3SKJH 1L7IL 5DZNA 4DGYH 3TA3A 4WU7B 2J5LC 2Z8VC 3BJLA 2HFFA 4NRYA 3W0WA 2QR0A 4PV9A 3CH1B 5I15H 4R96B 5C0DA 3VXNB 3VI4F 1N2RA 4JRYA 5L8LB 1AI1L 2X5PA 2P5EE 3P4OA 4LU5L 1AGEB 1CICA 4K7FA 4YLQT 3HE6B 4E9LA 2BJML 4OFVA 4PIRF 1CD1B 5DJ6A 4MD4A 1TCRB 3D2UA 5HDOA 2BY3A 2EXYD 3JV0A 4HXBL 5BZWA 4F57H 1QP1A 1ZWIA 1BFVH 3FAWA 3K2MC 1IM3A 1HNGA 1VA9A 2EICA 5DDHA 4B53A 1QRND 4DZ8A 4ODWB 1PKOA 4PLNC 1IM9A 4NUGL 4ODSL 4FQLH 3CXHJ 2H9GA 1IT9L 1XZ0B 2I24N 4RGNC 3C60B 4MDIA 4Z7WE 3ARFA 4NP4H 1P2CB 2QEJA 4TN9A 3L3GB 4LIQH 2FYYA 3D39D 4JN2B 1ONQB 2EIZB 1R3HB 4F15B 2JELH 3HG1A 1C1EL 5F89A 1OY3B 1SEQH 5HYIA 2C3XA 5EBLA 5DA4A 4HMCA 3MV7B 2GJZA 1ORSB 3M45A 1YZZA 4KJQC 1XFPA 4U1KB 3HNVH 3LKSA 3EDKA 3NA9L 2DTMH 3S96A 4HWZB 1V7ML 1FDLL 4V1DD 4XBEH 1QSED 4KQ3L 3V0WL 2CDEB 3MRDB 1E4WH 3VJ6B 3O0RH 4I3GA 4OZIB 2BHUA 1UVQA 4OCYH 2L7JA 3IGAA 1QTYT 1EA9C 5DJ0A 1PKQA 4LRIA 4LF3A 3TBTA 4M8QA 3HC4L 1IGMH 5AYUH 3VXRD 1SY6L 1S7WB 1KCRH 2IFGA 2VDOL 4JFOB 3RU8L 1EMTL 4L3EA 5CZKA 4ESKA 2HT3C 5CEZH 3EGSA 1LMKA 3HI5L 4JY6B 2A6KB 3KHQA 3QQ9C 4WHYH 4NNYA 5DJDA 4YXKH 1V3LA 2D7TH 4JJ5B 1IEHA 4MVBD 4PP2B 1QLEH 2AI0L 3LN5B 1Q38A 3MUZ1 4I18B 4XPAH 1U8JA 1ROWA 2VZSA 5D1ZA 3G6AA 1GOFA 1I1FB 1XF1A 3BH8A 4IDLA 4XCEA 4Y4FB 3MRNA 4X7TA 1GAFH 3QFJE 4ONHA 1NAKH 3HNSH 1SVZA 4WFHE 4LBEA 2JJSC 2OQJB 5F6IC 1MEXL 1I3RB 3PUCA 3ECBA 5JLZB 2NR6D 4OTXL 3QQ4B 2F8XC 5D72L 4KV5F 1T20B 4OAWA 4JKPH 3VGDA 4H0HB 1UZ8A 2EE9A 5DGQA 4PRHE 3G04A 5BCAA 3GSRB 3GJEB 2R2EB 2MCPL 5KSBB 4JZJC 1FNSL 2QV2A 4Z7OE 5KTEH 3WKMH 1CDHA 1X3DA 1JNNH 2WWKO 1EJ6A 5TDNA 2O61B 3KPRD 3CVIH 4KK5C 2HP4A 4L8DB 4QRTA 2WM0A 2EDQA 3RWCA 1K2DB 1G9NC 5D2NA 3NIDF 3BHBB 1YNKL 2YSSB 4IMKA 4NRXA 4Y5XC 3H9HB 3GMRB 2VUOA 4WTWA 5BVJB 1EEYB 1WFTA 4MJIB 3ROOA 2VKWA 4HKZA 4PJEF 1J86A 3NCFB 1JGUL 1KPRA 1RHHA 2AW2A 1P69B 3H7LA 2VH5H 4KUCF 1U92A 5FB8B 2FZ3B 5I71B 1OP3K 3G6JB 5HYSA 3BAEH 3I02B 5HDBF 2ICEB 4KI5F 4NBYB 2EXWD 3UTSA 4M1DH 5D70H 4U3CA 5KSVB 4WJ5B 4WWKB 3IAGC 2FR4B 4BFBD 5LGHL 1DLFL 2FLRT 3VXUD 4U6XA 1TDQA 3L3KA 4S1QH 5LAXB 1OAQL 1S7UB 1AGBA 1S9WA 3O6FB 4PD4K 5CUSL 4KVNH 4J6RH 4RFNC 3HB3C 5ENWA 4M9PA 3BRGC 3HMWL 3KLAB 3DYOA 5EO9B 1QRKA 3O3DB 2V17L 4PJBE 3DHMA 3UJTH 43C9A 1FZKA 2NY4D 1A1MB 3TPUA 1XF5A 2ENSA 4ZDHA 2DJ4A 1KCVL 3TBVB 2I60L 4R8WH 2NLJB 3CJJA 3V4VH 1F4YH 3W39B 4YHZH 5SX5K 4X8JA 4PJFF 1WTLA 4F7EB 1S78D 4K8RH 3HFMH 3PQYE 4ZNEA 4I13B 1JRHL 4N9GB 5EIIB 4D0BB 1A0QL 1NGWA 4LSDA 2E5EA 3QJHB 2Q7YB 3I75A 2APBA 1RJLA 4LCUA 2DRUA 3LKOA 2CRZA 4Y5VA 2IPKB 3K80A 3DVNB 1NCDL 3KLDA 3WXWH 5CP3A 1HDMA 2YK1L 4E42B 1B4JH 3DURB 2AJ3A 4PP1C 3L7EB 5DHVB 3OKOB 5FK9B 3JSSA 2W9LA 4F7TB 4PJCE 4K3DL 4E5XA 3L5HA 2ZG3A 2QSCH 4PBXA 2C5DC 2W59A 1BD2E 3RX8A 2PW2A 1EX0A 2J5LB 4EUPH 3WLWC 1RFDL 1UB6B 2R0LL 5MEOB 4EUPA 5I30H 4EXKA 1J88A 2G9HB 3OKEA 4G6AD 3JWOH 4Z95H 2PO6A 4NZDA 1IC5H 5K59F 5C0IB 5F1KC 3QIWB 2O5ZH 1VFBB 5JUEH 2EKSB 5E94B 5J9PB 3SHSA 3MLSL 4BH8A 4D3CH 5D1QC 3ES6A 1T7VA 4Y1AE 3JBG7 4JPVH 2P42B 3DUUA 1M7IA 3B2VL 1A5FH 1OSZB 4RFOH 1GGBH 3MACL 4EQ2A 3W2DL 5TFSL 4MB3A 5CHNB 3L5JA 3RDTA 3MRLA 1I9IL 3VGHA 1KJVA 3F12B 4AQ1B 1FNGB 4UINH 1YEKL 1A6TA 4K3EH 4ENED 2P45B 2NMSA 5FOBA 5HHOB 1H3GA 4KK6D 1UYWH 3IFLL 1OLZA 5IB3B 4Y19E 3C60D 2E6PA 4X7DC 2AK4A 3V5DB 3FT3A 3EOAB 3WEXB 2DQCH 4G8GE 3BQUA 3QSKB 3R06A 1FE8H 5FUCC 3FB7A 5FUOH 4MNQA 4WFFE 5BMFL 1G9EA 4QHUB 5LVEA 3HE7B 4PJXE 3MV7D 4MNHA 2DWDB 3UROR 4PJ7F 3I9GH 5GISL 1V7NL 2B1HL 4HCRL 3TH3T 4P99A 3P30H 1RZJC 1R24A 4GRLB 4CN6A 2DQGH 2IBGA 1YN7A 5C0AA 1VDGA 1AXIB 2W60A 2YN3A 1OP9A 4MXQC 1Z6JT 4YO0B 1EPFA 1QVOB 1AIFA 4Y4KA 4HFWA 2CDFA 4WUUE 3OJMB 4OF6A 3N85L 4P2OB 5K9KB 2H6PB 5CBAB 2JIXA 1G7PA 2FSEB 3QUXB 5CSZB 4TSCH 4MJ4A 3U7WL 4H88L 2C3VA 4WTZA 2CRYA 4F2MA 1RZFH 1I1RA 3RAJH 4HAFA 1KTDB 3BO8A 1D9KC 2FB4H 4J3SA 2A74B 4LSRL 1U8NA 4Z5RB 4NO3B 1NH6A 5I1LB 5JTWA 2R1XA 4KZDH 1NMCC 3CD4A 4S1DC 3CX5J 3K81A 1A3QA 5CJOH 3IDNA 5DMIH 1AGDA 2MSPA 2CXKA 2CR3A 1A7QH 1WFUA 2MOVA 4OZGF 1BVKB 4NC0B 3TC9A 2NY1D 1AY1H 4XNMB 4IRZH 4DOHE 2HVKB 1FL3B 4OF7A 4PJDA 2FX9L 2VDKL 2CUHA 4HUWA 3UZEA 5IHUL 1OD9A 4N8PA 1DBML 2YKLL 1FFOA 3BESR 4YNYA 2FECI 1G7MB 3HUJA 4ELME 4QHKI 3GBNL 1MCJA 3R8BB 12E8L 3O2DL 4PGDA 4X4YB 2VN4A 4G8IA 3CDCA 1UJ3C 2W0LA 4JZJB 3ARWA 3GUTA 2QSQA 4YDIH 2EC9U 5ACZA 1JFQL 1JGDA 2DN7A 5JXEC 3BPNB 2HWZL 1UCBH 3E3QC 4I4WA 3QXAB 3GSVA 3MSPA 4XCYB 1MCSA 4F9LC 5FFLA 4YHIA 4JFZL 4TSAL 4AMKL 4PJIA 5L88H 5DFWH 4PJGE 3MBEA 5LCVL 4RMVA 5AG9A 1Q9WB 1RK1A 3ARDA 1J0IA 4L4TE 5FYKE 4P2QB 4UZGA 5KG9A 3W11D 4HH9B 3MLVH 1DBAL 2XFXB 1CFBA 3ZHKA 1TTUA 5KSAC 5GS0L 3HAEB 3ZLQC 5HSFA 2AABH 5F44A 3U9UB 2ITDB 1T4KA 3SKJL 1SYVB 3HRZB 1XH3B 3QPQC 1TJHH 1BLNB 4FQXB 4E0RA 2CIKB 3DX6B 1NLDH 1S5HB 5GGSA 8FABA 1IRAY 1CXLA 2YD8A 4OIAA 4WWKD 4I0PB 3ARGA 1UM6H 4P59L 4ZUTA 5GRUL 4WCYH 5J13C 3GMNA 4EI5C 3V6BR 3FT2A 1A7OL 5F7FA 1E6OH 1RK0B 1X6NA 3WKNA 2BSSB 3DSNA 4YHNA 3O6FD 1DZBA 4JZNB 1JWMB 2HKHH 1D5ZA 3QDGB 1NAML 5HYFA 4L3CB 3BIAX 2RIKA 1A6VL 1S8DB 5HJ3A 3DV6A 4GKZA 2PTUA 3BDBA 2OJEB 1ZVHA 35C8L 4PJ5B 5TF1H 2PW1B 2VLRB 4UV7L 2DQHH 1U8MA 2JF1A 4G6MH 5C09B 3SCMB 3X13A 5HVHC 3ZE0F 1TZGL 3WS6C 3H9SE 3QAZC 2CLRB 2YR3A 1H15B 4Z0XB 3S88L 4LSVH 1VFAA 3Q6FA 2E9JA 4H20L 4XAWL 4Z7QE 4JO1L 3T0BA 3S34H 3SDDA 3MRHB 3R0NA 5K93A 3T1FA 4C83B 1FVEA 1I1YA 1TENA 2D4DA 1CWVA 5FO7B 4TRPH 3FT4B 5BW7C 5JO5A 4MDJA 3VFWB 5L7XH 1T5WB 1ZLUK 4XVUC 1L0YA 1DBJH 4NM8L 3RRQA 4PGZA 5T33H 3MREA 3RGHA 5HHPA 5ECJE 5INCB 5K9OB 4KY1H 4CVXA 4OLWL 2DQUL 3BGAA 4JDZB 3LCYA 1AD9B 1NUFA 2A0LD 5DS8B 3CK0H 2ZUYA 3MXVH 3KG5A 1I75A 3IJYB 4XP1H 5EB9A 3VXOB 3CFEA 2OSLB 2LAGB 32C2A 1H3VA 3IJHB 4XAKE 1KJMA 2ID5A 3QIWD 4O9HH 3HZMB 2P5EA 3REVB 4LASH 5LGKA 2V6HA 4HWEH 1I8KA 1T0PB 5I0DA 4U1IA 3TFKD 4NZUH 2GY5A 4HK3J 3CFIC 1ZHKA 1VKXB 3LKRA 1GOHA 1IGJB 4D9QD 3UPRA 2GJ6B 5HHOD 1K8DB 1FVCA 1S7RB 4NO2B 3EOTL 1G7LB 1X5HA 5TF0A 3T77A 4OI8A 4C4KT 4FFZL 5D96C 4APQC 1P7QB 3VG0L 4HZAA 5BXFA 1HHIA 1CFNB 4FQQB 4NQTA 4Q6IA 1RZ7H 4FQJL 1A4JB 4OKVA 1WZKA 4NDMA 4PLKD 3HE7D 4YK4B 3I3EA 1A64A 4FMKA 1T21B 1EFXB 1YQVL 4GRLD 1F6AA 4HKJB 3VI3F 2FO4A 1JNNL 1E27B 5I75B 5C0RH 2FHCA 1LEIA 4GO6B 5C0FA 1H3TA 4ZSOA 5GRJL 5I1EL 5HI3D 4TUJB 1N59B 2P5WB 3CVHL 1WEJL 3DROB 3O3UN 3QJFA 4P2OD 4ZFOL 1XR8A 3QUXD 1SBSH 3VH8A 3N1FC 4L8SB 3H3PL 4LVNC 4DGVL 4GQ9L 4H1LH 1QHOA 3U2SB 2X4PB 3QEQD 3QXWA 3R1GH 3TWCL 4JO4L 5BQ7A 4H1LA 3NFPA 4OSUH 4ZOCA 2I25N 3V0VB 1LEGA 5IROC 3INUH 3GMPA 4U1MB 1S7QA 5DZLA 3AREB 2VQ1A 3GBLA 5CEXB 1FHGA 4JGUA 2XI9A 3DJ9A 4ZOEA 1AR1C 2R0ZH 4OUUB 1CZ8H 5D7SH 5I8KH 4UU9B 4AG4L 3NAAL 4M1DL 5FYKU 4DTGH 2DD8L 2W9DL 4NJAH 5EIVA 3EYVB 1DP0A 4OZIF 4OD3H 4F33A 1JHLL 4D9RD 5C0JA 1R5VB 2X4RB 2R56L 1GGYA 4ZPTB 2MWCA 3QFJA 5GRZA 4J4PA 3ULUC 3OAUL 3FZUC 5IB4B 4P4RB 1MCCA 2XTJC 3HA0A 2OYPA 4MAYD 3FQUA 4XCCL 1ZE3C 3DETC 3MGAA 5JA9A 1F5WA 3V7AG 4YDJA 5HHMB 3UJTL 4OZHE 4M6ML 1T66C 4PRHA 4OGXH 4YQXH 4AL8H 1PZ5B 4GAJL 2BC4A 1C08B 3FFCE 2VZUA 5TE6H 4JFEB 5JHLL 1K85A 1JYWA 3MR9B 3E8UH 1N26A 5D7KE 1EERB 1JZ7A 3WN5C 1J0KA 4UT9L 5JHDE 3HI6L 3PWPE 1T7XA 4RBPH 1P4LB 4QY8B 2Q6WA 3MBXH 3EHBD 5DYOB 4GRWE 3CH8A 4NZTH 1LILA 3HR5B 3QRGL 3GHBL 4HEME 4UQ2A 1KIQA 1JPSH 3QZWA 2DM2A 1XCQA 2YEZA 3D85A 1KJ2H 3FONA 3TBWA 5C71A 3FN9A 1R3KA 4PY8I 1HHKA 3ZT6A 3WXWL 4P2QD 3O11B 2VJXA 5ID1A 4M4PA 1U95B 2YRPA 3WFEH 3O3BB 5ITFB 3PABB 5F7HA 1DDHB 3BGMB 4LP4A 4BQ8A 4KJPC 1MUJA 5L0QC 2HJLB 5KSAB 3PP3H 1TZHB 4FQXD 5E8PB 2BRQA 1FFQA 1RI8A 3FQTA 5D7LE 5JW5A 5L6YH 1JYNA 5DVKA 4HIJA 4DGIH 1CGSL 1REIA 3B2UD 5C6WH 4I0PD 1INEH 4M7JL 4OM0H 2CO6B 4P3DB 1GYAA 2Q8AL 2NX5D 3WNMA 5J7CC 3BWAB 4ODTL 5I19H 3CDGB 2RCSL 5HDLA 1KCKA 2V7NA 3O8XD 4ZS6D 1IC5L 4QRQB 4RIRA 5D6CA 1NC4D 3UC0L 1A1NB 5IEKA 5E1AA 5D1XB 2B4CC 9CGTA 2VXSH 4WV1A 5EZJB 4PJBA 5D5ME 2VLRD 2YD2A 1FL6A 4UV4L 1ZS8B 3G6JF 3IAQA 5TQ2L 5FYJD 4QNPF 5I1GH 2E7LC 1PFCA 2ZNWA 3QUML 1NGQL 3PWVA 3SCMD 4P5KB 2GT9B 1X5GA 5DRZB 4YHPB 1PD6A 2YUXA 1J05A 2AXGB 3LQAL 1UYWL 2I5YH 2V7HA 3PQYA 1DUZB 4AEHL 4XP9L 1FFPB 5ALCH 4ERSL 1F6LL 3RKDD 2VMFA 5GGSY 1KG0A 1N6QH 4ZODA 3OKYA 5FUOL 4PUBH 4ZAKB 4DN3H 3MA9L 4P2CG 3HPJA 1HXYA 1W72H 3V6ZB 3QIUA 3RZCC 5FKAA 5F3BA 1X4YA 1Y6MR 2R0WH 4P9MH 4OCWL 4PJCA 2MPAL 4ELKA 2NY0C 2A9MH 4JDTH 5SWZD 1UWEL 1UA6L 3UMTA 3ZYJA 2R9HD 4LLDB 4I3RH 4PRPE 4OBSA 1TTGA 1WGOA 1LO5A 4QXGH 4FFWD 1IILE 1W0VB 2B2XL 2BCKA 3U0PB 2R23A 4R97C 2M26A 4JZOB 1PQZA 1IAOA 2AXFB 4UBDD 4C56B 5KN5A 5I16B 3UZVB 4OGYH 4CU8A 2Y36L 4Y1AA 3WNNA 1HILB 2W0FA 3DIFA 4HUUA 4Z0BL 4NNXA 3QCTH 2J4WH 2AJSL 4HXAH 2GW5A 1W0WB 3QUYC 4KZDL 4XI5D 5DMIL 1MVUA 3ZTNH 5HYEA 4GMTL 3X11A 3T3MF 2HKFH 2F8OA 3B5TA 4GSDH 1P7QD 2AQ1A 3KPQB 3ZSSA 1B0RB 3KJ6L 4Y19A 3ABZA 4GUPA 5DWUL 5BV7L 1YEHL 3O9WC 5IMKA 4G8GA 2JTDA 1NCWL 3ZKMC 2ESVD 5CEYA 3ZKSD 3QG7H 4D9LL 4TVPE 3O41B 5D8JH 3X3FL 3EFDH 1TVHA 4PJXA 3LQZB 4RAVB 5JNYB 4CN1A 3CDFA 2Y07H 1LHZA 3QHFH 1T0MA 2AERT 1RZKH 5F7KC 5H37H 1AXTH 3OKLB 1Q9OA 1JGVH 1QLRB 1MFAH 1EBPA 4LKCB 3TT1L 4EDXA 1LO3L 4N90D 4U7KA 1MCDA 1RZIA 4WFEE 1S7VB 5ADOL 5T1MA 5EWIH 2YXMA 3TBSA 3N06B 3DI2B 4WUUA 3FMGL 3D0VB 3DUSB 3ZTJH 2E7BA 3D3VD 3L5XL 4O02L 4XZUA 5EPMB 5DSCA 1QNZH 1WFOA 3ZT7A 1VGKB 1FIGL 1WZ1H 4BUGA 4XT1C 4LVNB 4Q9BA 4GG8A 4IHOB 2D7NA 2X1WL 4QRPE 2DBLL 2JK5B 3V4PL 1CFSA 4CNIB 3LHPL 4CL7A 1BEYH 2VL5A 3O6MH 4I77H 4NC2B 3SDCA 3ARED 3KGRA 5AWNH 1TIUA 3MJ8B 3PV6B 2AABL 4NN7C 5IHLB 4P5MB 7FABH 5GSRA 4OT1L 1PG7L 2HTKC 1QBML 5F88A 3VA6A 1JVKA 3BVNB 1AXSA 3CSGA 1JWUA 1YEFH 1NLDL 3LKNB 5CGYC 3BUYA 1TMCB 2A1WH 1FG2B 1WT5C 4XXCA 5MENB 5AUMA 4M43L 4OD2A 5J1SC 2G60H 2Q76A 3EUUA 4TOYL 3L9RA 2JJWA 3VE0B 5D7JB 4U05A 1TVDA 1INDL 3QI9B 4UOJA 4UIKH 3T3PE 2HKHL 4JQVC 1UKSA 4ZPVB 1YJDC 4N0RA 1J1XL 3CPLA 5IESH 4FG6D 5HHMD 4D0DA 5DQDL 4ELMA 4WW2A 2RFXA 4M61B 2YA0A 3DVFA 5GPRA 3VFMB 3QQ3B 5EOQL 4QLRA 5ICYB 4LLUB 4GW4A 4JFED 4X6DB 3SKUD 4G6ML 1TQBC 4J3TA 5IJVB 4GT7A 2R2HB 1TPXB 4M6OL 3FO9B 5DHXB 3O2DA 3ARXA 4GXUM 4JPKL 3WN5B 3V6OC 3GMQB 1R3JA 2BVYA 4YDVA 5TPWL 1HQRA 1QUNA 1ULVA 5FYKH 2H32B 4PJGA 1HHHB 3DVGA 1CLZH 4M5YL 3V95A 4PR5B 1I7ZB 3QCVL 3F58H 5SWQB 4HWBL 2ADGA 1M71B 2GQHA 5E8EA 1X5ZA 1AO7A 5JQ6L 3MGTA 3ILQC 2D7QA 5L0QB 4P2RD 4RRPA 3BFOA 4LPCA 4NO0A 1CGXA 5HD8D 2ZKHL 4U3HA 5DEGB 3RX5A 5E70A 2YPLB 1G6RH 1JPST 3U83A 3DX7B 1CXHA 4U31A 4XHJD 2D3VA 1JPTH 1IC7H 1G6RA 2Q3AA 4QYOB 3O3AA 4KRLB 25C8L 5E2UH 5EU5B 3D9AH 5FGSA 2GFBB 4LQFL 4X5WA 2GTZB 4PJ9B 5EC1B 4Z77B 4XMKL 1CS6A 3RJQB 5AAWA 1CQKA 1ETZB 1GGTA 1B88A 2Z91A 4NWTL 5J11C 3ORJA 4YR6A 5JOPD 5D1XD 1FLTX 1QFWM 3BIKB 4ORGA 1PY4A 1U8LA 1DVFC 4Z7VF 1AHWC 2ENYA 1WBYB 1FO0B 2J6EL 1OAUH 1V3MA 2OP4L 5DK3A 1S9VA 2PCPA 1FNAA 3MZGB 1NAMA 1RUKH 4E41D 3QG6B 4P4KB 3ISWA 3SKMA 1VERA 5CJ5A 2I26N 2X4TB 5TDOA 3RWDB 1MRFL 4Y8DC 4P9HH 2UZIL 3KYKL 3H9SA 3U4BL 3HLAB 3JWDL 3AC0A 4KZEH 1WQVT 1GIGL 3I6GB 4XMPL 2J8OA 4PB9H 3KYNB 4NUJA 1U3HA 5DUPL 4LRNH 4LL9A 1L7TL 5B3JF 2X42A 4ZAKD 5CMAA 1O5DT 3UJJH 2DWEB 3NZ8A 5DRNB 2V2WA 4HPYH 3TO4C 4WI3A 3RL2A 2CGRH 5IBLD 1ACZA 4PBVC 2MKLC 4LSUL 1JPFB 1KTRL 4RGMB 4U6YB 4EN3A 4UI2A 2EEAA 4O51A 4JLRA 5KSBE 1X5YA 4L4VB 2OBGA 1M6OB 3TA3B 1NSNH 4U2YA 1QEWA 1OSPH 3DHJA 1PSKL 2HFFB 4JPWH 4LLVB 4NRYB 1OP5K 3W0WB 4R2GC 4ZO6A 5C2BL 3V2AR 2QR0B 3H42H 1M05A 3BH9A 4PV9B 1HYSC 5GQBA 3CU1A 5T3XE 3T0EC 3G5XA 3RPIA 1CBVL 3HZKA 2XNAB 2WBJC 1U3ZA 2FL5A 5DMKA 5C0DB 4C56D 2DQTH 2Y5TA 4JRYB 4MJIE 1EZVY 4R97B 3P4OB 1JE6A 4F7CA 1CICB 1T04A 4AENB 4K7FB 3QH3A 1AGCA 1P4BL 1FBIH 4DEPB 4MCZB 2QKIA 5DJ6B 2R0ZL 4MD4B 5D7SL 1YPZE 1GRWA 3TESA 4KKCD 3D2UB 4G7YL 2DB8A 2AS5M 4DTGL 3QULA 5BZWB 4U0QB 4GFTB 3ZL4L 4JM2C 5TH2A 2EH7L 5B8CC 4MB4A 3QPXH 1ZWIB 3L3DA 4MD0A 1L6ZA 1IM3B 1F3DH 3LDBB 3TVMA 3RWHA 1JGLH 4DZ8B 1XGPA 4Y8AA 5KJRL 2H9GB 2VXTL 2PTTA 5HYSG 5F1IA 1V05A 4JFDD 4MDIB 3CLEH 3ARFB 5DQ9A 5CBEA 1SM3L 2XA8L 4ZUWA 2FYYB 5BOZG 4GXVH 4ZXBA 4YWGL 3HG1B 5F89B 2OXHA 5ESAB 3OB8A 5EBLB 3TYGH 3CNKA 3BP6A 5TE6L 4MS8C 2GJZB 2J12B 3SGDH 4GS7C 1LK3H 2UWEF 4NQVA 1VFUA 3LKSB 1OP3H 2Y6SD 2WLYA 2QSVA 2X9YA 4W4OC 4J12A 2Z0BA 1N3NB 3OXRB 3I50H 3PGDB 3VGAC 2A83A 2HN7A 3STLA 4NZTL 1J0YA 4AEEA 4Q9RL 4ZFGL 1UVQB 4ZS7H 3IGAB 1UC6A 3VRLF 5DJ0B 4J7RA 4LF3B 4M8QB 2P24A 3RGVC 4XPFL 2IANA 1AE6L 1GGUA 1GPOL 5HHVL 3FOLA 3QCUL 5HI4C 4L3EB 5F9OH 5IVXE 1CDGA 3WFEL 4M48L 2VOTA 4KHXH 4YUEH 4WHCA 4ETYA 5DC0A 3UTPE 4HG4K 3SBWC 4NNYB 5DJDB 5IF0B 3Q5OA 3C5JA 3F7QA 1YMHA 4N8VB 4NN7B 1WLHA 2BNRB 3IETA 5DJAA 5E9DB 2O26U 5MEND 1X5AA 1QFWI 3U6RB 1MJ7L 3MJ7A 1U8JB 4FTVB 3MJGX 1F11A 3IDXH 2IH3A 5D1ZB 5D7JD 1J7VR 3D1MC 4LARH 3G6AB 1IKNA 5SX5H 5I19L 3BH8B 4FQIH 4XCEB 4J23A 3QI9D 3MRNB 3RIAK 5J12C 3ALPA 4X7TB 5DEFA 2R69L 4L3AA 4OF5A 4ONHB 1NKOA 1KC5L 2RJMA 2NY5H 1T03H 4MAUL 4XBPA 1C5DB 1LD9B 3CIQA 4OZFH 3ECBB 5HGAA 2UY7A 4OZFA 1A6ZA 4OAWB 4XNUL 2V2XA 3RUGE 4X99A 1UZ8B 4EUPG 3G04B 1BJMA 4DZBA 5JOFA 5MP6L 1JNLL 2BXYA 3S98A 4LEOA 4YE4L 3HPLA 4F58L 1GHFL 5CSGA 2QQNH 4M93B 1EZVX 3MRMA 3TIEA 4GRWH 5JHDA 1FP5A 2I5YL 3LSOA 3PWPA 4LPUA 2V5MA 4R7DB 1G1CA 1R0AL 3C87A 1WBXB 2CKBL 4D9QE 4W6XB 4QRTB 4S10A 1N6QL 1A47A 2MMXA 3RWCB 1P53A 5D2NB 4PUBL 1H5BC 1AJ7H 4NRXB 4U1JA 5D6DA 1N6VA 4RGNE 4HKZB 3O4OC 1TLKA 1KPRB 1RHHB 5C9JA 2YA1A 1MCOL 4P9ML 3SGDI 1OOAA 4XWGH 2M1KA 1FH5H 1U92B 3OAYK 3IFOA 2D7PA 4HS3A 3T08A 4CW1A 3OXSB 2PXYA 2IADA 3M1BA 4O2FA 5HYSB 3AU1A 2KH2B 3OKDA 4QCIA 2YPLD 4JFQA 4DWHA 2WBWB 3AS0A 3NCBB 5DR5H 3TNMA 1MFBH 3E6FB 5ICZA 2F54E 3UDWC 4J3WA 1YEEL 4GJTB 3C08L 4I3SL 5I8EA 4PJ9D 1GGCH 2JJTA 2HT2D 2ERJC 5JDJA 2DBJA 4U6XB 4OLXL 2I07A 2DL9A 3L3KB 2A6JA 4MYWB 5I1AA 1AGBB 1S9WB 4PG2C 2AJYH 5ENWB 3TN0A 1MSPA 2ZSVA 5LBSL 3SGKA 2F5AL 4HIHA 2GAZA 2J4WL 3WDHA 1F4XH 3G6DL 1FZKB 4P4KD 4RMSA 4I5BA 2AQ2A 3TPUB 3VWKC 1XF5B 4ZDHB 2MQ3A 4XI5C 3GI9L 3KJ4C 3C2SA 3GSXA 3OJDA 3T2QA 5IVNA 4LHQB 1FYTD 1E4XL 3QUMA 1ZTXH 4GKNB 4R3SA 4LSPL 3WD5L 2XG5A 1GXEA 1UACH 4Y2DA 1NGWB 4M62L 1OB1A 3WE6A 5JW4Q 3I75B 4R26H 3ZDYF 3MA7A 5JW4M 1RJLB 4LCUB 1B6UA 3ILPA 3U9PL 4GQPH 3EFDL 4FN0A 4Y5VB 5E8DL 3U0TA 5T1LD 4Y16D 1EIBA 1HDMB 4HV8A 1NLBL 1WCQA 3QA3B 3QHFL 2AJ3B 3CMOL 2P7TB 4X9GA 4XNYL 1JGVL 3RNQA 3C2AH 4L4VD 4NN5B 3OPZH 4HT1L 3TA3D 4PYGA 4LVHC 3QHTC 1KTLA 3KWWA 5DK0A 3CLFH 2Y1VA 3W0WD 4G6KL 5DLMH 3VFVA 4PRPA 2DMKA 2CDGB 5F1SA 4K7PL 5CD3B 1G7JA 1NMAH 1MFEH 5ACLA 3RVUC 5I17A 3OKEB 4JRYD 4G43A 1UQSA 3TJEH 1BQUA 3MUY1 1NFDE 1CICD 2OLDA 5AWNL 2P1YA 1HCVA 4BH8B 3ES6B 3DSFH 3ULVD 3DUUB 4CJ0A 1M7IB 2OCFD 3SE8H 5MERA 3SY0A 3U4AA 4P46A 2X10A 1U8KA 5HYQA 1U42A 3RDTB 1KJVB 2ED9A 1PW3A 4R0LC 5IW6B 1NMBL 1KYOJ 4XVSL 3L1OL 5AZ2L 1IM9D 5FOBB 2O5YH 3JTTA 1GOGA 5TJWK 4EIZC 1U41A 3GMOB 4TVPH 2AK4B 3ARFD 1A8JH 3BQUB 2YC1A 2AK1H 3R06B 2DM4A 4P3CH 3MXWH 4MNQB 3HG1D 5EA0H 3QDGE 4N5EC 3N1GC 4QEGA 1MI5A 4MNHB 4IOFD 2QADD 3F7VA 4KAQL 4KRPB 2HT4D 4PJ5E 4HUXA 2A77H 1R24B 4GS7B 2I9TA 1YN7B 5C0AB 5F7NC 3DO3A 4N0UA 2XG4A 5F96L 5C09E 1T83A 4JCLA 4Y4KB 1AIFB 4HFWB 3O2WH 1RUAH 2F8VA 2CDFB 3GHEL 1TVBB 1G7PB 3BRDA 1MCPH 2XIDA 1CLZL 4OCXL 2C3VB 3T2NH 4QRPA 3S37H 5BS0B 2IAMA 3F58L 4YIQA 5CEZD 3TCXA 2AJUL 4ONGL 3I3BA 5D2LE 4WHTA 3AS2A 4OLUL 2WANA 2DQJL 3BO8B 5H94A 2W65A 1PX4A 4KUZL 4M8VA 5DK2A 4JREB 1EVUA 1WBZA 2VL4A 4IDJL 1IGCH 5IBUG 3UPAA 1IKFH 4WU7A 1F6FB 5T3ZE 1JPTL 3GNMH 4JB9L 5FUZH 3IDNB 5D1ZD 2VC2L 3K1KC 3B43A 1AGDB 4IIQA 3WSQL 3CH1A 4LEXH 1J87A 3PDGA 3Q6GL 4PJ8C 4WI9A 5J12B 5DJYA 1MCKA 4EVNA 5I1DB 3I6KA 4HUWB 3VXNA 5I1HL 1FFOB 1HWGB 1A6WH 3NH7H 4YNYB 4L9LC 3SE4A 3HUJB 3HE6A 3VXMA 1KIRA 1ZLUH 3C09C 4R90L 3RY6A 4P9HL 4PGDB 1BF2A 2BOBB 1K3IA 3U7YH 4TUOA 1JGDB 1XF2A 3BD4A 4WEBH 1I7UA 2QHRH 2HFGH 2GJ6E 1PLGH 3MV01 4ODWA 3GSVB 3EYUL 2VZ3A 4X6EA 4YHIB 4PJIB 3IXAB 3MBEB 1NEZA 1H5BB 2VDNH 2J1KA 4K71C 1RK1B 3ARDB 1PGRB 1ONQA 2LQRA 5KG9B 4ONFH 2AV7A 5FUCE 2E9BA 1YNLH 2ZUQC 3NIGF 2XACC 3O4OB 3QXDB 1OTUC 3DVIA 1RZGA 4X6DF 1XIWA 4FNLL 3L3HA 1T4KB 3OJ2C 4Q0XL 1ORSA 1UZ6F 3LS4H 4NZRH 4YPJA 4YHML 5IIEA 5KOVC 4XPHL 3SE3C 3ZDZF 1PZUB 2X89A 5GGSB 8FABB 4M7KL 3UTSD 4IOIA 5DTFA 1WWWX 2VDPH 4YJZL 3NCCB 3GMNB 2P5WE 4XMLL 3FT2B 4S1RH 5E03A 4MA1C 3Q5YA 2YD1A 2AKRA 5TE4H 1HQ4B 3CCHA 2ERJB 4YHNB 2NY6C 5K9JH 4LHJB 1UCTA 1D5ZB 3AFLA 4JY6A 5C6TL 2A6DA 1A6UH 4XHQA 5EUKA 3PL6C 5HJ3B 3B9VA 3DV6B 4GKZB 1DANU 3VH8G 4HKXA 4IEFB 1CVRA 4OF3A 4M6NL 2R1WA 5DD1H 3FB6A 1U8MB 3JWNC 4H1LG 3UTOA 1BVZA 3X13B 3QPXL 3IDYB 5ICXA 2PYEB 3QHZL 4DAGL 2XKSA 4N68A 1IQWH 1JGLL 3PWUA 3UYOD 2JJVA 4H8WL 2VR5A 5EOTB 5HDQH 2IMMA 5EORH 5ACMA 4Y4FA 1I1FA 1HIML 4K8RD 1CL7H 2OMBA 2ATKA 1VFAB 3D87B 3Q6FB 4CVWA 3O2VH 1OARH 4UQ3A 4K94H 1BHGA 4LPTA 3SDDB 5FKPA 4AM0A 4KWUA 1FVEB 1I1YB 3M07A 4PS4L 4XBGA 4MDJB 5JO5B 4ALAL 6FABL 1YY8A 4R4FH 1UWGH 2E27L 5ALBH 1KEML 3MLXL 3MREB 4DUWA 5EZLB 5HHPB 5C07B 3RFZC 4U1LA 5T3XH 4CVXB 1RQ5A 3F5WA 3LD8C 2C1OA 4XC3H 4DQOH 2VLME 4ODUA 3B9EA 1MY5A 3LS5L 3CFEB 3E3QE 4KK8D 1YMME 2GCYB 32C2B 1CD9B 2PO6D 2QHLA 5I1JH 3WJJA 2K7PA 3SGEH 1ZVSA 1KJMB 1L4IA 2B5IC 4MJIA 2P5EB 1Z0NA 2V2TA 1FPTH 3R8QA 3L5WA 1I8KB 4U6VL 4U1IB 2FZ3A 3M8OL 1YPZA 2GHWB 1IGFH 3QZWG 1ZHKB 3QNZA 3A67H 1KBGH 5DJ2A 3RDTD 3QP3A 5EZOH 3UPRB 4MWFA 1MAJA 1YYLH 3GMLA 1FVCB 4NKIL 3TYFA 1CIDA 1T80A 4KHTL 2FR4A 3T77B 2AK4D 5BXFB 4OIIL 1T03L 1CLYH 3RBGA 5A40E 2IG2H 4L29A 3BQUD 1HHIB 3VFPB 2BVOA 4GLRI 4HBCL 4XXDA 3RVVC 4MQXC 4Q6IB 4MNQD 4OKVB 4MB5A 4EIGB 1W2KT 4NDMB 5GZND 5JXAL 1HZHH 1QKZH 1QR1A 5IT2H 5C8JA 4NQDE 4FFYL 4HFUH 3IDJA 4GW1B 4KRPD 4FQ1H 4PLJC 3X14A 4MNGE 1MHEB 1F6AB 1A1OB 2FO4B 5C0AD 2CMRL 2XN9B 2Q7NA 1ZLSH 4MZ2A 1LEIB 5E2VH 4FA8A 5C0FB 4Y4KD 1B0GA 4RDQG 4F7EA 4OM1L 4ZSOB 1CL7I 1IJ9A 1ZHLA 2JIXD 4KC3B 2LVCA 3VH8B 3RNKA 4PTTA 1N5YL 4N9GA 1XGYL 2ZP0T 5EIIA 2ZJSH 3TJHD 2XQYG 4LLMB 1GGIH 1EEZA 3GSNA 5IVXA 3BPLC 5C0NC 5BQ7B 1KENH 2XOTA 3NFPB 4H1LB 4ZQKA 2X2YA 5CCKH 3OX8B 3BDYH 3DVNA 5DHVH 1OPGH 1LEGB 3GMPB 3DURA 4LCYA 1S7QB 3RWEB 4OB5H 2VQ1B 1HSBA 3OKOA 5E7FA 4IRSC 3VXQA 4YHKH 3NN8A 3BSZH 2B1AL 1U58B 5ERWA 5DT1H 1MQKH 3P0YH 3HNTH 1OCWL 3L95A 3RTQA 2PR4L 1E4KC 1KFAL 2IBZY 4CMHB 2BVEA 1GC1L 1UB6A 3EO9H 5MEOA 1MLCA 3SGEI 4GH7B 2VYRE 2YD9A 5AZEH 4XNXH 5A2LH 4UNUA 4YGVB 4U1NB 2N4IA 2EKSA 1NGZA 2ZZUT 4YDJB 3RUGA 4AT6A 5B38A 5E4EC 4Y89A 2FD6H 5IG7B 1OSZA 3V8OA 2EKJA 1DFBH 4JN1L 1F8TH 1EHLH 2NY2C 3F12A 4Z8FL 5E6ID 5FYLE 2Q6WB 4JG0L 5FO9A 4PJHA 3CDYA 3OTTA 4UQ2B 2W91A 1WF5A 1WWCA 1F58H 3MBED 3QZWB 2CKBA 1ND0A 2YEZB 3FONB 2N7BA 3ARDD 2IQAA 4N0YL 3O6LH 4ZTPL 4K23L 5ID1B 1SJVA 3GO1H 4WW1A 3VFOB 4NFDA 3ZKND 1DLHA 4C4KO 4K2UH 1P5UA 4NC1C 1CDIA 4Q7DA 5JW5B 3FQTB 3TPKA 5DHYB 2VXVL 4HIJB 4QXTA 3RJDA 1CD0A 3FFDA 1U2CA 1FL5A 5L9DH 2XZQH 3ARGD 3NACL 2F54A 3VFGL 4AIXA 3LEYH 5B22A 1QVOA 3F8UB 3ULSA 2XZAL 4Q74A 1DQMH 5IFHL 3HMXL 2V7NB 1FAKT 1OAXH 5CSZA 2XRAH 4RIRB 3IT8D 5D6CB 2YBRA 5H37G 5C6PB 1LGVA 5IEKB 1UXWA 2Q1EA 2X7LA 3GKWL 3C8KB 1D5BA 5E1AB 3KXFA 3VW3L 1RUQH 1BJ1J 1FL6B 3LKPA 3C5ZC 1K9TA 2VZTA 3ZTJG 1ZA6A 4LSTL 2FO1A 5T5FL 4NO3A 3I2CL 3QEGL 1NC2A 2DI9A 5KVDH 4X6CF 4PV8B 1N7ML 3EJZD 5BRZB 1U8PA 5FHAH 2VDRL 2V7HB 4AK1A 3PQYB 3MV9B 5BVPH 2ARJQ 1BVKA 1CTNA 2NY7H 2ADFL 4RMQA 5EULV 1KG0B 3SDDD 3QUZC 4XPBH 2P8PB 2C9AA 3HPJB 3ULUE 2IBZX 5KOMC 3QIUB 5JDSA 4HC1H 2JJSA 2XTJE 5FKAB 5F3BB 3LH2H 1TZIA 5EBMA 4G42A 4U2ZA 4HC1A 4PJCB 3WFZA 4ELKB 5IFJB 2D03H 3ESVF 3GI8L 1S9XA 4X4YA 3BDXA 2ZCLH 4JZJA 4BFIA 3HZYA 4LLAA 1JI2A 4HDIA 1MCQA 4LHUB 4G8FA 1WV7T 4W70A 3MLYL 3RIFK 3FN0H 4OV5A 2IPTH 5MEQA 3QXAA 3MRFA 1KCUL 1LO5B 1G9NH 4XCYA 1X4ZA 4G3YH 5E8OB 3MFFA 2ADIB 4RQQA 2BCKB 3S37X 1FJ1A 2R23B 4IS6A 4GG6E 3GK8H 2P5ED 1GSMA 1C12A 1NFDA 1PQZB 1Q9WA 4Y5XA 5KN5B 4PG9B 3HAEH 2EZ0D 4Y1AB 5IEHA 3UO1H 1OAZH 2W0FB 3DIFB 4HUUB 4JG1L 3LKQA 1B90A 3OZ9H 4NNXB 2ARJA 2NTFA 5I2IA 1BLNA 2CO7B 2VSCA 5BO1L 1S5HA 1MVUB 5GS1C 5ILTH 5GGQH 5E5RB 4JR9L 3X11B 2OZ4H 4JFYA 3WIHH 3SDAC 1JF5A 2VN7A 5I1IL 1G7HA 5M7QA 1AH1A 4GUPB 3AXLA 3WIHA 2X4OA 5IMKB 1YDPA 1KLFA 4MHHI 5LXGL 1FZJA 1CXFA 2BSSA 1MELA 5CEYB 4JZNA 3QDGA 4L3CA 3RY4A 1E6JL 4PJXB 2NXZC 2O5XL 5A3IC 2OJEA 2PTVA 5FYJH 3P9LA 4PJ5A 1BQLH 2PW1A 2IC2A 1A3RH 3T0AA 5C09A 3VXPA 4EDXB 5E1HB 3E6HA 3GB7A 4GW5A 3B9DA 1RZIB 3KNBA 1GL4B 4M5ZH 1MRCH 5T1KA 4Z78A 5A16A 2CLRA 4K3JL 5T1MB 1H15A 3TBSB 4WUUB 1NKRA 2KZ1B 1ZKAA 4XZUB 4TUKH 4IRJA 3WO4B 3IS0X 43CAB 4GG8B 2VDNL 2XKUA 4RISH 3SDYH 1KJ3L 4HLZH 4C83A 1CFSB 3BWUC 1NGYA 2R29H 3BPLB 2VL5B 3G5YA 4YHOH 5D2LA 3SDCB 5IMOB 3T4YB 2ZPKL 3VFWA 4HUVA 2EO1A 5JPNA 1T5WA 4RAHA 5GSRB 5IV2A 4NPYA 5F88B 1KB5H 1FGNH 1ZOXA 1FRGL 1G7QA 3GSQB 1AXSB 3EDEA 1GZPB 5T3ZH 1JWUB 1F4AA 3OHXA 5HHNB 2X4SA 3JXAA 4UIMA 1KB5A 4OD1L 3BUYB 4KJWC 4N1EA 5ITBL 4Q9QL 4OD2B 1FG9C 2LTQC 4LMQE 5DI8B 2Q76B 5DGRA 1HEZA 1E28A 3L9RB 3GBML 3FOMB 3QFJD 4GKSA 3TZVC 4JHWL 4J4PD 4DOHB 5KVGL 4AEIH 2R8SH 4HUNB 4P5TD 4WFHD 2DTSA 4XP4L 3OB0K 1A14L 4HWNA 5I18L 5IW1A 3CPLB 4KDTC 4D0DB 1C7TA 3MGOB 1DQDH 5TQ0L 4PRHD 2RFXB 1MIMH 3IDGA 3IKKA 4PYHA 4GW4B 5D1QA 2HRPL 3M17A 3ULVE 4P23C 2EYRA 4KROB 1U91B 4N0CC 3FKUS 2DLFH 1ZANH 3ZDXF 5BJTA 2YUWA 1VKXA 4TSBL 4A6YA 1QHPA 4KK9C 4YX2L 2GJ6A 4LLWA 5EORL 1FNFA 2VAAA 4HGWB 2MJWA 1S7RA 2AJVH 1R3JB 4YDVB 1P4IL 1OP5H 1HQRB 5C0EA 5J0BA 1I3UA 4KMQA 3D85D 4PJDF 1WIPA 4TQEL 5JW4R 3CZFA 4PJGB 3DVGB 5AYQA 5LG1A 1I8LC 2QQKH 1ZGLB 2AQ3A 3PWJA 1T2QH 3HUJF 1Z9OA 2XYCA 1ZV5A 1OT1A 2ADGB 2EDEA 1AO7B 3MGTB 1CE1H 1T21A 1EFXA 1QBAA 1RZJH 4GMSH 1BJ1H 3GDBA 4NO0B 5E2WH 5F6HJ 5I73B 4JFPA 2EDLA 2QSTA 5E08L 1G84A 1RULH 1G7IA 4NOFA 4X7CC 1IAIL 1BZQK 1X5FA 1N59A 2P5WA 1HH6A 4BQBA 3O3AB 2NZ9D 1R3LB 4X5WB 5E0QA 2IGFH 3U2SA 4J1UB 4NBZB 1ITBB 2Z91B 2EH8H 3QDME 3EJJX 3K1DA 4YR6B 1CCZA 3LZFL 4JE4B 4L3EE 2BRRL 4PY7A 4XPGH 1U8LB 3QUKA 3V0VA 4Z7NE 5C70A 2DKUA 3JZ7A 5DMGC 2PCPB 1OM3H 1IGIL 1NAMB 1Z9MA 4FQCH 4MSWA 3A67L 2BNRE 1D9KA 3SKMB 5E9DE 1KEGH 5EZOL 5F9WB 3H9SB 4FTVE 1SEBA 1TJGL 3PQYD 4PJFA 1C5BH 4KTEH 1R5VA 2RB8A 1XGRA 3LQAC 4NUJB 2IG2L 1ES0A 1U3HB 4CDHA 2BDNL 4DKAA 3ALXA 5KVFH 1I9RL 5KZCB 2A6IA 5CMAB 5F72S 1HZHL 1CR9H 3QIUD 4NGHH 4WO4C 3NZ8B 1CLOL 2V2WB 5J6GB 3CSYA 4LPXA 4TPRH 3RL2B 3REWB 1QSFB 2FGWH 1P84K 15C8L 5IBTL 1IL1A 1C08A 1CYGA 4JLRB 2C7UB 1SJEA 2VO5A 2MNUA 1G0DA 5IQ7H 4KDWA 1UJ3A 3P9WB 2OM5A 4OZFG 4Y2OA 2FATH 1T1ZA 1MHHA 5DZOA 3I85A 3PGCA 5JXEA 5KW9L 4MA7L 1DBKL 3G5XB 2B0SH 1YMMA 3RPIB 3HZKB 3CFJA 3V6OE 3CUPA 1RVFH 4F9LA 2DYPA 2FL5B 5DMKB 3IVKA 3K4DA 3NFSH 1CU4L 5EBGA 3MLRH 2EDDA 1U95A 4I2XA 4Y1AD 4F7CB 3O3BA 1T04B 4ZG1A 2HTLC 3QH3B 3MC0A 1DDHA 1AGCB 3BYYA 2QKIB 4AJ0A 5KSAA 5TE7L 1TZHA 5DT1L 1J8KA 4OJFL 5DJZA 2E6QA 3DO7A 3QULB 4YFLI 2G75A 3NCJL 4RWYL 5TH2B 3L3DB 4MD0B 3CC5A 3TVMB 3RWHB 4Y19D 4K3HA 1J5OH 1XGPB 1E4JA 4G8GD 3NTCH 1MCNA 2PTTB 5GJTL 4EI5A 5EG6C 5BV7C 5DQ9B 1CVSC 5CBEB 4WFFD 1KN4H 4ZUWB 5HHXH 1KELL 2BY0A 4JO3L 4ZXBB 2BMKA 4NQDA 3BRFA 3UTTB 1INQA 5EZJA 2FX7L 3BP6B 3EYSH 4MNGA 2D0GA 3G9VA 4NQVB 3CFDB 3MX0A 3T8XA 1S7XB 4BSWA 5DJCA 5CZXC 3U48A 4F37F 4NM4H 1DR9A 4WUUD 2A83B 4DJMA 2HN7B 3MJ9L 3STLB 3WS6A 2BVQA 3PWNA 1QRNA 2P24B 2IANB 2CK0H 4HIXH 3O6LL 2C3HA 3GO1L 1DEEA 1F3JA 1QA9A 4D8PB 4C59B 2OL3H 1ADQL 3SDCD 4DKFH 4OCRL 3ARUA 1FFRA 5DXWA 5LKNA 3EZJB 2OL3A 1YMHB 5BW7A 2ED7A 3E0GA 3MLUH 1RUPH 3IETB 5DJAB 2J8UE 5JIKA 3W9DA 3BKMH 3MJ7B 5JOEA 1EHNA 1DBBH 4KI1A 1F11B 1EUUA 2IH3B 4V1DA 4ISVA 1QSEA 3K4AA 5DEFB 1Q9KA 2OI9B 3KHOA 1ZA3A 3D18A 3HC3L 3TZVB 4WRLA 3P4NA 3PGFL 5E5UB 1UM4L 4XBPB 3T0EE 2I9LA 4JZOA 1G9MH 1UH3A 3SE4C 1BM3H 2FX8L 4QWWC 5I1KL 1A6ZB 4HJGB 2V2XB 3JV4A 4X99B 1MJ8H 1K5NB 3WFDH 1UKTA 1T22A 4KROD 1RY7B 4LOUD 2GSGA 5JOFB 2Z8RA 3F62A 3P3YA 3AY4C 3LMJL 1NCBL 2HYMA 4M3JA 4LEOB 1A7BA 3HPLB 4QF1A 4P23B 4UNTA 4NKMA 5FYLH 5KVDL 3RHWF 4UT6L 3MRMB 3TIEB 5FHAL 3LSOB 3PWPB 1NFKA 2AEPL 3I3DA 4NHCH 4RSVA 4GRWB 3SKOA 4D0CA 3MRIB 4G9FE 4XPBL 3NIFE 2VRAA 4APQA 1JTOA 4U1JB 2Y4SA 5FYKD 2L0DA 2COQA 2FEEI 1BVLB 5C9JB 1NCCH 4OZ4B 1T3FA 4L5FH 2YPVL 5DA0B 3LQZA 1KPVA 2ZCHH 1AO7D 3SQOH 4CADA 4Z7OF 5IFAL 4XX1G 2VR9A 1KIPA 4NO0D 4XB7A 4CW1B 2PXYB 3M1BB 4DN4L 4UTBL 3OKDB 4LKCA 4QCIB 4JFQB 3SE9L 1N0XH 5ICZB 4ZTOH 5HVWA 4BQCA 4WI2A 1MHPH 4G3YL 3RL1A 1I3GH 4JCMA 5I8EB 1CK0L 3DTXA 1A6PA 2I07B 3ARTA 2H2PC 4IHOA 2A6JB 2JK5A 5BS0E 1IEAA 2H2SC 5EOCJ 1YYML 3UO1L 3O6KH 3TN0B 2ZSVB 5DO2C 1UXSA 4HIHB 2GAZB 1K6QH 4RZCB 2OX5A 5IROA 5GZOC 1L6XA 2YZ1A 4KTDL 3WJLC 2W9EH 4I5BB 1LO4L 2UVFA 4F7MB 3H9SD 3OJDB 1FG2A 5E5MA 1TJIL 5DURB 2WK2A 3QUMB 4M1GL 4R3SB 1U3HD 1RZ8A 4G6JH 1DSFH 4Y2DB 3VWJC 3FQXB 4HD9A 3WE6B 1OB1B 2FEDD 3ULUH 5EU3A 5KZCD 3MA7B 4DVRL 1HSAA 2Z92B 3EYQC 3ILPB 1ZMYA 4FQ2H 1J1OL 3K0WA 4RDQF 1F00I 4PJBF 4HV8B 5FYJL 2VXUL 2XXMB 2WIIA 1BQLL 4M61A 4EN3D 3SJVE 3VFMA 3N0PB 3UAJC 2IQ9L 3GSOB 3MUHL 3RNQB 2FBJH 2D0HA 3EBAA 2HMIC 2AJXH 1KTLB 1QQDB 3KWWB 1TETL 2JCCE 1U6AH 5DK0B 5SX4H 2R2HA 2XQBH 4UILH 2F19L 4TTDD 2VZ1A 1Q1JH 1FLRL 3VFVB 4PRPB 3WN5A 2BSRB 3B8YA 1G7JB 2DQEL 3GRWH 4XAKD 5I17B 1N4XH 4GG6A 3BKYL 2BVTA 4PJIE 3MNWA 5DD3L 1UQSB 1EHAA 1A7PH 4FS0A 3BPOC 4PR5A 3BT2L 2D4FA 4HPOL 1D5XB 2CSPA 2P4AB 3ZHLA 2FHBA 3QNXA 1KN2L 5SWQA 3N50A 1OLLA 4PJCF 1FGNL 2NY3B 4YHLL 4QXWA 1H9VA 3PHQA 4XPTH 1IFHL 1U8KB 3ARSA 3SO3B 5HYQB 3TH2T 3U30C 1OTTD 3IKCA 3KVQA 4LSSH 1RMFH 4LSQL 4N8CH 5DEGA 2V9TA 3THML 3TVMD 4U49A 4XP6H 3IU4L 1NL0L 3P11H 4HMEA 4JANB 4M7ZC 5EU5A 3EZ8A 3VGBA 5KSUA 2YC1B 3W82A 1FO0H 2HLFC 4ZXBD 3DWTA 3RWFA 2GTWA 5IWLC 1T1XA 4HW6A 1MIML 2Z8WC 3BIKA 4JVPA 2B4CH 1FO0A 1LO0L 3Q1SH 1MI5B 1SJXA 4HH8A 3A6CH 3F7VB 5I76A 3DMMC 5FHBH 4IBLT 3K2UH 4HUXB 3TBYA 5T1DL 4I0KA 3A6BH 2WUCL 1ZEAL 4NKOA 3FCTA 4HQQL 1IAKA 2E7LA 5KAQG 4N0UB 2PYEE 3HLAA 3NCYP 1UWXH 4KKAC 5IGXH 4EDWL 1N64H 2IAND 4EXPX 1LO2L 3FTGB 4B50A 5CILL 4Y4HC 3WFBH 2R0KL 4QRPB 3TO2A 2KL6A 2DQFA 2IAMB 4C58B 4YIQB 4PJXF 4JRXE 4JHBA 2YPKA 4WHTB 4UTAH 1U8IB 3RZCA 1EFQA 5H94B 1TQCC 1VHPA 2W65B 4U6YA 4ZO8A 5DK2B 5E7BA 5SX4I 3WXVL 1M6OA 5C07E 1U9KA 2BFVH 4JM4L 1BBDH 3PXJA 3TV3H 4LLVA 4XP5H 2VDQL 4IIQB 2CXGA 3NA4A 3ALWA 4M7LH 2EDJA 5JZ7C 3RVTD 2X4NA 5F7EH 1A21A 3ZYOA 2XNAA 5DJYB 3SO5A 4EVNB 3I6KB 4EBQH 1VB9A 4OGAD 1VFOA 3C6LC 4XPGL 4YBHA 1R3IL 4PRAA 3ULVH 3VGFA 1S3KL 1OM3L 4AENA 3VXMB 1KIRB 1HH9A 3FFCD 2QLVB 3FO0H 4FQCL 4HJ0C 4JQIL 4MCZA 1JZ2A 3WFCL 1WIUA 5D7KD 2EEBA 3RVWD 4XRCA 5JHDD 3N9GL 3PWPD 3QUYA 4TUOB 1XF2B 2H1PH 2AEQL 1I7UB 3G5VA 4RGOL 1U8HA 1FIEA 2PYFB 4XNZB 5I1CH 4X6EB 1CR9L 1NEZB 3O9WA 2X6MA 1X5KA 4PB0H 2V5SA 4YDLC 5FM5M 4TPRL 4ELMF 4WW2F 3Q5TA 1FC2D 2AV7B 2FGWL 4HUKB 1BOGA 4QHKJ 5ESAA 5DD6B 4R4ND 3MLPA 1RZGB 1XIWB 5EOCH 1OGTB 5D7LD 3L3HB 4BZ1H 1DQJB 1JZ4A 2FDBP 5IIEB 2R4SH 5HPMA 5CLWA 5E2TH 2YA2A 2XN9E 1EAPA 3LRSA 3BKJL 3PGDA 1N3NA 3OXRA 4IOIB 5DTFB 4Q58C 3QWOA 1I1AC 1WK0A 3G08A 4ZSOE 5GGUA 2OJZH 4F3FA 4PJGF 5FM4A 2AKRB 4FRWA 3QDMA 3CCHB 3MLRL 5CGMA 4X7SH 3TN0D 1MCFA 5EUKB 5DD5L 5IF0A 4HKXB 4U1GC 5C7XL 4YBQC 4GOSA 4LMQI 4N8VA 5I66A 2BNRA 2A9NH 3EYFA 4TNWF 2R1WB 1H3XA 5E9DA 2NTSP 3FB6B 5EU4A 4S11A 4RMTA 3U6RA 4LCIH 1F4WH 5DURD 5ICXB 4H26B 4FTVA 5DQJA 1WT5A 3PWUB 2F58L 1IAMA 1PG7W 1ZAGA 4J3OC 3NTCL 2EIDA 4Y2DD 4HX1A 2CJUL 3LN4A 2ATKB 2EE3A 4S1SL 3EJYD 1IMHC 3ARBC 4UQ3B 2WWMC 4M1CC 4Q2ZA 2B20A 2OS7A 5HGHA 3D0LA 1C5DA 1LD9A 5FKPB 4AM0B 4UB0H 1HHGA 1F90H 1VFMA 4JQVA 3MV8E 5FDYA 2KQNA 2XPGA 4MA8L 2LABA 4XBGB 1YY8B 1KT2B 2Z31C 2DMCA 5FCUH 1J1PH 2P8MA 3FRUB 3D69A 3O3EA 2RBLA 1A7NH 4JKMA 4POZC 2DQDL 1J8HE 4HHAA 1RUMH 2DLEA 1YA5A 3DGCR 4U1LB 1XGTA 3F5WB 4PRPD 2C1OB 2A38A 5B38G 4R7DA 1WBXA 4ODUB 2Y7QA 4Z7QF 5DFTA 3K46A 3V6OA 1JI1A 2NPLX 4UDTB 5D7IE 1JV5A 1DTUA 1ZVSB 3X12A 5HI5D 1DL7L 4DKFL 3BXNA 4KKNA 5L2KA 5CJQH 3TT3L 2V2TB 2IALA 4HWUA 5DRWB 3IXTA 2NY3D 2GK2A 3MO1B 4PRIB 1OAYH 3L5WB 3F7RA 3U0WH 1QZ1A 2H8PA 5FEBA 1YPZB 1FAIL 4P46D 4JY4A 1MAML 3PIQA 3BKML 5GHWL 3OXSA 3QNZB 4NQCB 5DJ2B 1QG3A 3U30B 4MGXA 3MODL 4MWFB 3E6FA 2K9UA 3GMLB 2BY1A 4QT5A 3TYFB 4FFVC 2HVJB 5DMJB 3PV7A 1HHJA 2OR9L 4FP8L 4W68A 3TEUA 6CGTA 1NDGA 1KPUB 5GGVH 1HINL 1RU9H 4FZ8H 1NUNB 4L29B 4X6BA 2BVOB 4XXDB 5GGRA 4TVPD 4X98A 5CINH 1CFVH 5E24E 1KXQE 5IMLA 1YEIH 2VLLB 1QFOA 2Y72A 1QR1B 3BKCH 2Y06L 4FABL 1QYGL 1MI5D 4YXLH 5C8JB 4DUXA 3LPWA 3IDJB 1DVFA 1AHWA 3OR7A 3X14B 3MRBA 5J6HA 1JPGB 2GI7A 1B2WL 3VFNA 4JJHA 1D6VH 1MWAL 2QQLL 4OQTH 3GGWA 4V2BA 4WFED 1BZ9A 5J3HC 4OQTA 2ZUWA 5CIPA 4ZO9A 5GGTL 4MHHG 1B0GB 4GKNA 5GRYA 5BRZE 4IRJC 1ZHLB 5B4MD 3OAZK 3MV9E 1JWSA 4P2YA 3RNKB 4PTTB 4K9EL 4CMMB 2K1MA 3VXTA 4KVCL 4QRPD 1EEZB 4AZ8A 2IAMD 3GSNB 5IVXB 4KPHH 5CP3H 4KMTL 1DUYA 4ZQKB 1U3YA 4GAGL 2ZCHL 1JHTA 5LQBL 2PKDA 3QA3A 4LCYB 3I6LE 3TO4A 1MREH 1HSBB 1NGPH 3VXQB 1YECH 2J8UA 1J18A 2P7TA 4HUMB 3NN8B 4NWUL 4Z9KB 2EECA 1TQCB 4QKXB 5ERWB 3QEHB 3L95B 1N0XL 3AGVA 3RTQB 1W8NA 1SQ2N 4ACPA 2GKIA 1FV1A 5GSVB 2CDGA 2H26B 5ESVB 2BNQE 5CD3A 1RIHH 2CUIA 1KLGB 2NXYC 1MLCB 1BAFH 1Y6NR 3O45A 1MCIA 3R4DA 4WY7H 3T0EA 1QFUL 3RA7H 5JW3L 2WBJA 1A22B 3MOBH 1FORH 3UTQA 1AQKH 4N0FA 1NGZB 3HE6D 3VXMD 3RUGB 1HKFA 1OW0C 4LAQL 3G5ZB 3RVXD 4AT6B 3P0VH 5B38B 1HXMA 2NYYC 5IHZB 3CAFA 5FIEA 5IB1A 1DQLH 1Q72H 4JFHE 3S36H 1T1WA 3HCVA 1WAAA 1KNOA 1RIUH 1C5CH 1MHCA 4ODHH 1UM5H 4KKLD 4QGTA 2Y23A 2APTA 4M7LT 1YN6A 3FQRA 1MIEL 4P9HC 2MHAA 1AFVL 2HH0H 4JM2A 5B8CA 5IW6A 2R2BB 4ODVH 3HAEG 5FO9B 4PJHB 4G9FA 1Q0YH 3ZYZA 5LJYH 3GMOA 5I9QC 2CKBB 1ND0B 3CXHK 1YEGH 1H3PH 4RGNB 3GEWB 3MZTA 2I27N 1YY9C 1JF1A 4L1DA 2IQAB 3RX7A 4OZHF 1RURH 1CF8H 4WW1B 4MAYA 1P84J 3NZHH 5D71H 1DLHB 4ZD3L 1XIWD 1HI6A 4YPGB 3LIZH 1S5IL 3U1SH 2MCG1 1WUNT 2X89D 3CXDL 4QXTB 1OTSC 2BVUA 4KI5C 4POUB 3FFDB 4URTB 1FL5B 3V52H 2VDMH 3LN9A 3WUWA 4X80L 3BMWA 2F54B 4QHMA 4W4OA 4GRWF 4U6TA 3ULSB 4XWOC 4WGWB 2N1KA 1EGJL 5I8OH 1TVBA 4HZLA 2F5BH 2H41A 3FO2A 5CP7A 3KLHC 4PY8J 2YBRB 1A4KA 5F9JA 3MOAH 3SOBH 5CD5C 3RGVA 4BM7A 1QFHA 1ACYH 1UXWB 5BS0A 2X7LB 2ZWLT 4HF5L 4JHAL 1YNTA 4DFIA 1D5BB 3S97C 3MCLH 3KXFB 4NOBA 2XZCL 3RI5F 4Z7VA 3SBWA 5C86A 2EDRA 2V5YA 3LKPB 1LE5A 4U1GB 3SDXE 1ZA6B 3VDBA 5DFVD 4XCFH 1NC2B 5D9SA 3S35H 2DQIH 2OK0H 2HJFB 1U8PB 4PGBA 4Y4FD 4LK4A 4YC2C 1C8PA 3ARZA 4H8WC 4ONOA 4QHLB 5E95B 4OLVL 3MTRA 3O8XA 5I1DA 3WIIH 1ZLVH 5JDSB 3Q1SL 5D5MF 5F6IB 4ZMAT 3SJVA 1TZIB 5EBMB 4G42B 3IFNH 5M94B 3A6BL 4NBXB 3MMEA 1S9XB 2JCCA 1IEBA 3BE1L 4GBXC 4BFIB 2BOBA 3HZYB 3S7GA 5KVEH 4BSVA 4HDIB 3GJFK 4UT7L 3QBTB 1MPAH 4G8FB 4QXUH 5EIQA 5T3XD 1K8IA 2DDQL 3DV4A 3S4SA 1MJUL 4OV5B 5MEQB 4O58L 3MRFB 3EDJA 5EZIL 4HJJL 1YQ2A 4BFEA 1CN4A 5IKCA 4TNVF 3MFFB 4XTRD 1RJCA 4LCWE 1MFNA 4RQQB 2AGJL 1QR4A 1FJ1B 1EDQA 3IXAA 3LEVH 4IS6B 4MJID 1C12B 1H5BA 1NFDB 4Y5XB 2X44D 1NDMA 3X3GL 1HK6A 3QIBC 1MFCH 4R9HA 3B9KC 5EUOE 3QXDA 3GMMA 5IEHB 3BN9D 3LKQB 2J88L 1A7RL 2CH8A 1AO7E 4DGYL 3AMKA 4BYHA 2JB5H 2ARJB 2O93L 2NTFB 5I2IB 1J10A 3RWJA 3B8SA 4NC1E 4B0MM 5H2BA 5CAYB 4JFYB 1X5JA 4CVUA 1KB9J 1G7HB 5I15L 1AD0A 5DJXA 5F7EL 3AXLB 3UDWA 3QO0A 5EU6B 2X4OB 1YDPB 4Y5YC 4YEFA 1J11A 1FZJB 1HQ4A 5CS7A 4KKBD 1OAKH 2JB6A 2DL2A 4OLZH 4KRNA 4FXKA 3RZWA 1ITCA 1WFNA 5CJXC 3UYPA 4JRWA 4PG2A 5EO1A 3STBA 5IR1A 4RFNB 3P9LB 4YDKH 1MRDH 3ZE2E 5ETUA 4LPYA 4IMLA 5KANI 4F57L 2EXYC 4LNVA 3VXPB 1BFVL 3E6HB 3GB7B 4GW5B 3VWKA 1MNUH 2PYEA 3KNBB 3BZFA 2HFTA 3VD7A 5T1KB 5A16B 1BFOA 4Z78B 3NABH 5EOTA 5FM8A 4FQLL 2DM7A 1ORQA 4IRJB 1OQOA 4XVJH 4NP4L 1T2XA 5IB5B 1G1YA 4RCAA 5ADPH 2LE9A 4LIQL 4A2LA 3UTPD 2ATPA 2KDGA 3OGCA 4YZFE 1NGYB 4JRXA 3ROLA 2ESVA 2JELL 3G5YB 5FF6A 1SEQL 4FZEH 5D2LB 5IW3A 3T04D 2XWJA 4N1CA 3V6FA 2FH8A 4HUVB 4CVZA 4FXGA 5CJBA 5JPNB 1NBVH 5IV2B 4NPYB 1QSFE 3J8F7 5GGRY 4CAGA 1JYXA 4TULH 1G7QB 5GGVY 3HNVL 5B3NA 5HY9B 1VGEH 5J89A 2DTML 3OHXB 2X4SB 4I9WD 4UIMB 1KB5B 5EZLA 2X70B 3RTQD 5C07A 1SHMA 1CFQB 1L7IH 4XBEL 4NQSB 4PGJA 5I6XC 3IYLW 1E4WL 3P77B 3O0RL 1HEZB 1E28B 4OCYL 4GKSB 3V5HB 5AYUL 1IGML 2AV1A 1GC1C 3AB0C 1KCRL 2GCYA 2YOCA 2NXYB 4X9FA 5CEZL 1NUDA 3WYRA 3P2TA 5IJKC 4PJAA 5IW1B 4YFDB 2UUDH 5SV3A 5L8KB 5AEAA 4YXKL 3KDMA 1AI1H 3IDGB 4LU5H 2D7TL 1T1YA 1WZLA 5D1QB 1I8IA 3M17B 2EYRB 4MVBC 1QLEL 4XPAL 5BJTB 1JL8A 2GITA 1SYSA 1RD6A 3JTSA 4A6YB 4HXBH 4LLWB 2VAAB 3QO1A 1P5VA 4NFCA 4UUJB 1GAFL 4R0LA 1FFNA 3T3PF 5C0EB 1ZHNA 1NAKL 3HNSL 2BZDA 4RGND 5HHQB 4NUGH 3CZFB 3VFPA 4ODSH 1IT9H 1TFHA 4PPTA 4QRRE 4X4XA 2NR6C 3CFBA 5I0ZA 3PWJB 3W9EB 4YXHH 1JGEA 4JKPL 1ODAA 1BQHB 4JKWA 4P49A 3ETBF 3MRPA 3UTTE 4GW1A 5DJ8B 4BK4A 1C1EH 1CG9A 5KTEL 1MHEA 3RWIA 3WKML 4ZNCD 1A1OA 1H3WM 1T89C 1GJIA 5DVNA 5F7UA 4KJQD 2XN9A 4JFPB 2F54D 3NA9H 1PAMA 3UEZA 1Z9SA 2WNGA 2DM3A 4TYUA 1G7IB 3CVIL 1TNNA 1V7MH 1J0HA 4I48B 1FDLH 1WC7A 2UV3A 2YRZA 4NSKB 4KQ3H 3V0WH 1HH6B 4S0SD 3OV6A 3T2PA 3BGFC 3PHOB 3KPPA 2IF7A 1JUFA 3C8DA 4LLMA 2IANE 3HC4H 2K3TA 1SY6H 5CJQL 1VADA 2BVPA 1UH4A 2HT3D 2CLVB 2VDOH 3OX8A 1EMTH 4PY7B 3RU8H 3QUKB 2VH5L 1SY6A 3QQ9D 5DVLA 3HI5H 3U0WL 4HIEA 3RWEA 3T0XA 4MSWB 3ZYIA 1D9KB 3BAEL 2B7DT 1EK3A 1URLA 1U58A 1UFUA 3OSKA 4BZ2H 4LKXA 2AI0H 2EXWC 5JMRA 1RHFA 5D70L 1BBJA 1SEBB 4H25B 4X4ZA 3S8WA 4JFFB 1NMCB 3CX5K 4PJFB 2CQVA 5GGVL 1XGRB 2DJUA 4OCSH 1ES0B 4KMLB 4YC2B 2H45A 1ZLWK 4S1QL 2EO9A 3AUVA 4PJ8A 2A6IB 2ZNXA 3WDJA 5KAQF 4KVNL 4J6RL 2OTWA 1S7TA 2DIBA 3MV8A 4YGVA 1ZT1A 3CSYB 1MEXH 4U1NA 2ITCB 4OTXH 5D72H 3VDAA 4L9LA 4ZO7A 3RHWK 5IG7A 1B4RA 2NY4C 4PGEA 3TF7C 1IL1B 4EQ3A 2FIKA 4R8WL 1J8HA 5FA4B 4PTUA 4Z18A 1F4YL 2MCPH 3V4VL 1SJEB 4NN6C 1FNSH 3MROB 4YHZL 1UJ3B 4K8RL 1S78C 3HFML 1T1ZB 1MHHB 2DI7A 5TDPB 3PGCB 4KK5D 5CJ8A 4YFEA 1YMMB 1NGXA 4LQ1A 4CN4A 1K4DB 3CFJB 5D7IA 3CUPB 5GRVL 2DYPB 3HZVB 3IVKB 1YNKH 2WW8A 5HYJE 5DMYA 3Q3GB 1B4JL 4I2XB 1SBBA 2X05A 1JGUH 1PX3A 3QIBB 3VFOA 1FVDA 3B9KB 5KSBF 5IB2B 4BELD 2QSCL 2IMNA 5DJZB 5DHYA 3DO7B 2G75B 4RBPK 2DIAA 3SE3A 3CC5B 5I30L 1BAFL 4Z7UE 5LGHH 4Z95L 2D2OA 3JWOL 5J13B 4G6AC 4EI5B 1DLFH 1NUGA 1O7VA 3MOBL 1FORL 2RR3A 2O5ZL 3QDGD 5JUEL 1J9CT 3VCLB 2P8LA 2CPCA 1OAQH 1PEWA 3C8KA 4D3CL 2BMKB 2OTPA 4NQDB 1B6DA 5CUSH 1R5IB 4JPVL 3HB3D 3OF6A 3IDIA 2FECL 4JGMA 1INQB 3PP3K 4PJ5D 3S36X 1RIUL 1YPZF 1A5FL 3QDHA 3PL6A 3HMWH 4MNGB 4RFOL 1GGBL 5E4IA 5DC4B 3UPCA 1MCLA 2V17H 1P7KA 4LP5A 4NQXA 1KF9B 5C09D 3SKNA 2JJUA 1KCVH 4UINL 5T1KD 3T8XB 4BSWB 5HGBA 5DJCB 4K3EL 5HVHB 2UYLA 4PV8A 4ENEC 5BRZA 2WZPD 2BVQB 4KK6C 3PWNB 3QAZB 3MV9A 4ZOAA 1QRNB 4ZUUB 4H0GA 3C60C 3FO1B 5GGTA 2DQCL 2X1QA 1YEGL 4BFGA 1NCNA 1JRHH 3R0MA 1FE8L 1J0JA 1A0QH 1OL0A 2P8PA 4NIKB 4F15C 1RURL 1DEEB 1F3JB 1QA9B 1XMWA 4G9DA 2VWEC 3NPSC 2R15A 2XQYK 3I9GL 2ICWB 2E3VA 2OL3B 2APXA 2YK1H 3U7AA 3P30L 4PP1D 4U6HA 4J2XA 1L9NA 1NQBA 2DQGL 5IFJA 3W9DB 2AJZA 3QWRA 4K3DH 5T3ZD 5TGBA 1ZT7A 4HMDA 1BZ7A 4DUVA 3TCLB 2X1PA 4LHUA 4V1DB 2BNQA 1QSEB 4ISVB 3I84A 2F5BL 1ZSDA 3WLWD 1FC1A 4OZGB 4TSCL 1Q9KB 2R0LH 4NCC2 5E8OA 1ZA3B 3D18B 3P4NB 5IVXF 2ADIA 2FGZA 1RJYA 4WI8A 2Q8BH 4XGZB 1AKJA 2X9XA 2I9LB 2X40A 1RZFL 3RAJL 1YUHA 4O2CA 4PG9A 4QRSA 3WHXA 3JV4B 3V7MA 3CZJA 2FB4L 3MLSH 3ESUF 5D1QD 4OF8A 1T22B 2GSGB 1I1CA 1Z3GH 2AXHA 4I18C 3B2VH 1EJOH 3EIFA 3KYMA 4QF1B 4ZFZA 4NKMB 3MACH 5E6YA 2DQIL 2OK0L 5CJOL 3S35X 2P43B 3W2DH 3MNVA 3DX9B 3UBXA 2GJ6D 5ISZE 5TFSH 4MJ5A 1A7QL 3PF2A 1I9IH 3MRQA 4O2EA 1MCHA 2G5RA 1AY1L 3SKOB 1YEKH 4IRZL 4D0CB 2NY1C 4KRMB 3QNYA 3PDOB 4Q9CA 3IFLH 4IOSD 5D96B 4APQB 1IBGH 2XKNA 3OBAA 3RUGF 1T3FB 2BP3A 3B9AA 5BMFH 4CADB 1KPVB 2VDLH 1MI5E 1EFXD 4CUCA 5CWSA 3MJ6A 1KIPB 5GISH 1V7NH 2B1HH 4HCRH 4YDIL 4LLQB 5KVEL 1F3DJ 5HBBA 4HCRA 1EXUA 1UCBL 4N0UE 2X4UA 3E1F1 4MXQD 2P5WD 5C0CE 5EN2A 1JRHI 3VXSE 3HI1A 3RL1B 3WNLA 5L88L 3DTXB 3N85H 43CAA 2HJKB 2F9BT 4MD5B 2DOCA 4U1HA 3U7WH 4H88H 1S9KC 5K33A 1IEAB 1NBYA 3W11C 3MLVL 5IMOA 3T4YA 1UXSB